3GX1A

Crystal structure of a domain of lin1832 from listeria innocua
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
126
Chain Sequence
SNAQVEVIVMMHGRSTATSMVETVQELLSIESGIALDMPLTVEVKAMYEKLKQTVVKLNPVKGVLILSDMGSLTSFGNILTEELGIRTKTVTMVSTPVVLEAMRKASLGRGLEDIYQSCEQLFENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of a domain of lin1832 from Listeria innocua
rcsb
source organism Listeria innocua clip11262
molecule tags Structural genomics, unknown function
molecule keywords Lin1832 protein
total genus 31
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03610 EIIA-man PTS system fructose IIA component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.510 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphotransferase system, mannose-type IIA component 3gx1A00
3CT6A 4TKZA 3MTQA 5IM4F 3BEDA 3GDWA 2JZOA 3B48A 5T3UA 1PDOA 1VSQA 3GX1A 3LFHA 1VRCA 3IPRA 2JZNA 3CR3C
chains in the Genus database with same CATH superfamily
1G4AE 3EY4A 3O0DA 4E6PA 3C87A 1Q95A 1W4CA 4FIDA 4CCYA 4YV0A 2P6RA 3FUWA 1UOOA 3EUWA 1IU9A 4UVHA 1C3EA 5ALJA 4LOJA 1ZGZA 4RJKA 1CUUA 3LF2A 1MW9X 2ZWMA 4HJRA 1V1RA 2GZ2A 1DG1G 1WF6A 4G84A 3P9ZA 1AMUA 2NO9A 2H4HA 2B21A 1A1SA 4MARA 2D5AA 3O4HA 4PAWA 4YRFA 3GLKA 5ALEA 3ZJ4A 2WEKA 4CLRB 4W9MC 1NONA 2W42A 1CRPA 4KOEC 2QK4A 1E3JA 3IAM1 1TVKA 2B30A 3SEAA 2FDCA 3ZLVA 1GD1O 1L8OA 2B7BA 4TV8B 2WYOA 1U4SA 4N82A 3W6UA 3RROA 5JBQA 4WZAB 1QU2A 1DVRA 3KTOA 3IHLA 4MPPA 4Y2SA 5K0CA 1I3MA 2H63A 4BRSA 3MWYW 1CEYA 5JYCA 4DV0B 3RC8A 5AQ1A 2O14A 2A9QA 3QUSA 1OZFA 5G4LA 1ADGA 2Q3CA 1I7QB 1JB1A 5LMUB 3ZD6A 1JHOA 1Z0ZA 2O2GA 2D54A 4LE0A 1Z5NA 3P32A 2Y9PB 1RBYA 2P67A 2NO7A 1LBHA 3D5TA 3UFXA 1Y6FA 4KYUA 2PQMA 1XRNA 3KJIA 1GV0A 2AUNA 2ILVA 3QVOA 2UU9B 1QJ4A 4UZEA 2BONA 3N58A 3AUKA 1F4VA 2I1WA 2WWTA 3EAQA 3NC0C 3T1OA 4HRAA 5A3JA 3KR1A 3NATA 4HMOA 3LRPA 3UT6A 2WB2A 1O3YA 2BFDB 3B9QA 2R00A 2E1PA 5C8DA 1O1YA 2VQFB 1LRLA 3GP8A 1Z7BA 4CKCA 1R64A 3AZOA 5F2NA 3GEHA 1QKIA 2WJHA 1LVGA 2PZFA 4OXRA 4AT1A 2YYZA 5BV1A 3CLSC 3N86A 5CVTA 5JH7F 2IOHA 3JASB 5DOZA 1EZ4A 4YLYA 3JQFA 3INGA 3WA7A 1CDOA 1FUYB 1N2EA 4DSTA 121PA 1J39A 3QF7A 1MH9A 2IOFK 1M2WA 3QJ5A 3UMSA 4QVIA 2N47A 3QFCA 3MYYA 3TPCA 3EGIA 2W6ID 2PLAA 3ZR4B 5I47A 5ALYA 3PC8A 3HS3A 3FF1A 4GECA 2JATA 2H7XA 2VLIA 3QE3A 2J3DA 2ODPA 3ESDA 2SKDA 5FV4A 1JAZA 3P2KA 1P3JA 4G09A 3RK1A 4LQCA 4FHEA 3BRQA 2CBGA 1YUMA 3PVSA 1AUPA 1B16A 1GUZA 3CVJA 5FYDA 4JB2A 1A95A 2ZUCA 4DQXA 5B4TA 1EWQA 1HZZA 4BDTA 1KRWA 3HXMA 3GA5A 4TSFA 1KK0A 3CVWA 3EULA 4MVJM 4F4CA 3KB2A 3E22A 1EVZA 1T6NA 5I4KA 2C2GA 3IDAA 3O2NA 4OIMA 5KVCA 1CK4A 1H3NA 2COUA 4IYRA 4N5MA 3VPSA 2EAUA 1QP4A 2V1UA 2F62A 2BHRA 4X20B 2R11A 1ABEA 3I05A 1YJ8A 2Z5VA 3OM9A 3RTAA 2NO0A 3T3GA 1F2VA 1UDXA 4RENA 1C4WA 2O2IA 3KUUA 4MCIA 3GQVA 3L0IB 2M1XA 1LB1B 4M7WA 2XY4A 3OLCX 2ESRA 5F64A 1C30A 3FKQA 3RREA 4ALIA 1WHSB 1KBZA 2QAJA 4AXXA 3MWGA 1GRQA 2V3VA 2BMVA 3G89A 5EIEA 1K8YB 1X19A 2ACEA 3DKRA 1T8TA 3Q3HA 1XZCA 5HCUA 3W1VA 1RXEA 3LDAA 1FLNA 1SVMA 5AT1A 5KTYA 5IZ4A 5EIBD 4O1MA 3KSZO 3LCMA 3K0AA 2A9RA 4TS1A 5C2JB 1VE9A 4IG9A 3IUJA 5F2EA 4U0KA 5DRYA 4JNCA 2JPDA 1BHO1 2D0DA 4PZPA 3H5NA 1PKEA 3FDZB 1HNXB 1YRHA 2NZWA 1M2EA 3G17A 5ALUA 4KH0A 2BEJA 1I30A 4BC1A 4X00A 1WXIA 3JZAA 4ZQBA 5B12A 3H3JA 5ES4B 4M7RA 3DV0A 3ZE1B 5AJVB 4M3NA 3IBTA 3ZWQA 3SX2A 5CXUA 4LBYA 1UBUS 4V0QA 1CSEE 2C3YA 3BXZA 1U65A 3BSSA 2XR1A 3NAMA 4O4IA 4U7GA 1YB1A 5GVRA 3RWMB 1WAMA 4HXFB 2WIAA 3LGXA 3R6WA 4P35A 4RHXA 5DGCA 1IDN1 1PNTA 3SX4A 5EY5B 5BYAA 4JA2A 3X1ZA 1LBEA 3N2KB 8ATCA 4RM2A 3GV0A 4OQEA 4KHPB 5DH9A 7ADHA 1G3MA 3QTBA 1FYXA 1DC8A 3PUHA 1L5QA 3GEPA 2ASEA 3QXXA 4XDHA 4WK4B 2H8GA 5CW2A 5EAIA 3ZH9B 2GZDA 1ZWKA 3DDUA 4OQFA 1VYVA 3CUTA 4DR2B 3LLUA 4F4HA 5AVXA 3CB4A 4X91A 1KEKA 1KZGB 1PT9A 2QLMA 4V0KA 3T9FA 3ZKWA 2PUVA 3TZ6A 3H11B 2Q0SA 2NV2B 4Y7DA 2O8FA 3ESAA 4E11A 2BT4A 4S0ZA 3EEOA 4L07A 5C1DA 1G0NA 2H06A 3I9NA 4G1CA 4LJ7A 5TMBA 5L51A 2O2SA 2QR5A 2C7VA 2D5BA 3D54D 4G86A 5E9JA 3TF5A 4AKSA 1RC0A 2CVHA 2PZKA 1VZ3A 4XR9A 4AU1A 4C29A 1XZQA 1NP3A 4RJ2A 4CKWB 2R6DA 1EI9A 1JIIA 1SXJA 5JD5A 4LJKA 1JLRA 5EYPB 2XKBA 4I5EA 1XZNA 1CKEA 1YXMA 3JYQA 4L2IB 5DYTA 1XAJA 2JFYA 4IM7A 4HDKA 1BKDR 1C1YA 1DKOA 3OCVA 2DFVA 3MTJA 1FIUA 1Z5UA 4CQLA 2QSYA 4P81A 5H5JA 2C9ZA 3AI1A 3GMTA 4XUGB 3NH9A 4V02A 2FAXA 2HRCA 4OHRA 1Y1SA 2OD9A 2HMTA 3E7FA 3GGGA 4RWZA 2ZRJA 3E70C 3SMVA 2GBLA 4ZYUA 6NULA 1HH4A 3Q6IA 2EF0A 1H2RS 1B6SA 1FLAA 1FUIA 4QDJA 4DA4A 3R0IA 2W2NA 4S2EA 2B78A 2C57A 1C2TA 4XVHA 4BASA 5AUOB 1V1MB 1GXSA 3O8OA 3RADC 1SCDA 2IU0A 4MCHA 4AMUA 4TMFA 2R85A 3MCAA 5HDBB 4YYEA 3LUHA 4PVCA 4RETA 1NZJA 3AKDA 5HGXA 4WECA 2WIDA 1EUYA 1UOPA 2EC5A 1YULA 1NRWA 1GNPA 1VLJA 2NACA 3ISTA 1YBMA 2O2JA 1RZRA 1N2GA 1HORA 1QHHB 4RNDB 2ZJYA 3KM0A 1W4RA 3LCCA 3R6TA 2PBLA 2RGGA 4GPIB 2FZEA 1N6PA 1GNLA 2RGNC 4EY8A 1TKCA 3CM0A 4H0NA 4IWNA 4UVGA 1R4NB 3DW1X 1TJ3A 3MCZA 5EKDA 2VATA 3AEUA 2IYOA 4I6EA 3VR3D 5C5DA 5CA0F 2YXNA 1ANKA 4NOLA 4R2MA 3VYTB 3Q9UA 2R751 3CVOA 5C7YA 4RJJA 1CIVA 2H1FA 3ZZUA 1ENYA 1KYYA 2VK4A 1Q14A 1SJ9A 1FSSA 3DEAA 1NNUA 4WCFB 4YQYA 3RRFA 4CZ2A 1SURA 1BS9A 3GFRA 4DMMA 4IZHA 