2ZTVA

The binary complex of d-3-hydroxybutyrate dehydrogenase with nad+
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
260
structure length
260
Chain Sequence
MLKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISALAEKNGVDQETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
publication title Closed complex of the D-3-hydroxybutyrate dehydrogenase induced by an enantiomeric competitive inhibitor.
pubmed doi rcsb
source organism Pseudomonas fragi
total genus 98
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ztvA00
4XR9A 1P31A 1NAHA 3QA9A 1VLLA 4TZTA 1P44A 1PR3A 3VKUA 3Q9NA 3CUKA 3DBHB 3W6UA 1DIAA 3U4CA 5FYDA 4OJNA 1H0KA 1ZSVA 3E03A 3PRJA 3PVZA 4J49A 3I6QA 4II3A 4XJSA 1I3MA 3KOUA 2P9EA 3WBFA 4ZD6A 1P1KA 5DN9A 3ASVA 3HDYA 3ZNNA 4YT8A 9LDBA 4NDNE 4ALKA 1G1AA 3A4VA 1I2CA 5KOIA 2VT3A 1K3TA 3INRA 3B1FA 3AI2A 3FNEA 1PJ4A 3VPGA 5DP1A 3GVXA 1UXGA 2HKIA 2X9NA 3HFGA 1M66A 4MVJH 3HDHA 4RPKA 5G4KB 3H6KA 1E7YA 1XR3A 1WLYA 5THQA 3QSGA 1M75A 4J6FA 5I7SA 4DTIA 4CMEA 1QP8A 3JQCA 1NPDA 3LYLA 1T25A 3AY6A 3HNPA 4DBVO 3OBBA 4YRDA 3H2SA 2HK9A 2BGMA 4U8GA 3VPSA 3W4JA 4EBFA 3D4NA 4IS2A 2F00A 3STHA 1QXSA 1R15A 4L76A 4NI5A 3AJRA 4F6CA 3D1LA 5JMPA 3RROA 3F47A 3H8VA 3SJ7A 1CYDA 1OMOA 4JLWA 5IDQA 4FC6A 1ZFNA 3ZWCA 3WGIA 2PY6A 2O7QA 3NT2A 3HN2A 4EI2A 1KERA 4PLVA 4OKIA 3DDNA 2JL1A 1X1TA 5CPFA 1RM5A 2DUUA 1YB1A 2NQTA 5I7VA 3L4SO 1F8FA 1JW9B 3C7DB 3RC1A 2NTJA 1HKUA 3CPSA 3WB9A 2Q2VA 4TWRA 5BNFA 1P0FA 1VI2A 4I5DA 4AJ2A 4Z0PA 5CEFA 2GD1O 4R4JA 5BSGA 1E3EA 4CLDA 3EC7A 3NX4A 1X7GA 3R3SA 3ROQA 4FCCA 1ML3A 4LSWA 1XG5A 3ZHXA 1U2GA 3RBXA 3E5MA 4D44A 4UVEA 4NK4A 4A7PA 1E3SA 3FWNA 1E92A 2VHVA 4IXTA 1SOWA 1BXZA 4M8SA 4KDEA 