3GX1A

Crystal structure of a domain of lin1832 from listeria innocua
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
126
Chain Sequence
SNAQVEVIVMMHGRSTATSMVETVQELLSIESGIALDMPLTVEVKAMYEKLKQTVVKLNPVKGVLILSDMGSLTSFGNILTEELGIRTKTVTMVSTPVVLEAMRKASLGRGLEDIYQSCEQLFENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Lin1832 protein
publication title The crystal structure of a domain of lin1832 from Listeria innocua
rcsb
source organism Listeria innocua clip11262
total genus 31
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03610 EIIA-man PTS system fructose IIA component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.510 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphotransferase system, mannose-type IIA component 3gx1A00
5IM4F 3B48A 1PDOA 3BEDA 3MTQA 3CR3C 1VRCA 2JZOA 3CT6A 2JZNA 3LFHA 3GDWA 3IPRA 4TKZA 5T3UA 3GX1A 1VSQA
chains in the Genus database with same CATH superfamily
4TGLA 1LBSA 4CCSA 3ML1A 3CO0S 5DX0A 1L8OA 2WG2A 5JJ5A 2QF7A 2FI1A 2X5JO 4J0QA 4PSUA 4JZKA 2I34A 2ZIWB 4R6WA 4WKCA 4GX0A 2WTUA 1MU0A 1KI1A 1U7PA 1EVZA 1B8OA 3RHZA 3UCFA 3A6PC 1AKEA 3GL9A 2WE7A 1BKDR 5ECYA 2GDZA 4NECA 2AE1A 1RSZA 5TJHA 1GWNA 4ZRMA 1L4GA 1FCJA 4EJSB 5IZ4A 4FNMA 4PCUA 2HH9A 3A9SA 4BJHB 2ZT5A 3I8SA 4ZQEA 1IMJA 1Q0QA 2P9EA 3K0BA 3MLAA 4JA0A 1F2TA 4LYGA 4ZAFA 5B1DA 1EX6A 1NXWA 1T15A 3CWZA 3IEIA 2COUA 1VIVA 5AVRA 2UU9B 1F9EA 2VQ6A 2W48A 5EIOA 2BWJA 3OMLA 5I48A 3UGJA 4RABA 1EUDA 4G1BA 1A2BA 4RIFA 3UWMA 1BKSB 2B9EA 3GQVA 1HO3A 2L2QA 2BMEA 3T5PA 5K8VA 1SQFA 1CF9A 2R8XA 4M53A 4URWR 1ZSYA 4O4LA 3WK9A 2WIFA 3CVVA 1JDVA 5CFRA 5JARA 5JZSA 4DJEC 3WGMA 4ME6A 1ENPA 2YY7A 1KK1A 5IC4A 4RLQA 2X1LA 2NN3C 5FBRB 1QRAA 2DFLA 2HJWA 3D6UA 2CJFA 1GL7A 1D3AA 2BRUA 4MVJG 5ELXA 3M6LA 4HQRA 4IG9A 1W2HA 1SCUA 3SYRA 4TKLA 2OWEA 1ZOOA 1IC6A 4IWXA 1XYGA 1XQ1A 2GM3A 3H97A 4F2WA 3ORSA 3SK0A 2BMDA 1KY3A 1NVAA 1ESMA 1C7ZA 2QKYA 2XUAA 4M8IA 4OMFG 2XOKD 3UW1A 1YSCA 1AKWA 3JRXA 4FOPA 4FPXA 4KZPA 2FSHA 1V11B 1F8UA 4EUNA 2NXNA 2NOAA 5TPWA 3JVUA 2CZQA 2DFNA 4K0RA 1E32A 1P1IA 4IG4A 1ISGA 2H3HA 2PG3A 5KWVA 1XFAA 3KUKA 2VN8A 1U65A 2G6BA 1IBSA 3HKBA 3SQOA 1VPWA 2H9YA 5HDBB 1P1KA 5AD1A 1U8CB 4G84A 1JH8A 1T34A 4LJAA 3ZNOA 3T94A 2AZ4A 2QPTA 4X44A 4DNQA 2B94A 3I8OA 5HK9A 2AC7A 4PEVA 4XIYA 1LUAA 1TGVA 2BCJQ 2LKDA 5K09A 1Z0FA 1DEHA 1X94A 3C2QA 4TQUS 4J91A 2WC1A 2C7OA 4KKVA 3D3WB 4C6TA 3IKMB 5JNWA 2X23A 1HMYA 1RHKA 2YJGA 4F3NA 5F73A 1A5SB 3LHIA 4CKEB 2HD4A 4ALJA 1AJEA 5FADA 3SJCA 1UEJA 3U7QB 2Z58A 1WDMA 2HNBA 1E3TA 1B3BA 2BZ1A 3KQWA 3TX6A 4UVGA 4KQGA 1G63A 1IBMB 4M0UA 3LUGA 5K8CA 3D1JA 1PL6A 5DRTA 4EB6A 2FQWA 5D3MA 1ZVQA 4NY1A 4TTRA 2PNFA 3HKEA 4TRNA 4PGHA 1A04A 3BRCA 3GJYA 3RFFA 4DREA 4P3XA 2Z2ZA 5JO9A 3IHLA 2BKLA 4EHIA 2WM8A 1JQ5A 3SBDA 1J07A 3AM4A 1EK0A 2XCSB 4O6VA 1CRQA 3EDMA 1EFPB 3N6RA 1UXHA 4KO3S 2AEMA 2C58A 5DSZA 1QH8B 5AKIA 3EFOB 3ETCA 2C29D 4DWOA 5KEIA 1ADYA 1E1RD 3RT7A 2OZVA 2E2WA 1KMCA 3H2SA 1WUIS 4W5QA 5F78A 4R2JA 3LL7A 1T8YA 3RVQA 3F7TA 1SEPA 2GFIA 4MWSA 4XWWA 2NG1A 4BZPA 3FROA 2QVCA 1HM5A 2ZR7A 3HU2A 2Y9PB 5D51S 4X1YB 1L8XA 1A27A 2HXYA 2VO1A 1BWSA 3K09A 4JC5A 4MKGA 1M2VA 1J5XA 1QS0B 4YJHB 3RFTA 1YZHA 4ER5A 5ILOA 4BGVA 4BQNA 2FPOA 1IBKB 3O8OA 3PXCX 3KWFA 1MAWA 1L5WA 2I29A 2VT2A 2A35A 1WJGA 1O6CA 4RD4A 1CRZA 3P9NA 1IZ7A 2QX9A 1Q0LA 4DA9A 4ZEVA 4JI4B 1SHTX 4IV5A 2RHWA 2B36A 2G67A 3LDHA 1GNTA 3LF1A 4YP5A 5FLXA 1M1YB 1WNFA 2EKLA 1KEVA 2FSFA 4E88A 3BMQA 1L5MA 3F1LA 4AT1A 1GN9A 3A26A 3DWEX 3QJYA 2JASA 4K2HA 1UFOA 4J6FA 4R9UC 4RFSA 4YV0A 3TW8A 3LPDA 4WXYB 1Y1RA 3ZEIA 1J2YA 1IB6A 3PJRA 2A1UB 3LHSA 1GRRA 3QEMB 3FWPA 4S2EA 4YCSA 4OX9Y 2CK3D 4BNJA 2QP4A 2CL5A 3DE7X 3H75A 4RL4A 4EFNA 3HTXA 1PP4A 2DKNA 4DXAA 3A4NA 3F78A 4BLSA 3K5IA 5FO1A 5FH9A 5AW4A 2AZMA 2F62A 5AWFC 4Q9LA 2VS1A 3OCVA 2LKCA 2Q2WA 2PUCA 1I2AA 3B9PA 3DLTA 3R4CA 5JY1A 2ZSDA 1IHYA 1PN3A 2EGUA 1JR2A 1M34B 1HLFA 5FBWB 2JHAA 1UDXA 2VP6A 2RSLA 3D3KA 3G0BA 1WBDA 1HBJA 3PXUA 1JU9A 2GWHA 2P5SA 4NZ9A 4P4LA 5E8JA 4E5NA 1L4MA 1YGYA 2J59A 4PTYA 2JVIA 4DQ0A 4QYIA 3VU8A 4LVCA 4B47A 4MPDA 3C3MA 1XRPA 3UT5A 2F2TA 2H4YA 2Z1DA 4JAVC 4RIEA 1LFDB 1NW5A 2JANA 2OMKA 1OI3A 2JIMA 4TXMA 2JPDA 2XUKA 3EGVA 5ESXA 3UW3A 4Q3BA 4YXFA 1I5OA 2IY8A 4XDHA 4CM8B 3CHYA 1MO5A 3BULA 2Q9AA 3IHTA 3UBTA 4JI2B 1NXTA 1OX4B 1AUQA 1OBCA 1FNDA 1QGDA 2AZDA 2IOHA 3KE8A 4J3FA 3KT6A 4K9MA 3D54D 4KQIA 4Q93A 4B3RB 1ZGAA 1XEAA 2IYOA 1ZK4A 2ZJ6A 4RNDB 4TWRA 2FZCA 4DEVA 4QBIA 1B73A 2GPSA 1A9PA 1UPFA 5HKLA 3H13A 4QL3A 1CB7A 5J4KA 1XRRA 2CNBA 3S8YA 1UC5B 4XVQA 1C8VB 3R3ZA 3GGDA 1QUFA 3QE9Y 3TIFA 4X8MA 3GXOA 4TVOA 2Q2QA 3F67A 4Z53A 2EKBA 3R24A 4I9UA 5D00A 2GBLC 4YJKA 4HWTA 2WQ7A 1AN9A 3F4LA 1H9BA 2AK3A 3L0OA 4ZEWA 4EG6A 4PE5B 2PH1A 3EGOA 4E5KA 1NLMA 1Q15A 2DG2A 1OREA 4GM4A 4YAEA 5CDTA 3LWBA 2QU7A 2XWSA 3QVLA 3K6SB 3C8MA 2NT3A 4HAXA 5HJ5A 2ZB7A 3ELYA 1QNFA 4JJ8A 4MLZA 1L5OA 2JA2A 2NXJA 3OFND 2EW8A 3ONDA 4NAVA 5DNWA 3I83A 1QVWA 1S4QA 2HF9A 1MA3A 4Y1GA 3E82A 5CT6A 3SY8A 1PGQA 3DEJA 3LFUA 3LUJA 1JLKA 3NRBA 3K1YA 2Z1NA 4MAMA 1FZTA 1F51E 2HWYA 1H66A 1J8YF 1G6KA 4PICA 3WO1A 3ZKAA 1RE1A 4L0DA 3LUHA 4IR7A 2FOXA 