2ZTVA

The binary complex of d-3-hydroxybutyrate dehydrogenase with nad+
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
260
structure length
260
Chain Sequence
MLKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISALAEKNGVDQETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
publication title Closed complex of the D-3-hydroxybutyrate dehydrogenase induced by an enantiomeric competitive inhibitor.
pubmed doi rcsb
source organism Pseudomonas fragi
molecule tags Oxidoreductase
total genus 98
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ztvA00
4KQWA 1EVIA 3AOEA 4EJ6A 4TVBA 1DPGA 4P4LA 2POQX 3T7EA 2OGUA 1NFFA 1YQGA 2OUIA 5TF4A 3ZU4A 3NDJA 2EERA 4Y6SA 2P5YA 4MVJM 1IE3A 3OJFA 4MIYA 4QECA 3W1VA 5C3MA 3B1JA 1SB8A 5HRUA 2Y93A 5T57A 4B7UA 3TJRA 3GPIA 4NZ9A 4RPGA 4TRNA 3KTDA 3CZMA 1O8CA 3QWFA 3EC7A 3AI3A 1PQUA 1ZSVA 4BKRA 1ISFA 1U2DA 2WYWA 1NFQA 2BFMA 2VTDA 1JKJA 2VUUA 3DBLA 5BNFA 1TT5B 1K2WA 1GPDG 5DP2A 3GRPA 2B5VA 4Y8VA 4CLOB 5F21A 3S1LA 3TL3A 4YPOA 2FRDA 1BSVA 1B14A 3EDMA 4YJHA 3H7AA 3COSA 1WDKA 3M1LA 4IDCA 1GFSA 1H6DA 3MOIA 1D1TA 2O4UX 3I9KA 3Q2KA 5A3VA 4F46A 4TWRA 2E49A 4JK3A 2UYYA 2PH5A 3NYWA 2WTBA 4FB5A 2C2XA 4XDZA 2C82A 2P9EA 1I2BA 2CDCA 1ADFA 1ZH8A 5G0VA 4H3VA 5KJCA 1SMKA 3JQDA 3E9QA 1OFGA 5L4LA 4E4YA 3O38A 3VKUA 4BMVA 4CMAA 4JLWA 3GT0A 1CQJA 5KOIA 3CXRA 4G65A 4EI2A 3IDSA 3HN2A 2BI7A 2G76A 3OEYA 4HWKA 4MVJI 2R00A 3PHGA 2X23A 4YEDA 5C7LO 1XG5A 3ANLA 2PFGA 4OSPA 3TFOA 3TZHA 4R1TA 4PVDA 2BH9A 2VOJA 3IKVA 3QY9A 4RVDA 2YHIB 1PZGA 2RH8A 2ZQZA 1YBMA 2CSUA 3INGA 2VUTA 5KNLA 3AOGA 4WK6A 1HYGA 1B8PA 1HTBA 1KVSA 4FFNA 4OO3A 4W7HA 2D5AA 5IZCA 1W73A 1E3LA 3RIHA 2W4QA 3GEGA 3AK4A 3A28A 1EBUA 5DZSA 1ORRA 4RPHA 3Q1LA 3E9MA 3GA0A 4IINA 3RC2A 3GVPA 4AJJA 1MC4A 1Z75A 3D64A 4GPD1 1JTVA 4HP8A 3TOXA 1DEHA 1XELA 1KY4A 4WCFA 1X7HA 1UDCA 2FR0A 5C37A 3KSDO 1N8KA 3D4PA 4Q3DA 3PHLA 2Q2VA 4R69A 4ND3A 2IYOA 1P1IA 4LCJA 4EUFA 5A03A 4ZU3A 1E5QA 4IZHA 4J16A 4H7PA 4II2A 2P91A 5TT1A 3SBOA 3MTGA 3ENNA 2VYVD 1BTOA 3WIDA 4P8RA 4CLDA 1HSZA 1WPQA 2NLOA 2J5QA 3I1JA 4B7CA 2UUPA 1A4UA 2JCXA 3PIDA 4MVJH 4DPKA 2ET6A 4AICA 4J90A 1ISGA 2NU9A 3U9LA 4IGFA 2EF1A 3OQ6A 2VYVA 4ITUA 4WOJA 3WBFA 3JQ9C 1VSUA 4LVUA 3S2FA 4XYGA 4A0SA 3PDJA 5GZ1A 3GFGA 5JFOA 2D8AA 2Y67A 1R6DA 2LDXA 3UXYA 3R6DA 2WE8A 1LUAA 4EEZA 4PRKA 3VVBA 1VJTA 1MUUA 1MA0A 1Q7BA 3CEAA 1LSJA 1Q7GA 1X13A 4Q3NA 5CDGA 1TVEA 1XR3A 1JVSA 4BMNA 4BS9A 4MINA 5TJHA 2IEBA 2W98A 2H63A 4MOWA 1DHRA 3DMYA 2VZ8A 4NU5A 5ITVA 4L4RA 3PTZA 3HFGA 3DFZA 4YXFA 3KYDB 4UVIA 2PR2A 2GDZA 1B8VA 3O8QB 1M76A 2GASA 3C7DB 3OQ1A 3RUIA 3H65A 3T4XA 3ZWOA 1H93A 1SPXA 3OECA 4KP7A 2O3JA 2P2SA 3TNLA 2BD0A 3I52A 2PNFA 2H1SA 4F3YA 3ZCXA 3BMOA 3CE6A 4JNKA 4WNCA 1RM0A 1HZJA 2FMUA 3PK0A 3AY3A 5FF9A 4D3FA 1NNUA 4GVLA 2DFVA 3OICA 1JAXA 3ONEA 2Y68A 3EHEA 1Z6ZA 4EJ0A 3I9LA 2DLDA 1I0ZA 3VPHA 2DBVO 4C7JA 1E3SA 1M6WA 1A27A 4IPTA 4FSHA 4DLBA 1EQ2A 3H3JA 1GZ6A 3N58A 4XYLA 2QRKA 1LDBA 1PGJA 1BXGA 5JAZA 3KLPX 4JJFA 1GTMA 3PHJA 4XDYA 1PR3A 3ZWVA 2EW8A 5A4DA 3D3WA 4ZJUA 1UDBA 2NTNA 4I8XA 5KJFA 4I5FA 4OL9A 3L0DA 3WJ7A 3U3XA 1ZNQO 4HFJA 5JCXA 1XU7A 4FOOA 2B83A 1ZK0A 1U28A 2Y1OA 2OFPA 1NPYA 1ZK1A 3DDNA 3OA0A 5T6BA 3UW3A 3DBLB 3AOEC 3EZLA 5H83A 2CVZA 3IUPA 4DTIA 4BO9A 3Q11A 3GHHA 2DFDA 1V35A 3AUTA 3HE3A 4ZRNA 1NQOA 1N9GA 2UUOA 3FTPA 4FJ2A 4L0QA 1T4DA 3L77A 1U7HA 4YJHB 4Z0PA 1LDYA 4BV9A 5L9AA 3DZJA 5KTKA 1XSEA 1U8XX 3GVIA 4YT8A 4WOKA 2EW2A 1MXFA 3LT0A 4TZKA 1LA2A 4U6SA 4FCCA 4OYRA 3K6JA 1ARZA 3EMKA 5CDUA 3HB4X 1EDZA 1UR5A 1ZW1A 2PY6A 4UULA 5EQDA 2O48X 3C7CB 3JYNA 3LT4A 4HKTA 3BTSA 3JD3A 3UH1A 2C7GA 1NBOA 2NTJA 5IXSA 4RPJA 1PSDA 3WJAA 2FSVA 4HNGA 1OOEA 1I32A 2AQ8A 3JD4A 4CUKA 1H9BA 4OHUA 4D42A 3PQDA 4LN1A 3U49A 1I36A 1LJ8A 2UV8A 1FXSA 3IMFA 3N7UA 4KDFA 5CHEA 3BMQA 1YB5A 1ENZA 2C07A 4E5YA 4HV4A 1Y9EA 2AQKA 4ZQEA 3T4EA 5TJ9A 4CM6A 5CEEA 4A27A 2C20A 3O03A 4E0BA 2B4QA 2NWQA 1WAMA 3ZU2A 5TLSA 1ZCJA 4NK5A 4IQGA 3UOGA 4DMLA 3D3EA 1H5QA 1DC3A 1NP3A 3PYXA 2GERA 3DBHA 3C1TA 3W6UA 1DAOA 3Q0EA 3VPFA 4XRGA 1GDHA 4GKBA 3HB5X 2PKQO 4LCEA 1ONPA 1I30A 4XYMA 3D5QA 1I2ZA 1HDYA 2YDYA 3E82A 2DPGA 1IPEA 4CM5A 3ZHYA 1KVUA 3S2IA 3K92A 3SVTA 2EJWA 2EG9A 2PLAA 3C1AA 2Q4EA 4BNXA 1N1EA 2FR1A 4PG7A 1DC4A 8LDHA 4PRLA 1D3AA 2TMDA 2AEJA 3UAGA 2VWGA 3RC9A 4NBWA 1YE3A 3PP8A 2ZIZA 1YXMA 2R00C 4WCFB 3RAJA 3C24A 4TZTA 1UZMA 5KJEA 3I5MA 4R51A 1SOVA 1VM6A 3MTJA 4XQ9A 1U3TA 3SEFA 2Y1DA 3NX4A 2ZB4A 2FHSA 1DB3A 1Y81A 2J3HA 4MKRA 3WNQA 4CMIA 2RAFA 5BR7A 5L4SA 3S2EA 4E13A 5IZCC 2XAAA 2WE7A 1AN9A 4IY1A 2OBNA 5L95A 2B37A 5FI5A 3W6ZA 3RU7A 4LSMA 3S8MA 4DWVA 4J2OA 2O3SA 3IS3A 3PXXA 3PJDA 2P68A 1R4MA 3TWOA 3LT2A 1DOHA 4IMPA 3W8EA 1Z45A 3ZWYA 4WCFC 1ULSA 3GNTA 5K6AA 1SOWA 2ZCUA 3ASVA 3EYWA 1Y5RA 1RM3A 4HADA 3W8FA 1DXYA 3IC5A 3QQPA 2GZ2A 4K9DA 4RVFA 5JC8A 4J1SA 2PD6A 2YDXA 1KERA 3WGGA 3RUDA 4AJ4A 2X5KO 1BWSA 2C5EA 4DXHA 5BSHA 1FDTA 2HKIA 4FDAA 3ULKA 4ND2A 1NWHA 2D59A 3I9NA 3NKLA 4RORA 3DHNA 3W4JA 2BMAA 2CVQA 3E5RA 3GQVA 1EE2A 4W7IA 4P4NA 3KHUA 3NT4A 4JJIA 3O26A 3V2GA 2AW5A 5B4TA 3BMOB 4E5PA 4MIEA 4XD2A 3WGIA 