1BW9A 4AF6A 3OM1A 3SQMA 3QA9A 1CV2A 1QDLB 1Q50A 2V03A 3DDOA 3UUEA 3VYRB 3SVTA 3OAAA 4XOUA 1XVLA 1DX9A 3L2OB 1FRQA 1TK2A 4ILKA 2PUWA 2V7BA 3W9SA 2EKQA 3K0CC 3JARB 2HA7A 4HY3A 4JT2A 3VBCA 1H22A 5KCMA 3HV2A 2O8DA 1X9IA 1YQQA 1MOQA 4FP9A 1EXDA 2E4AA 4RACA 1F38A 3U7HB 4DVJA 4ZYWA 1YIDA 2Q4OA 1II9A 2ORVA 3G2HA 3G2OA 2QV7A 2ZRBA 2F3PA 2I9PA 3M6IA 2QPTA 3RIYA 3TEMA 3QKRB 2WWYA 1M0EA 3ANLA 1HT1E 2HX1A 3DBHB 2ZIWB 1FFSA 1LPMA 1ZXLA 2OV2A 2VTBB 3W6ZA 5KTKA 4U1RA 2FZ5A 2VRNA 2NU8B 1ZOSA 1J70A 2OGZA 3OESA 4MV1A 4TUYB 4IDFA 2BRUA 1G5IA 3OEEA 4MGKR 4XYBA 2QJFA 1Y1KE 4LMBA 5GAJA 4L5BA 2QX7A 1KKLA 2F00A 2DUMA 3AWDA 3FTQA 1ULSA 1XDZA 4GFDA 3T34A 1L4NA 1PJSA 1O03A 4XARA 1RM4A 2YJ3A 3B1YA 3GH1A 3CW2A 3NBXX 4HRVA 1H3FA 3JD2A 4CKBB 1RKQA 2ZAOA 2HO4A 4IINA 4WA8A 4E1VA 2R6FA 2XUPA 2VC2B 2V97A 3AP2A 3KIPA 4QO8A 2C2WA 5CDYA 1GUFA 1DXQA 1DAMA 1JS1X 1TZKA 2J46A 1DOHA 4EGQA 3AHCA 5BYJA 2PT6A 3GEEA 3ORYA 4DV6B 2Z3WA 3E3LA 3DHNA 4GO1A 3BMNB 3RSZA 3WK4A 4J0EA 1U9CA 3GOQA 4L15A 5EWJB 2Y1WA 1GPBA 5EIAA 3OUTA 4DVGA 3MCTA 2VT7A 1QIFA 1LWOA 1Y8AA 2FX5A 3K7EA 3LECA 3R0JA 4Q34A 3BAFA 5DNVA 1HE5A 4EMUA 2F43A 3HB4X 2GF0A 3QJYA 4LOLA 3QI2A 5H80A 3VO9A 4DF3A 3H1TA 5KQGA 2EZTA 2L82A 3QWFA 4GBMA 3WLRA 4PHGA 3QBTA 5LJLA 3CH5A 1KAOA 5J58A 1K5DA 1D2MA 4F2WA 3JW8A 2VZ0A 2REXB 1KZ1A 2YQZA 2CXQA 4G5HA 4NOJA 3PNOA 3DQQA 3G2PA 3FYUA 4KO1S 5AD1A 5HSGA 5KNBD 4Z9BA 2JFBA 1BROA 1MO6A 3DO6A 3JQAA 3SN6A 3UAWA 3C43A 4XVRA 1ZIYA 1U3WA 5C46F 3S1AA 721PA 1UT5A 4UUMA 3C1AA 2G6BA 3BD8A 4IV8A 1ID1A 3A1VA 1Z2EA 1GTJ1 3UF0A 1GL3A 4PZEA 3WB2A 3AR5A 2CMFA 2EGHA 5FV7A 4BS9A 4FJ0A 2VHJA 3ONDA 4XX0B 4MDYA 3WNQA 2PBRA 2H1WA 1R8XA 1WUJS 4XR4A 4B3TB 1FNCA 4OFZA 1O94C 5BV7A 4FSDA 2GN8A 2V54A 2YHAA 2BR3A 3IQIX 4QYMA 3QSGA 4N40A 4N12A 3HL4A 4UU0A 3RUCA 2NU9A 2A1UA 1ZM4A 2FG5A 1ZAKA 2KMLA 4PO9A 3BRWA 2OCDA 1KI6A 1NR1A 3LZ6A 1S1CA 1Z6YA 2YXDA 1Y4AE 3NHPA 1ISSA 3IR6A 1DL5A 2PT9A 1U28C 1QKJA 2BCGY 3FIUA 3Q9LA 3UAZA 2Q49A 2RH9B 2GBFA 3ELWA 2VYVD 1MO3A 2PA0A 1JBQA 2CF5A 2QIOA 3CZQA 3B60A 3G0OA 4GP9A 4I4TF 1BMDA 4K40A 1R6XA 4WDQA 3KUDA 4YJ2F 3NPAA 5IT4A 3JR3A 1NI3A 4Y1RA 4BNZA 4DCSA 1MC1A 2HK7A 4R7GA 4PTZA 2E5LB 3FETA 3E58A 4G8CA 1QKKA 5JCJA 4X44A 4PSCA 1EVYA 1MXHA 2HHHB 3H0EA 1DKPA 2H18A 2H4XA 3B36A 4G9EA 3K1ZA 1XELA 3MF4A 4H7FA 3A11A 5I7RA 5K3OA 5JRJA 1EYZA 2HQBA 2I6SA 4RVGA 4XVQA 2OYSA 3KK0A 3L7JA 3VBEA 4E5MA 3WY9A 5I7SA 4XCXA 2Q3JA 3AFMA 1FUEA 1RS0A 2G9UA 3NIGB 3A1FA 1T1EA 1HZJA 1I7NA 2X13A 3NONA 3PQ5A 3PDJA 3ABQB 1C0PA 2B6HA 2PX6A 4R84A 5BVHB 3AP3A 3AUJB 8MHTA 2EQ5A 3ZG6A 3BIFA 4RL6A 3IKTA 1T1GA 2YNMD 1G98A 2CNBA 4YJHB 4IDNA 3EH1A 5FEMA 1ZIPA 2JGNA 3ZXUB 4EW1A 1NUAA 1ZD3A 3MFQA 3DJFA 1XDGA 3TIIA 4DQLA 1QE5A 4LYDA 3W8NA 5AICA 1KKUA 4PO1A 5FQNA 1KP3A 1SGWA 3GVCA 1YB2A 4FK8A 2FVXA 4LJ6A 1IY2A 4FN5A 1A5SB 1I4DD 2PMEA 3ED5A 4F6LA 1FNDA 5JEDA 1NBOA 1DWUA 3HN7A 3OCZA 1SU6A 2HBQA 4XXHA 2UUCB 1NDUA 4OB7A 2B2XA 3DS8A 1DAEA 1SIUA 2IYTA 2RGCA 5J5AA 1VGQA 3I9OA 4AFNA 4O02B 4FBGA 4XWTA 5KX5A 1WHTA 3BYZA 1FFAA 1HLPA 2LGJA 1W88A 2GJ8A 4WFJA 1CJKC 2G0AA 2XUIA 1GUDA 4II3A 5TB5A 1L5ZA 1N2BA 1UXHA 1E9DA 2IDKA 4UHHA 2PSHA 4KOAA 3GJ0A 4IHQA 3KJFA 1L1EA 3D7KA 5BOSB 3WL6A 4KITB 1DHTA 2XDQB 2NTVA 2QXUA 1EBUA 2OO5C 2JLCA 3EIUA 1VSUA 4JI5B 1IBKB 4AJOA 1XL1A 4DDKA 4DDUA 3UXMA 2QVZX 3TJMA 3U44B 1FP1D 3HWWA 2CXOA 4H7JA 3ZU3A 1KH2A 3BIWA 1X86B 1RM0A 2GETA 2R1ZA 1XZJA 1ZD8A 1FQKA 2HUNA 3IUPA 5K3CA 4BEBA 3EVZA 4WA7A 4XFDA 2GN0A 4MWDA 4ECAA 2J5XA 3EQ6A 3I73A 4E6EA 2WTUA 3ZIDA 3ANNA 4G1MB 4MB2A 1AGXA 4BJ1A 4EVSA 4EOGA 1X42A 1T0UA 3M4NA 4XD7D 3L7IA 1I1NA 4TL9A 3LBNA 4IJVA 4X7BA 4CF5A 4N7JA 4EG1A 4Z3OA 1F3OA 4HAUA 2ZRMA 4JAVC 2I03A 3BZUA 4XOIA 5CBKA 2Z98A 3I6YA 1WZCA 1FNNA 2E1RA 2Q29A 3LSYA 5E7MA 3WP1B 1OH6A 1T9CA 2A0XA 1NF3A 1K92A 4DZTA 3VR2A 3HZOA 1JALA 4CN9A 1NV8A 2A2ZA 4RZSA 5DNUA 1ZMXA 3HNPA 5FWAA 3TW0A 3F78A 5G3ZA 2VNIA 5LXTF 4BCDA 1SY7A 2JJYA 4BN4A 3TNJA 1C1DA 4OBWA 4LYHA 1U7UA 3MJEA 4CG1A 3IV9A 1G42A 1OUMA 3KZXA 5BWBA 3RYIB 5B3LA 1XTUA 2ECPA 3PC8C 4OQXA 4JI8B 1G2OA 1S2MA 2GZMA 4NCIA 3NYQA 2FEWB 4QPJC 4LI3X 1NBME 4LK2A 1YB7A 1W0JA 4AULA 2DEUA 2FCRA 4MMXB 5LIPA 3K8YA 1Z2CA 5IH7A 4FJ2A 4WESB 3S8EA 5ESDA 1Z34A 4RD1A 3L92A 1Q6YA 4BE9A 5GIOE 3CF6R 2CZGA 3OEED 1KI3A 2VIIA 3KPJA 1NASA 1SB8A 2NQ8A 4OB8A 1C30B 4EM6A 3DXYA 1CUHA 4IBOA 5D6OA 2X9QA 5E38A 1IQ0A 1GSHA 2C0PA 2ENWA 1Z8FA 2Q2WA 2G7ZA 4KI7A 5FI5A 1FDVA 4FNAA 1K7YA 1P8JA 3GJYA 3KX2A 4WI1A 5GZ1A 1NOJA 3GMSA 3R7FA 1OIVA 3ADDA 1E1NA 4L85A 3EWSA 4XLZA 5ITZB 2NG1A 4KPFC 421PA 1HBJA 1BN6A 5AYVA 1K5HA 4TX1A 2VF4X 1NAHA 2VAVA 2WJ6A 5EG5A 4BVKA 2ORYA 5K0BA 4GOXA 1JFTA 4I36A 2DB3A 1HRDA 2QY6A 1KR2A 4LZZA 2CE7A 3DTVB 1R3DA 1FMCA 3KR2A 4E7PA 4DBZA 3B70A 2GJ9A 5HIKA 3GNQA 1TEHA 2ECFA 2Z57A 4TLLB 4K6CA 1ZJ6A 3OBBA 3KEQA 4LXGA 1KQNA 3LXXA 4FLMA 1D2RA 2GAOA 1H5QA 1F6BA 2WMOB 3OAAD 4KIJA 4NULA 4XTCS 5I9TA 1XYYA 3TS1A 4X84A 4YPVA 4ZCRA 5TE9A 3CNOA 1VGRA 3GFTA 2Q0QA 4YRDA 3WXBA 2LWIA 3U4IA 3L8ZA 4UD6A 3PL1A 4WE3A 1E99A 1UC5B 1GZDA 4NYJR 2HAEA 3OF5A 1HPLA 4TGLA 4YCMA 5LXTA 1Q12A 5KZMB 3FPJA 2PR2A 3EVBA 4EVQA 4BQEA 5FPPA 4E15A 1WLYA 3PD0A 3LQ1A 1M2HA 