4BRZA 2VDWB 4AX8A 4WBNF 3SM3A 5DP1A 1JMVA 1BSVA 3LCVB 1QIDA 1TAGA 2LTAA 4LV8B 2PKXA 4N3AA 3FHCB 1SVKA 1AUXA 1CPYA 4DSUA 5JTTA 4RJ2A 5EMLA 1CUEA 1ONBA 2EW2A 4CLRB 3WAGA 1TEZA 4GL2A 2AFIB 2BMAA 3AEYA 3IVCA 5ALUA 1XZQA 3CF2A 4HDNB 4R1OA 3ZBPA 3MS2A 4DSOA 1WXHA 3OEWA 4RZSA 1DIRA 1P4GA 3LX8A 3INTA 2EF0A 3G9XA 2V55B 2O8VA 5JT1A 2NO5A 1YT5A 1DJLA 3KKNA 4FTWA 4CIWA 2QTVB 1GPH1 3ICOA 4E5YA 5L45A 4NCBA 3JQBC 3WJ2A 4DIKA 5THKA 1SPBS 4OL9A 2QB5A 3PS9A 2QSZA 3MWLA 3OCXA 4LISA 3UWOA 4AJ2A 4D9CA 2BL4A 6REQB 2LUOA 2ZIEA 3KKQA 4MLPA 3QVGA 4ZCQA 3ANNA 4KK3A 5A04A 1PZGA 5HUHA 1A4UA 3D9QX 2MTBA 4YRZA 5C9ZA 5F98A 2P7HA 4CMBA 3L6BA 1DHTA 3IKJA 4J0JA 2V7BA 1AQNA 1JZSA 3S2IA 3OWHA 5IVHA 4MO9A 4B4KA 3RO7A 4MVJH 4O4JB 4MZDA 1D0VA 1UMKA 4OYRA 1J42A 3HBJA 1RKBA 2NVUA 3AXTA 3HR4A 1NVKA 3MC1A 3GA0A 1MVOA 2CLEB 3BREA 2QW8A 3OY2A 3PEUA 4GLLA 2JBWA 4M98A 4U2CA 5SZIA 2WWVD 2YCLA 3VSBA 1IXSB 2G4LA 5H81A 2OKGA 2VXYA 2W83A 3ET4A 3NR2A 3TSOA 2GD1O 3AH8A 2G9UA 4FGZA 4N12A 3BAZA 1QWSA 3R23A 5TV2A 3W4JA 4XPZA 1E8NA 1XTRA 1LJLA 1IEQA 3TBKA 2FK7A 4X54A 4XH9B 2EYUA 1I32A 3SX4A 2D13A 3R9KA 4EKIA 3O03A 2K4MA 5DHQA 1QX4A 4TWIA 4DR3B 4G0UA 1GPUA 3HA5A 3KLBA 4OUKX 1PFYA 5LP6F 3FOBA 3FHLA 2CXTA 3KQOA 5INTA 5EIBD 1T4DA 2Q0SA 3OETA 2KBFA 3UJ8A 2Z08A 1Z5ZA 1DADA 1NL3A 2WSSD 3A7DA 2VKQA 3BA6A 3JV7A 2VPWA 4LHVA 4MVJI 2RKOA 1YI1A 5JPDA 1I2CA 4NFSA 1JEEA 3GJ5A 4Q9NA 4UJ3A 4EY7A 3N0VA 5MN5A 3H6HA 4A15A 2RHJA 4Q0MA 5CJJA 4CFSA 4UBMA 1MDBA 1KVSA 3EODA 1PUIA 4C04A 2W2LA 1PUXA 3D8HA 1H3EA 4U7WA 2P69A 1SXHA 3BHMA 3STVA 3SLGA 4QGAA 5I3CA 3WYEA 1MJFA 4I4TF 2J0SA 4GX1A 1Z6TA 4B2PA 4TYYA 1SQSA 1MABA 4QJ4A 1Z5OA 5G0WA 3WKBA 5KYGA 5PGMA 1E3QA 1YFKA 3D7SA 4M9ZA 3G0DA 4AF8A 1Z0DA 2KB0A 2IZ6A 3GRCA 3FSEA 3I76A 4BMVA 1KR5A 1CXZA 4GH5A 1RM3A 2ZKLA 3EK2A 3QKSB 3WRYC 1Q44A 4YRSA 1BCSA 1RZ3A 2NTVA 1NBIA 5A3QA 5BWBA 2XPCA 4ZVPA 1NUPA 1Y1PA 4Z54A 2WILA 1M7BA 3CRVA 3HUDA 5DBEX 1OGJA 4ITRC 4MW5A 2EDAA 1BQEA 5BVHA 5DIZA 2O0HA 3EEIA 5HIMA 4FCTA 4FIDA 4U0KA 3P32A 4Y0AA 3IAM1 3EGWA 1SZCA 4H7KA 3O4JA 2DXIA 3UH0A 3VUFA 3J81A 2RE8A 1NQTA 1RQ2A 4A23A 1LDEA 1DPGA 1P62B 2ZVQX 721PA 1CUUA 4BO2A 5CP8A 1Q7EA 3TFOA 1ZUIA 4J07A 4QUBA 1GKYA 4B6EA 1RYYA 1L5FA 1RWKA 2PSJA 3O91A 2CSXA 4TPKA 1C0EA 1MGPA 1UPUA 2GTPA 3PGLA 3OZXA 1LPSA 4AQ7A 3OCUA 1ODJA 3MWYW 3ACBA 1ISFA 3GEGA 4OLJA 2O8CB 4V0RA 3HBAA 4RVGA 3D4NA 2D6FA 2HNKA 2FLKA 2QTGA 5DM1A 3AR2A 3QNMA 4RCZA 2GA9A 2QNRA 5BNIA 5ULLA 4O2RA 2FPGB 1CIVA 2IZ1A 3NWBA 4FE3A 4P3NA 4BLPA 3L8FA 1F38A 1MNQA 3OPYA 1VRWA 1GGKA 1O3YA 2A9JA 2QYTA 4ZDWA 3VR4A 3T5AA 3IBFA 3T1OA 3TF5A 3FTFA 3VNUA 4GVLA 4XCXA 1RPNA 4MRSA 2YC2C 1G2PA 1EINA 1BS1A 4G1FA 3ZHBA 2E9SA 3FD8A 4PNZA 2EL7A 2ZTLA 3R4VA 4KLNA 5E95A 3OD1A 3AY6A 5AW2A 1PR6A 3OLWA 4JS0A 5J23A 2DR3A 3I09A 5E2AA 4CE6A 6NULA 2XXAA 1MTZA 3Q6MA 5ALJA 3F73A 1NI4A 3F5QA 3ZCSA 3H5VA 4MV9A 1XTKA 3WHIA 2Y66A 1A1VA 1B4DA 3BMNA 3CVWA 1DAMA 2QAGA 5F76A 5ICMA 3CSDA 1C7RA 2YHIB 4BNZA 1FQJA 1E0JA 2XCQA 1K6JA 3DJFA 3PDIB 1L5KA 2JGKA 3B3AA 3VPXA 4WFJA 2Q9BA 2OOKA 1S02A 3I6BA 3V42A 2Z56A 2FZVA 2E1PA 4LQ4A 4EHLA 1GPAA 2VSYA 2QK4A 4BFLA 2JH9A 3PDUA 1OSNA 2KMLA 3A7EA 4LA4A 2PX5A 4HLNA 4PBSA 4FBLA 3L8DA 5JE8A 1ZI6A 4UHHA 3UAWA 4JUDX 1RM5A 5IWAB 1LW7A 2WWHA 2WK1A 4I55B 3GVIA 2FZ4A 3EMKA 3PTAA 3RJ5A 1QOPB 5M04A 3ZJTA 4WH0A 4UBLA 3WSVA 1G2OA 2J9FA 1I6KA 3RC9A 3O7WA 4NAHA 1R88A 1XEWX 1XZEA 3KUDA 2PWAA 1W2WB 4XDYA 3V1YA 5CAEA 4MUKA 4BAGA 2PZGA 5DHSA 1EFUA 1P2GA 3O1JC 1YJ8A 1AHPA 1ZOSA 2C2BA 3EVTA 3DUWA 1FYFA 2WEKA 4ZO9A 2Z95A 3I0ZA 3BSYA 1E9RA 4CEIB 1ZWKA 1YQXA 1O4WA 3B1JA 3H1FA 3LNCA 2V59A 4FYWA 4F1JA 4CKWB 2W6JA 1PNRA 3ESZA 3DMNA 3TRIA 1SWVA 1QIEA 1PV4A 2E6UX 4TVBA 2F4NA 3RODA 4BFUA 2XF8A 3C6XA 5KMGA 2X9GA 1WQ1R 2A88A 1ZD3A 4R2KA 3TXXA 4XI9A 1C30B 3O7MA 4MW4A 1J8QA 4BASA 1DQZA 1G5FA 2BM1A 5K0LA 4YRAA 2G77B 4BRUA 5DO9A 3U4CA 1DRJA 2XNKA 3IUYA 5A7HA 3JYQA 3W3AH 2AQ8A 3O26A 2UV8A 3ZY5A 1RXIA 4YAWA 5BSUA 3KTOA 5B3KA 4F4HA 4UARA 4L0QA 4K9OA 1YTUA 3OQIB 3AEKB 4ZIRB 2O3TA 3H18A 3PRKE 4DL9A 2P2LA 2XDAA 4YR7A 2GM4A 4B4OA 1EX1A 1YOVA 3UMJA 4OIMA 5JVDF 1O5OA 4MRRA 5BMVB 4UNPA 4AJKA 8ATCA 3I23A 1B7GO 1SUCA 3HCBA 5CXSA 1T1JA 4UHFA 2Y6VA 3HP7A 4B35A 1ZIPA 1CU1A 1RYZA 3K15A 3RABA 3K0FA 1VBFA 2X41A 1PE0A 2Y8EA 4HEQA 3UAVA 4NMWA 3LSTA 4ZGWA 1L1QA 4WKOA 2HJ9A 4BB0A 5LOVB 4WOCA 5JG7A 1HDCA 2XGOA 1F8GA 2IIBA 2PLAA 2YQ5A 4RTNA 2PYDA 3QBDA 4BFWA 1QMPA 2A8YA 1ISMA 2WJVA 1X1QA 2C94A 4NCNA 4HGRA 1KP9A 4BX8A 2JAUA 3OJCA 3FAKA 3QXCA 5KQRA 1JKXA 2CDAA 3FXAA 3GEDA 1K7XB 2GWRA 3EDYA 3DKIA 4ENPA 2QT9A 2ZWIA 1C1DA 3OQVA 4AUKA 3MEQA 1OZAA 1PTKA 2GN4A 3HSKA 3Q3HA 3AP3A 2BUBA 3AGPA 3I45A 3O4HA 2KSQA 4HEJA 4MRMA 4TTSA 3VZPA 5IT9A 1S0UA 5K4HA 1Y6ZA 4L76A 4OJQA 1PRYA 2W2KB 4KYUA 3RUHA 5AM3A 4OGWA 1MB3A 4GM1A 5T4BA 3S6JA 1ONOA 2QX7A 1Z7WA 4PPYA 1TYZA 1Z4MA 2NO6A 4YV2A 3KTAB 1YUMA 1D2HA 2H8KA 3H1AA 1W7AA 2X3FA 1WVGA 2R4UA 3EA0A 3MUEA 3JARB 5GVSA 3MMXA 2C2OA 1K6EA 3PL1A 4OEHA 3A58B 4YDSA 3B2EA 1XQ9A 4NAUA 3WLQA 1TKBA 2NV6A 3O3MB 4WJLA 1IY8A 4CM1A 4JWKA 2AYZA 3AF2A 3P9KA 1U0RA 2IQIA 1MJGA 4L4RA 2WA1A 4TXNA 1D9XA 4JB8A 4ZCLA 1VIMA 2QLTA 5DXAA 3MA0A 1NW3A 