1KC3A

Crystal structure of dtdp-6-deoxy-l-lyxo-4-hexulose reductase (rmld) in complex with nadph and dtdp-l-rhamnose
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
298
structure length
298
Chain Sequence
MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVNAAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETDATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVINDQYGAPTGAELLADCTAHAIRVALNKPEVAGLYHLVAGGTTTWHDYAALVFDEARKAGITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFDLILPQWELGVKRMLTEMFTTTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Variation on a theme of SDR. dTDP-6-deoxy-L- lyxo-4-hexulose reductase (RmlD) shows a new Mg2+-dependent dimerization mode.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Oxidoreductase
molecule keywords dTDP-glucose oxidoreductase
total genus 104
structure length 298
sequence length 298
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kc3A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kc3A02
1YVEI 1ZVMA 2A4KA 5U1PA 4J43A 2Y99A 3UUWA 3HDJA 1QR6A 3EDMA 2NSDA 3TDKA 3RC9A 4E5MA 5CHEA 1HDYA 1H6AA 3RROA 1FDUA 5KVSA 3ZWOA 2DFDA 2ZQZA 4UUNA 2VOJA 4TVOA 5IZ4A 4NI5A 2E6UX 4FJ1A 4CMEC 5KKAA 1UDCA 2X9GA 4YACA 2R00A 3X2FA 1PZGA 4KUHA 5DT9A 1ORRA 5LDHA 1WNTA 4R3WA 2NU6A 3DFUA 3C7DB 5KKCA 1PIWA 4NFSA 3DL2A 3PYXA 1NR7A 3QJ5A 3WGYA 5EERA 2QYTA 5DN9A 4F6LA 4NK4A 2EW8A 4OXKA 5CAEA 3H9JA 1I3KA 2Y93A 1ISMA 2O7QA 3PJGA 3R6DA 4DLAA 2GNAA 4EW6A 4IBOA 4I9UA 2UDPA 5G0SA 2CZCA 2QRLA 3PVZA 5A5EA 1W6UA 4QEDA 1YS4A 1U8XX 2DC1A 4CM4B 2NV6A 4JLWA 3VH3A 4DUPA 4FFMA 3DMTA 4FC7A 3TZKA 3UCFA 4BGIA 1GQYA 1U3UA 4IINA 4ZQGA 3JD4A 3AU8A 4QFCA 4DREA 5CEJA 3OEWA 4J7UA 2ZCVA 2QX7A 4H7PA 4J0EA 4TRJA 3WIDA 4RO0A 3B1FA 4MINA 3JSAA 4A03A 4TRNA 4DXHA 3OJ0A 4DIFA 2VWQA 4NNJA 5JS6A 2P9EA 3NT2A 3TZQA 1PQPA 1SCUA 1WP4A 3PLRA 4FCCA 4FJ2A 4J9VA 3GDGA 1E7YA 2BFMA 3ZWNA 3I6IA 5L95A 3I1JA 1A4UA 1JKJA 1ZZEA 3A14A 2FR8A 3JCZA 1QMGA 1L7DA 4OKNA 4PZEA 4IDGA 4K1LA 2XF8A 3DHYA 3O4RA 3SC4A 4L0QA 4KDFA 4P8RA 5F1OA 4ALLA 3O8QB 3PTZA 3PWKA 4RPKA 1HSOA 3T4XA 4R9RA 4BUCA 3HHPA 2HKIA 2IRWA 1DRWA 5L4NA 1B3BA 3DZJA 2ZATA 2ZB3A 1YJQA 3GRPA 3FSRA 4WE3A 1O6ZA 3GFBA 3RUAA 4BV9A 2P91A 3V1UA 3JYOA 4LK3A 4YVFA 4P4GA 3X2EA 3L6EA 1I3LA 3GAZA 1PGQA 5COBA 4L73A 1ZEMA 1HYGA 2YY7A 4MPDA 2HRZA 4UUMA 4CQMA 5JW6A 3SLKA 1QYVA 3DBVO 4CR7A 4RDHA 1YQGA 1MP0A 5DZSA 4CM9A 5U4QA 3RKUA 5GY7A 3U4DA 2I99A 4XGKA 1U9JA 3NTQA 1GCUA 3JQCA 4PG5A 3FNEA 1MFPA 2XOXA 5ER9A 3LT1A 1Z73A 1E1MA 5TS3A 2I76A 2NVUB 3M1AA 3T4EA 4IM7A 1DFIA 4WNIA 4U0KA 4KWHA 4CMIB 2YDXA 3Q2IA 1EBUA 3EVTA 1PJ2A 1AHHA 5THKA 4MO2A 3FI9A 4BO6A 2HQ1A 4CLEA 3ETGA 2EKPA 1U7HA 2WMDA 3KEQA 5BR7A 3VH1A 4FFNA 1E7MA 3GG2A 4J49A 3JD2A 1CEQA 2X0RA 1NVMB 4YJFA 4ZN6A 2ZK7A 4OHUA 3K5PA 4E21A 4WOKA 2CSUA 3ZWXA 5G0TA 4YQYA 4OIMA 4G81A 4HUJA 1FDSA 1BMDA 4TMFA 3H3JA 4MP3A 3JQFC 1ZNQO 4BO9A 1AXEA 5B1YA 1MB4A 5F3RA 2P5YA 3BTUA 1OZAA 1PL6A 1ULSA 1BVUA 2J8ZA 2Q1UA 5CDSA 3L77A 1BXGA 1XSEA 3MJSA 3WFJA 1A7AA 1T1SA 1Q0LA 1ZXBA 3TPCA 1LJ8A 5T8KC 2D5CA 5T64A 3HG7A 2CY0A 2NU7A 1DBVO 1JQBA 2Q46A 4GX2A 1H0KA 4A5OA 4P4LA 5CDGA 5G0WA 3U4IA 1DXYA 1UP4A 3EK2A 4RVGA 4B3HA 1C1XA 4R54A 2PH5A 4JK3A 2O3SA 1SO8A 2WD7B 4AG3A 4IMRA 4DGSA 4UVHA 4MVJA 3AM3A 1T2CA 4CLHA 2A92A 3GUCA 1J0XO 1HE4A 1O95A 4AJJA 2NQTA 2W4QA 3TL3A 3OQ6A 2D0IA 4UVEA 1PSDA 4XQCA 1M2WA 2JFHA 4LSMA 2VN8A 4WGGA 4RLSA 4R01A 3IDSA 2Q4EA 4CMHA 1IUKA 1I01A 2P4QA 3WOHA 1NQTA 1Z6ZA 1P74A 1M6WA 3JD0A 2JKVA 4ZD6A 4IGEA 4E30A 3JQGB 5DCWA 3BIOA 2X5OA 3HDHA 2DTEA 4BO5A 3H2ZA 1KIFA 3QWHA 4F46A 4ZVVA 5JYEA 2X22A 1T2DA 3B20A 2JFGA 1LC0A 2HDHA 2JL1A 5DNAA 1YKFA 2B36A 1SC6A 2Q1WA 4XWYA 4HV4A 3ROPA 5JDIA 1MV8A 4D79A 4NQZA 3QWIA 4TWRA 1IYZA 1WDMA 3JYLA 5AXAA 3E48A 4TSKA 3I3OA 3PXXA 3ZN2A 5BNTA 1B15A 3F4LA 3LVFO 3ZWCA 3VPGA 4L76A 1ADCA 2JHGA 3GNQA 3PJFA 2Y1FA 2A9FA 1BXKA 3PHJA 5A05A 4NHEA 5KVCA 3RUIA 3ZV6A 3KUXA 3PEFA 4OQZA 1LDYA 1G0OA 1BDMA 3G3EA 3IC5A 3PGXA 4IJVA 4M8SA 3PP8A 4IQ8A 4HADA 1KEUA 3U9LA 3R3SA 3RKRA 4P38A 5HA5A 2DBVO 3F9IA 3I6QA 4A0SA 1DIGA 3I9MA 5L7TA 3MEQA 4J16A 1NPDA 1NWHA 1I10A 3V2UA 4I1IA 1RM3A 4PRKA 1EDZA 1N2SA 2C7VA 3TFQA 3W8FA 4BO8A 4JNKA 4ZQBA 4Q3BA 3RC1A 4E2WA 3LT0A 2RHCA 1V3TA 2DBRA 3KO8A 4FOOA 4CMEA 3FTNA 1MC5A 2HSDA 2Y1CA 3KTDA 1GQQA 2YV1A 3W4IA 3MTGA 4PFJA 5T57A 2A94A 4BNUA 1UXGA 3NUGA 4GWKA 3E6AA 4E13A 2X5JO 4XX0A 3HE3A 4GPD1 3NTOA 3QW2A 4DPLA 5A02A 4GX5A 1VC2A 2EF1A 2Q3EA 4IDFA 1Z7EA 3C3XA 5JY6A 1DIBA 2ZTLA 3JQ8B 3WX0A 2CMDA 1OFGA 1DC3A 1LI4A 2EW2A 4E32A 3I9LA 4H16A 1E3WB 1ID1A 2GZ3A 4CLRB 1PWXA 5CP8A 4CQMD 4Z9YA 5EINA 1Y5MA 3F4BA 3PYMA 4LN1A 4WNCA 1MC4A 3SVTA 2JJYA 3NJ8A 1E92A 1LLCA 4L9RA 1DLIA 4C4OA 1P45A 4XRRA 5FI5A 1NTOA 3ST7A 4GVLA 1Y8RA 2PD4A 1EFLA 4IS2A 3U0BA 3OETA 1ISGA 3OJLA 4BO7A 1X0VA 5IAAA 3H65A 1A5ZA 1XYGA 5JNLA 3F46A 1T2FA 1T4BA 4LMPA 1UDBA 3W6UA 2ZQYA 1RM0A 4YJGA 5I7VA 4CR8A 4H15A 4AJNA 1ZK1A 4II2A 3GN2A 1EQ2A 1PZEA 4Q3CA 4PGFA 3KYCA 3JQ7A 3ENKA 1OBFO 3PI7A 3RFTA 1Q7BA 3UHAA 3I9OA 3UKOA 3RUDA 4BKOA 3IJRA 3MWEB 2HMUA 3ZHXA 3P7MA 2GCGA 4NK5A 4W9NC 1SBYA 3LSYA 1ADGA 4QX6A 1UP6A 3K96A 1D7OA 