2ZTVA

The binary complex of d-3-hydroxybutyrate dehydrogenase with nad+
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
260
structure length
260
Chain Sequence
MLKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISALAEKNGVDQETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Closed complex of the D-3-hydroxybutyrate dehydrogenase induced by an enantiomeric competitive inhibitor.
pubmed doi rcsb
source organism Pseudomonas fragi
molecule tags Oxidoreductase
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
total genus 98
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ztvA00
4MKZA 4ILKA 4IXTA 4B4VA 3OJOA 2QHXA 3F1KA 4KDEA 2C2YA 3H4VA 3OIDA 2O50A 4R5HA 1DJNA 4R54A 1D4FA 1NWCA 1PZGA 1NR1A 1RWBA 2BF7A 4E32A 2DBZA 2I3GA 2OO5A 1M76A 2BRUA 4W7HA 4R9RA 1M66A 2CVOA 1BG6A 1UUFA 2G0TA 2JFFA 3IJPA 3PLNA 2P9EA 3G49A 4BKUA 5CAEA 4DPKA 4MVJE 3FPCA 5L51A 4GQAA 4XYBA 4J6FA 3VHRA 2Q1TA 4ZICA 5A04A 4XQEA 4IQ8A 1WWKA 1J4AA 1R4MB 4RVGA 5IZCA 5A1TA 1HYGA 3CZMA 1K0UA 3GZ4A 3SEFA 5GZ3A 2QW8A 4PRKA 3OH8A 1A9ZA 4K28A 2DPGA 3GF4A 2VRBA 4BB5A 3DC2A 2EF1A 4WPGA 2FHSA 2VHZA 2QZ9A 4IJVA 2I99A 3DZIA 2PZMA 4TRNA 4BNFA 4CM6A 1HYHA 4CLXA 2GASA 1O9BA 1S7CA 1T2AA 2GNAA 1I5RA 3TZCA 3NTQA 4DYDA 4EUHA 4RF2A 4DXHA 4XIYA 2GZ3A 1Z45A 4EBFA 1GCUA 3LQFA 3ANNA 4XD2A 1PGNA 4F6CA 1BXKA 1UZMA 4I9NA 1P77A 4CLRA 4L9RA 3ZV6A 3D4PA 4W9NC 4CM9D 1DC5A 1R15A 2I76A 2W4QA 1LQUA 3MJTA 4NHEA 4NK5A 3VZQA 1MFPA 5KNLA 3STHA 1YQGA 3SJ7A 3TFQA 1T1RA 4NDNE 3EW7A 3ENNA 4AJEA 4R3WA 4OXKA 4ALLA 4FOOA 3OEYA 1E3WB 3TFOA 3C8MA 4AVYA 2AEFA 2AEMA 2VUSA 5MDHA 1E6UA 5JMPA 1GEGA 2VN8A 3GUCA 3PQFA 4QECA 5A5EA 1UZLA 4RVHA 2OBNA 3ROKA 2ZB7A 1UH5A 1GZ3A 2FSSA 4E4YA 4F6LA 3WIEA 4Q9NA 3LLSA 3WYBA 3W6UA 3H2SA 4AJLA 4L8VA 3NGXA 1LRJA 1C0LA 5KJCA 5IZ4A 4YT5A 4R16A 4XGIA 4CLOA 3CH6A 3NTOA 4BO3A 2Y1DA 4MPDA 3WGIA 1ZKMA 3NKLA 3HFGA 5JYEA 4DIFA 1H6DA 1LDEA 2X7HA 1Z74A 3DL2A 5KVCA 2A94A 1XU9A 1JU9A 2ZTMA 1EVIA 5ICMA 1OOEA 3JQDA 1VJ0A 2ET6A 1P1JA 2EKPA 1PU2A 3HB5X 3DTYA 1P45A 4FIZA 3OJLA 4ALIA 5EESA 1QP8A 1YKFA 4BNGA 3BA1A 3DEYX 4GPD1 1GQ2A 4PGFA 4EYEA 1YVEI 1H6AA 5THKA 3ZV3A 4BHTA 1Y9AA 1ENOA 2G1UA 3BHIA 1T4BA 3V1YA 4QSMA 1W73A 4B3JA 4LN1A 1H2HA 3WX0A 4D79A 3JQ8B 8LDHA 4J7UA 5DULA 3RWBA 1C1DB 4G65A 1R66A 1I30A 1QYXA 4WCFC 1PJLA 3OIFA 4AJKA 1JAYA 2WD8A 3EY4A 4Q3NA 1X1EA 3TZHA 5U4QA 1YJQA 3QVSA 2X0RA 3KB6A 3U62A 2WD7B 1NASA 5JC8A 1AHIA 1DPGA 1KVTA 2CF6A 4BKPA 4J0EA 2Y1EA 1UP4A 2IZZA 4B8ZA 3JD1A 4JIGA 1I3LA 4B4WA 3ADOA 3U3XA 3OETA 2B37A 5JFOA 4XRGA 4Y67A 4P4LA 4OHUA 1GTMA 4J4TA 1B15A 3KRTA 4WCFB 1GY8A 3IAHA 4YAIA 4PLVA 3AM3A 3JSAA 4M8SA 2H1SA 4UEOA 3RUFA 5CDSA 3GDOA 1LEHA 1LSJA 1NQOA 2GCGA 2WSBA 4M54A 1E7MA 1Z7BA 1LLCA 1P1FA 2D4AA 3L4BC 2VOEA 4I5DA 2NU8A 3W8FA 5KJFA 4QEDA 3LC2O 3HB4X 4GWGA 4NK4A 4W82A 4R1NA 2GR9A 1O94A 4ZGWA 1TT5B 4KDFA 5AOVA 3GG2A 4ZRMA 5EQDA 1B3RA 3V8BA 2VZ9A 5JAIA 1ZZEA 1HDRA 4IQ0A 4IMPA 4Y6SA 5TLSA 4ZVVA 2W2KA 2XF8A 4A26A 2B5VA 4W99A 5I9MA 3BMNA 4DBZA 2HJRA 2DT5A 2DM6A 1NAHA 5LDGA 3ZCXA 4A2CA 2E82A 3NTRA 1PJQA 3P2YA 2X86A 1O8CA 3QE3A 4RCVA 1BXZA 4CMHA 3S2GA 1X0XA 4A03A 2AXQA 1QMGA 1P74A 3X2EA 4E21A 5KIAA 1EE9A 4TZTA 5G0WA 1PX0A 1YDEA 2CF5A 2R6JA 2X0NA 3HNPA 1E1NA 2CDAA 3FCOA 1ENYA 1XLTA 4ND5A 2VRCD 4ITUA 5FI3A 5TGDA 1HSZA 3Q9NA 4GSLA 3K2BA 4L4XA 3VZSA 2GRAA 3DAFA 3DZHA 3HN7A 1JKIA 1U3UA 1JN0A 4KQWA 5BT9A 3ZWOA 7ADHA 2X9GA 3RC7A 2C07A 1KIFA 3ZWCA 2DBRA 1Q0HA 3IIEA 3HN2A 3PIDA 2W90A 4XKJA 3DMTC 1V8BA 4NIMA 3ZN2A 1NAIA 4YXFA 3LU1A 3O38A 2GN8A 1LA2A 2Y93A 4BNNA 2CNBA 3PIIA 4XA8A 4BVAA 4CM8A 1PJTA 1DHTA 3WXBA 4UVHA 2Z95A 4NBUA 5K6AC 2HRBA 2C5EA 4HFJA 3ZNOA 1E7WA 5FI5A 4M89A 1RM0A 4DQXA 3OECA 3ZHBA 1X7GA 1F8GA 1VM6A 3RROA 2DC1A 4F46A 1AXGA 1R0KA 1EUDA 4XCVA 4E5MA 2D5CA 2VWQA 5IJZA 5DBIA 3RUHA 3BTVA 4BB6A 2J3HA 2AQKA 4JROA 1L7EA 4JJIA 4XYGA 4BNLA 2X58A 4OMUA 4PN3A 1ZFNA 4L75A 4PZDA 3JD4A 4J9UE 3MJ4A 3H9UA 3DB2A 1IUKA 3BXXA 4WLUA 1TI7A 3UVEA 3E03A 1GPJA 3CKYA 1T24A 2PNFA 2H63A 1BW9B 4BNIA 1TT7A 2IODA 2HKIA 2VNSA 3WGZA 2HAEA 4TSKA 1ZMOA 4M87A 4LCJA 4IGEA 3A1NA 4J2OA 4D7AA 4PFJA 3GAFA 3H9QA 2GZ2A 1SC6A 4BO8A 4MP3A 1NVGA 3BHMA 1NYTA 2H6EA 3PGJA 3SLKA 3KSZO 1Z82A 2B4QA 5ICSA 1DB3A 3H6KA 4W9NA 1O6ZA 2RH8A 3FNHA 1U5CA 2Q50A 2FY8A 4XRRA 4AFNA 4BMSA 3ZHXA 1LLUA 4TVBA 5DBFA 4DWVA 1LBEA 3I6IA 1V3VA 5EQFA 1C1XA 1VJ1A 4U0KA 4EEZA 2B36A 2ZB4A 5LC1A 1SNYA 1ORRA 2RCYA 3TOZA 4E2YA 3INGA 3QVOA 4E2WA 4IINA 2DTEA 3AUUA 3VZPA 3ZWVA 3HDYA 4CLOB 4FCCA 4HFNA 4L76A 1K3TA 1XWFA 4J49A 4U6SA 2QYTA 2HJSA 1WDLA 5JO9A 5JYDA 4O5OA 1BXGA 1UJMA 1K6IA 3CUKA 4FDAA 4CMIA 4FQ8A 1R16A 3AI3A 3GHYA 1KY4A 4KUGA 4PIVA 2OOSA 4F45A 1QRRA 1WDKA 3E18A 4AJJA 2FRDA 4WEOA 4WUVA 4KTTE 4KWIA 3GMDA 1KBZA 5A05A 5A3JA 3OM9A 3QY9A 4FN4A 2NUAA 3WBFA 2XAAA 3EZLA 4R69A 5CDGA 1Q0LA 3GVIA 3F9IA 2OMEA 2R00A 3MEQA 1LSSA 4GH5A 4DRYA 3WGYA 2QZZA 5IN5A 3EVTA 1WLYA 1MA0A 3RUAA 4J4BA 1NQTA 1XEAA 3AOEC 4BMNA 3U5TA 4WCDA 3WJ7A 2BD0A 3IMFA 2Y0DA 5DZSA 1UDBA 1ZO8A 4ND2A 3U0BA 3E5MA 1SB8A 5LCXA 5G0VA 1KC1A 5JS6A 1GV0A 4CQMD 3S8MA 1R0LA 4EW6A 3MOGA 1A5ZA 4CM5A 