4DQXA 4LRTB 3PHIA 4XCVA 1C0KA 1WXDA 4RPKA 3ONFA 1UXIA 1NHGA 3SXPA 1BXZA 1K6IA 4M86A 2EGHA 1DJNA 2BGLA 4CMGA 1JLLA 2X6TA 4M8SA 4QUKA 4CUJA 1L1FA 4WECA 2GZ3A 4JJGA 2HRBA 3OHSX 3R1IA 4GH5A 3WFIA 3DC2A 3B1KA 3H9UA 4UUNA 3VH2A 4J4TA 5DT9A 3H8VA 4BB6A 1BXGB 3RU9A 4LVCA 1ZEMA 2A35A 2O7SA 2PZKA 1A9ZA 4WCDA 4BNKA 4IIUA 3NTOA 3OETA 1E77A 1VKNA 3AUSA 3D3WB 4BNHA 3RROA 2NV6A 3QWBA 1QSGA 1HXHA 3V1UA 1P1FA 5TIIA 4UEJA 5HBRA 5C7IO 1JAYA 4XGIA 1ZUD1 4BNZA 3TZKA 3HDHA 4M54A 3KETA 2VWPA 5F5LA 2GN4A 2JKVA 3UN1A 2X0RA 3IL2A 1LRJA 3K9QO 3S2GA 5JO0A 1H94A 2PH3A 3PDUA 3UGKA 1GZ3A 3RBVA 4Z0TA 3BAZA 4GKVA 4OQZA 1N9GB 4Y9DA 4U7WA 2Z5LA 1DIGA 3AM5A 4MVJG 3P2OA 1DFIA 1ADGA 1QLHA 4PLFA 1JKIA 1PWXA 1WDLA 2DBZA 3TF5A 5G0TA 4MKZA 1FDVA 1R0SA 1V3UA 2O3QA 1KC1A 4J3FA 4JQCA 3WGZA 5KVQA 3I6IA 1I3KA 2O2SA 3BXXA 5U1PA 1Y6JA 3HG7A 3KZVA 4GX5A 4B4UA 2X22A 1X7GA 2JAHA 3PFFA 1QP8A 5IN5A 5DOZA 3A06A 4HFMA 1IB6A 4IGEA 1U5AA 4FIZA 4EITA 1B16A 1XIVA 3JCZA 2WSBA 5JE8A 3RBXA 3ST7A 1D1SA 3BMQB 1YDEA 3PJEA 1LC0A 1AXEA 1I33A 4HY3A 1F14A 1LNQA 1R37A 4CMJA 1KEWA 1M67A 3E6AA 4XB1A 4AJ1A 2OMEA 4J4BA 3TOZA 1ADBA 3SJUA 2OHXA 3DTTA 1T4BA 4FGWA 4WLNA 3RASA 3DBHB 1CIVA 2GRAA 1FDSA 3WTCA 4DBVO 2NQ8A 4W4TA 1MP0A 2IZ0A 1CERA 3PLRA 4LGVA 1VC2A 2EIHA 3TZ6A 1NVTA 3KEOA 4YAGA 4L75A 3WLEA 2VCYA 2PTGA 3NT2A 3KSZO 2HCTA 2C0CA 2VTEA 4A2CA 3V1TC 4XYEA 5BNIA 2YQ5A 1ENYA 1Y8RA 1J6UA 1LTHR 4FFLA 3ZV6A 4CV3A 1E3WA 2WDZA 4R9SA 3U4HA 2AXQA 5JSFA 2EKLA 4NFSA 2DBQA 5EJ2A 4GX1A 3I83A 1GV0A 3ABIA 1TA4A 4KUEA 4RF4A 4YCAA 1YDWA 4BKUA 5HS4A 5EESA 3CIFA 1A72A 1EMDA 2GD1O 3WG9A 4YRAA 2CY0A 2Q50A 4PCVA 2ZTUA 4CMIB 1IYZA 1N92A 3MWEB 2XF8A 4PLPA 2D4AA 4UVEA 3WQRA 1LI4A 2OORA 3FF4A 1LRLA 2EGGA 2FWMX 4FN4A 1OI7A 5KCZA 2W90A 3ITKA 4Y67A 1NPDA 1DSSG 2AMFA 2V6FA 2JD2A 3OH8A 5CDTA 1VJ1A 4IS3A 3W4IA 4RVUA 1QYWA 1UP6A 4BNLA 1R4MB 4BO5A 4E5KA 4IDAA 2ZB8A 4DYDA 2ZYDA 3ASUA 3KRTA 5DDIP 1WVGA 1PGQA 3LU1A 1SC6A 4N5LA 4AJEA 3T7CA 4E2WA 4B3HA 4OKIA 1K0UA 1YB4A 3HADA 5CEFA 2J5RA 5IZ4A 3O9ZA 1DC5A 3F5QA 3GFBA 3NDRA 4XQCA 4ZGWA 2J8ZA 1Y1PA 2A94A 3ZNOA 4RQTA 1X7DA 3LDHA 1EZ4A 1SEPA 5A3JA 3RD5A 3WIEA 2H9IA 4AVYA 1AHIA 1ZFNA 6LDHA 4UUPA 1Q2XA 4FC7A 4R41A 1ISMA 5JC1A 5CPBA 5T64A 3WX0A 4FBGA 4D43A 4LISA 2DU8A 4Z0HO 5K6AC 1FDUA 2ZJ1A 3KV3O 3ROQA 3AJRA 4DBZA 1MFPA 1I5RA 1KIFA 1LRKA 4URFA 3K2EA 4O59O 1K3TA 1SEVA 4AG3A 4J9VA 3C8MA 3AM4A 2GN6A 1IUKA 1WDMA 3B70A 1HF3A 5I7VA 4PZEA 5U4QA 3U4CA 5IF3A 5IFLA 2VRCD 2YV3A 4RPLA 3JQ8A 4CMBA 5JPIA 4CV0A 5DF1A 5IDWA 2NTVA 3G49A 4CQLA 1EVZA 1H6CA 4GMGA 4EEXA 1KVTA 2BRUA 4WLEA 4EGFA 4A03A 4YAKA 1LSSA 1KBZA 4GX0A 5A02A 2VRCA 2F1KA 1YONA 4MO2A 1BGVA 4NDNE 5A9RA 4X54A 4BB5A 5CPFA 3D5TA 3VC7A 1N2SA 3L6OO 4B3IA 3EVNA 2FY8A 2Y1GA 3DAFA 5EMHA 1F8FA 3RVDA 3HDJA 4XQEA 4EZBA 1AUPA 3RJ5A 4RQUA 4ZICA 3W8DA 4QXMA 1H2BA 2J3IA 4Z6KA 1QYVA 1CEQA 3H9QA 3AUUA 1UXGA 5T67A 1QXSA 4YJFA 5EERA 3E9NA 4F6LA 3EY4A 4YAJA 3L4BA 4ZQFA 4B4OA 2G0TA 4PLCA 1HLDA 3WMXA 4OAQA 1BDMA 4PG4A 4CM7A 4Q3EA 2QG4A 4E5NA 3FCOA 3SLGA 1PIWA 7ADHA 1PS8A 4BNJA 4A7PA 1IULA 3D0OA 4BGEA 3GGOA 3D1LA 4BO2A 1VL0A 4BNTA 1O6ZA 1E5LA 2RBEA 4GLLA 4IJWA 3GH3A 1HRDA 1QLJA 3RI3A 2XXBA 4RV9A 5AQ1A 5IN4A 3PWZA 5IDXA 2Q3EA 3JQEA 3A1NA 3HZZA 3RWBA 3QP9A 3IQDB 2WM3A 4ROSA 3L6DA 2YZ7A 4MP3A 3JSAA 4B8ZA 3PGJA 5A5FA 2IXAA 1B15A 3KOUA 3DONA 1ZKMA 3F4LA 3OF2A 1ZJYA 3ZHXA 3E48A 2ZYAA 4J49A 4Z3KA 1F06A 4NH4A 1ZMOA 4YDRA 2OOSA 1V3VA 1SBYA 3O4RA 5C5IA 4WLFA 1KS9A 2F00A 3H9GA 4Q39A 2AE2A 2HDHA 3VDQA 1VKOA 1WZEA 2NACA 4BQPA 2GNAA 4J1QA 3NV9A 4UEOA 5A05A 4I9NA 2JL1A 3DOJA 2OO5A 3AFMA 1HSOA 1NQTA 1R0KA 5GMOA 3QHAA 1LSOA 1WLYA 1EVJA 3AWDA 4L74A 3AI1A 4A10A 1Y8RB 4PLHA 3ZWMA 3LZ6A 1KVQA 4DUPA 2J5KA 3WWZA 3UHAA 1UH5A 1E3WB 3GAZA 5G0SA 1QYDA 2IXBA 4JP2A 4WKGA 1FDWA 4GSKA 2YV2A 4MIOA 4PVCA 3SJ7A 1SZJG 3GZNA 4HFNA 3OIGA 3C3XA 1UP7A 2NADA 4KTVE 4U8GA 4YJDA 1GADO 3VDRA 2P9CA 5I8WA 5DN9A 1YWGO 3PHHA 5CP8A 5T8KC 3RKRA 2JFGA 4DA9A 2YFQA 3RSHA 1TXGA 5LDGA 3H9EO 3PZBA 1D8AA 2EP5A 1F0YA 3WLFA 3JQBA 1XYGA 2DC1A 4R5HA 4NU6A 3JQFA 2D2IA 2XXJA 1UXKA 3KLMX 2O3UA 4AJIA 1KYQA 4NK4A 2QZ9A 4L9RA 4EDFA 1M66A 3INRA 1ADCA 1PS0A 2JHFA 3FNEA 1P31A 2QRLA 4ND4A 1MFZA 4DIBA 1FF9A 4KWHA 4BKQA 4CL8A 5B4UA 3M2TA 2AQIA 4R68A 5F1PA 1KEUA 4D3SA 1LLUA 2X0IA 2YHUA 3JQ7A 3QWIA 5EINA 5G4LA 2G82A 1MC5A 3JD1A 4YRBA 3BHIA 4TMFA 5JDCA 4J6FA 2GSDA 2W2LD 3RFVA 3WDSA 5GY7A 4IQ0A 2X5OA 2V6GA 2HRZA 4FD3A 3VH4A 3DWFA 1UZLA 5COAA 5ILGA 2E82A 3M6IA 4PLZA 1NVGA 4GMFA 1C0PA 4NQZA 1AGNA 2W2LA 1S6YA 4OXYA 1ZJZA 3VPXA 1QR6A 1GUFA 1WMBA 2PGLA 2Q1UA 1LLCA 4WGGA 2ZATA 4WASA 2RHCA 1OC4A 3GAFA 1B0AA 3OQBA 2HU2A 2O3TA 1O95A 3QW2A 3EW7A 4M89A 3ROKA 3DZKA 3OIDA 4RF5A 1Z74A 4Q9NA 3WFJA 5AOVA 4CR6A 5HA5A 3PPIA 2FPGA 3DO5A 3NGXA 1XWFA 3CSDA 3PIIA 2CDBA 3SX2A 5HTOA 4QT0A 4ALNA 2UVDA 2I3GA 3LVFO 1GY8A 1EEHA 3GEMA 4M1QA 2ZTMA 1YJ8A 5CG1A 2V6BA 3HN7A 1O89A 3U62A 5K0ZA 1LSUA 3ZW9A 1E6UA 4B79A 4W6ZA 4K1LA 5TT0A 3JQ8B 3VPSA 4CQLB 3SC4A 4PZDA 1H2HA 1N1GA 4ALJA 4O6VA 5FFFA 4MPDA 3NT5A 4R01A 4CQMD 1Z7BA 1JWAB 1T1RA 3VPGA 1CDOA 3GUCA 3BTUA 4YB8A 4XZ3A 1T2FA 1K6XA 