3DMTA 3ZWKA 2RGRA 1W2HA 4MHSA 4UCFA 3V8NA 4C6SA 1E8MA 2ODNA 3AGPA 1B0PA 2GESA 5A2QA 2XW6A 4TQAA 1LQTA 4C5AA 1MFZA 4ZQEA 3PFHA 4C03A 3DCIA 1X13A 5FTMA 2YFQA 1XMSA 2A1UB 3JASA 1BCSA 5DHPA 3UB3A 2PRYA 1PSWA 3TMAA 3UMFA 4DV1B 4O3MA 1RNLA 2VP4A 2QTZA 3USES 1HLDA 3EEQA 1K3FA 1UK8A 3CSDA 1GZ5A 1FF9A 3B1FA 1LPOA 4FQ5A 5T3YA 3F2IA 5IKEA 3THWB 3D6AA 2CB0A 1CW2B 2QENA 4IZ6A 4ETNA 5I9BA 4GEGA 5J4KA 2FE4A 3AFIA 1QV9A 1IZ7A 2HD4A 1K97A 2CBXA 3DAYA 2XPCA 2E0IA 1CJVC 3GPDG 4QPPA 1R10A 1TFRA 1H94A 2PIDA 1NE7A 4F6RB 3ZHBA 1QP8A 4ZTUB 1U8YA 2IXAA 4OHYA 1J8YF 2K6GA 2ZJ7A 1JWLA 4I5DA 4RPGA 1QH8B 2D7CA 4OEHA 1M1XB 3OPMA 1SH7A 3GRCA 3KL4A 2ZIGA 5H16A 4XD2A 3RKUA 4MRMB 3OQBA 2P3OA 2JGMA 2FP3A 1RLMA 5I7EA 5JPIA 2A84A 1TPYA 1ZW6A 3IQFA 1D9ZA 4BZPA 1QIKA 3PGJA 1LWNA 4OIFA 5DNCA 2ERCA 3KU1A 4JL6A 7AT1A 5HUJA 4KYTA 1FYFA 1TZMA 1NU8A 2ZYIA 3WVNA 1C7ZA 1WP9A 1XZIA 2JRLA 4MUBA 5SICE 4NCHA 2JAQA 3HVIA 4WFIA 1TCVA 2UYHA 1SVWA 2HDWA 3KS9A 1PRYA 1H85A 2X2OA 3OG9A 1M76A 4UMDA 5K0TA 3RBVA 1VJ5A 2YH2A 4PG8A 3BMCA 1I13A 2AH5A 2C3PA 2OLEA 4LUCA 1SPBS 1JBEA 3VMMA 4F2DA 1S2NA 2OQIA 2GJAA 4WN9B 4X92A 1TYDE 4OK3A 1N3BA 4QTUB 4XYGA 2IWRA 1BDHA 1Z0KA 1KPHA 3CWZA 1E7MA 4OFWA 5EZ5A 5H81A 3O6VA 1TJ4A 3F98A 1UPTA 3PFGA 4ZEXA 4EYGA 4ZDJA 5CA0B 1MTZA 5J43A 4GR9A 4L8VA 1EFKA 1OROA 4LJLA 3YASA 4GH5A 1I7LA 1RBZA 3LA6A 4G0MA 4IYJA 5AWFC 2I6GA 1DLJA 2FPUA 4JR2A 2AWNA 2O3SA 2ZRAA 3LIIA 3VR5H 4ER5A 3G7NA 4YBRA 4FFOA 4CLOB 2PAFA 4HZIA 1AHPA 3V8EA 1NBIA 3HYSA 1PV1A 2Y77A 3EZLA 4Q7QA 5JISA 3V97A 3DAHA 4BVEA 2XUFA 5LQNA 1TK3A 1MQ8B 4D97A 4KR6A 3CNBA 3IPAA 3WISA 4ARVA 2OFWA 4X6UA 5LZ8A 1W87A 3GJQA 4G5QA 1R4NA 3ABOB 4Q66C 5FUYA 3SFTA 4CG3A 2IC5A 3PE4A 2OLKA 2C5SA 2W98A 1O89A 3DAGA 3CMMA 4WUTA 1PJBA 2IY9A 3OHPA 2VPZA 3TTYA 3FA2A 3L1IA 3THYA 2PQ6A 1XU9A 1UF9A 3I1YA 2AW5A 4QGHA 4WCFA 4X0EA 5F73A 2C5FA 4JYMA 4LPKA 1F8XA 1O57A 2OFXA 5DE3A 3SYKA 3TTWA 4NPAA 3ZV3A 4L4UA 3EIXA 1CZOA 1JHZA 2PX2A 2V7QD 2AKEA 4B33A 4JJAA 2BJWA 3ZGOA 4C7BA 1J00A 4B7UA 2JG3A 3OUZA 3TJZA 3W8RA 1U2QA 2Z5FA 1JFVA 1RC1A 1ODJA 2V0NA 4MGYR 4NZYA 1V3QE 3FTNA 1MOSA 4WASA 3M5WA 5FRDA 3RS0A 2L19A 2QROA 3ZW7A 3WQSB 1J2EA 2UYQA 4HNVA 3DZJA 3BIXA 2ID7A 5HJ7A 2CXXA 3PITA 1UFQA 2L0XA 2QE7A 3DBLA 5FTWA 2QM3A 3HKEA 3OCYA 3TBHA 2W2OA 4ECEA 4BOYA 4RL4A 4EPWA 4KQKA 1O8CA 5DBEX 2O3TA 4BLUA 4G23A 4DREA 1EUDA 5AXAA 1UXGA 2Q9BA 2IHBA 4D82A 1PJ4A 4PLFA 4QJ5A 3DT6A 1ETUA 4QUKA 2D7DA 4Z53A 3F7OA 2BBSA 1L9KA 5TF4A 2IP2A 2GN9A 4OGWA 3WYGA 1WXQA 3HU3A 1Z6GA 4D9EA 3REOA 4DBVO 1T2NA 3GZJA 4EA7A 1TMKA 4DB2A 4ZEMA 5HK8A 1M74A 4JEMA 5AOCA 4QFBA 4GC9A 1OLXB 3CLTC 3RVBA 1F2UB 2YWXA 5CLLA 5D51S 4I1IA 5LBTA 5C7OO 1RFGE 3ZDYB 3K0BA 5EXXA 2AX3A 3IMKA 4YJHA 3M8KA 3RUIA 2X4GA 1D6JA 3ECSA 4KGZA 4Y2GA 3GROA 3BXFA 2ZITA 2EBFX 2Q1WA 4L4ZA 3AR4A 3HH8A 4BWGA 3HDHA 2I9KA 3DM5A 2XQJA 8ADHA 1JDJA 2FSIA 3Q3JB 1R5BA 4ZQIA 4YXFA 1E1RA 2BPOA 1X7XA 5EVCA 2PS0A 3LA8A 4MYSA 1KDYA 2GZSA 1LRJA 4C0JA 1PI3A 2GUGA 1LJLA 2QLTA 1B3RA 5JLJA 2AEMA 2EX0A 3RVDA 5J40A 2GXQA 2BGNA 1YQEA 4BNWA 5JSQA 2VYVA 1ZCAA 2BGIA 3LFTA 5TQ0A 3NG1A 4GSYA 3R9XA 2PPVA 4WNAB 5LD2B 1EMDA 4YMUA 4NR0A 3I4FA 1K2WA 2A30A 4E5PA 1CY4A 1UDWA 3H13A 1X7GA 2VT6A 5CBPA 4MVXA 1YZTA 4MS4B 1XHEA 2Z4RA 3BTUA 5I9IA 3G5LA 1CUCA 1PGOA 1YDGA 2Q6KA 1XD2A 3HKBA 5DULA 4N76A 5K6TA 4EB8A 1WPRA 2FHPA 4R3WA 2QLLA 4LDJA 1S96A 3BXEA 4K9MA 4UAVA 4XQ9A 3VZQA 3ZWPA 4XJVA 1N6IA 3E05A 1HQYE 3IEIA 3HU2A 3G79A 3FPHA 5DO9A 4YR9A 3ITEA 3CLKA 2GFQA 2QP9X 3MWJA 2JHGA 3A9RA 5I45A 5AI4A 1DV1A 1I4WA 1LY1A 4DQ0A 1CF2O 2QD4A 4LF4B 4K2AA 4HLUC 2HF9A 1YCDA 3PCRB 3PNVA 4W6QA 1E94E 4D46A 2ATCA 4OA5A 5H3LA 2AN4A 3BK1A 1BG6A 1QIDA 2RONA 3RIEA 4MP6A 3RFXA 1DWQA 5CLHA 1FSGA 2Z9CA 2BGJA 2RCNA 1H8HA 4PGFA 3WMWA 1WXHA 4BKOA 4DIKA 5LUAA 2YR0A 1Y5IA 1IHPA 1BAPA 1SXIA 4WKCA 1MGPA 4B73A 1UPBA 3KPWA 4ZT6A 4DLTA 4BMNA 1D4OA 2FDRA 3UHOA 1TDJA 4YT2A 2DFDA 4AL4A 2QNRA 4JVMA 5JNTA 1PS9A 3FTFA 4RULA 1RQGA 5DXFA 4DUGA 2FY8A 3QPWA 4L3VA 1J99A 2IPAB 2XOXA 1Z8HA 3DZFA 1QWSA 2PFSA 4G0QA 5FTKA 4PN3A 4GKJB 2ZPAA 1PJLA 3PPYA 1THZA 1H0KA 2MSNA 1GYRA 2VJPA 3L1JA 5JATA 3AR7A 1WW8A 2GK4A 2REOA 3NGMA 4JQYA 4KPGA 2A5YB 3FNHA 4IVPA 3TW8A 2E87A 2W71A 5A7FA 2RHHA 4HLDA 1OC4A 1J1ZA 1FDIA 2CVQA 1DQYA 3HA2A 4HBGA 5KINB 1H0RA 1L7QA 2AE2A 1S8OA 3WGYA 2PWBA 1Z4LA 4FKZA 1RPAA 3AHGA 5GONB 2VK1A 2FI1A 3H2BA 4PE5B 2H2IA 2PQ2A 2QDKA 4BMYA 2QVXX 4MZDA 4QQKA 3SZMA 5GGYA 5T6MA 3WAKA 4IEFB 1M34E 4EJ2A 4ARZB 3ZGVA 2K7ZA 2F55A 1CR1A 1U6IA 2R6JA 3RYHA 1XCGB 5C31A 3DEHA 4O4LF 4DDHA 5IH3A 4I5GA 3GLFA 4K0KB 1SCUB 4FT2A 4UASA 4RADA 2RC5A 5IYZF 5IAAA 3KLPX 1ZQ1A 4Z6KA 1E9BA 1MH1A 2XGMA 3MJ4A 1T9KA 1R9GA 2HA5A 4CR7A 3JQBC 1CQIA 1JZTA 4ZCTA 2J3JA 2XQFA 1WDTA 4OHOA 2IUYA 4PEVA 2HWKA 3Q7IA 1WMEA 4C89A 3FZGA 2JLQA 2C4UA 1K4MA 3G9UA 4NS1A 5DTQA 5FPKA 3CVXA 4CFYA 4YJGA 1MAAA 2O7NA 2KW5A 4YECA 5BSMA 1P2FA 1NXVA 3A9WA 3FUUA 3NHSA 5TGTA 1ES9A 1EDEA 1XN4A 2WC1A 3HYRA 1I5OA 1MDFA 4IUBS 5AHKA 1XLUA 5F9FA 4LYGA 3AUAA 2GF9A 4IICA 1U2SA 3X2EA 3ZWNA 5AW7A 3UBTA 5F1YA 2VQ3A 4J1TA 3V3KA 1L5MA 4KIGA 4W7IA 4UHBA 5GOZA 2RHWA 5KVSA 2OECA 4H4EA 4ZRMA 4EX6A 4ZYYA 4LZAA 3WZ2A 1GVHA 