1HXHA 2VRCA 3CE6A 2EP7A 4WCFA 1ONOA 4E5NA 1V9LA 3U09A 1ZNQO 4E30A 1M6WA 1OC2A 4DGSA 1KS9A 2YDXA 3ON5A 2QIOA 3U9LA 2AQHA 1FXSA 4FFRA 2GSDA 2VTEA 5DCUA 1SEPA 4UVDA 4YAKA 3FF4A 1GFSA 2VWPA 1A7AA 1NHGA 3OIGA 5K9ZA 3IKTA 1UXJA 1ZSYA 2PGDA 1SAYA 2BI8A 3JYLA 2WYUA 3QWAA 4PG6A 1ADGA 4OXNA 4DPLA 1EK6A 4WOJA 1GYRA 4YRDA 3CPSA 3UW3A 4CUJA 2CDBA 4OAQA 2NU6A 5F5LA 1FMCA 3FPLA 5KVSA 5JE8A 1I2CA 3MTJA 3F47A 1HZJA 3PFFA 2HSDA 3JQ8A 4I5GA 4LMRA 2P9CA 5TF4A 2JD1A 3RBZA 1B14A 4Z9XA 3GVXA 4N5NA 3WWZA 1IHYA 2AG8A 2GPTA 1ISHA 4PLTA 4CM3A 3MCVA 3ASVA 4FJ1A 1I32A 2XOXA 3ZWMA 3GVHA 4DC0A 3W4KA 3C85A 4OOEA 3UH1A 1CQIA 3FHLA 5ENVA 3VKUA 4GLLA 4BNZA 5L95A 1O89A 4GX2A 4XJTA 1NVMB 4GX5A 3BTOA 2J8ZA 3SLGA 3AFNA 4QUKA 3VAZA 3HQ4O 3RCBA 3GFGA 3DOOA 1KOLA 3C7DB 1R0SA 3JQBC 4EI2A 1D3AA 4GMFA 1ZMTA 2Q2WA 3FBTA 3CIFA 4FFOA 1U1IA 2PA3A 1ZK0A 3WYCA 4D44A 2E4AA 3OJFA 4D3SA 1UR5A 3L4BA 4PLZA 2JL1A 3AY3A 5B37A 3ASUA 2NADA 3AFMA 3IP3A 3S2FA 5TRTA 5JCJA 3RUCA 1BWSA 4MIEA 2OZPA 4BO1A 4W6ZA 4MVJP 4PG7A 1PZEA 3KYBA 3PHIA 2EXXA 4FS3A 4NG5A 4TRMA 1XELA 1V3TA 1DO8A 1BMDA 3ROQA 5I8ZA 3GRPA 3KYCA 4LCEA 1QR6A 4BKQA 3NDJA 1OMOA 1IL0A 1PZFA 2IEBA 3GDFA 4D3DA 4O63O 5IFLA 1HDCA 5G4LA 3QWBA 3IQDB 2YFHA 4AJNA 5L3ZA 5F21A 2YFQA 3T4XA 3MJCA 5HTOA 2OP1A 2ZQYA 3NJ8A 4IIVA 4J4HA 4PZEA 1ZXLA 4PRLA 4B3IA 4DMMA 4L4RA 1E1MA 1LSOA 1VLLA 2YHIB 4DMLA 5JCXA 1ZXBA 1T4DA 1TVEA 2Q1UA 2BKAA 2H5LA 1F14A 2QYSA 3FTPA 3UN1A 1U3TA 1ISGA 4OKNA 3OMLA 3OJEA 4UAGA 4IIUA 1LXCA 5L9AA 3RFVA 1B0AA 4NMHA 4IDFA 4RVDA 2AA3A 2EV9A 2YV2A 4XR4A 3DTTA 3AUSA 1F8FA 3V5NA 3ZHYA 4E31A 2HU2A 2OBYA 3AI2A 1Y5RA 1EUCA 1FDUA 5KOIA 1CIVA 4Q3EA 4RL6A 4WLOA 2ZQZA 1VSVA 3OICA 4XGKA 2CDCA 3KHUA 1Y5MA 1A27A 3KTDA 3WTBA 2X8LA 3NDIA 4KQXA 1E6WA 2RHCA 4UUOA 1DSSG 4J3FA 4OOFA 1FDSA 5IAAA 1PJ2A 3WDSA 4YAJA 3G0OA 3QLJA 3ZWWA 3W8DA 4P8RA 5HS6A 2BGMA 2G17A 4WJZA 3DBRA 4IDCA 1EEHA 3RKUA 3PQEA 4UUMA 3R3SA 3Q6IA 1GQYA 3ZW8A 2X6TA 1Y9EA 5GY7A 3WFIA 2ZB3A 4B4OA 3ULKA 1HETA 1FDWA 1I24A 2FPGA 3GVCA 1XYGA 1GR0A 3V2HA 4CJXA 4NQZA 1YQXA 4CUZA 1E3LA 3QWFA 1PWZA 3L9WA 2C82A 2JFGA 2AG5A 3O8QA 2NVBA 4AJ1A 3GH3A 4IJWA 5THQA 2DU8A 2YJZA 1P1IA 3PYMA 1WVGA 3KSUA 1LLDA 3X2FA 4MVJM 4W4TA 1U3VA 4D43A 5TJHA 1AE1A 1NBOA 1DIAA 3INRA 2GD1O 4EJ0A 3HSKA 1ZCJA 2RHRA 4PLWA 3LLVA 3I9JA 1WZEA 4XQGA 5G2OA 4J1TA 1B8VA 4K9DA 5CEFA 4BKRA 3PI7A 4IS3A 4FGSA 2XPCA 4FD3A 5COQA 2VUUA 3IL2A 1PS9A 1UDAA 4YYZA 2GF2A 5TS3A 4BMVA 5DOVA 4RPHA 4CR6A 2VYVD 3OEWA 4MVJI 1NP3A 1GL3A 4ND4A 4TWRA 2J5RA 2EJWA 3RJ5A 3CEAA 4XX0A 3FN4A 1WW8A 3PJFA 3N58A 5HA5A 1HE2A 4WLVA 5I8WA 1JWAB 2Q46A 4N18A 1YH3A 3PDJA 4FOSA 1GZ6A 2FMUA 4ZQFA 3WSVA 1F12A 4RPJA 1NPDA 1DRUA 1X1TA 3GY0A 4FFNA 4R1SA 2A35A 4FFLA 4U0JA 1LRLA 4CM4A 2X9VA 3H9JA 2VCYA 1AGNA 2DQ4A 2OGUA 2VHVA 3D3WB 4R1TA 2NVUB 5C7OO 3GNTA 3PYLA 3PVZA 2FR1A 5CG2A 3D0OA 3DHYA 4J7XA 2ZCVA 3IDSA 4IDDA 5BQFA 4CMCA 2X5KO 3GZNA 4D46A 3RFXA 1H9BA 4ZQGA 4XDZA 1ULUA 1ADCA 1JWBB 3A9WA 3LC7O 3P7MA 1MV8A 1P1KA 2FP4A 1EQ2A 1GU7A 1A7KA 3MOIA 2AHRA 1LTHR 3EC7A 4II2A 2IRWA 4J91A 1YWGO 3VDRA 1LNQA 2FPIA 3PEFA 3DZBA 4LK3A 2Y99A 4E2XA 3B1JA 4PG8A 1HE4A 4RPKA 1DAOA 3Q3CA 4PVDA 1P44A 1LX6A 3LDHA 3DOCA 3UCXA 5A06A 3QVXA 4R4JA 2LDBA 4XYMA 1Z6ZA 1NXQA 4UVIA 1UDCA 4BO9A 4DUPA 3WQSB 4GWKA 4QT0A 5L4LA 1DFHA 4YT2A 5TIIA 3ZU4A 4IQGA 3RBVA 3WOHA 3IS3A 4HWKA 3VH2A 4MVJH 4ZN6A 2YYYA 2HK7A 4LISA 1NVTA 4RORA 3U4CA 3VPFA 3FNEA 1GYQA 5BNIA 4OO3A 1UP7A 5TX7A 3LK7A 1VL6A 4Z9YA 4LRTB 3KXDA 5CDUA 4D0SA 3P5SA 1MG5A 1E3WA 3B20A 3K6JA 1G0OA 2V65A 1K5HA 5DN9A 3V2GA 4Z3DA 2O7QA 2YUTA 1EBFA 2I67A 3JQ9C 4R01A 1U4OA 4WLNA 3UGKA 4AL4A 4L74A 5TSDA 5DF1A 3GEGA 1ISJA 3D4NA 4A73A 2C7GA 3JYPA 3H65A 1VSUA 4S3MA 1JA9A 1DIHA 4KMSA 4NI5A 3H5AA 4CMIB 1LDMA 3I23A 2ZK7A 4RZHA 1HWYA 3O4RA 3I4FA 3GDGA 3RASA 2OFPA 5I7FA 2HMTA 2GLXA 3VOSA 1FF9A 3HFSA 1MXHA 1YB4A 3ZGYA 3TSCA 2D0IA 4IGFA 3LF1A 4H15A 3TJRA 1NFQA 1PGQA 4ZRNA 5CDYA 2O4UX 3H5NA 3B70A 3OQ1A 1UXGA 8ADHA 3BMQA 3E5RA 3BAZA 1N5DA 3D4OA 3PPIA 3UICA 4O1MA 1X7DA 3AUAA 1OZAA 2E49A 5G4KB 5JDCC 1H6BA 1K89A 4YR9A 1HYEA 4N7RA 3SC4A 3WLFA 3HDHA 1EUZA 5TQVA 4BNWA 2O3JA 3UAGA 1Z7EA 2CD9A 4AICA 2D3TA 4BNTA 3C1OA 5JW6A 4DA9A 4WEQA 1MFZA 1UXIA 3ANLA 3PDUA 1GDHA 3B6ZA 1CRWG 1DXYA 3JQEA 2ZYGA 3E9QA 3E48A 4Z0TA 2B4RO 2PV7A 5KJEA 5KJ6A 2VHWA 1HKUA 5ER9A 3IUPA 4XEHA 1L1FA 1HE5A 4DQVA 4TZKA 3E9NA 2EKLA 2TMGA 4E33A 5AXDA 3BMCB 4JBIA 5DNAA 5JDCA 2DBVO 1ISIA 1DEHA 4TMFA 3RU7A 4I9HA 1EVZA 1WMAA 4AJIA 1MB4A 3OA2A 4KP7A 1MC4A 2GYYA 2GN6A 1YBMA 2YQ4A 3F3SA 1BTOA 1NWHA 4YDRA 1VC2A 3KEOA 3K73O 4O59O 1T2CA 2NNLD 2E6UX 1B7GO 2BFOA 2PZJA 2ZYAA 1C1DA 4YVFA 4AJ4A 4L4SA 9LDTA 3HJAA 2BI7A 2NVUA 2OL4A 1M6HA 4ALNA 3T4EA 3MTGA 5L7TA 2C5AA 3JYQA 1UXKA 4HFMA 3WGHA 4QO8A 3KVOA 4XQCA 1D8AA 3VPHA 4CL3A 3KOUA 5EN4A 1AN9A 1EFLA 2IE0A 5FFFA 3AUTA 1GYPA 3LT4A 2VYVA 2GDZA 2ZATA 1CJCA 3ZI0A 1YXMA 4IBOA 3TNLA 2HMUA 3RIHA 1HLPA 2PGJA 5JCJD 2Q4EA 4UREA 2Y1CA 5FF9A 3TZKA 1I33A 4WNIA 2Q1SA 4HP8A 5JNLA 1YBAA 4HADA 3ZWNA 1ONNA 1D1TA 3MWEB 3UCEA 3M1LA 3B1KA 3DR3A 3ZWPA 4P4NA 4BGEA 5AQ1A 4JXKA 2IYOA 3K92A 4BNMA 4HFRA 2VOJA 4ID9A 