3SNHA 2VAWA 4XVUA 2DHDA 4MXDA 3CNNA 2CZGA 3PWTA 2YXBA 2WY2D 4EPXA 3TSZA 1GPYA 4OXQA 2Q49A 1KYIA 3EVZA 4PRLA 3AJ9A 3MJVA 4C43A 4K9RA 4V2UA 1PGPA 1ZSVA 4CDGA 4O4IA 1I4EB 1NQVA 4ZOLB 1ORRA 3R0XA 1NKSA 3NU1A 1CY4A 2QMHA 2BR5A 1YNOA 2CYBA 2GPYA 3S4YA 4YRMA 4ARCA 2QLBA 2XWJI 3JWGA 4BJ5A 4ZAZA 1JYSA 3A4MA 4HRYA 7REQA 1OZ0A 2IY7A 4HNVA 4LW8A 4RS3A 2VK4A 2ZJ7A 3V46A 5DNYB 4M9RA 1D0IA 1S2LA 2BH2A 2QRJA 4PN3A 4YC7A 1H5NA 4HYEA 4L51A 3I34X 1PS8A 2FPIB 3HJBA 3RVJA 3WI7A 2YZMA 4Q3EA 3Q98A 4KOEC 4DT1A 4GKJB 1I3OA 1TO6A 3BD9A 3P52A 1N4AA 1QPBA 2I9PA 2EHJA 1TU3A 2GA8A 4FHFA 4H31A 1YJAA 4HNSA 3O3NB 4KGVA 1H2BA 4QU5A 2PSFA 3ZWKA 3S2ZA 3MOIA 2C7QA 4G89A 2Q2NA 2AMVA 1FC0A 3QI7A 4G5FA 2FWBA 5AOCA 3GJZA 3MJRA 1ONSA 4HUQB 2WSMA 1WDWB 4KO1S 3KBOA 4KODA 2PLWA 3PX7A 4LF5B 5JI3E 1PFKA 5DTEA 4I4TA 4ZD6A 4PIMA 5DBOA 4YIHA 1N2GA 3SQDA 4IL5A 3ZH9B 4PO3X 3A3NA 1KYTA 2AN1A 3B70A 2BGLA 5D6NA 4B76A 3NTVA 4UTNA 3FAZA 2MSDB 5AW9A 3HM2A 2HYDA 1Q1BA 3G79A 1ACJA 4MR9B 2ZU0C 1XJ5A 1Z83A 4MV1A 1ZG3A 2CB0A 1DEOA 2QMZA 4O3MA 3QHQA 2RB4A 3R5SA 3UTCA 1ZLXA 3SS9X 1B15A 1F5NA 2IODA 3KC2A 4LIPD 2F9MA 2WVAA 4MEJA 5A03A 3TZ6A 5JALA 5KTTA 5LDDC 2PH5A 1URPA 2ZUSA 4AMUA 5EHNA 1E18A 2OORC 2Q27A 2C8LA 1EBUA 4JI6B 1FSGA 1GL9B 1NJ2A 1W47A 3DO6A 3OOWA 5T64A 4P84A 2XWQA 4R81A 9LDBA 3OVMA 1JSLA 3EIXA 1JDBB 1RMYA 1NT2A 8LDHA 4BKPA 1M66A 2QL7A 4Y2PA 2J4CA 4PCAA 4YNBA 3BXOA 3MILA 1KFKB 1JJFA 1NKTA 1T6ZA 4G0XA 3NB0A 1NR5A 3W79A 4BFYA 2J5XA 5F1PA 1SIOA 1QYVA 2PGXA 1NJFA 2H2WA 2Q0HA 4JQOA 3M70A 3I37X 4OFXA 5KJ6A 4MPRA 3QYAA 3IBSA 4KPGA 4YK7A 5DULA 4H9GA 5DW0A 5IAEA 5B58T 1FSZA 1G98A 3R09A 5KYUA 1O2DA 1VECA 2C84A 4LOLA 4QODA 1J1UA 4GC5A 4NH4A 4JJ4A 4L8WB 3UJ6A 4AS1A 4XDZA 1PK8A 1BO6A 2EC5A 1L7AA 3LG2A 3MJEA 4G85A 4I50B 3PUIA 4C6SA 4N0DA 4JV5B 1U0LA 1JHUA 4BU1A 1B76A 1LLQA 2GD0A 1G3IA 4LCBA 4M37A 1O96A 2PQ0A 2EDCA 4DMFA 4EFMA 1HX7A 2NADA 3PG5A 4NSNA 3KPJA 2R47A 4JT4A 2XMZA 2VK1A 3GLHA 5EUCA 4W99A 4Y8VA 3SR4A 4UW9A 4CODB 1UPBA 1TTHA 5U1PA 1T2DA 2O3SA 3AMVA 4PGFA 4RTLA 1YZKA 3A6JA 2E4WA 4DV6B 1IVNA 3IVMA 4U6SA 4POOA 3CEJA 2R0QC 4YJ2F 1B2LA 1UFRA 3U1VA 5FUWA 3DAFA 2VSFA 1UM9B 2SNIE 5LB4A 4EM6A 5CXUA 4EJ2A 3GBPA 1SULA 4KXLA 4FFNA 5E1DA 4LE1A 5K3AA 3U3OA 5JQWA 1T5BA 1XNGA 4DHWA 1Z6AA 3EY9A 4GMXA 2NO7A 2R4QA 2YHSA 3EW7A 1PJ8A 1JDNA 1U7WA 1V2GA 1BDJA 5DX8A 4V3BA 2PAAA 2CNOA 1P1BA 4V0ME 4YLYA 1QHHA 6PFKA 1CR6A 3BCSA 3IYLW 4DLNA 2BHSA 5C7IO 3RF6A 1ISRA 4NATA 4D6XA 1LY1A 4RSHA 2FV8A 2ZTUA 1SBIA 1QQ7A 3BN3A 3EZ2A 1DIAA 3NOOA 3RHFA 3V8MA 3ZY4A 3NDRA 1JLSA 3SYKA 3MBKA 3ZLVA 5BSEA 4TYNA 1YO6A 1B0ZA 2WTEA 4N5DA 4JI8B 4CM9D 5AVUA 3KVVA 1XLWA 4B3HA 4OX9B 1JFRA 1KO7A 3BGSA 1VM6A 1G59A 4S1PA 2HCTA 3BKWA 5CUQA 3PKIA 1X1BA 1ZL2A 2DE0X 2H31A 1EWRA 3HR8A 4INPA 5DSXA 5DW3A 5BSFA 4DWVA 4WOPA 3ZGNA 2ZROA 1AK2A 5LFAA 2VJQA 4HDCA 2XWPA 2IJGX 3JQQA 4TMXA 4G56A 1NJSA 3PB3A 2W6IA 2GKGA 2Q6VA 4IF6A 2ZSJA 3UB4A 5ILGA 3S7ZA 1OBOA 1FRNA 1X38A 2FN3A 2SKEA 1P1RA 3JVEA 4G5YA 4Q1DA 3W78A 5I4IA 4J43A 1NGSA 1ZSNA 4JC0A 2G4CA 2VNKA 4B32A 4DWJA 1FP4B 4FC6A 4NBWA 3RCBA 4Y9RA 3DBHB 3UKJA 3ZCXA 3ORHA 3P5SA 4XQEA 2J0EA 1XPRA 1WLYA 2AYXA 1CUJA 4QEKA 4DNOA 1FLAA 1XKTA 2J07A 3HCFA 1W59A 3OLQA 4MYDA 2ORYA 3VDNB 2ZDGA 3O95A 4YPOA 3KOZA 5K9ZA 3R3VA 1RS0A 1YCFA 3BIJA 2JHFA 3NHRA 2ESRA 1ZLYA 2EQBA 1Y8RA 2QE7A 2RG1A 2W4QA 1BS9A 1J39A 3P0FA 4JUIA 2VDNB 2R7NA 4YI3A 5BSVA 4I1SA 2P9QA 1DI0A 1AZSC 1W46A 3DV2A 1PUJA 3FA2A 5ENDA 5H80A 1X1DA 2B0JA 2VP5A 3DYBA 3MUFA 2KLBA 4JJEA 3P9YA 4G5GA 4Z8YA 4CMCA 4ARZA 2CV2A 5CD9A 1TMKA 2GEVA 2IGTA 3VHQA 4MUXA 5MGNA 1CUCA 4EYSA 2WG0A 3CISA 3PQ4A 4JLPA 3UJCA 3I6YA 5D7NA 5TVGA 1R3DA 2H85A 5IJ0B 3FDZB 4UAJA 1JE1A 4RGYA 3ZZMA 2VTEA 3D4PA 4PQYA 3ZI0A 4AX4A 2PGDA 1XAIA 2B25A 3BJZA 5DN6D 2KW5A 5AHXA 4DR2B 2CCGA 4EZIA 1JKMA 4U3JB 5D7BA 4DLTA 2GAAA 5DCLA 1BNCA 4J0DA 3RAGA 4BNDA 3ORYA 1NYRA 3KSUA 1WW2A 1ZD2P 5JVDA 4ZEXA 2C5AA 2GVNA 3QNWA 1CY6A 4NWIA 2G83A 3M4XA 1T1RA 3NKLA 3IO5A 3CPJB 3U49A 3LFTA 1G8GA 4I4IA 5E0OA 4BUZA 4PYQA 2QMQA 2VHCA 2J3DA 3GH3A 5DEOA 2P79A 5AI6A 1YUBA 3E1GA 1X7GA 4QNNA 2LWIA 5JYCA 4BVEA 3CLHA 4HAOA 4CLDA 2C42A 4PINA 3B3FA 3EA5A 4KGDA 1J0XO 2MINA 3G2NA 3K8ZA 1ESEA 2GZSA 2X14A 3Q7QA 3PQFA 3TJZA 5I7OA 4IYJA 2ODTX 2QYOA 5CA0F 4WHMA 1CRPA 1F2TB 3UIEA 5BN4A 2WMYA 4YMIA 3SYLA 3KCQA 5AI4A 3AUTA 3FFBA 1WZCA 1IZ0A 1AHNA 1VYVA 2WIKA 3CS3A 1MB2A 2IUFA 3RGWS 1ZIOA 5H9WA 2QORA 3DMPA 1EUDB 1SXIA 3VKGA 5FFMA 1YL5A 1PJ2A 3OWXA 5AKLA 5JSKA 4GF5A 1Y7PA 4X1IA 2I4TA 3O92A 2AR7A 3ZNNA 1EVQA 2H1VA 5BOVA 5AUPB 2WJ3A 1GZ4A 1KO5A 4JKIA 1G9TA 4KVAA 5A62A 3AOEC 3DLHA 5JYDA 2DM6A 2QTNA 4EAAA 2CT8A 3NDJA 3PA6A 3BS4A 3JQEA 2WSLA 3KALA 1YIAA 4UM8B 2E5LB 1KIMA 1Q14A 2IYNA 3S68A 3BIXA 4GQBA 3KOYA 3FUUA 1DBIA 1OB5A 1KORA 4LBZA 3KL2A 5C81A 4AJ1A 3V4SA 3K7EA 4MRAA 3IJ5A 4Q4LA 1YBVA 5JSHA 1ZQ9A 2RKBA 4AXXA 3REOA 4WK4B 2X1HA 5E6RA 1N5IA 4ZVRA 2XBUA 4EUFA 4H1UA 4AUMA 2AOUA 5JDIC 5ALXA 1PSZA 3QFTA 4MJLA 3U3ZA 3M1YA 3ZEAA 3I28A 2VPYA 4JEMA 4LDAA 3QVVA 1U2DA 1T6XA 1XDWA 5TPWB 1E69A 3KB6A 4HJRA 4BQQA 2IEAA 3HXQA 3EAQA 5HX7A 2UZAA 3G0CA 4UPDA 3KKEA 3NATA 4K46A 3JZFA 5AVQA 2IYVA 1YB4A 3KB8A 