1KC3A

Crystal structure of dtdp-6-deoxy-l-lyxo-4-hexulose reductase (rmld) in complex with nadph and dtdp-l-rhamnose
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
298
structure length
298
Chain Sequence
MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVNAAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETDATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVINDQYGAPTGAELLADCTAHAIRVALNKPEVAGLYHLVAGGTTTWHDYAALVFDEARKAGITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFDLILPQWELGVKRMLTEMFTTTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords dTDP-glucose oxidoreductase
publication title Variation on a theme of SDR. dTDP-6-deoxy-L- lyxo-4-hexulose reductase (RmlD) shows a new Mg2+-dependent dimerization mode.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 104
structure length 298
sequence length 298
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kc3A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kc3A02
1SCUA 2J3JA 3OJOA 3PEFA 4FQ8A 2X0IA 4KWHA 2XAAA 3ETGA 1YB4A 1JVSA 3E03A 3V2HA 3IMFA 2D5AA 3RQSA 3KB6A 3LK7A 2UVDA 4ND1A 2YZ7A 2GZ2A 4PLWA 5IJZA 3IUSA 1J5PA 2GR9A 2PK3A 4FSHA 1TT5B 4JXKA 4LN1A 2YDYA 2O3JA 5JW6A 1UDBA 3QWHA 3SJUA 5TT0A 3UAGA 2G17A 1BGVA 1GQ2A 5T64A 1NASA 4PZCA 5G0WA 5JNLA 5A5EA 3VKUA 3WS7A 1CDOA 2JFFA 3DHYA 3HFSA 1ZMOA 3W8DA 3UW3A 1MXFA 3DEYX 3GQVA 4W99A 4N5NA 3VH1A 3WQSB 3A28A 3ZDFA 5DOZA 4P4NA 4WNIA 5ES3A 3V8BA 4C7JA 1GCUA 4CQMA 2OBYA 1PGNA 3FBTA 1SPXA 3HN7A 1D1TA 3VVBA 4CQLA 2VZ8A 2IEDA 5EN4A 2NV6A 3OA2A 3CIFA 2VZ0A 4DQVA 3WMWA 3FNGA 2QRJA 3L4SO 4R1NA 5IN5A 4LISA 4ND3A 4D42A 4MDHA 2YV2A 3PWSA 1C1DB 5JYEA 3EZLA 3RFXA 3LQFA 1BVRA 1M66A 3DAPA 1K6XA 2X23A 4NFSA 4CLRB 4LMPA 3LLSA 3JQEA 4Z0HO 5KVCA 1LSOA 3V5NA 4E2XA 1BHSA 3F3SA 1LRLA 4I5GA 5JO9A 5ITWA 1T2DA 4G65A 1GZ6A 1DHTA 1WMBA 1E3JA 1SNYA 5JCJD 1N1EA 3ORFA 1IE3A 1ZVMA 1GPDG 3L4BC 4GKBA 4R3NA 4MIYA 1EBFA 2XXJA 2IYOA 3RU9A 2BRUA 1AXGA 3HDHA 4WLNA 3U4DA 1BVUA 2FWMX 3WTBA 3ZN2A 1N9GB 1CF2O 3I3OA 3WB9A 3S55A 4CMBA 3OETA 5TSDA 5KJFA 2H9IA 1UZLA 1YH3A 1ZNQO 2FR8A 1JW9B 4WJZA 3RROA 2E49A 2FR0A 1LLQA 4Z3KA 2C59A 3F4LA 4MVJH 4RLSA 3D4NA 3GVXA 2ZJ0A 4NDNE 1Z73A 3ON5A 4XQEA 4RORA 3JQ7A 3DC2A 3LT1A 4XJTA 5F5NA 1DDOA 1KEVA 3JQGA 4OJNA 1D8AA 3DZJA 4R9SA 1HEUA 2P68A 3F1KA 1JDJA 2TMDA 4AG3A 2FN7A 4ESOA 4CM1A 1PQUA 5KKAA 1U1IA 4N18A 1QYDA 3MWEB 4CR6A 3JTMA 1WZEA 4CM4B 4E0BA 4IJKA 1PJ2A 4FJ0A 5THKA 4DMMA 1F8FA 4EUEA 1HXHA 1LBEA 5JBIA 1C1XA 2VUUA 1HLDA 1OC4A 4DQUA 3FPCA 3S2GA 3NGLA 4U7WA 1C3VA 1Z82A 3TOZA 3E9QA 1IUKA 4B4UA 1FF9A 4FD3A 4GWGA 5G0SA 2UUPA 3G79A 6ADHA 4BNHA 1AXEA 1N7GA 2A9FA 2OO5A 1GUYA 3JQBC 1X14A 3H6KA 3MTGA 4JN6B 3AUAA 4MVJD 4L0QA 3U9LA 3ZHXA 1T24A 1U4OA 3RC9A 2J6IA 3ONDA 4A5OA 3H5RA 2WYWA 4HFMA 1X15A 4B7UA 3B1JA 3H3FA 1WDMA 1JTVA 1X1EA 4PLHA 1CQJA 3U4CA 4TWRA 4ZICA 3EW7A 1PJ4A 3B70A 1KETA 5KJCA 2UUOA 3HG7A 2C7GA 4E31A 1NQAO 2V6GA 3P2YA 1PQPA 4YJHB 1V0JA 2V65A 5GZ1A 5DP2A 3PVZA 1MFZA 3IAHA 1Z7BA 4RDHA 1DLJA 5FI5A 2QZ9A 1QYCA 1UXIA 4DXHA 3QWFA 1NNUA 3GT0A 3F9IA 3HSKA 2G0TA 5CPBA 2V7PA 2NVWA 4HX5A 5LCXA 2CUKA 3SLGA 2VYND 3KO8A 3BMCB 1Y8RB 1LSUA 2GDZA 4J43A 2Y99A 4GKVA 3UF0A 2IZZA 4HP8A 4GX1A 5JAIA 1JU9A 5LC1A 2D59A 1UXKA 4JP2A 4XZ3A 5JC1A 4JQCA 1QLHA 1XYGA 1YOVB 1GUZA 3VVCA 3MJSA 4WGGA 2A94A 4ZRMA 5A3VA 5GMOA 5TC4A 3NJ4A 7ADHA 1TT5A 2RIRA 3ROQA 3GDOA 5ICSA 3K2BA 4UAGA 2HK7A 5L4SA 5TJHA 4BO5A 3TZCA 4RCVA 3PYMA 4WECA 3KRTA 3S2FA 4A26A 1LRJA 2VOEA 4NFHA 4DLBA 1ZW1A 1T4BA 5CG2A 2FRDA 1I3KA 3PQEA 2GO1A 1E7QA 3ZV5A 2BKAA 3QP9A 3U62A 2A35A 2YV1A 1HDYA 4XDYA 5G0TA 3AM3A 5H81A 3BAZA 2BI8A 1V3UA 2YQ5A 2W2LD 2GUGA 1I36A 4Q3DA 5ILOA 1NTOA 3VZPA 1SZJG 3WX0A 2IXBA 5A5FA 4OL9A 3RAJA 4BO6A 3GY0A 4PVDA 4CMEC 3PRJA 3FN4A 4WNCA 1NYTA 4KUHA 1T2FA 4R54A 1GZ4A 2R00C 2DT5A 3AI2A 4WCFB 5I8ZA 1U3UA 2O3TA 3OJLA 2BGMA 3WXBA 3WGIA 3AM4A 4AFNA 1JAYA 2AA3A 4D3SA 1IB6A 1PL7A 4J7CA 1WLYA 3K2EA 4CLRA 4NU6A 1B15A 4CPDA 2EHDA 2JD0A 1XIVA 3O8QB 5AXBA 3WWZA 2J3KA 5JDIA 9LDTA 2BD0A 2E37A 3B1KA 3JQ8B 1GD1O 4XJSA 3JQAB 4ITUA 4HY3A 1HDZA 1FXSA 1E1MA 4WOKA 3KXDA 1C0KA 3W4KA 4AJEA 2CVOA 5F1KA 1ISFA 4YA6A 4RL6A 3ASVA 1P3DA 1XDWA 1A4IA 3D4PA 4WCDA 1HDOA 1MUUA 4ZD6A 5EQFA 3NDRA 1ENOA 3QV1A 3SBOA 1T25A 2EGGA 1MFPA 1A7AA 1DC5A 4BNFA 1RM4A 2H1SA 2VWQA 4TZTA 5KJEA 3JV7A 1E3EA 1LU9A 3RUDA 3ZWCA 5K6AA 5KCZA 1SBYA 2E6UX 2GERA 2IXAA 3CE6A 3D3EA 4YJGB 1KY5A 4BNKA 2OXIA 3DZBA 1W0CA 4IDBA 3S1LA 1AUPA 1U5CA 4BB5A 1YBMA 1IPFA 3NGXA 3JQFC 4F6CA 3C7CB 3QWIA 1NVTA 1NAHA 4CV2A 3E5MA 4IDCA 4GVLA 3A14A 3QY9A 4D43A 2FR1A 1A27A 3WQQA 5KNLA 3PP8A 1HT0A 2HKIA 1F14A 3AUSA 3R3JA 2Q1TA 1UDAA 1BXKA 1H94A 5JDCA 1E3LA 3BHIA 2GN6A 5CAEA 5FEUA 2C29D 2JL1A 4E13A 4JLWA 4NU5A 2UYYA 3ZWXA 3C8MA 2AQKA 1YKFA 3GDFA 3HB5X 4E2ZA 5KVQA 4YEDA 3HJAA 1PZGA 3PWKA 4O5OA 1T2EA 1MGOA 4EEXA 4D45A 2I66A 3FBGA 4AJKA 3C7DB 5U9CA 5C7IO 3VHRA 3UXYA 4CLHA 2DTDA 2QQ5A 3H9JA 1NM5A 2Q46A 3ZV4A 4LRTB 5FYDA 1SO8A 3I5MA 4C4OA 3WICA 3WNVA 5EJ2A 3I1JA 5HA5A 5IF3A 2FMUA 1HDRA 2NM0A 4NR0A 2NACA 5A9RA 3I52A 1PL8A 3SLKA 3QVSA 3PHIA 3GK3A 4K6FA 4YJHA 3D0OA 1VRWA 2Y66A 3DZHA 3ADOA 4XYEA 