4LMPA 4BV9A 1E1LA 5A9RA 4WNCA 3RUIA 1E92A 1W0CA 1WNTA 1I0ZA 2WTBA 1HTBA 5JO0A 5T57A 3WIDA 2AE1A 5C37A 3HDQA 2C54A 3KYCB 2I6TA 3DZJA 3EGOA 3KV3O 4ONEA 2ZJ1A 2EP5A 4LVCA 4GX0A 1U2DA 1RJWA 3K5PA 3TF5A 3QWIA 3AJRA 3KLMX 4I08A 5DCWA 3K31A 1GV1A 4FFMA 3U4DA 5CPBA 1W6UA 1J49A 4NBRA 4GMGA 5T8KC 2ILTA 1FJHA 2O3RA 4JNKA 1QYDA 2DLDA 4RF4A 1P0FA 1ZK3A 1I10A 4NH4A 5EPOA 5GZ6A 2PGLA 3C3XA 4XYEA 2AQIA 4Z6KA 3JQBA 2O23A 3RI3A 4OL9A 4OIMA 3S2EA 3ETGA 3VH3A 1N92A 1KC3A 3NGLA 4M1QA 5DBGA 1Q7GA 4Y8VA 3CMMA 3U49A 1SEVA 4C7KA 4Y98A 1WMBA 2X22A 2H9IA 1AUPA 2V6BA 7MDHA 1ISFA 3ZNNA 2NTNA 2CZCA 4HBGA 3HWRA 4RPLA 3WG9A 2VHXA 5C5IA 1C0IA 4RVUA 5K0ZA 1E5LA 1E5QA 4I8XA 3GEMA 1NTOA 3TL2A 5BSFA 2JFHA 3H3JA 3ZWXA 4D0RA 3HG7A 1R4NA 4BV8A 5G4KA 3FNFA 1SPXA 2I3AA 4FPXA 4D45A 1TLTA 4YA6A 4F3YA 1HL3A 4YT4A 5HM8A 3PHJA 1YDWA 3O8QB 2C0CA 3HE3A 1GEEA 2AW5A 5FWNA 3AW9A 4MP8A 2IDZA 3PWZA 2ZIZA 2I66A 3PHGA 1UAYA 4QTZA 3U4IA 4W7IA 2J3KA 4ZQBA 3ZWBA 1A72A 2EHDA 4L0QA 1B3BA 3OQ6A 3ZNQA 3RC2A 3JQAA 3DFUA 3IUSA 3L0DA 1PQPA 1EVYA 4NJMB 2PFGA 2PH3A 2X5JO 5IDWA 2V6MA 1VKOA 3I1JA 3D5TA 4GVLA 1ENZA 3AOGA 2WWRA 4MOWA 2B5WA 1N9GA 2EJVA 6ADHA 1E6EA 1JKJA 3P19A 1EDZA 2EW8A 2O7SA 4A7PA 2FOIA 2JHGA 3NX4A 1X7HA 1YB5A 3PP8A 4C7JA 2RH4A 1SOVA 3L07A 4BO5A 3BHJA 2JD2A 4RZIA 1U3WA 3DONA 3ZU2A 2FR0A 1MXFA 4P22A 3DFZA 5L4SA 2X5OA 3I6QA 3WQRA 4G2NA 5DP1A 4NZ9A 3TDKA 4BL5A 4ALKA 3PJGA 3D5QA 4WGGA 1LDYA 1D1SA 4Q3AA 2VZ0A 4YQYA 5IDYA 3AU9A 4NR0A 1DDOA 3DBLA 3TWOA 3PLRA 4EGFA 1R4MA 2CY0A 3T7EA 5ITVA 4TQGA 3KLPX 4YTEA 4FGWA 3GGOA 3O26A 4GSKA 1TA4A 3RSHA 1M2WA 1DLIA 1JKFA 4ZD6A 3BYZA 2ZTUA 3QW2A 4XIJA 1MX3A 3PJEA 3OF2A 3S55A 1BDMA 1NQAO 2C29D 3PZBA 4M86A 4HY3A 5U9CA 4KUHA 3JQ9A 2BLLA 1CDOA 4YT8A 1QYCA 6LDHA 5A9TA 5H82A 5ITWA 1KETA 4BGVA 3RUEA 3RKRA 5CG1A 2HUNA 3QVTA 3H2ZA 3LF2A 3QRWA 4DLBA 3R3JA 3N74A 1P33A 3VTZA 1EFKA 3I9LA 4ALJA 5KCZA 5DDIP 3S2IA 3UHAA 2Q3EA 3M6IA 3WGTA 4PG5A 1NM5A 2WM3A 2JKVA 4J1SA 1ZJYA 1HLDA 2BFPA 5BR7A 3ABIA 3AY7A 4CMBA 4IJKA 4YAEA 1E1KA 4GAEA 1IB6A 2UUPA 5F1OA 2PY6A 2V7PA 2VYNA 4JBGA 3GVPA 1YBVA 4YJHA 3RUDA 4BGIA 4HX5A 4YRBA 1KEVA 1ZK4A 5AXAA 3PHLA 2CVQA 3CINA 2POQX 4GGOA 1ARZA 2YV3A 1QXSA 1IPEA 1GADO 1I2BA 2B0JA 1T26A 1PR9A 5F1PA 2AQ8A 4ND3A 5A02A 1DC4A 4MO2A 5LDHA 3NAQA 2WEKA 1DLJA 2I65A 2YV1A 4FW8A 1RM3A 3EAGA 2EG9A 3GZNB 3FR7A 4BUCA 4OYRA 2D2IA 3TZ6A 3DO5A 1KVRA 4HNGA 1BGVA 3FI9A 4BGUA 4CLHA 3WLEA 4HUJA 4XR9A 4CV1A 4NJMA 1E0DA 2EERA 2PWZA 3GN2A 2OXIA 5C3MA 1CEQA 2C59A 4JK3A 1ID1A 1LQTA 4CMEC 4YCAA 4BO7A 1VE9A 5I9NA 1Y7TA 2FWMX 3ITDA 5F5NA 3KETA 3GNQA 1LRKA 4DBVO 2I9PA 4DVJA 3QA9A 4QX6A 1GUZA 1Q1NA 4BKOA 3DWFA 4EJ6A 1KEUA 3DBHB 1IZ9A 3T7CA 3KO8A 5G0UA 1PJ4A 3AOEA 3E82A 4OGWA 4D41A 1VL8A 3Q2IA 1QV7A 4JJGA 3EVNA 5DP2A 4EUEA 2WMDA 4CMKA 2PKQP 4J0FA 4R3NA 1E77A 3RC9A 4BNXA 1XKQA 4AJOA 2P9GA 4FSHA 5KJ1A 1F17A 3ZU3A 4Z9FA 2DTDA 4QFCA 3DMTA 4FJ0A 5TT1A 1N7GA 2HMSA 2NM0A 3G3EA 1FK8A 2D59A 1PSDA 2JAHA 1YQDA 3KYDA 5CEJA 5DCYA 4RQTA 4DPMA 4ROSA 5T64A 3GG9A 4MIOA 5GMOA 2P68A 2NU9A 1DJQA 2D8AA 3NT5A 1LDGA 1SZJG 2EEZA 3D7LA 5IF3A 1D7OA 3AWDA 3PRJA 3DQPA 1T1SA 1ZEMA 2O48X 4IDEA 4AJPA 2C2XA 2Y67A 2BFAA 2PD3A 3ZHZA 1PEDA 3AK4A 4OKIA 3M2PA 4RF5A 4OQYA 5A9SB 4KOAA 2WD7A 1V6AA 4WLEA 3FD8A 4UEJA 3GA0A 2PR2A 5MGBA 3WTCA 3E8XA 2W2KB 3K8ZA 3OA0A 3I9KA 4B79A 1WZIA 4J1NA 1JAXA 5CFZA 3D1LA 4XB1A 3ENKA 1EBUA 4LRSB 4R51A 2X1HA 3PWSA 4CPDA 4NFYA 3O03A 3K2EA 1T2FA 3K96A 2CUKA 3AY6A 3VH1A 3ZNPA 5IN4A 4IY1A 3QIVA 4YJGB 4BO4A 1AHHA 1OC4A 3Q1LA 1H9AA 4K6FA 3MJSA 2F1KA 1Q7BA 1U28A 3IKVA 1PIWA 3WS7A 1YS4A 5JSFA 4LSMA 1HT0A 4D42A 1K2WA 1U9JA 1ML3A 1XA0A 3ETEA 3ORFA 1C1XB 3WNQA 3LYLA 3TZQA 3SVTA 4A27A 4UVEA 4ZJUA 4K6CA 5A3VA 5JAZA 1IOLA 1J0XO 3GGPA 3C24A 2PD6A 3L6OO 4XQ9A 3VTFA 1ZVMA 2C7VA 3L4SO 3CZRA 3RJ9A 3C7AA 4DTIA 5FEUA 2AE2A 1MLDA 4OXYA 1PS0A 2JD0A 2NVWA 3I4CA 4GVXA 4HV4A 3OHSX 4E6PA 1NFFA 1YJ8A 2OHXA 3FNGA 3RVDA 2C20A 2PD4A 4O6VA 2IXAA 1U7HA 4TRJA 3K30A 3VVBA 4BNYA 4BNUA 1Y6JA 1PGOA 2G76A 3V2UA 3BMOA 4JX8A 2NTVA 1I2ZA 4PLFA 2Z5LA 1H5QA 1QG6A 2HK8A 1C0PA 2VWHA 2D5AA 3E6AA 3JQGA 5JXWA 1U4SA 2YHIA 3UCFA 1Y8RA 3ANMA 2EW2A 5JPIA 2CMDA 1EK5A 3KBOA 2BELA 3DHNA 4QO7A 4N54A 4EZBA 4CLRB 2OORA 4FC6A 4XWYA 5HWSA 4Z0HO 3DZKA 3FRJA 4XGNA 1F0YA 2VQ3A 1BDBA 5ADHA 3WGOA 3NRCA 1H2BA 4WE3A 4ZQEA 3V1UA 4G5HA 3RAJA 5L53A 4MIYA 5EIOA 4J9VA 3H7AA 3UOGA 1ONPA 2YZ7A 2A92A 5ENDA 4BOYA 1YE3A 1K6XA 4J90A 3PTZA 3GHHA 3HUDA 5ILOA 1JVSA 1KERA 2DVMA 3H9EO 4CM9A 1HDXA 5L40A 2B83A 3LVFO 4LW8A 3V1TC 4CL8A 5I9LA 1N1GA 1P0CA 4EJMA 3GAZA 3RQSA 1IULA 3KEQA 5K6AA 2NLOA 2EGHA 2DTXA 4B3HA 2ZCUA 4HXYA 1YRLA 2Q49A 3PGXA 1KEPA 2Q99A 5G0TA 5EJ2A 2NTJA 4BNJA 3ZWAA 3I9NA 4BO2A 1YL6A 4CQMB 1JVBA 4MJLA 1HDGO 4IZIA 1LC3A 4RF3A 2X0IA 4GBJA 3Q9UA 4A10A 5I7SA 1WPQA 2VT2A 1VI2A 3OBBA 1T2DA 4CMGA 1PJCA 3DZGA 1E3SA 2B35A 1PL8A 3WR5A 3VH4A 4K26A 1R6DA 3F1LA 1F06A 4L73A 2IZ0A 1A4IA 1T2EA 1GUFA 1E7SA 2DBQA 3AM5A 1HEUA 2OUIA 4AJ2A 1LJ8A 1X15A 2O2YA 3WMWA 1ZK2A 3H5RA 5U1PA 3WICA 2J6IA 2BFMA 1VPDA 4UUPA 1XR3A 5A5FA 3NT4A 4CM4B 4M55A 3M1AA 1R37A 1Y1PA 2CVZA 1NQ5A 3FWNA 5T67A 