3SLKA 2YR0A 2PZBA 2Z04A 3I6QA 3IQFA 4QOSA 1XV5A 2WT8A 4EI9A 4U2GA 5KDOA 1S3FA 4DR4B 2O8FA 3FMGA 2DECA 3PD1A 4OHWA 1THGA 4M7WA 1GPBA 4DCCA 4QOFA 4I3GA 3V4ZA 2CFTA 1UXJA 4G8CA 5EEGA 2FXIA 1H6DA 5U4XA 4RDHA 1LF0A 4DKXA 3FDFA 3FKQA 3A14A 3C6QA 1QHIA 1P60A 1K2VN 2VWPA 2AUTA 3B1YA 3HGMA 3N76A 1BH2A 4G0MA 4O2LA 4X1KB 4AP9A 2CJPA 2IEBA 1PQPA 3M3PA 4B75A 4EBBA 3HJTA 2PNJA 3KG2A 1GNPA 3HJCA 4ZYZA 4NEGA 4FS3A 1YFZA 2H2DA 3DWFA 2VQDA 1VPEA 4J7XA 3A6FA 2HSJA 1NF8A 4Q7LA 4UNNA 3TG8A 1VPTA 3KQLA 3ZTWA 1F48A 4B4WA 3OF5A 4DDKA 1S4MA 1TO2E 2QUZA 3N8NA 5EL0A 2WAYA 1E0SA 1NZJA 2DY0A 4J7CA 5LYYA 3TNYA 4EY4A 4YDHB 3E70C 2HO5A 2B2CA 1SVWA 2LIVA 2JB9A 4LOJA 5D3MB 4X24A 4IZ6A 3HKEB 4LZNA 1XTBA 1XU7A 2VPQA 2Z2YA 3GELA 4OHPA 5E4FA 5EEHA 1O97C 4A8JA 2HB6A 2HO4A 3Q6NA 4MW1A 1C0LA 1XJCA 2E1RA 3ICWA 2VP4A 4IJKA 3LKBA 4J0KA 4NJMA 4XLLA 3T4EA 3G82C 3T7SA 2XBMA 4J9UE 4NBLA 3HZRA 4G81A 4Y6RA 1WDTA 1UF9A 3MD0A 1WXIA 2RBKA 2JLWA 4JCOA 2JAXA 4E22A 2G72A 3O1HB 4P8RA 3KE9A 3WL7A 2UVQA 4J3JA 4DEYA 4TMVA 4IV8A 1C9KA 1C41A 3TXYA 3P9XA 1QZZA 3BGIA 4XX0A 4AQYB 4HSEA 1UBNA 4LV6A 3CC8A 3WZ2A 2IRWA 3L6CA 2X9NA 4DIOA 1ZY2A 2HF7A 1RC1A 4JI0B 2E87A 1L8AA 1E9BA 4KE9A 3LOPA 4FWTA 1O94D 3X3HA 1M2VB 1P9RA 1M5UA 2HLNA 1UZMA 5A1JA 3RADC 4K6KA 2BD0A 1DCKA 1Y33E 1D04A 1L4NA 4MMYB 3O8OB 4XWYA 1UKYA 5AYVA 5LQCA 4EY6A 4RHCA 4I1PA 3ZGOA 2JLCA 2Q5JA 3SSAA 5BNTA 3QTLA 4FYYA 3E61A 4B0PA 1CR1A 3COZA 1G4HA 3RRMA 1QAMA 1JSCA 2IPMA 1TAUA 4NBVA 4JELA 4IJVA 3RVKA 3QX3A 1PDOA 1WP9A 1DZIA 3I1JA 4KE6A 5TPZA 4AUNA 4IQ4A 5JS7A 1JIQA 2Y1GA 2JFYA 2O7QA 3DOEA 2DB3A 3DMHA 3LUKA 1AUPA 1NR7A 2CL6X 1UFKA 3DG9A 1KJ9A 2HQSA 3BMQB 4GI5A 2GZ1A 3RRNA 1CX9B 1I7LA 3FE2A 4Z9AA 3WL3A 1ORWA 1WZUA 2ZZMA 4OHOA 1SKQA 4X7BA 2NZWA 3H5AA 2I3GA 1G20A 4UD2A 2XGSA 1U7HA 5BNZA 4OXYA 1LPAB 4BBZA 3MTGA 5JAUA 5ALTA 2Q4BA 2GM5A 3AU9A 1YMUA 1A9RA 3DD5A 3M4JA 2WOJA 2BKVA 3THSA 3DR3A 3IKLA 1D6NA 2ZB4A 3MMSA 5ES3A 3VVMA 4MW7A 1T1SA 2LCFA 2II6A 3NHJA 1R8JA 2WNIA 1QQBA 3IV6A 4TN1A 4YP7A 1QH1A 3M82A 3WB1A 2XSZA 4BV3A 2WKWA 4YQEA 3R75A 1UQUA 1YACA 2H07A 3DO5A 3E9CA 3GVXA 4XJXA 4WOKA 4YJ2A 1RKQA 1X42A 3H4IA 2Y1OA 3HWWA 5LP6C 3T0IA 5K4GA 1VJDA 2EKQA 5H1YA 2CBZA 2YJNA 3LZCA 4YXWA 3VH1A 5AVYA 5G0TA 5EMKA 3QELA 2M98A 4HBZA 5HQJA 4QYIB 4UVHA 1F2VA 4NZPA 1SVLA 1TCUA 3ABIA 2QR2A 3IQIX 4W9NA 3UT5B 4I7EA 2YJ6A 1SG6A 2RAVA 2XTAA 3BZBA 1GQ2A 2IPXA 1T3TA 3KUXA 5ALEA 3RI3A 3GLIA 4I6GA 3X2SA 2P6UA 3ZDBA 1L7VC 2JNWA 2VLBA 3P2YA 4DBLC 5JRDS 2H9IA 1R4ZA 1PGJA 4HH0A 4EG1A 1E2IA 2W6CX 2PL5A 2XDQA 5P21A 3HSSA 1R50A 2ZI9A 3GUZA 2AC2A 3LU1A 5A2QA 1J1ZA 1R74A 4R2LA 2OLJA 4KQ1A 1RYHA 2FG5A 3HRHA 2ZWOA 1Q0UA 2C9BA 4DGSA 4F6CA 1W1WA 3D5QA 1PQUA 5FBKA 3VYWA 1CLUA 4B2LA 5AFSA 1TM1E 2NSHA 3FVQA 5I01A 2FPMA 2EAUA 4UTPA 4YAOA 5ALOA 2YWXA 5BV7A 4HDMB 3MFQA 4PHTA 2XCUA 1SVIA 2EFGA 2IC5A 4K9LA 2BF7A 3P9IA 5LNK6 1NQOA 3Q3CA 4PV7A 5M7EA 1V37A 1I3KA 4IMJB 1WCIA 4BB6A 1U1DA 1VJTA 4IUYA 1MLDA 1AUVA 4WFQA 3R3SA 5EGSA 2X15A 5F77A 2ACVA 2O19A 1R4MA 4O33A 1G41A 5CURA 5F4BA 1AA6A 1MNAA 5BNWA 3IOBA 4LGVA 3SXUA 1G8PA 3G1WA 1KJIA 5FI0B 1FX0A 2UVPA 3EW9A 3GN1A 5F9MA 4DB4A 1IIBA 2NXWA 2PT9A 2QZ9A 3M1LA 1WX1A 3P0JA 1T0PA 4JKOA 4ZAYA 3ABSB 5JSUA 2O6LA 4LHZA 3GQBA 1C1HA 1YQGA 4OGLA 1RABA 1KI3A 1EDZA 4BNNA 3TAHA 1X1RA 5EGNA 1E99A 1AS0A 3FHJA 3MS4A 3R5KA 3C5VA 2QRHA 3TUJC 4I9GA 3LS2A 3UWPA 2B9VA 4JMPA 4L5BA 1ZM7A 5KVQA 3UK1A 2O5RA 5HFNA 1MC8A 3RUPA 3DOOA 5C1PA 4GGOA 2P9ZA 2PJUA 1SU6A 3P0RA 4HB2A 3I0NA 2AUNA 4MUJA 3VOSA 5FUYA 2XCIA 3WL6A 5CH3A 2GLUA 2QUBA 1KI8A 3GPBA 1QFJA 5TF4A 3W2GA 2Q1TA 1RQRA 4FW8A 3FWNA 1FU4A 1R5JA 4Z7NB 2VZEA 4WZBA 2ATCA 5LA6F 1FK8A 2QTAA 2MSWA 4A8TA 1XSEA 2VZ9A 1XF1A 1TJ4A 1G8AA 5B4TA 4RVNA 1DLJA 2R1VA 3EDRA 3M4ZA 3JAWA 3ROFA 2NU9A 1B43A 3ZBQA 5L9AA 2QE6A 3IFSA 1Q0ZA 3ZHYA 4M86A 2PTGA 2HSDA 3QFSA 4X93A 1T36B 1B6TA 4O0MA 1MIOA 2OBBA 3QVGB 4GSYA 4D96A 1E6LA 3KELA 3GPLA 4LF4B 3DCYA 3QHPA 1GSIA 3FCYA 1YBHA 3QVXA 2Y1XA 1R0SA 3LRTA 4PZ0A 3S27A 1DAFA 2VJDA 2VDVE 3FSRA 3LDUA 2IE0A 3HJHA 4RPKA 4QBFA 2F3QA 2EGHA 1NJ1A 1W8DA 2PBRA 4D9KA 1PJTA 2G0TA 1U2TA 1GFWA 5G53C 3VH4A 4B3SB 2FSIA 2PSHA 1W75A 3RYCB 1J8FA 3QE0A 2FFHA 1LPMA 2JIRA 4LCJA 5A0TA 2DHEA 4ESHA 1YS2X 4NBSA 2FZEA 3CJTA 4I5FA 4OATA 1EFVB 4F3YA 3L43A 5EIBC 4H08A 1QRUA 1JAIA 4RVUA 5EYPA 3W2FA 4GW3A 1ENZA 4P82A 1SGWA 1JEAA 5LCXA 2FRDC 1UBCA 3TB4A 1EFHA 4LYDA 3I2FA 1Z15A 4ATNA 4C7XA 5IYZB 3CKMA 1H0KA 3HY3A 1ZA1A 4R7GA 2EIXA 4R83A 2P9JA 4MVXA 4XIFA 1H4TA 4I08A 4L3WA 5IJAA 2VTKA 4BNHA 1MJ5A 3H42B 1XD9A 2XMQA 1W4CA 4BMNA 3B89A 4DCVA 1FMFA 2IYTA 3SF8A 4GSKA 4HPWA 1JVNA 1VG0B 2DR0A 5IDVA 1K0FA 4NFHA 5ELMA 5E38A 1OF1A 1P77A 3GLQA 2YV1A 2O9JA 2P2CA 2BMWA 4ND3A 3GDOA 1R7RA 1ZMBA 1ND5A 1PO7A 2QIOA 3LWZA 1Y4SA 3K5PA 4UE3S 1PNTA 3AFOA 3AVPA 3DBOB 1RYBA 4Y9TA 2YUIA 5DBIA 4MRNA 4C3ZA 1DHRA 1YS7A 5B1HA 5L4NA 1N2XA 3JATB 2P6MA 2PUHA 4U2KA 4UU1A 4RTOA 3WBFA 1ODCA 1UKCA 2D1YA 2D1RA 2J3LA 4LRUA 5SYMA 5JZOA 2MSLA 1MABB 4LV5B 5JAOA 3J80A 4RD0A 4K3UA 3UOGA 1KQOA 1YA4A 3NHZA 3WJ1A 2AOWA 3CTPA 3ZYZA 1BCSB 5D01A 2Q3HA 1JXQA 2W2LD 2XAAA 4LN1A 5J5AA 1KH3A 4AY4A 1LEHA 1EVEA 2QZPA 2GO7A 4U7FA 