1TT7A 4IS2A 5ENVA 2DAPA 3DZBA 3FPLA 1GYRA 4CQMA 3VZRA 3NGLA 3TPCA 4XB2A 3FHLA 4I5GA 3QVXA 1YL6A 1N5DA 4PG6A 4BNWA 1PJTA 2O7QA 3EGOA 2OP0A 4BNYA 4O1MA 2QYTA 4MVJD 3GN2A 3WYEA 1H6AA 1UZNA 1A4IA 3DQPA 3ICCA 3ZNNA 3F5SA 1R12A 4MDHA 4ZA2A 3EUWA 2YQ4A 4YJFB 5I9MA 2B0JA 3JYLA 1PZFA 2OZPA 4NJMA 1NQAO 2JCYA 4NHEA 2VNSA 3GGPA 4MVJA 4E2YA 5CDSA 2E6UX 2BLLA 3KVOA 4I5EA 4AJKA 2DTEA 1N7GA 4U5QA 4CM4A 3G3EA 4IJUA 4RVGA 3JYQA 4JX8A 3A14A 4WPGA 3KUXA 4RF3A 3H9JA 3ZV3A 2RCYA 1A9YA 1ISHA 1NPTO 1U3VA 3L9XA 4KUHA 1RPNA 1I2CA 1GD1O 4DRYA 1ZMTA 1C3VA 4A5OA 2IE0A 4DLAA 1HDXA 4YT4A 4FFMA 1RJWA 3ADOA 1YO6A 2IZZA 3Q9UA 1WZIA 1NM5A 1QORA 3H3FA 1YL7A 1HE4A 3WQQA 2PGJA 4K6FA 2VWQA 1MGOA 5BT9A 4BO6A 4J0EA 3L4BC 1FMCA 4UEKA 2C5AA 3PQEA 1T24A 1HT0A 1YQDA 2AQHA 1U4SA 1X0VA 2NQTA 2NVWA 3G79A 2YUTA 1DAPA 1XDWA 1R15A 4JXKA 1Q0HA 2DPHA 3FBGA 1LXCA 4CL3A 3K8ZA 4MKXA 3RUAA 1HE2A 4FJ1A 1DRWA 2HMTA 4UAGA 3A4VA 2H6EA 2Y1FA 3RFXA 1J0XO 1F8GA 4S1VA 2VHVA 3K5PA 3WMWA 5DP1A 1P0CA 3F1LA 1LQTA 3DHYA 4YT2A 2HK9A 4UUMA 4CMCA 5KWEA 4R4JA 3WSWA 4R3NA 2GO1A 3E8XA 2WYVA 1L7EA 1U1IA 3I9OA 4GBJA 4DC1A 2BFAA 3GZNB 3HJAA 1PJCA 2VNAA 4TRMA 2Q1SA 1B2LA 4OH1A 4P22A 4Y6PA 1V6AA 3JYPA 1K6JA 3JQAD 3MWDB 4FFRA 1IZ0A 3U5TA 2BFOA 1DFHA 2BF7A 3WGOA 4B4VA 4ND5A 4KZPA 4AJPA 3ZGYA 2QX7A 3ZI0A 5U9CA 4NBTA 1LLDA 1T2AA 3CPSA 3JQAA 3L6EA 5L45A 2EEZA 4QSMA 1I24A 4GI2A 2YFHA 3UICA 4YTEA 1ZK2A 1PL6A 1G1AA 5AVOA 3C7AA 2HJRA 1BMDA 1QV7A 1P1HA 2E37A 1H9AA 1N7HA 1X14A 2GN9A 1O0SA 2WD7A 4GQAA 4YYZA 1UJMA 5I9LA 4FW8A 1I3LA 3ZNPA 2X5JO 4OM8A 3BHJA 2PGDA 4RZIA 1GR0A 4FFOA 3JQ7B 3R3JA 5F3RA 3VH3A 1ISJA 1NTOA 4ZQHA 3PJGA 3NRCA 1Y7TA 5JY1A 4G5HA 1XLTA 1ZBQA 1PU2A 4L4XA 2X58A 4E6PA 4I9UA 4YR9A 3JQBC 5A9SA 3PJFA 3ZHZA 2GN8A 4LRSB 3G1TA 4QO7A 3LLSA 3JQFC 4F45A 1YB1A 1HZZA 2YY7A 3DBRA 2GF2A 3JQCA 1PTJA 3CH6A 4LSWA 1LDGA 1QRRA 1P1RA 2C54A 5TSDA 2Q4BA 3ZDFA 1YL5A 1XU9A 2AA3A 3GEDA 4N5MA 4PLGA 4IBOA 5B12A 1EFLA 5JY6A 3MJEA 4Y6RA 2EHDA 1JN0A 1QYCA 2NU8A 4XYBA 3QV1A 3IUSA 4TSKA 1JWBB 2O3RA 5KVVA 3CUKA 1O5IA 4KTTE 4B3JA 1U3WA 3C85A 2B36A 4ZHSA 2WWRA 5JDCC 3WGHA 1GQ2A 1HL3A 1BW9A 4DMMA 1W0CA 5ER6A 2B4TO 4NFYA 3QRWA 4DGSA 3I23A 5AXCA 2C59A 5DCUA 1ENPA 1I8TA 5KVSA 3ZH2A 2OXIA 4NMHA 2Z1MA 3LC7O 3UCFA 3ADPA 3ZN2A 3QVOA 1U4OA 5ITWA 1GL3A 3QE3A 3HWRA 2XOXA 2VN8A 3HDYA 3I3OA 5ENDA 3UF0A 1YGYA 2BGKA 2FP4A 5L7WA 1HETA 4BVAA 3DZGA 2QIOA 4NNJA 5J23A 1NQ5A 3DMTA 5JNLA 2PZLA 4BOYA 3AI2A 1KVRA 2GYYA 4ZQBA 4PN3A 4CQMB 3C1OA 4HUJA 4TROA 3ETDA 1E92A 4YVFA 1CYDA 3TFQA 3MJCA 5DULA 5EQFA 3HUDA 1P33A 2J3KA 5I9NA 4WNIA 2DUWA 2JFFA 3PQFA 4YQYA 5CDYA 3WR5A 4PG8A 1DIAA 3KXDA 2P4QA 3M2PA 4R9RA 2JJYA 2I5PO 1YKFA 4GVXA 2VWHA 3KBOA 4B8WA 5CG2A 4D79A 2X7HA 4NJMB 2EV9A 4EUEA 4ALKA 3V2HA 3UKOA 5THQA 4E2XA 4BGIA 1CETA 1X1EA 3VTFA 5JO9A 4CM4B 1HE3A 5IG2A 5COBA 1PJ2A 4OJNA 4FJ0A 4NIMA 1RKXA 3M1AA 5TC4A 3QLJA 5G4KA 3V8BA 4PLWA 2HLPA 3PWKA 4FFPA 4H16A 4CMEA 4E31A 1HLPA 4Z3DA 3F1KA 3BMNA 3KB6A 4DQUA 2X9GA 5HS6A 2AG8A 5A06A 2BGMA 4J7UA 2GUGA 1BDBA 1A7AA 3GMDA 2E48A 4HX5A 1DBVO 1KEPA 4A26A 2O2YA 1LBEA 1VPDA 3RBZA 3ROMA 3U09A 2BFPA 3QIVA 2D5CA 2I99A 4CM9D 3ITDA 2NM0A 2IEDA 1GUYA 4G2NA 1EBFA 3IP1A 3GUYA 3AY6A 4D0SA 2OBYA 3I9JA 5KVCA 3RUEA 4B4WA 1LQUA 1XCBA 3LYLA 3N74A 2DUUA 2PKRA 3CINA 3IIEA 1Y9AA 3K96A 1XKQA 3QSGA 4L4SA 1GYQA 4CM9A 4BNFA 2WYUA 2C29D 3NUGA 4GX2A 1YBVA 4Q3CA 5JW6A 2X4GA 1Q1NA 3FNFA 4R1SA 3RC7A 3DBVO 1V0JA 3WGYA 2CD9A 4W99A 2W2KA 4OMUA 5GZ3A 4BO3A 1IY8A 1XQ6A 4LMRA 4UREA 1IOLA 1KY5A 3GLQA 4AJ2A 4CJXA 1C0LA 1LLQA 4J4HA 3PYMA 1V9LA 3DAGA 3H4VA 4WEOA 5IDYA 4XQGA 3DOOA 1JQBA 2WMDA 1B7GO 3I6QA 4JCOA 4K28A 1MG0A 4E32A 4BNUA 1P0FA 4HXYA 4AJNA 5IXYA 4HNHA 1A71A 2DM6A 4WUVA 2Y1CA 1A5ZA 1Y8QA 2PA3A 4Z9FA 3ZNQA 3ETEA 4AJHA 3FTNA 4RO0A 3OP4A 4XIJA 5IAAA 1HYEA 2X8LA 1G0NA 2ILTA 5H82A 1EQUA 2IODA 1TLTA 2QYSA 4FS3A 2HO5A 1MV8A 4KQXA 1HDZA 1XGKA 4N54A 4CLXA 4J1TA 2PZMA 4I9HA 4KMSA 1WMAA 1VSVA 4L8VA 4YJGA 2FOIA 3K2BA 5DBGA 4NBVA 1PJSA 1YBAA 1ZO8A 3JQAB 3F3SA 3RUFA 1DRUA 1GQQA 3Q6IA 4KOAA 4R54A 3GVCA 2G17A 3A9WA 5ICMA 2DBRA 3EAGA 1C1DA 3I4CA 4OXKA 1E7YA 2WD7B 1ULUA 2FR8A 2YW9A 4LMPA 1Z82A 3GRKA 4OIMA 3GDOA 2BELA 3AY7A 4P38A 4U6QA 1BXKA 1DIRA 2PD4A 4M55A 4DLLA 1R16A 1IL0A 2LDBA 3PWSA 4HBGA 3GPDG 2P4HX 1X15A 1Q0QA 3BTVA 3RQSA 4ESOA 4AJLA 1FJHA 4F6CA 1DRVA 4PG5A 1L7DA 2DVMA 5A9SB 4BV8A 1EDOA 1ZZEA 3VOSA 1T26A 3TQHA 3P19A 5GZ6A 3JQ6A 3DBRB 4ZVVA 5DBIA 1T1SA 4RL6A 4FGSA 2FN7A 3WXBA 4CM1A 4BNGA 3DZFA 1PJLA 2ZB3A 3ZWCA 1EVYA 4BKPA 2Y99A 1VJ0A 4N18A 3HFSA 4KDEA 3WB9A 3VZPA 5ADHA 5KKCA 1SO8A 4GWKA 1YS4A 3GNQA 2HK7A 4ALMA 1RYEA 5KKAA 1ONOA 4BO4A 2PKQP 2VYND 1P45A 1I10A 3QVSA 3CMMA 1GCUA 1U3UA 3GZ4A 3PLNA 3Q9NA 2O23A 3OA2A 1R4NA 2B69A 3LF2A 4RDHA 1I3NA 2QHXA 2P5UA 4U0KA 5CAEA 1T25A 1QG6A 1BW9B 1E3JA 3FPCA 3D4OA 4P4GA 3F6YA 2VQ3A 2Z1NA 3CZRA 3ON5A 1EE9A 3Q3CA 1E6WA 2VYNA 2Q99A 4O63O 5HM8A 1AXGA 2O50A 2FSSA 4AL4A 4CODB 5IDQA 3QWAA 3DEYX 4FPXA 3H5NA 2J6IA 1CWUA 1OBFO 1P44A 4E30A 2Y1EA 2E4AA 2HAEA 2IRWA 4UVHA 1JA9A 4L76A 1A7KA 3OJLA 4XGKA 4RVHA 4CR8A 5I7FA 1B3BA 2CZCA 3P7MA 3S55A 4BGVA 3GK3A 