4JX8A 4AJPA 1MUUA 2EV9A 5KVVA 5EMHA 1EFKA 4RV9A 5I7EA 3ZHYA 4ZICA 1EUCA 2G17A 5JAIA 4UVDA 5IZCC 3DZBA 3TRIA 3VKUA 2DVMA 3L4SO 3DBLA 4OJNA 1JKIA 1M76A 3MJTA 3KYBA 3DZKA 1ZEJA 3H5RA 3UOGA 9LDTA 3LYLA 3LC1O 1QG6A 3Q6IA 5TIIA 3GHHA 3GVPA 3HFGA 2NUAA 1YL7A 1B2LA 1TB4A 4E5YA 3SX2A 4RF3A 4MVJF 4MKRA 1I8TA 2X4GA 4MIYA 1DIRA 1ZCJA 4M55A 2B4QA 3ZV5A 1OI7A 2PGJA 4IXTA 2WD8A 1JA9A 5ILOA 3DBRB 2CUKA 2Y66A 5GZ3A 1IOLA 3ZHZA 1R0KA 2BHLA 4OQYA 4ZU3A 4YQZA 4XZ3A 5IF3A 4RQTA 1LDNA 3JQBC 1GYQA 2J5KA 5L53A 4YTEA 3AI3A 2X0IA 3GZNB 4WCFB 2IYOA 3E5RA 5BSEA 1PX0A 4KDEA 1EK5A 3BHIA 4FW8A 5BNIA 1UZNA 5TC4A 3WQRA 1U2GA 3DMTC 1P1HA 1YB5A 1UAGA 2Y05A 1R4MB 1DAPA 1W8DA 3TSCA 4BKUA 1N8KA 5K0ZA 3DAPA 4TQGA 1DJNA 2HCTA 2X9NA 3G1UA 1XA0A 3IUSA 5K9ZA 3S8MA 3SJ7A 1QP8A 4UULA 4NBVA 5A3JA 4B7CA 4D7AA 2C7GA 1QYXA 1I32A 4UAGA 1WDLA 1YXMA 3WJAA 1LRLA 2DLDA 2WYVA 4DC1A 1MXHA 3FRJA 4U6SA 4ZGWA 3AUAA 4YWJA 3D3EA 4CMKA 2VRCD 5TNXA 3CINA 1PZHA 5CFZA 5CEFA 5L45A 4I5DA 4N7RA 3QWFA 3ORFA 3EGOA 4XA8A 2QRJA 1X0XA 3AFMA 5K6AC 4I5GA 1UZLA 5L4SA 2HLPA 2NQ8A 1PJSA 1N9GA 3RWBA 3DBHA 3ZU4A 1GFSA 2QW8A 4HWKA 3UH1A 5B4UA 1P1RA 4D3SA 4D3FA 2ZYAA 4FGSA 1HTBA 4YXFA 3PK0A 2I3AA 1LSJA 3I83A 5JE8A 3WNQA 2Q4BA 5MGBA 1EK6A 1HDCA 4LCEA 3C8MA 2D3TA 5L4LA 2O3QA 4AJEA 1WXDA 3GC6A 3JQ9C 4YJHA 3F6YA 1ZBQA 2ZJ1A 3HADA 1IY8A 5F21A 5CDUA 2C0CA 3K31A 4UREA 1Y81A 2FHSA 4D43A 2R6JA 1K6XA 1KEVA 4I8XA 1PTJA 4Z6KA 4RZIA 4WASA 1KVRA 3E9MA 3GMDA 4J2OA 1G6KA 3QVXA 4PLCA 4TRRA 3ETEA 3R3JA 4RVFA 2HMWA 1ONOA 3GEDA 3GOHA 2J3KA 4ILKA 1E7SA 1OAAA 3NEPX 3ZCXA 4RORA 5CDYA 3KYDB 2FR0A 2W2KB 4BKRA 1ENYA 3K73O 3LDHA 1TI7A 2IZ1A 3GVXA 4YDRA 9LDBA 1IZ9A 3VPHA 3IKTA 3RUFA 4R1NA 5G4KB 3DONA 1TT5B 3IS3A 3ZNNA 3KLMX 5F1PA 2YFQA 1LSUA 1MXFA 4XDZA 4JP3A 1B8VA 1I2CA 2YYYA 1O89A 4I5FA 3SXPA 4RPHA 3ZU2A 2ZTMA 4ND1A 1V35A 3MZ0A 1DOHA 2YHIA 1NQOA 3OH8A 3D5TA 1KC1A 3GAFA 5T67A 5KIAA 3HDYA 1R4NA 3HDQA 2DUUA 3OJOA 4CMAA 2QZ9A 4M1QA 1HETA 5KTKA 4YEDA 1XDWA 5HS6A 5TSDA 4XJSA 1PS8A 1GZ4A 2DU8A 4FDAA 1HDOA 4YB8A 2YHUA 1E3JA 4PLZA 4EDFA 4GWGA 2PR2A 1E3IA 1G0NA 2LDBA 1F8GA 4PVDA 3P5SA 4JN6B 3E03A 1KEPA 1XWFA 5C7LO 4YA6A 4J90A 4P4NA 4AJIA 2I3GA 1AN9A 3QQPA 2VZ9A 3ASVA 1UXJA 3PGJA 1U8FO 3U49A 3LC7O 1PGPA 1YBVA 1ZK4A 4ZHSA 3W8DA 4B7XA 4GMGA 4O1MA 3AM5A 1Z7BA 3Q3CA 3ZV3A 3A28A 3FNFA 3NRCA 1ZFNA 3OM9A 4GGOA 4CODB 1QYDA 1XHLA 4WLNA 1UH5A 3PJDA 2VCYA 4CQLB 3WYEA 5B4VA 2WEKA 1Z82A 3S2GA 1GV1A 3G1TA 5AQ1A 4L74A 5G0UA 1C1DA 3ZWBA 1YO6A 4J1SA 5EL0A 3DEYX 4BO2A 3BTVA 2Y1OA 1YGYA 3KXDA 4N5MA 1ZUD1 1ULUA 4PLVA 4FIZA 1LNQA 3CE6A 4BQPA 1VM6A 4GMFA 4RPJA 2GPTA 4Z0PA 1EE2A 4MIEA 1KYQA 2ZB4A 3LT4A 5I7SA 1DAOA 3ZWMA 2O3TA 2HK7A 2HRBA 3ZGYA 4ALJA 3BA1A 1XQ1A 2GN6A 3GGGA 5TT1A 5IFLA 3GNTA 2JCXA 5C7OO 4I9HA 1NYTA 2V7PA 3GN1A 2DQ4A 4J1NA 4BNLA 3D4PA 4E2XA 4WKGA 1T2AA 4GBJA 4J3FA 5EN4A 4EUEA 3VOSA 1BTOA 3NGLA 4RF2A 2GN8A 5KJFA 2VHVA 2OBYA 2HAEA 4ALNA 2EHDA 3IIEA 2IZ0A 4XQ9A 4YAKA 3E9QA 2OORA 1DO8A 3ZI0A 5I8WA 3RU9A 3D4OA 3H3FA 3VDRA 3VPFA 3O8QA 4BNZA 3WS7A 1IPEA 1DIAA 5KJ1A 1AGNA 1YDWA 3JD1A 3S55A 4YAGA 4U5QA 5FFFA 5AYVA 4YT5A 3E1KA 1LU9A 1YOVB 4GLLA 4L4SA 5K6AA 4YT2A 4BO0A 1H5QA 4GH5A 4UUOA 3L0DA 3QRWA 1ZIDA 4DRYA 1OC4A 2OZPA 4DC0A 2VOEA 1PJ3A 4NJMB 1KERA 4E2ZA 4UUPA 1SMKA 4XCVA 4GKBA 2JAHA 2LDXA 3JV7A 3F3SA 4HP8A 3JYQA 3GPDG 4YT4A 3EUWA 4CM3A 1O5IA 2BKAA 2GR9A 3ROKA 2AE2A 4N18A 1M67A 1XKQA 3ROMA 2PY6A 1P33A 3AOGA 3CTMA 4BNIA 4CPDA 3Q9UA 3I9KA 1R37A 4B8WA 1O94A 5CPBA 1PR9A 4B7UA 4Z0TA 4F6CA 5KNLA 3BMOA 1SZJG 1QYCA 3ONDA 2IEDA 5THQA 1YJ8A 5IDYA 1N1GA 2A35A 4L8VA 5JC8A 1WZEA 2VUTA 2Y1GA 1SB9A 5LC1A 3ITKA 4JBIA 2WSBA 2VUUA 1EUDA 3O26A 1PQWA 3DQPA 4L4RA 5ITWA 4R3NA 5L9AA 7MDHA 1HYEA 3VC7A 1XG5A 1CIVA 3F5SA 1D1TA 4HNGA 3H5AA 4HFRA 1E1LA 1ZK3A 1GEEA 3RJ5A 1LEHA 2HK8A 4YJFB 3GGOA 3MJ4A 1WPQA 1HWYA 4AFNA 2J3IA 2TMDA 1I2BA 3ROQA 4XEHA 3HQ4O 2Y0CA 3UCEA 4NIMA 5JO9A 3RUCA 1ISIA 3GF4A 3QVSA 3WGTA 3GZ4A 4IPTA 5A03A 4EYEA 3RVDA 4G65A 3MOIA 1LDEA 1K89A 1V0JA 1PJBA 4W6ZA 2GASA 3H9UA 3KRTA 1OMOA 2GRAA 2YV2A 5LDGA 5HTOA 4DPMA 4KQWA 3OA0A 3H9EO 2YQ5A 1YL5A 3JD3A 1QSGA 1T2EA 3IUPA 4OL9A 1E0DA 3QE3A 5C7IO 1N1EA 1MGOA 1OC2A 3BMNB 1LX6A 4M86A 3BMCB 3MJVA 4RGBA 4TRMA 4CM9D 4R9SA 1VKOA 3KV3O 3WB9A 5A9RA 5ENDA 5FF9A 4X54A 5A06A 1NM5A 2VT3A 1C1XB 4UEKA 1EUZA 1ZW1A 2BH9A 2D2IA 3M6IA 1CYDA 3PFWO 4WLUA 3CMCO 5CEEA 2WJPA 3ZNPA 1YRLA 4IIUA 8ADHA 4XIYA 1B14A 4YAJA 3AM4A 1WW8A 2C54A 4D0SA 4FC6A 4FPXA 1F14A 2CF5A 2PD3A 1E3EA 3WXBA 4DQVA 4CM4A 4FQ8A 2E49A 2I9PA 5JPIA 3BHMA 1HXHA 1MG0A 2PV7A 4CMJA 3OEYA 2NU9A 3CMMA 3NTRA 3QVOA 3ICCA 4IDAA 2VYND 2QQ5A 3WG9A 3LK7A 7ADHA 5AVOA 1DC5A 1M66A 1O8CA 3ANMA 4BMVA 3EY4A 4CMGA 1DHTA 2NM0A 4FBGA 3BTSA 2OL4A 4RPGA 1P77A 5HS4A 4L75A 3SJUA 1CRWG 1WZIA 1GL3A 1VSVA 4J2HA 5JAZA 1BHSA 1P31A 3VPXA 4W99A 1NR1A 1N7HA 3K2BA 3INRA 5BSHA 4ZQHA 1QORA 4GX1A 1LA2A 3WGGA 1K5HA 1A9YA 1X1TA 5F5NA 1LDBA 4DMMA 1PJTA 5JC1A 3F47A 3ZW8A 4A2CA 4IZIA 3JYPA 3I23A 2NTJA 2VNSA 4LGVA 5KWEA 2EKQA 1X7DA 1PS0A 4MDHA 3L4BA 5G4LA 1A72A 5COAA 4PLTA 3RD5A 1E7QA 4MVJH 2PZJA 4AJ1A 1LDGA 1Z45A 4PLYA 1KVUA 4E5NA 3RIHA 3ZV4A 3H4VA 4CV1A 3GMSA 4D41A 2PA3A 