3T5CA 3TLGA 1J9EA 2K2WA 3BTOA 2OHOA 3NHLA 3N0RA 2AF3C 2XVZA 1H23A 1Y6QA 3H05A 1G1MA 4QFCA 1DELA 1G7CA 4TV8F 1OY1A 4OQNA 5FOVA 1V6CA 3WNDA 1EXNA 3LVRE 2R7KA 5ECWA 1YDEA 2OCIA 4I36A 3TGLA 4BJ6A 3GVHA 1U7DA 4BVJA 3HFRA 4WNAB 3TVDA 1PV1A 4D80A 4C20A 3K0EA 1R6AA 3BQMB 3KSZO 2WIBA 3MOSA 3PR2B 5TR9A 2XD4A 3K6JA 5IF9A 5JAZA 3CTMA 3OC0A 4RZ3A 5JZVA 2D4AA 1XXHE 1L4UA 2Y76A 4GPD1 3D2CA 4JL5A 2G17A 4DA4A 3GJSA 2EF1A 4MGKR 1J56A 4IQFA 4NBUA 3V2GA 3NZEA 4RDCA 1V9SA 2C2GA 1U4SA 1ZJ5A 2A57A 2XLBA 1D2RA 1DV2A 1KJYA 3TAUA 4DLPA 1VFNA 1UBMS 3NETA 1CY0A 3V8RA 3ZY2A 4XE5A 3LUFA 4MGIR 2R7AA 3HVJA 2C78A 1JU3A 3MZ0A 4RY0A 2AT1A 5ETJA 2HDWA 4X94A 3OPYB 4J4BA 4NPAA 4ZT2A 3NC0C 1X77A 4F9TA 1ADFA 3NJ4A 1UWLA 2F3UA 2B4KA 3UHPA 2IEYA 1MEOA 3NPMA 5KNDA 3CXRA 2OESA 4QHSA 2ZJOA 4LCEA 5L8VA 1A82A 4GLFA 4BKMA 3H2YA 1NF2A 3HUEA 1KSGA 4CR8A 2WAXA 3T7TA 1TZ2A 5I4KA 1T4CA 3SP1A 1Z8HA 2FEXA 2XYPA 5FBLB 2XXAB 1JR6A 1PZNA 1LLUA 3PC8A 1V8BA 3A1UA 1N2BA 2OC9A 3L82B 1GPKA 5F1YA 1D07A 1X1AA 2IHKA 3F6PA 3PLRA 4XAQA 4AZ3B 1NA5A 1MX5A 4URFA 1F4LA 2QAGB 3BDIA 3GJTA 3O9MA 4G0PA 5DRYA 4M0FA 2WPNA 2I3AA 5CVVA 3FNHA 3KUUA 5DNDA 4F12A 3MAJA 2ZSBA 1NQWA 1YR7A 3SZMA 3H86A 4QRHA 2JH3A 3QP9A 4QE3A 1Y4AE 4ZAGA 4QG7A 1ACMA 4EG4A 9MHTA 4DSNA 3TFQA 3L0DA 2VPTA 4FDUA 1GG9A 2P3QA 4MWDA 4B7AA 4Z7JA 3GI1A 4P3YA 4J2TA 3H65A 1ZNQO 1O8BA 3GR6A 3I12A 1E6MA 4KSYA 2IOFK 4QECA 4ZVNA 3H9QA 1NW6A 3K16A 3ZWNA 4HEA6 3LPMA 4WD3A 4D4HA 1IJBA 1Z0IA 3RHTA 4QM6A 5KREA 2HUNA 4WNCA 1HLGA 4G0YA 1KZHA 1N6KA 3R3YA 4CQMA 3NOQA 4YYZA 4ZZIA 2PYZA 1EPUA 3RDPA 1GAEO 5U9CA 1QE5A 2J9FB 3DR5A 1LDYA 2ZPUA 4V38A 5E3JA 2D2FA 1T3GA 1FL9A 1MB9A 1THMA 3WWYA 4E5DA 4LMRA 3CNEA 3UN1A 3R6GA 2O2HA 1JI3A 3GLFE 1WPQA 4MDFA 4YJ3F 1BE1A 5IXYA 1W5BA 1BXRA 1F12A 2E48A 3CUSA 3ZR4B 4LNUA 5F2EA 1FJ2A 1BMFA 3QQ5A 3X1ZA 3H5NA 5A5VA 2C5HA 2O8BA 2YWRA 4D4GA 4MYTA 3WRXC 2VJMA 5J40A 4Q02A 4BRWA 1JPUA 5K0FA 1GFSA 3ZE8A 1F7UA 1EBBA 1XGKA 1K98A 1Z37A 2HIAA 2WWFA 4G5OA 1KO8A 4LWZA 3SPXA 2HCBA 4BV2A 6ADHA 4MNTA 2YS7A 5KMGB 3C6YA 4G4SP 4TROA 3WLTA 1OBVA 5HVNA 1Q6ZA 1X3SA 4OJTA 4RDXA 1YRBA 4FLMA 1PJLA 1WUJS 3O21A 4WZ6A 2G09A 2XMGA 4ZP1A 1KAEA 2LXNA 1T29A 1XHEA 2W6JD 3CR8A 4YAIA 4DC9A 5JYBA 1NBHA 3M4YA 4P34A 5KSPA 5J43A 5B3LA 4KPUB 4MKZA 1JGTA 5HE9A 1U9JA 1GFZA 5KNCA 1NMXA 3E5MA 3RS7A 4QHTA 3EEOA 3Q3GE 3IQDB 4PR0A 3TD6A 3ZG6A 1YOVB 4PX2A 1YE3A 3FOEC 2ID8A 1Z82A 4IO0A 4I8XA 4E08A 3E84A 3PQEA 2HRQA 1YRYE 1HQKA 2X6RA 3GHYA 1RCFA 4QG3A 1DO0A 3VGPA 4H15A 1I0ZA 3K0FB 2OM2A 2G6TA 1USIA 4AC9A 5B6PA 2B82A 1HFWA 1NQ5A 3ZW9A 4RF4A 3SF0A 3T61A 4L5YA 4DHEA 2XZDA 3GIWA 2WF6A 1RI4A 2DEUA 13PKA 1NWHA 1OTHA 1VI2A 3W9UA 2BI8A 3RYCA 1X2BA 3S29A 3SFTA 1YE8A 3AM5A 3ESCA 3MERA 3YASA 3M1AA 1ZINA 3EVFA 5C0OE 3U7IA 3VDXA 3MTEA 3USZA 3BD6A 4CR7A 5K6TA 1UJ6A 3IMKA 2DLCX 3FLMA 1EZ4A 4OA5A 3KWJA 2FW9A 4WQMA 3ZVMA 3A1WA 1C1DB 3BB4A 2CF6A 4TS4A 4MYRA 3EPKA 4NI5A 4PFSA 1QV9A 3LT1A 1DKOA 3QVMA 4HR7A 4MRMB 2G5TA 5LA6A 4BMDA 3NGLA 4BNGA 2OOSA 3NWOA 3P2MA 4EGSA 3LUPA 4YVFA 2ODEA 3GGOA 1VYUA 2IU6A 3I4CA 1HT2E 2V9PA 3DEYX 3EUAA 1AB6A 1C8BA 3H2BA 4FNOA 5F33A 3WLMA 3DQZA 1Y9JA 1WCV1 3DDHA 5DYTA 4A8HA 1DQNA 2JLSA 1CVRA 4ARBA 1B74A 1NXVA 4XM2A 3UJ3X 2OVFA 3WAKA 4OVKA 2X19A 5TDHA 4D9GA 5A3SA 3UJNA 4B73A 1MQAA 3WIBA 4F6RB 1NAIA 3BGOS 3AR7A 4MB2A 3RUCA 2ZPAA 3MQFA 5JDCC 1RCUA 1RP7A 2C00A 2YWEA 4WWHA 3RRBA 1QU3A 1E1YA 1LBIA 1AKTA 3HKDA 5K0JA 1Y6JA 4RVOA 3T15A 2EARA 5F35A 3W7VA 4MLDA 3HGTA 2HFKA 2OD2A 1FMCA 3E9EA 3JZIA 1ZH2A 3WNZA 4N03A 1K5HA 1SBHA 2DULA 3ST7A 4DLAA 1Q91A 3FPAA 1MO2A 2XYHA 2OA0A 1H2RS 2ILTA 1FS5A 2P8SA 1M54A 2QPLA 1MOSA 4O4IB 1XD8A 1H2YA 4R1TA 1BRTA 1O5TA 1H0RA 3ZV7A 5IVIA 2ZE6A 3BERA 3WGYA 4R7TA 2VR1A 3RVPA 4BFTA 4OJMX 1L5HA 2AVDA 4MJXA 4LKRA 5K2OA 4WV3A 5A4MS 1IN6A 2H5IA 1GT6A 1SD5A 1TEVA 5D86A 3TEJA 3C3CA 5DKFA 2Q6OA 1P39A 3LY5A 4AULA 1ESNA 3G9QA 3LC1O 3N58A 1N0WA 4B2IA 3SC3A 1UK9A 4N7MA 2NPFA 3V1UA 1EHIA 2HN9A 1M8PA 1KMMA 1VPDA 2XOEA 2CB9A 4RVCA 4QJ3A 4XWKA 1VZ2A 5KO2A 2F8TA 1F8YA 2NYUA 1F8XA 3GD7A 1S3SA 2EERA 1ECBA 4OFBA 2NVWA 1E7SA 4D0LB 3B3QA 1Z88A 2J6IA 2QQ5A 1WSAA 2IS6A 1MO4A 2I2BA 4ENWA 4CF3A 4DRXA 4D57A 4ENQA 5FTNA 1RRPA 4KI7A 5A4AA 2JCGA 3E5NA 3C48A 3BMCA 1CETA 3Q9SA 4CUJA 3JYPA 1GTG1 1M8KA 4I4TB 3N8GA 4NG5A 5GINE 2BPOA 1G3QA 1ZVJA 2V5AA 3QU9A 5H59A 1FPMA 2R1TA 2RIPA 3F3KA 5HF8A 2AFHE 3V4LA 5HF9A 3S44A 2NM0A 3A6DA 3ZUGA 3K72B 1P2BA 1HRDA 2I1LA 4LXXA 1FLDA 2JKYA 4DLUA 3LW8A 1V3TA 2ODPA 5FQNA 1XAGA 1OC2A 1BU5A 3VKFA 1Z3CA 2H1CA 3RSSA 5J5VA 2Z4TA 3UNXA 1PVDA 1I1HA 3N87A 5TC4A 5JQGF 2MDTA 4EG8A 3BFXA 3NJRA 1XN4A 2FGJA 4FZ5A 2ERYA 3E9MA 4TV8A 1OLOA 3EX7C 3KYBA 3DFUA 4Z3DA 4AB1A 3SHVA 1D5WA 2IU3A 3FLBA 3Q2KA 4RK1A 4DJAA 1J00A 3DXXA 1ZZGA 3DPSA 3MT9A 4UPVA 5FYQA 4DJFC 4Q12A 2H5EA 5HF5A 3O1LA 3U62A 3OQNA 3LKVA 3ZDZB 4FQ7A 4TZTA 3ZU5A 1XDDA 4LTNA 4M1YA 4U7PB 5CHYA 3IQWA 1YVDA 3FOWA 1M0EA 2AL7A 3L8HA 3VJMA 1V7CA 4AMVA 1BD3A 1R0RE 4GZ3A 4WY2A 1APBA 3MJHA 4RD2A 4PBTA 1Q0RA 3PNSA 5LUAA 2EWWA 1M10A 5KYUB 4IOJA 1T0HB 1UP6A 1HQCA 1GXSA 3GVCA 3M6AA 3OLZA 1DAGA 4QXRA 1L1FA 5C46F 1X7XA 1ZK3A 3DXFA 4OP2A 4RKYA 4WEQA 3EIWA 4RM2A 2DJ5A 