3KSUA 1J5PA 2B35A 3ZW8A 4JBHA 4ID9A 1VRWA 1GQYA 2D3TA 4IJVA 2HUNA 4J1NA 5TGDA 3EK2A 3GG2A 3OJEA 4QTZA 1C0IA 1P1KA 2RIRA 3FNGA 2DQ4A 4NJOA 1EUZA 1O94A 3ANNA 3OEWA 2HMSA 3VZQA 4IQ8A 3HNPA 4BNNA 3MCVA 4C7KA 3AUAA 5EN4A 2A92A 2ZYGA 1BHSA 4R1UA 4PLTA 4E2ZA 2PV7A 4WLUA 1NVMB 3PFWO 5BSFA 2X0NA 3MJ4A 5JCJD 1PQWA 4JGBA 3WOHA 1CJCA 1NAHA 4UUOA 2NVUA 2IYPA 2ZJ0A 4OOFA 2H5LA 3ZWAA 4JN6B 4BGUA 3I9MA 1CF2O 3DMTC 3OJOA 1DHTA 4O5OA 1YRLA 3PI7A 5G4KB 3QA9A 2FPIA 3FD8A 5JCJA 5FWNA 4GAEA 1PGPA 1HYHA 5JYEA 2I3AA 3BMNB 1HE5A 3D4NA 4H15A 5DNAA 5AXAA 1W4ZA 3FI9A 3HQ4O 1IPFA 1NFRA 2Q1WA 1F12A 1WP4A 2I66A 4ONEA 2ZK7A 4YA6A 4A73A 3NJ8A 1AE1A 1E7MA 1NASA 4J0FA 4TKMA 3GY0A 1DLIA 1UAYA 5L51A 1QMGA 1Q0LA 3VKVA 1PGNA 2X1HA 1E7QA 3BIOA 4RZHA 4YAEA 4D41A 2HMUA 4XWYA 3G0OA 3D7LA 4WJZA 1PWZA 1B8UA 3DXFA 1ZK3A 4QX6A 3BHMA 1HDRA 2NSDA 1PJ3A 1P1JA 2Y0CA 3LC2O 4O0LA 3PGXA 8ADHA 2Q45A 4QEDA 3FWZA 4R5MA 4RCVA 1EFKA 2W2KB 4CM8A 4CMEC 1AHHA 1KETA 1Z73A 5TX7A 1PEDA 4GLOA 4MP8A 2Y0DA 3PVZA 3MJTA 4BMSA 5L40A 3K73O 3UFXA 2JHGA 4CLRA 1HDCA 5JAIA 4EYEA 3OM9A 1SCUA 2GZ1A 3E18A 3DB2A 3GG9A 1PGOA 1QKIA 4IIVA 2JD1A 2Q49A 4RLHA 2R2GA 4D0RA 2QW8A 2Z95A 3KYCA 5JLAA 3UCXA 4KWIA 1LEHA 1P3DA 5CFZA 1EUDA 3GDFA 1Y8QB 4GGPA 1DIHA 1MLDA 1B26A 2CNBA 2I6TA 3GNSA 2DTDA 5DOVA 4XRRA 3ROPA 3SLKA 1BG6A 4W9NA 1X1TA 2FPPA 1JU9A 4CM3A 3IOYA 4CLHA 1C1XA 3NAQA 1NR7A 3E5MA 3BMCA 4YJGB 4YAIA 4BKOA 3MJSA 4J9UE 4DIFA 3PEFA 4IJKA 5BQFA 4UVDA 4MP6A 5KIAA 4BNMA 1P9LA 5EPOA 3UUWA 3V5NA 3RKUA 2Q1TA 1ML3A 2P9GA 2VOEA 3RC1A 4DYVA 1V3TA 4J7XA 1T2CA 2VZ9A 1B3RA 3WNVA 4NI5A 1GPJA 5ILOA 1C1DB 4PLYA 4FC6A 4MVJE 3BTOA 3WICA 3WYBA 3GN1A 1GU7A 3ZU5A 3R3SA 2D0IA 3GHYA 3IAHA 1E1NA 2IZ1A 1ZXLA 2BI8A 3MOGA 4YRDA 4PLVA 1GEEA 3K30A 4M87A 1YVEI 3AW9A 1K5HA 4LK3A 3ZHBA 1DO8A 3F47A 2I9PA 1GUZA 4IZIA 2D1YA 1S7CA 4CPDA 1HKUA 5JYDA 1ONNA 4BIIA 3E03A 4GWGA 3INTA 1CRWG 5DCWA 1PL8A 3QJ5A 1YH3A 2UAGA 4FOSA 3UVEA 4QFCA 1FK8A 2VHYA 4II3A 4CMKA 4TRJA 3WGTA 5JS6A 3CMCO 3LT1A 5JDIA 2X9NA 4J43A 2CDAA 3H5AA 1LDEA 2QQ5A 4NG5A 4DC0A 2ZB7A 5T5QA 7MDHA 5LC1A 4EBFA 4NR0A 2NNLD 3LLVA 1KEVA 3DTYA 3QWHA 4XJTA 4N5NA 2V7PA 1R4NB 2DT5A 4NBUA 3ENKA 3G1UA 3VH1A 1PZHA 1PQPA 3BZUA 3ETGA 3KM0A 5L7YA 4AFNA 2ZTVA 1IHXA 5FI3A 2ZCVA 4DVJA 1LX6A 2BHLA 3LSYA 3GGGA 2GGSA 4TQGA 1JDJA 4XIYA 3WGQA 1G0OA 1GV1A 4W82A 2HSDA 4EJMA 5B37A 4TRRA 2GCGA 2O4CA 1LDMA 3LC1O 3ZZNA 4ZQGA 5A9TA 1JW9B 2CVOA 1UAGA 3GVXA 3TSCA 4G81A 1O9BA 1ENOA 2Y0EA 1SB9A 1NHWA 4OQYA 3HHPA 1R66A 4IXTA 3TRIA 3VHRA 2JAPA 3PZRA 3AU8A 4XEHA 1T2EA 3WQSB 1SAYA 1VL6A 4YACA 3ZU3A 3AM3A 2AEMA 4B7XA 1YOVA 1E7WA 3TZQA 5JXWA 1HEUA 3KYBA 1H6BA 2DTXA 4CV2A 4I08A 1KOLA 5JMWA 1ID1A 3DFUA 1E3EA 3JD2A 3U4IA 1HWYA 2VRBA 2NU7A 3DOCA 1HDGO 3LK7A 2ZQYA 3EVTA 4IMRA 4RLSA 2NU6A 2W8ZA 1X0XA 3L4SO 3MZ0A 5ER9A 2GR9A 2VUSA 3UCEA 2G1UA 4Q3AA 2HK8A 5FEUA 3OIFA 1D4FA 2EKPA 3ORFA 2NVUB 2I76A 4E12A 3L9WA 3U0BA 4L73A 4ZRMA 1RM5A 3DHEA 1NWCA 3H2ZA 5A1TA 3VZSA 1U8FO 3B6ZA 1UXJA 1PR9A 4J7CA 4CMHA 3F9IA 4BNVA 3ZV5A 2A9FA 1MG5A 3QVTA 2YV1A 3I4FA 4D45A 5B4VA 3W4KA 4ILKA 3NTQA 1NAIA 4ZD6A 4KUGA 1PJ4A 1BVRA 3QVWA 4OGWA 3ANMA 1DFGA 2IDZA 5G0UA 2NUAA 5F1KA 4XR9A 4D44A 4IM7A 1NYTA 4MVJF 4RVSA 3NDIA 1I3MA 1WWKA 5I7EA 4RJTA 1P74A 2C2YA 3FR7A 1PL7A 4DL9A 4C4OA 5LCXA 3IKTA 3NJ4A 1RM4A 4XR4A 3E1KA 4PGFA 3CKYA 2V6MA 5KJ1A 1M75A 4BHTA 3GR6A 2PZJA 3H6KA 4U0JA 4Y98A 4CM8B 1PJBA 3X2EA 1DJQA 4INAA 1MB4A 3MEQA 1TI7A 4J2HA 1ZK4A 2EKQA 4FQ8A 5L53A 2JD0A 3AU9A 1W8DA 4I1IA 5G2OA 4CLRB 1ZSNA 5EIOA 1MXHA 4R16A 1PX0A 3WSVA 5IJZA 1U9JA 4YT5A 3ICPA 2RH4A 3GVHA 3KYCB 2X0JA 4XKJA 2R6JA 1VL8A 2TMGA 4PFJA 1IHYA 4QQRA 3RUHA 3Q2IA 4D46A 3WS7A 1DLJA 2Y66A 3RFTA 2VT3A 4R1NA 1U2GA 2EWMA 4WEQA 4MVJP 1F17A 1GZ4A 3DR3A 3JQGA 5THKA 1NR1A 1M2WA 3G17A 3IJPA 4ND1A 2UDPA 3KO8A 1C1XB 3K31A 1E1LA 1ZVMA 4GGOA 1UP4A 3BMCB 2VT2A 5TRTA 2A4KA 4CR7A 2YYYA 2GLXA 2Q46A 1DIBA 3AFNA 4JROA 4OXNA 4ALIA 2AG5A 1H0KA 3TL2A 4S3MA 1ZSYA 1DDOA 4NBRA 2HMVA 1E0DA 1J49A 3ZWNA 4BO0A 5CEJA 3WTBA 5G0WA 4DPLA 5L3ZA 4ALLA 2AHRA 3V2UA 5MDHA 1D7OA 5MGBA 2CUKA 3FBTA 2PD3A 2BKAA 5AYVA 5KJ6A 2GPTA 3NTRA 4D7AA 5F1OA 1YQXA 4QFDA 1VI2A 4QO8A 5F5NA 4BO8A 1GYPA 5I7SA 4W9NC 2HQ1A 4DREA 1GCOA 2FZEA 2OL4A 2PK3A 3H2SA 4TKLA 4M49A 1TT5A 3EZYA 1J4AA 4CV1A 1LC3A 3TN7A 1EK5A 4EUHA 2CF6A 2XPCA 4CLOA 3RUCA 1ISIA 1UDAA 4OOEA 4E21A 5A04A 3TZCA 1E7RA 2QRJA 3WWYA 4RGBA 1HDOA 2WD8A 5I8ZA 3L07A 4XX0A 2SCUA 3FRJA 2YJZA 2EP7A 1RWBA 4UVGA 4Z9XA 1ZEJA 1E6EA 3OMLA 2AE1A 3GDGA 4JP3A 4IXWA 4DPMA 2HMWA 4RF2A 1XEAA 4YQZA 3P2YA 1TEHA 1KC3A 3NEPX 1BVUA 3SC6A 4ZN6A 4E33A 2JFHA 2EJVA 3IJRA 2X86A 3JV7A 1QYXA 5TNXA 4IDGA 3GF4A 4BQRA 4D3DA 2G5CA 1C14A 1ZXBA 2RHRA 1W6UA 3RCBA 2Y05A 4IUYA 3JYOA 2X9VA 5ES3A 4HFRA 5C7OO 1TB4A 1G6KA 5H81A 1JVBA 3DL2A 4K6CA 4BNIA 1U5CA 1V8BA 4Z9YA 1NX6A 4YBZA 3PRJA 4Q3BA 1VLLA 5DCYA 4XJSA 1EUCA 5JDIC 3ZV4A 2JCVA 2C7VA 1BRMA 3U4DA 5AXBA 3BA1A 4E5MA 4RDIA 3X2FA 5JBIA 2YHIA 4WE3A 1Y5MA 3ZWXA 4J91A 1UXHA 5B1YA 1RYDA 3FN4A 3VTZA 3WBBA 2ZKLA 3OBBA 5JAMA 1CQIA 2CFCA 4EW6A 2J3JA 3JD0A 1YOVB 4BO1A 3R0IA 1QV6A 3LQFA 4LW8A 2AEFA 5DBFA 