5FFFA 3D64A 4A26A 3ETEA 3PGJA 1DRWA 5GZ6A 1B16A 2YZ7A 4QT0A 2BHLA 2FR0A 3L9WA 4HX5A 4UUOA 4UVDA 2CFCA 1LUAA 2JAHA 5L4NA 3K96A 3E9MA 2D0IA 4YQZA 2YFHA 3NEPX 2XAAA 1U2DA 3ADPA 3OJLA 4ND3A 3WG9A 2IRWA 3VH4A 3WNQA 3TSCA 1C3VA 4IM7A 1U3WA 1B8VA 2C5EA 5JPIA 5LC1A 4DC1A 3H5AA 3QVTA 2CDBA 3SJUA 2CZCA 1K6JA 2PZKA 3NKLA 4BUCA 1DHTA 3GAFA 3VPFA 5KKAA 5C7LO 3JQGA 3W6ZA 1CIVA 3VZSA 3H9JA 4CM9A 1FDUA 1UZMA 3GPIA 4YEDA 5BR7A 1F14A 2GN6A 2GR9A 2HQ1A 1PJLA 1HE5A 4RJTA 3ZHBA 4DGSA 4LW8A 2VWQA 1SB9A 2O2SA 1GL3A 3ZU5A 1U7HA 1GY8A 1FJHA 3GN1A 3KYCA 1UDBA 2D5CA 3P5SA 3ZWBA 4XJTA 2OL4A 5GZ1A 5K6AC 3K2EA 1VJ0A 1YRLA 1NQTA 2YV2A 2E6UX 3IJPA 4MIYA 4AFNA 5T8KC 3ZV4A 2G1UA 5JO9A 1YQXA 2EKQA 1YE3A 3RUFA 3C3XA 4F46A 1TB4A 1SMKA 2P91A 2J3KA 4DWVA 4CLEA 2W8ZA 2C7GA 4J16A 3Q0EA 1EZ4A 2EP5A 5JAQA 1XCBA 5LDHA 2R2GA 1C0IA 4U6SA 3PI7A 3DO5A 4DPMA 4YA6A 2PD6A 1PZFA 2Q4EA 4PLPA 1PR9A 1WZEA 4A73A 1E3WA 1HDYA 3C7AA 1QLJA 3PJDA 3MJCA 1JAXA 2AE2A 4MOWA 1LDEA 4QSMA 4B3JA 1YXMA 2VRBA 2Y0EA 4FS3A 1O9BA 3DEYX 2IODA 3D4PA 3L77A 3UW3A 1KIFA 4CM3A 3EAGA 4MVJG 4OM8A 1TT7A 1YL7A 3Q2IA 2R6JA 3V5NA 5IDWA 4BGIA 4CR7A 4FFRA 4NBVA 3KHUA 1P1IA 3ZWNA 4EGFA 1I33A 1UH5A 2PKQO 1V0JA 2EXXA 1DHRA 4GKBA 1ULSA 3R1IA 1EBFA 3C85A 2PNFA 3WYEA 4CR6A 2P5YA 4UVHA 3P19A 4XB2A 1AHIA 1F17A 3GC6A 1K0UA 4HFNA 2RBEA 2BMAA 3S2GA 3D4OA 5TT0A 2AEMA 2BD0A 4BNYA 1LDMA 1VE9A 1DJQA 2Q1UA 1OI7A 4Q3CA 1GZ6A 2HMSA 1FK8A 2DT5A 4CQMD 4HNHA 3EYWA 2YV3A 3WIDA 1WPQA 3GN2A 3U4DA 3VTZA 1E6EA 4B7UA 3HDJA 1M6HA 3O03A 4BMSA 4HP8A 5HM8A 1A4UA 5TT1A 4BNWA 1YS4A 4EDFA 4O6VA 4AG3A 2G76A 4MIOA 3RWBA 1MC5A 2YHIB 2YYYA 4N18A 3V1TC 2BKAA 5G0WA 4MKRA 1DOHA 4WLNA 1F8GA 1U3TA 2B4RO 3CZRA 3S55A 2Q4BA 5C5IA 