4RK5A 4IZHA 4IH1A 2YWGA 2QUJA 3EWSA 3NIBA 5A2GA 3I9JA 2W0SA 4FKMA 2H1OA 2Q46A 3CUKA 2WSIA 3VO1A 5BW5A 3CINA 4L08A 5C80A 2CHUA 3GLHB 4LXTA 5HS6A 1EG7A 1ICEA 4CKCB 1OVMA 4ALIA 3ZZNA 2VDKB 3L0SA 3WJAA 5HW0A 2X4GA 1GA1A 1KC3A 3PENA 1DJPA 3BUSA 1X7WA 2BV3A 2JFQA 2KLHA 2RH8A 5ARBA 3SD7A 2QR5A 1HG0A 4O08A 2H4FA 5KQPA 1BZYA 4HNAA 4MVJA 1YZLA 2GS9A 1OB2A 3Q7PA 5FJJA 4KPFC 1R2QA 1VHJA 2Q3MA 2YWCA 3UHFA 5BSMA 3VJLA 4OQYA 1HDIA 3GLSA 2FCRA 2FMFA 3ESAA 2C83A 1QHFA 3OMWA 1L6RA 4ND6A 4AK9A 2ZYRA 3SR0A 1J2RA 1NASA 3ZDEA 5B3JC 2P11A 1E6KA 4S3MA 1DBPA 1W4AA 1P3Y1 5F2OA 1OH5A 5ARDA 1DGQA 5DSTA 3KU4A 4P4TA 4FMCF 4TLLB 2OZPA 1N9ZA 2OCGA 5FPPA 2WHRA 4C6RA 1ZGCA 2FE4A 1AGPA 1EHCA 1C0IA 2OYRA 4HYQA 4GBJA 4JA2A 1JS1X 1TECE 1DS6A 4NICA 3CZ5A 1BN7A 4RMHA 4YUWA 4P1ZA 4LY3A 5DNVA 5FIUA 2Z2IA 2V6IA 3AVOA 1PS0A 4C03A 4DJJA 3IURA 1UPXA 2GCOA 3NFRA 4X0EA 2PZMA 2YRFA 1AGXA 2JLZA 4CGYA 1B23P 4E07A 4HFJA 5I7AA 1IZYA 3DE1X 4YUXA 6CHYA 4XGNA 4YJ3A 1UMDA 4DA6A 3VYTB 3ZVRA 3K0HA 1C4KA 3BWBA 2WD9A 1XQXA 3GJ7A 1PKXA 1TUEA 3N0XA 2W6ID 2WV9A 1P7YA 1I36A 3ID6C 3QEKA 3GDHA 4BX9A 1T8SA 3AERA 3KB2A 3P9QA 4GXRA 4Z9YA 5CLJA 1ZN9A 4DY4A 1DXYA 1H1LA 5I7WA 2JFOA 1LKZA 3AUJB 4XQGA 4LVUA 1XJWA 2C8JA 1ADBA 2VDRB 5CT4A 4B3FX 3GGGA 2ZXUA 3PNYA 1A7AA 5K3SA 4Y2SA 1OLUA 2XVYA 3QX9A 3DZGA 4JDUA 4N0PA 2C61A 4TTVA 4X6UA 1ZVVA 1P61B 1IAVA 3OE7A 4ARZB 1W0CA 2C98A 4E2ZA 4NE2A 3HB0A 1ODKA 2GK7A 1FNSA 4OHZA 2BCEA 3RU7A 2O4UX 1UC8A 3VU3A 3FYCA 3KWLA 2R4TA 1PZMA 5CYFA 1H2EA 5I9SA 3TL3A 5FTLA 2QE7D 3JTEA 1DAOA 1EUQA 1TPYA 1PT7A 1DBRA 2V3WA 2CUTA 1E1NA 2YN2A 1R6UA 3EMDA 1SELA 1G2QA 3NYWA 4QOEA 2QD1A 3H8JA 3L6UA 4UHEA 2W2QA 4BNDB 4Z2YA 4HVCA 3OE1A 4IDQA 2YFYA 1E9VA 4CLOA 4JIGA 5BW8A 4MAFA 5JVDB 3L4KA 1B8PA 3PLNA 2D00A 4ID9A 1IDOA 2JCBA 1KXJA 2REQA 4ZVUA 3SZLA 1NN3A 2R6AA 1VXOA 2BMVA 1EVLA 3HZHA 4PZYA 2UZ0A 3INNA 1QTNA 3OIFA 1HZZA 2Q7XA 1UFVA 2MMGA 4I4CA 5EP3A 3HXLA 5G2OA 3WISA 4COOA 3H5WA 4RPGA 1IEWA 1UXIA 4CW7A 3N0TA 1J6UA 1OV4A 2MINB 2AV6A 1XT6A 4WINA 1HSOA 2QGNA 2WF7A 4XUGB 3OP4A 1N5LA 2QTRA 3A4IA 3HCEA 3HA3A 1MPXA 2X0JA 4WXPA 3UV6A 4D42A 5KYWA 1E5QA 4JX9A 5BN4B 3OD5A 1D6JA 1B0AA 3FDXA 4C7OA 3AF3A 1KEEA 1I7PA 4GDFA 4K1XA 3Q10A 3IEVA 4KQKA 3WNVA 3L6DA 3LKZA 3LI2A 3H5RA 4XLTA 1MAVA 4CLXA 1PWXA 3DV0B 3G7SA 3L0BA 1NUHA 3DMGA 3DMTA 3JYOA 5HA5A 4E0BA 2DY1A 4X1IB 5F5XA 1OI7A 3BE5A 2QMYA 1TEHA 3W90A 1ECFA 1QYWA 1LQUA 3RIYA 1BS2A 1AKUA 1JUDA 1TQ8A 3E2PA 3VV2A 4A26A 1TA4A 3NAZA 3MXOA 1XRMA 3MBOA 4LECA 3V00A 5HIKA 3QE2A 4X20A 1PEKE 1PFVA 2R9VA 1C9MA 2RGEA 3H3FA 4R8LA 4RS4A 2G71A 5ADUS 1IYZA 3H04A 3KZNA 3P2EA 1LDGA 3UJ7A 3JQ7A 2A4KA 3EE6A 3EAFA 2NP6A 1C7FA 5KHOC 4EYQA 3JALA 5E6RB 2IW1A 3DHWC 3EUEA 3N0WA 1VKHA 2YW2A 3ENQA 1P0IA 2AOUB 2FEWB 3Q7IA 3QFCA 4IGEA 2IUTA 1CS0A 1R8SA 1U31A 4B8WA 5A4IS 4WKBA 3BXXA 3LUCA 2XIQA 1KNQA 3TZBA 1YS6A 4ZI5A 3PI6A 3NBYC 3HNOA 5AESA 5T7BA 2F7SA 3CF6R 1O9HA 1UK8A 3OHMA 4OHUA 4A8PA 1S3GA 3MHTA 3TUZC 3P2OA 4LBVA 2DHQA 2ACWA 2VPPA 3JQ9C 3H9CA 2GLTA 3QLVC 2WJPA 1FFBA 3TX2A 1T4GA 4DZTA 3HI6A 1LVGA 2O8FB 4JVMA 4PX5A 1OXKB 2P9FA 3ZCTA 1FDRA 3CUWA 3E27A 1CZUA 5DXJA 1NLUA 2HDHA 2O2EA 1E2KA 1QF7A 2O2GA 2XTJA 3SYMA 1AF4A 2R6R1 3K53A 3OCJA 3B52X 4EW6A 2CHFA 1N5DA 1HH4A 3SFZA 3ADPA 5DLYA 3ZWAA 1PR9A 2BR3A 4XRRA 2VEOA 4MWCA 3F3MA 1E58A 4UU8A 3HFGA 1Q1EA 4XA8A 1LLFA 3AF5A 4GNKA 2HGZA 1U9ZA 3W4IA 2J32A 1J21A 2M1XA 4CQJA 2SECE 2X0KA 3IGFA 1JVSA 2A5LA 4B5LA 1K75A 1QIHA 5LQMA 1U9YA 3H5OA 4E30A 4EVIA 4HK4A 4K88A 2HQRA 3W6ZA 5C5CA 4A8JB 3QYJA 2R8ZA 1ISHA 1D7OA 4HUJA 4I3HA 4CMJA 4D7AA 4TTQA 1DB3A 2GAFA 3HVHA 4NJMB 3T54A 1KSHA 3QFRA 2ZWPA 3EXG1 5E6UA 5LBUA 1IONA 3HWRA 1Y1QA 4JLJA 1L7BA 2J09A 1T6YA 1ZD1A 1NC1A 3NIWA 1DU4A 5DOVA 1O94C 2B83A 3BXGA 3DDSA 4UVIA 2PVSA 2SHKA 4CI9A 2DOKA 4AYTA 4UQLA 3AO0B 4JBIA 3KQUA 1WY7A 2VBFA 4GECA 1IPHA 1W36C 4YRBA 4FVTA 4TOIA 4JYBA 4D9NA 4I5IA 4YO7A 1D2AA 4L4XA 1JJAA 4PHGA 2C2XA 4QEZA 5JQGA 3T4UA 4CKBB 5BQFA 2C8VA 1FVHA 1NTOA 3KEOA 2ZI7A 3O5AA 3LH5A 1QTRA 4FGUA 4RFVA 3RGGA 3RHSA 4XUEA 3RBXA 3NBUA 3QA3E 2BKUA 4AIRA 2AN5A 2OO5A 4OQXA 4H1WA 1KMIY 3NDPA 3ZD6A 1VKRA 3D2BA 3GJ4A 3KJQA 5CLGA 5CFNA 1JR3A 2RJOA 1JXAA 4EHHA 5LLDA 2WF8A 1EVYA 1ZX1A 1KAMA 2QG9A 3B8HA 2IYFA 2XMRA 3JCZA 1D0SA 1RJFA 3QYFA 4G97A 1ESZA 4QGFA 1X39A 4YLGA 3W6UA 3G59A 3QKUA 4MTLA 3R7AA 3PYLA 4MYUA 5DGCA 4Y2YA 3I9NA 5G1OA 5J3JA 4ABTA 3AZQA 1XLUA 4MQEA 1HT0A 1INLA 2XLCA 3WV5A 4EQ6A 4GX2A 3RFCA 4S1NA 4A03A 2QGFA 4FN5A 1YQWA 1PCXA 1B16A 3GA5A 3OCYA 4FZRA 4WCDA 1UCFA 3EG5A 4MJ7A 4UNIA 4BU0A 1G20B 5ALFA 3TOSA 1UZNA 3VNVA 1I4WA 1SIBE 2PX0A 1IDN1 4PZ9A 2JCVA 2CMFA 2O54A 7YASA 3IXQA 1MVNA 3PX2A 3JQFC 4H3SA 4LJRA 1X1TA 1ZWLA 3A04A 4UTVA 4D45A 4ZEMA 5K0GA 3AY0A 2WKPA 5F52A 2QR3A 2WIDA 3RAFC 1RHQA 4KCGA 4EP1A 1MRZA 2VHQA 4QDUA 2A9FA 4WLEA 2OCBA 3I04A 1XZHA 3Q9LA 1QH1B 3QIVA 4LPKA 2BY4A 3DLIA 3T9FA 3UICA 3UK0A 4TV9B 1S5PA 4YJ2B 5KWEA 3T7KA 5JJIA 1ELOA 3LCJA 1XHFA 2H5JA 2XUHA 3KR1A 1KAQA 5CLQA 3I62A 2HGSA 3HL4A 5DTQA 1EFTA 3JR3A 2F6RA 2RKWA 3QELB 4GLOA 1IFXA 3MXTA 5GY7A 4D44A 4JT2A 4YREA 1YDMA 3HYCA 3VPCA 5AW7A 3FCOA 1T1EA 2E4YA 2H0RA 3X0DA 2CLHB 1RPJA 4AM8A 