5BR7A 5CEEA 4BO2A 5EERA 3HUDA 3U09A 1ADBA 2RAFA 1U5AA 4IJWA 4CJXA 2PA3A 2SCUA 1KBZA 4LGVA 1PGOA 3TQHA 1YQXA 1T4DA 3FNFA 1XA0A 1Y8RA 4CMKA 4BNXA 1EE2A 3JQ9C 4J3FA 2O50A 4BKPA 4CODB 1LI4A 2NADA 3RCBA 3VZSA 1EBUA 4S3MA 5B1YA 3E1KA 2PGDA 3H3JA 3GNTA 3PXXA 4OM8A 3RSHA 1FMCA 4CM9D 4ND4A 2BLLA 3ZU4A 1UXJA 3H5AA 2ZYDA 3G1UA 1S6YA 3MJVA 4J6FA 1QV7A 2EF1A 2XXBA 4A73A 4BKOA 5CFZA 3MOIA 3Q1LA 2VWGA 3PHJA 4ZA2A 2POQX 1LQTA 4AJNA 3OQ1A 3P19A 4YAKA 3CH6A 3IP3A 5A9SA 3SVTA 1VC2A 5CG1A 2DBZA 5L45A 1VM6A 4CM8A 3QRWA 3EMKA 5L7YA 5B12A 3JYNA 4YDRA 4I08A 3WBFA 1HRDA 2Y93A 1UUFA 3KYCB 2AE1A 3FR8A 3O4RA 4MINA 1OZAA 1P1HA 1XELA 3OFSA 3DWFA 5TT1A 2JKVA 3PZBA 1JQBA 5A05A 1LDGA 1NHWA 2J3HA 5C3MA 4WLFA 5KWEA 4TVBA 3MTJA 4FN4A 2F00A 1M2WA 2E48A 5EL0A 1EQ2A 3D5TA 4IMRA 2J5QA 3HN2A 4KWIA 3ZWNA 4Q3AA 2VHYA 2HMTA 3HDQA 4WCFA 5JY6A 5K0ZA 3VTFA 2C2YA 3UN1A 3LC1O 5HRUA 4L4RA 2UAGA 3B6ZA 4QFDA 2W8ZA 1EMDA 4I9HA 2FHSA 3RVDA 3M6IA 1KC1A 5JAMA 4ZU3A 4PLZA 1Q2XA 4YAJA 2WD7B 3AK4A 4RVFA 4CV0A 3O8QA 1UAYA 2DTEA 1LNQA 4YVFA 3JQAA 3WG9A 1R4NB 4UVIA 1PR9A 4MVJG 1B2LA 2C2XA 2PH5A 4UUMA 4TVOA 4LVCA 5A06A 4BIIA 4FDAA 1P0FA 2PZKA 3K6JA 4JBGA 1W6UA 3RBVA 4E5MA 1IHYA 1LUAA 4DA9A 1VSVA 2Z95A 1Y1PA 3QLJA 4OXNA 5DULA 3AFMA 2JD2A 1UZMA 2VT2A 4BNZA 2ZYAA 4AJPA 2HU2A 4XYLA 1NX6A 4BL5A 4CMAA 1FDWA 2ZTMA 4YJGA 1I01A 1DC4A 1C0PA 4CV3A 4RDIA 1UXGA 3EAGA 4PLCA 1FDUA 4YB8A 1HE4A 1HTBA 2VWPA 4RPKA 3WR5A 3S8MA 3EK2A 3WIDA 4FJ1A 4IBOA 3SEFA 3SXPA 3PK0A 1ADCA 2DUWA 4XGIA 4XKJA 4CL3A 4GH5A 3QQPA 3RIHA 1YBAA 3ZW9A 1S7CA 2XOXA 4U0JA 4L75A 3FTPA 2QIOA 4BNTA 3IQDB 4PZEA 2I9PA 3GPDG 4RVHA 4E2WA 3Q9NA 4E5PA 1GEEA 4WEQA 1VE9A 1H5QA 2WYUA 1E1LA 3PYLA 4I5EA 1R66A 5DBGA 2FY8A 5T8KC 3I4CA 5BQFA 2EGHA 2Q50A 3PFFA 1CIVA 5CDGA 5KVVA 3TZHA 4QQRA 1F06A 5F1PA 1E92A 2DLDA 1M67A 2CF6A 4TSKA 4DBVO 2Y1GA 2W90A 3I83A 4OKIA 5JCXA 3MZ0A 3DBLB 3WIEA 1ONOA 1ZK4A 2VCYA 4K9DA 5HBRA 3WLFA 1KEWA 2ZK7A 1I2BA 2ZIZA 4Z9FA 4AJJA 1EDOA 4U5QA 2P5UA 3IL2A 4W9NA 2DPHA 3PFWO 3HDYA 3RFVA 1Z45A 3GHYA 4I1IA 2PZJA 3B1FA 4M87A 1J6UA 3OEYA 3PQDA 4CL8A 1PJ3A 4OQYA 2WD8A 3WJAA 1A5ZA 1WW8A 4WEOA 5T57A 1XU9A 8LDHA 4OXYA 3IJPA 3K8ZA 3F46A 4BO3A 4YWJA 2CDBA 1MB4A 2WE7A 4UVGA 1T26A 2IDZA 1GQQA 2C5AA 3F5QA 1ISIA 4PN3A 1RJWA 3GN1A 2TMGA 2C7VA 1Q0HA 1HF3A 2RHRA 4E21A 4NK5A 3D7LA 4FFMA 2GSDA 5H83A 1VJ1A 2B37A 3UH1A 3NTOA 4PLYA 3KSDO 2YYYA 4F45A 5F1OA 4PGFA 3W8EA 4F3YA 1GYPA 2GLXA 2C82A 3VPHA 2HAEA 4CM6A 2RH8A 5G4LA 2I99A 4Q3EA 2DBVO 1ID1A 1GV0A 2CF5A 3FD8A 3ULKA 4NPCA 4UVHA 1EVIA 4DBZA 1I30A 4CV1A 3KBOA 1YDEA 3AU9A 2WM3A 4BUCA 1ZUD1 3DB2A 2BGLA 1RM5A 3AOEA 3KYCA 4MO2A 1R0SA 4MJLA 3HFGA 3E6AA 2IYPA 3ONFA 4ALJA 4CMEA 1IZ0A 2H63A 4NMHA 1WAMA 3MCVA 3DQPA 3NTQA 3F6YA 4Y6SA 2J3IA 1L1FA 3H5NA 4XRGA 4QFCA 4LK3A 3UFXA 3NX4A 4FPXA 1E1KA 1AN9A 4AJ2A 2HMVA 2P9EA 1ZSYA 3H65A 3TDKA 1EUZA 5JSFA 3GA0A 3DBVO 2WTBA 4HUJA 4JJFA 3CZRA 3UCXA 1TEHA 1PJQA 1ULSA 1G6KA 5IG2A 3GPIA 4R51A 4GGOA 1PWZA 4ALLA 1MA0A 3E9MA 1E6EA 2AQIA 4R68A 2WD7A 4J90A 3ANNA 3K31A 1I2CA 4JBIA 4XR9A 4B8WA 4KP7A 2HSDA 5G2OA 4BKRA 3FNEA 3I6QA 3BHJA 1R4NA 3GG2A 4XIYA 3OQBA 2LDXA 3ZWAA 3EGOA 4BNUA 2NVUB 1KYQA 2X22A 5ENVA 1TVEA 4BV8A 4ZHSA 1WP4A 2C5EA 2JCXA 1NBOA 5CPFA 1BWSA 4D7AA 2AMFA 3OM9A 1ZSVA 1HETA 1EK6A 3ONEA 4EDFA 3OH8A 3V1TC 2VUSA 1J49A 4CMCA 4E12A 4EEZA 2QZZA 1X1TA 2C0CA 3IDSA 4PCVA 5JAQA 2YFQA 3LF2A 3OSUA 4XX0A 4IUYA 4R41A 2OOSA 5LDGA 4E30A 5DF1A 4OSOA 4INAA 5U1PA 3V2GA 1BSVA 1KC3A 1L7DA 1U3WA 1YL6A 1I3LA 5DN9A 5I7VA 1Y9EA 4NJOA 2X1HA 5AOVA 3Q3CA 2VZ9A 4JNKA 4KUEA 3WMXA 2HO5A 1GTMA 1P31A 1BDMA 4IGEA 1PQWA 1M6WA 4HXYA 3A1NA 3ZWVA 3PLNA 1Z74A 3SX2A 2DQ4A 3W6ZA 4RF4A 4FFLA 5B4VA 1EEHA 2B35A 4DIOA 4YPOA 2QG4A 3ANLA 4H15A 1U3TA 5DCUA 4E33A 2PKRA 5B4UA 2CY0A 4GX0A 1CYDA 3DBLA 2EW2A 1XLTA 3GHHA 1MG5A 4Y6RA 3KM0A 3W1VA 3IKTA 3U4IA 2PZMA 3FR7A 4UUOA 3UHAA 4MP6A 3MEQA 4TZKA 4EJ0A 5A3JA 1KS9A 1UJMA 4R5HA 2EKPA 5L7TA 3VPGA 1Y5RA 3VZRA 2NU7A 2FOIA 2CNBA 3K9QO 4TRRA 1B7GO 3DONA 4Z0TA 1TXGA 5G0UA 4EZBA 2GN9A 4MP8A 3FHLA 4IPTA 2GZ3A 1QSGA 4XIJA 4NBTA 1OBFO 4BGVA 5A04A 3Q6IA 1CERA 1PZEA 3JD3A 3WWYA 1PJTA 4CM7A 1KVSA 5U4QA 2G82A 4AICA 4TROA 4HFNA 5KKCA 3GVHA 4D44A 4W7HA 1LSJA 2GN8A 3BXXA 3BHMA 2VNSA 4ALNA 4UEOA 4MKZA 4KTVE 4N54A 4AJHA 4DPLA 3INTA 1XG5A 4J0EA 1X0VA 3QVOA 5EMHA 4PRLA 4ID9A 1ZEMA 3NYWA 3OF2A 5I8WA 1FDVA 5JC8A 1EFKA 3GAZA 1OAAA 3DR3A 4FR5A 2PTGA 2FSSA 1E1NA 4ROSA 4BMNA 4CMJA 2X4GA 1PWXA 3JD0A 1NR1A 2ET6A 3DOCA 4LCJA 5CEFA 4J2OA 5KVSA 5L4NA 1N8KA 3KVOA 2CVZA 1AHIA 4QXMA 2Q1UA 1U7HA 4H16A 4QT0A 4R1SA 1T1SA 2HK8A 2DAPA 2C20A 3DMYA 4U6QA 3P2OA 1KOLA 4BMVA 3TZQA 3LT2A 4B4OA 4BKUA 1NFRA 5DNAA 1YL5A 1U8FO 1IY8A 2Q2WA 2I3AA 3C3XA 4D41A 4XQGA 4J0FA 1E77A 1UXHA 4QSMA 1PS8A 4BNNA 3JSAA 1LJ8A 1QXSA 1VKNA 1UH5A 4DWVA 4XWYA 4DVJA 2UV8A 3O26A 3DOOA 2PY6A 1DIAA 3I9MA 4YQZA 4NZ9A 4WLEA 3IUPA 3QVWA 3ZU2A 5JFOA 2J5KA 1RWBA 3DO5A 4DMLA 1X13A 1SB8A 4FJ2A 1HSZA 2PR2A 4IZHA 3WGYA 3L0DA 3LYLA 2D3TA 1PSDA 2CDAA 3LC2O 4AJOA 4IZIA 2ZJ1A 2DM6A 1H9BA 3I6IA 3DHNA 2B5VA 5JCJA 2NVUA 4XGKA 5A9SB 2RCYA 4DYVA 2O7QA 1QG6A 3DFUA 4IQ8A 4TKMA 3NV9A 5T5QA 4CM8B 1EVYA 3PHLA 2BHLA 4CMIB 