1E7SA 5AXDA 3JQ9A 1P77A 4XGNA 5COQA 3RJ9A 3ONDA 5TS3A 1I01A 1T2DA 2B4RO 4PZCA 1M6HA 4E3ZA 2VHWA 5A5EA 9LDBA 2I67A 2Q2QA 2B5WA 5T8KA 2QZZA 3STHA 2VZ0A 1OMOA 3CTMA 3MJVA 1SNYA 4PIVA 3VVCA 4BUCA 3F46A 2PWZA 3IP3A 4N7RA 4WLOA 1Z7EA 3DZIA 4OKNA 3HDQA 1PJQA 4FR5A 5L7TA 1PS9A 5BSEA 3FR8A 4DQVA 4NPCA 5L4NA 2EXXA 9LDTA 1OAAA 2V65A 5K9ZA 5TQVA 3V1YA 4NFHA 2VHXA 3PYLA 1WW8A 4K26A 3WYCA 4JBIA 3H5RA 1XQ1A 6ADHA 2HJSA 1K89A 4YWJA 1GEGA 3FNHA 3ZWWA 3VAZA 3ZWBA 3P5SA 1JKFA 4GL4A 1E1KA 3B20A 4WLVA 1PZEA 4JBGA 4XA8A 1LU9A 4AJOA 3OSUA 1XHLA 3KEQA 4OSOA 1OZAA 2WEKA 3B1FA 4TVOA 5BNTA 1E1MA 2FZWA 5LDHA 3LF1A 1NXQA 4R3WA 4GSLA 2VHZA 2WJPA 4CUZA 3ZWPA 5HWSA 2NVBA 4IDFA 5FYDA 1E3IA 3HSKA 2I65A 1GAEO 1VE9A 3OJ0A 1MX3A 2CMDA 1DC6A 5JMPA 5ICSA 4IDBA 3F4BA 3BYZA 3KYDA 2OP1A 5BSGA 1LDNA 1U7TA 3O8QA 4I5DA 2ZTLA 3OFSA 4MJLA 1R0LA 1XA0A 2CF5A 3GMSA 3DZHA 1IZ9A 2DKNA 1Q7CA 3TDKA 3FSRA 1UUFA 5EL0A 4BL5A 1ZIDA 3FWNA 1YJQA 3DAPA 1OC2A 4CLEA 3GOHA 4DIOA 4JIGA 1WNTA 2Q2WA 1EK6A 5JAQA 3JTMA 4BO7A 4IDDA 3JQGB 4IDEA 3GC6A
chains in the Genus database with same CATH superfamily
4HNAB 3QLVC 4REOA 5I8PA 4W5HA 4M60A 5CA1F 1W5AA 5CK4A 2E1RA 4GE3A 1GTL1 1JBKA 5AW3A 3CR7A 3FPAA 1F9EA 3HKBB 1P2SA 2FFHA 3UAYA 3BE8A 1QP0A 4P4LA 3DGFC 4ZDJA 2F62A 1WXIA 2OK7A 3GV0A 3OX3A 4JB2A 2A59A 1GAWA 1A2BA 5HMLA 3E9YA 2IYQA 5TF4A 1WDTA 2BI4A 1P7PA 1VP9A 1NJ8A 5I47A 2NMVA 4Y6SA 5JAPA 4JU9A 1UM9A 3PUZA 1IE3A 2FMKA 4Q4HA 3OJFA 5FV4A 1P81A 2XMCA 3ZLJA 3OPNA 1P9WA 1FFSA 3IESA 1E2GA 3HV0A 3DNMA 4FYWA 4B34A 4DLZA 3Q8KA 3D8HA 4NCAA 3A1VA 2FTKE 4HRAA 1NXTA 4WGFA 3SP1A 1EFAA 3ENZA 3GPIA 2WIDA 3TLKA 3ZDXB 1J06A 5CM2Z 3CZMA 3HGQA 3M5DA 3AEUA 5F3WB 2I2FA 3QPWA 4BKRA 1Y42X 1ZSVA 4BUZA 4C6SA 2F8TA 1YR6A 4IO1A 3TLCA 1VPWA 3DH0A 5LMUB 1JKJA 1JLHA 3B6EA 3KU1A 5BNFA 1K2WA 3NUZA 4XIIA 3NH6A 4FI3F 4RS4A 1NJ2A 3GRPA 1DTWB 4HC4A 4YPOA 2M6RA 2VSXA 4I4LA 4RIFA 3WWEA 2G83A 3TQQA 1G8MA 2F1HA 3UT5B 3EDMA 3T3HA 1VYVA 2ZYRA 4FILA 1MQSA 1X7ZA 1K4YA 1QHHA 2EJCA 2YHSA 1C4WA 4UHHA 4ENRA 1FPMA 1M2FA 5LQKA 5JJ5A 1A7JA 1J9GA 2H5EA 2P8SA 2O2HA 3OP1A 5HCUA 5BP7A 1NI4A 1E99A 4F46A 1RBYA 5CGQB 1CUUA 4U02A 5BW6B 1L7OA 3ZEAA 1SXPA 8ABPA 4YBRA 1XHFA 1Z39A 2Q9AA 4KFSA 2P9EA 3HBJA 4TTIA 3K9FC 2EGUA 1ADFA 3K0AB 1JSLA 4HZUB 1E32A 3SJCA 4URXR 5HGXA 5G0VA 5DLEA 4H3VA 3SOZA 3MS7A 3IP5A 1XEXA 1SMKA 1JHPA 1PDVA 5J5CA 2YVQA 3NM6B 3NC4A 3KR0A 4DCVA 4GDFA 5L4LA 1M1YA 2ZJ7A 1BWRA 1SU6A 2GWHA 1EM8B 1G66A 1QK3A 3O38A 4FYPA 4HXEB 4CMAA 5ALUA 1CIPA 1KMHB 1ESNA 2J85A 1KJWA 3AFHA 5KOIA 1BE0A 1ZAKA 4EI2A 3HN2A 3PD1A 3FH0A 2QI9F 5FV7A 1FUYB 3O91A 3OMXA 3PHGA 2JI4A 1EUCB 1RXEA 2X23A 3FB4A 3C8HA 2GFIA 1ST3A 1XTZA 3ANLA 3KLBA 3IQFA 4BJ1A 5BV1A 5CVUA 2VL7A 2XA1A 1RDFA 4PSCA 4PGMA 2ZRDA 2BLNA 4RTQA 5HSGA 3TFOA 3HEBA 1TF7A 1O7JA 3DDHA 4PVDA 1P75A 3QY9A 4DNFA 1P0QA 2YHIB 3EDRA 2RI0A 4A9AA 1PZGA 2RH8A 5TR9A 3DYVA 1YBMA 2VUTA 3CJRA 5REQA 5KNLA 4DFDA 1VYHA 2Z4RA 3MGBA 4WK6A 4JP8A 2UUBB 2QD4A 3GUVA 2FLWA 2V7VA 5F7ZA 5KTMA 5HZKA 4W7HA 4LHYA 1KYTA 4QXRA 2O8DB 2QMZA 3WYAA 1A2OA 3IAM6 1K6EA 4M0MA 3QXJA 2AF3C 4MYUA 4ZC8A 3GEGA 2OQVA 3AK4A 3FYUC 4JDPA 3RIHA 3A28A 1EBUA 1SCJA 3SU8A 3L7YA 3EQZA 4OGFA 4P4SB 3OHMA 2I8AA 1NQWA 1I9CA 3DGEC 1ZR2A 4NONA 3I6ZA 1SA0B 3GVPA 1PR4A 2R60A 3ILHA 2JPDA 3KXKA 1YB6A 2XMDA 3A1CA 1FP7A 3V34A 1JTVA 4Q3LA 3SHOA 5B6PA 3QEBZ 1EYZA 3QTTA 2VA8A 3RWOA 3EEFA 4ZV9A 2LWIA 1N2HA 4M1SA 4AZVA 5IFKA 2IU3A 4YMVA 3D4PA 3RV4A 3B1WA 2DPXA 2ADFA 1P1IA 4EUFA 5C8XA 1E5QA 1KOGA 1P9RA 2YINC 4WY8A 3PNSA 4II2A 2P91A 1Z34A 3B9RA 3SBOA 1ZJWA 3W5HA 1V48A 4NZMA 5KYWB 4PAQA 3DLHA 4CLDA 2VYVD 4N5HX 2IY7A 4P8RA 1WPQA 2JAWA 5AKGA 4C0WA 2NLOA 1Z6QA 4FFWA 1J90A 2MU1A 1X1DA 1R0XA 2VR1A 4RHEA 3AIKA 3ZY5A 4OBXA 2PL9A 1A4UA 2JCXA 2A0YA 3PIDA 1LKZA 2ET6A 4P4UA 4AICA 2PQMA 5FH9A 3BF8A 1N5MA 4BRUA 5LXTB 5CMLA 2A9JA 3FDFA 2OCDA 2OE2A 1WF6A 1VSUA 3RR2A 2A58A 1JBEA 3S2FA 5JQWA 3O75A 4XYGA 3R9KA 3K5IA 2VP4A 2BFWA 1Y7LA 3EDYA 3HB7A 3R3VA 7REQB 2Y67A 3GXOA 1D04A 2LDXA 3UXYA 1JIQA 2WE8A 2WZCA 3R6DA 3DR5A 3WLTA 4BP3A 1LUAA 3C14C 2VHCA 4L3VA 5BSUA 3AQIA 3KDPA 4AURA 2WWYA 1HYBA 1MA0A 1Q7BA 1CNFA 3O9VA 4PR0A 4F96A 3M6WA 4RZ2A 5CH3A 2QVZX 1XR3A 1GRRA 5E7QA 1MF7A 5LNK1 2EDCA 4BS9A 5BN4A 1XZLA 1NE7A 5TJHA 2XBUA 3VKGA 3A70A 2H63A 1NLFA 2L2QA 3U0VA 1T29A 1ICIA 3KZXA 4FONA 5T41A 5ITVA 1QZ3A 1TA9A 3PTZA 2C7OA 5HM6A 3C8UA 2D8MA 4UVIA 5DXAA 4O1HA 3O8QB 3PBKA 4WZZA 3G8BA 1PHRA 1X1SA 4RELA 2BR4A 3C7DB 1D0VA 3OQ1A 2G1AA 4EPWA 3OECA 8GPBA 3TNLA 3JAMA 2XWPA 1H4QA 3I52A 4WOPA 3KQOA 3CSUA 2BOVA 3HZOA 2A5LA 4V0MA 3MTDA 1CQPA 2X76A 5LB4A 1FFEA 4BJ5A 5KTOA 4OP1A 1L0BA 5CM8B 2QLMA 1LPOA 4NENB 4TXMA 3EMBA 1LPNA 1HZJA 2SBTA 1D6JA 1OCEA 4J6EA 4DMGA 5CFPA 4H6WA 2JLZA 1NNUA 3QELB 3M9WA 3RIMA 1EH5A 5FOXA 1U7ZA 5CFNA 2VQDA 3U4QA 1JAXA 3ISVA 5LQJA 5FO0A 2GM4A 1ZH6A 1KPGA 3QGMA 4ZOCA 2BEWB 2FCRA 2J46A 3DE1X 4BQSA 2VP3A 4R84A 3PQ6A 1JF8A 3K5HA 4MHOA 4DSTA 1CHDA 1W59A 3A26A 4IPTA 4CIWA 3E58A 4DLBA 3A1FA 3GJXC 1EQ2A 1YK1A 2CXPA 3FYDA 3C74A 1PGJA 1BXGA 3S5UA 2CLDX 3TVYA 3PHJA 1PR3A 4TXNA 3CVVA 4G0OA 2EW8A 5EJEA 4QLBA 1XD2B 