1NYTA 8LDHA 4AJNA 2J3IA 4O5OA 3NAQA 1R37A 4I9HA 3RASA 2OZPA 2WYVA 1ZO8A 4J7UA 2BFPA 1VSUA 2W2LA 3JQ8B 2H5LA 3BMQA 2PA3A 3I52A 3KEQA 5F3RA 4E0BA 2V6GA 2VRCA 5H81A 4WLOA 1R0LA 2EW2A 2P2SA 3B1KA 1P1RA 5L7TA 3DBRB 3ZN2A 2C0CA 1RYDA 1PL8A 4P4LA 3OEWA 3QVWA 2ZKLA 4BO0A 4RCVA 3ZU4A 2FZEA 2Z5LA 1Q7CA 4GMGA 5CP8A 1S6YA 1EFKA 4GVXA 4GLLA 4A0SA 3M2PA 2CDAA 5T8KA 2PWZA 2WD7B 4BHTA 4GLOA 4CV2A 1WP4A 3ADOA 4CMHA 1R0SA 3DONA 3Q9UA 1FDVA 1Y8QA 4XGKA 5JBIA 4D42A 2PLAA 3PFWO 4JXKA 5CEEA 4DREA 1WWKA 1PZHA 1BHSA 4CLOA 1SEVA 3QW2A 4NG5A 1TT5A 3GZNA 2NTNA 1SAYA 1XLTA 2EJWA 3W4KA 3RCBA 1HSZA 2AQHA 1H93A 3FNHA 1LBEA 5EQDA 4RF3A 3TRIA 5EPOA 4D79A 3E8XA 3OEYA 1IY8A 5JSFA 2C7VA 4WGGA 1Z75A 3VC7A 1LSSA 1B3RA 1N92A 1Y6JA 3OM9A 5I7EA 1EVJA 2ZJ1A 1ZMOA 2ZTUA 3KO8A 5KJFA 3ABIA 3H5RA 3S2FA 3KVOA 3NUGA 3GRKA 3KEOA 1JQBA 5L4SA 3WIEA 3COSA 5JY6A 4EEXA 2EV9A 1DDOA 1E0DA 3ZW9A 1Y9AA 4ZA2A 3JQDA 2I67A 3ZU2A 3NDIA 2HRBA 4OXKA 1UP4A 5I9MA 4JJIA 4X54A 4EJ0A 3QWAA 2X9GA 1N9GA 1C1DA 3D3WB 2VNSA 3F1KA 2JHFA 1RWBA 2I9PA 3TFQA 3CINA 2AA3A 1Q2XA 3RD5A 2BFMA 4LVCA 2EHDA 4PLTA 5HTOA 1P1HA 3UKOA 1E3JA 1Y81A 3S8MA 1S7CA 4PGFA 4J4HA 3VH2A 2Y1GA 4E33A 4D3FA 1EVYA 1Q0LA 1BTOA 2RHCA 3WWZA 3RC7A 4OOEA 2ZATA 1VC2A 1DBVO 4A10A 3CMMA 1D3AA 3GUYA 3RUAA 3IUPA 3BA1A 1N7GA 4CMBA 3GDGA 3KTDA 2V6MA 2OUIA 2NQ8A 3H7AA 1T2CA 2OP0A 3RC2A 3ZWAA 5G0VA 4WCFC 1PEDA 4CM4B 1ZK0A 3TWOA 1AXGA 3H65A 1XA0A 1O8CA 2CUKA 4PLWA 2VHZA 4P38A 4JP2A 3WOHA 3WTCA 2PR2A 2QRLA 1I3KA 4MVJM 1YO6A 2HAEA 2DBZA 1GPDG 2JD1A 3SC6A 2BF7A 4CM5A 3IP1A 4MJLA 4RF4A 5ICSA 3PZRA 2PH5A 4IBOA 1NM5A 1PS9A 5JS6A 5HRUA 2WE7A 3UAGA 3LDHA 5A9RA 3ANNA 4H3VA 3GOHA 3K92A 3NTRA 4U5QA 3ITKA 1M67A 1HTBA 4CJXA 1A5ZA 