5AQ1A 4ZN6A 2B4RO 1E6WA 4KMSA 3NKLA 3F5SA 4IDFA 3A9WA 4DLAA 2VN8A 3I4FA 3QHAA 2GNAA 2OP1A 1HZJA 4IINA 4CLOB 1VI2A 2O23A 2ZB7A 1LLUA 2HMSA 4BQRA 5F5LA 3VDQA 2AE2A 1U4SA 2I67A 1ZCJA 4A0SA 3OBBA 1ZH8A 1NPTO 3OP4A 2EWMA 4ONEA 1DC6A 1HYHA 3AY6A 3L6EA 4J1QA 3K73O 5JLAA 5IXYA 1U9JA 1HDXA 5DDIP 1K3TA 4K1LA 3WYCA 1Y8QB 2IEBA 3WQRA 1CJCA 2O3RA 1P0CA 3VKVA 1H6BA 2Y05A 1ENYA 1NPYA 3OA0A 4GWKA 5TS3A 5CDUA 2AQHA 1ZJZA 3UOGA 2ILTA 4R3WA 1V35A 1O6ZA 2AXQA 4KTTE 2ZTUA 3UUWA 3OQ6A 2HUNA 5GY7A 1G0NA 4RVDA 4Q3BA 4YCAA 2X6TA 3PGJA 1DAPA 1R0KA 4MVJF 2PLAA 3VPFA 2B0JA 4J1NA 1ENZA 2JHFA 3SJ7A 4MVJA 3VDRA 3OIGA 5JMWA 1YQDA 4F46A 3G49A 4IS2A 2HK9A 1HL3A 3CKYA 2EKLA 4YRAA 2Q99A 5DCYA 3T7CA 3EYWA 4DC1A 1BMDA 2QX7A 3GR6A 4R9RA 2DVMA 4CUJA 5JXWA 2VT3A 4YACA 3R1IA 1PJCA 4PLPA 5TGDA 3GDGA 4J9UE 3GLQA 4J7UA 1U2DA 4IDGA 1I3NA 1LDBA 1DIHA 3PIDA 2P4QA 3GEDA 1OI7A 5CDTA 1E7SA 3WGHA 1HE2A 1M6HA 8ADHA 2B4TO 1PR3A 1T1RA 2B69A 3K92A 5AXCA 5A03A 2OUIA 3ICPA 2O4CA 4WLVA 4S1VA 2YHIB 1GYQA 1E5LA 1Y6JA 2VYNA 3LZ6A 4IIVA 2X5KO 4W4TA 1VKOA 4FFNA 4D3FA 1U8XX 1UAGA 4BO4A 1H93A 4BO7A 4J16A 1Y81A 4BKQA 3GRPA 3OIFA 2CFCA 3ZHYA 4D46A 1VLLA 4XR4A 1LQUA 4BGIA 2NUAA 2FPIA 3PDUA 1YXMA 1GY8A 5I9LA 3CXRA 4MKRA 1QP8A 2H5LA 4OGWA 2Y0DA 3BTSA 1O0SA 3DBHA 4E32A 4XGNA 3ZNOA 2X0JA 5L51A 2GPTA 3RUEA 4BNVA 3I9NA 5JMPA 4E5KA 1LEHA 3PHGA 3KYDA 3QVXA 2VWHA 4PLTA 2AG5A 5EESA 2ZB4A 5JYDA 3C1AA 3DMTA 2Y0CA 4OYRA 2VHWA 2QRKA 2HLPA 4ZQEA 4R69A 4B7CA 1B0AA 5HM8A 2ZTLA 4FGWA 4HKTA 5HS6A 1ULUA 1XSEA 3GG9A 5COQA 4B4WA 4LW8A 1RKXA 1YO6A 3AUTA 1UP4A 1N7HA 4PRKA 2HQ1A 3HNPA 1R16A 1P1JA 1ZSNA 3I9OA 4B3IA 2NU6A 4LCEA 3DTYA 3GNSA 3Q2IA 1UDCA 4XEHA 3F47A 3PIIA 5BSFA 4BNWA 4YXFA 1LTHR 1DB3A 1I5RA 4D79A 5DP1A 2JFHA 2ZTVA 1ISMA 4EUHA 4CLEA 2NTJA 1HE3A 1SMKA 3H9EO 2FPGA 1E7MA 4RQTA 2JFGA 2PKQP 4FS3A 3W4IA 3ZHBA 1RM3A 2HRBA 3KV3O 4KQWA 4R5MA 3RUHA 5AXAA 3FNHA 4W82A 4PIVA 3ZWYA 1BW9B 3GMSA 4CMIA 3P7MA 3RI3A 3RUAA 4MIOA 3TFOA 4L4SA 1F8GA 2GRAA 2DFDA 4K26A 1GCOA 1WZIA 4XDZA 4Z9XA 4LMRA 2ZB3A 4P8RA 5JS6A 1HYEA 2HRZA 5L40A 3I9JA 2D4AA 3WDSA 4CLOA 1NFQA 4TRMA 1EZ4A 4HBGA 3ENNA 2GCGA 1N1GA 4MPDA 3CPSA 4RLHA 4XYMA 5ADHA 4OHUA 1GUFA 5DOVA 1DEHA 3OICA 4W7IA 3ZI0A 5JAZA 1B16A 4IS3A 5EQDA 5IDWA 4CUZA 3H9UA 4XQCA 5B4TA 4HNHA 1OC2A 2ZQYA 4EI2A 3CTMA 3QA9A 1X7HA 4IDEA 1UZNA 2O4UX 3NEPX 1Y8QA 4B3JA 5KJ6A 4BO9A 2HCTA 2W4QA 3WYBA 4GGPA 2P2SA 3T4XA 4IXWA 1QYVA 3L4BA 3N7UA 5LDHA 2X9NA 4PG6A 4HFJA 4GSLA 4NIMA 3ST7A 2JCVA 5DBFA 1GR0A 2ZKLA 2Q45A 3GEGA 1XCBA 1NPDA 5GZ3A 1I3MA 1QKIA 4BO8A 3C1TA 3RJ9A 4YTEA 1NWHA 2CDCA 1RPNA 5BSHA 5IZ4A 2OORA 1BTOA 2PWZA 4PLGA 1F0YA 2V6BA 3GN2A 3MJ4A 4Y8VA 4OOFA 1N92A 4UUNA 1NQOA 1PX0A 4YT8A 1A9ZA 2E82A 3DZKA 4IY1A 2IZ1A 3GNQA 3MWDB 2BH9A 4R1UA 3WFJA 1YDWA 3ZNNA 5MGBA 2NVBA 1BDBA 2IZ0A 4GMGA 3L9XA 3MJTA 3OEWA 1CQIA 3VPXA 4K28A 1TB4A 2X7HA 3W6UA 1QRRA 1GADO 3QW2A 3NDIA 2B36A 1R0LA 5IZCC 3VH3A 1XR3A 1CETA 1DIBA 1ZK0A 2OZPA 2JHGA 2I3GA 4R4JA 2BELA 1XQ6A 1ZXLA 3N58A 3GVIA 3L9WA 1W8DA 1DIGA 2P4HX 3ZGYA 3IIEA 1PGQA 1VJTA 1NVGA 3CUKA 1JVBA 4H7PA 3AWDA 4EBFA 2CD9A 3CMCO 2OHXA 5THQA 5TF4A 2OP0A 1V3VA 2YHIA 1DIRA 4J1SA 3OMLA 4ALIA 4TKLA 5I9NA 4GX2A 1NP3A 1FDSA 4RPGA 4E6PA 4IJVA 3WGTA 4Z0PA 5C7LO 4L76A 1XWFA 1R12A 3PGXA 2YHUA 4TRNA 1AE1A 2YQ4A 3JQBA 3LF1A 3D3WB 4WUVA 3DAGA 3H7AA 3JYOA 4BNMA 3ZWBA 3M2PA 4PLFA 2YJZA 4OMUA 2BF7A 3WYEA 4NHEA 2AG8A 2BGKA 4YJDA 1V9LA 2P9CA 3HE3A 4XYGA 4UVDA 1OOEA 4W6ZA 1EDZA 5BSGA 1ZK1A 2EIHA 2F1KA 4Y6PA 1SOVA 3R0IA 3KZVA 3K96A 5AXDA 2O2YA 2YV3A 1ZKMA 4HADA 3DXFA 4QO7A 4CLXA 3EC7A 4NJMA 4LRSB 3U0BA 2Q4EA 1NHGA 1K6JA 1I2ZA 4II2A 4P4GA 1ENPA 2VYVA 2G1UA 4AL4A 4GSKA 1I33A 3KLPX 2IODA 3X2EA 3C24A 2Q2VA 2P5YA 5GZ6A 4O1MA 1U2GA 1DOHA 1GL3A 1E0DA 2X9VA 3UVEA 4BB6A 1MC4A 4NG5A 3VZQA 1PU2A 5CP8A 4E5NA 1ZEJA 2BMAA 4KOAA 3WGGA 1B3BA 4JIGA 3U3XA 5IDQA 4CQMD 1QLJA 1YGYA 3RU7A 2D5CA 4RV9A 4CMGA 3QWBA 4J49A 3AFNA 2IE0A 2VHVA 3PQFA 3V1YA 4BNGA 5K6AC 1ADFA 5IN4A 3LT0A 3GZ4A 4OQZA 1O94A 7MDHA 3QJ5A 3JYLA 1J0XO 3RJ5A 1AHHA 2RH4A 3ITDA 2PGLA 2EJVA 3VPSA 5KJ1A 1DO8A 3NRCA 1GDHA 2X5OA 3R6DA 4Y98A 2EP7A 3KEQA 3GGOA 2Z5LA 1YB1A 1GQYA 1BW9A 1T2AA 2X8LA 1A72A 5DCWA 1DRWA 3L6DA 3P5SA 3OJ0A 4LSWA 5FI3A 3LC7O 4UULA 1ZIDA 1HLPA 1EVZA 1TI7A 2Q1SA 4RVSA 5TQVA 3PLRA 3ZV3A 3G3EA 3RC7A 4DPKA 4UUPA 5JDCC 2J5RA 5KTKA 4HV4A 1EE9A 3IJRA 4BNYA 3ROKA 4Z9YA 5COAA 2R00A 1YE3A 2X0NA 3KETA 4YAGA 1B8VA 4RVGA 4DPMA 1C14A 1OFGA 5MDHA 3EHEA 2VRCA 1P1IA 3ZH2A 1IL0A 3M1AA 4QX6A 4RQUA 4LVUA 1DFIA 1KVRA 1R4MA 4OH1A 3O9ZA 4DUPA 1EVJA 1XQ1A 4E3ZA 3B20A 1MLDA 3UICA 4Q3CA 3DZFA 4BMSA 1ZMTA 2HMWA 2GYYA 2DU8A 2CZCA 1QYXA 2QYTA 3ETEA 3AY3A 4RPLA 1X0XA 3F1LA 1PZFA 3DZGA 3PDJA 2DPGA 4MVJP 4Q39A 4ZQHA 4N5LA 1NFFA 3RD5A 3NT4A 1WMAA 3NT5A 4GL4A 2OBNA 2AEJA 4B79A 1DC3A 4GQAA 4L74A 4YQYA 1TA4A 1WDKA 3GH3A 2NU9A 3E48A 1U3VA 1P74A 1O5IA 4YR9A 1P33A 2YY7A 4J4TA 4N7RA 1D4FA 3ZV6A 1VSUA 5ILGA 3D1LA 5IAAA 1ISJA 5TJ9A 1EUDA 1B8UA 3TRIA 4CMHA 3JQFA 1PL6A 4NH4A 4B8ZA 3ADPA 1A71A 1K5HA 2YFHA 3ZHZA 2O7SA 4FOSA 3L77A 2HMUA 1D1SA 3ZNPA 3ZWWA 3GAFA 3DZIA 5AVOA 1Y9AA 1R6DA 4XB1A 3R3SA 1P1FA 2XPCA 3KEOA 3KYBA 2I5PO 3QWAA 