3T1TA 2JS7A 5E2AA 1O6FA 2YRXA 1CNMA 4MWCA 4LQ4A 5FBVB 3LKBA 1XNQB 3GJ0A 4HHEA 4Z7QB 3VAYA 3IXLA 4K9LA 1YR2A 3MSCA 2A5FA 2B1QA 4KQ1A 2OFPA 2W0SA 1NPYA 2XBMA 5AKXA 2OHVA 1M54A 3HSYA 2F3SA 4XM1A 3RTAA 4QU0A 3V8EA 1RWPA 2RAUA 5BMOA 5K0SA 1Y6FA 3ZJUA 2O8EA 4MWTA 2CWDA 2XCOA 2YY5A 3AOEC 2CVZA 4Q7EA 4BO9A 4CIVA 3GHHA 4BV3A 1UFRA 2WICA 2Q5QA 4Q4AB 1V35A 4MQUA 5E6UA 3SZGA 1NQOA 4QHTA 2UUOA 4PX5A 1X8JA 2D54A 3I34X 4LJ9A 1UOEA 4BV9A 4X5OA 5L9AA 3AF3A 1SIUA 3U31A 1U8XX 3GVIA 4YT8A 2WJIA 4JEIA 1MXFA 4RESA 5FOSA 5H9VA 1LA2A 5JEEA 4FCCA 4ZAZA 4D5GA 2R751 1VPTA 3ASYA 3K6JA 3EMKA 1CY2A 3HB4X 4UXIA 1EXWA 3F6EX 2X13A 2JIZD 5CK5A 3FWHA 3I6YA 3L49A 5GINE 5FBLB 5EQDA 1PQYA 3JYNA 3LT4A 2A1TS 3BTSA 2GOYA 2YNMA 1KWGA 3CVWA 3DL0A 4Y2XA 1SQ0A 1K66A 2HF2A 2Q5FA 2YVLA 3DCIA 3UAVA 1NBOA 1T9GS 1EWRA 3IT1A 2IHUA 4LKRA 4RPJA 4EX6A 1R3UA 1C1YA 5DNEA 1OPXA 1U2DC 4D25A 1JA0A 4YYEA 4QDKA 2YXPX 2B2NA 1IY0A 3R77A 5FAXA 3L40A 1Q3HA 4RKWA 3B6JA 5FXMA 5IC5A 4D4HA 1SRRA 4N41A 1NU8A 3N53A 1LJ8A 1A9XB 1FXSA 2QTTA 3F8TA 1CQJB 1DRKA 3P0IA 1YB5A 3HVJA 1IVYA 1L4MA 5TJ9A 3RVRA 4GUDA 1LVGA 5CEEA 1LW7A 3G2NA 2C20A 3ND7A 4JIMA 1TO1E 1EA5A 1F6BA 1YS2X 2B4QA 3A10A 1XZJA 4EQ6A 2C4NA 1QE3A 4DMLA 1CY4A 3QW4B 1KDVA 3SQLA 3WRVA 5CDGA 5KMGA 2P30A 3PYXA 2HU5A 1RJ9A 2HT6A 3RS3A 1EJBA 3PNKA 1X94A 3QK7A 1GHTA 1G2OA 2ZRNA 1N2XA 4EBBA 4KQJA 4XRGA 3PC8A 2L18A 3HB5X 1P5HA 1XCMA 3KT6A 2ONYA 4LCEA 1ONPA 5TMDA 1I30A 3D5QA 1IG0A 1EHYA 4OJYA 1M5RA 4PNPA 2RGBA 1A96A 3OT5A 3VYTB 1X86B 5AJXA 3E82A 5E3JA 1KS2A 1IPEA 1N8TA 3HXLA 4PS1A 4ZDWA 4XWGA 3S2IA 2PQ6A 3DF7A 4KI7A 4L5CA 2GJ9A 3C1AA 4BNXA 1G9TA 1PNTA 4ZCQA 1Q6ZA 1BYUA 3FETA 2FR1A 1DC4A 1GPYA 2C9BA 1O8BA 4MKIA 5TGTA 4AQ7A 4PRLA 4PZ9A 2XYHA 3IT0A 4W1PA 1HFWA 1JUDA 2DWCA 4ZT3A 1E69A 2G1JA 2ZIZA 5E6RA 5KDLA 4C4AA 4Q9HA 4Z4GA 5K3CA 3N59A 5KWIA 3EIFA 3MAGA 1CVLA 3QFRA 4M88A 4LOKA 4TZTA 5F78A 4AZWA 5H68A 4EPTA 5KJEA 3A1TA 3I5MA 1L5VA 1JJFA 1S2OA 1F3LA 1V4NA 2LGJA 3ABSB 3KU4A 1JA1A 4D4KA 4N9QA 4XQ9A 4JVSB 2Y1DA 1X9IA 3ZDDA 1JQ3A 1GTG1 2ZB4A 2FHSA 3T3EA 1Y81A 3DYBA 2BGNA 5ECDA 3MWEA 1MO5A 3PNQA 2DXIA 4E13A 1WY5A 3OOYA 5IZCC 1AN9A 2JGEA 2OBNA 4FW9A 4HAIA 4ASUA 2CXUA 2GXQA 3FUVA 5KYVA 1Z0KA 4WXPA 4D0NA 2NU9B 3U37A 3L7AA 1LLFA 1ZMBA 1K0FA 2XEXA 1TVCA 2DWQA 1F0KA 3KB8A 4ER5A 2B34A 4OLAA 3AJDA 3K53A 5IVIA 3PJDA 4V0QA 5CIQA 2VDJA 3TWOA 5KNCA 3MRTA 3PKIA 5F2NA 3P9ZA 4PAOA 4Q19A 2HU7A 5AHWA 3W8EA 5K4AA 3WMRA 3K1AB 4WCFC 3RV3A 2AK2A 2IZ6A 5E8RA 3ELYA 1JDNA 3GNTA 1BXRA 2B8TA 4PE5B 2NZ2A 4NOMA 2J48A 1JEJA 1SOWA 4QFBA 2HHHB 4JJ4A 4HO1X 3BMXA 3G5LA 1RM3A 2J4CA 4GGMX 4UHJA 4C43A 4BFUA 5EZQA 2RJNA 1WZUA 4HLUC 2VH5R 3FKSA 2QRNA 3N2YA 3WGGA 5B36A 3C16C 4UBNA 4AJ4A 3UPDA 1GG2A 2OCKA 1YR3A 2C5EA 2Z9DA 1T2NA 1TKCA 4R8KA 5BSHA 1M8FA 1ZOLA 1SQSA 1EGHA 4FDAA 5EJFA 4ZCLA 2QDKA 2B30A 1XDBA 2GARA 4HWGA 1FXUA 1PNVA 1TUGA 3DHNA 4JLOA 4IVNA 4E14A 1FRVA 2D06A 3K2IA 1EE2A 2JJMA 1Y8CA 1XZPA 3NT4A 4KRGA 3HKCB 3ZI7A 2AW5A 3OWHA 3E23A 5B4TA 1N0IA 1ECLA 5JWRA 3LCMA 1NLYA 4E5PA 2E5LB 1USGA 1M34B 4XD2A 5BRNA 2PT7A 1HYQA 3N2ZB 1OFUX 3H8JA 4ZMBA 4XCVA 1C0KA 4RPKA 1IPHA 4EW3A 4MDFA 1UXIA 3LD9A 2WZDA 1XYYA 4C7OB 4CMGA 2FFAA 1TADA 2WSMA 1E0JA 5JH7F 4CNQA 3GEIA 5CHYA 2GZ3A 3SYNA 1VECA 3OHSX 4GH5A 4ZMSA 3E7PA 1YIOA 5FBQB 5BV7A 3QEMB 5LMNB 3HUFA 4BB6A 4XJXA 3K70D 3QV2A 4GKJB 2O2JA 3OKFA 2A35A 3T4PA 1A9ZA 4LOAA 3GXBA 2ZUTA 3T5MA 2OV3A 2A84A 5FNVB 5K8JB 1E77A 4Y6GB 1IN6A 4BNHA 3EOAI 2NV6A 3QWBA 3R7WB 2VQ6A 3KJZA 1T0PA 3DBOB 3M5WA 3V1UA 3GLGA 1WVIA 1ZVVA 4UE3S 1OZ0A 5HBRA 1T5TA 1JAYA 2OECA 2HA2A 3IBTA 4XGIA 4DSZA 2P6RA 4YCBA 3NWJA 4FTWA 4G84A 4WVFA 5TPWB 4E03A 1MENA 1U8UA 3ZD9A 3C6BA 1XK7A 3P4UA 5CBPB 1KPHA 1LRJA 2WFAA 4UJ5A 4WZ6A 3MUFA 3PUVA 3PDUA 3HNRA 1GZ3A 2O2XA 3CPJB 1VGVA 2CL0X 1ZA1A 3BAZA 2B6NA 5DIZA 4B80A 1NT4A 2Z5LA 5EP4A 4EATA 5CFRA 1UMBB 1XD9A 4C4RA 5EJ9A 2UU9B 1YS6A 3IAM1 1QE0A 1EP2B 4M0KA 1QLHA 2X5XA 1IBRA 4MR8A 1IZZA 3LBYA 2BFFB 1S8AA 1T35A 4MITA 1QF6A 1Z0FA 2OGTA 3AHHA 5FPPA 4MKZA 3OF5A 3FTDA 2QPOA 4JQCA 1X3SA 5A4MS 5HE8A 5JCPA 3WGZA 1J0EA 3JASA 3WDLA 3E27A 1I3KA 3I6IA 1OGJA 2O2SA 3BXXA 4QBHA 3R3UA 3D4BA 4N39A 2VAPA 3STWA 2XWQA 3KZVA 4B4UA 1N6KA 1PFUA 4PIMA 1X7GA 2WJGA 4RK4A 3A06A 2OXEA 3B7PA 3GYGA 3MBKA 4IGEA 3BFVA 4FIZA 3DSRA 1XIVA 3LJKA 2FW9A 3KTOA 2W6NA 2OPHA 2WSBA 4HWSA 4I6JA 5JE8A 3RBXA 3WMGA 3NHPA 2B1RA 1JHVA 2C2OA 3F8SA 1PUXA 5AKZA 2ISSD 3MFYA 3PJEA 4RIHA 2AR7A 4HY3A 2O2DA 2AXEA 1G7RA 4Q1VA 4B0OA 2HHCA 1LNQA 4QGBA 4WSOA 3TNJA 3TM5A 4F2WA 1CUYA 1EXVA 5DHFA 1YZQA 2Z6UA 1EQAA 2H1OA 2CL7X 4US1R 3E6AA 1ORIA 4ZO9A 3L7BA 3MXTA 2QT9A 1YKSA 5DGTA 4FGWA 1T4BA 2QTVB 3VR1A 1JHAA 3DBHB 1CIVA 2QL7A 5AICA 1FDSA 3FPGA 1NW6A 3WTCA 1DX4A 4DBVO 4EF5A 2NQ8A 1KR5A 2ZI9A 3GLIE 1F1BA 4LGVA 5TGZA 1TYAE 1WBDA 1VC2A 2EIHA 2JVJA 1NVTA 2AFRA 1X7XB 3ORSA 1CK4A 1M7GA 2JFUA 2WFLA 3NHBA 4U7FA 4MQFB 5IEBA 2PTGA 2QD3A 2FSVC 1RRCA 2F17A 2IE8A 5EJ7A 3FGOA 3BD8A 1Q5PA 1CIJA 1TLLA 4FBLA 4EB8A 1S4QA 2VTEA 4XFJA 5M5BA 4YJ2A 4GKAA 2YQ5A 1B0PA 1LTHR 4DM7A 4DWOA 3E35A 1PAUA 5JU6A 2PLWA 1CUJA 3OX1A 2NPOA 4LZAA 2AXQA 5JSFA 1G291 1WPRA 