4RZIA 4NJMB 4J1TA 5B1YA 2Q3EA 1JWAB 1RM3A 2EG9A 2NNLD 3F5QA 4D46A 4R9RA 4Z9FA 3WGYA 4B4WA 3QLJA 4URFA 5CDGA 1FDTA 3B6ZA 3GHHA 1PS0A 3I3OA 1K6XA 3QVSA 2NADA 2DFDA 1QRRA 1AE1A 2E48A 3AFMA 2X0RA 3WDSA 2NWQA 5C3MA 3KZVA 3AUTA 2VTEA 1A72A 3P2YA 4CV3A 4CL8A 1T1SA 4D3DA 1IB6A 4YAGA 5L45A 4JJFA 1U8FO 4IQGA 3UHAA 5IAAA 4B4UA 4JN6B 1B14A 3UCFA 3CH6A 4KUHA 2HRZA 2ZJ0A 4MVJE 1R4MB 1PU2A 3FCOA 3TZQA 4NU6A 4DBZA 3F3SA 3PP8A 1WDLA 2NV6A 1IZ0A 3QVXA 4NFHA 1XYGA 1LXCA 2ZYDA 5KIAA 1EBUA 1E6WA 1ZKMA 5F1KA 4AVYA 1GYQA 2EEZA 1ZEMA 4Q3BA 2OP1A 4CMJA 4YRAA 5CDUA 3T4XA 1P0CA 4XD2A 2PD4A 1K89A 2GCGA 2IEBA 4XQCA 3DMTC 3AI3A 1LLDA 3CZMA 1C14A 2IZ0A 4WECA 4YJGB 3WQRA 3DBVO 3BMOB 3IKVA 2A35A 4EUFA 3JQAA 3ZWMA 2X58A 4BO9A 4YJHB 1EQUA 1NVGA 4PZDA 1ADGA 4Y6RA 1BWSA 1YB5A 1X7HA 2X4GA 2DKNA 1V6AA 2ZB7A 3ETGA 3KM0A 1Z6ZA 4CM1A 4RO0A 1J6UA 3EDMA 3GDFA 3C7CB 4NBTA 4Y67A 2SCUA 4FGSA 4GX1A 5TLSA 2V6FA 3NDJA 3Q11A 2GZ3A 1LU9A 1YQDA 3WYCA 5AQ1A 1E1NA 1PGPA 4UEOA 1LSUA 1LJ8A 1WDKA 4J43A 4I9NA 1ZK4A 5CDTA 3E1KA 3HG7A 2Y1EA 4E32A 1XQ1A 1ID1A 4KDFA 1DC3A 3FF4A 1EE9A 1T2AA 5TGDA 3GEGA 1GCUA 1UJMA 1U9JA 5JMWA 1OFGA 4ALJA 1RKXA 1HT0A 4Y9DA 3ICCA 5ENVA 3PGXA 2GYYA 4WCFA 3UCXA 3G79A 5B37A 4BNHA 1PJSA 2HSDA 1LTHR 1ZK3A 4CLXA 1HZZA 1WVGA 2JJYA 4H16A 4K6CA 4BMNA 3PHGA 2H6EA 2QYTA 4YWJA 1IZ9A 1ZSNA 4D0SA 3NGXA 3OJFA 5IDYA 4OKNA 4U0KA 4WCDA 4XEHA 1SOVA 4ZRNA 1C0KA 3X2FA 1JA9A 3WLFA 2PTGA 3DFUA 3ZHZA 4KOAA 2C20A 5IJZA 1T2DA 1Y5MA 1GU7A 4XYBA 4JK3A 1DPGA 4RVHA 4I8XA 3I1JA 3E9NA 3ZNOA 5B4TA 3SX2A 1YKFA 1GADO 1M2WA 2EP7A 2VOJA 4G5HA 1O94A 3DZBA 1NVTA 2FWMX 1NFFA 2FPPA 2X5OA 3DAGA 3DQPA 4L75A 2FRDA 3ZWOA 4J3FA 7ADHA 2O23A 4XGNA 3OQBA 4BQPA 3GA0A 4RORA 3WGOA 