1YB5A 1E7RA 1HKUA 2X5JO 2FSVA 3ZZNA 3LLVA 3FWNA 1ZK2A 4Q9NA 3H2ZA 3TF5A 3LVFO 1DBVO 2HDHA 4QO8A 1DJQA 4JX8A 5L7WA 1VJ0A 1QR6A 3ZW8A 3GVPA 4GI2A 4L73A 3ROPA 1LLCA 2JCYA 4OOEA 2D1YA 4WPGA 3DOJA 3D3WA 5DZSA 3M1LA 3O38A 3OHSX 1ZZEA 3DFZA 1LC0A 4TRJA 3BMOB 1Q7GA 1HYGA 3DTTA 5IDYA 5I7EA 2EEZA 2GD1O 4G2NA 4MIEA 2PFGA 5ITVA 4WCFC 3RUIA 2AEFA 1H2BA 4E4YA 4O0LA 1K2WA 4PFJA 4NBVA 4WLOA 2YW9A 4Y67A 4BQPA 3HZZA 1ADGA 1ARZA 2NLOA 4AVYA 3VOSA 3ZU3A 3ENKA 3ZNQA 4OKNA 4EUFA 1HDCA 2Q1WA 1GPJA 3E8XA 4RF5A 1G1AA 2Y68A 4RF3A 1K0UA 3W8FA 4BGEA 3ZU5A 1WWKA 4IM7A 5CDYA 4GLLA 2ZQZA 3EUWA 1N2SA 1NVMB 1QYWA 2VTDA 3PZRA 4GBJA 4L4XA 2BFMA 2EV9A 3FF4A 5IXSA 1VL0A 1JN0A 3ITKA 3UKOA 3JQ9A 4DIFA 5KIAA 3TPCA 1H6CA 3SC4A 4A10A 1U7TA 1LSSA 1Z75A 4PZDA 3ZWOA 1MV8A 4CR7A 3FSRA 4U0KA 3H9GA 3V1UA 5G0VA 2QRLA 3LT4A 1YJQA 3PJDA 4RO0A 1E3SA 5F21A 4JP3A 4FW8A 4MVJE 4E2YA 1DFGA 3STHA 2I76A 3NDJA 4ZJUA 3TOXA 4IDDA 4NK4A 2DBQA 2VNAA 4I9NA 4DTIA 3DBHB 3GGPA 4RPJA 3FTNA 2I6TA 5G4KB 5T6BA 4PG7A 3I9KA 3KYDB 3JQDA 4M55A 1LRKA 2BFPA 3KTDA 2Y1EA 3RKUA 1W73A 1HDGO 1DJNA 1RYDA 3DBRB 3GZNB 1BRMA 2XF8A 5CHEA 1JA9A 3INGA 1WNTA 2R2GA 3CINA 4D0SA 2D8AA 2YUTA 3I23A 3PPIA 5HTOA 1XGKA 1LDEA 2D2IA 2E4AA 2OFPA 5F3RA 2PD6A 1H9AA 3PHHA 1LXCA 1ML3A 3RFTA 2LDBA 3EY4A 5L3ZA 1U28A 3AUUA 1LDNA 3FI9A 1ZXBA 4L9RA 2QW8A 4JBHA 1ISGA 3TNLA 1PGPA 4YJFB 4RF2A 3OECA 2EW8A 3GUYA 3U49A 4M86A 3HDJA 4BNLA 2B4QA 3TZ6A 3G17A 4C7KA 2O48X 1E3IA 2FPPA 3RBXA 2BI7A 3O03A 4W9NC 3RC2A 4EITA 1YS4A 1M76A 3MJEA 4XYBA 2NU8A 4I8XA 2DFVA 1P1RA 1MG0A 3LU1A 3I9LA 3BMNB 2EG9A 2P91A 4OSPA 4AJ4A 1XKQA 3PJEA 4DYDA 1B26A 2ZCUA 1B3RA 4ILKA 5C37A 2OL4A 5A1TA 3RC1A 4FCCA 1KY4A 2PH3A 4P22A 3CZMA 1YVEI 5BNFA 4IIUA 3ETDA 1Z7EA 4G81A 4M89A 5IZCA 4J4HA 1ZK3A 1P9LA 1CRWG 2NWQA 2X58A 4J1TA 4XA8A 3Q2KA 3IS3A 3VAZA 3WSWA 1SB9A 3PTZA 3RUFA 4B4VA 4DIBA 3N74A 4YT4A 2NQTA 1BXZA 2DC1A 3ZWMA 1WDLA 1GEGA 2BFAA 3AJRA 2PV7A 3WOHA 1UP7A 3NTRA 2DKNA 5ER9A 4DC0A 3TFQA 5BNTA 1P45A 4J9VA 4FBGA 4ZRNA 5T8KA 2NTNA 3MJCA 5A02A 3QIVA 4JJIA 5I7SA 2ZATA 1TLTA 3JD2A 4KUGA 1M75A 3BA1A 3IP1A 3AOEC 2O3QA 2VOJA 4UVEA 3Q11A 1PGJA 5C7OO 2GASA 4BOYA 2O2SA 4PG8A 4PG4A 2J8ZA 3NUGA 4IJUA 3UGKA 4BVAA 1H0KA 3HHPA 1I32A 4M1QA 4ZGWA 2Y1DA 1C1DA 3BMOA 2CMDA 3PWZA 4KDFA 4J7XA 2X86A 4WOJA 4YRBA 2WYVA 1XU7A 1I24A 2WMDA 2FZWA 4O6VA 4KQXA 4BNJA 3IC5A 1HE5A 2NSDA 3IOYA 2V6MA 2FP4A 3EVTA 2GGSA 1RYEA 1IPEA 3WBBA 5L95A 4I5FA 1ISHA 4J91A 4XD2A 1IOLA 4GX5A 2NQ8A 1DRUA 1Y7TA 4XB2A 3RWBA 2OMEA 4UEKA 1D7OA 1NQ5A 4AJIA 3WJ7A 3C7AA 1NAIA 2NTVA 3QVTA 1PJLA 1IYZA 3WLEA 4DQXA 2Q3EA 3COSA 5IDXA 1X7DA 1N9GA 1MXHA 4M54A 1SC6A 5EIOA 4EJ6A 4A7PA 3GF4A 3ROMA 2CVQA 4YT5A 4NQZA 1GV1A 3W4JA 4B7XA 2EJWA 1DXYA 1GAEO 1RM0A 1SAYA 1YONA 3U5TA 4G5HA 1DSSG 2X9GA 5JO0A 5TLSA 1GU7A 3ASUA 3OJFA 1KVQA 4WKGA 3BIOA 4GVXA 2UDPA 1KIFA 1JKJA 1P1KA 4EGFA 4MKXA 3BZUA 1K89A 2JD1A 2C07A 5H82A 1YQGA 3WGZA 4FOOA 5J23A 5A4DA 2Z1MA 4CM4A 1YBVA 3G1TA 4PVCA 3WGOA 5G4KA 3SC6A 2AQ8A 3H4VA 3E18A 3GGGA 1AGNA 4U6SA 4NBRA 1EUCA 1PEDA 5TRTA 5TNXA 4R16A 3D4OA 3GEMA 3LDHA 4Q3NA 2QYSA 1H6DA 1B8PA 2V6FA 3DBRA 2WE8A 3D5QA 3GZNA 3JQAD 4NJMB 4FC6A 4BS9A 4DRYA 1HWYA 5COBA 4QEDA 1FK8A 4P4LA 1I10A 1LDYA 1KERA 3CMMA 4IDAA 1ZBQA 2W2LA 4R1TA 1SEPA 1B14A 3GC6A 2CSUA 5I9MA 4EW6A 1ONPA 5CDSA 1VL6A 1QMGA 1SEVA 1IZ9A 5L4LA 3NJ8A 4ZQFA 3ANMA 4FC7A 1BXGB 1O9BA 2RBEA 4MOWA 1PJBA 3WFIA 4YBZA 1Q7BA 4YJFA 1JKIA 1W4ZA 2P9GA 5A9TA 4QTZA 2GZ1A 1DFHA 1DAOA 2B83A 3K5PA 5DBIA 4DGSA 4CUKA 4F6LA 1X7GA 3AOGA 3VC7A 1DRVA 1OMOA 4IMPA 5JY1A 1JWAB 4X54A 2H6EA 3BTOA 3M2TA 3PYXA 3QSGA 3EDMA 1Q1NA 3KLMX 4EJMA 5DT9A 1PTJA 4RGBA 3WTCA 1E3WB 2IRWA 4GPD1 4LSMA 4U8GA 3TJRA 3RKRA 3BMNA 3QE3A 1C0LA 1TT7A 4CLDA 3BMCA 4ALMA 1IHXA 4BV9A 3JQCA 5FFFA 3FWZA 3BMQB 3H9QA 4YT2A 3JYPA 1UR5A 4JK3A 3FRJA 4Y9DA 4UREA 4BO0A 4H3VA 1LLDA 5BT9A 4D3DA 5JPIA 4ND2A 2W2KB 3RASA 1KVUA 1YOVA 2DBRA 5JE8A 3H2SA 4JCOA 4ND5A 1A7KA 3JQ6A 1XEAA 1O8CA 1Q7CA 3BTUA 3KUXA 4MVJI 3K30A 3OIDA 1GFSA 5BSEA 2EKQA 3PJFA 1R4MB 2DUUA 3F4BA 2VHZA 4OO3A 1YL7A 2Z1NA 1O89A 2QHXA 1R37A 5ENDA 4Z6KA 3L6OO 3NAQA 4MVJM 4AJ1A 3GFGA 4II3A 2VYVD 4HNGA 4IXTA 4UEJA 5KOIA 4HFRA 1V3TA 2AHRA 1P77A 1C0IA 1NQTA 3C85A 1KVTA 3INRA 2VRBA 3U4HA 2G76A 4A27A 3AY7A 3KOUA 3HQ4O 2X0RA 3TL3A 5HS4A 2WWRA 2Y67A 4WK6A 4PG5A 4B3HA 3KSZO 5IFLA 3FCOA 3DHEA 2Y1OA 2VHXA 5EINA 1Q0LA 2DTXA 4IGFA 3AW9A 2HJRA 3VTZA 3FPLA 5HWSA 4PLVA 2JAPA 1ZFNA 3E82A 1K6IA 4Z3DA 4FB5A 4CM5A 2EERA 1CEQA 3TSCA 1LX6A 1J4AA 3JQ8A 4N5MA 4ZQGA 4HWKA 3CSDA 1PIWA 2EXXA 2PD3A 4I9UA 1ZO8A 3RBZA 3JD4A 4FFOA 3HB4X 1Z6ZA 3LSYA 5B37A 4QECA 4R01A 2A92A 2R6JA 3EVNA 4DLLA 4M49A 1BG6A 3WNQA 2Q2QA 3ABIA 1JAXA 2VTEA 5CEJA 3VH4A 5L9AA 6LDHA 1MX3A 1KEPA 1G0OA 3EZYA 4P38A 2PKQO 1LA2A 3GUCA 3PI7A 4IQGA 5I7FA 1N5DA 4CQMB 4YRDA 4TQGA 4DREA 1JLLA 3A06A 4RPHA 2PGJA 4CQLB 3WSVA 5EPOA 4ZQBA 5TX7A 2VRCD 4BNIA 1PS0A 1YJ8A 1R15A 1VPDA 3G0OA 3JD1A 1D3AA 2PZLA 4FGSA 4GAEA 4CM9A 2Y1FA 2HJSA 4CR8A 4WLUA 1LC3A 5TIIA 4QUKA 3X2FA 4ZVVA 2O3UA 4M8SA 1GYRA 3MOGA 1YWGO 3UCEA 4YAIA 1NR7A 1I0ZA 3T4EA 3Q0EA 1V8BA 2GN4A 4WE3A 2WEKA 4A2CA 3DL2A 3HADA 2I65A 1HZZA 2PNFA 3NT2A 4RJTA 