4H3VA 2ZIZA 4DIOA 1CERA 3VHRA 5ITVA 2DKNA 2X23A 3O9ZA 1HYHA 4R16A 4UEJA 3ONEA 2RAFA 4CQMB 4ESOA 3OIFA 5U9CA 5L3ZA 4ZJUA 1CQJA 3QP9A 2DBZA 4BV8A 2V6FA 3FPLA 1H2BA 5DBIA 1FJHA 1IZ0A 1PJ4A 4LISA 5BSGA 2DTDA 3ZWYA 1H6CA 2V6GA 4FFLA 4LVCA 4Y8VA 3MTJA 4WLVA 4WK6A 3RJ9A 3GG9A 1Q7GA 3JQDA 4M89A 3V2HA 4CLRA 1ENPA 4BO3A 2OP1A 4CMIA 1NFFA 3IP1A 2QYSA 3INGA 4XQGA 1SNYA 5H83A 3M2PA 4R41A 4Q39A 1FDWA 5B37A 3I5MA 1DJQA 1YB4A 2QZZA 4W7HA 4I9NA 1LLUA 1GU7A 4QQRA 4FB5A 2B35A 1HSZA 2DPGA 3D3WA 2O23A 3UAGA 2Y0EA 3D1LA 4E6PA 4NPCA 5I8ZA 2PD6A 4U0JA 4CM8A 2BF7A 4MKZA 1T4DA 3B1KA 1CJCA 3AFNA 2C5EA 2NVWA 1BDBA 3U62A 3RFXA 2W2LD 4PN3A 4XQEA 1H93A 3GQVA 3OFSA 4KTTE 4PLWA 3ZWVA 1T1RA 4DTIA 3KZVA 3KSDO 1LSOA 1X1EA 4JGBA 3PHGA 1GUFA 2Q1SA 2G76A 1W0CA 1BXZA 2VHYA 2G5CA 4OXNA 4KWIA 4RF4A 3TFOA 2E48A 1I24A 3GR6A 2JD0A 1JVSA 5DCUA 1D8AA 2IXAA 4LMRA 4FD3A 3WR5A 4BOYA 1C14A 4KZPA 1XU7A 1U28A 2GGSA 1KS9A 3ADPA 4J9UE 3VH2A 2HJRA 2CDCA 2RCYA 2VWGA 1EVJA 3TZCA 3RASA 4O0LA 1K6JA 3IJPA 4GQAA 1F06A 1EVYA 1RYEA 2ZKLA 3WYBA 1A9ZA 4S3MA 2ET6A 2ZB7A 2I66A 4IJKA 3O03A 1H9BA 2NLOA 3WWYA 2R2GA 4ALIA 2WM3A 4BO4A 4MVJD 2O50A 3C7AA 3DZGA 1TLTA 3OICA 4QECA 3RQSA 2OGUA 4Q3DA 3INTA 4RVSA 4WEOA 4PVCA 3WMWA 1D3AA 2VUSA 4IDEA 4EZBA 4RJTA 1YH3A 1DHRA 3DZFA 5ER6A 2D8AA 1WDKA 2GUGA 1Q0QA 4TZTA 1F8FA 4Z3KA 1B8UA 5JDCA 2OBNA 4U7WA 2W2LA 3OIDA 2GDZA 4CV3A 5T5QA 1UP7A 2W90A 3A9WA 2B5WA 2V6BA 2W8ZA 2E4AA 2EG9A 2Q50A 1RWBA 1IE3A 2V6MA 3EAGA 4J4TA 4JJGA 3JQGA 1U7TA 4XGNA 5IZCA 4CLOB 2PFGA 4ITUA 4N54A 1U4SA 3VKVA 4D45A 1B3RA 3JQEA 1ZH8A 1N7GA 1UZMA 3TOXA 1J4AA 1EBFA 3DFZA 3DZHA 4J6FA 3GT0A 3ZW9A 4DYDA 4QT0A 4CUZA 1DIHA 1I2ZA 3G49A 4AJHA 1UAYA 4WUVA 4OH1A 1PL8A 2VTDA 5G0VA 4DQUA 3SEFA 1ZMTA 1V3UA 1YB1A 4ND2A 5KJEA 2PGLA 5DOVA 2OHXA 2BGMA 4OMUA 1Z75A 3AY6A 5F5LA 5IDQA 3N74A 1OOEA 2OXIA 2P9GA 2BLLA 3BTOA 1IB6A 1K2WA 1UXKA 5CDTA 2EP7A 4NJOA 3DHEA 1T25A 1JVBA 4JXKA 3AOEA 1P0CA 3ZWWA 1U3TA 2DBQA 1LQTA 2Y68A 2DT5A 3KSZO 3WLEA 2X7HA 4IS3A 2C2YA 5FYDA 4AJ2A 5IDXA 2GO1A 4CL3A 1RKXA 2O3UA 3WYCA 2EEZA 3AI1A 2EKLA 2UV8A 5EJ2A 4KOAA 3VZSA 2XAAA 4MVJP 4CLDA 2HMSA 2VT2A 3K30A 3GH3A 1PGOA 1R12A 4HBGA 3U09A 1UUFA 3NYWA 2DTXA 5TGDA 1X14A 4LCJA 2FRDA 2GN4A 2DPHA 4Y9DA 4EEZA 1LLQA 2H6EA 5JO0A 2AA3A 2X1HA 5TJ9A 1P44A 1HDZA 4IJUA 3RU7A 3CZRA 3DAGA 2AG5A 4NR0A 2ZYDA 4HFJA 4OM8A 4ONEA 3JQ8A 4DVJA 3FR8A 2X9VA 2BELA 4KMSA 3UFXA 1E7RA 3V1TC 1QV6A 5G2OA 1MA0A 3BMQB 3ZWPA 5A9SB 3G17A 3Q0EA 1YBMA 4AL4A 2AMFA 1BSVA 2C29D 4B79A 4KTVE 4EJMA 1GY8A 3G0OA 2RBEA 2WYWA 2VHWA 4PZDA 1Y8RB 4S1VA 1VPDA 3RCBA 2PKRA 3S2EA 3JQAA 5J23A 3M2TA 2ZCUA 1YE3A 3STHA 2AEFA 1CF2O 5CG1A 1I3NA 2IODA 1DPGA 4N5NA 3C1TA 2GYYA 2HO5A 4IMPA 1BW9A 3WSWA 2YW9A 4IXWA 1YDEA 1HLDA 1UJMA 3LF2A 4IIVA 3CH6A 2OMEA 4U8GA 2B4RO 1KETA 4YJGB 5T6BA 3LZ6A 3TL2A 4BNHA 4A7PA 4GLOA 3BAZA 5F1KA 3AJRA 1I3MA 3WQSB 3ZU5A 2IEBA 5L7WA 3NDRA 2Y0DA 1FMCA 3KYCB 2EGHA 3FHLA 1VJ1A 3ONFA 4BNXA 3PDJA 4DBZA 3P19A 1ZSYA 1QV7A 3PLNA 5I9MA 2O2YA 2D4AA 2FSVA 5DULA 5G4KA 5KOIA 1CQIA 3IOYA 3V5NA 1E6WA 1V3VA 5BQFA 1U5CA 4CR6A 3HFSA 2GF2A 3FR7A 4NU6A 1E1NA 1LQUA 1UXHA 4KUEA 5JMPA 1E1KA 1U4OA 3DOOA 4BGEA 3NJ4A 1NXQA 2WDZA 2FPIA 4BKQA 2CVOA 2BI8A 3DAFA 2YHIB 3VTZA 5GMOA 3AUTA 5A1TA 5JFOA 5TQVA 1R4NB 1PGJA 3QWBA 4NU5A 4PRLA 1PU2A 3OMLA 4JROA 1VKNA 4TVBA 1NBOA 1VSUA 1L7EA 3UXYA 5KVQA 4HFMA 1GCOA 2FMUA 3DHNA 2WTBA 2P9CA 3GK3A 3RUEA 5TLSA 1ONNA 3KHUA 1SPXA 3UN1A 2PLAA 4OO3A 4KQXA 3KETA 1QKIA 4D0RA 2Q2VA 4FJ0A 8LDHA 1GADO 3JQ6A 4YYZA 3QSGA 3E18A 1R66A 1HZJA 2PGDA 4JQCA 3RC7A 4MIOA 4WJZA 1IHYA 3KLPX 4D42A 1NX6A 2D5AA 2J5QA 3PWSA 4NMHA 5AOVA 3JTMA 3EHEA 4WPGA 1C0LA 4NDNE 4JBHA 4OSOA 1ISJA 3WBBA 5JXWA 3U3XA 4PLGA 3GZNA 3AK4A 4KP7A 3VDQA 4B4OA 1WVGA 4RF5A 2F1KA 3GEMA 1O9BA 5IDWA 4URFA 1ENOA 4MP6A 1R4MA 3E8XA 5B4TA 1HE5A 3ETDA 1ISHA 3D4NA 3DOCA 2NADA 4UVGA 5DDIP 1EMDA 3WFIA 4A26A 4II3A 1GDHA 4HY3A 4R69A 2DUWA 1AUPA 4Z0HO 4LSWA 3PQFA 2C20A 5DBFA 1LBEA 1QXSA 2EGGA 4M87A 3PRJA 3VH4A 3DDNA 4B4UA 3H7AA 4CUKA 3EYWA 4RDIA 1XELA 1PS9A 3IKVA 4PLHA 1U5AA 1RM4A 5JDCC 1DB3A 4E3ZA 4NBUA 3I52A 2RIRA 2B83A 1Y8QA 1D1SA 3ANNA 3I9NA 4NFHA 1JWAB 1Q1NA 4DMLA 1B0AA 5JY1A 1LTHR 4B3IA 2Q1TA 1GUYA 4N5LA 5COQA 4M54A 3EMKA 1PEDA 4O6VA 4MKXA 3HB4X 2YUTA 1GZ6A 3AUSA 4E12A 4IJWA 1HDGO 1WMAA 2HJSA 4XR4A 3RUHA 5JCJD 2ZB8A 3ITDA 1GYPA 3HUDA 3TNLA 2HK9A 2UYYA 1LRKA 1PGNA 3WDSA 1V6AA 2H63A 3WICA 4D44A 3LF1A 3AWDA 3KSUA 2CFCA 4YRDA 4IDBA 4OXYA 2HMTA 1NQAO 2C2XA 3AUUA 5GZ6A 5HRUA 1KVTA 3TF5A 4XYMA 3FPCA 1Q0HA 2SCUA 1YONA 1NNUA 4Z9FA 3OA2A 3P2YA 1PR3A 1T26A 2YV3A 4E5PA 5ICSA 2E37A 3C24A 2D1YA 3GVCA 1QRRA 2BMAA 4BMSA 5ENVA 4LVUA 2UVDA 1PWZA 4R1TA 3UVEA 2BRUA 1DC6A 3V2GA 3DO5A 2V65A 5HM8A 3GY0A 3GGPA 3BMOB 2AE1A 3OJEA 1JWBB 1ISFA 1VI2A 3F1LA 4ROSA 4W82A 4PLPA 2W98A 3LLSA 3TZ6A 5HBRA 3DB2A 1O0SA 3KYDA 2W2KA 4K6FA 4FN4A 4BNFA 1HZZA 1YWGO 4XYBA 1DLJA 1NQ5A 3ASUA 4FS3A 4R5MA 2EP5A 5TT0A 4B8ZA 1WMBA 2JHFA 1GTMA 4E5KA 1XQ6A 5BT9A 1E6UA 5JBIA 3BHJA 5JAMA 5MDHA 1H9AA 4IUYA 1J6UA 1XU9A 4INAA 1ZO8A 4WCDA 3OF2A 4IQGA 4J4HA 5TF4A 3CZMA 4EITA 2J3HA 2HMVA 4DA9A 1HE2A 4XYGA 4P22A 4TROA 1F12A 1NAIA 3PHLA 4NH4A 3V1YA 