4TRJA 3DZJA 3D3EA 3BIOA 3QVOA 4IQ8A 1YWGO 3HSKA 3WJ7A 3RU7A 5G2OA 1M76A 4IJKA 4YAKA 1UR5A 2I66A 3L6DA 3JQ9A 1KEPA 3HDQA 1ONNA 3M2TA 4BKQA 1D8AA 4Z0HO 1YJ8A 4DPLA 1PIWA 2GF2A 2BLLA 4JBHA 4GGPA 3AM4A 2OFPA 2X22A 4TZKA 5JCJA 3PEFA 1ZIDA 4EYEA 3UUWA 3L07A 4N5MA 2CDCA 1OC2A 4S3MA 4OOFA 2C82A 3JQ7B 1LQTA 3RJ5A 2G82A 3U0BA 4DIBA 1OBFO 2WMDA 2O3SA 4A03A 1QYXA 1UP7A 5C7IO 4ALMA 2VN8A 3D0OA 4J0EA 1PJTA 5A9SB 4XA8A 5G4KA 5ILOA 3KSDO 1E77A 4IDFA 1SZJG 4KP7A 2OXIA 3EGOA 3ZW8A 4PLYA 1R4NB 2AHRA 1HDCA 1X1EA 1YH3A 2D59A 2LDXA 2V6BA 3OJOA 3PWSA 2HJRA 3K8ZA 1JVBA 2VYND 3DAPA 1LLUA 3M1LA 5T64A 2ZCVA 3OA0A 2B83A 3JSAA 4CM6A 1A4IA 3HJAA 1W0CA 2DU8A 2NUAA 5BSHA 4XRRA 5IXSA 5JC8A 3WICA 2GNAA 4AJJA 1HZJA 3FPLA 3OECA 1I2ZA 3JYOA 1Z7BA 1ZVMA 4PLZA 3ROMA 3INGA 2IXAA 1MC4A 4TRRA 4YTEA 3BXXA 1VSVA 2RHRA 1LRLA 3H9GA 3H9QA 4MPDA 2XXJA 3K6JA 4C7KA 2X9VA 4JQCA 4MKZA 4PG8A 1X14A 3AUSA 2WDZA 3RUCA 3FI9A 3G0OA 3Q6IA 3KUXA 4FPXA 4LRSB 3TOXA 3VVCA 3I83A 1G0NA 1PX0A 2I3AA 1RM4A 1CQJA 1IPFA 2ZIZA 3IIEA 4O1MA 1U5AA 2GN4A 3KB6A 4R3WA 4BOYA 4WASA 4PFJA 2YHUA 1C1XB 1SO8A 1ZK2A 4ND2A 1O6ZA 1OAAA 2D4AA 4BNKA 4I5FA 4EJ6A 1UAGA 3FWZA 4BL5A 4B8ZA 2GZ1A 3D5QA 3PXXA 4QFCA 4E21A 3SXPA 1SBYA 2EJVA 3QWBA 4CMKA 3E5RA 1ZMTA 2GO1A 1A71A 3G3EA 1Z73A 5JE8A 4DL9A 4YT5A 1Q1NA 4BO4A 1V3TA 1YL6A 5ER6A 5J23A 1BDMA 3WTBA 1V35A 1EE2A 4DQXA 2HCTA 2WJPA 3O9ZA 3GGOA 4CODB 3GFBA 3F4BA 4JNKA 4JBIA 1HF3A 3JQ6A 1GV0A 4FFLA 4NU5A 1DC6A 1EK6A 3NTQA 1WXDA 1MXHA 1FDWA 1LSOA 2I3GA 3EW7A 1K2WA 1LDGA 4OXNA 1BXGB 1A7AA 2XOXA 3AW9A 2X86A 1QG6A 2J8ZA 1P1FA 3VTFA 1PZGA 1NQ5A 1HETA 5B4UA 5HS4A 4CMIB 3FBGA 4E5YA 3KYDB 2ZTMA 2RH4A 3VAZA 3T4EA 5TJHA 5KVVA 2DPHA 2E4AA 2Y93A 3B70A 