3EG9B 3U7JA 1VL2A 1KOGA 4F5DA 2QTWB 1X1TA 1KHHA 5SZJA 4D6XA 1K6MA 1OXSC 2QRVB 5TY0A 2WINI 2YXEA 2ZIXB 3DYVA 3M5CA 3KZ1E 1LK0A 5J2UB 1R18A 3ES9A 2B3DA 2DULA 3D6NB 3HABA 8ABPA 1C9YA 3NFYA 2NAFA 3NBAA 2LKCA 1SU7A 1YS7A 1P0PA 4CF6A 4MIOA 3FOFC 1GM5A 2RB4A 4L6CA 3WIEA 5KKNB 1SCUA 1U9JA 4RK0A 4EUSA 3IKMB 4BX3A 1B76A 2C96A 3LLVA 3VPFA 4CWAA 4A1FA 1VE7A 5HBGA 1Z2DA 1P2GA 1UKCA 2V65A 2VBIA 4TT3D 4IIDA 3WWEA 1Y7LA 1C8KA 1NRJB 4AUMA 3O1IC 3AONB 1R1DA 1XROA 3DVAB 1JFFA 5T4BA 4P08A 3SYRA 2HADA 5JHHB 1XYGA 5ILOA 2A78A 3UJ6A 2XOKA 4LI0A 3HCRA 3L8HA 2PBZA 2Q3MA 3AU9A 4KQIA 5IM5A 4K9DA 4MI9A 2GN1A 2GBLC 4PAMA 2C98A 3V6LA 2VJBA 3IAM6 3RT7A 1ZVKA 5F78A 1THGA 5AKEA 3W5JA 5EEHA 1LU9A 2XRYA 3CLUC 3GUHA 4TXHA 5CYFA 4AIIA 4LFAB 2PUHA 2WDZA 1QGED 1GHTA 1IEVA 2F90A 3HCNA 3IDZA 5TS3A 2R6HA 5JXJA 1NX6A 2D1QA 2I55A 3HR7A 4JLKA 4WN3A 5DLEA 1Z9BA 4BNUA 1OFIA 2JLUA 1Q2UA 3B5JA 3FOEC 1FPQA 3QXHA 4QM7A 2Q5EA 4EAAA 3SXJA 1JIXA 1HDOA 1CUDA 2IDZA 3JQEA 2JVKA 1DRWA 4HNGA 1L5OA 3R76A 2AG1A 4GG1A 2CVFA 1VIAA 2YJZA 4H1WA 5KO2A 1UWVA 3LI2A 1Y89A 1H8EA 3Q7RA 1U9ZA 3HY3A 4ZVMA 4Z4CA 3MWLA 1ZK4A 5JW6A 2XTAA 5AKJA 4I1UA 4QASA 2B4KA 4CF4A 5CDUA 1PJ8A 2VZ8A 2O5VA 3PZRA 4LMRA 4HAOA 1A8HA 2Q28A 1X7HA 1TW2A 2B20A 1WTAA 4L78A 4U63A 5F3WB 3RRBA 2G5PA 4B3MB 2R48A 1X7ZA 1X1QA 2R60A 4QZVA 2IYYA 4EI2A 1N57A 4B2YA 3UV7A 3FFWA 1SWWA 3KHSA 4E5KA 2XXJA 4FOSA 3UZUA 3GOHA 5JECA 5KOYA 4WW0A 2AXEA 2F1HA 3B1ZA 3HCOA 3R74A 4BEJA 1TA4A 3EJWA 3MAAC 2FW9A 2IHYA 4I4NA 5BSEA 1TF2A 3GFOA 3ASZA 3BHJA 1JPVA 3KT0A 1LFAA 1VDZA 3OA2A 4PC6A 3F9CA 3AF6A 3Q2KA 2HH9A 2JI7A 4ANFA 1BN7A 2CZQA 2O6LA 3CUKA 4HH1A 1BGXT 1ZUD1 2F8TA 4JP3A 4GKKB 2G76A 3L0SA 3Q3IA 4G0OA 1DIBA 3VJKA 1M6EX 3CRZA 3ZQKA 3ND9A 3ETJA 1WMAA 4GQBA 5B1HA 4BGDA 5HUHA 3AHIA 1WMBA 4KX5A 4YAFA 2JEZA 2XYVA 3ZLTA 2I2WA 4G0UA 3FHTA 2PU7A 4K6MA 1NVFA 3CJRA 3W77A 1T2FA 2HNAA 5F4BA 3B1XA 1BWQA 3VHQA 3VOTA 4HN2A 1NW7A 3ZI7A 4C4XA 1NJ1A 5CD9A 5EQJB 5IWAB 3QEBZ 2W9XA 2BM1A 1HDZA 4RSMA 3ST7A 1P17A 2IYSA 4PR3A 5L95A 1ENZA 2WVGA 1Z0JA 1FDSA 2VG8A 4KGDA 4QNNA 3ESRA 4ZIRB 4YXWD 1SXQA 4LAFA 2JD1A 2X0DA 4YGXB 1OW3B 1R4ZA 3K1YA 5EJ4A 1Z37A 4AKTA 3FH0A 3ZK7A 5TGDA 3FFBA 1Z2PX 4I9UA 2CL6X 4KQWA 5IDYA 4S1VA 4I50B 3I62A 1N0HA 2A5LA 2UUPA 2ZDQA 3DCJA 3RJTA 5DI3A 2XZDA 1KAHA 2WT8A 2YBDA 3HO6A 4R1MA 4ZVUA 1G8KA 4V03A 1YMQA 4KMRA 3D64A 4R1LA 3U09A 1JVNA 4Z1OA 1JQ5A 3B6KA 1R9JA 1SB9A 5IAKA 5BQPA 1G5PA 1BFDA 2GBPA 2YMMA 3GFVA 3IBFA 1NGSA 3LG2A 1FBTA 2ZRFA 3AVWA 4WBXC 1FRNA 1C29B 2C3UA 1OGIA 1W0KA 1XNJA 3D8NA 2QVCA 4OQPA 5ECYA 3X2FA 1BOFA 4CM7A 1A2QA 3H5IA 2GAJA 5FR2A 5K8UA 2OBBA 5FA5A 4MPTA 2C92A 4CL2A 2KX7A 2WU4A 3SU8A 1SXHA 4RY2A 1ORHA 1OZ0A 3QMWA 1EG2A 1KOJA 1PFGA 3AJEA 2A9VA 3VU9B 4AYXA 3NLLA 3SLGA 4BZZA 2GEBA 5EP1A 2NSDA 2D5CA 2ETVA 1C1XA 3A3OA 2HGSA 4I4TB 2DHEA 3B1VA 2X3YA 4IJWA 4MQFB 4IY1A 4EMBA 4LHWA 2XMPA 1C80A 4DT1A 4K46A 1QGUA 3UHAA 1TAHA 3QLUC 3T7AA 3DAPA 4KYVA 3RIGA 4G5FA 2P41A 4P3NA 4RKQA 3WDKA 2ORIA 2ROQA 4RXMA 3VSCA 3N5CA 1KR5A 1O94A 2M9MA 4LDQA 4TKLA 1BD3A 4KJZA 3EOBI 4UNPA 1X8KA 4NYIQ 4ZDKA 4CMBA 1ZVVA 5IVIA 2CHVA 1JHVA 3B6EA 3GLRA 4ML3A 2CXPA 4EG4A 4JBXA 2QZ4A 4IHAA 5E4FA 2DZDA 1V2GA 3IOBA 3BS4A 3X1DA 2GEVA 4D6PA 4H35A 4AN1A 1LTQA 2Q4DA 5FNVB 4ABYA 2R8XA 4KR7A 1IJKA 5HVNA 1KP2A 1PWEA 2GASA 1NA5A 2BMAA 3FI0A 1VOTA 2PX3A 2W2QA 1MOZA 1WKCA 3BJIC 3LUKA 4GIBA 3K5WA 4NAVA 4ALNA 2J7PA 1Q0SA 1Y4DE 1GPWB 1QIMA 2BIFA 1KORA 2ODQA 3UFXB 2ODEA 2AI3A 1CZNA 1RMYA 1QTQA 3AHDA 3NDIA 2R8PA 1CULC 1KVTA 1PZXA 3G23A 4WACA 1IPEA 5H83A 4ZODA 4ZO9A 3RR2A 2OZLA 3FTCA 1KAGA 4NTZA 4JYAB 2JS7A 4WK6A 3W4KA 4PFJA 2OBXA 3KKLA 3QVUA 2E82A 5CTAA 1YF3A 4QOEA 5FADA 1U0FA 1DELA 2WWIA 4YJ3A 5CXXA 3I61A 3VRHA 1SHJA 1OB5A 5IHPA 2C9YA 3WGOA 3V7WA 3HNOA 1SD1A 1ONSA 2NU6A 4EB6B 5J1SB 1G38A 1Q3TA 1BX0A 1ICEA 1YA4A 3SYLA 2WF9A 5EZQA 4HWPA 5EN4A 3UCFA 2LD4A 1DP4A 2KSQA 3WNBA 1BCRA 4BQPA 4BVGA 2WU0A 5A5VA 3ENKA 3TD2A 4AWAA 1DGQA 1SZDA 3SR4A 5CFLA 5DLPA 1QB7A 2G04A 1X3LA 2GILA 1E5LA 2VSNA 3TRFA 5HRUA 1BWPA 1TD9A 3BMQA 4PTLA 3CS3A 2QTVA 1HSZA 2ZBGA 3PC3A 3RJMA 3WYCA 1NNEA 4TUYF 2HLDD 1QR6A 4OAOA 1OE0A 1EK6A 3OX2A 3MT7A 3L7KA 1C7QA 1N9GA 4CLEA 3LW7A 1KK3A 1X74A 3D0OA 3E9QA 2VBGA 4QEZA 1XRJA 4JLJA 3KVOA 3L79A 4XW2A 3KJHA 4Q9LA 4M1YA 2QRGA 3GPCA 1K4YA 3V46A 1LNQA 2HM7A 1CY6A 1RYNA 3FE2A 1UXOA 4AZ0B 1FTYA 2O52A 2PT7A 3GJRA 4IJMA 1VG8A 4M88A 3MBKA 3T3HA 3KSAC 2E55A 1QPZA 3OWOA 5BUQA 4UMEA 3V8BA 4R1SA 3QU4A 2AG8A 4IOMA 3IPCA 4MRVA 5SV2A 2JLRA 2IQIA 2I7VA 5EI5A 1ESCA 1XTBA 3A6EA 1C7RA 3ODGA 4TROA 1EM6A 2JB9A 1L8QA 2I0FA 4IJUA 1J2TA 3OY2A 1KI8A 4PZZA 3ZU5A 3AERB 3AG6A 1VCHA 7GPBA 4RTPA 3MJFA 3OLZA 4ON9A 3L6EA 2Z83A 3OFKA 3SIPA 4F11A 3I37X 1A88A 1IEXA 1AKUA 3H4MA 3QNUA 4O8CA 1UBGA 3Q3GE 4MOWA 4EO4A 1R9NA 1KA9H 3HA5A 4LNHA 4Q3EA 4WOCA 3RWBA 4MS4A 3ICPA 3WGUA 5LQRA 4E31A 3THYB 1MO4A 1EUQA 3PTAA 2G3YA 4HAZA 4WNIA 3LV8A 2NVWA 4QELA 3RRMA 4ERNA 5JFOA 3OM8A 3FPEA 1CEEA 3D0QA 5IABA 1RPTA 4YV2A 1JH8A 5DTRA 3LF1A 4QQNA 3MXOA 3AF2A 4G26A 5G1NA 4JENA 4OGLA 3HCWA 3ZWCA 4KPUA 1P4GA 2IH4A 3BHIA 3K09A 4OLAA 4TXLA 1XLVA 2V6BA 2Y92A 2PCJA 3PYLA 4K9QA 2XEXA 1T0PA 2FFRA 