1SOVA 2J3JA 3WLFA 3PPIA 5KJ6A 1ZMOA 1P1KA 3KM0A 5L40A 1B26A 4HNHA 3T7CA 1XGKA 5JAQA 2GD1O 3MJEA 2PWZA 3C1AA 4OYRA 2OUIA 4BNGA 4BQRA 4D46A 3RBZA 3TOZA 4C7JA 1JU9A 4TKLA 1ZSVA 1CWUA 3IP3A 3EZYA 1WLYA 2UUOA 3UW3A 1HEUA 2IDZA 1ZXLA 4OKIA 4NZ9A 2PKQO 5EIOA 3GPIA 3BMNA 2AG8A 2JD1A 3BMCA 1NFRA 3AY3A 4PG6A 3GDOA 4JJFA 1FXSA 1H94A 1P3DA 4ID9A 3VZQA 3PZBA 2QG4A 1N5DA 3MJCA 1B7GO 1CDOA 4BNKA 1KVQA 3ZHBA 4R51A 2R00C 3W4KA 1MG5A 3GLQA 1G1AA 1H6DA 3EZLA 1B8PA 2WWRA 4G2NA 2YDYA 2VTEA 4EJ0A 2FOIA 2VZ0A 4O59O 2O2SA 1V8BA 1C1DB 3C85A 3KBOA 2WD7A 3JQ9A 2JCVA 4IY1A 2EERA 4J91A 2VRBA 1U3WA 2F00A 2I6TA 2OFPA 5IXYA 2CNBA 3AU9A 3AOEC 3FBGA 4IZHA 1BGVA 2XXJA 1U1IA 2WYUA 2FR1A 4I5EA 4JBGA 5T8KA 3DTTA 3NV9A 5EPOA 1CETA 4Q9NA 1X7HA 2ILTA 1K3TA 4BKPA 3DR3A 4RZHA 4XIJA 1RPNA 1EZ4A 3PYLA 4EBFA 2P5UA 4QSMA 1XLTA 4UEOA 3WNVA 4RPLA 3FCOA 4GSLA 4OSPA 3WGHA 2NNLD 3V8BA 3OQ1A 3BXXA 3DMYA 4GI2A 1L1FA 4C7KA 5FWNA 1Y7TA 4M49A 1I30A 1GPDG 3D5QA 2CF6A 4DPKA 1BRMA 1AXGA 1JAXA 3CUKA 1W73A 4AICA 1XCBA 2EIHA 1ARZA 1Y5RA 4GGPA 3PIIA 3PQEA 1E5QA 3H2SA 3MCVA 4JIGA 4DIBA 3PWZA 2POQX 1H6BA 1A7KA 3LC2O 2IZZA 2AHRA 4ZRMA 4IDCA 1NASA 1Y6JA 4ND3A 1MX3A 2JD2A 1BVRA 5C37A 5L51A 1JDJA 1YOVA 4HXYA 3QVTA 2XPCA 3OQBA 2RHRA 1LSSA 4OAQA 4BNJA 2CVZA 2UAGA 3KOUA 2AQKA 5A04A 3ZNQA 1F17A 2VYVD 1TVEA 3FNHA 2PTGA 4WECA 3ZWAA 4HKTA 2GSDA 1ADBA 1ENZA 4QO8A 1EVIA 5EQFA 3NKLA 1EE9A 2Z1MA 1ZSNA 2PZLA 5C5IA 1VL0A 4MJLA 3WQQA 3UICA 5HWSA 4QO7A 3C7CB 3LQFA 4E31A 4ND5A 4XD2A 2YZ7A 1GQ2A 1P1JA 2FPGA 2AW5A 3H5NA 4J4BA 3W4JA 4PIVA 3NAQA 5B12A 1A71A 4ALKA 5DOZA 1R0LA 2GZ2A 1A27A 4E4YA 4CL8A 5FEUA 5I9NA 3Q11A 2NVUA 4EUFA 3D64A 1V9LA 3S1LA 2NVBA 2P68A 2BD0A 1K6IA 4J1TA 2X5KO 3NT4A 3L9XA 1E77A 3GNSA 4PG7A 4Q3EA 3OP4A 4J0FA 4YRBA 2IYPA 3G79A 4LRTB 1NP3A 5JCXA 3S2IA 3H8VA 3EC7A 3QY9A 5H82A 4W7IA 1M75A 2Z1NA 1LXCA 1R16A 3EW7A 4CM1A 2ZTUA 3AI2A 3NX4A 2PNFA 1PJCA 1X7GA 4NBRA 1JTVA 2PK3A 3PDUA 2C07A 2OOSA 1HL3A 4XYEA 3E5MA 2G82A 3N7UA 4OOEA 2B69A 2FY8A 4RVDA 5EQDA 2AEJA 5JLAA 4XDYA 4CJXA 2J6IA 2TMGA 3D7LA 4BGVA 4BGUA 5IN5A 4R68A 1DRVA 1WWKA 3ICPA 1C3VA 5H81A 5IG2A 1SEPA 1BXGB 3JQ7B 1H2HA 3HN2A 1LUAA 1YQDA 1DFGA 3RFVA 1E5LA 1TT7A 4NBTA 1HRDA 3GVHA 2NTVA 1SEVA 2CD9A 2O3JA 4MVJM 4RLHA 4A73A 2O3RA 3FWNA 3S2FA 4BB6A 1HDXA 1J5PA 1P0FA 1VJ0A 4NBWA 5BSFA 6ADHA 4IDDA 3ZNOA 2VNAA 3OHSX 1K0UA 3NDIA 5IN4A 4J7CA 2AQ8A 3I9JA 4YJDA 3GRKA 4J1QA 1S6YA 5DCYA 1I0ZA 1R0SA 2C59A 3GA0A 4NFYA 2I67A 5ICMA 4CLXA 3DBLB 4J7XA 4PLFA 4OOFA 2BFOA 3LT2A 1IL0A 3EVNA 5A5FA 3L07A 1PJQA 3K8ZA 3WWZA 4YPOA 4OGWA 2B5VA 4ZQEA 5TX7A 1RYDA 3JQAD 3MOGA 2VWHA 2Z5LA 1F0YA 1KY5A 2VYNA 3COSA 2DAPA 2O4UX 4PZCA 3PZRA 5A3VA 1T24A 3K2EA 1UR5A 1FDTA 3W6ZA 1Y9AA 2O48X 3DZIA 4YBZA 1NVTA 4EEXA 1SAYA 4DQXA 4Q3NA 3DBRA 4E0BA 3A1NA 4U6QA 5JCJA 4F45A 1QLHA 1Q2XA 1Y1PA 2EWMA 3Q2KA 3PHHA 1UDAA 1GD1O 1P1FA 1PQUA 3DWFA 3ADOA 1YL6A 4WCFA 1R6DA 1KY4A 5AXBA 4Y98A 5DF1A 4MVJG 3K92A 4DBVO 5JDIC 1S7CA 2GERA 1D4FA 3KB6A 3K9QO 3VTFA 3U4CA 1X13A 3AY7A 1GAEO 1NPYA 5TRTA 4GL4A 1E7WA 2JAPA 5EESA 4TKMA 1FF9A 2YJZA 4D3DA 1E3LA 4O63O 1IHXA 4GKVA 2J5RA 4R5HA 1VRWA 4CV0A 3TZHA 4IGFA 3R0IA 2X58A 4RVUA 3HNPA 1UXIA 2VWPA 4Y6SA 4IQ0A 2CDAA 2ZYGA 1WAMA 3D0OA 1I5RA 3HSKA 3VVCA 1B16A 3VZPA 1HE3A 1N92A 3BYZA 3E82A 2AEMA 3HZZA 1HT0A 5DP2A 3RBVA 1E3SA 1EDOA 2IE0A 2DFVA 3RC2A 3ENNA 3GEGA 1NWCA 1C0IA 3AW9A 3GVIA 4MP8A 4TZKA 5FI3A 4XYLA 3CIFA 1NAHA 1RJWA 4ZA2A 4YAIA 4YAEA 3T7EA 4BB5A 2PZKA 4Q3AA 1YQXA 1DSSG 3NDJA 2EJWA 3DBHB 4Z3DA 1ZK0A 2VYVA 3FN4A 1Y9EA 3L9WA 4O5OA 5DBGA 2X6TA 3BZUA 3QIVA 3B6ZA 3SBOA 1VJTA 3B70A 3OJFA 2FZWA 5A4DA 5TJHA 4HX5A 1C0PA 1ZKMA 5IJZA 4W4TA 1HKUA 1E3WA 2P2SA 3QA9A 1LC3A 3JQBA 4FGWA 5GZ1A 3RSHA 3D3WB 3ABIA 3F5QA 1AE1A 1ZJZA 2B37A 3WSVA 4CM6A 4CM8B 4CMCA 3PQDA 3H6KA 2QHXA 5CPFA 3CSDA 3QLJA 2H9IA 4WEQA 4BNVA 4QXMA 2DM6A 2D59A 2P4HX 1LDMA 3LU1A 4BNMA 4WCFC 3KVOA 2FP4A 4B4WA 4CM5A 2ZTVA 3FF4A 1XR3A 2PKQP 1TEHA 4FOSA 3E9NA 1GZ3A 2H5LA 3CKYA 1GPJA 1XEAA 3FD8A 4XB2A 5ILGA 3VAZA 4LRSB 2X86A 5ES3A 3L6OO 3CXRA 4JP2A 1J49A 2QRKA 2I5PO 3GUYA 4R1UA 2CDBA 4FSHA 4BVAA 2C5AA 2NACA 2I65A 1ONPA 1LRJA 3FWZA 1TT5A 1I33A 5KCZA 3PIDA 2VHZA 2BI7A 2IXBA 4NG5A 1PJLA 4QTZA 3MWDB 3KEOA 4YRAA 2EXXA 4WOJA 1MFZA 5JSFA 4BL5A 3L4BC 5JMWA 4CMBA 3JYNA 4FFOA 4K26A 4W9NA 4Z9XA 3TQHA 4AJ4A 1ADFA 4BNYA 2Q99A 3H9QA 4GX0A 4Y6PA 3IL2A 2Q49A 4FR5A 4QUKA 3OIGA 4FFRA 3OSUA 3IMFA 3OBBA 4WLFA 3WIEA 2CVQA 3DC2A 4ZRNA 3ZU3A 1VL8A 4K6CA 1BG6A 1A4IA 1EQUA 2BGKA 2YQ4A 3F1KA 3NGXA 4YT8A 1P9LA 3Q1LA 2PH3A 5AXCA 3HN7A 2Q2WA 3UF0A 4CLOA 4A10A 1VL6A 3DTYA 1TXGA 4XGIA 4A27A 2WE8A 4BIIA 4AJLA 2VZ8A 5L7YA 4ALMA 4PG8A 2RH4A 1P1IA 4WLEA 1QYWA 2PZMA 4XJTA 3R1IA 4YR9A 3DXFA 3GHYA 4MOWA 3WMXA 3ZZNA 3L6DA 2C82A 4L4XA 5DP1A 4DL9A 1QLJA 3ULKA 4EJ6A 3TN7A 4K28A 3N58A 2X8LA 1SB8A 2GN9A 4HFNA 1IULA 1E6EA 1NFQA 3DOJA 3TJRA 2Z95A 5AXDA 4CQLA 2X0JA 4BNNA 3WGIA 4Y6RA 3RI3A 2YFHA 2B0JA 3GDFA 4CV2A 3FNGA 2Q2QA 3B1JA 4XR9A 1GUZA 4AVYA 1AHIA 3U4HA 1IPFA 3P2OA 1HF3A 3FBTA 4DYVA 2BFAA 3IAHA 3RAJA 1FDVA 3H9GA 4G5HA 3O38A 1PZFA 3ZH2A 1Q7CA 4RL6A 4ZQFA 2NWQA 5CG2A 3M1LA 4GVXA 4BNTA 2GZ1A 2FZEA 3HJAA 1MLDA 1KBZA 1Y8QB 