2X2EA 2C57A 2J9RA 2EKLA 2ZWVA 4LJSA 5FWYA 1XQVA 1DCMA 1JHMA 3LS2A 5JI2E 2XB2A 3M5CA 3ABIA 4MQEB 1OV4A 1YDWA 1YU6A 4RA9A 3F7MA 5HKKA 1SU4A 4E7PA 3FXAA 5BV2P 3HVKA 1LVUA 5HS4A 1XMPA 4FK8A 3CIFA 4RKFA 4DV1B 1RTKA 1WSDA 5CR9A 2GD1O 3PLAE 1ORVA 3CIOA 3DE4X 4KSYA 4ER0A 1QP4A 1TL7C 4GOJA 3T9CA 1XB2A 3A37A 1U2ZA 1UT6A 2QYHA 5ABPA 2HFKA 2D4AA 3DTVA 4HB0A 4PLPA 4B44A 5BOSA 1CZRA 1EK1A 3WQRA 2OORA 3HO6A 4CVNA 3WL8A 2EGGA 3WLJA 4LQLA 2FWMX 4DA8A 4MX8A 3VNSA 4LJRA 3DAHA 1F2UA 3K5WA 1CLEA 4L5YA 4OB8A 1VJ1A 4IS3A 3W4IA 1V4VA 3KAQA 4TMXA 1BOFA 1R4MB 3L18A 4H7FA 1UKBA 5E4YA 1URPA 3D6JA 3ELBA 2V7TA 4IDAA 1F9AA 2HBRA 3ASUA 3KZNA 4ICIA 5EZYF 3WGVA 4P92A 1DL5A 2REXB 1HT2E 1HDEA 3FSGA 4N5LA 3SYMA 1GTSA 5F9HA 3AVVA 1GUAA 8AT1A 3MTEA 1KO5A 2GLUA 1QG0A 1I3CA 1MIHA 5I9BA 1VLVA 3W8RA 4WBNA 2IXGA 1FNSA 4OKIA 4EJSC 5BUZA 5IVKA 2QJTA 4QNRA 5B6IA 2H2AA 2J5RA 2WNHA 4ZO4A 1RAHA 5AI4A 4RMJA 4DSUA 1T8SA 3CT4A 3GFBA 3UATA 1S0UA 4ZTUB 2QTGA 1W36D 4ZGWA 2ZRIA 1W88A 1ECPA 2HK6A 4J03A 1X7DA 4QELA 1DAGA 1R5NA 1QIFA 3O82A 3Q7TA 3D6HA 4H1VA 2WU4A 1AKWA 5TMBA 3RIXA 4X8LA 4V24A 1OYOA 2OMKA 1C29B 4AVYA 4AMZA 1FFGA 1AHIA 1IC6A 1ZFNA 6LDHA 1UXOA 3WLRA 5BMVA 3SYRA 1G8YA 2VBFA 3HXPA 1XXHE 2LE0A 5CPBA 3WX0A 4DXDA 4V0SA 5KOJB 5KYUA 1WHSA 2PFSA 3H2YA 4MJ3A 4N3NA 4QWMA 2FA9A 3CB2A 5AJWA 1MFPA 5C1PA 3ONVA 1WCV1 2AD5A 3PUXA 5IJ9B 1IEQA 3ZQUA 3ICEA 1A04A 1SEVA 1KA9H 3FIUA 3S6JA 3OURA 1QGUB 1IQRA 4MICA 2GN6A 1KI7A 3U80A 1N25A 5IF3A 1EESA 4PZEA 2PFKA 2QVGA 2WMYA 3EDOA 3FRIA 3PXAA 3ZZ0A 5KREA 5LKAA 4B9AA 4XDGA 4LNUA 4RPLA 1G6Q1 5JPIA 1A4RA 3VMFA 2VDKB 2C1EA 5EHGA 1OKKA 2FETA 2NTVA 5IDWA 1EVZA 2A9VA 1H1TA 2ZLBA 1AJEA 1MIOB 4DADA 1QB8A 3T3GA 4WLEA 3QYPA 1J7KA 1R9NA 2OFWA 1KBZA 5HNKA 1RJDA 2GS9A 1NULA 3C6XA 4M53A 2GK7A 5DYWA 3O4VA 2F1KA 5BQOA 3JR7A 2H31A 1YONA 5CT6A 3PEUA 5A9RA 4BB5A 5TB5A 1YJCA 2W2MA 3L6OO 1N8SA 1J2TA 4KH1A 4BLPA 1N5RA 2VG8A 5EXDA 4V02A 1AGXA 2PMDA 4W8GA 2VNKA 4FNAA 3CTPA 1DDIA 4MPRA 3N39C 1E0AA 1S3FA 1I4WA 3A1UA 4JWKA 1AK1A 4AROA 1JMYA 5A5GA 4EZBA 3IVCA 4O8ZA 5HILA 4RQUA 3G5TA 5AH0A 3G0IA 3U7RA 4ZICA 3OCCA 1SURA 2Z58A 1WL8A 4O3FA 1CEQA 1P62B 1EWKA 3R5XA 4K2HA 4RCYA 3TOVA 1KJQA 3DL7A 5IANA 2PQ2A 2PDAA 5T67A 4F6LA 1OFHA 5EERA 4Q7QA 3L4BA 2XUQA 4CNBA 1XPOA 4BB0A 1J8VA 1QZXA 5KNDH 1P4RA 4YMHA 2G0TA 3P4YA 3GLFB 3JPWA 4DDVA 3WMXA 2ZUCA 3N3AC 4HEHA 2IQ5A 4QL3A 7ADHA 3ED1A 4G41A 1AVTA 4EHNA 1DADA 1OPRA 1PS8A 2QW0X 4RY0A 4BGEA 1T1GA 3GGOA 3H18A 5C8ZA 1F0NA 1IB0A 3TQCA 4BWYA 1IN1A 4GLLA 4IJWA 4MUNA 4EG6A 1KAHA 3EXFA 3RI3A 1ZD3A 2C88A 3LAWA 1JJIA 4RV9A 1YZVA 2NXWA 4HTFB 1JIUA 1E2FA 5IDXA 2Q3EA 2XYPA 1OA1A 2KW5A 2ACWA 2CFRA 2WVHA 3UMMA 1DV1A 1R7RA 2XUOA 1N5OX 3C4JA 4BFTA 1SVNA 1P4GA 3L6DA 2W6JA 4OA5A 5TMEA 3BEDA 3F5DA 3LXMA 2RGGA 1BNCA 1SJ9A 3OZGA 5TF0A 4DIDA 3EXAA 1O96A 4FOPA 4QQ8A 3T7SA 1ZKMA 4PZLA 2D0DA 1DQZA 4TLLB 4LRYA 1QIGA 3M9LA 3WLLA 5ALRA 1WKVA 2P2GA 1OBCA 1JPJA 3BXFA 4Y2TA 1RI3A 2EQAA 1KS9A 4Q39A 3I5XA 1L7VC 3AB8A 2AE2A 4QUGA 5EE0A 2IWRA 2WA2A 3FPBA 2HDHA 1W0JD 5CLHA 4ZEWA 3VDQA 1KFBB 2GNAA 2X6RA 4J1QA 4I9NA 2JL1A 3LHDA 3RYIA 4CCYB 1RFLA 2INGX 5E6SA 1SXQA 3QHAA 4ZO7A 2AUTA 3EH2A 2X6QA 1MAVA 5NULA 1O08A 4YECA 4YRPA 1TF2A 1W1UA 3IB3A 1RQ7A 2F8LA 2QRVB 1KVQA 3LZ6A 4MV4A 5SICE 3ZWMA 4EI7A 5I3ZA 2D1RA 1E3WB 1CRZA 2RGEA 3VC2A 2CLHB 2I54A 1FDWA 5DO9A 3O21A 2YV2A 5DASA 5IJAA 1L7AA 1B74A 2HIHA 4JVOA 2G63A 2WM9B 1NMYA 4UNPA 3FCUB 3SZMA 1YFKA 3GFOA 2NADA 3PDIB 1VDMA 3R5TA 2BJHA 2FUEA 3VDRA 1GZSA 1F4LA 1JSCA 4U2KA 3TMYA 5EIBC 2QA5A 2Q4OA 3TECE 2BFCA 1TKRA 5AMXA 4CCAA 2JFGA 1THZA 3RSHA 1L4NA 1TXGA 2Z3VA 3ETJA 4B5KA 2EFCB 3DEIA 4JLAA 2X7XA 5BV0A 1WQ4A 5IRCD 1Z0ZA 3M3HA 1QS0B 1JJVA 3JQBA 4RGQA 3ZGXA 3IEVA 2H0AA 3EGXB 3RHTA 1KARA 4M6WB 2BM1A 3ZLUA 2IYWA 5HF9A 3NTXA 2FW0A 2YN4A 3JQFA 4FNOA 4NK4A 3ZR4B 1GG9A 5TQ0B 1L7RA 4F72A 4TMTA 4JI0B 3FTEA 1XQXA 1E18A 1OROA 1E9BA 3JVIA 5H1YA 3VVMA 2H2GA 2ZT6A 5D3MB 1IBMB 2VSFA 2Y76A 4CL8A 1TQHA 4J0HA 2AQIA 3T9DA 5E3HA 3I9V1 1MOPA 2IUFA 5F1PA 2AWOA 1SR8A 5EQJB 3KQTA 2ZRAA 3BDAA 3PR3A 3PGMA 4MYHA 4UPEA 2CXHA 1ZN8A 3VU1A 2ADMA 1OZGA 1U9CA 4PAWA 5FUMA 3CZPA 1YRQA 3JTEA 2VRWA 3WXMA 2JGNA 5L3QA 4RSHA 2VJKA 4YRBA 4MA0A 3A6GA 5JDCA 3RFVA 3PGVA 4EG0A 2HXSA 2QUJA 4I3GA 5HRAA 3PXGA 3C45A 4WA8A 2A67A 2FZLA 5CVJA 4U2FA 1J97A 4WY2A 4Y2UA 1Z63A 1Y80A 4PLZA 3CONA 1XTRA 4GMFA 1C0PA 1SC1A 2PSDA 2XY4A 3PL1A 4YRZA 1VFPA 2W2LA 3TLXA 1R0RE 2R47A 2YASA 4I2VA 5KDOA 3DKKA 1U5BA 3VPXA 2O2EA 2PGLA 3AJAA 1BKDR 3HJRA 1LLCA 1SWWA 4U2EA 4OHPA 4ZCPA 3W77A 5B64A 4F3RA 1OC4A 3GAFA 3OQBA 3VR0A 9GPBA 3BQNB 5JHHB 4LDZA 3DW3X 2HU2A 1V7CA 2BGJA 4ZOLB 4C6TB 1T8UA 3ROKA 3DZKA 3OIDA 3BULA 5EE5B 3WLPA 1R9GA 1NJ6A 3N5KA 3P26A 4JC8A 4Q9NA 2VJMB 2J9ZB 5G1OA 1RP7A 3WFJA 4DWJA 1SVSA 2HMAA 5JFTA 7GPBA 1VSBA 2CDBA 3SX2A 5HTOA 1WXGA 5F77A 1T5LA 2WF6A 1QTIA 2XVAA 3GRUA 4JLVA 5A5VA 4JP1A 2N42A 5A3QA 2QN7A 1TJNA 1R3DA 1SBIA 1V37A 4O4IB 3DV0B 3DCYA 5LP6F 1D03A 1DIOB 2V6BA 4LTMA 2CHVA 3U62A 5K0ZA 1LSUA 2XNHA 4M7OA 3RSFA 4B79A 2HPVA 1UKAA 4UDXX 5HJ5A 5TT0A 4MV8A 3LMKA 1KQ3A 4U39A 5ALTA 1T6XA 4N0EA 1TEZA 1CDDA 