2JJYA 4K1LA 4WLFA 4B4UA 1QLHA 4HNHA 3RFTA 1HDOA 3DBLB 4NJOA 3VZRA 2XXJA 3WMXA 1XCBA 3QJ5A 1JW9B 1SO8A 1G6KA 4UEKA 2UYYA 4IUYA 1ZH8A 1C3VA 1DC3A 4JLWA 3ZW9A 4JQCA 3TL3A 2W8ZA 1MC5A 3JCZA 1HRDA 1QYWA 3F5SA 3MWDB 2WDZA 4AG3A 1KYQA 3L6EA 3AU8A 3OP4A 1SB9A 3WJAA 5IDXA 5COBA 4J1QA 1BXGB 1OAAA 1LC0A 4IJUA 3JYNA 3G17A 3SX2A 3ADPA 1DFGA 4GKVA 4BQRA 1XHLA 5H81A 2FZEA 1G0NA 2X4GA 3JQAB 2AEJA 3UFXA 3JQFC 3WWYA 4MINA 4PLCA 5ES3A 1Z75A 5JAQA 3W4IA 4CQLA 5IZCC 1YOVA 2Y1OA 4RV9A 4CMEA 1VRWA 2EWMA 1ZSNA 1N9GB 2Y05A 1S6YA 3GRKA 1IHXA 1Z73A 3DAGA 4GLOA 1AXEA 3JQ7A 4OJNA 5EL0A 4E5YA 4D3FA 2ZB8A 3I9OA 2RAFA 1K6JA 3BMNB 4NU6A 5F1KA 5T5QA 2Q4BA 9LDBA 1PJBA 4ZU3A 3IOYA 5L7YA 3GK3A 3I5MA 3ROMA 4BNVA 4R5MA 4YJHB 5IXSA 3FR8A 4NBVA 4WKGA 2PLAA 3I9MA 3LSYA 4HKTA 2ZTLA 1BSVA 1ZK1A 3GC6A 4CV0A 1LSUA 3DHEA 1IYZA 3Q2KA 2DFDA 5B4VA 1GAEO 4OSPA 2Q2QA 2RBEA 2HK9A 3A14A 3BIOA 3TPCA 1G1AA 1Y81A 4CV2A 1YL5A 3INTA 4RJTA 1N7HA 1MUUA 3O9ZA 3LT2A 3D64A 1CETA 1ENPA 4CODB 5KKAA 3BTSA 1MG0A 4G81A 2GGSA 2JCXA 1KVUA 2GERA 4S1VA 1GCOA 3NYWA 4PLGA 3GGGA 3F6YA 4U8GA 1H93A 4YEDA 4B7XA 4TRRA 5KKCA 5B12A 3DAPA 5EMHA 1PQWA 4MVJG 4OM8A 1P1RA 1R12A 4CR8A 4YWJA 1WP4A 4XJSA 4J7CA 3GOHA 1PL6A 2NV6A 2YY7A 2I5PO 4KWHA 1M67A 3Q11A 3WB9A 5KWEA 4N5MA 2GZ1A 3VDQA 5TC4A 3OQBA 2BGLA 3HZZA 3VKVA 4BO0A 4MDHA 3L9XA 2Z1MA 4ND1A 2PKQO 4MKRA 4Z3KA 3R6DA 4MVJA 4XB2A 1BVUA 1DRWA 3BMOB 4XZ3A 2J3IA 3TOXA 5IXYA 5AXCA 5JLAA 1P3DA 5JY1A 3SBOA 2J3JA 3F4BA 2ZKLA 4PLYA 3Q0EA 1LDNA 5G0SA 1BVRA 5B4UA 4YJFB 3B1FA 1DAPA 3JQGB 3NV9A 5T8KA 2A4KA 1I3KA 4E3ZA 1VJTA 4GX1A 2ZJ0A 1NPYA 5JMWA 1RYEA 2QRJA 4PG4A 4CV3A 3JQ6A 4R68A 4YPOA 5JY6A 3DMYA 2Q45A 3UUWA 1CF2O 1ZBQA 3WSWA 1YGYA 1A71A 2O3SA 1ZSVA 5KVVA 3F5QA 3ETDA 3H8VA 1FDVA 1MGOA 4UULA 3MZ0A 4B8WA 4CMJA 4DLAA 4U5QA 4KUEA 4TROA 3EMKA 1N1EA 5IDQA 3DBVO 2GUGA 1ZEJA 2DFVA 5L7WA 2VTDA 2PZKA 4I1IA 3H9GA 4PLPA 4ESOA 5JDIC 3VC7A 3NDRA 5EINA 5HBRA 4B7UA 4DYVA 2Y0CA 1H94A 2VWGA 1RM4A 2O3QA 1E3JA 4LGVA 5CEEA 1EE2A 4E5KA 3CMCO 4XDYA 3A28A 1E7RA 1SOWA 1XGKA 2JHFA 2SCUA 4J2HA 3JQFA 1X13A 1JLLA 1U5AA 3I52A 3PHHA 3DBHA 3G79A 2FZWA 3DZFA 3L6DA 4AJHA 5HS4A 3G1UA 1UXHA 4RPGA 2J5KA 2PTGA 3BTUA 3GMSA 1B8PA 3QSGA 2CSUA 5CHEA 5C7IO 3JD2A 1PL7A 2VNAA 5KTKA 4RGBA 4U6QA 3PXXA 2VZ8A 1UZNA 1PJSA 3DBRB 3EHEA 4QFDA 4CQLB 1Q7CA 3WGGA 2TMDA 1C14A 1P31A 1E3EA 1Y8RB 3JQCA 1HE3A 1N2SA 1WAMA 5CDTA 1QSGA 4YRAA 1U8XX 2VYND 1RM5A 2B69A 2BHLA 4MVJF 1B2LA 1EDOA 1X14A 4I9UA 2JCVA 4CM1A 2FPPA 1HF3A 2EIHA 3KYDB 4TKLA 1Y8QB 1M75A 3A4VA 1O5IA 4DIOA 4DREA 3QV1A 1SBYA 3G1TA 4YBZA 2HO5A 1CERA 1H6CA 1X0VA 1LUAA 1V35A 3GNSA 4H16A 2O2SA 5F3RA 4ALMA 5BSHA 1QV6A 1NPTO 2HRZA 1H0KA 1KEWA 1QKIA 3C1AA 3GR6A 2X9NA 5I7EA 4NFSA 2DPHA 4DC1A 2HQ1A 3GQVA 3RU9A 3DXFA 3UXYA 3LT1A 2IYPA 1Q0QA 5L45A 1A4UA 1O95A 2WYVA 1QORA 3P2OA 3KSDO 4NPCA 4P4GA 4PLHA 4C4OA 5FYDA 1E7YA 2F00A 5CPFA 3ONEA 4WASA 2G5CA 4FFPA 2IZ1A 3W8EA 3IJRA 3PZRA 3CXRA 2DAPA 4ZQHA 2W98A 3WNVA 1W8DA 4IDBA 3W4JA 2FR8A 2Y68A 1OFGA 3EK2A 4I5FA 4OQZA 4R9SA 5IG2A 3GFBA 2QRKA 4LVUA 3ZDFA 4E2ZA 2VHYA 5BSEA 4YJGA 2Z1NA 5TNXA 3KZVA 4YJFA 1V0JA 5BNTA 3PJDA 2V6FA 1DIBA 2P5YA 4Q39A 4OH1A 4WK6A 3VPGA 3D3EA 5HRUA 3WBBA 3QP9A 2NACA 4YACA 1GQQA 2B4TO 2E48A 2CFCA 2NQ8A 1TEHA 1DIGA 3EDMA 5JAMA 1ZW1A 4JGBA 3MJVA 4IZHA 3TN7A 2GN9A 5GZ1A 1GPDG 5COAA 3ZV4A 4Q3BA 4OSOA 1I8TA 1ZJZA 2UV8A 4EUFA 3QWHA 1V3UA 1IPFA 2E37A 2HMVA 1I3MA 3WYEA 3NEPX 5DOZA 2Q2VA 1YONA 4IXWA 5JC1A 1YL7A 3I3OA 3MJEA 3ONDA 3I83A 4E0BA 4EDFA 4LSWA 1PR3A 3VPXA 2V6GA 3ITKA 4JBHA 2NSDA 4GI2A 4KTVE 4ZHSA 1NR7A 1B16A 4JCOA 1QLJA 4FJ2A 3PYXA 2NWQA 1XG5A 3GN1A 2HLPA 2LDXA 5H83A 1ZIDA 3JYOA 4FR5A 3HADA 3ROPA 1E3IA 2P4QA 3C7CB 4TVOA 3IP1A 3PQDA 1IY8A 5I7VA 1L7DA 4DLLA 2BMAA 3GPIA 2WYWA 1ULSA 4E5PA 1RKXA 2Y0EA 3NJ4A 1A9YA 3ZH2A 3RD5A 2X23A 3JV7A 4FB5A 5CP8A 1FDTA 4QXMA 1VL0A 3KM0A 4WOKA 4FC7A 1DC6A 3JD0A 1IE3A 2R2GA 2Y66A 3ICPA 4H7PA 5AXBA 1XQ6A 5ER6A 4ZA2A 2O4CA 3GLQA 2O3TA 2HCTA 4II3A 2DUWA 4IPTA 1UP6A 2YHUA 3EZYA 3S1LA 1LI4A 3D3WA 3E9MA 4R41A 1XQ1A 3U4HA 4CM8B 1LDBA 2R00C 1Q2XA 4R1UA 3FWZA 3ZU5A 2HDHA 3E1KA 4Z0PA 2NQTA 2VUTA 1RPNA 3F4LA 1N8KA 1VKNA 2D1YA 5JBIA 1KY5A 1EZ4A 1MP0A 2YDYA 4NFHA 3RBXA 4EITA 4RDIA 1HDZA 3ZV5A 1XSEA 4BNHA 1DHRA 2IEDA 4RLHA 3SC6A 4N5LA 2DUUA 2JAPA 4IDGA 2GO1A 4FBGA 2VT3A 3F46A 1NX6A 1TB4A 1XIVA 1Y8QA 3CTMA 5BSGA 2YW9A 1KVSA 4JJFA 3COSA 4WECA 3VPSA 4B7CA 2X0JA 3DOJA 3SXPA 1UAGA 4YB8A 1EVJA 4PZCA 3ZZNA 4IDAA 1YO6A 3GT0A 4BS9A 3C1TA 1O0SA 1PZHA 2ZTVA 3CSDA 2Y1GA 4RLSA 1DIRA 3IC5A 4RO0A 1PWXA 4RVSA 4GKBA 1EMDA 2NU7A 2PZLA 4CUKA 2A9FA 1PJ3A 4J43A 1HDYA 1T25A 1BW9A 3ST7A 4INAA 3JQAD 4MKXA 3UKOA 2WE8A 1PGPA 1JTVA 4E12A 3NT2A 1I01A 1C0KA 3PFWO 5KVQA 4GGPA 5EERA 3SJUA 4CQMA 3NUGA 2P91A 4RDHA 4IMRA 5A03A 5B4TA 4CLEA 4Y6PA 4Q3CA 1YOVB 1HZZA 3HHPA 3WGQA 2P2SA 2ZYDA 2BGKA 1OBFO 5A4DA 2UAGA 1J6UA 1CWUA 2AMFA 3OFSA 3W1VA 2PKRA 1OI7A 4YJDA 2IXBA 2QQ5A 4YAGA 1KVQA 1E7QA 1LLQA 1NHWA 4BQPA 1PQUA 5T6BA 4BNKA 2WE7A 3BZUA 3L77A 4MVJD 1BRMA 4UUNA 2J5QA 4Y9DA 3RC1A 3PWKA 3DDNA 2BH9A 1ADFA 1LU9A 3R0IA 3GPDG 4IM7A 5TT0A 1WDMA 4QQRA 4JP2A 