3LWDA 1AT1A 3B12A 1ORDA 3G1UA 3KKOA 4R01A 2D1FA 1LQ2A 2ATEA 2NUTA 3P0FA 2DTXA 3VHXB 3RC9A 4BTEA 5ARBA 2I22A 4HR7A 4Y6PA 5CB8A 3SDSA 3I2JA 1XXLA 3O4FA 5IKOA 3QW4B 4QWWA 3VSBA 5JZSA 4TRNA 1Q22A 5A9SB 2FX3A 4LWQA 3OJEA 3FOCA 3QYJA 4N0DA 2NU8A 2BDEA 2XUDA 1UAGA 3SSNA 1V37A 3WLFA 1Q0RA 4ZJYA 4A9AA 5AVZA 4A15A 5CDGA 2V4ZA 2VJCA 1W47A 5AOVA 2WI8A 4HZGA 3AY3A 3C16C 3V4PB 1YH3A 1OLOA 4NH0A 3EQZA 3OQIA 1RI2A 2HWXA 2YFHA 1N78A 2Q4TA 4MW9A 5ECWA 3I9LA 1FRZA 4BGEA 5J4HA 4BFUA 3LS2A 3PNYA 5KYYA 3M70A 3T7IA 4FDTA 4AX8A 4OHZA 3R7WA 2FWRA 3GY0A 4HX9A 4LBZA 4UU7A 4RTLA 5K8IA 3PEUA 1F7UA 4OL9A 2GHTA 1JG2A 2YHBA 4ZFNA 5I7WA 2PMCA 2ZT5A 3AWIA 4AZTA 2HA4A 4PBTA 5CBPB 1IBCA 2Z8ZA 5FUQA 5IN4A 1R0WA 5JHGB 2QYTA 4ZOQI 3CLSD 1UFRA 4MV5A 2R9VA 3MGKA 4Q4AA 3RANA 1OZAA 3DNFA 4L9SA 3MUFA 1AUXA 5AI5A 1F60A 2QQGA 4J90A 4QIHA 3QPBA 3N3AC 1B6TA 4B8WA 3SMQA 1W49A 4HGNA 2IXFA 3SS8A 1Y8CA 1Y5RA 5F51A 3DCNA 1J09A 3C24A 1ZJ5A 1BXRA 2PSDA 3AP1A 4L02A 1B6RA 1HRKA 2NW6A 2W37A 2D59A 1HG0A 4DGSA 3TQCA 2LCIA 1TAGA 3MPUA 3T3OA 4MK4A 1BOOA 3BH0A 5GM1A 5BWLA 3RSQA 2BJHA 5JALA 1XZMA 2XKKA 2DQSA 1SBNE 4G97A 4W7HA 3OZIA 2RKWA 3L7BA 3QPDA 1F4PA 1PL7A 3MJHA 3LUPA 4LEIA 5IBQA 4L4RA 2QZZA 1PL8A 3WRWA 3ZDAA 4BNIA 4CM9A 1W25A 1YSCA 4MYDA 2PMBA 4O4HB 2ZUDA 4LOAA 5J5CA 4YY3B 2X9GA 4IFIA 4BZWA 4C2UA 1CFZA 2W8BB 3Q85A 4UMFA 3BXXA 1VZ2A 4AS1A 4OLBA 1Y6ZA 1AUVA 1KDOA 3K1TA 4XFJA 3HJHA 3TKYA 2XCIA 5JANA 2HDNB 4YS6A 4IMRA 4DA6A 3SC2B 4ZEOA 4DQKA 3T3EA 1ZUNB 3UY4A 4E03A 2WF6A 4RHYA 1VLQA 4O8ZA 2Y3IA 4IGKA 1AUOA 2VJMA 2EIXA 2PUBA 5EVJA 3BFJA 1EDDA 1KJJA 5ECDA 2O6HA 3NP9A 1GG2A 4BZXA 1MB2A 3I6IA 1FYWA 1H1TA 3AJDA 4M53A 5IEJA 4OQDA 2GPYA 5C0OE 4BNYA 3INNA 4JLVA 3L6DA 4L0DA 5TARA 4YONB 4TZ0A 4YPFA 1HYQA 1M0TA 2OCXA 4L27A 4YRNA 3FWKA 1WDLA 2GN2A 2OTCA 4BPBA 3T38A 1WA5A 4ARCA 2JFXA 2C9DA 2XUGA 4W5RA 1NVWQ 1ECJA 3WMFA 2YFYA 4OMFG 4WEOA 5J4YA 3W5BA 1W73A 2O23A 3HWRA 2HRQA 2WSSA 1QBKC 5JTUA 4IXMA 1VRVA 4UBJA 3BULA 5A0TA 4ZXPA 4BFZA 2INGX 5AVTA 3DDHA 1PR3A 1KYWA 4BLTA 2H48A 1J97A 1YRLA 4WX2B 1G9XA 3D4LA 4YIKA 2NU6B 2QX9A 3FRJA 3WHLA 5CFRA 2C42A 1KK1A 3DVRX 4MRMA 4ZT4A 1E9AA 1TCAA 3LLSA 2DLCX 2QU8A 1JAIA 5I4CA 1U5AA 2C29D 3LX5A 4WLVA 3ISJA 5JAZA 3UM9A 3OFJA 4B79A 2VP2A 3GLVA 1XWWA 3NTRA 2JA2A 1GKYA 3E18A 3RAPR 4GMKA 3FKJA 3M9XA 4HWGA 3K1AB 5IT5A 5LB4A 4MDEA 4Y0AA 1WIWA 3G6KA 1JFRA 1VFPA 2BFBB 3ETGA 3OU2A 5EA2A 2VJDA 4BAZA 4BNFA 4EWLA 3AB8A 2CDRA 1YHZA 3QVTA 4YA6A 4UOEA 4LGCA 4N5HX 4CIDA 1RQ2A 1ZD2P 4PSDA 2GM3A 5KYXB 1CR0A 4E4YA 4R31A 3GCDA 4MGIR 7MDHA 5JFGA 3NAZA 3T5AA 1FP7A 5COBA 5JH7A 1BQ4A 3FZQA 3U3JA 4DT1B 1LA2A 2OBNA 1BDMA 3QNMA 1CUIA 4MHTA 4UTRA 3EA4A 2NSLA 3LY5A 1CVRA 5TNXA 9LDTA 1IZYA 1FB5A 1ORTA 2GPWA 2RBEA 4WCVA 2IWHA 1CZLA 4J76A 4TZ6A 4H7HA 4G3XA 1DKUA 2G6TA 821PA 4P7FA 3NEPX 1K0UA 2BE7A 4JJZA 4HADA 3WRYC 1T36A 3DOOA 5JSUA 1E0DA 2CEAA 2JCSA 4RO0A 1KO8A 1ZI8A 2GM5A 1UJ5A 1UQRA 3LVQE 1W4BA 2FLKA 3VKHA 3DTTA 1JW9B 4H1HA 3IEUA 2ICAA 2EFYA 5E95A 4B8YA 4ETIA 4QRHA 5DPMA 1PAUA 1XVTA 5K6AA 5L3ZA 4LY3A 3H87A 1RFLA 4HATA 2PR7A 2GVDC 1GGFA 2JHAA 2QRLA 2KPOA 3E84A 1CYEA 1NM5A 1UM9A 4F71A 3RG2A 1A72A 4YBZA 2FSHA 2HV9A 3ZHSA 2HZ7A 2FZCA 5HHTA 3E9EA 1KAQA 2QQ0A 4LDRA 2CV2A 1V5WA 1Z25A 1H65A 2BFCA 2VAXA 2XX3A 4RJLA 3DV2A 3WK7A 1ZSYA 3OQMA 3I2IA 1CR6A 4XEHA 1YFLA 1WP4A 3TW6A 4CQMA 1SVKA 3EDCA 1Y98A 4WKBA 5CK5A 3DD1A 1HMPA 1E4YA 4ZN6A 3P96A 3UNXA 1TM7E 2BUBA 4TYQA 1GGNA 2I65A 4Y2RA 4TKVB 1UEIA 1SA0A 2QM8A 5EKSA 1CJCA 3NBMA 1IULA 2DUJA 5HK9A 3FWZA 2ZB2A 4M9RA 5DYGA 5LLDA 1XZKA 3QLVC 4BNVA 1I1HA 1NMQA 2ZZKA 1NQOA 2QLNA 1N1EA 3FPSA 3PNSA 5DK4A 1SKYB 4MROA 5BN3A 2WU1A 3PUYA 1QCDA 2X1HA 1T9GR 1QZTA 2GXUA 2QW8A 3WGIA 3MB5A 3ZNNA 3AVQA 5L8VA 1PYDA 2FMUA 2JFWA 2XA1A 2O1EA 4B3SB 2O4UX 1CJSA 4HPWA 4I46A 5EWMB 2DQZA 3G2LA 5AOAA 3RFTA 5B3JA 1DUSA 4ZZ0A 3WRXC 2YOHA 3HXPA 4HJXA 3WL5A 4OVKA 4ZOLF 1WQ4A 4ZO7A 3QOWA 2HCTA 1OMOA 3WQHA 4IZOA 3RS5A 1C9DB 3OF2A 4JLAA 3OZRA 2Z1DA 4C7OA 1PJAA 1Z29A 5HKLA 1XKQA 5BQOA 3RU9A 5AUNB 1ID8A 3ZJTA 1EQ2A 2XI4A 3I9JA 3C3AA 4MR7A 2TMDA 3A06A 5BNFA 1GQSA 2YV4A 1GAWA 3GELA 4OBEA 4IMPA 4Q7MB 3UBMA 4E3WA 1HFKA 1QO7A 4EQ6B 2OESA 3DHEA 1NLYA 3U1VA 4G8JA 1AQ6A 1J20A 1UCFA 4EG5A 1JEYB 2W0SA 1CQXA 3C8UA 2D1YA 3X0DA 2XYPA 1P3DA 2FN9A 2YMPA 5ALMA 4RTRA 1J24A 2BMFA 4H4DA 1YRAA 3PWZA 4R6XA 5JD4A 2L18A 3LK7A 4TZKA 2CDAA 1FMFA 2IYEA 3RVOA 4ZAGA 1LJUA 1Z8NA 4FI3C 1PJTA 3LCUA 5F23A 1JN0A 2QMZA 5CH5A 4TV9F 2M6SA 2WM2A 4B5KA 5KMGB 5KTNA 1HX7A 1FDWA 4GM0A 1OX5A 1VSQA 2QKYA 1XTIA 2I87A 4UBIA 4WZAA 1HG1A 3A26A 2P6NA 3FUTA 3UWPA 2O19A 9MHTA 3DFIA 1KI1A 1MC5A 3P2IA 1R8QA 4GR4A 4O2BA 1PFQA 1E7YA 4I5IA 5BN1A 2GFHA 2ZE7A 1WUTA 4IRMA 4WZ6A 5FBLB 1LS1A 2BL4A 5CB4A 4BMCA 5AW8A 5LA6B 2P62A 1VP9A 1WM1A 1IOVA 4N65A 2BGKA 2EW1A 3BL6A 3AILA 3K1JA 4EBFA 3VHLB 3T1QA 4EABA 2HB6A 4R9SA 3TQQA 4Z7JA 1A8PA 4N5NA 2Y4NA 1A0OA 2JAWA 2R1VB 2PD4A 2VHWA 4BU0A 1BE0A 2P2ZA 2YINC 3TLGB 3K4PA 2DR0A 4J7XA 4XWAA 1OQAA 5CFOA 3N7UA 2Q99A 1GZUA 1OX4B 2Q1SA 3LHKA 5I48A 3WR5A 1ENPA 3HYTA 5C3UA 3VTZA 3ZVLA 4NATA 4AP5A 3WKCA 5LYJF 2JJQA 5EOVA 4XQGA 2DHCA 4ZAYA 3RS3A 4YRMA 2IVFA 3MWEB 4OUDA 3VR6H 