3DBLB 3JV7A 4J1SA 5A04A 4BO5A 1YOVB 3C24A 3BMNB 2Z1MA 4ALLA 3HFSA 5A05A 1CQIA 3DMYA 4CV1A 5G4LA 1G0OA 2X0NA 4D41A 5I8WA 4Z9YA 3GK3A 1LSJA 1UXHA 1ISGA 4RVGA 4YJFA 4DUPA 1ISFA 1V3VA 5ES3A 4ZQGA 2QW8A 3I4FA 4XQ9A 3GNQA 3ITDA 3WGHA 3JD0A 1BVRA 2UVDA 3GY0A 1NQOA 4BO1A 3ZNPA 1GQYA 4WOKA 4AJ1A 4E6PA 3QV1A 1U7TA 1GEGA 1B7GO 1LX6A 1UZNA 2XPCA 4WNIA 5EQFA 1ISHA 1ZEJA 3DHNA 3GR6A 4F3YA 2BFAA 1DLJA 3HWRA 5TX7A 8ADHA 4MKXA 1PQUA 2CVZA 2IDZA 4XQGA 1E1MA 2RIRA 3RKUA 4BNMA 1L1FA 4NBUA 3ONFA 1H6BA 2C54A 1NHWA 2J5QA 1GDHA 2JFHA 4GX5A 4J9UE 5JDIA 1VJ1A 2IE0A 4FQ8A 4TROA 5ADHA 5BSEA 4R1UA 4MDHA 3TDKA 1UAYA 4I5EA 3NRCA 5JFOA 1IUKA 2B4QA 4DLBA 4IJUA 1NVMB 4DQVA 1KVUA 5JC1A 2Y99A 4M49A 4FBGA 3L6EA 2O4CA 3TF5A 2HJSA 3HZZA 1B8PA 4QEDA 3DZKA 3LT1A 2VNAA 3PHIA 3L4BC 5A5FA 1ZSYA 4YAEA 1E7MA 2WE8A 3JYLA 5A5EA 4IQ0A 5TQVA 1Y7TA 2Y0CA 3N74A 4E4YA 5KCZA 1CRWG 3F4LA 2E37A 1BSVA 3LT2A 4GGOA 4O63O 5A02A 3UFXA 4BO8A 5K0ZA 3O26A 5C37A 5F1OA 1DXYA 3HB5X 2FP4A 3SVTA 2H9IA 2VHXA 4BQRA 2D2IA 4TRMA 4A2CA 3W8EA 1I10A 1NR7A 4Q3NA 3IQDB 4EEZA 2CVQA 3KRTA 1YJQA 4Q9NA 3RAJA 4CL3A 3WR5A 3MJVA 2C2XA 1KVSA 1O89A 3E82A 4XCVA 3I6IA 3VHRA 4YAIA 1DLIA 1U5CA 3I4CA 3JQ8A 4JJGA 4WLEA 1PQPA 2NVWA 5DBGA 4E13A 3TZHA 3JQGB 4YDRA 3DC2A 4O0LA 4BO2A 2H1SA 5KVSA 4C4OA 1LLQA 2TMDA 1D7OA 1DRUA 3DBRA 4ZJUA 3RUIA 2Y1FA 1MB4A 2FZWA 5KWEA 2EERA 4GL4A 2DTEA 5TSDA 3ULKA 2B69A 4LN1A 3KETA 1EFLA 1ENPA 3KYCB 3PWKA 2A92A 3PHJA 4FD3A 2HO5A 3JYNA 3RBVA 2VYVD 2X0JA 3HE3A 3WGTA 2IXBA 1I01A 2D3TA 4F6LA 2WD7A 1RPNA 3H3FA 4XX0A 1A9YA 3LT0A 1KEUA 5JO0A 4M55A 4CM8B 1ADBA 3FPCA 4BGUA 4KTVE 4E2XA 4W9NC 3GAZA 3QY9A 3FD8A 4BNGA 3WX0A 1X15A 2X5KO 3Q1LA 4BKPA 4MVJD 3H3JA 2QZ9A 4J0FA 1DAOA 