1YRLA 3C1OA 1P44A 1E5QA 1WXDA 2GF2A 1H2HA 3V2UA 5C5IA 1Y5MA 4L8VA 2ZB8A 5JDIC 3H8VA 4O63O 4JGBA 1JWBB 3S2IA 3AI3A 4E5YA 3WGQA 3GFBA 3JCZA 4A03A 2A4KA 3GVCA 3IKVA 4XCVA 3CEAA 2JAHA 2D0IA 2G5CA 1E7YA 1KEUA 1F17A 2FZEA 3BTVA 3BYZA 2YDXA 1NXQA 4GMFA 1BXGA 2ZCVA 3TZKA 2Q49A 4JROA 2O3SA 5T67A 1Q0QA 4RZIA 4YAEA 4RZHA 5ICMA 1HSOA 4ALKA 3Q9UA 3TL2A 3TWOA 3JQ7B 4J4BA 4OXKA 2Y1CA 1MC5A 3KSUA 1I8TA 1ORRA 3JQGB 1ONNA 1XHLA 2AEMA 2EP5A 9LDBA 1FJHA 4CM3A 1DHRA 1QV6A 1E7WA 4OAQA 4DL9A 3D64A 1E3WA 3HWRA 1IULA 2AW5A 2VQ3A 3A4VA 3DAFA 3L07A 4O59O 4BGUA 3JYQA 1ZJYA 2WJPA 3E5RA 4MP3A 2B5WA 4NBUA 3VH2A 5FF9A 4KZPA 4NNJA 1VL8A 2ZYGA 3BMQA 3T7EA 3UCFA 1C1XB 4XRRA 4NI5A 1H6AA 1A4UA 2W2KA 4WASA 4IQ0A 1WPQA 4BHTA 4K6CA 2VUTA 3AM5A 1WVGA 1JKFA 1DLIA 2Q4BA 1SOWA 2C54A 4J2HA 3OJEA 3PJGA 1PJSA 3ICCA 4TMFA 1FDTA 3AI1A 2WSBA 3GMDA 4URFA 1EFLA 1DPGA 1LDMA 4FFPA 4GLOA 5BNIA 5K9ZA 4RVUA 4D0RA 3GOHA 3TN7A 4YYZA 3ZCXA 3RUCA 3E9NA 4AJLA 2PD4A 4BO1A 1F12A 1MP0A 2BFOA 2NNLD 1A9YA 2Y0EA 3AU8A 1PZHA 3DDNA 5ER6A 3ZWPA 2JJYA 1V6AA 4FIZA 4EYEA 1EQUA 1CWUA 4I5DA 4FFRA 3DMTC 2RHCA 1GZ3A 1UP6A 1L7EA 4XQ9A 4KDEA 1O95A 2W98A 3GRKA 4JJGA 1NWCA 4NBWA 5AYVA 1PS9A 1T2CA 5FWNA 1E6UA 3KHUA 4OIMA 5L53A 2OGUA 1QORA 1EK5A 4NFYA 2WDZA 3S2EA
chains in the Genus database with same CATH superfamily
1N2BA 3G2KA 5LDDC 4PFKA 1Q74A 5GJVC 3EIUA 5TPWA 1SXHA 2P62A 1A1SA 1TM5E 2JFWA 1JVSA 4JI1B 4BLTA 3DHVA 5L3SA 3OHMA 3RSSA 4LXGA 2MINA 3RQSA 3K3PA 2H7XA 3LK7A 2DH5A 2HPHA 1NDHA 2LPMA 4ND1A 4P3XA 2BAGA 4Y0NA 5IARA 2YZ7A 5C81A 5I7WA 4BRWA 3S29A 1M1XB 1Y3DE 2GR9A 1JLMA 1QH0A 1TT5B 2HBYA 4JXKA 5CRIA 2YDYA 2C83A 3AIKA 2J9FA 4OHZA 2ORWA 4MWTA 4UAJA 4JC4A 1KNXA 3ANYB 1TZKA 4KQMA 3IP6A 4BP1A 1G3MA 5CW1A 1L5WA 3KV1A 2PG3A 3BH0A 4P81A 4HZGA 2YOHA 2ZSIA 4NAVA 3WS7A 4HUQA 4WOBA 4MYCA 1IEQA 1R5BA 1MXFA 2WTNA 3W8DA 5IWCA 4I55A 1SXPA 4TTRA 5DOZA 3TTYA 5P21A 1QQ6A 1E2LA 3UWMA 3S3TA 3EWIA 2XMDA 2B7CA 3A2NA 1SVSA 2I2AA 3HN7A 4HB3A 3DMDA 3VVBA 2XE7A 2J41A 3STVA 4WESA 5EN4A 2FNAA 3OA2A 1P39A 2X8JA 3A4NA 3CIFA 2GEVA 3EC1A 4DQVA 1U3FA 3BZBA 1WV1A 4HZIA 1S9HA 5EFOA 2O8CA 3P4XA 1TJYA 4B9EA 3L4SO 4R1NA 4MW1A 1LK7A 2VATA 3G82C 3I1YA 2YV2A 4UPDA 4MGIR 5A4JA 2PZ8A 4F2HA 1QIGA 5AVTA 1S2NA 3KQKA 3N2YA 3TRKA 1MO2A 4E5SA 4QDZA 1J2EA 3RADC 4HJRA 1T5OA 3WDMA 4UNNA 4JLUA 1QDEA 1TCBA 4HEJA 3DDOA 4EA6A 3RS0A 3VNSA 3TGPA 1FUIA 1U8AA 5LB2A 4HDMA 1KZHA 1W5EA 1JTEA 3DM5A 5EXPA 5DEIA 5B2FA 1SNYA 3Q7RA 4Y2PA 3RANA 1SU6A 1JDVA 4QFMA 3KR2A 3O83A 2OHIA 3AKZA 3GFSA 4Q48A 3G59A 4GKBA 4MIYA 2E3JA 4U8HA 1EBFA 3RU9A 2BRUA 1FRQA 3COVA 3HDHA 4EFDA 2HTEA 3C5CA 3IIJA 3ZN2A 5BN4A 2HPVA 4C20A 2H0QA 2D7JA 3VVMA 5A7FA 3OPYA 2OORC 1AURA 1YZFA 3PXBA 1OYYA 2C59A 2W0MA 3KR9A 3ZW7A 2GN2A 2WUVA 3WLTA 1OI4A 3D4NA 3WLNA 2X6QA 4EKNB 4TMXA 1ZA1A 4ZAWA 3IELA 4NDNE 3JAMA 1NJ5A 4HX9A 1Q7TA 4HAVA 5BXYA 3DC2A 2H29A 3LT1A 5EJ8A 1KEVA 2QD4A 3LW8A 3DZJA 1JR2A 5NULA 1HEUA 1SQ6A 2WAOA 4N6OA 5CH8A 3A3KA 4AG3A 2R8BA 5KYWB 1KEEB 1W5BA 2IYRA 3DV0B 3Q8WA 2HV9A 3VHQA 3L6CA 2AJLI 1Z6XA 4B3MB 3MA0A 3EC2A 1OQAA 4I6GA 4IOLA 4CR6A 1WZEA 4TS3A 1L7NA 4D1YA 5KMGA 1PJ2A 4C2UA 3AETB 3GLFA 3WK6A 2IOFA 3S68A 3K0CC 3RVJA 2YOGA 4RKYA 1FMFA 3C16C 2PUEA 2J7PA 5BVHB 2CHQA 3RVKA 3CLRD 1CIPA 1J8FA 3ICVA 5KWJA 5AKLA 2R5FA 2B9VA 3AIMA 5CAEB 2VUUA 1HLDA 4PINA 1O87A 4HDSA 4N3CA 3QLTA 3S2GA 1C3VA 3P2JA 3E9QA 4FYHA 4CI0B 4PZAA 4D4MA 3N87A 2J1LA 3W5DA 3M4YA 1QK4A 1AQYA 1RRKA 1EP2B 4BN5A 6ADHA 3WLLA 1NATA 1VLMA 1X7XA 1QK5A 4NEHB 1R6TA 3NHPA 4ENVA 2OCDA 3FMVA 1KZ7B 1N7GA 2OO5A 3MIZA 3JQBC 1EDEA 4HWPA 4IF6A 1O9GA 4JODA 4K3UA 3T0IA 3U9LA 3GEHA 3CKKA 1SQ5A 2J6IA 2J9ZB 3KYJB 4LI0A 1NUQA 3WK4A 2I9KA 4F11A 1WSBA 4HFMA 1X15A 1UK6A 4EOGA 3FFBA 2B92A 2RKOA 2GK6A 3BWEA 1ZN2A 3JSXA 1X1EA 4PLHA 4RY8A 3U4CA 1Z0ZA 2VXCA 2XCOA 3KKEA 2ZSBA 1W4AA 4RH0A 2P0EA 4ZICA 1AMUA 4A8PA 3EPKA 1PR0A 3LIPA 1RXSA 4DHEA 5KJCA 5F3WB 4JCCA 1P4SA 4FWTA 3F3KA 3I39X 3P2YA 4QYTA 4B6JA 4EYGA 4OATA 5GZ1A 4JI8B 1W30A 2ZUDA 2ZRLA 1IZ7A 1T9BA 3ELBA 4JSTA 4XWGA 2X5NA 2DLCX 3IAHA 3QNUA 4B5LA 4DR2B 2QZ9A 3K8QA 1UXIA 4G5SA 2RMKA 2QMEA 3A27A 3NGMA 3QWFA 3V3KA 4J0CA 1TOAA 2G0TA 5CPBA 2V7PA 4HX5A 5K4GA 2VYND 3BMCB 5ALWA 4G1FA 1ZM3A 4GKVA 4JWTA 1E1DA 5H16A 3B82A 4QNNA 1YE8A 2OGSA 2ADFA 2ORVA 2PUJA 1OH6A 2PS0A 2D59A 1EXNA 3GYBA 1DMRA 3DO8A 3K0HA 3PE4A 5GWXA 3ZQ6A 1S1CA 1QLHA 4LYDA 1QIMA 1G16A 2P79A 3G9TA 3MJSA 3O90A 4H0FA 1YBFA 4WGGA 2A94A 5AM2A 1Z4JA 3DE1X 4GC9A 4DY6A 3NJ4A 1ZD1A 2YXPX 1W85B 1CR6A 3LBYA 4KIJA 7ADHA 1U3DA 1NZJA 1NVXQ 3IQHX 1O94C 3GDOA 4PYJA 1VIAA 5K8VA 1KIAA 2QJFA 2CLLB 1U2TA 2UYHA 2NO9A 4BO5A 4ZCRA 3QEBZ 3KKQA 1Y8CA 4V0RA 1XE3A 1BCSA 1MDBA 4L78A 3SU8A 4C2TA 4WECA 3ICOA 1EP9A 1C3OB 1PKXA 3KZCA 1TC2A 3T34A 3ICWA 4F1WA 1H69A 3WB1A 3UT5A 2QMQA 4Y18A 2GO1A 4NY1A 1ODTC 1NQXA 3FCUB 1HDYA 5G0TA 1IZ8A 3AM3A 4KE6A 2ZSAA 4M8NE 2YQ5A 4M1KA 2W2LD 4H1UA 4AC9A 1OWNA 4CDRA 1BMFD 4RADA 3CNQS 4BO6A 4PVDA 3SQOA 3PRJA 1J9EA 3PX3A 5CT4A 1MOZA 4YP9A 4D92A 1FVFA 4R54A 3AI2A 3RHZA 4ENSA 1KWGA 2AI1A 4FDLA 1UT6A 2ZIAA 1U3UA 5I8ZA 1US8B 1SIOA 3OJLA 5EGSA 3WXBA 1HKHA 3VKGA 2QVCA 3O2SB 3KU1A 2ECKA 4DR5B 4RKQA 4M9ZA 4XTRA 