3CVOA 1XDSA 1JLLA 2XGMA 4FP9A 4HQKA 3GLIB 4DDVA 5E3IA 4J1TC 2C1XA 2IYUA 5K01A 1W29A 4MPTA 3LXXA 2W5UA 5L7WA 1R37A 2FG7C 4BO6A 4YXWD 2XDQB 1D4AA 3KT0A 3KTFA 3BH7A 4BLUA 1VJGA 3H9EO 1XLTC 2Q41A 4FIZA 1JSRA 4XQCA 2IBTA 1N7JA 4KWEA 5TE9A 1XCPA 2X3UA 3CIFA 3GFPA 1F9AA 1E1KA 1E2HA 1MXHA 5LQKA 2NPOA 3C6BA 4EKEA 5G3YA 2IUYA 3L6OO 1YZFA 4M1QA 1M6NA 4Q1BA 3PUKA 4RCVA 1U9IA 1VMIA 1WCIB 3R40A 4TMYA 1XP5A 4RE6A 1X1SA 1XMXA 2VRCD 1R4MB 2HW8A 1O6BA 4HXGA 2IW3A 2ZSHA 4WJZA 4C7JA 1YULA 2MWMA 3W77A 4OA8A 3LCRA 2CUKA 1FX0B 5EWMA 1BX0A 1TF5A 4UEOA 4AECA 3QENA 1Q16A 4KL8S 4K5QA 4ANFA 5BV1A 3GQBB 3A9TA 3QLUA 3X1JA 4BP9A 1M1UA 4UE2A 4O2AF 2ADOA 2JIZA 4HAZA 3W0LB 2O05A 4CYMA 5B7GA 2ERCA 4R7ZA 2VHUA 2RIRA 1G0NA 4H4CA 2E4ZA 3LQKA 3KXKA 4IKEA 4H16A 2B34A 2OGUA 2CLLB 2VUHB 1P19A 4ARUA 1GSHA 2IK8A 3B5EA 2RGNA 4PLGA 1KARA 2CV1A 1G3MA 1IMOA 2HQBA 3JSXA 4P93A 4H27A 3DZKA 4DB2A 2RHLA 1YKGA 2B5OA 4IUDS 2BISA 3X1KA 5BV8A 2OHIA 3TLEA 3JQ6A 2Q07A 3NO4A 4JYMA 1M0SA 1SCQA 3WZMA 4LNAA 4WZBB 5EE1A 1LFAA 2A78A 3CH4B 3EXG2 1M8JA 4XJSA 1A9XA 3EZ9A 3OESA 1VHWA 1BEZA 3CEMA 4IZIA 1BA3A 1U3FA 2C5GA 2QVLA 2UYOA 3JAWB 3O8BA 2NU9B 3GW8A 5GONF 2HWKA 3HY4A 3CWCA 3V9PA 4BLQA 2ODWA 1L6IA 1HEUA 4NCKA 3FIUA 3UAXA 3DL0A 4NZZA 2Y68A 4CDNA 5L3VA 4MS4A 1GEEA 3GEEA 4J9VA 1LWOA 2QD2A 2PGOA 2J85A 3GO4A 3V97A 3KQYA 2PEYA 3DZ8A 2FPXA 5EIHA 1X7ZA 4PLHA 3R7WA 4R0VA 4S0XA 1V45E 1JFLA 5NLLA 1KEPA 2GCIA 1IWOA 3D4LA 1Y8ZA 4FCCA 3TCXB 1KOJA 3PJEA 4F4DA 2RONA 5H0IA 2F1HA 2CW5A 3IE0A 5FXMA 3T5DA 5EJAA 3HEBA 1YJCA 5K0TA 4MV7A 4O29A 1B00A 4Q34A 1TU4A 2E55A 2B7LA 2QAIA 3RBZA 2AKYA 3CX6A 3D8SA 4BQEA 2RH4A 1FX1A 2HA0A 4XGIA 5ALQA 4HTFA 2K7FA 3TJRA 4X61A 5HCUA 2ZJ3A 4Q18A 1T3SA 3GRUA 5BUZA 1V25A 5EYPB 3WOVA 1RYNA 2QPAA 4CIYA 2RI6A 4QFDA 5CNMA 1Y4UA 2J87A 4G2NA 1LB1B 3MMPA 1S96A 2POCA 2X86A 4E2XA 5BRAA 1OYVA 1N2JA 4HG2A 5GJCA 4RTRA 3P9SA 1LSOA 3VSDA 5CCXA 1J49A 3LCMA 3B78A 4UM9B 1QGUA 4UATA 3ROQA 1K89A 3IPCA 5KINB 4NONA 5BSTA 3SF8B 2JATA 2EJTA 2A5FA 3AIMA 3ROGA 5LWQA 1VFPA 1HPLA 2GEJA 1YK1A 4RHXA 4BV9A 2OFPA 1P1CA 2P2DA 3WLAA 5AI5A 4B8ZA 1RLUA 2IE8A 2FOIA 4YMHA 1KJNA 3FH0A 1VMAA 3COJA 4J16C 3RSOA 3IP8A 4I1VA 4AKEA 2F48A 2P3OA 2PJDA 3I01A 2PFGA 4UM9D 2XTMA 2PHZA 3QWAA 4QJBA 4MEAA 4G1UC 1FUYB 1X0VA 2RHCA 3EJ6A 1BDMA 1E6CA 2G9VA 1RZVA 3Q1KA 4OH7A 4ABYA 4YRRA 5A0VA 2R65A 5JW6A 4FDTA 4TTAA 4CR6A 3EDCA 3VTKA 1YZQA 3NT5A 2X1MA 3MRXA 3OLCX 4IMRA 1KY2A 4XCVA 3KQNA 2IYPA 2WLSA 4R16A 1G291 2ECFA 3EZFA 1VIDA 2ZXEA 4CI0B 1TX4B 4BAUA 3WFZA 5BR1A 5B7PA 2H2HA 3IMGA 4Q66C 3OT1A 1CJUC 1K7EB 4KNWA 5AIAA 4D1YA 2B2NA 4NV1A 1FDVA 1CY1A 3LX4A 2B98A 4L02A 3GY0A 3TLGB 3TTXA 3FCXA 4EEZA 3I0MA 1V41E 2IA5A 1CFZA 2Y93A 2ZJYA 5CLIA 3WB0A 2GBIA 1WXGA 3W3ZB 4E4RA 1WWKA 2GX6A 4GAEA 3EAGA 3WGQA 1KAOA 1YZNA 1E7WA 3C1UA 3I9KA 2PRSA 4IDDA 4QT0A 1N36B 3RKUA 1T26A 4BMCA 2H08A 1HT3A 1PGNA 3LA8A 2OT3B 3B3GA 5ESWA 2GAIA 3F9RA 2FKAA 2AVNA 4I3FA 3VU9A 1KI9A 2H4ZA 4FFOA 1Z34A 5IZCA 3PPWA 2SICE 1DTWA 1HMPA 1P4RA 2J9GA 2NVOA 2VH1A 3PHCA 4W5JA 5IVPA 2HC9A 4G01B 2XADA 5D6OA 4ZJUA 2DUNA 1GKIA 3D6MA 4XPIA 4CZ2A 4FW9A 1UZAA 2FCAA 5KSYA 5KJ1A 5EUQB 4BVAA 5TEWA 3OBBA 1IJKA 2QI9C 3CUVA 1CR2A 3WWZA 3NASA 4CCAA 3TLJA 1CF4A 4RTJA 1BXZA 3BFJA 1RI5A 2DT5A 5MGBA 1I5EA 1OXUA 3K1AA 4E15A 2VOJA 3PFNA 3ZHSA 1LLCA 3AEZA 4M36A 5JUWA 1MPTA 4UHBA 2X0EA 1MW8X 4EGJA 1ISJA 4QDXA 3VC3A 3F9IA 1OBHA 2C03A 1QR2A 2FRVA 3K71B 1U2QA 1XMSA 3MCUA 2P3SA 2XUFA 3LT0A 1E98A 2P91A 1XMOB 1GG2A 4WZAA 1BEEA 3WLHA 1KS9A 1GVHA 3AI1A 2V03A 1T3LA 3OJOA 3FI9A 3RG8A 1SJ9A 1Z62A 3OZIA 4GOND 5EFZA 1LS6A 3F4BA 3BX1A 1NP7A 3UZUA 2W4MA 1P31A 3DBLA 1E9FA 4JYAB 3MFYA 4RHUA 5KNDD 1VRCA 1UBLS 1V0JA 3C39A 4DM4A 4ZAWA 3W5IA 2QJOA 1FS6A 4AJHA 4D81A 3CNOA 3L07A 4HD8A 4MH0R 4ZYTA 1VG8A 5IP5A 5WRFA 2Z9DA 3TTUA 3TSWA 4YY3B 4LDQA 1MUUA 1QP4A 4ZCTA 5AW1A 1UMCA 3BILA 2OYSA 3NHUA 4R8RA 2P5TB 5EJEA 4W9RA 1SXQA 4QULA 3BK2A 1G21E 5DX1A 1C4OA 2AC4A 3E9NA 1N2CA 3EISA 2YL2A 5CHEA 4F71A 2BCGY 1KKMA 4D8WA 1EFAA 4GYWA 1ZS9A 3AVUA 4Y1EA 1G8KA 2FU5C 2Y9MB 3D59A 4CQMB 4D8XA 4D9JA 1JZTA 3NH6A 3R8XA 2V4MA 1SEVA 3P0HA 1D4FA 5AHOA 2NZVG 4IW3B 5DI9A 2ZBUA 1ESDA 2BM9A 3K94A 4RSMA 5LLTA 2GGSA 3VHRA 2Q9CA 1XVVA 3D8BA 4ZDJA 5DM0A 2XCRB 4Z9FA 3U4HA 5HZHA 5KU1A 4JLOA 4P0PB 4EWLA 1VIYA 1BXRB 4B82A 5T5QA 1DDGA 1PR3A 4C4SA 4CQMD 4LNUB 4UZFA 1IOVA 1COZA 4OIFA 3SIXA 3DE5X 3PV0A 1LI4A 4JL6A 1RZRA 2RAPA 2UVDA 4WLOA 3F47A 5KOHA 5CCBA 3EB9A 1RJDA 2VJMB 4YCNA 5D5HA 2Q5LA 1V47A 3MYRA 4PZEA 1WUKS 3FVRA 4HDKA 4EAQA 3D4BA 2VLIA 2QBYA 5FLEX 2GN1A 3OZEA 1X3LA 2CNLA 1FSSA 1MZVA 2RHDA 3HWSA 3NM6B 1NE7A 3OI7A 3WSTA 2FZGA 4EMUA 4HZUA 1KI2A 1BMFD 2AGVA 4C07A 4JEHA 2OK8A 2RG7A 4D98A 4YCDA 2QRGA 2QTTA 2X0IA 2PXXA 1NBAA 3RREA 2DX7A 2C8KA 2R5WA 2VH2A 4BQPA 1WV1A 3C3WA 1IVYA 1G8FA 1NAHA 1PJSA 3GXBA 4X7PA 4E5PA 1YVPA 5CFMA 1YZVA 1W88A 2CVQA 5EJGA 1TVMA 4B7XA 1MJHA 4M46A 4YCMA 1D8AA 2J5QA 1E5XA 2A1IA 3AONB 3J7TA 1J70A 1Z74A 3C4JA 1Z28A 3NTUA 3O90A 2QJTA 7AT1A 3VC1A 2BJWA 3PPVA 2G76A 2WUVA 1G38A 2C07A 1W4RA 4YRIA 1BAPA 2CEAA 2IIQA 1K97A 1QK5A 1M2GA 1WW8A 1Z0SA 3K35A 3KOOA 2ZR0A 3R5XA 3AI2A 2A9PA 4CUZA 1PK7A 