1IZ0A 4DL9A 1XDWA 1PGJA 1JQBA 4NNJA 4Q3DA 2HMWA 3FBGA 4A0SA 4CLDA 4UVGA 3ICCA 3ONFA 1J5PA 2OP0A 1I3NA 2W2LD 3A06A 3K9QO 4JP3A 3TRIA 2P5UA 2O3UA 2QG4A 4P38A 2RIRA 1SMKA 2FN7A 4JN6B 4NBWA 4URFA 3JQ7B 4A5OA 5JDIA 2PH5A 3JD3A 4M49A 3GEDA 4O0LA 3QHAA 1ISMA 1DOHA 4PVCA 5C7LO 1P1HA 3LC1O 4NBTA 4RVFA 3R1IA 4EEXA 4H3VA 3JTMA 1CYDA 2Q1WA 3EUWA 2WJPA 1ZUD1 4RQUA 5BNFA 1XU7A 4YQZA 4X54A 2XXBA 3AI1A 5TJ9A 1R4NB 2GN4A 1DFIA 1SCUA 3H3FA 3WQQA 4I5EA 1DBVO 4E13A 3FSRA 1I36A 4MP6A 3W6ZA 1P9LA 4IS2A 1PS8A 1B8UA 4J16A 5A9SA 4CM7A 2P4HX 3VVCA 4Y6RA 3BMCA 5J23A 3LZ6A 1GUYA 3WFJA 3QQPA 2UUOA 3ZWYA 1NFRA 1BHSA 1HSOA 3FTNA 4CMAA 1GD1O 1TXGA 5AVOA 4DQUA 4DIBA 1CQJA 2UDPA 2YQ5A 2EGGA 1PTJA 5DT9A 1QYVA 1TT5A 5ILGA 3UF0A 4BO6A 2G82A 2PK3A 3HDJA 4TKMA 1DRVA 3OJ0A 2Y1FA 4CR7A 3LT0A 2EKQA 3M2TA 3TQHA 4KZPA 5B1YA 1JDJA 5AYVA 3GUYA 1NNUA 1YB1A 3N7UA 2QRLA 2UVDA 1W4ZA 2FSVA 1WXDA 4NU5A 1U7TA 3AM4A 3PK0A 4GL4A 1GZ4A 2QX7A 4XYLA 1U8FO 5L4NA 3OSUA 3EYWA 1EQUA 2W2LA 4BIIA 3BMQB 2DKNA 1U2GA 1B26A 3KUXA 1ADBA 4U7WA 2JCYA 4PCVA 1RYDA 3QVWA
chains in the Genus database with same CATH superfamily
4HAYA 2AFIB 1T9BA 1NUQA 4LE2A 4A23A 2VP0A 3PICA 2ZREA 2NT3A 4ILKA 3Q7TA 5CRIA 1FNSA 2QX9A 1BU8A 2OLKA 2B6NA 3AX6A 4MW9A 4E15A 3IDFA 1U8AA 4ESHA 3OJOA 1HL7A 1OVGA 4IO0A 4DR4B 1MZPA 4M4SA 4Q9LA 2C2YA 3L6BA 4R7ZA 3MIIA 2CJFA 1JJVA 4DCUA 4DHEA 1NWCA 1YR6A 1NR1A 4C4XA 4UPEA 3TQRA 4NE2A 1QH8A 2DBZA 4PZZA 3HLKA 1GPAA 2G7ZA 2I3GA 5KYUA 1OAOC 2QLNA 2VJDA 5EKUA 2OO5A 4IJMA 4F8EA 4W7HA 3TBFA 2XRZA 5AM5A 2CVOA 5F4ZA 2FZLA 1GNSA 3PLNA 2P9EA 4PAGA 3PFNA 2I4MA 5BMVF 4DPKA 1GWNA 4AW9A 4GM1A 2O2ZA 2C2HA 1Y3CE 3D3QA 4HD8A 4NYJQ 4UOZA 2YASA 1HG0A 4DS3A 3NWBA 2Q6KA 4L72A 4N47A 3AF6A 3AGPA 3C16C 1W1WA 5A04A 4B74A 3A2LA 1QAQA 1XO1A 5E6SA 5EE3A 5FAXA 1XQWA 1S2IA 3GZTB 4LBWA 1GTL1 2QB5A 4Q9HA 4XQEA 1J4AA 5IZCA 3BVPA 1YS9A 1JFRA 2J6CA 1J33A 3CZMA 5HKAA 2FPMA 2D7DA 5AW4A 4U63A 2HB6A 4X5OA 2CFSA 2P4UA 2QMEA 3UXMA 1DXQA 5TQJA 4DLUA 4BB5A 4PNZA 4A6DA 3UJNA 4BZWA 2VHZA 1KYXA 5I7OA 5AHKA 1A1VA 5K0EA 2J9RA 2WTEA 3EW9A 4BNFA 1QZXA 4CM6A 1I0IA 1HYHA 4TTVA 4J1TC 4CEJA 1T2AA 1I5RA 1WW2A 4EUHA 1IVYA 1X1AA 2AWNA 3D7NA 4IHJA 2BMJA 3UT5A 4DXHA 3ZXUB 1GCUA 2YN2A 1L5FA 5HDBB 4PYOA 4I9NA 5E6UA 4F6CA 5JZMA 3ED5A 2JFBA 2C5GA 3PGA1 1OKKD 2PX3A 3MJTA 1IDN1 1Z5VA 3CBQA 4NHEA 3LQ1A 4EX6A 2SKDA 1FZQA 1D6MA 5DBHX 1NVDA 4IX9A 3PF9A 1AA9A 4MGKR 1MOQA 4YDHB 2EJBA 5EXDA 1W581 1YQGA 3MHPA 3DDHA 5FUVA 5EP4A 1SBCA 5H02A 3JQPA 4NDNE 1GGJA 3T94A 3ENNA 4R3WA 2PQMA 3CLTC 3N53A 4ALLA 3TTUA 2HXYA 4FK8A 3OEYA 3TFOA 2QJFA 1C7RA 1NN5A 1WKCA 3C8MA 4Q4AB 5EHZA 1CZHA 3DSRA 1RXUA 2AEFA 5LOVB 2HBQA 2RJ3A 1JQ5A 2DFPA 2VNIA 1AB5A 2VUIB 2CN1A 3VR2A 4B9AA 3SKVA 3DOIA 4LOKA 4D9GA 4R7TA 3IAM1 3GLVA 2JRCA 4TYQA 3WA7A 1UZLA 4GIBA 4MTCA 4YUXA 2ZB7A 2ASEA 2FSSA 1XB2A 4OSEA 4UW9A 2GKOA 4IRXA 1CPYA 1QG0A 1GR1A 3QPAA 1CNEA 4JB8A 1DCKA 3R7NA 1OLSA 2FB9A 3UAZA 4AJLA 2H31A 1S9HA 2ODBA 3FYTA 4JGGA 1SIBE 1GAJA 2CWWA 2VZLA 2I7VA 3V8QA 1LRJA 4D1YA 2H7YA 4DV6B 1C0LA 1OE0A 1HM5A 3R3WA 3RVLA 5KJCA 5FQOA 1TTQB 3UJDA 1H0SA 4Q5IA 4PO8A 1VHJA 3NTOA 4JSYA 2ZZNA 4W1RA 4BO3A 4M9CA 1M1YB 3WHKA 2QRHA 4D4KA 1DUIA 1ZKMA 3S5JA 3HFGA 3FHOA 2JFVA 2X7HA 5CFMA 2PRKA 2QGZA 1GLVA 1H2WA 1X94A 1XZNA 2FPPB 2BUBA 2GX6A 3MVEA 4ZYLA 2A3RA 1C0EA 4LOJA 4G0ZA 1VYVA 2ID4A 3HB5X 4TM7A 3ET4A 1WOYA 4FIZA 4TXJA 5EMMA 2PL1A 4DNPA 5K6RA 1GGNA 2J3QA 5G1PA 5K99A 1SVWA 4BVBA 4BNGA 2BKXA 3BA1A 1X80A 4LYYA 4PGFA 1GQ2A 1YKGA 1C4XA 3PD0A 1H6AA 1RXIA 2PAFA 1RHRA 4FX2A 2E1PA 1ENOA 3ZV3A 1XKTA 1VCOA 3HKDA 1DUSA 2UZIR 1QDUA 2II6A 1OFIA 4LN1A 3WX0A 1KMMA 2RKBA 4JI7B 3IQZA 5DASA 3T7KA 4DSOA 1SG6A 5JYBA 3T5CA 1Q1AA 5DULA 5KYNA 5LYYA 3NRJA 1M2EA 1MIOA 1N8SA 3AUYA 2D2VA 4AJKA 4E7PA 2WD8A 2VPWA 5ISMA 4TUYB 1X1EA 3V6LA 3TW8B 2V7QA 3QVSA 1M6EX 3CW8X 2AI1A 1V9SA 5CTJA 4EKYA 1A5SB 2PUWA 3VZDA 4BMYA 5A3QA 5LU9A 1F51E 1W30A 3B7GA 1Y7LA 2OQRA 2XOEA 3QU7A 2FFJA 4O4HB 4YC7A 2VSXA 3HN6A 2CHVA 4ZOLB 4BKPA 1TCBA 1IBSA 3JD1A 1QQ6A 3PQ3A 3PUKA 1EFPA 3KKNA 1FQOA 2QTHA 1UPUA 2W0MA 4L9SA 4A82A 4XRGA 2W11A 1C4WA 3CJTA 2P5TB 4IUDS 1B15A 4J4TA 2CLKB 4ZKDA 2GEUA 4WCFB 1TAGA 1HEIA 3ABRB 3DKPA 3IAHA 3TAUA 4BFXA 4ESEA 4YAIA 1E1CB 4PLVA 2Q2NA 4M8SA 2J09A 3COYA 4DCMA 2C3PA 3HH8A 5I01A 1ZONA 2A9OA 4IZ6A 1LSJA 3PHCA 3UB4A 1XWIA 1SK8A 1U0FA 2AFVA 4ZEWA 3WLRA 5I48A 3T5PA 2GPWA 3TG8A 3NMUF 4M1ZA 4ZAFA 5KKNB 1OTXA 3ZHCA 2QF7A 4UMEA 1NVWQ 3L43A 3W3AD 4NYJR 2NPFA 4GPTA 4X64B 1KE2A 2O8BB 5F12A 4F7DA 1IZZA 1XVLA 3LC2O 1L1RA 3EIFA 2ZSKA 4GWGA 1WF3A 2JVIA 3K0KA 4EJFA 4W82A 5JH7A 3LNCA 2Y1XA 4GSYA 3ZS8A 3S8EA 2IYEA 4ZRMA 4Q3KA 2BF4A 1BFKA 4M6WA 4RHTA 1P8AA 1AJEA 1C81A 1OZHA 4IQ0A 3T3GA 3TVTA 3M83A 3G2NA 3K6SB 2OAEA 5FTNA 3WKCA 3EWNA 1F1BA 4W99A 1DDIA 2FN9A 1ORWA 3DNFA 4MV1A 3BMNA 3CEHA 2QD5A 2DT5A 4GYYA 5I9MA 3S6JA 5ES4B 4NE7A 4FS8A 1GZ7A 3FRHA 1L4FA 1TGVA 1BNCA 4A2CA 1MO5A 2FP4B 4D8UA 1JRLA 3P2YA 3SY8A 1O8CA 1BXZA 1L1QA 4D4MA 3SU8A 1L5VA 2D74A 4AUNA 5AJTA 4A03A 3ZHOA 4GSKA 3VR4D 2ZCJA 4X91A 4TWAA 3A1UA 4TZTA 5G0WA 2ZXEA 4NYIR 4I55F 3HNPA 1H8HA 4C89A 2R5NA 4L5IA 1W5TA 