5DK6A 2DQSA 1PL7A 1SG9A 2Q8QA 1WLYA 3K2EA 5F4ZA 4KFCA 4BQSA 1NJGA 4Q12A 1YK0A 5CFMA 4H3HB 4HATA 4CPDA 4HRXA 2P9YA 4EZEA 1ODSA 4CNBA 1CQPA 5J2UB 5EUMA 9LDTA 2E37A 2H92A 3IT3A 2M32A 3DTVA 4FXOA 1V5IA 4V0NA 2QNIA 1A4RA 4HY3A 4MLCA 1E1MA 1KR2A 2BP7A 3EE6A 3OQJA 4RNCA 4WOKA 3NEAA 4AJEA 4EO7A 3WLSA 2CVOA 3FBWA 2ODBA 2LBPA 1A4IA 2ARKA 3TIVA 5EQFA 4ZZIA 3F2VA 2IP2A 1C2YA 3VJMA 5BW5A 1ENOA 3EGEA 3QE9Y 1ESCA 5TR9A 1A7AA 5HKOA 3T15A 1VXRA 1P17A 1E3EA 2B2CA 1F48A 2IVFA 2PQ0A 3D8UA 5DNCA 1DEKA 3L8ZA 4KAAA 1KY2A 5KCZA 3OI7A 1XXLA 1SBYA 4RH3A 1SXIA 1JYFA 4JMPA 5F33A 3SHWA 2GERA 2IXAA 1GUAA 4AMZA 2UU9B 4KRXA 1KY5A 4ARUA 3DZBA 2BBSA 4PZUA 2P40A 1W6RA 3Q3HA 3VTAA 4D25A 4F93B 4Q66C 4KE8A 1U5CA 3IKLA 4IXNA 2G72A 3FDZB 4BB5A 3VNBA 2ODWA 4Y2VA 4P5EA 2XRZA 1IPFA 3NGXA 4ERNA 4F6CA 1Z2NX 1NVTA 1NAHA 2SKCA 5AI6A 3USZA 4P7JA 3AVTA 1QDLB 1M6VA 3L05A 2WJAA 2EKZA 4GVLA 1BA3A 1DAKA 3A14A 5AJVB 1JG3A 1I5OA 3DOIA 3ESYA 3UKJA 4YAWA 1X9HA 1A27A 5AI0A 3WQQA 2FWNA 5FTWA 1X38A 3MWEA 2WR8A 4GHWA 3NV7A 1K86A 2DHDA 2HKIA 3LYAA 3R3JA 3WHPA 1YDGA 2II6A 4RSGA 3PITA 4K9RA 1ZYUA 1MHTA 1BXKA 3WGUA 3DLPX 1DBSA 1NF3A 3BHIA 4P5DA 5FOXA 5FA6A 4DV2B 2O0KA 4GOLD 5FEUA 2JL1A 2IV2X 1K7SN 2NZ8A 4NU5A 2FSVC 5DGDA 4P82A 3ZWDA 5JXHA 5LXTA 3H99A 3MB8A 1PJZA 1XEXA 3K6KA 3E3NA 1VSQA 3RIYA 1KJNA 5KVQA 2IYXA 3URMA 1Q44A 1MGOA 1T2EA 3BD9A 3FNBA 3H19A 4X6LA 5CNIA 5CXSA 5SICE 5BYAA 2I66A 5CXUA 5HSGA 4RTOA 4BCBA 1ZOLA 5U9CA 3VHRA 4CLHA 1L7QA 4D4IA 1ZM9A 3H9JA 2GOYA 2ZJ4A 1BYUA 5IM4F 2I7VA 2UZ1B 2W93A 3F8WA 3GEIA 3I5MA 3JWEA 1W94A 1QWOA 3OCXA 3NU1A 1F38A 4OUDA 4JXJA 4PHGA 4GKJB 3IUEA 2FTKE 1BDHA 5JVDA 2ZI7A 3HTXA 1P80A 4OB6A 1FOEB 1M1NA 4WBNA 3SLKA 3SXUA 1GSHA 3PHIA 3GK3A 1YJCA 5D2CA 3T9FA 3W05A 4HH4A 1ZGZA 1JIKA 1L4BA 1LGYA 1A76A 1TVCA 2H59A 3DZHA 1CS0B 2ZUSA 4R8MA 5ALFA 3SLRA 5BR7A 4OQ4A 2ZZMA 1YOBA 4FWIB 1DWUA 1R2QA 4L50A 3AV3A 1BHQ1 1U5AA 4IJWA 3W2FA 1LLFA 2SCUA 2W6QA 4FI3C 3IBCA 3T7SA 2JVIA 3ZK7A 4CN9A 2FX2A 4PM4A 3QKWA 4Z54A 1UT8A 3NVKI 2D0OB 2QBYB 3I5UA 1V95A 2HCBA 5EQTA 1T4DA 2RI1A 3FNFA 1B43A 3AQIA 4X1OA 4UPVA 2FK8A 5AKIA 4FHCA 4J3FA 4UCQA 1L4HA 4M7WA 3WYFA 4M0UA 5CJPA 1A9XA 3RCBA 4BVKA 3E1KA 1A9PA 3HYRA 2AF4C 3GNTA 3MILA 1RLOA 3PXXA 4OM8A 1GZVA 1FMCA 2ZEJA 2EYUA 4AROA 2G1AA 3M6XA 2Y0PA 1X74A 1NP6A 1JX6A 1BQ3A 2MSEB 2XXBA 2C3UA 2Z9DA 4RD2A 2O6LA 3UYLA 1RR6A 2POQX 1K8YB 4U2CA 1RYYA 2F62A 3IIMA 2O2JA 4ZT5A 4IIJA 2JBWA 2RHGB 4YAKA 3CH6A 1UJ2A 5FOVA 1TM1E 5CG1A 5J2TF 4RHFA 5L45A 4OI1A 1KQFA 1JPJA 4X63A 4HN4B 1L1EA 5B12A 5FO0A 3JYNA 3CWZA 4JDPA 4Q4CA 3D8BA 4O4LB 3BCUA 1UUFA 3F97A 2RGGA 1JS1X 2CLMB 3HBLA 4QHTA 4JJKA 4URWR 3RYCB 1UEXC 3PGMA 4DR3B 1COWD 3OFSA 2GK4A 3DWFA 4J76A 2WM9B 3C5WP 4RJIA 3TEFA 3ME5A 3P0JA 5A05A 1GRNA 2PUWA 4MS1B 1FFEA 1JQAA 2AR9A 3GJZA 3UBTA 4QGBA 5T4EA 1PR4A 3TLKA 5AK4A 3PQ3A 1ZD5A 1LV8A 1GDTA 3QI7A 2P4UA 2ZXEA 3D5TA 3JARB 3HCOA 2IYNA 2DLNA 2J5QA 1ZMRA 2H2DA 3PR3A 3F6CA 2XD4A 3VVLA 2VHYA 2HMTA 1NU8A 4WCFA 1VXOA 4WT7A 1E2DA 521PA 3RO7A 5JY6A 4E4RA 3WDKA 1ZD2P 3EFEA 3GLUA 4S24A 5C5CA 3GRAA 1QG4A 2C2YA 3Q15C 3L0IB 1NE2A 4PTLA 3ZQUA 3RR2A 3TLEA 3VNVA 5BMVB 2UAGA 3TTSA 1QVRA 4WX2B 5TPWB 2FHSA 5JAMA 1I4WA 2DT8A 1Q2XA 3DMGA 3HNRA 1NRWA 4YAJA 3VYVA 4ZVLA 1NKVA 2NZXA 3PNLA 4CV0A 1RMQA 2OMKA 4FK8A 4YK7A 3DVAA 1LNQA 4YVFA 2VS1A 2XUHA 3BICA 3IAS1 1PR9A 1TMGE 1W4BA 1A88A 2PH5A 2XUIA 4PXAA 3ZI7A 3OT4A 4LVCA 3IAUA 5FNVF 3PXGA 3ZVNA 1FC0A 2PO7A 3MPOA 4MMYB 4YMSA 4KPYA 4JBGA 1I6MA 4ZJZA 2AHOA 4E5MA 1SU4A 5J4VA 2YVUA 1U2ZA 1M34E 2P2GA 3F6RA 4LXIA 2V4ZA 3UB4A 4BQOA 4HUQB 4HLNA 2PVSA 2OFFA 3Q3GE 5DLYA 4ESVA 4LXTA 1Z8NA 4YCSA 1Y1PA 2I2CA 5GONF 3TMYA 1IOVA 1XZCA 3LQ4A 3AFMA 1SD1A 4QEKA 4CHGA 4WNAB 2G25A 4OXQA 4R2XA 4B9AA 2MDTA 4JITA 1L3CA 1XMQB 3AF0A 1ZHHA 4XX0B 5KTTA 2A9VA 4RDIA 1YSCA 3NJRA 3X3HA 3X1YA 3R5JA 2Q4TA 2XB8A 3GRRA 1SKYB 4MPRA 4F3KA 2JIZD 4RPKA 3WR5A 1IN5A 2R1UA 4U7HA 2WJYA 4IBOA 3WIDA 4EYOA 1L9KA 3KX2A 1NVUQ 5JFTA 4CTNA 5BWBA 3SXPA 5LBIA 3MOSA 3M9XA 2DUWA 3E81A 4CL3A 4KO4S 3GCDA 3W34A 3QQPA 2IW1A 3ZW9A 3PQ2A 5DBHX 5FT9A 2QIOA 1E6KA 1WSWA 3IQDB 5H9VA 2R3SA 2IFTA 3HI6A 4GMHA 1EFPA 5IJ9A 3VSBA 1V1MB 3UB2A 4AXXA 4E5PA 4WEQA 1D2CA 2ZJAA 1TVMA 3ABZA 4C0XA 2WSYB 3GGSA 3FAKA 3OCZA 4QBKA 4XDHA 1XJCA 1TFRA 3NHSA 4HDMB 3WLRA 2JLYA 1MZVA 2H0RA 2NT4A 3I4CA 2BHRA 1ES9A 2EX1A 3LV8A 4H1VA 4LXXA 4DCNA 4KXLA 5CDGA 2JGFA 4QQRA 4PE5B 4A9AA 1E3MA 5DHQA 3CLRC 1RWNA 1WZUA 4DBVO 4WAUA 4ZQIA 1LCIA 2ZIXB 3KIPA 4L6CA 3KHSA 4PV7A 1IC6A 1ONOA 1ZK4A 4UQLA 3S1AA 5HBRA 1PT9A 1FFSA 4QEZA 1XVAA 2ZIZA 5LKAA 4UCWA 3C3CA 5YASA 4X0EA 3KNZA 2GNOA 1JBQA 3ZI4A 2JFVA 2JBAB 3L3BA 2HCRA 4TL7A 4U5QA 3RVLA 3HY3A 4DHWA 5CA1A 1HYQA 2P5UA 2JIBA 3U7JA 1FEZA 4BFTA 4NVRA 4RK5A 3UK0A 3B1FA 2JBHA 3ELWA 2YWJA 4R8RA 1A5ZA 2C3YA 2NW6A 5T57A 1JEJA 4H1TA 3C8ZA 3U2QA 3EIOA 8LDHA 1O57A 1DAIA 3F46A 3IEVA 3GFTA 2BI4A 3CR8A 3JASA 2AB0A 1YKGA 3OFKA 1I7DA 5LQJA 2WE7A 3A0UA 1HNNA 4RHYA 3T1QA 4RD0A 4EJSB 1ISIA 1U2RA 2FPRA 2NTEA 2HZBA 5KNBH 3AGPA 3GLFB 5CW2A 1TA0A 3BFXA 1XU4A 1Q0HA 1HF3A 1GKLA 2RHRA 4C4PA 1QGAA 3VYWA 1U98A 2AZTA 1GPLA 2GSDA 2C4VA 4BCCA 3AKYA 3M0EA 1Q3TA 2YYYA 3LUFA 2PBFA 2QV0A 