4YV7A 1G3UA 1UMCB 3A6HA 3UY4A 5FFFA 4MPDA 4CQMD 5FCDA 4EUNA 1JYFA 5IPFA 1Z7BA 4EHAA 3TZBA 1Z26A 2QE7D 2EAUA 1TNDA 2WSLA 1C9NA 4W7SA 4HVAA 4UATA 4FZRA 1TT7A 4OMFG 5AKEA 3FPLA 4MMZB 1GYRA 3M33A 4PC2A 1G5FA 4BYMA 3R0QA 4K9PA 2QRUA 3VZRA 3BAFA 2XF2A 4XB2A 1GNLA 3TPCA 3UEOA 2W6CX 5FLXA 4V1CA 3A9UA 1VIYA 3BXOA 3K9LA 4PG6A 4HUTA 1TEXA 1FX0B 4O1MA 1E9SA 4X3PA 2QYTA 1PK8A 4BBZA 4AK9A 2VYQA 2QL5A 3LTNC 4O4JB 2E85A 2C5GA 3ZBQA 4C07A 2PYIA 5C8YB 1BU5A 2QI9C 1CVRA 1FU8A 1Y98A 2O8VA 3DQPA 3ICCA 3KVRA 1KI2A 3F5SA 4MDHA 5B1HA 1JT9A 2C2HA 1NX9A 3EUWA 4QJ5A 5EE9A 3RVKA 2VEOA 1ABEA 3QKRB 1RMYA 3A3YA 3C15C 2B0JA 3QBTA 4NJMA 4JSRA 4EECA 1NQAO 3OU2A 3UAXA 5BXYA 4OHWA 5CDSA 1OXVA 3OHPA 3KQLA 4GYWA 3GP8A 3DOHA 4Q9DA 4B73A 2E6UX 5MHTA 4I5EA 2CHEA 3AZOA 5BN1A 2R8XA 2DTEA 5GTDA 3QMWA 4A8JB 4ZEOA 1FFXA 4KC0A 4IJUA 4RVGA 4B2LA 1QO0D 3QIAA 4JX8A 5KZMB 4G85A 3N8DA 2R7NA 2A9OA 3F9RA 3H19A 4INPA 4KPUB 1XPRA 2VYCA 4Z86A 3HI4A 2QNRA 4KIFA 1VLZA 4MWEA 3U7JA 1A9YA 1ISHA 2IVFA 1U3VA 4KUHA 2BF4A 5K5EA 2W6MA 3EZGA 1I2CA 4YP1A 4DARA 1EG2A 1TKBA 4QBFA 1QIMA 4TMKA 4GZ3A 3UA4A 2P1RA 3GU3A 4FZ5A 4L2IA 2CVFA 3ADOA 4R98A 1VZ2A 1YO6A 2PUVA 2DKFA 1NM5A 3LPCA 2E4XA 3WMFA 2BH2A 1KORA 2YIVX 1YL7A 1OT3A 3SZUA 3V7NA 1P8JA 3WQQA 2CV1A 4K6FA 3GJ7A 2VWQA 1MGOA 4QKQA 5A6VA 4UEKA 1FMCA 1SXJB 1RS0A 3PQEA 4UM9D 1NVUQ 3QVJA 1T24A 3WSTA 1YQDA 2AG0A 2DR0A 2PAAA 1U4SA 2I3ZA 1GRQA 1DAPA 5CVEA 1R15A 1GN8A 4EGJA 2ZGVA 1JHUA 3FBGA 2Z2YA 5E4JA 2PRZA 2X77A 3OZTA 4X8HA 4Z3OA 4TTSA 4MW2A 1BMFD 4EMSA 1BVHA 1QQ7A 3CBGA 1CDEA 2A7XA 1HE2A 3AESA 2H4ZA 2O8NA 4AIIA 5JQGB 1V8PA 1XZ8A 1ZM7A 3QMVA 1DRWA 3SIWA 4FHGA 4ZI7A 5AVTA 2FX2A 2RMKA 4BP8A 3RFXA 1J0XO 1F8GA 1UPTA 1EAMA 2A78A 2XMPA 3WP1B 4B7AA 2O05A 2ZBPA 5D5QA 3FIJA 2Y1KA 5DLPA 4MQ6A 4OVKA 4MGYR 5FUYA 4MB0A 3WSWA 4R3NA 2O1XA 3R3YA 3DKVA 4DZTA 1W29A 1SOUA 2Y71A 3I9OA 1RI5A 3GZNB 4RMGA 2FZCA 1CYEA 3MF4A 4PSVA 3T3IA 1B2LA 1Y89A 4AUKA 1TVKB 4CKEB 2BKVA 1B73A 4AKGA 3DLAA 3MWDB 2ZRQA 1E96A 4FFRA 2R5WA 1RZVA 3U5TA 2BFOA 1OE0A 1DFHA 5DGCA 4B4VA 4RH0A 3BZWA 5JISA 5KTYA 5FHQA 3NVKI 2H65A 1FTYA 4OI0A 3O2NA 4JLMA 2H18A 5U9CA 5IK2A 4LC0A 1JG2A 4NBTA 1H2EA 4YCNA 1TEVA 1RWKA 2OGWA 3I61A 2OXTA 4B6RA 5L45A 1LZLA 1RLUA 1U1FA 4NBSA 4Q82A 1F48A 4LJ7A 2QN2A 4GI2A 4P5DA 1DG3A 2X1VA 2HYIC 1UIMA 5AVOA 3RFFA 4HEA6 1QV7A 1P1HA 2E37A 1DINA 1H9AA 1X14A 4LJ5A 3QG1A 3FUCA 4MYCA 4NYJQ 5D8DA 1UJMA 2OBXA 1O4VA 5T7BA 3TL6A 4OM8A 4GHWA 3MTIA 4E08A 1GR0A 1TCBA 5KBYA 3JQ7B 3TBFA 1SKYE 3SQWA 1QRSA 3VH3A 2V6JA 1NTOA 4L1KA 5D51S 1G8JA 1Y7TA 3KBBA 2NT4A 1CJMA 1U80A 4G5HA 4JKOA 2FZ5A 5J5AA 1ZITA 1P2FA 3HPRA 3T9EA 1L4BA 4LY6A 1T9ZA 3KJEA 3PJFA 4DJJA 3PQ4A 2QMOA 3ZHZA 4AY4A 1P80A 1FQJA 2O9JA 3AIOA 4QO7A 3RVPA 4OIFA 2JBHA 1YB1A 3JQCA 5LBTA 2JFBA 2OHHA 1ANKA 1QRRA 2C54A 1JFRA 4OP2A 1T6YA 4RWEA 3O94A 3WHKA 1YL5A 4CIXA 2GK6A 4EVSA 1OFIA 2ZSBA 3IE0A 1NVWQ 1TJ3A 3KQWA 4AZSA 2QWXA 4HTAA 1D6MA 1H8ED 2HT1A 1CJKC 4R1MA 3BG5A 2EHDA 1JU4A 2ZQ5A 1JN0A 3NJRA 2CZQA 3UB4A 3GT4A 3RW9A 2OZVA 1XCPA 2YWDA 3IUSA 2Q28A 3QV1A 1LPBB 3ETCA 4GMHA 4I55B 2CMHA 2C5HA 5B1IA 2SKEA 2G06A 3BWXA 3OOEA 1WRBA 4WTOA 2OBMA 3UENA 2P6NA 2Y3IA 4C6RA 2FV8A 3QI2A 1U99A 4IV8A 2WWRA 1C7JA 3W9SA 3W9YA 4CTNA 5BSRA 4GBGA 1QGED 4NAHA 1GQ2A 4EY7A 1TPZA 3V3TA 1QFSA 1T9BA 3ESCA 4FSDA 1OI3A 3LWZA 2P75A 1S9HA 3QFCA 1ENPA 1I8TA 3BS4A 5C31A 4CDMA 3QXGA 3FCSB 1YC5A 5JOQA 3UCFA 3ZN2A 1F0PA 2OV2A 3QVOA 1O1YA 4ATNA 3E4DA 4LWZA 3I3OA 2VN8A 3HDYA 4J76A 3MW8A 1GGKA 4FUQA 3K6RA 4QNNA 2FP4A 1NKVA 1HETA 3O31A 2WAOA 5C53B 2QIOA 4TYYA 5A03A 3DMTA 4K6HA 3V33A 2C9MA 2IX9A 4PSAA 1OYWA 1NRWA 2WKPA 3MTQA 2XAUA 2Q5HA 4MAFA 1GTZA 4DV3B 1Q1AA 5C1IA 4PN3A 1KRXA 2CUZA 1DAMA 2JGDA 1KBOA 4TROA 5I4KA 3ODGA 3I28A 4YVFA 4TKVA 4BEVA 4ZJYA 1U0TA 3DVSX 4B6FA 3U4GA 3WGJA 3GWGA 5LFAA 4Z9BA 3SBXA 1P33A 2J3KA 4V2IA 3R9WA 3PQFA 1G4HA 5F5XA 1TK3A 4GXNA 4PG8A 4YLGA 4R40A 4LRXA 3LPMA 4KXWA 4NV1A 5CB4F 2P62A 5AJVB 3KBOA 2O0LA 3AB7A 4NEHB 2H2HA 3EAFA 2IF2A 4LF8B 3DWIA 5E3IA 1OFUA 3QKTA 4IOKA 3D7MA 1A5TA 1UBUS 4QPCA 1KO8A 4CM4B 1GM5A 1RE0A 4RBNA 4WESB 4TLEA 1Y6RA 2HO4A 1JHQA 3IR5A 2MINA 3PR2B 3HABA 4KQIA 5K8UA 4E31A 4FFPA 4H16A 1N0HA 4CMEA 5DNYB 1U3DA 1FQKA 1XEFA 2AG8A 4GMDA 1P4SA 4XUGB 4DDMA 5A06A 4OK3A 2NP7A 4L4ZA 1U6KA 3AP3A 3LP8A 2WJ4A 4E11A 4RANA 2FUG6 1DBVO 1KEPA 2KQUA 1AO0A 3LPDA 1OBHA 2BFPA 4HS4A 3NBZC 4IVRA 3AUKA 1BQ3A 4LTDA 2FX5A 3ID6C 3IRVA 3OBIA 2H9AA 2MYNA 1MAHA 1OD6A 4G2NA 5FPHA 1OX4B 3QM1A 4ZVNA 1PZNA 2PWPA 3H2HA 4MRVA 4MGKR 5D3KA 3UG7A 3LYLA 5KYXA 5KQMA 1FLVA 4KVGA 3IIEA 4Q3KA 2IHYA 5AO9A 4X94A 3QSGA 2JGKA 3NUGA 2C29D 5DCLA 3AR2A 3IR7A 4AS1A 2IK8A 2I7XA 2GFHA 2JJ1D 3MMNA 1IQPA 1HE1C 3ZQ6A 3RC8A 3SQOA 1IUNA 4AS2A 5IYZA 4K9MA 2W2KA 2V54A 1OWPA 2F8MA 3VYUB 3KOXA 3PNOA 5EKTA 3ZK9A 1D4ZA 4LMRA 4CJXA 1KY5A 2PR7A 3GLQA 1I4OA 5JPCA 1KNQA 2G36A 3A0UA 3PYMA 3DOUA 1C7EA 3DAGA 2EX0A 2YMPA 4M1OA 3H4VA 5CFOA 3AR8A 3DOOA 2DZDA 4DT1B 4F4FA 1J99A 3PDCA 3R23A 4YGXB 2NG1A 4K28A 1YT5A 4BECA 1XRSB 4CN8A 3G2OA 2XDYA 4WQMA 4LYYA 1CJBA 4HXYA 5NLLA 3BSSA 5IXYA 3R0XA 2XIQA 3VR3A 3IO3A 4WUVA 4HZIA 4Z9FA