2MHCA 3NHSA 1LBQA 3PG5A 1HGXA 2QN1A 2OHJA 2VRCD 4ITUA 3COJA 5FI3A 4KK4A 1QFSA 4KQJA 1J90A 1HSZA 3FVRA 3Q9NA 4GSLA 4RA6B 4YBRA 4L4XA 3TQCA 4QXQA 1Y6FA 2GRAA 3BXHA 3DAFA 2IX3A 2PBRA 1JKIA 3I92A 3M34A 1JN0A 1OXVA 3MRSA 4H7IA 4ZCPA 1NXPA 2VJPA 3EIWA 3LTEA 4UUQA 2O05A 5BR8B 4FLMA 3ZDXB 3OJCA 4LPKA 4OA5A 3PR2B 4IIXA 2IDMA 4MB0A 2XKBA 3DOEA 4EFDA 3K4HA 4UBLA 3FNQA 1I13A 3ZN2A 1PF7E 3IPAA 4YXFA 1ZOSA 3LU1A 5ANRB 1N78A 2GN8A 2D1FA 5FXMA 4CM8A 5JLJA 1DHTA 3LBAA 3QKTA 4ZPXA 2JLBA 3FMIA 1Z39A 4Q1AA 2IYVA 4JYBA 1TO6A 2H06A 2PQ0A 4LDJA 3ZNOA 1CJTC 3KOXA 1QIDA 2F62A 4S1TA 4YAUA 3KTFA 5AK6A 3TTYA 3OECA 4D74A 4Q03A 1F8GA 1QPBA 3THWB 1ST3A 2BFDB 4XWGA 3WIOA 1AXGA 1PNQA 1Y80A 4F46A 3E22B 1R0KA 1EUDA 3H4IA 4GUAA 4NYMR 4BVGA 2IZ7A 5CB4A 2C31A 1KP3A 3EZGA 1I4WA 2VWQA 1D6JA 3DMGA 2JIMA 4AF8A 5IJZA 2B6HA 1PEYA 3BTVA 3CYFA 2J3HA 3L8YA 4JROA 1D0IA 1P39A 3H42B 1RHJA 2BBTA 1Z5PA 4FYWA 1HOXA 5CYGA 2F3TA 2QAGA 1IY2A 3I58A 1ZFNA 4G5YA 4L75A 3SHTA 5CLIA 1M34B 3JD4A 1M34E 4IFEA 2VJLA 3H9UA 3DB2A 5B36A 3BXXA 1Z0IA 5I7WA 2ZIXB 1TI7A 3LUJA 3EH1A 1ECGA 2ZRAA 5JAMA 2WHEA 1JLLB 4BWVA 2Q5IA 1HR0B 1T24A 4EPRA 4MWEA 2H63A 3EPJA 1V1MA 1BW9B 1EJ6A 3UXEA 1JIKA 2B8WA 2HKIA 1S89A 2CMHA 3KHTA 4ZO4A 2QMYA 1YMUA 2HAEA 2VNKA 3AEYA 3KFXA 5FBHA 1T5TA 2JBHA 5G53C 1N5JA 3RTAA 1ZMOA 3STTA 4CF6A 2XDYA 3E7XA 3JWIA 1O94C 3CUWA 2NTYC 1CJSA 1U7DA 2AOXA 3BWYA 4PFJA 3GAFA 4YR7A 2HLDD 2AEEA 1M0WA 1P6QA 1TJ3A 5EG5A 4MP3A 4B32A 4D56A 5LMNB 1K66A 3A6JA 1PT9A 2J0UB 3HU1A 4PFKA 4H7DA 3TE6A 3ZLUA 1I9CA 3H0CA 3IDOA 1NUUA 1JIJA 1B1CA 1QM5A 1S2DA 2C2KA 5DK6A 2JG3A 2RH8A 3K71B 1CY2A 2IXTA 1EXVA 4WZAB 5CB6A 4WXEA 1KKMA 1ZJ4A 4P31A 1T1JA 5B1HA 4BMSA 5AK3A 3KUKA 4IUBS 4EKEA 2BGJA 4OHRA 1AC5A 1LBEA 5LDDC 1V3VA 1ZWLA 4WKCA 5EQFA 1J00A 4L07A 4U0KA 5EEGA 4WBNA 1BS1A 1SNYA 2Q0HA 1Z6AA 1ORRA 1N2JA 1Z07A 2ON6A 3VR6D 4L3VA 4E2WA 1QE0A 1YZVA 2ECFA 1XZIA 4ZT2A 2G71A 3ZWVA 1DMSA 1RRVA 4CLOB 2YXNA 221PA 2ZROA 4E1VA 5FPYA 3EGEA 1Z6QA 3CWZA 4HEHA 3RV3A 3JVUA 5KPDA 3N8IA 2FU5C 4OJMX 2XYQA 3DYVA 4L6AA 4DGQA 4IEEA 3D59A 4O5OA 2W5UA 4Q3LA 4UKDA 4C6HA 1H2YA 1BXGA 1JEQB 4OIFA 2X9QA 3CKKA 5KPJA 1OA1A 1R16A 3NNSA 5KYTA 2A5LA 1IN5A 4PIVA 2HA7A 2OG2A 4TS3A 3UV6A 5JS7A 4WUVA 3SSAA 3AL2A 4KTTE 2J7PD 5A3JA 1NNEA 1KPIA 3QY9A 2H57A 2NUAA 4NYMQ 1BCRB 2LCIA 3WLKX 2VXOA 3EZLA 5HX7A 1Q0LA 1IY9A 2X15A 1KZGB 1IEXA 3MGKA 3WGYA 5EKSA 1NRIA 2JH8A 3HM2A 3WLIA 5IN5A 4R31A 5E0OA 4EHJA 2YY5A 3RUAA 1CUXA 4NVRA 5JVDF 1XEAA 2WHYA 3IAS1 3HB7A 1L4NA 1U6JA 1ID8A 3WJ7A 4XCXA 1ZU5A 4MIKA 2PLNA 2PMCA 3TH5A 1OUMA 3EA5A 4R2HA 2Z58A 3FX2A 4GYKA 3I9V6 3L04A 4GS5A 1R5OA 2ETVA 1TJ5A 3E5MA 1C9DB 4QUIA 2BEJA 3IRVA 3USES 4B47A 1NBWB 3ZC3A 5JS6A 1W7AA 1NRJB 4CQMD 3S8MA 3WLTA 1R0LA 1SXGA 1T6YA 3NOQA 1DU4A 2IS4A 2COEA 4JKYA 4TKUA 4AIRA 1LBTA 5EJGA 4GXQA 2P2ZA 4ZYVA 1CB0A 1TJNA 4FONA 3LCJA 5DYTA 1IN6A 1NTRA 3IBGA 4DUGA 2RHWA 1W5BA 2IA5A 2EFEB 1OC2A 1O5TA 2E4WA 1UK6A 3GYGA 4AMVA 1SHTX 5BN1A 1UFQA 2YDXA 3PRHA 2QIOA 2VUHB 3RVKA 2BT4A 3EYAA 2CBGA 2QIPA 4G0PA 3PR1A 1UDRA 2H2FA 3F8SA 1NP6A 2DX7A 3MJRA 4FFRA 4P2BA 3UANA 5C35A 1DEOA 4Z7JA 4X8OA 3D8SA 1CQPA 1SEPA 2XB4A 3FYSA 3P45A 3UA3A 1BDJA 4EL0A 3OCVA 5K9ZA 3NHFA 3EEFA 2PUAA 4ZV4A 1A8SA 3FKJA 4GICA 1O57A 4Y7CA 3RRZA 4C2TA 4P6VF 4AM8A 1F5NA 1ADGA 4NMMA 4IH9A 2A0FA 3MT7A 4JR2A 4KSCA 4DPLA 1EK6A 2G67A 1DX4A 1FFDA 1GSIA 2PX8A 1EU1A 2VDUE 2GEFA 2XT6A 3I6BA 3CPSA 1CIPA 3O84A 4YRDA 5AO9A 3UFXB 3UPDA 3G68A 5IW8A 5LLTA 3FPLA 1ZAYA 3JY6A 5KVSA 2GHTA 5H70A 4F2DA 3QEKA 4YMTA 2P9CA 3DKKA 2YN4A 1FU4A 2YRXA 3RBZA 1JSRA 1TCCA 2H92A 4QUJA 2QRNA 4CKZA 1ISHA 3K9CA 5B1DA 2NXEA 4D6XA 1HZZC 2YWHA 3KL4A 3NNNA 2C58A 4HDRA 2EFJA 2O0KA 4KB5A 4HB3A 4IRMA 4LQDA 5KX5F 2BGGA 1PZNA 3FHLA 4X1IB 5C8YB 3K35A 3NTXA 5JMOA 2JLVA 3MBIA 2WP0A 4XJTA 1BYUA 3GFSA 3ED1A 4M1MA 4RMGA 1LQ2A 4GX5A 4F38A 1GL7A 1JR3D 3WGUA 1SKYE 4QUKA 1ETUA 2ZSJA 1VHWA 1U0GA 3DAOA 1A2QA 1E9RA 3IQXA 4AMBA 4WBNB 9ABPA 1APBA 2CLDX 1R0SA 3CZ4A 1D3AA 3UT5B 4WXMA 1V9CA 2Q2WA 3FBTA 2GXSA 4FFOA 4GMHA 1YVDA 3ZEIA 1Z4OA 4C2BA 2BY4A 4KRXA 2PA3A 1EM8B 1ZK0A 4V38A 2YNMC 3TLKA 1CUSA 4D44A 1IWOA 1JECA 1K8QA 4PSUA 4C3UA 3H2BA 4DY4A 4ZMSA 5IVKA 2XCQA 4LYHA 5B37A 2J87A 4WESA 3SF8B 1GFIA 2P2DA 1QIJA 1UJ2A 3V8NA 2OPBA 3PQ7A 5LR6A 1BWSA 3GFRA 3NHWA 5EIXA 1NW8A 1TD9A 4GOJA 4W6ZA 4RD6A 3R24A 2VHJA 4KN6A 5E1BA 4A6XA 3DZCA 1M6NA 1Y98A 1XELA 2HWYA 2VXYA 4TRMA 1DO8A 3I2YX 3M6UA 2X1MA 3ZYCA 2FG7C 3DVLA 1QR6A 1KGSA 1ETHA 2AOVA 2H1IA 4RABA 5BWNA 3EISA 4ZEXA 2XCSB 2IEBA 4NBKA 3BUSA 2VDMB 5ALJA 5IFLA 1KYVA 1YZFA 1EFDN 1J7JA 1KZ1A 1V45E 2CL7X 4MGIR 3LZCA 2BM0A 4LNHA 5FJIA 4P5EA 2HV9A 5L3ZA 3WGLA 1GG2A 2CKMA 5B58C 2CWDA 3T7JA 3UMCA 2O14A 5C8ZA 4IXNA 4R6WA 2OP1A 3NJ8A 4A2QA 2UYQA 1YRWA 3DQZA 1OQAA 2YXEA 4DMMA 3O91A 1YS2X 5E6UB 4JBYA 1DKQA 4G4GA 3RARA 4DMLA 4IXMA 5M3BA 4RDXA 4D9CA 2HRRA 1SHJA 3L01A 4ERXA 5ICMA 6ABPA 2HK6A 5PNTA 5DXFA 2O1XA 4ZI2A 3MTQA 4L85A 1F14A 4OREX 1EJ0A 1CUJA 4JX9A 4MCAA 1ZH2A 4CIXA 3GLGA 3CV3A 3U7JA 3OMLA 3OJEA 4UAGA 1L4EA 4IIUA 2ONJA 3H5IA 4TUYF 3NVKI 1L7OA 1F0NA 5CXXA 1XP8A 2WZBA 4G63A 4AKSA 1JR3A 5IT5A 