5TX7A 2XE4A 2C5GA 3OKFA 3HEBA 5CHYA 7REQA 3ZY4A 5DWDA 2VYND 5TPZA 2ONZA 1RDFA 1AQYA 1BD4A 1YWGO 3NTOA 2XMZA 2W6JA 4IIJF 1AX9A 1O54A 2FP4A 3HRIA 4K88A 1LVUA 4KWHA 4OHBA 4YUVA 1M2VA 1VB5A 4JJ4A 2LKDA 4PLZA 4IDBA 3M9LA 4UNRA 2B98A 2HJHA 1QQAA 2XGJA 1E3IA 1KH3A 3ENZA 5DBFA 2GQ0A 1V7QA 1RWXA 2WLTA 4P31A 3IXLA 2EL7A 4Z99A 2XTNA 5IK2D 4UUQA 2BV3A 1OXVA 1SG0A 2PXXA 5DJ5A 5T67A 1SUDA 3U3XA 3OX3A 4XCVA 3QX8A 3PR2B 4YT5A 3NALA 2V3CC 2QY9A 5JSZB 1U6KA 2W0MA 1BXKA 1VBMA 4ZVOA 3ROEA 2O8FB 2X5OA 3NRJA 1VE1A 4MJ7A 3H11A 1LQUA 4PIVA 2MINB 4HCJA 4XGNA 4LFCB 3SKVA 4CKEA 3FR7A 3QQPA 4KTVE 4DN6A 5EPEA 2DX7A 4FMCB 4YUYA 1CX9B 2TMGA 3KBOA 4XDYA 3JV7A 5J2TA 1U5BB 4AMZA 4EKGA 5AM3A 2XSZA 3C8DA 3FZNA 1FNSA 5G40A 2NADA 3K71B 5HA5A 5JJLA 3PYMA 2F3RA 2WUVA 4YROA 2I4TA 4ENSA 1K27A 5KYXA 1KSGA 1IHXA 3TTVA 2FGJA 2B0JA 2DPLA 2JEOA 5H68A 1H5UA 4OQ4A 1ZGGA 4YDQA 3MB8A 1TADA 4E13A 2Y76A 5CT5A 2RI6A 2HU8A 2P9JA 1GPKA 1L5HB 2NGRA 2B9VA 3DEIA 4DA8A 1UIRA 2DT5A 4CGZA 2R5NA 2ZKLA 1T8SA 3KKEA 3N8IA 4D81A 3EGDB 3K5PA 2WW8A 4NL4H 1GT91 1YU6A 1UEJA 4R5MA 4UE6A 1NKTA 4NZ9A 3SQWA 1KO4A 1LLQA 2NV0A 3O8BA 1EWRA 1AZLA 2UAGA 3CB2A 3HKCA 3EBOA 3JQ9A 3VKGA 4C0SA 4KXYA 3ZJUA 1DWOA 2QAGB 3C14C 3NU1A 3QG5A 3KPUA 4XI9A 5HMMA 3TRHA 2JIZD 1RAIA 2EFGA 3GDHA 1Q92A 2I4NA 2P2YA 1L7VC 3HDQA 3AYXB 4G6ZA 4URHA 1A9PA 4WZZA 1Q7GA 3RAGA 3RM3A 1OFTA 5BVHA 4C5BA 3BN3A 1F20A 4L0CA 1UMCA 1GFZA 3EN0A 1R7RA 4JUAA 3OVMA 4FR2A 3C85A 3FGNA 3LHDA 3ZTTA 3DYIA 2YVUA 4ADSG 3L0YA 5PNTA 2GEUA 3ITKA 2QRNA 3QPVA 4FX2A 3ZGYA 4ZQHA 2WSYB 5BWNA 4K9PA 4N48A 2Q3LA 2A4KA 1L6IA 3BTVA 2ZBEA 1V5FA 2H0AA 5B53A 2NM0A 3NHUA 2WF5A 1RE1A 3TPFA 2XTMA 3BOSA 5TLSA 2A58A 3BJZA 1QC5B 2VNAA 1MENA 3GDFA 2RHCA 3W06A 1QS0B 5ETJA 4Q1CA 3UKOA 1SCJA 3PLNA 5KNDA 3U5ZB 1IYZA 3I2YX 4OI2A 4U00A 3W2FA 1UBNA 2AOUA 1OAAA 4OX9Y 2FNAA 3R20A 3FGOA 1YGPA 4TVKA 2VCEA 3DXFA 5GV8A 2P8JA 4H18A 1FS5A 4KRFA 3ZS8A 2FRDC 3KETA 1II8A 2J3KA 3IAAA 1NJFA 3IJRA 3H2JA 1VJGA 4EUHA 5EJ5A 4R2HA 4OU4A 3AEZA 5T4FA 1GYQA 3UC5A 2XDQA 2QUAA 2HUPA 2JARA 3DE1X 2QXTA 1NJ6A 2P3QA 3W8FA 3IAS6 1E4EA 3KQNA 3LC1O 4D8YA 1CUZA 1RXYA 4R1OA 3E4CA 4DAEA 1UPCA 1ISGA 2Q4EA 2VF2A 2RGUA 4A92A 3BWMA 1UADA 2B4QA 2E4YA 3MBOA 2HI0A 1JXQA 1BHJA 3RO7A 4QAQA 3SOZA 3O9MA 4BUCA 1G5HA 4DRXA 4J16C 4CG2A 3R8CA 1P2SA 5ERGB 4TWRA 5HIAA 3EIOA 2AYYA 1MEJA 4MV7A 2YWCA 1RWNA 2GCIA 2Q5QA 2ZEJA 2DBVO 2V0CA 3KUCA 4EI8A 3W3AH 2ZAYA 5CLJA 5IJAA 4RUKA 1RPJA 4RSHA 1SKQA 4TM7A 4Q9IA 4KBYA 5ARDA 5JC8A 5E3HA 3ZDXB 3L40A 4MR8A 2P6MA 4K26A 1LC3A 4MLZA 5E2IA 1U7DA 1PG0A 1R5NA 1Y3IA 4NYJQ 4M7OA 4YT4A 1U8EA 3FB4A 5ALOA 1T3TA 1M2KA 1YHNA 3DMHA 2VYCA 3L93A 1YE5A 3CBGA 4D3FA 2XOKD 3LAWA 3PWSA 3ZV6A 3GJ4A 4ETMA 2R3SA 1U0RA 1U98A 2QUBA 3FPGA 5HMLA 1KEWA 5HM6A 4F5EA 1WABA 2D3TA 4IDOA 2D4HA 3N74A 1YE8A 3CRQA 2QRJA 2A1TS 1O96A 1SKYE 3PYXA 4PWYA 3SOPA 3QM1A 1JDSA 1AB6A 2VBCA 1WCWA 4C4SA 1CIPA 2J1LA 1MA0A 2WHPB 4IDQA 4RFSA 3PQCA 5EE3A 3WLSA 3DTYA 4DCMA 3IIKA 4ENQA 4KK3A 2ANBA 1Y1RA 2ZUBA 3QKSB 1NXTA 4H9GA 1G21A 3UV3A 1GWNA 3I6ZA 4KLZA 4NWIA 3OH8A 4MUGA 1TTQB 4Q15A 3Q98A 1DFIA 1U8CB 1RM5A 4AO6A 5KWEA 1M66A 3OQ1A 5AM0A 1A82A 2XMCA 3BORA 1CB7A 3U7IA 4NHEA 4DOMA 2J59A 3VOSA 4Q9NA 1XD8A 4GGMX 2B1QA 3SI7A 2P9TA 2YWGA 4GXTA 3VHXA 3RAEC 2PUEA 2PVSA 3KAQA 2IIBA 4FYPA 2WWFA 4PU0A 3WG9A 1K0FA 4B3BA 1Q15A 3AJ8A 1H2YA 2NUAA 3BD7A 4JXKA 1OC2A 1KQOA 4H7PA 3ANYB 2W43A 3R9IA 3CJQA 3E2PA 1R74A 3AUUA 3JRXA 3KQVA 3R23A 1KYXA 7MHTA 5FBVB 4N5IX 2GRJA 3K31A 3RUEA 4WLOA 3IAS1 3ZWYA 4FM9A 3BWDD 5JIBA 5G2OA 1HOXA 4MCJA 2QIPA 2WTEA 2Z8YA 1SQGA 2OA0A 3VM6A 2VAPA 1U0HC 2WKQA 4FR0A 2GPBA 4FMBB 3ZVNA 4X6XA 4LGVA 4ITRC 3LO8A 2TMYA 3O2JA 4Q3OA 1AGYA 1JAYA 1JEDA 3ORFA 2F7SA 3RUFA 1ZH8A 1YKGA 4R5HA 2I4IA 3DM9B 3IDFA 4NHOA 4PNPA 1ZMOA 1R0YA 1CDDA 4CKWA 4REQB 3DWEX 3H6KA 2J9YB 4FHCA 1UH5A 4K9KA 5CJPA 4XASA 3FHJA 4RVFA 5G4KB 3A1SA 2JBHA 3ZHZA 2Q3DA 3AL0C 1UMKA 1M2VB 3IHTA 3KVVA 4YQZA 3D4NA 2OP1A 1IWPB 3CZRA 5B7PA 2GPJA 4KXXA 1TM4E 2CB9A 3EDOA 2X8LA 2ZCVA 3AESA 3WAGA 2ZAIA 3NUGA 4UXJA 1DPFA 5JRZA 3C3BA 5B2ZA 4K8OA 2XZLA 3P0RA 5BSWA 4E5NA 3KYBA 1O6GA 5C5IA 3WFJA 3WI7A 1Y1LA 1JEQB 1FP6A 1QFZA 1U2GC 1M8PA 2YUTA 5CCBA 3CRNA 4NONA 3OD5A 2DQYA 4GQIA 2GCOB 1XYVA 3H1BA 1XA3A 3QTTA 1J33A 4YFVA 4WJLA 3KB8A 4YAGA 4KLNA 1LSJA 3AETB 3N2ZB 1WPXA 1U2RA 1VJ0A 2HJRA 2IIVA 2EJWA 4M55A 5K45A 1QP7A 1BO6A 3CR7A 5ICMA 2WFLB 2P4QA 4M1ZA 4LWZA 1KZ6A 1ZMTA 2ET6A 1UWCA 5C8XA 2AXPA 2LIVA 3CRW1 2QD3A 4NNPA 2B8WA 3N75A 4M8IA 4ER3A 3BTOA 4DCOA 4PYLA 1EXWA 3U7QB 4Q47A 1OFUX 1QR2A 3WK5A 3D0KA 5E6SA 5B37A 3PQDA 1MVLA 1ZFNA 1A5TA 3B20A 4HEA6 4IOJA 4XPZA 1ZNZA 1DIRA 1XVAA 4PCLA 3UYLA 1E64A 1WD5A 4FILA 1RE0A 2P4EA 4UPDA 2EP7A 2VH1A 2K5UA 3DR3A 1FVHA 1GITA 2IVZA 4U2KA 3LCVB 3AU8A 4B6GA 2WD7A 1C0IA 1JSCA 1XU4A 5FWDA 1E9VA 1Z75A 4MVCA 4B6FA 1G2PA 3PIRA 4UDOA 5ELLA 1T0HB 3RUDA 2AMVA 2FPSA 2NTYC 1NUHA 4V1CA 1QH8A 2QRMA 4D5GA 1REQB 3S81A 2JBWA 2OKCA 1FDUA 3VH3A 1TQ6A 3MELA 3MMNA 5FNZA 4EMTA 3WMXA 5EUCA 5IXJA 5BSFA 4RGVA 2B37A 1YUBA 1ZSNA 2YWFA 3MTIA 4HS4A 4X62B 4HL6A 1NNLA 2P77A 4Q39A 5TMDA 2FPIB 1EVJA 3N6VA 2EX4A 4KSBA 1ZD5A 2CMKA 3SHOA 1W8IA 2COKA 4QUIA 