1Z74A 1M6HA 2BFPA 4LW8A 1EEHA 1DC4A 3HWRA 2FSSA 4R4JA 4YCAA 3WGOA 1JKFA 2FPPA 3QWAA 4BS9A 5C3MA 3WJ7A 2UUPA 2X0NA 4JCOA 4K9DA 3RBXA 3W1VA 3I4CA 2G0TA 1KOLA 4GSKA 1I36A 3WGQA 1NVGA 3PHIA 4QFDA 4BHTA 4B4VA 1TA4A 1BWSA 4B3JA 6LDHA 3GFGA 2JFFA 2Y1DA 3LLVA 3U5TA 2HU2A 2VHXA 2GLXA 4PCVA 4E2YA 5ADHA 1JAYA 4JJIA 1N9GB 3A06A 3TWOA 5IXSA 2FN7A 2XXBA 3QV1A 1U2DA 3BMQA 5A9SA 3VVBA 4MVJI 1JN0A 3HB5X 5I7FA 1NHGA 4E33A 2B4TO 2FWMX 3I4FA 2BGLA 1U3VA 3Q9NA 4FFPA 4DWVA 4F3YA 1ML3A 1HLPA 3K6JA 4MVJE 4RQUA 4DLBA 1R15A 5A9TA 1KEWA 3QVWA 2E82A 4BO1A 3JQAB 4YJHB 2O7SA 3PFFA 1DDOA 4NJMA 5BNFA 3C1OA 2Q45A 2O4CA 1BW9B 3ON5A 1EVZA 2WE7A 2AXQA 3JQFA 3ZDFA 5JYDA 1KC3A 4EUHA 4Y67A 4RVHA 1JLLA 1GEGA 1ZK2A 1HDRA 3CEAA 1PL7A 4WLOA 1NHWA 2QIOA 3FTPA 1FK8A 4EI2A 3NT5A 5LCXA 1VE9A 2HUNA 1GYRA 1DFHA 2NU8A 3PJEA 3SLGA 1YBAA 1GR0A 4CUJA 4AJOA 1C0KA 3A4VA 4PG4A 1DEHA 1DRUA 4BMNA 1ZJYA 4GAEA 4UVIA 4XB1A 2ZJ0A 3W8EA 4EGFA 2EJVA 4DLLA 1SOWA 2RH8A 1W4ZA 2OP0A 3CPSA 3UGKA 3OECA 5KJCA 1XIVA 3ANLA 2H1SA 3QHAA 1LLDA 2Y67A 1VLLA 4AJKA 3SC6A 4ND4A 2Y1EA 2OO5A 3VPSA 3UCXA 2G1UA 4R1SA 2AQIA 4BNWA 1NPTO 1RM5A 2AQHA 2JCYA 3VZRA 1JW9B 4I08A 3WGZA 3IQDB 4RCVA 2NTNA 2VQ3A 2VRCA 3WBFA 1X15A 4KUGA 4CM7A 1KVSA 4XKJA 3WTCA 1GV0A 5I9LA 4XRGA 3WTBA
chains in the Genus database with same CATH superfamily
2HQOA 1WPXA 1YJXA 1ZKDA 1ZVMA 2WF9A 4OB6A 3TD2A 4NCAA 4ZXFA 1SU7A 5SZKB 3F8WA 4E46A 1E62A 1ECGA 1QIJA 1QR6A 1T6NA 2EBFX 2NSDA 3CUSA 2RGGA 1SK8A 2JGFA 3EDMA 3Q9LA 4I55F 3RC9A 4ER7A 5J2UF 1FDUA 5KVSA 2HYDA 3VR0A 3QFRA 2XE8A 4EHFA 2PKEA 1QH9A 2QX9A 4UUNA 2X0FA 5BW5A 1QWSA 4O4IF 5IZ4A 5E95A 4A6PA 1QRUA 4CMEC 3RFFA 2JLRA 2X9GA 2R00A 4YACA 1PZGA 4KUHA 1TUBA 1X87A 4IMJB 4AN4A 1ORRA 3PUXA 2P67A 4CRWB 4R3WA 3ZI4A 1ITZA 3K9FC 4BASA 4TLMB 4GM1A 1L4HA 3LQ2A 4LRWA 3DOEA 4O8CA 1Z2NX 2JCSA 2Y1WA 3M6LA 2GYWA 1MB0A 4KV7A 4ZAZA 4FU0A 2I71A 1KAEA 4LNHA 2Q9UA 5JXJA 5I7RA 2Y6UA 3NTVA 2OPHA 5DN9A 1JQ3A 3VNBA 3CGGA 1OT3A 3UMRA 3FYUA 3FG9A 5J3JA 2VLIA 1ZOLA 3H9JA 2O7QA 2CXRA 4ZQIA 1RLMA 2XOEA 2GNAA 1Q21A 2JFOA 4EW6A 4IBOA 5J2TA 3EUAA 1S0UA 4CIVA 2FSGA 4E4TA 5EHZA 5G0SA 2AFIE 2VCHA 4UBMA 2VJMA 4G97A 4P36A 3KYIB 3Q7RA 4QEDA 2VEDA 5BSTA 4EA8A 3EH1A 1H2YA 4LOIA 3DMTA 4S24A 4AAYA 5CLHA 1GQYA 5DSZA 1DKNA 3UMVA 1K1EA 3MJDA 421PA 3JD4A 3GW8A 4NYIQ 4B84A 4QU0A 4YGXB 1WR8A 2DCUA 2VS1A 2QX7A 3Q72A 4OMCA 3B2QA 4QGAA 3T0GA 3R3VA 4W5WA 4XM0A 1CR4A 1I1OA 2P3LA 1JECA 1FEZA 4MINA 2PHZA 1GILA 1A9XA 1NONA 4TRNA 2XUFA 1QCDA 2VWQA 2XWSA 1JFSA 2WUGA 3A7DA 5JS6A 1EAMA 3DE0X 1E4YA 2P9EA 4GLJA 1ZIPA 4L02A 3MHPA 4Y7CA 4KK3A 2GHQA 4WESA 1CUGA 4JUFA 1M7HA 1BKYA 2BFMA 1QTNA 1UFVA 3E9RA 3T6KA 1NJSA 2YJTD 5LKAA 2H2DA 1IC6A 3C0KA 4Q9KA 4QE3A 1WDWB 4MZDA 4DV0B 1JFVA 1TVKB 3KOZA 2FR8A 3JCZA 1DQYA 1BFUA 3N6VA 2WZQA 2GD0A 3KQMA 4ND8B 3DLIA 2H8KA 2WFZA 2WW8A 1U63A 4RQAA 1VG0B 1U8YA 3GZJA 3SEQA 3CG4A 3ILVA 4GPBA 3HVRA 4D4HA 4K1LA 4C6HA 1JDTA 1MKYA 2QZ4A 4O1HA 4Q4JA 3SC4A 2EDAA 1WMFA 4V0RA 1GKYA 4D1YA 3KYJB 3O8QB 3PTZA 1CVIA 1GOTA 1LI5A 1QVVA 4RPKA 1U65A 3T4XA 4XWOA 2E9SA 2CNOA 4Y6QA 3HYNA 4NEQA 1A2OA 2R7MA 2ZSHA 1I5EA 2Q6OA 3UK0A 2FQYA 3H5IA 3B38A 3MGBA 2C99A 2XUGA 1GLGA 3Q12A 4URYR 3GRPA 3VU3A 3FSRA 4B0OA 2R8OA 4KFRA 1O6ZA 1XTZA 1XL0A 2QT9A 2A57A 4HS9A 4MYTA 4PY2A 1UBMS 5AM4A 2J0UA 5ELLA 3VBEA 4BV9A 4YVFA 3C3AA 4BFLA 5JH7F 3LUHA 2ANCA 5B30A 3HU3A 1TC1A 3PPYA 4EP1A 4QGSA 3MQFA 2JBWA 1HO3A 1KYXA 3II6X 4MPDA 1UADA 4GMHA 3W1EA 4OQMA 1M7GA 4FYVA 4UUMA 4ABYA 1QQ5A 4KAJA 3KAQA 1DG3A 3ZV4A 2JF0A 4CR7A 1K88A 2J33A 3I61A 4HWOA 1U7OA 2AUMA 2O2EA 3KOMA 4TTSA 3RSQA 3VAAA 4C4TA 3DE7X 2BKLA 4UM5A 4IOLA 1QX4A 1U9JA 5KTPA 4HB4A 4O4IA 5UKDA 4LY9A 1GCUA 3JQCA 1J5XA 2VBIA 3BCRA 4GDMA 4G25A 4HH3C 1CRPA 4HQ0A 1KBOA 3LW7A 2QG6A 1KJQA 4KJZA 2QTZA 3VKWA 2EIXA 4FSXA 2WJHA 2QM0A 4UC0A 1IMJA 2C2BA 4WNIA 4CMIB 4IVPA 1SOMA 4G67A 1TLLA 4HXFB 3Q2IA 4JS0A 4EQ6B 2ID4A 2XJ4A 1PJ2A 5LZ7A 5KNCH 3KVVA 1W19A 3K70C 3MYYA 4C0WA 2XW6A 4RHCA 1T5IA 1YR9A 2PKYX 2ZBUA 3PNMA 2FV8A 2XUPA 1SUCA 2AJBA 3ETGA 4B6OA 4C7MA 2WMDA 4WA8A 1PT9A 3CW8X 3VFDA 4Z3OA 3L6UA 4FFNA 5M3BA 3D31A 4ZO7A 5BMVB 4BL5A 4WMLA 1K06A 2E4VA 1Q77A 4F4HA 1A5BB 1BHO1 2I7DA 1F2UA 2RGRA 1BVYF 2OE2A 1Y1TA 3QEMA 5IU6A 4QUBA 4E21A 2E87A 2QTLA 2DB3A 3ZWXA 4JEHA 4BX9A 5KTSA 5FJIA 4OIFA 4OIMA 3RYCA 1O5OA 1L5NA 4NS1A 3LPLA 1FDSA 1BNCA 3MJRA 4REQB 2G9VA 4CE6A 1JG4A 3BCUA 2ZCJA 4BO9A 2P69A 1NBEA 5B1YA 1VBKA 2P5YA 13PKA 3BTUA 3NBYC 3PX3A 5J5CA 4BKMA 3EVEA 2J8ZA 2Q1UA 5CDSA 3U3KA 3W2EA 4N01A 4G4SP 3TE7A 2ZVPX 4WHMA 3WL6A 4F4UA 1T1SA 3R3HA 3Q4GA 3ELWA 3LPNA 4A23A 4O02B 5KDDA 1RRKA 3OLQA 5H4GA 2QLJA 1P7ZA 1RYZA 3LY8A 2JIOA 4KWTA 1O87A 4BEVA 1M34E 3N2ZB 1R0WA 4JL6A 5AQEA 5C1OA 1JIJA 4P80A 2Q46A 4GX2A 4WJLA 1RWVA 1PCXA 1RYHA 4MB6A 3K20A 4A5OA 5F9FA 5G0WA 1YASA 1DXYA 1UP4A 2VP5A 4CG3A 1U11A 1KIMA 1QGED 1YQQA 2MSWA 3FJYA 3KQWA 2I4OA 4EY5A 2PH5A 1GAQA 1YS9A 2WD7B 1IJKA 1LJUA 4B6FA 4AG3A 4G56A 4WBSA 5EPUA 3IQZA 1A77A 4CLHA 1AA9A 1F48A 4H77A 4MV0A 1J0XO 3WDLA 3WC4A 3CCFA 2XZLA 2OB1A 2F1HA 4N3GA 1BXRA 1XMQB 4Y1RA 2ZYVX 3RFUA 2GH1A 3Q5EA 4X7PA 2EQ5A 1PSDA 4PPFA 1YDGA 1JIVA 2JFHA 4IX9A 4LSMA 3T12A 4B5LA 