1B0AA 2XHEA 2JAXA 4TM8A 5J2UA 4Z4FA 1TQHA 3B89A 4XR4A 3K1ZA 1KDPA 4J2TA 2HA0A 4E31A 5LKAA 3OE5A 3OPYI 4JLPA 2OBYA 5AWFC 3UHJA 4H0FA 3CVWA 5K45A 1EUCA 2ZRLA 3KT6A 3HDVA 3ZCSA 4BFUA 4DZZA 5BW5A 2IUFA 3VNRA 1CIVA 5JNUA 1GNVA 1KXZA 5HRAA 3KOOA 3QBVA 1Q95A 4CTOA 4OX9Y 3AEQB 3SYLA 1TKCA 3AVQA 1E9CA 1N75A 1Q6ZA 1O96A 1XAJA 3I5AA 3VJRA 3KHUA 1BJRE 4M9ZA 5ECWA 5KTYA 5FLXA 3NDIA 3LY5A 5KSPA 4TGLA 1Y89A 2RHCA 3ZE6A 4AZVA 1Z2PX 1TAUA 5KBYA 4J3FA 1V8OA 5AIAA 1EBBA 2CYCA 2OHGA 5EJFA 3EA4A 3VX4A 1U1DA 1RYFA 3QEOA 4R1LA 4YAJA 3W8DA 2ROQA 1EQAA 4PY2A 1O8BA 3L7MA 3NC4A 1B41A 1JDBB 1PI3A 1PZMA 1NLMA 4D4GA 3R3SA 1DOZA 3Q6IA 1GQYA 1P6UA 1SIWA 2C8KA 3GD7A 2X6TA 5EP1A 5H80A 5KQPA 1YCGA 2B2XA 4KFTA 2NPOA 1XALA 2HN9A 5AJXA 3U39A 1SA0A 2FPGA 2QS9A 2REQB 4E4TA 1TLLA 2WWHA 3LPNA 3GVCA 5EP3A 3CSSA 1Q7RA 4GW3A 2P9HA 4NAVA 1AA6A 1I6WA 1JHMA 2FLKA 3HBFA 1R8JA 1PWZA 3K9WA 3E8MA 3H1EA 1WNFA 5B6PA 4MJ7A 1QQAA 1I6MA 5JC1A 2B8JA 1U7ZA 4QELA 2BVNA 2PFKA 3DCNA 5THQA 1P1IA 1JSLA 1N8NA 1IB0A 1LY1A 1WVGA 3HP7A 1T3TA 2IXFA 2BTOA 2IXGA 3AKDA 4AN1A 5IUKC 1ZGGA 2GWHA 4D43A 1RAFA 5TJHA 3TDNA 5K8JB 3NHJA 4DIEA 1T8PA 2GD1O 4RH3A 4QDUA 4V1CA 1TYZA 3K16A 5K4GA 5BXYA 3VX3A 3VVLA 2WU3A 3G7UA 4RFSB 4J1TA 2LGJA 2LIPA 3D6TB 3ENWA 3L41A 4FQ7A 4K9DA 5CEFA 5IYZB 1WSBA 4Y2HA 3VJMA 3GARA 3PRYA 2XPCA 3IRUA 1SVLA 5COQA 2WLSA 2W22A 3SMVA 2YVUA 3FGZA 1V48A 4F1KA 4HUQB 4N76A 3NIBA 4JCCA 2OBFA 1V7ZA 4B3DA 4BMVA 3CIOA 5LFAA 2F3SA 3TIXB 4CR6A 3DDZX 3GPLA 4MUHA 1ATIA 3IAM6 4MPPA 3PGKA 1UMKA 2J5RA 1QFJA 3MJDA 2EJWA 3CEAA 1SCJA 3FN4A 2C97A 3PJFA 2NO9A 3MJFA 1L7QA 4AX8A 1HE2A 4WLVA 4UU0A 5I8WA 2Q46A 4N18A 4LF8B 2EQAA 3KKQA 3KKPA 4F9GA 3PDJA 4FOSA 1XPJA 1Z8HA 2FMUA 1C9JA 3A6GA 2PRIA 2ZUDA 3T3OA 1DRUA 5E9JA 1JLMA 1Q21A 4C2AA 4G1VA 4JC8A 3RVBA 3BDAA 4R8MA 2ZBVA 3S2SA 1UPXA 1R7RA 5DPMA 2NAFA 3H9JA 1AGNA 1YC2A 2DQ4A 2OGUA 2QRGA 3KFVA 4MKFA 2OA0A 3SC2A 3ZTWA 1TJYA 1Z28A 1R9MA 3PYLA 3DZDA 4LV6A 3ZDDA 2V4ZA 3E3OA 1PW7A 3KQTA 4HSEA 1VA4A 3SFTA 4J7XA 5CG2A 2ZCVA 1JSXA 3IDSA 4KPGA 3OIVA 1J39A 1P60A 4NULA 2H16A 3L92A 4CMCA 5KNCA 2VP9A 3LV8A 5HFAA 4K6MA 3RFXA 2OOKA 1H9BA 2P0AA 1GGEA 2PUCA 1Y6GA 3LC7O 1RCUA 4EBBA 4IMJB 4I81A 2FP4A 3FFAA 1A7KA 1KO1A 2O8NA 1KQOA 4JZYA 2AHRA 1BE0A 4MUAA 5FHQA 1LTHR 4YRKA 2DEUA 5HZKA 3VDRA 1YWGO 1LNQA 3M6FA 2HHAA 3FDXA 4BXOB 3RLFA 3RRJA 4E2XA 4JSRA 1ICIA 4ZANA 3TOCA 3B1JA 2XCRB 3TSAA 1HE4A 4RPCA 4RPKA 1PNRA 1EUCB 3SBEA 2EKDA 2ERCA 3WHIA 1WXIA 3DOCA 3GJ4A 3LHIA 5TPZD 3QVXA 2G9UA 3IULA 3H1TA 1EFCA 1Z6ZA 5F76A 2B8EA 2HRCA 3O82A 3FB1A 4IP0A 3WQSB 1IQ0A 3FPFA 4LY0A 3BG5A 3AVPA 4B73A 2OZEA 5TIIA 1HRKA 3DVAA 3ZU4A 1J2EA 3TW0A 3LKZA 4IQGA 3Q3GE 4DDTA 3HKBB 2X42A 1ECCA 3LBYA 3IS3A 5KQSA 4MVJH 2HK7A 3N2ZB 2W2MA 4RORA 3U4CA 3VOBA 1GYQA 2W7TA 3TRKA 2I78A 1UJ4A 2XADA 5HHTA 5ARBA 1RJFA 1LX7A 1P2DA 2XQGA 2QRVA 2FWRA 3GLTA 3IUNA 1SRQA 1F4VA 3KXDA 5CJ2A 1QH8B 1UBFA 4D0SA 1EE1A 3K6JA 5KDOA 1G0OA 3CLHA 1BOFA 3AILA 3N2GB 3P9XA 4YJ2B 4CHGA 4OUDB 4G1CA 5GQSA 2JGDB 4IVRA 1GFWA 1MABB 3PNLA 3WAKA 4OATA 1Y6RA 4B3SB 3USCS 4CIVA 5J47A 1U4OA 3G59A 2FRXA 5LZ7A 4J6EA 2IWHA 2O06A 5C53B 1Z47A 1M3SA 2JH9A 4B3MB 5DF1A 1EFVB 1VE7A 1DAIA 2BFBA 3AR4A 1KH2A 1NONA 2P30A 4EPWA 2HOQA 3VU9B 4AG6A 1TRKA 1Z0ZA 2A1IA 1ABFA 1NKVA 1NJ1A 4NI5A 3SXUA 4CMIB 1LDMA 4A8PA 2ZK7A 3PC8A 4G8BA 2W6MA 1XZJA 3O4RA 3OKAA 4Y2GA 2OFPA 5I7FA 1OXUA 2BBWA 4EECA 1AQYA 2GLXA 2IUYA 2F9LA 3HFSA 2FFQA 3LGSA 1OPRA 4UCQA 1Q7TA 1LI5A 1UBUS 1IJFA 1V43A 1YB4A 2B78A 3VDMA 3SM3A 2D0IA 3F6SA 3KHSA 4I8IA 2HJWA 4D8XA 4JI6B 3B9QA 1OB2A 3ZWQA 1W1IA 4H7EA 1D6NA 3TJRA 4Z54A 5JUWA 3ISVA 1KJ8A 2JCSA 2VDQB 4FFBA 1NDHA 3BC1A 3HB0A 3W2EA 1VYTA 4KPFC 8ADHA 1YFZA 2DY0A 3KQVA 3DL7A 4YCMA 2E55A 4QQNA 4F4CA 2J5BA 1F3OA 4Q48A 1P5ZB 4O1MA 2PPVA 5JEDA 1LK7A 5ALSA 1GVNB 2P62A 5JDCC 3OUUA 1EFRA 1CZLA 4LDNA 3WIUA 2QUHA 1I7NA 1YT5A 4YR9A 3JVVA 5JQGA 3HDHA 1EUZA 5K0GA 5TQVA 1KJIA 4JI1B 2W43A 2H2DA 2RJOA 3FWYA 2R7MA 3ML1A 2D3TA 1TW3A 4YUYA 1NIPA 3A7DA 4DA9A 1BMTA 1UXIA 2B7BA 2PE5A 2RB5A 3O4HA 2QE6A 2JZCA 2WUWE 3H3XA 5IYZA 2Q8PA 1CRWG 4MQBA 3Q7EA 3JQEA 1C8VB 2JBAA 1AZLA 4KE7A 3E9QA 4Z0TA 4Q4HB 2QD1A 2V0NA 1Z7GA 1HT1E 3LX8A 2HA6A 4R2KA 3UWSA 4Z86A 3HCBA 3TDMA 4E94A 4A8JA 1OXTA 4IOKA 1FRNA 4TZKA 2EKLA 4E33A 5AXDA 4EYKA 4P92A 4EJSB 1VE1A 2GD2A 2NU9B 3EZ6A 2PIAA 3KQQA 4TMFA 4EQZA 4AJIA 2KBEA 1WMAA 1OILA 3LCMA 4KP7A 1MC4A 3TS1A 3WL3A 2GYYA 4JVOA 3HBJA 5AW0A 3FCAA 4G26A 4EGSA 1K97A 5IJXA 3E9RA 2AK3A 1WS6A 2HF9A 1T2CA 2PT9A 2CUZA 4OLAA 4NICA 1C1DA 1S8AA 1K9SA 4DIUA 1N0UA 2BI7A 4TLCA 2PNJA 4E5UA 2OL4A 3HYNA 3GRAA 1TQ2A 5E1MA 4FYKA 3T4EA 1LFDB 4BBAA 2GAAA 5KYWB 4HFMA 1DTEA 4X71A 3L06A 2ZYVX 4H59A 2R7KA 4G4JA 4UBOA 3KOYA 3R5JA 4EHNA 4N5HX 1A8PA 1L8AA 2A57A 2FEXA 3KOUA 4GPIB 5EN4A 1ZWKA 5CB4F 1F2UB 2QPOA 4FHFA 1ZD8A 2XUDA 1O4VA 3KE8A 4YCDA 5FRDA 3FAKA 1KI8A 4MQEA 3IKLA 1VDZA 1Z68A 1RVDA 2OQVA 2Q3BA 1ACLA 2HLHA 2H8GA 1HC7A 3ZBQA 4EO7A 4KXNA 5CB8A 5JXGA 4M8IA 1H9CA 4EW1A 5JCJD 3ZXXA 1Z16A 1YCHA 4UREA 2HDNB 2F1RA 3QFTA 4FSXA 4QATA 1YCDA 1I33A 1OKKA 5FF9A 3U3KA 2Q1SA 5J1TB 4HADA 1JIUA 3A04A 3ILHA 1Q20A 2BTQA 