2WKWA 2WPDD 4O4LA 5C1IA 2CDNA 2WA2A 2Z04A 4R54A 4NFSA 5C4MA 2WAXA 3ZX5A 4ZVVA 4ZGBA 3PXGA 2ZSUA 5CJJA 3CCBA 5JS8A 1L4LA 2H54A 3U4QA 2Y1OA 1NC3A 4O4JB 1ZHFA 4MW6A 1FBNA 1Q0QA 2VCYA 2KM1A 4GRDA 4L3OA 5KI6A 1QYXA 1WNFA 3H9UA 3I32A 2AN1A 1UWLA 2JHPA 1NMYA 2RGAA 1QRSA 1P1JA 2HQSA 3M5PA 4H6VA 1MNAA 5JH7B 1I2MA 4EY6A 4YEDA 4F4DA 4F91B 1YKSA 4OXQA 2OBMA 1EGHA 3CF0A 3LQKA 3NNSA 4W5JA 3UJ7A 2NU7B 1E2HA 4A8JA 1QHFA 3V2IA 1VMAA 1PSZA 4MKGA 1BXZA 3ZY3A 4C7OB 1SC4A 2Q27A 2FUEA 1YFZA 5IJ9A 2WWRA 5JXGA 4HDMA 4YNBA 4X1YB 3AR6A 1MN6A 3COWA 3QBEA 4UC0A 4KV7A 4QYSA 3G8AA 1KEVA 5ES3A 2Z3VA 1CJMA 4JLBA 4N3GA 4OBBA 3HXLA 4WVLA 1MAHA 2FWMX 3NBUA 3V1MA 1S01A 3NT2A 1GOTA 3ORRA 4N3AA 4D3XA 4GUAA 3S7ZA 4AF7A 1H4TA 2ADMA 3IUYA 3UT5B 4EHNA 4F2PA 3BEOA 1GNSA 5E7IA 1CUXA 1IEQA 4PBRA 4AMBA 5B1YA 3R5XA 2IUEA 2C4KA 1NJ2A 2AMLA 5HE9A 1BJKA 1VBNA 1JSXA 4MDHA 1PR1A 4ATNA 3T94A 4B31A 4XSHA 5SZHB 4MMYB 1J8VA 4QUHA 5F33A 4KQ9A 5KQPA 4DV2B 4I19A 2ZSJA 3HUTA 4DR6B 1RZVA 2I8CA 2JAXA 4EY7A 3LBAA 5ITZA 5K0ZA 3KELA 1XTSA 1QH0A 3G85A 1FSZA 4M7PA 2P2GA 1V2HE 4D8VA 1OFHA 1OIWA 2OPHA 2GEDA 4UFOA 2CNKA 3MSCA 4ZRNA 2VYNA 2EWVA 2I6XA 3M7IA 4BWVA 4YRGA 3UPUA 1H9BA 2X5NA 1ENOA 1EQUA 2X6TA 1VJRA 4NOMA 3BX1A 2ISQA 3PDIA 2WMDA 3LZCA 1ECCA 2DECA 4YMLA 2X58A 2VT2A 1R2QA 3ADOA 1U81A 5LDGA 4M0DA 5HRAA 5DM0A 1DO8A 4P4SA 1WSWA 4PLPA 5F52A 2FMXA 2HFJA 3IV6A 3ZU4A 3NHYA 4K6GA 4JJEA 4EY4A 3BFKA 4QD3A 4QHSA 2XYQA 4R4JA 4C4YA 5K0SA 2G09A 3ZY5A 1GYPA 1JHPA 1PTJA 1KIFA 2B6NA 2LPMA 2YHUA 4NAUA 1TPZA 2N1BA 4ENTA 4JK3A 2OOSA 2O7SA 5DYYA 5IJXA 4EB0A 5A4FS 3ADCA 2WWGA 4AJPA 1CVIA 4CDNA 4CU2A 5E1MA 3HI6A 4F5YA 1IPHA 5CEFA 1DTWB 2FPXA 1EJ0A 3ILYA 1CBUA 2VPTA 3Q72A 4V38A 4LWOA 3AI3A 2PYDA 3F0TA 1FFDA 1JA9A 2K4MA 3IOEA 4FE7A 1HE1C 4QG7A 1C7JA 4GPTA 3W0LB 3WJAA 1JPUA 1ABBA 4FEYA 1TYBE 4LX0A 3ZZMA 3PJFA 3WDMA 1ZCBA 3OP1A 5K4GA 1VA5A 2B1IA 2QWXA 3GLHE 3W2GA 3BIOA 4F4FA 1VC2A 4BBPA 4BO6A 5CDFE 2UZ1A 1RMQA 1V3TA 1NQ5A 2R5FA 4HTFA 4XQCA 4MS1A 4C22A 1XD2B 4PGMA 1ORWA 2OWDA 3PXAA 2D1SA 4FHDA 5LIRA 5IT9A 3UAOA 4DLNA 1PQYA 3QXGA 2PXHA 1WU8A 2POQX 2BKAA 2CYAA 3EARA 3NHBA 3JYOA 1VJTA 1MX5A 1WHSA 3CC8A 3U81A 3WMGA 1ULTA 2YHSA 1FVOA 1O6FA 2ZP1A 3BWEA 3PUXA 4GVXA 3Q5DA 1CUGA 1AHNA 1CUJA 2G7MC 4HEJA 2LVBA 5CB6A 4LC0A 1SCQA 2UUAB 4CGYA 1DJQA 1UPAA 1G60A 1QG0A 1M8GA 2ZQ5A 2YICA 1SR8A 2D2VA 4IIJB 3WGGA 1E2GA 1PCXA 3BA6A 2FSUA 1LBSA 3CN9A 4FOOA 5JJBA 2GZ1A 3R3XA 5IVKA 2QP4A 3PUVA 4PS0A 4B3HA 2XAAA 2W4IA 4IO1A 2WZCA 4MV3A 4BNMA 3O9ZA 2H31A 4QKQA 2G40A 2X8WA 3E1KA 2O8BB 4ESVA 1PS8A 2VDWA 1DXOA 1Y63A 3BWVA 1EDZA 3O93A 1TU3A 4KW7A 3OE7A 3BQMB 3I9FA 3ID6C 4KXVA 4UD2A 4MVJA 4U7TB 5DM2A 2F64A 4Q1VA 4M9CA 2PSFA 1M34B 3VI4B 3L05A 4K2HA 4KE9A 1YTUA 4Q1AA 5T41A 5KYGA 3U4AA 4JKOA 1V6CA 2ZUVA 1RYYA 2PKQO 3KT3A 4GW3A 1ULUA 4OM8A 1NUUA 4UEKA 3SE0A 5JASA 3G7SA 2Z2XA 2VLBA 1SEPA 1XA0A 3LY9A 4ZD6A 1YB5A 3HBFA 1C1HA 4JSTA 3BGWA 4W4TA 4Z54A 2ZXUA 3JPYA 4JT9A 1TJYA 4G24A 3A10A 5ICEA 2OWEA 3I34X 4EEKA 1L4EA 4A8PA 3OTOB 1NKSA 3GC6A 3PHIA 3TZBA 1KVRA 4MKRA 2VQDA 1PJCA 3PX7A 2V8OA 3AETA 4KZPA 3NO4A 1C50A 4TWJA 4NBRA 4CMIA 1M1NA 1MB9A 1Y1QA 2OCGA 4MWTA 3LU1A 1UK9A 1MVOA 2IZZA 2VDUE 3CKMA 3KQWA 4TTPA 2CEKA 1PZEA 1J2JA 2VNKA 2PUAA 1FU7A 1WZ2A 3IHWA 2BEWA 2PD3A 3M6AA 1NJSA 4OYHA 2RE8A 5B1SA 1OBVA 4HLUA 2J0VA 1TLFA 4FCWA 3PXUA 1OVGA 1U3CA 3A1WA 4G41A 3HZZA 4AX4A 5L6MB 3PNPA 5F7JA 4FE3A 2Z09A 2A3RA 5AH0A 1TIKA 4Y2HA 2D74A 1UAYA 2W90A 5E6UA 3WHIA 1U7TA 1CRQA 3HBMA 1N33B 2E21A 1C3XA 4R40A 1O08A 2VZEA 1S9HA 2CXSA 1XZFA 4F2HA 4L5JA 4L6IA 2PD6A 2V7XA 1H2FA 3N6XA 2ZKIA 2ZRCA 3BE6A 4B74A 3WIVA 2BR5A 4MEBA 4CEHB 4UHDA 2GEKA 2JFGA 3B2QA 2QVYX 2Z58A 4FOTA 1SVOA 4MV4A 1O5IA 3PR1A 4US1R 4JEUA 1IUPA 1RQPA 2B8NA 3GRAA 2IYNA 3K92A 4S1WA 5B1EA 3WWZA 4QXAA 3MIIA 1ILWA 4M0CA 4J7CA 4Y2UA 4QG3A 5K8VA 1U1GA 1X2BA 1HDEA 1KI7A 4IDHA 4BFSA 1EXVA 1B93A 3QE2A 1T13A 2WG2A 3FCSB 5DBHX 1HC7A 2XNCA 3AFGA 2A9KA 3ZLBA 4ZCSA 1DU4A 1Z33A 4MUFA 2Q3EA 2XB2A 2DWUA 4JL8A 3S27A 3T12A 3H1EA 4OSOA 4U3JA 1BIFA 2EZ4A 1SBCA 4QNMA 1V1RB 1LK7A 2EJUA 3G5MA 3K4QA 3UHJA 4CT0A 2B5OA 4IV0A 4DJJA 5TMEA 3SYMA 5LN1A 3UW1A 2ZUUA 5U1PA 3TO5A 1O77A 2OORA 2XD4A 1EVQA 4E22A 1W19A 3FXAA 4IX9A 3AV0B 1JEJA 3DA8A 3K4HA 3NHRA 1JH9A 1JR3E 1D07A 4BX8A 5BUZA 2WJ3A 3HO1A 1X8LA 2OCLA 5FF9A 1ADBA 2WV9A 4Q9AA 1SM4A 5KQLA 1T0BA 1GLVA 4OF4A 3OZVA 3H86A 3S5UA 2YL2A 1GGKA 3N2NA 3TDKA 3SJ7A 1W2WB 2F3TA 2FKAA 4CXMA 4JJ6A 3HR4A 1N8SA 1XRLA 2G5TA 1QZXA 5DLYA 4FD3A 2W11A 4FGSA 1JWAB 3O21A 4BHTA 2X6RA 1W36C 1Q0UA 2WHPA 4RFSB 3UV6A 2XCQA 1PT8A 1F0KA 2XDAA 1ZL2A 3EXEA 3KQQA 4OQNA 4B48A 5L4NA 3IL2A 1NW9B 4RAOA 1OBFO 1XDBA 3OCUA 3KPYA 1FNMA 4RABA 3V9AA 3WLJA 1QP0A 2P6OA 1P77A 1E1KA 2VTBA 4YO7A 2FEMA 1R15A 4QBGB 3WQBA 3N05A 4CJXA 1GKKA 4G5SA 4PYNA 3LPNA 4BO9A 1VG0B 2FPRA 1NUPA 2BHLA 1H93A 2XMQA 3QVGA 1P3Y1 4ZVLA 4HT3B 1MXFA 1HYEA 5JXIA 3FNEA 3HUEA 1T8YA 3QXCA 1D9XA 3DTNA 5K4HA 3GZNA 3EFOA 3M49A 2GHIA 1B2RA 1NXPA 2WJGA 4H0CA 5IFKA 4EKNB 3AR9A 1T0JB 1BRTA 1S1MA 4HP8A 4FFWA 3TOXA 3R6DA 4F3TA 1Q7EA 3IUMA 1G17A 1ATZA 1RI1A 4NENB 2C2HA 3TIGA 4YHHB 1U3FA 2BFDA 2CXUA 2ZTVA 3QEJA 2P7IA 2PX5A 