1D6MA 1EH5A 3HP4A 1UKZA 3F5FA 2ZIWB 4R01A 4RLSA 3IDSA 3MILA 2ZI4A 4DMRA 1YJBA 2FF7A 1T5TA 3EGDA 1NQTA 3EIFA 2X5NA 3PR1A 1P74A 1JDZA 4OU5A 5EZYF 1ODKA 4E30A 1L5MA 1RLOA 1B93A 1XZAA 4BO5A 2IW1A 3CN7A 1X8XA 3SI7A 2AD5A 4UNIA 2C1ZA 1YS7A 3T3NA 1KHHA 3QWHA 3T99A 2VQEB 4EJFA 1EZ1A 5F7JA 1FS6A 2HDHA 2JL1A 3AEKB 1ZOOA 3B5IA 2P4SA 3GU3A 1AC5A 1RJDA 1DAKA 1SC6A 2ZW9A 3HZRA 3MPUA 4Y18A 5CX1B 4HV4A 1MV8A 1BH2A 1XEFA 2HDOA 3I58A 3ETCA 4GR4A 4KXFB 2RI0A 4TWRA 1IYZA 1WDMA 2ALJA 2BBWA 3C5EA 3SQWA 1RXVA 2IXDA 2W6JD 3E48A 4TSKA 1PTKA 5BNTA 5F12A 4HZUA 1RSZA 3EXAA 5EIBD 3VPGA 2QUBA 2CK3D 3GNQA 4IUBS 3RLIA 4LF8B 1EWQA 3ESBA 4LXQA 4YRJA 1BXKA 4M0CA 1Y5IA 3KCNA 2NO0A 4KHZA 3T7SA 1EM8B 1GZDA 1GT6A 1WY5A 4ITRC 3B82A 4OQZA 1K7CA 1GJRA 5JSYA 4IJVA 1P62B 3G3EA 3DVQX 1USGA 3PP8A 3B3AA 5EUBA 3ILSA 3U9LA 5LMCA 3B8HA 1JTEA 3PEWA 1ZC3A 4QUHA 3I9MA 5L7TA 5T4HA 2RGNA 1NPDA 4J16A 4JGIA 3QPDA 1NWHA 3G7SA 1UT8A 2HRRA 1RM3A 2ZRNA 3VNVA 3LUFA 4PRKA 1EDZA 1YZ3A 4DSAA 3NHMA 1CUHA 1MVOA 3HNRA 3TB4A 4ZQBA 3H2KA 1PJZA 2DF8A 5DH9A 3KO8A 1KZ7B 1SU4A 2PEZA 3CUTA 3KALA 2CYBA 3U3JA 1MC5A 5IUJC 2OXFA 2Y1CA 3A4IA 3LC0A 3W4IA 3BH6A 1CUXA 3MTGA 3OLVA 3VSDA 4GWKA 4J0IA 1G3RA 2QYOA 3A9CA 3FWHA 5CBPB 3UMFA 3CR8A 3RIMA 4B71A 4ZI7F 1T4CB 4ZMRA 5A02A 4DV1B 4GX5A 2EF1A 2Q3EA 3WNZA 4B6SA 1B41A 2AK3A 5FTNA 3AILA 3JQ8B 3MMXA 3OZBA 3WX0A 3ZD8A 2COUA 4EF5A 2XNDA 3BB3A 1LI4A 1Z29A 1IUPA 1Z4IA 4O4LB 4FOTA 4JLJA 3W9UA 3ZQUA 2Q4OA 3BWEA 3OEED 2ONZA 2VPZA 4YUAA 5A3SA 4PBTA 1FE8A 1BHQ1 4CQMD 5AJUA 4Z9YA 5EINA 5JZ9A 3AW8A 3V1KA 1PT7A 2JJYA 2NUPA 3NJ8A 4NL4H 3FLMA 4DIEA 4YMVA 2PT6A 2WJJA 1T2NA 5FLXA 4XRRA 2CXNA 5FI5A 2FPLA 4FI3F 2G5GX 4BPRA 4F9GA 1Z4MA 2ZWAA 3OETA 2EFGA 3ECSA 1N0UA 2NXEA 1C1HA 2JLQA 4I6GA 4J7AA 5IK2A 1ISGA 2P9HA 2UKDA 4YXWA 3P9PA 5KHOC 3IAS6 2O8NA 5HFAA 3UB4A 1X0VA 3EUEA 1KU0A 4BO7A 5A5VA 4OX9Y 2QTTA 4HGQA 5IAAA 4P3PA 1PFGA 4NENA 1RZRA 1I2AA 4UAVA 3W6UA 1AQNA 1OT5A 1D5WA 1KXZA 2H1LA 3KC2A 1EQ2A 1PZEA 3SQNA 3FDJA 2ERXA 3VC3A 4RETA 1JR3E 1T0UA 1C81A 3JQ7A 1I2MA 1D0IA 1QFYA 1WEHA 3BFKA 1IN8A 2JLBA 1DWQA 3UHAA 3TM5A 1M0WA 2VBCA 3MWEB 2HMUA 4FW9A 5EJMA 4C29A 3UPTA 4W9NC 3LSYA 3OOSA 4C07A 4TTVA 3UJNA 4HGZA 1COZA 1UBTS 3HRKA 4MULA 4B9AA 1UP6A 3DSRA 4UCXA 4XTRA 3X3HA 3FZYA 3SG0A 4JX8A 3TIXB 4XLTA 1S8FA 1L3CA 3GJXC 3R75A 5DV9A 2EV9A 2F3TA 2GUWA 2PWYA 5KVVA 1YMVA 4WUTA 4CKZA 4RV9A 5H7XA 3LUJA 4JY7A 4ZICA 4KGDA 3NH9A 4L8FA 2W71A 1G5PA 1T2VA 3DE5X 3L4SO 3MWFA 3V4OA 3W77A 1IQUA 1JKIA 1D2HA 3LFUA 3MJTA 2ECPA 2IVFA 4Q02A 3K0AA 9LDTA 1D5CA 3LYLA 4DADA 3FVVA 3LKDA 3OZGA 4YLEA 1UC4B 2YJ3A 3W8NA 5TIIA 3QPAA 4HCJA 5T6MA 1NBAA 2BGJA 3ELDA 2NUAA 3VU9B 3BWCA 2V3VA 3EVAA 3TLGB 2EC5A 1NTRA 1QFSA 1APBA 1PUXA 1LWNA 2X4GA 4FHGA 4MIYA 3S5UA 4EG6A 1Q20A 2B4QA 5DEIA 1OI7A 2PGJA 2R8YA 4IXTA 4HVTA 4QHTA 4BXOA 1X7YB 3TNFA 3VJMA 4E51A 2LKCA 4PZYA 2JAOA 4H31A 5E9JA 3U81A 2Y66A 5GZ3A 2XQVA 5IF3A 2R85A 1PNQA 2XWQA 2CBZA 1GYQA 3EXFA 3JQBC 5AFSA 5LXTB 2FJ0A 5FOUA 1L4BA 3AI3A 5JCPA 2FR8C 3FMGA 3G0BA 3SYRA 4DSZA 5LQKA 3GZNB 2A4MA 1RJGA 1OWNA 3FHOA 2VP4A 2I54A 4F3CA 4DV4B 2UZ3A 1IOVA 5AW2A 5BSEA 3T1YB 4KDEA 2E5FA 1N0IA 4WXYB 1EK5A 2GPNA 1E69A 2PA0A 4A8JA 2FVYA 3DMTC 5HJ5A 1P80A 2J31A 2DPYA 3ASZA 5IM4F 2NW6A 3D9QX 4ZVSA 1J8DA 3ZDYB 4C4RA 3TSCA 3IEVA 4BKUA 4Q82A 5K0ZA 4ZALA 3GLIB 1FFBA 2HCTA 2X9NA 4U7FA 1SCQA 3IUSA 1SIOA 3H0KA 5FPPA 1G20E 3EA4A 1OWPA 4RZ3A 2H0QA 2DECA 2CXPA 2WIBA 5AIAA 2IEZA 3K6SA 3ISJA 2DUNA 1RJEA 1K98A 3TPZA 2H2HA 3IQHX 4NP6A 1CUDA 3ZG6A 4HEQA 3B7WA 1WRBA 2GFIA 2C7GA 3DPUA 4QTUB 4KU4A 2Z9CA 4I4IA 2IV2X 2C94A 1I32A 4Q47A 3FCXA 1O97C 5IT5A 2ZBRA 2RGYA 3DWGA 3K9HA 2WYVA 1MF7A 2QW0X 2WHRA 3AERB 3GL9A 2PJDA 2J3QA 1ISPA 4U6SA 2GK3A 4DNQA 4ZGWA 2BCJQ 4PM4A 5AKYA 2AC7A 4HDMB 3GRRA 4NJEA 2LGJA 3D2BA 3HKCB 2FN3A 4MV1A 3KB2A 1EVEA 2ZBPA 2B8EA 2I7TA 3K1AA 1ZL2A 3ORFA 4I5DA 4RGQA 5IKEA 4K46A 2N1MA 1BDJA 1ODLA 5C53B 1E1QD 1VBMA 1A04A 1UQTA 3HBFA 1PJRA 3R0VA 1N9GA 2NO7A 2C97A 1XCPA 3EJ6A 3OOHA 1NQXA 3AHIA 1AURA 2BFCA 4I6JA 1TM5E 2QW8A 4MJ3A 2QR2A 4DMCA 5K2OA 2FDCA 5JJLA 1HOTA 2GLTA 3WNQA 2Q4BA 3DGEC 3LY5A 4CI9A 4G1MB 1UDWA 2OXCA 4Q93A 2D3TA 4QDOA 1DZIA 2W0MA 5L4LA 3WB2A 1FB5A 4HL6A 3KSRA 1Q1EA 2BMJA 3CLKA 2BGTA 2F3QA 1CQPA 2JRLA 1YMQA 1SUSA 3C15C 1FLAA 3F6YA 3NHJA 2P9BA 2XMPA 2OAEA 1KFEB 2I33A 3FKSD 3NWPA 2YN4A 2HPZA 4C04A 5K0NA 5CDUA 1RLTA 1E2NA 1XV5A 1DCMA 2F1IA 1N8NA 2WUWE 3GLHA 3K31A 3RVOA 3ZQ6A 4CM7A 4YMTA 4IG9A 5KC8A 3R3WA 2ADMA 4RIIA 4EHNA 1W5SA 2QF7A 4I8XA 1XRSB 1Z0SA 5D51S 4QULA 1SOAA 3QG1A 3QYPA 5EXEA 2ZR7A 2WHYA 1UBJS 3HJCA 4WASA 4WXEA 3K6KA 3ESRA 1QH8A 5ALLA 1VJDA 5HX7A 3UMJA 5LL6P 1G6KA 1THTA 3ETEA 1F20A 4GMXA 4RVFA 2FPSA 5DGXA 4DNXA 1ONOA 2C4KA 2H65A 3GOHA 1OAAA 3A9SA 3H6GA 2OD2A 1TDJA 1Z2PX 5DYWA 1P2SA 3KYDB 1KR2A 3KFXA 4LECA 3RTAA 4EABA 3SYKA 3LDHA 3LTNC 1E1CA 2NXCA 3R7NA 3T9FA 2PRJA 1TI7A 1IEVA 2QZSA 4YDRA 3KPWA 1Z5PA 3IKTA 1UBEA 2WVHA 1EINA 4D9MA 3QELA 1TT5B 3FKJA 1M1YB 1MTZA 3CTPA 4DMFA 4U7TB 3OIWA 1F38A 5CVCA 4BAZA 2X15A 3EX7C 2WICA 1O7JA 1QVRA 4OI4A 1ZX1A 1B8OA 2CL6X 3O5AA 1RTTA 1U6JA 4J0QA 1E9CA 2FZCA 4BZXA 4I5FA 2ABWA 1DP4A 2GK6A 3NORA 2H2IA 4YJ2A 1Q44A 