3MWEB 4HNTA 5L6LB 1JG2A 2D4HA 4EY6A 1ZD9A 1X92A 2C4HA 1VA5A 2QZPA 3NP7A 4PC3A 5UKDA 1M1NB 2V03A 3I0ZA 4DLWA 3KXIA 1PV4A 2IYOA 4BNMA 3DA8A 5D7NA 2XA9A 3EGIA 3IKJA 4ID9A 4LMPA 5M5BA 1C3OB 5A9RA 1FTGA 4FYJA 3EEOA 4B6EA 4FKZA 5JO0A 1D5WA 4PZ9A 5CA0B 1M8GA 1YJXA 3HI4A 2QW1A 3DOHA 3N8GA 3GDHA 5EWMA 2QXUA 2FEMA 2IIVA 2QRVB 2O8CA 3DZJA 3GRZA 2PN1A 1DEAA 4L8FA 3HA3A 2BBOA 3KV3O 4H18A 4ONEA 3MUNA 1EX7A 1N3BA 3CLVA 2XJ9A 3UB3A 3ZZ0A 4DR7B 3BERA 1U28C 3DT6A 2VP5A 3QEMA 3TF5A 5B3AA 3CO0S 4FR0A 3KLMX 4I08A 5I7UA 4WJLA 3LWBA 4MQMA 5C5EA 5F2EA 2HDOA 2QMZA 1DWUA 1WR8A 3WK7A 5KYXB 1GV1A 1M8PA 3LUHA 2G9VA 2NO4A 1W94A 5K8TA 4NBRA 5F9FA 5BW4A 1PFWA 2PMEA 2QN8A 1CUYA 1FJHA 1NXXA 1VHTA 4WA7A 2O3RA 4JNKA 5ALFA 2W6ZA 4HDMA 2OXTA 4RF4A 3GJ6A 2CE2X 3LVRE 4OI2A 3LO5A 2PG3A 1ZK3A 2VDRB 4QSHA 4AK9A 2EATA 2FCRA 3C3XA 4XYEA 1RXCA 3JQBA 2EU8A 4EW3A 3QA3E 4DWOA 1N92A 1YRHA 2NSHA 4K5QA 4M1QA 2VP2A 5DBGA 1Q7GA 5I7AA 3OHPA 4HDSB 4CL2A 1BA2A 1QFXA 3H6HA 5HFNA 2FPOA 1WMBA 2H9IA 1GLGA 2V6BA 1AKRA 4A0FA 3BF7A 4E70A 1TQDA 2C4MA 5IKXA 3ZK9A 2V45A 2BFNA 3GGCA 4RVUA 5C5IA 3UM9A 4R1OA 4B35A 4D97A 5K0ZA 1E5QA 4I8XA 1YR7A 5DRTA 2JFHA 2OQIA 3H3JA 3ZWXA 4D0RA 1R4NA 2VPQA 5G4KA 3UKJA 4D45A 1SZCA 1WEKA 1F3LA 3KQWA 4YT4A 5C81A 2W37A 3QV2A 5A0VA 3SJZA 2R1UA 3LYUA 2R6HA 2C0CA 2V98A 4ER5A 4PS1A 2IZOA 1UKVY 2N47A 1GEEA 1T9CA 2AK2A 4MP8A 4EFNA 1W4LA 2X0EA 5FPSA 1UBHS 2GMWA 2I66A 2IY9A 3DFMA 3C3YA 3A9SA 4OYLA 1TVCA 2MINB 1T6ZA 3KFLA 2J3KA 2OFXA 3CRZA 3ETJA 4ZQBA 5HUHA 1A72A 1L5MA 2ST1A 3IJ5A 2MT9A 1AKWA 4QZVA 2R25B 4JLBA 2GSWA 5HCIA 2V9ZA 3CH4B 1G55A 3A3YA 4NJMB 3VKWA 3WLHA 1FSGA 4QTYA 1X1RA 3ER8A 3D5TA 4D98A 1KWGA 2WWRA 1VCMA 2GRUA 1UBKS 6ADHA 2H11A 4EATA 2G7MC 4IIJA 3S68A 3CLKA 2VLBA 1RZ3A 2EW8A 4OGGA 1ZRSA 3BEOA 4R2JA 4KLZA 2JAQA 3MWDA 1IQRA 1PX2A 2JHGA 3GP3A 5SY9A 1MB0A 3WYDA 4C7JA 3P5BA 4BP3A 4DSUA 1ILEA 2OV6A 3QXGA 4RTOA 4MUXA 3NHKA 3SIPA 1QTRA 2BGWA 1TZBA 1NNSA 5TS2A 1USVA 1MXFA 3NWOA 4QYWA 2FPSA 2YMMA 3DFZA 4RSGA 4XIIA 1MZVA 2X5OA 5DP1A 1TE2A 4NZ9A 3PUIA 3G2HA 4GR9A 1YBHA 1B0UA 3E22A 3PJGA 4X6XA 4WGGA 4MULA 4ALKA 2BC9A 1D1SA 2QTCA 3AU9A 5GIPE 3ITNA 4LC9A 2PCLA 1Z83A 3TWOA 3WV5A 4TYYA 1DKPA 3AESB 3T7EA 1OFUA 2DR2A 2QTGA 9MHTA 2CLLB 4JLMA 5C31A 2XMGA 3A7EA 3KLPX 4ITRC 4UJ5A 2NYUA 3SX4A 5J4YA 2EZ4A 4KR0A 4JBLA 1GG8A 3STUA 1PE0A 3N0XA 4HAZA 4AMGA 2F64A 2ID8A 2WOJA 3BYZA 5LLSA 5K0LA 1E4YA 2ZSBA 2PO5A 3OZFA 3PJEA 1BDMA 1NQAO 3A31A 4M9SA 5KEIA 3FSGD 3QKSA 4MEBA 3PS9A 3VHQA 2BLLA 2R8OA 3T0FA 4CCSA 3PNQA 3IMCA 2V7XA 5A9TA 4BYGA 1T4MA 1WTCA 3JARB 4BGVA 1FP6A 4N0PA 3M1IA 4YRQA 2O8EA 2R6AA 1ZYUA 5SYNA 2HUNA 3QVTA 5HK8A 2FN8A 3NIGB 2O0LA 3H2ZA 4MRMB 5KYYB 1NSYA 2AOUB 1NVXQ 4KLNA 4RNDB 2QSJA 1SULA 1U4NA 1E62A 3PCRB 2JJ8A 1KARA 3QRWA 4DLBA 1SD5A 2ZBQA 2X8JA 5JNTA 5F1YA 1DGQA 2ETXA 2W2PA 1Y63A 4G1FA 3TLBA 4D96A 3CPJB 1OA0A 4L57A 3LGAA 1U2RA 2CCJA 2O7NA 3WBJA 4ALJA 5A5DA 3SC2B 2OEPA 1NXOA 3O3NB 5DDIP 1B0ZA 2Q3EA 3T9AA 3U19A 2F3RA 3BXPA 3R40A 1JEYA 1NQUA 3KD3A 3W3ZB 1NM5A 4MKGA 2O7RA 1C9NA 1NLYA 4MI9A 1MB9A 1P0IA 3V7UA 4AC9A 5HE8A 4EAQA 1PT6A 3ABIA 3AY7A 4LY9A 1ISSA 5AICA 5F23A 5MHTA 4KIUA 3IOMA 2ZR8A 1E1KA 1IB6A 2ZE5A 5EHXA 3UPTA 1AHNA 3MJHA 3UFBA 3O75A 1I94B 3IP8A 3UMSA 4P0PB 3GVPA 2QPTA 3T4PA 4W5WA 1XPOA 1N5RA 2W42A 1H8HD 3OZIA 4KAFA 3RUDA 3OQVA 2R5WA 2GD6A 3PE3A 3C8ZA 3L6UA 4TTJA 5BSTA 3DBOB 3LQRA 1Z5WA 2CVQA 2FWIA 2VK8A 4Z8YA 1YHNA 1O2DA 4ZO9A 2D2EA 2XWBF 3DR5A 2X6QA 1QXSA 3NC1C 4U7JA 3SBXA 3VTAA 1B4DA 4CKBA 1I2BA 1KI6B 1DAKA 1NJ5A 4HDMB 5F1PA 1M33A 2WWGA 4FWTA 4HDOB 2D62A 2ZRQA 3AL0C 4K9SA 1IBCA 3NAQA 5DYWA 4MHTA 4E1BA 2WG1A 1AUQA 3F7MA 1U9IC 1Y1LA 2BEVA 3RSCA 2NN3C 3LRXA 1PJ8A 4G37A 1Q22A 1Q6YA 2Q4TA 4PYRA 5K51A 2NUAB 2D2IA 6NULA 5AKIA 1K63A 4J16C 2DQYA 4PCUA 1KVRA 4R40A 4BGUA 4BMXA 1CDEA 3D8BA 4QTXA 3WLEA 4YI3A 2JEYA 1AKEA 1E0DA 2DP4E 2FX5A 3PBKA 3VYSB 2Z98A 1RBQA 3FI0A 5IAOA 1N2CA 2Q07A 2OXIA 4G5SA 3VNQA 4JK3A 4YCAA 4BO7A 4N40A 2ARKA 2NSJA 5I9NA 1Y7TA 3C6KA 1FFCA 1Z3CA 8MHTA 2YIDA 2GEDA 1LRKA 1KIAA 4HS4A 3ODPA 1UZAA 1Q1NA 3OLWA 2IEAA 5DHPA 3T7CA 5G0UA 5TXGA 3E82A 3B3GA 4BBPA 4EPTA 1MO4A 2NYVA 4U7PB 3Q2IA 5BVHA 3H84A 3MK31 2F1JA 1QIMA 1UKAA 3EVNA 3URMA 3J81A 4W5TA 3VNSA 4PONA 4XAQA 5HGXA 4QOSA 4CTKA 3U3RA 3LCUA 2H5IA 4FHCA 1EDEA 3RGGA 1JG7A 1GXSA 1H5NA 3D7SA 3FVWA 3DMTA 4FJ0A 4QHSA 4L3OA 4YDSA 2ZT6A 1XUOA 2Q7OE 1JI0A 2XMZA 1X80B 1YFKA 5C8YA 3M8KA 1PSDA 3UK1A 1UF9A 2VJBA 4YY3B 3MAAC 3G82C 4RANA 5JEEA 4QDJA 4DPMA 4ROSA 2A4MA 3LECA 1MC1A 5GMOA 5A2QA 3HEBA 1L5GB 1DJQA 1LDGA 3D7LA 1D7OA 1D2NA 4FIDA 1WZCA 2BFBB 1CUWA 3E7FA 4IF6A 1ZEMA 4P9NA 3SEAA 5M34A 4AJPA 2X4IA 4UHHA 1DE0A 1O54A 2Y67A 2Z2ZA 4NOMA 3M2PA 3K0CA 2FN4A 2FWAA 4GQIA 2Z0MA 1VLMA 2EX4A 2LPMA 4MRVA 4UEJA 4F2PA 3QF4A 2PR2A 3BULA 5MGBA 3WTCA 2ZJ4A 3B9PA 4PX3A 4LKRA 5LQUA 2IU3A 5HIJA 4WVLA 1YC5A 2AI2A 4MDYA 5SYMA 4BVFA 1UMCA 3WHPA 4RADA 1XF9A 4P3NA 1L6IA 3OBIA 4CPDA 3PWSA 1VGVA 3GLFB 1J8YF 2C1EA 2D5IA 2BDTA 5CNMA 4DG8A 2NX2A 2CUKA 1G3UA 4HYYA 3FJYA 2AN4A 2E2WA 5AI0A 5ALEA 3UMJA 2PPLA 1MABA 1H9AA 4BTLA 4K6FA 2Z1DA 2JI7A 3IYLW 5F33A 1Q7BA 4FYMA<