1VP3A 2O5VA 3HYNA 4S1WA 1KU0A 5J58A 5KNCD 1E2QA 3CH6A 3JS5A 1E8DA 3CRMA 3RWBA 3TW6A 1RACA 2ZETA 1M6VA 3PFWO 2FWIA 2X5OA 4KAAA 3LPLA 2A5JA 1XXLA 2PLNA 5E2BA 3RE1A 3B38A 4GSLA 4IDPA 1Z0JA 2GK6A 4B17A 3UMMA 2CXNA 2J48A 4FR0A 4FHCA 3CXUA 3A0RB 3A37A 1Z4KA 1JYEA 2ZSKA 2OO7A 1M0WA 2ECKA 1XMQB 2PTHA 4BP3A 2ZIUB 3SVZA 3GLGE 1TVCA 3T1QA 3ZJUA 4GWGA 2VRBA 1I4DD 4MIEA 4RFLA 4TSKA 3ZGXA 5LQNA 3PRYA 1SVNA 4ZQIA 1G9SA 2AN4A 3A1NA 1R5BA 4HEHA 1P9NA 4EHJA 4ECEA 4OU5A 5BSRA 1AK1A 2XJ4A 3EQ8A 5GONA 3Q2OA 1KNXA 2OEPA 1L4YA 2COKA 2RK4A 1E1MA 1OHHA 1U8TA 4V0KA 2IF0A 1V26A 4AO7A 1OA1A 3CZ9A 4F3RA 5KNLA 3WADA 5AJVB 2V1UA 2HRCA 2I2XB 3WGVA 1GM5A 1BOFA 1X9GA 4UOEA 5KWJA 1VE5A 4RA6B 1K08A 1RAEA 3E7WA 3LFHA 2ZRMA 4HDRA 4MGEA 4BPBA 4TXJA 4P0TA 5SY9A 4Y0VA 1BX3A 3FX2A 5ALNA 4DZZA 3OA2A 2QP9X 3UWDA 1YU6A 3IUQA 1C80A 3O8NA 1KVRA 2QRLA 4GI3A 4IH9A 1VKZA 2WVHA 2Q4TA 3JRNA 3TS1A 2VIIA 1CLEA 2YJ4A 4G9BA 4JHXA 4UHDA 3THXA 2WTNA 3I9V1 4PNPA 4X6LA 3EIQA 2ZQYA 5EERA 3BL6A 4BZWA 1LF5A 1E5TA 2H4XA 2J6BA 1XZBA 2QYSA 2TSYB 4KK4A 1VGVA 4RADA 3ZE7A 1UKVY 1P9OA 2JFVA 4DQKA 3EGCA 3TKAA 1J06A 4QDJA 5EHZA 1MBZA 3T9BA 5JXWA 4CU2A 5DHFA 3UMVA 1E7MA 1SHUX 1JG7A 1C3LA 4AKIA 1IOZA 1L5HB 1WDLA 5JISA 3SXJA 4EOGA 3A32A 2G1UA 2AK2A 1DWUA 2RHBA 1R0BA 4Q1FA 3PL5A 1PLJA 1EUYA 5BV2P 2DPYA 4YN3A 3CT4A 5KJCA 4G1EB 2O0JA 2PSEA 5DM4A 2ZRFA 4WA8A 4G23A 2P3LA 5ICCA 2IELA 4OFWA 3NVAA 3PNOA 1SXJA 2BUCA 1GKKA 3V8VA 2XDYA 2V4UA 3EVDA 4NXMB 3TQFA 3RFXA 4KJZA 4AMBA 3KQVA 7ABPA 3JX9A 4TKZA 1M1XB 1Z0ZA 3A3KA 3CF0A 4G8BA 1OWMA 2BGWA 1XPUA 3U5TA 2IKQA 3QOFA 1YF3A 2BJVA 2MSNA 4D4IA 3UATA 3AETA 3N1UA 2PIDA 1QP0A 3Q8MA 2OD7A 5BSHA 2OBLA 2P41A 1PVVA 1PTJA 5CVCA 1KAHA 2Q4RA 4PLVA 3ND5A 2NO0A 5LXTF 5REQA 1RBQA 2V54A 4H7PA 5BQPA 1Z2AA 3EGEA 3BMCB 5BVGA 4BV8A 5IH7A 4GKKB 2AI1A 5FO0A 2WAMA 2NACA 2WYWA 4B85A 2R1TB 4JVSB 4JLUA 3NM4A 4P53A 4ER7A 2OGSA 5FL7A 2GLXA 1NP6A 1U5AA 1J9GA 3JR7A 3QLTA 3QPUA 4FFWA 4W6QA 3VR6A 4AVYA 4LWPA 2VTBA 1ZXXA 2Q5EA 4MUIA 1NDQA 1SCNE 2JFUA 3K9BA 2TMKA 1W93A 3C41J 2ZUDA 1Z4IA 4HQ6A 1XA4A 1U5BA 1QF6A 3GMSA 2ZAYA 3MUOA 4JL8A 1QG0A 4K6HA 3WBBA 3CBGA 3ETDA 4HN9A 3D1VA 4XTCS 1W5SA 2DZDA 4TV8B 4C0JA 1JMKC 2FR0A 3ADKA 1LZLA 2AN9A 2P0AA 2WHQA 1GR0A 2FK8A 2B1IA 3LT5A 4TM8A 4QNRA 4UOQA 5CB4A 1NYLA 1TYCA 2GZ2A 1TLLA 4TMZA 1M33A 1M3SA 1KZ4A 3TTWA 1XRSB 1C5KA 2Z5LA 2IYAA 2AH5A 2OG1A 2W8BA 2W2OA 3TRKA 2UYQA 4AMZA 4L9SA 1DTSA 4WRRA 3L7NA 4EPRA 5EKXA 1A50B 1S9DA 2JI6A 4MVCA 2X42A 3L1KA 1FYWA 1CUZA 4M9CA 4ZU6X 1X7YA 2VKTA 3ER9A 1OAKA 2RI0A 3MGBA 4JJ6A 1G6Q1 4PSCA 3M4NA 3M2PA 3UXEA 2BEVA 2Z2KA 3DAPA 2VUUA 3STTA 1BE6A 4FCWA 3ICPA 2FFAA 3EXIB 1U02A 1C7IA 1VJRA 4MI3A 4KE7A 5E4YA 3O73A 4AF7A 5JBQA 1U2GA 1RJEA 2B3TA 3GGSA 3FGOA 4UFPA 3MCAA 1RJ9A 1P2DA 3DONA 3EGXA 1BGXT 4JGBA 1N9GA 4ND7A 3ZWDA 2IP4A 4B6JA 2LBPA 3OCZA 4LSMA 3OZRA 4NTZA 2P0EA 4B79A 1XL0A 2FJPA 4RSGA 2DU8A 4LFBB 2F1JA 4INOA 3IERA 1E8MA 3AB8A 1Y6FA 3EBPA 3PFHA 2OAP1 4O1HA 1NSYA 3VR4H 1LPBB 3DCJA 2Q29A 4F5ZA 3Q0TA 3AR9A 3C6ZA 2A3RA 3L06A 1TF2A 1EDOA 4R2XA 3KLMX 4HPXB 5L3RA 1X7WB 4L74A 3HLYA 3H87A 5BN1A 4HVTA 3L84A 2HJVA 3H0KA 1MH9A 1SU7A 1US8A 3UFBA 4HNAB 4UM5A 2PO5A 3EOBI 3EPRA 3R5HA 1Z5GA 3P20A 3I39X 1EZZA 1Q11A 2CKDA 2J9YB 3HLTA 1P8JA 3STWA 4BNKA 3AUFA 1UP7A 3GGPA 3ON5A 1V2HE 2A5YB 2JVJA 2QLMA 2ST1A 2I6FA 3CIOA 3F97A 3NPAA 3BBLA 4KN8A 2HPZA 4FHGA 4F85A 2XKAA 1Q83A 1V5FA 2A0WA 2CWWA 4GBGA 4Q4AB 4FDLA 4I5EA 4LXUA 2BBWA 4FT2A 4CDMA 2BHRA 3VAAA 4MVJD 1O95A 4Y6OA 4Q15A 1JBKA 2OLEA 1EB8A 5HCNA 3CPHA 5CLHA 2QW1A 1KPHA 3AIOA 4X95A 3COVA 4P4SA 1A7JA 4RMIA 3RJZA 4LI0A 2O8DA 3OPVA 4ENSA 4PO8A 5C18A 1ZD8A 4Z0NA 1FYVA 4DMGA 2GHTA 4WCFA 5TX7A 1GU1A 4JUCA 4LSGA 2X4IA 4JFAA 3SLRA 1IUPA 1FMTA 2DF8A 2GCOB 3UY4A 4X91A 3C3AA 4B09A 1XAHA 3PCXA 4KWTA 2Q1UA 1QV6A 1L9XA 1RVDA 3EF3A 4K86A 5EUBA 3AHJA 4IXMA 4FXOA 4KXUA 1E7QA 1FRVA 1M6YA 4QYSA 1T25A 2FF7A 3BIWA 4BNIA 3KQMA 4PTZA 1JQBA 3NUQA 1TCAA 1Z22A 4K6OA 5AJYA 1NPDA 1P0CA 1TUBA 1RLTA 4HX9A 1COWA 5AKXA 2OXIA 3AERB 3HV2A 3WKDA 4JLDA 4RELA 1O1YA 2V0CA 3S0JA 1H1LB 3A9UA 2VATA 3G7NA 3Q72A 3Q7SA 4OGFA 4WLVA 3IKVA 4NL4H 4WXHA 4OLAA 4CDRA 3QV1A 1U98A 4FFDA 4EHKA 4BE7B 1XDZA 1B8UA 3WHLA 3AF6A 3HXOA 1IBRA 2YMMA 1KETA 3JWPA 4IZOA 1OLUB 3R7LA 4KXMA 2BHNA 5K6AC 1OFGA 3E7PA 1ETHA 1HFKA 4Q7JB 4E6PA 3DLBA 2WJ4A 1EWQA 1Y9EA 3TECE 3O1IC 5ER9A 2I8AA 3RUEA 4QYMA 1E62A 4OAQA 3A2NA 1UP4A 3F6RA 4AJLA 5EE9A 1T2UA 3WICA 1EIWA 3GK3A 1HA3A 3RYHA 4AIIA 1SVSA 1KWGA 2A0YA 1QIJA 3B6EA 5HZGA 3KSBC 1YB2A 2C5LA 3IT1A 3GRFA 3QKRA 4YP1A 5C1IA 3VPGA 3BXFA 3OIDA 5HK8A 4CLOB 4HLUC 4JUBA 4XYLA 4OXKA 1Y1LA 5E2IA 3ZHUA 1U1CA 2XECA 2J3QA 2REQB 3D6AA 4N5NA 1K3FA 2MT9A 3BXEA 3KQSA 1NV9A 2JGLA 3TZHA 4CTMA 1E9DA 3GG2A 4UUOA 2ES4A 3M83A 4A6DA 2Z8ZA 5L6LB 3IDFA 3FDJA 4TQAA 5BYJA 4EYEA 2XRYA 2O2SA 2XRMA 3AC0A 3QJ5A 4NYIR 3KKOA 5L53A 1ZUWA 2RGWA 4E03A 4FGWA 3X1WA 2J3HA 4ZT3A 4OD0A 3LMKA 3NEYA 4QDTA 1JFFB 2PKYX 3DP7A 3E35A 1TK2A 4J94A 5KYWB 4WKPA 4Y2HA 2YNMA 3I9LA 5EHIA 2GEDA 4CL8A 3CKLA 4WGFA 4A5OA 1NXOA 4C7OB 1DBSA 1JYFA 1KEEB 3NHPA 4M89A 3WWEA 3IODA 2LV8A 3CCBA 1JZQA 1T5IA 2O3JA 5FOSA 3FZNA 1WCWA 4BO8A 5HFJA