2WU3A 5F1OA 3EVAA 1GQRA 2JGJA 1UK7A 2A8YA 4NONA 5F52A 3C6KA 1ST3A 2O0MA 3KQTA 3JWGA 2C03A 2YH2A 2RH8A 2FPUA 4CM6A 2I99A 3DEZA 4BJHB 2ZXUA 4QULA 3GH1A 3A3NA 1VIVA 2CF5A 2ZP1A 3L1HA 3T5GA 1MEJA 3ULKA 3ZIUA 3PBKA 3IH5A 1I30A 3U81A 4AF6A 1BX0A 2XMCA 5F3DA 1L4MA 4GYWA 1XT6A 1YFJA 1Y3BE 4YXWD 1P6UA 1Y89A 1GG2A 3TPZA 3UATA 3KYCA 4JJ7A 4NZNA 2J0SA 1CJVC 1XL1A 2Q8NA 2FFQA 3CUUA 3HCPA 2FWAA 4MV4A 3ONFA 1Y1QA 4YP0A 3QEKA 4PNPA 4C01A 4CMEA 1G4HA 1IZ0A 1O03A 5AI5A 3OUTA 4NQRA 3Q8MA 1P1BA 5DH9A 1QQAA 1NVVR 3MTQA 3NTQA 2F1JA 2ZWVA 1RRMA 1L1FA 1HMYA 2ECPA 4MAFA 1XHEA 2XNCA 3PSAA 4XRGA 2PS9A 2F64A 5B1EA 4GOOD 2W6MA 2HMVA 1JV2B 1CR1A 2A7XA 3O94A 4AIRA 1MBZA 5HRAA 5LU8A 1LBIA 1IBCA 3DBVO 2XNDD 4QQ8A 1MAWA 4L9WA 1QFZA 2GDJA 4Y1GA 1TZBA 1N0UA 4O1IA 1ULSA 1S2DA 3MUFA 4LJ4A 2NVOA 3LWNA 4OBWA 5LZ5A 3C70A 4BBPA 2WTUA 1XQXA 1V4VA 1RKVA 1MA0A 3E9MA 1E6EA 2VP6A 2AQIA 4R68A 5IT5A 1NNLA 4TMWA 4LWQA 3ANNA 5B64A 1GFZA 2HSDA 1TW3A 3AX6A 3FNEA 4U00A 1HGXA 3GG2A 5CIWA 1Z68A 2VHEA 4KLNA 1K08A 3PDCA 4PX2A 4XIYA 1VKHA 2V1XA 3SMQA 1TA9A 2E4YA 4BNUA 2JKZA 5AI8A 3F4KA 3HCWA 2MSCB 3C8DA 1WX1A 1TVEA 5ENVA 2Q07A 3K0KA 1WP4A 1X1SA 5ADWA 1MDFA 3OM9A 1O77A 1HETA 1V8ZA 1EK6A 3KXLA 3UT5B 3OH8A 4EDFA 4PYOA 1K5DA 1Z8DA 5LYJF 3VQTA 3S2ZA 5TS2A 1IIRA 5DM4A 1NRXA 4EQ6A 1DQYA 4KVZA 3LKVA 2C2BA 2HWYA 1D6JA 2ZJOA 2OOSA 1VJGA 2G3YA 4BLQA 3KT0A 5U1PA 2XT9A 1ZH0A 1JTFA 3B9RA 2C1XA 1L6RA 3PXUA 4ZK6A 1FBTA 4FFSA 2B98A 5JS2A 1NC1A 2RG7A 2ZYSA 1I3LA 1Q91A 5DN9A 5I7VA 3DOHA 4NJOA 4ZAZA 5EMMA 1U9IC 3MHPA 2X1HA 1ZXXA 2ZSJA 2VTVA 5ULLA 1JJ7A 1EP3B 3W1EA 3IBGA 1GGVA 4FX5A 3W90A 1M3SA 4G8DA 4RTPA 3A1CA 3VTKA 3VV3A 1FRZA 3L7CA 1E3TA 1P31A 5LA6F 5KC9A 4UKDA 3OE4A 1FTGA 1ACLA 3K09A 1GPUA 1XVUA 4WN9A 1U0BB 3A1NA 1RYNA 1RWKA 3NVDA 3ZWVA 1R27A 3BL8A 2QN6A 3CHYA 3KSMA 3MLAA 4FT4A 1K1EA 2P7IA 4MA5A 4ESHA 4HH1A 1CUZA 4FFLA 5B4VA 6GPBA 3NLLA 1HTTA 2YR0A 2WD9A 4JB2A 1R6BX 3BD8A 1RWVA 1QQ7A 3ANLA 3PFIA 4JOBA 1U3TA 3TLGA 4FYYA 5C8ZA 4GPZA 4QOSA 4M7RA 4GX0A 1CYDA 4YRRA 3AEQB 1EGAA 1HFEL 3O2QB 1Y98A 3FM9A 3PFHA 4UHCA 5AK0A 5DXFA 4HAZA 4ZYYA 2Z9BA 5B55A 3GHHA 3UMYA 2QRVA 1EFVA 4Y6RA 2JVJA 3W1VA 4J8PA 2NSLA 4LOKA 1NBEA 2QTBA 3FNIA 3U4IA 3TQRA 2C4KA 2ASEA 3KSRA 4MS3B 4UUOA 1DP4A 2XITA 3A10A 4MP6A 4O4IA 4D9BA 4N12A 5A3JA 2HR1A 4DR4B 3VPGA 2V45A 3VPCA 3AR5A 1SZCA 3BRCA 1F5NA 1MB0A 3DONA 4FVTA 4Z0TA 4BV2A 3EGDA 5IMSA 1KQGA 3W5AA 1YGPA 1ZJ4A 3FJOA 4W9MC 2QL6A 2CXUA 1N8NA 4HDCA 4V0MA 5KU1A 3QVUA 1JB1A 1ACMA 5J47A 4FLEA 3G9UA 3GDHA 3FHLA 4IPTA 2GZ3A 1UBOS 1VDMA 5BQ5A 4XIJA 1KFBB 4KIWA 4MPPA 1OBFO 1LPSA 1N5OX 3OZVA 1G60A 4UBNA 4AMBA 3JD3A 4J0DA 3FGPA 4XFKA 3IQEA 5KQPA 4QDXA 2EJCA 1KVSA 1SHKA 2EIXA 4UM8B 4ZCSA 5U4QA 3SC2A 4MR8B 5KNCD 4LKOA 3C6ZA 2FEPA 2PH7A 5DJ5A 5C4MA 1N6LA 1NJ8A 4YR7A 5FWAA 4UNIA 3RC8A 4N54A 1T34A 2B3TA 2ZETA 3DCYA 3H04A 4Y3UA 4L2IB 1VLJA 1XG5A 1Y5NA 5AM4A 1ZHOA 2HLDD 1IDN1 3TMKA 2CYBA 5I48A 1ZJ5A 3KQOA 4ID9A 3UJAA 3FYTA 5JCOA 1CJBA 1QHHB 1AQJA 1ESDA 2GVDC 2ZZKA 1PFQA 2REXB 5ADVA 1CDEA 1WW2A 2I4RA 5HQ3A 5IJWA 3QF4A 3OC0A 2COKA 2F3QA 3DQZA 1RQRA 1XZIA 2FSSA 2PTGA 3LHFA 1WCXA 3IJEB 4BFUA 1LJUA 4ROSA 4NYMR 3H18A 1UBRS 4LBZA 5E7QA 4RE6A 4LFAB 2VEDA 4KXMA 1D2RA 4UMEA 2CLDX 5DN6D 4U9UA 1JQ3A 5EG5A 5L4NA 1WUIS 4QHYA 3KVOA 1NN1A 3T35A 4ZGGA 3OHPA 4NCNA 4ARZB 2VQ6A 4QXMA 3LQ1A 1QE5A 1U7HA 4QT0A 4JYAB 1X94A 4KVAA 4X92A 1B8NA 1NULA 1RWQA 2C20A 2QUIA 3ESBA 2VP4A 4MAAA 1KOLA 4BPRA 2MSKA 3UWKA 3A3OA 1NFRA 1L8LA 4GM1A 1YL5A 2GJSA 1QOPB 3NETA 3SR3A 1A9RA 4R2JA 2QJOA 3AEKB 4MUNA 5LP6B 4IH9A 4HUTA 3GFOA 2I0FA 2SKEA 2N1MA 4XQGA 5ED0A 3AM1A 1PZMA 2AWNA 3NCHA 4ZODA 3VR5A 4AM8A 4B7AA 1D4ZA 2PLRA 5HUHA 4XUCA 3KB8A 1C9MA 2H1VA 1UH5A 2I4MA 5K5EA 4XLZA 1SUDA 4DVJA 2R7LA 1K68A 2X2OA 2HPZA 5FOUA 3WL6A 3DOOA 2C4WA 3QFTA 3T7AA 3I9MA 4YQZA 2CB9A 4HAIA 3EX7C 3JYHA 1IRIA 2QTAA 4KSBA 1HEYA 4BX3A 3CLSC 1TMOA 2J5KA 4KAXA 5D3QA 3DO5A 5FBLB 2ANCA 2I7TA 3N8KA 2BFDA 5KQLA 2ZYRA 1NOKA 1XXHB 3WGYA 1SCDA 3LYLA 4P36A 4DCMA 3ORYA 4RJLA 1YAJA 2CDAA 1AV7A 5J5VA 3OFJA 4AJOA 1Q7EA 4OA5A 2CFSA 3L7OA 1DQRA 4HMQA 5IPFA 2WNHA 2LWIA 3QVMA 4RMJA 5D1HA 1NIJA 3I6IA 4UCXA 5EWMB 5TPZD 2B5VA 4P4SA 5JCJA 3UUEA 2NVUA 3BB3A 2WY2D 1U0RA 4G4GA 4GMXA 4TKMA 1KAHA 3HJUA 3NV9A 1R8SA 5D85A 2Z8YA 5T5QA 3QA3E 4F85A 1U7ZA 4DW8A 2CV2A 3WA6A 1UPXA 1F9AA 1XRQA 3DJYA 3RGGA 3UMBA 4A3SA 3ANSA 1YKSA 3VAAA 3QVVA 1E6WA 3ESRA 3F5SA 1RAFA 1QZUA 2ZAGA 1PSWA 5DWDA 2VCHA 4BFSA 4XVUA 5EWJA 3OURA 4PEVA 5EJ7A 3DA8A 3QPDA 5EQJB 1HZJA 1M10A 3ISJA 3NBUA 4G0YA 4I4CA 4IINA 3U7RA 4Z8YA 2LKCA 1SKUA 1J5XA 4RAQA 4S1PA 2I67A 3W04A 4PZPA 3ZUGA 1V7ZA 1ZCJA 1TFUA 4D8UA 1UKVY 1ZH8A 1YS1X 4I36A 3MCUA 3OPMA 2RHTA 2R7NA 2XVAA 4OFXA 3PHBE 3ZYZA 5KYGA 3DPIA 4FBMA 1YV9A 4EA7A 1EX1A 2WUDA 2PRIA 2OV2A 2HYDA 4ZT6A 2L0XA 5JV5A 5MFPA 3RRBA 2D06A 2QI9C 2A6PA 5JLAA 2IYWA 2MU1A 3IUNA 4RA6A 4HB0A 5IXYA 1B93A 1HDXA 3GLGB 1AKVA 1OUMA 1QAOA 1OXXK 3M6UA 5K3CA 1P19A 1T4MA 2QP9X 4YJ3F 4KR3A 3LFHA 1Y8QB 3K4QA 2C4TA 3AYZB 2O3RA 4L8GA 4XQ0A 3BEDA 3ROGA 4DV3B 5FCDA 2QPAA 1SRQA 1VZ3A 3D1VA 2ZSHA 3IVGA 3AR3A 5CDUA 5JFGA 3R7BA 2RGRA 1XZBA 2BCJQ 5JG7A 2QRZA 1JBKA 1UPTA 5D84A 1P0IA 1V35A 