2YHIA 1N4DA 2F17A 2JKZA 4EGJA 1KH1A 4RHTA 2BGIA 5AHRA 3ECCA 3OCCA 4JA0A 3O4GA 2DHQA 3EPKA 5BPHA 1XJQA 3ZIUA 4CEJA 1BE6A 2JW5A 1ZMRA 2Z30A 1KDVA 4YEDA 1XDWA 4URWR 5DNWA 1THGA 4P0QB 2WKWA 2QL5A 1Z4JA 2O1SA 1IMOA 3N8NA 3QKRA 5TGTA 1E3JA 2AD1A 4MRAA 1SD1A 4KLRA 4BCDA 3HXOA 1DS6A 2LDBA 4HOYA 1U0FA 1F8GA 4CNQA 1DBPA 1X2BA 1Y42X 5EKDA 1U1FA 4E4RA 3P9NA 2PPLA 3SP1A 3UKJA 4GI5A 4M0LA 2IWHA 3V48A 2C5SA 3E03A 1KEPA 1XWFA 1P91A 2IXEA 3IBGA 4YA6A 4RJIA 2I3GA 1AN9A 3QQPA 4JMPA 3ASVA 5CLQA 5EE5B 1UXJA 4R8SA 2PMEA 1EZZA 2WFLA 2ZWMA 4UAUA 2Q6TA 4ZT6A 3LC7O 4J07A 1TMKA 2RI1A 5E9QA 3SM9A 4CU2A 4MDYA 1U4NA 4IUCS 3L8HA 1ZK4A 3LWZA 4EBBA 2Q2NA 4F8JA 3TMKA 4MAMA 2AGVA 3FJ1A 4KE8A 4QOIA 4B7XA 4YCMA 1MJGA 3AM5A 5BN3B 3NVDA 4HNRA 3GX1A 4Z4EA 1OFHA 1RRMA 3A28A 1YK0A 4JP8A 4QATA 4QYIA 3TE6A 3LY9A 1NN5A 4JLAA 4X9XA 2ISQA 5BWMA 5CXUA 4WLNA 5JO0A 1T6ZA 4H6WA 4GU5A 2JAUA 4EYQA 5DO9A 5B4VA 1HTWA 1LS6A 4RJ2A 2WEKA 1F5NA 2FN9A 3L7AA 3RUPA 3TJZA 1W76A 5JZBA 4JB3A 1SKQA 1C1DA 1UQRA 4TL6A 2FG5A 2WFAA 5D3KA 2IYRA 5EL0A 5EYPA 5IC5A 4IH9A 1PWYE 5LDDC 4D9KA 4DLNA 1VYVA 2R66A 4EG4A 4W1RA 2I91A 3AP3A 1ULUA 3HY4A 5DI3A 2XHEA 5HDQA 1XZEA 4DF3A 3N1UA 2BE7A 4QRIA 3MNFA 4HUQA 3MB8A 1QR2A 2XQFA 3QSYA 1CJSA 1VM6A 4RPJA 4Z0PA 1P17A 4MIEA 1Y34E 1XVLA 2W2NA 1KYQA 2GO7A 2WF6A 1N2ZA 5A71A 2R79A 2Q5LA 3IBCA 3L41A 1UBUS 2P6OA 4LVOA 1JHRA 2HLNA 1U9CA 1ECJA 5FFNA 2HRBA 3AWIA 3ZGYA 4H6XA 2IIPA 1W85A 1XQ1A 1G8KA 4HDOB 3H7IA 1W59A 2HU8A 5JASA 1H1LB 1MRZA 3NTXA 1YGPA 5BN5A 3RSSA 1TJNA 5ADVA 3ZI7A 1NNSA 1YVUA 2XDYA 4JKYA 6NULA 2V7PA 1ZN8A 3GN1A 4HX2A 2ZI6A 4J1NA 5BXQC 1G98A 5JWOA 1HFJA 5ALKA 5EP3A 2H52A 3PGA1 5K05A 1BTOA 1T3HA 4IXNA 5ICEA 5KJFA 4WN9A 4C3ZA 2CXOA 2IF0A 2J48A 2EHDA 3FW1A 3G0IA 3IIEA 3PNBA 2IZ0A 4RD1A 5DN6A 4ZVMA 1W47A 1LB1B 5BYBA 2OORA 4H4DA 1YU6A 3GFQA 3HRHA 4YREA 3HN6A 4QJ5A 4Y9RA 1CZLA 3VPFA 4BNZA 1J2JA 4FYKA 2Q6IA 3VHQA 1DIAA 5KJ1A 1P18A 2CMHA 2D62A 3NBKA 4LWZA 2FZGA 2JGKA 2V74B 1RQRA 3EASA 3GFPA 3IFSA 1HC7A 1P5JA 2RI6A 1NMYA 3S40A 3E9ZA 3S55A 3W7VA 3E1KA 4KO1S 2XMCA 1YOVB 16PKA 4C08A 2MJLA 4BO0A 1T0JB 1H5QA 1JQJC 4GH5A 2V1UA 3QRWA 4KLCA 5EE0A 1ZJWA 3ED1A 2NSLA 1U02A 3R7DA 4DC0A 1XQVA 1LV8A 1JEJA 2GVDC 2HL6A 2VOEA 3DHWC 3M4JA 1PJ3A 4R2IA 1HK7A 2I4IA 3UFBA 1MAWA 2WPDA 4DHWA 2JLZA 4LF5B 3ERCA 1HE1C 4XCVA 1FQKA 1P60A 2LDXA 3JV7A 3PKIA 4HP8A 3JYQA 4Z4FA 2HT1A 1XWIA 4KPUB 3R3ZA 4Z51A 4R2KA 3BF7A 2AE2A 2PS1A 1H8ED 1GNLA 1OFTA 1UEJA 1G2IA 3CTMA 4IH4A 4GR9A 4OQ4A 3ROMA 1I4DD 2B21A 3ODGA 4M7PA 3QGMA 1GL7A 1O94A 1XMJA 2PV0A 4R7GA 4L57A 3MMZA 5G1PA 5J4VA 4B7UA 3LDUA 4Z0TA 2H7YA 4F6CA 3N3AC 2O2XA 1BGXT 4OFBA 3TQFA 4YUWA 1SZJG 1E9BA 1QYCA 2IEDA 3ONDA 4QG3A 3ONVA 4EI9A 2O2DA 4NAHA 3D8RA 3LHSA 3CLTC 1X70A 4N1AA 5JC8A 3T4UA 1PG5A 1UBKS 4CCAA 1WO8A 2XYGA 1NUQA 3ORQA 1Z6QA 1MB2A 3AV3A 4JBIA 2E21A 3SQOA 1KHTA 2WSBA 3WB0A 4QVIA 5CH5A 2GM5A 4KFSA 4O4JF 4KITB 1MJ5A 1NUPA 3C70A 3UBTA 1E63A 2ZRCA 1CB0A 3DQPA 1S3IA 3R6LA 4N49A 2DWQA 3EPRA 5JEDA 3C3JA 2ZIFA 3L0IB 4HNGA 1RI1A 3F6EX 2FRXA 2IX9A 2CWDA 4HH4A 1AGRA 3OO0A 3PNQA 3L0CA 4RH1A 5EJGA 3RJ5A 3UWOA 4AQYB 4R1PA 2EFEB 2JDID 2YJ6A 3A6KA 3MJ4A 1R27A 1NW8A 3BGVA 3BL8A 1HWYA 4MUMA 2F8SA 3JPWA 1Z39A 2AFIB 2Z3WA 4QDXA 5I4IA 1XK7A 3HQ4O 3FCAA 1PFWA 1MMFB 4Y2JA 5ERXA 3UCEA 1RZVA 2QKYA 3PC7A 4TV8F 3HGMA 1T15A 1ISIA 3T7KA 4QVGA 2Q7XA 3GZ4A 4F3KA 2ZULA 5AHXA 3ROZA 4DHEA 1FJXA 5A03A 2QVLA 1W8IA 4ARIA 2OWEA 4L08A 1RW4A 1V0JA 3LUCA 1Z33A 3CNBA 4G26A 3MCTA 4W6ZA 5AOBA 5KDOA 3I62A 4MKHA 1S2GA 2CKMA 4INOA 5LDGA 2GJ9A 1Z34A 4KQWA 2E4WA 3TW8B 5LMUB 1LF0A 1VG1A 3H9EO 2JPDA 4KX3A 3IA2A 2F3PA 5G41A 3T3HA 5HGXA 1OCEA 3AVQA 1E0DA 1KYTA 1T8RA 3BJEA 2Z2IA 4AYTA 2HCRA 4POOA 3COWA 4XSHA 3ZY6A 2MCFA 1LX6A 3COPA 4GUAA 5TQ0B 2ZOSA 3MJVA 3LNTA 5K5EA 1VFPA 3E4DA 2NNWB 3KV3O 5HF9A 1NKTA 5JJ5A 2V03A 2B98A 2W6MA 3ND6A 4GMDA 3STWA 4IJ6A 4MW7A 4PCAA 1KYIA 3QFHA 1C1XB 4UEKA 2GZSA 3F9CA 3GFSA 4K2HA 4WLUA 2JK1A 4PAQA 3V2IA 1II8B 3HJFA 2WJPA 5ALGA 1ZYUA 2RJOA 5CAEB 3URKA 4QPJC 4LJAA 3NXKA 3OKPA 2DR2A 3AM4A 1WW8A 2C54A 2R8XA 1MO2A 4FC6A 1Y8CA 3FMOB 1F14A 3R76A 2WYHA 2DUMA 1XLVA 4CM4A 3UUGA 1IUNA 2ASVA 1JZSA 3CM0A 4BFYA 4UPDA 2OLKA 5AKKA 4X60A 2JGDA 1HXHA 2XZPA 3IPRA 3OQHA 4RIEA 4XGRA 4DABA 1R2QA 2PV7A 1Q0SA 2H07A 1PYGA 2WTEA 3CF4A 3NYQA 3CMMA 3RV4A 2WNSA 1K8ZB 2IYNA 4F3RA 2F1RA 3N2LA 1QDUA 2VH1A 4IDAA 2VYND 1OBVA 2PZAA 3PNOA 3WLAA 4BZZA 4OG2A 4UTNA 1JG6A 4F4IA 1SU8A 1BJTA 4MI9A 4AI6A 1QHSA 3TSYA 2AZMA 4BMVA 2WINI 1FP6A 1LW6E 2Z6QA 2Q8PA 1RIIA 1DHTA 3GGSA 1ZMXA 4TWJA 1SCUB 2XOKA 3QU2A 4EW3A 5T4BA 3SJUA 1CRWG 4H3KB 5AJVB 1GL3A 4BFSA 4O08A 1P31A 4O3FA 4I66A 2NYAA 3KZMA 3G82C 3EDQA 1W0JD 1LA2A 4P7KA 2NYRA 1IIBA 3BXPA 3WGGA 1KI2A 2D1QA 1Z4NA 2PO5A 5F5NA 4NBLA 3P1JA 4I4NA 2X6RA 2BMDA 5JC1A 3ZW8A 4ZDKA 1XCJA 4YDHB 1P73A 1CQXA 4UHBA 1YQWA 2YXEA 1X7DA 1WKCA 4K6OA 3NWJA 1RC0A 3L4BA 2BP7B 1AKRA 2ATIA 4H1VA 5C3UA 2C1EA 3FTFA 4NMMA 5COAA 3RD5A 1Z16A 4G0WA 1IEQA 1H2AS 1QM5A 1FSGA 1A8UA 1Z45A 4IVQA 2O20A 2RHHA 4P6VF 3L8ZA 3GLFE 3CXUA 3ZGOA 5LZ9A 4KYTA 1RI5A 3H4VA 4CV1A 3CRZA 4H3VA 3W5VA 3KZ1E 1YR2A 1KEEB 3P9ZA 3VDXA 4MAFA 2IHUA 3VO8A 1OFVA 1YR8A 4XCXA 