1CZUA 4AJ4A 5JVDF 1DAFA 1VPEA 1ORIA 3U4GA 3HDJA 4I55B 2NZJA 3ZWWA 2EFCB 1EZZA 3N2GA 4G01B 3AL3A 3HSSA 1K9SA 4QJ4A 2G9NA 1U6JA 1EH5A 4X6YA 1WETA 3KWFA 2QTVB 1A9OA 2YN0A 1SCKA 1A9ZA 1H2ZA 4N3NA 2CFOA 3M1LA 3A7EA 3I2GA 2H65A 4TMKA 3GJ6A 1T91A 3RJ9A 3VSAA 1T29A 1K9VF 2YN4A 4AS3A 1GQOA 4J03A 5K9ZA 2J9FB 2YS6A 1NVVQ 3UA3A 1P7CA 1QGDA 4CU5A 4Q4HA 2GH1A 3VNAA 5FAXA 1QK5A 4FFSA 5CYGA 4YDSA 4EUNA 5KQSA 2ACKA 3O0TA 2WTXA 1I01A 5EXDA 1SZCA 3VU3A 5LOVB 2EYUA 2GYVA 1EP2B 2QLFA 4KXNA 1QM5A 4C7MA 3AZQA 3ETHA 3FLBA 5FOWA 5FA8A 2OK7A 1C7EA 2HY7A 4Y2PA 4MDFA 3W4IA 2IQ5A 3AB7A 3ERCA 3ROPA 1S02A 2BGTA 5DGXA 5B4UA 1PJ2A 1W94A 3CX4A 1FQWA 1TCCA 3WTCA 1DEXA 5HTKA 4DLUA 3PNQA 1V9SA 3MINA 5WRFA 3RHSA 3S68A 4G1UC 2D1TA 1REQA 2WUGA 3DB2A 4XLTA 1UC4B 2H16A 3KSMA 1FA9A 2O3RA 1KFCB 3SJAA 2KB0A 2FSSA 4EHHA 3ZBTA 5I7FA 1YZYA 1W7AA 1OF1A 4UE3S 4MTLA 2OK8A 3MZ0A 1M10A 4REOA 4JLPA 4YCBA 5K05A 2H2DA 3GK3A 3O8NA 3QV2A 4J91A 2YOGA 3HJNA 2WKSA 4ZEWA 1C9EA 1NHGA 1WCIA 1DT3A 1F8UA 3C6MA 1GP2A 2II6A 3EDRA 1I0IA 1OFUA 2CNWA 3NGXA 4AP6A 4DMFA 4EHLA 1O0CA 3DMNA 3SXUB 1N5JA 4AXBA 3MOIA 4A5OA 1G8FA 2ZBDA 2RHDA 3GJSA 5GV7A 3GJ3A 1L2TA 1TQ4A 4HG2A 2XUJA 3UB2A 4ASUD 4RC9A 3JVVA 3M6FA 3N8HA 4KJXA 3ZDEA 4JR1A 5BYKA 1GADO 1APBA 3D1VA 3GJTA 1P0QA 1XZPA 5B7QA 1HTWA 2ZRIA 1I80A 2XZTA 5FKJA 4R71A 5J2TB 1TQ8A 1QF7A 1CP3A 2H1SA 2YDYA 4DM3A 1DO2A 1ETHA 3HGQA 2V96A 3DPUA 1STOA 4IDDA 5HR5A 3HFSA 4INOA 4ZZ2A 5A0VA 2GM9A 3WIDA 2KQUA 2MDTA 2WHRA 5JQGA 2VPQA 4B87A 2NP7A 1L3CA 4JJ7A 2JA1A 3HJAA 4YWHA 1XP5A 1U80A 1GPDG 2R44A 1SKAA 3G0CA 1YIAA 4US0R 4QARA 3NP7A 1WR8A 3TE6A 2CK3D 4URYR 4KEAA 3NBFA 4M87A 4WXPA 4E0BA 1B1CA 4X8OA 3BSFA 4AY6A 3NORA 4I1OA 3DF7A 1Q21A 5IM4A 5HFAA 3V5NA 1MJHA 1ZUWA 1P5RA 1J5EB 1M75A 4FONA 1AK9A 2MSWA 3ND8A 4FWIB 4N5LA 4MS1B 2JK0A 4PX2A 3TLBA 2UVQA 3KT8A 1H69A 1J9EA 4CEJB 3GO4A 4DM7A 5E4TA 1P31A 1JJIA 1CZKA 1J9GA 2FQWA 2WSLA 3TK1A 4HVCA 1QRAA 2AG0A 2PX4A 3LDUA 1FS4A 3MYRA 5EJMA 1Z0UA 2RB5A 1SUEA 3A27A 3T3IA 4JUIA 4EMSA 5AVSA 3JQQA 1E6EA 1Y8QA 3M4ZA 3ZX4A 1UANA 3UXEA 1GU7A 2LTAA 1GN8A 1DAPA 4H3VA 4PVDA 1HNWB 3KHUA 3KOWA 4HNSA 2D06A 4KO3S 1YZHA 3VDQA 4C2AA 3KQUA 4IHJB 4XIIA 4BFYA 4O4HF 4ZAZA 4MKFA 2KBEA 5AHWA 5AOBA 2WTNA 2J6IA 4PLGA 4ASUA 2HSEA 5KDLA 1Y1TA 4ICIA 1YJBA 1USUA 2L69A 4L5AA 1ARZA 1Z2NX 1YMVA 1G7CA 4R9UC 4U3JB 2CWWA 1I32A 5EERA 4HKTA 4D26A 2TMKA 2RK4A 3EEBA 5T3UA 4FTWA 3RT9A 2MIIA 3I3OA 1WBBA 4LGYA 3GUVA 2G4CA 3AH8A 2CC2A 1OLUB 3R3JA 4DABA 4B3IA 4YAIA 2GB4A 1BE6A 2V55B 1EFTA 3LZDA 2VPYA 2MMGA 1T25A 3QUBA 1E1YA 2DBQA 2I1QA 2JFQA 1KMHB 4JSYA 4JX8A 1KDZA 5C7IO 2WP0A 1HE2A 2IZ5A 5GADl 5D3MB 1Z6TA 3SJZA 1N5LA 1H9AA 1N3IA 2I6TA 4IXWA 1IK6A 2VUHB 1CU1A 1QZUA 3EVNA 3BD9A 4KKVA 4Q3DA 2VT3A 5LB2A 4R6WA 2FRVA 3B5EA 3KAKA 4I1YA 1ZC4A 3HJFA 2VSOA 3MUNA 2W6PA 4K3VA 3MTEA 1Y0BA 2FUG1 5ED0A 1TTTA 1CQPA 2V45A 4NEGA 4WJZA 1P0CA 2P0YA 3QZUA 4OH1A 2FEXA 3AEQB 4TQGA 1D2NA 3KKQA 4IF4A 5DN9A 1KYQA 3OIUA 5E9QA 4ZT3A 1KZ7B 1B8PA 4YWJA 4EJSA 3ZDCA 5C8YB 1ADFA 3MMPA 2W6JD 3LD9A 3C48A 3KZOA 1R50A 4NENA 1IHYA 5G0SA 1GZVA 3GP3A 2XEDA 3WLPA 2BI7A 2IS2A 1MEOA 1S3FA 3ZHUA 3J81A 3UK1A 1H6CA 4ZOCA 4PYRA 3QITA 4WCDA 3HVRA 1M1NB 1NYRA 3FPAA 1LDMA 1E58A 3L07A 5C1OA 1HKUA 4I7EA 4IVQA 1QVZA 2QRZA 4X1YA 1ZC3A 2CLCX 2JJ2D 2P9FA 4Z0TA 1HT0A 3AM5A 2WG0A 1SBIA 3NHAA 4J16A 5G0TA 4ZGWA 3O83A 5CYPA 3ISVA 2NU7A 4JROA 2PT5A 3HHPA 4DFDA 3C97A 3K9CA 1HEUA 2VDPB 1N2CA 2IBMA 3K70C 4JI0B 2C54A 2C2BA 2FN4A 2WJIA 1P6QA 3AJAA 3CRRA 1WPGA 1GR0A 3A9SA 3E3OA 5CA0A 2WJ4A 3FLAA 4I8IA 4COKA 4DPLA 1FDRA 1FCJA 1U4OA 2QG4A 2N75A 3MN1A 2QAIA 3E15A 2C77A 3VR6A 4NY1A 4G5GA 2ECKA 2I2XB 3KD3A 1FW6A 1R88A 4EJFA 5A4KA 2JJMA 3RVRA 1GCAA 1XZGA 1TM3E 3I2FA 3LSTA 4JR0A 3A9UA 2IHUA 2VK8A 2ZULA 2CD9A 2Q8PA 3HHEA 4RA6A 4A27A 5KDDA 5JARA 4Z9AA 4CLRA 1PT6A 3EQ9A 2ZBPA 2GN4A 1Z06A 5EJ2A 3H19A 4QXPA 2HHLA 4Y2VA 1E79A 3RSLA 3A9CA 1N2JA 4L57A 2F9MA 1UBMS 4GEKA 3HI4A 4K9LA 4TMVA 3T7RA 4ZGGA 3NXSA 4LJ4A 3A4YA 4F2GA 1Y82A 2AF4C 5BQ3A 3ORQA 4GBGA 4LDNA 2OVFA 3CWCA 1N3YA 2DHDA 2W6ZA 4KAAA 2BW0A 4A7PA 4RTQA 1RLOA 3O73A 3AVXA 2POCA 4NU0A 2VWPA 1JSRA 2ZUEA 4YXWA 3DZDA 3I5YA 1HYBA 4DCGA 2XT6A 1RRKA 3SXPA 4X97A 4S3MA 1C3OA 3BJEA 4F5ZA 1EJBA 3LC7O 3JQGB 1SWVA 5CX1A 1UM9B 3GRYA 3B9PA 3PE3A 4OI1A 4YP0A 3E7DA 2IEDA 3O2QB 3CVUA 2J85A 3OTWA 4ROTA 1VJCA 2R4QA 5FX2A 1YR3A 3D8BA 3VPHA 4B09A 3DHWC 5H3HA 2H11A 2E2WA 5I8PA 4D4KA 2XMSA 4DPMA 1LTHR 3EGDA 1G16A 1FQOA 3MK31 2O2YA 2LP4Y 1E7SA 2RAUA 3AQ4A 3G8CA 5B57C 2A5DA 3NWBA 4UDNA 1TZ2A 1ZVQA 1Z6QA 2H1LA 4FINA 4ITUA 3SVZA 1QRTA 1ZOOA 2CJYA 5EPOA 3N8DA 4KFUA 5ECGC 3AFHA 5A0FA 1DBQA 2H29A 1YL5A 3PUIA 1XDWA 1Y33E 5B3AA 3JARA 1JUDA 3QKIA 3IAHA 1NW6A 1XTPA 3PGLA 4NS4A 3F3KA 3ON5A 3VNRA 5KSOA 3D5EA 4RTMA 1M5TA 4AJJA 1GZSA 2V6GA 2CLSA 4KC0A 2G72A 5EHZA 2VUUA 4CR8A 1KTVA 3VKVA 4LVNA 3WHKA 4DV3B 2EV9A 3H4IA 5ANRB 3IULA 2FGKA 4LKRA 1BW9B 1RQNA 1L0BA 2JIQA 3TZKA 2X0JA 3UT0A 4ZJZA 5HWSA 5KVVA 5A7HA 1BVUA 2BFBA 3AW8A 1BHSA 1I6KA 1QF9A 3ABZA 3D6UA 3AR8A 3D0RA 4C7VA 4TV8F 3KCQA 4KRYA 2AXQA 2P9CA 1RJEA 1N1GA 3V1UA 4TT8A 1VHTA 4O25A 2MSDB 3WS7A 3LT5A 1MFPA 2QN1A 4IQ0A 4UEWA 4WVFA