1O6ZA 2BN4A 2G08A 2ZXFA 5TQ0B 5IVPA 2HUNA 3C2QA 1G0NA 1V41E 1WOMA 3PS9A 3BB1A 2RAUA 2X6TA 4IHJA 4YCAA 1QQBA 4D3SA 1JT9A 1R0KA 4Q37A 2H7YA 3DXZA 5CLJA 2AC7A 3LP5A 4ZOBA 3VPFA 1JFTA 3BE6A 1H2WA 1ENZA 4C4XA 3OIGA 4F46A 3G49A 3B6JA 3MWJA 4IWXA 2REQA 3L7LA 5HM6A 4DLTA 2GTHA 2FCRA 3KT8A 3MT8A 4PPNA 1CUDA 4WIAA 3DV9A 1WUTA 3PNQA 4NCJA 5FBQB 5FBHA 4C08A 1NA5A 5TMPA 1LZKA 2QX7A 1R5JA 2L19A 4R9RA 4XJVA 3COZA 4RX1A 3VR4H 4CUJA 1DI0A 3V8VA 2IE8A 2NXCA 1VE6A 3GDGA 5FQOA 2HO4A 3GLQA 4GZ6A 2CVPA 4MQ5A 4PPYA 1QG0A 2OBBA 5TMDA 1GAJA 2QAGB 3HFRA 4XSGA 2OQ2A 5CDHA 1NXPA 1OI7A 3MUNA 4KQJA 5CDTA 2OQRA 3NASA 1Q12A 1NVBA 4O3FA 2MYPA 5EMKA 4FDMA 3SS9X 4EUSA 4EELA 4YO8A 3C3EA 2P9HA 3ZY6A 1VE7A 4A4DA 3ICPA 2PIDA 4HX2A 3DR5A 4WLVA 4DABA 3QEAZ 4S1VA 2YHIB 4H35A 3R9XA 3B8HA 1CUEA 1XLUA 1REQB 4TL8A 1HM5A 4HQNA 3SF0A 5IJ9B 1KMIY 1GZDA 4XGQA 1Z4NA 3LZ6A 2PZAA 4IIVA 2X5KO 1YIOA 4OKSA 4TM8A 4YPFA 5IUNC 4BMZA 1U8XX 1UAGA 1H93A 4G23A 1Y81A 3R4VA 1SBHA 1QHYA 2K6GA 1N1DA 2CFCA 1G6HA 2H31A 1L7MA 2I55A 2ZR7A 1ZQ1A 1C8KA 5DO9A 3PDUA 4OL0A 5ALDA 4AAYA 3RSQA 3AT1A 5LOVF 5I9LA 3DFKA 1JEQB 2J3QA 3KOWA 4GQIA 4OGWA 4WZZA 3DB1A 4EFLA 3V46A 4Z49A 2VDJA 4XGNA 2GFIA 2V8OA 3KHTA 3TXXA 2BJHA 5IT4A 1JZQA 1KI6B 1OFVA 3LBAA 3GZTB 5L51A 3RUEA 4E5KA 2G40A 3TZEA 1Z6PA 3PHGA 5D5HA 2HU5A 4PLTA 1POXA 4IIYA 5FKJA 3C1AA 4D3XA 3IEPA 3ADBA 2JLXA 4L5BA 4Z4GA 4PCAA 4OYRA 2E5WA 2NO6A 5KO2A 1M8FA 4JR2A 1V5WA 2EP8A 4F71A 5HM8A 2PUTA 3GA5A 1L8OA 2RB4A 2ZTLA 1SC4A 4I19A 4V1CA 5T4BA 1N3LA 4DUGA 3A6EA 2VRWA 4MI9A 2HL6A 2R8ZA 4HYTA 1U80A 3F90A 3SC3A 2GN0A 2BCGY 2HDWA 5COQA 4OI0A 1RKXA 5KHAA 2ZRPA 4EGAA 3FPSA 1JLRA 1CNMA 3EXEB 4OK5A 3V4ZA 3IAM6 2F6RA 1WCYA 3CLHA 1A7JA 1JT2A 2HFKA 2DULA 2H2IA 5T3YA 3RIXA 3I9OA 1QGUB 2DMRA 2NU6A 3HCNA 2V9CA 2Z8XA 4C0WA 1TGYA 4MDFA 5AOCA 2A0WA 3AJEA 5KYUA 3SDSA 1JMKC 3F0TA 2YXEA 4L7QA 1YTUA 2QE7D 2P3SA 1WF6A 4GO1A 2UXDB 3BGDA 3QG5A 5FOSA 4CLEA 1DUSA 1P2DA 1RKBA 1CJSA 1LBQA 2J0VA 1HE3A 3QEMA 4JYZA 5K3AA 1SQGA 4MKHA 2PKQP 1E9CA 4C21A 2RH9B 3FPFA 3I28A 4W1PA 4ZVNA 3NQ41 3RUHA 5ED4A 3TECE 2H5EA 2Q62A 4MV8A 2VPYA 5I7UA 1ZRMA 1PKEA 5FUXA 3U7IA 4AZ3A 4B1FA 2Q9UA 2H1CA 2G9QA 2OZKA 4Y0VA 3RI3A 3VUFA 4CMIA 1Y42X 4XWOA 1R4AA 4ZOEA 2IZ7A 3R44A 1EGMB 4GXNA 5EYPB 3TFOA 1F8GA 3WKEA 2W70A 3QY0A 2HI0A 3EARA 1D03A 1GCOA 3E0QA 1L8XA 4IX9A 3S7TA 3UK2A 4LMRA 4M9XA 3VYRB 5HTKA 4Z2AA 5C8DA 3PTLA 1HYEA 4MRMA 2PL9A 1VHQA 4LEIA 3F3YA 1SFRA 3PD0A 1V1RA 5IKOA 1ZZGA 2D4AA 3RE1A 3BL6A 3WDSA 3DE2X 3KJHA 2X1LA 4AO8A 3ENNA 3V4OA 4KAFA 5D51S 5DRYA 4PBTA 1C29B 4UFOA 3X43A 1KO4A 2CXPA 4KRYA 3FYSA 1PN3A 3SXJA 1DEHA 1GDDA 2GBCA 2UXCB 1SKAA 2WIGA 1BN6A 1HT3A 1QGYA 5JJIA 1B16A 1M7BA 1XQ9A 4UE6A 2OFWA 5JHGB 1NN0A 4YQEA 3RTEA 3VHLB 1RMYA 2I3DA 5IDWA 2CWWA 1HDEA 3T8YA 4CUZA 4HNHA 5CM2Z 2W6ID 2Q41A 4BLSA 3TAXA 2IH4A 2YVLA 1I1NA 1X7HA 1O7JA 3D3NA 3QEOA 4IDEA 2OENG 3E9ZA 1Z0FA 4BNYA 4Q9DA 3ROZA 1G5QA 1RADA 2QXTA 2YWBA 3KPVA 4FEGA 1GKKA 3U1BA 3ZHSA 1O08A 2YHBA 2C5HA 3IAFA 3N5KA 1ZL0A 3M6LA 2P2SA 4K3VA 5I5EA 1OX4B 4HO1X 1SC3A 10MHA 1QYVA 4B40A 3SP1A 3RQIA 2DQKA 4PG6A 3N8GA 4FCTA 5D7NA 4C03A 1BXRB 3S5JA 4BFWA 5BSWA 3GGJA 1GNPA 3GARA 4M53A 5E95A 2JLCA 1XV5A 4PNEA 1AF4A 4OMFG 2ZRQA 1NPDA 3O1HB 3I8SA 3AY0A 4XIFA 4BO8A 4LECA 4YTEA 2J67A 1RPNA 5IZ4A 3DKPA 3CEHA 2QL7A 3GN2A 2WB4A 3T9EA 4DCGA 4PO1A 4Y8VA 4UUNA 2QRUA 1A9ZA 4FMDF 3DZKA 5FA5A 4PS1A 1MO3A 3ZNNA 3KBBA 4CF3A 2JLBA 1BDBA 3K2IA 4GMGA 2V3WA 2H4JA 4RKFA 3ZCUA 1I4LD 2IU6A 3OEWA 1FYXA 3L1JA 3HWX1 5AHWA 5BORA 2YNMA 5E1DA 4OQQA 3OEED 5EEHA 1CY7A 3W6UA 3Q6NA 2B7LA 4TSFA 3TE7A 1HQKA 3KQSA 4RCYA 4GNKA 4A6DA 1L5HA 2B36A 2FUNB 2XBUA 3HR8A 3U4GA 3B3GA 4C5AA 1R0LA 1V9CA 2GM3A 2H4XA 2IIPA 4V0OA 1PF7E 2VJCA 1TZMA 2ZUBA 4DLPA 1JIXA 3ADKA 1NMXA 3LUKA 4QNMA 3G1WA 3KXIA 4R8VA 3II6X 1ZXLA 2O8VA 3O82A 1G8JA 4ZHQB 4MQEB 3SIRA 1CRZA 1DIGA 1W8DA 5LSAA 2R8OA 3IIEA 4JLSA 1HR0B 3T3MB 3QITA 4PIPA 2NP6A 3H1BA 1SELA 2CD9A 5THQA 2OP0A 1V3VA 4J1SA 1DIRA 2VHQA 1M2VB 4ALIA 1DBWA 2HN9A 5ALKA 3WGVA 5I9NA 1ZC3A 4A1OA 1FIUA 1NOIA 5ALPA 4PC2A 4WA7A 1PUXA 3PCTA 4U7DA 5C7LO 3TD6A 1O95D 3I2HA 4JSYA 4L76A 3TEJA 3UG6A 4Y2UA 3E7XA 1XFAA 3U40A 2AJCA 4TRNA 1AE1A 1P4RA 1RZVA 2J6CA 1KI7A 4QG7A 5EHNA 4K0KB 3JYOA 4ZP1A 4BNMA 3VC1A 1T0HB 3VNRA 4GR9A 2YJZA 4ZJYA 3ZWQA 1GCGA 1C9JA 2Y77A 3Q0IA 1S3IA 5F2EA 3ZH9B 1G21B 1B42A 3EODA 3VR6H 3BT7A 4H4CA 3GA7A 4W6ZA 4L8YA 5G1NA 4NG4A 3IE1A 1EFVB 1TKRA 3L7NA 1W4RA 1KAEA 5AIAA 2FW6A 1F0KA 5HFAA 3KZVA 3QYJA 2H4FA 3VU1A 1HG1A 2YV3A 1V8DA 4W63A 4YWHA 4QO7A 2ODTX 3TIFA 4CLXA 4FHDA 5DTIA 3TINA 2GAJA 3LGSA 1TRKA 4ZCTA 1C7IA 1NHGA 2G9ZA 1N1MA 4JX9A 4O29A 4X84A 5EC8A 1ENPA 4QDUA 2VYVA 4AL4A 4CIXA 3A9VA 3HSSA 1G7SA 1CP3A 5JSHA 2CXOA 3MRSA 4Z1MA 2P5YA 4WDQA 4B74A 5B1DA 1IU9A 1U2GA 1MU0A 3JZMA 4FR2A 2OHFA 5ITZA 4H7IA 3LZCA 4J0GA 2ECFA 4J1JA 1YFKA 3VZQA 1IJBA 5CP8A 2C7OA 1Z7GA 1EFTA 3HUEA 1B3BA 4JIGA 4DZTA 1YGYA 5FPTA 4UTNA 4IXDA 3V32A 3WHIA 4J29A 4CMGA 3EQZA 3AFNA 4LC1A 2IE0A 5K6AC 3R5XA 3EPLA 2GD0A 4B8YA 1JEEA 1OXBB 4HEA6 4L5IA 5LMNB 1FQJA 1UJ5A 7MDHA 1H2EA 1ODKA 1S9DA 5AKGA 1UKAA 1CR4A 2GM5A 5K0TA 2OXRA 3U26A 2GZRA 2ANBA 2RB5A 3K7EA 4ENTA