3ZEAA 2GAAA 3NEAA 4ESOA 5U9CA 3EOBI 3SU8A 4CQMB 4PYNA 4ZJUA 1CQJA 1PL0A 2BMEA 1JQKA 2DBZA 3I8SA 4BV8A 3ZGVA 4HJRA 1P0MA 4UMEA 4NARA 3UJ6A 1VE7A 4JLNA 4AECA 3L7DA 1QU2A 4MQFA 4PZ0A 3B9QA 2DTDA 4TV8B 3WLLA 4X91A 4C0AC 3HHEA 4QXPA 1UM8A 3V33A 1HV8A 3FSGA 3FCYA 4FFLA 2CNWA 4LVCA 1IN5A 1D2CA 2BUBA 5ED4A 3RJ9A 1XXLA 4BMDA 3NOVA 4MQMA 3U31A 1QAMA 3JQDA 5AW1A 1MNAA 1YBFA 2WSSD 4GF5A 4BO3A 4PO1A 1NFFA 3TGWA 3UT0A 2QYSA 3INGA 4G0MA 1BDHA 3M2PA 3U26A 2CLMB 3I2FA 4OUKX 1GIAA 3TEMA 4BC0A 3EEOA 2GPSA 1FDWA 1UC8A 5B37A 4BFTA 5LP6F 1YB4A 2FPXA 2QZZA 4MVWA 3EFBA 1SG9A 1XC7A 2MSEB 3GLSA 4QQRA 4ZT7A 3RYHB 4DLKA 4FBMA 3VTAA 1UAAA 2ZSFA 2E1RA 4QA9A 5CTAA 1AGYA 2X76A 1CU1A 4IX1A 1FUEA 3G0CA 2ZRGA 3HMQA 3MM4A 3U4GA 2PD6A 4TMXA 4HN4B 1OXBB 5LWQA 2W0SA 4KX5A 2H2FA 3LX5A 3SR3A 3TH5A 1JQEA 5B7GA 1UF9A 4PIPA 1CJCA 3AFNA 2GWRA 3JALB 5LIRA 3FF1A 1X1RA 4LV8B 5G1NA 5EZ5A 1ATIA 5BQXA 4BGDA 3U7QB 2V7GA 2EX0A 1H93A 3E8MA 3GQVA 3NAZA 4KLNA 1GSAA 2G4CA 4KTTE 4QHSA 5LYJA 3ZWVA 3KZVA 3V55A 1L5FA 3OOJA 2WMOB 3Q0TA 4RJJA 4P9NA 3BVPA 1F2TB 1PLJA 3L8GA 3M6UA 5HKKD 2UXBB 2G76A 4R2XA 3VR5A 1E2HA 1GQFA 5D3ZA 3VOAA 5KC9A 2OGTA 4IEEA 3L06A 4RF4A 2R68A 4Y9UA 4KQEA 1I24A 3PE3A 3GR6A 1NBMA 2JD0A 2R1VA 2WBLC 3LP5A 4PR3A 4QDJA 1R00A 3QJYA 5LQMA 3J80A 2NZUG 1EK2A 4PNEA 2XMRA 4FD3A 3PRKE 5EY5B 1C14A 3OPYI 4G1EB 1VG8A 1CK4A 4JYCA 1U28A 1XXHB 3GWGA 1YQUA 1KS9A 1OX6A 3BILA 3ADPA 4R3UC 3FUTA 3LRTA 4ENVA 4AG5A 1GA1A 1AHNA 2B94A 4YRIA 4GYKA 1F06A 1MEOA 4JC0A 3BGSA 2IA5A 2PX0A 3AIKA 1WKVA 1Z6GA 3R20A 3GDHA 3I9V6 1VIVA 1TOAA 4RS3A 1P2FA 1JU3A 2I66A 1U98A 1JJVA 1GWNA 2MYTA 4OQQA 2CVPA 1VJGA 1QV9A 2CMGA 4PYMA 4Q9LA 5CT8A 5HF6A 5SYNA 3ZW7A 2WM3A 4ALIA 4Q0MA 1OUMA 4D2IA 4YDQA 4LGYA 3UB2A 3C45A 3OICA 5K20A 1TLFA 4DLYA 3FWPA 3RQSA 3WA6A 1KZGB 1O95D 1YAJA 1S3FA 1UBRS 4RVSA 1PV2A 2A1UA 4WEOA 4ETIA 4RJTA 5JS7A 1NP7A 1N2HA 4DLRA 2C5BA 1WDKA 2O06A 2VG8A 2GUGA 5JDCA 3ICWA 3PL1A 1B8UA 4MR8A 1N0HA 2D1SA 4MVYA 2IDKA 3E4CA 2XTMA 4KV9A 4EA6A 3F6CA 1SOUA 3FWKA 2B5WA 2V6BA 4OHWA 1KPIA 2W8ZA 3PI6A 2E4AA 3PX2A 2VA8A 4KXUA 3DVLA 2H51A 4TWZA 5BO5A 4K9SA 1IE3A 4DARA 2GAJA 2UU9B 1AOXA 1U7TA 4HDNB 2BT4A 3R5JA 3COYA 4KB5A 2D7DA 4ITUA 2VHTA 3A9RA 3O8LA 3QYJA 5ESDA 3FOEC 4UPEA 2BKEA 4XWAA 1A4XA 2AI3A 4N54A 3G6WA 1IAQA 1U4SA 4LHEA 3P9KA 3WAJA 1LK7A 3QK7A 4D45A 1B3RA 1QP7A 2OO7A 4CTJA 1UZMA 2CYAA 4ZYTA 4J6FA 1E6LA 2BDEA 2FEMA 2ICAA 3GT0A 1KQ3A 3HKEA 3ZW9A 4M9UA 5IJ0B 5JPCA 3N2EA 1RRPA 1YVPA 4CF4A 4MS1B 2C4UA 4AJHA 3AUKA 3G2NA 2V97A 3TLYA 4LDNA 1PL8A 4DQUA 3SEFA 3FGPA 4KQ2A 5KJEA 1DX9A 3KEMA 5EJFA 4FN5A 4OMUA 5EMMA 4RTQA 3AY6A 3DLTA 3R5XA 1ZOIA 5F5LA 2XYVA 3H04A 1P7VA 3N74A 1OOEA 4XVCA 3RVKA 2P9GA 4HHEA 5DHUA 3D7NA 2J9XB 2Y0BA 5FTJA 1UOPA 2X0KA 4JI7B 1UXKA 2P6RA 2KW5A 1W35A 4RDCA 4RGVA 2IV7A 1TRKA 5JS2A 1T25A 1JVBA 2QXYA 3OMWA 3OURA 3AOEA 1JEOA 5C8XA 1P0CA 3ZWWA 5G1OA 4OI1A 1I7PA 4JUIA 2X4LA 3WLEA 2X7HA 1HLGA 2C2YA 2Z3VA 3IHWA 4I1OA 3P2EA 1RKXA 2O3UA 3ZD7A 1I1QB 2UV8A 3Q41A 5EJ2A 4KOAA 2CNWD 1AVTA 4DNFA 2HMSA 3K30A 2FX5A 8ATCA 1JHAA 1PGOA 1P2GA 3OD1A 1QS0B 3TSZA 3RRMA 2FEAA 3BREA 3NC4A 1YQTA 5LBUA 3BC1A 1P81A 5IJ9B 2H6EA 2GKOA 1E0JA 3L8CA 3CJRA 4G0ZA 2X0DA 3O8OB 1E6CA 3CZRA 4TYWA 2V7VA 3OOWA 4QQFA 4NWIA 5FPQA 3PDIB 1ZHHA 2QM7A 1JEYB 1EX6A 3H19A 4HFJA 4CF6A 4ZHQA 5IVHA 5SZIA 1DXQA 1TAGA 1ZCFA 2JASA 2RGDA 3FR8A 4XUEA 4F93B 2IPMA 2X9VA 4WZZA 3WOVA 3AZQA 2BELA 5LYJF 1GPBA 3HABA 4JLKA 1L2TA 1QNFA 1YVRA 3BMQB 5A9SB 4U5XA 4HMOA 2PZGA 1TQ6A 2HQSA 3Q0EA 4BLVA 3B2NA 4AL4A 2AMFA 3M3PA 4LKOA 3UUEA 4NPHA 5EWLB 4JLPA 4DQ0A 2PS9A 4AKIA 4HNSA 2RBEA 1TKBA 2CLKB 2WYWA 3IPAA 1W1UA 4PZDA 4BVHA 4DW8A 3C3PA 2IUYA 1DBSA 4GR5A 5ALPA 4XH9B 5DIFA 5FNVF 3S2EA 3UG6A 5KMGB 3JQAA 1QMPA 2V9ZA 1KI6A 1ZBDA 1A8HA 2ZCUA 1P1CA 4KO8A 3STHA 2R1ZA 5CG1A 4C87A 1I3NA 1L8AA 1T36A 3FGZA 5DHSA 1ZGBA 1QQBA 2IPXA 3CRNA 2C3UA 3C1TA 3RIXA 3AHHA 3HCAA 4RLFA 2ZVQX 2XOKD 1EG7A 1YDEA 3LL4A 1ELOA 3WLSA 5CIYA 1TJ3A 2G8LA 2QTMA 3OE7D 1C7EA 3PC6A 2ZUBA 5IVDA 1FLNA 2R4QA 3OU6A 1DAEA 3X43A 2I4TA 1DINA 1VZ2A 3IUEA 4RD0A 4YJGB 3TL2A 3CPJB 4DR3B 3ADBA 4BMXA 2CEKA 1QU3A 2MINA 3H8SA 1I3MA 1P1BA 1BS9A 2ONCA 2WHQA 2RE8A 1FNSA 1M1NB 1FMCA 1P0PA 3NDRA 3ONFA 1ZITA 2Q5JA 3R3XA 4HH1A 3ZTYA 4FGLA 1Y5LA 1WV1A 3KPYA 3P19A 4C76A 4EMTA 3PLNA 5DK6A 2NYVA 4XDGA 3TRDA 3TUJC 4A0GA 4LJRA 3R5TA 3A2NA 1SELA 1TUEA 2M1ZA 3SF0A 3VYSB 1ZXXA 1CQIA 2IUEA 3IOYA 2CB0A 3AR8A 2O1WA 1UINA 3HH8A 4I2NA 4JHLA 4JKIA 5D84A 3X1MA 1U5CA 4AU1A 5TPZD 3WI7A 4C4YA 5AJYA 3E61A 3VYVA 2IELA 2YXNA 2AKYA 4A1FA 1E1KA 3DOOA 1H85A 2W5UA 4MGIR 1NXQA 3AEUA 3HDVA 4BKQA 1W5EA 2CVOA 2Z4SA 4RKFA 3BKXA 3VNQA 3HP7A 1USUA 3PS9A 1R4NB 1PGJA 2EAUA 4HO1X 2D5LA 4PRLA 3BFPA 4WZAB 5CHYA 4E22A 1VKNA 5C32A 5BSRA 1JDBB 5CW2A 5LQDA 2O8FA 1MOZA 4BTEA 5CUQA 1UFRA 1L7EA 4EFMA 5KTNA 3A26A 1QHHB 1R6TA 2WMNB 4XM1A 1C4WA 4V0QA 2I6UA 1BS2A 3DHNA 4IVNA 2P9CA 2XKBA 3RUEA 1E9FA 1ONNA 3KHUA 1SPXA 4Y2XA 5GGXA 4D02A 2GJKA 2PLAA 1NATA 4RY0A 2YBEA 3W5HA 4PICA 1SQSA 5DASA 4TTTS 2FWJA 3X1XA 3T7IA 5HIIA 5IFKA 3FOBA 1HZJA 3PQ8A 5L3VA 3KT6A 3U39A 4F84A 7REQB 1N5MA 2R6FA 5KTOA 2PUAA 1RHUA 3WWCA 3D3NA 1M74A 3ZVMA 3IHLA 4WJZA