2VCYA 4DYVA 2OORA 4ILKA 4TMFA 3SLGA 3GH3A 4PLGA 1VJTA 1LA2A 4YT2A 1HDRA 1ZCJA 3V1YA 1MXFA 4BGVA 4UUPA 1ISJA 3L0DA 2XXBA 4L73A 4UEKA 3GMDA 1XGKA 1T2FA 3GVCA 3GNSA 3LLSA 2X6TA 4NFSA 5IZCC 4MO2A 2HK8A 3BHMA 1QORA 5T6BA 2UUOA 3FTPA 2ET6A 3VVBA 5AXBA 3I9NA 2VUTA 1HRDA 2V65A 2V7PA 2OBNA 3CXRA 5H83A 4XKJA 4BNZA 1JVSA 4IDEA 4J1QA 4GQAA 1XSEA 2B4TO 2BH9A 4PVCA 3ZWPA 4Z6KA 1F12A 1NBOA 2VQ3A 5ITWA 4Z3KA 2AQIA 3GDOA 4E31A 4LISA 2FMUA 1KC3A 5I7FA 1PQWA 3OF2A 4GX2A 1YBVA 4CUKA 1UXKA 3MJSA 2AW5A 4J4TA 3VH1A 3L4BA 1E7QA 5K9ZA 5MGBA 1D1SA 1TXGA 1HE3A 2EGHA 1BW9B 1I5RA 3PYXA 1MGOA 2HK7A 4U6QA 4BNNA 4CM4A 1JTVA 3UGKA 4FJ1A 3RFXA 1YVEI 3BHIA 4LK3A 4W6ZA 1DIRA 4PLHA 1IE3A 4BKRA 2WD8A 4IPTA 5COQA 4BMVA 1R12A 1U28A 1WW8A 2YW9A 4U0JA 4ZQBA 3BTOA 4IDGA 2ZB3A 4AJPA 2JD2A 4RLSA 2W98A 1QMGA 2GUGA 4R69A 3WNVA 1PL6A 1BGVA 5FWNA 1NASA 2JCVA 4M54A 1ENZA 5DBIA 1Y5RA 1U1IA 2H63A 1C0LA 5AXCA 3U5TA 4WLVA 4BKOA 4NJMA 2ILTA 3I9KA 4OL9A 4RL6A 4CUZA 1SCUA 1PSDA 4UREA 4LMRA 1N8KA 4E2WA 2NVUB 2F1KA 1NHGA 1ONOA 5AYVA 3DTYA 1SC6A 1H6CA 4TRNA 5ER9A 4YACA 4J9VA 4EUEA 1VPDA 4QECA 4B7CA 4EZBA 3VH3A 3DL2A 3GT0A 4BNTA 2BI8A 3UF0A 2FPIA 4RVDA 1JKIA 3MJ4A 1GFSA 1YQGA 2YY7A 4RPLA 2PGJA 3GVIA 1QSGA 4PZEA 2O4UX 4W9NA 1UP6A 4HKTA 1TVEA 1R4MA 1FXSA 4FSHA 1HLDA 3AY3A 2DBVO 2OHXA 4C7JA 1KVQA 1YBMA 1SNYA 3I23A 1XELA 3PJEA 4FFPA 4HUJA 4WUVA 1PJ2A 3A1NA 3LC7O 3E6AA 1Z74A 1QYWA 1CERA 3G1TA 3PQEA 3IJRA 5B4VA 2E82A 1AHHA 3NYWA 1FF9A 4F45A 1BRMA 3QIVA 4QQRA 2PH3A 3DZFA 1QR6A 3LK7A 1O0SA 3PIDA 4YJGA 1XU9A 4E5KA 5A9TA 1T26A 3CIFA 3INTA 3BMOA 1HDZA 2W2KB 5KVQA 2GLXA 4LVUA 3PIIA 4E30A 2DUWA 2P9GA 5IZCA 1TLTA 4YJHA 4B4VA 4EITA 2ZB8A 1K5HA 5CG2A 1T24A 5A3JA 3IS3A 2VWGA 1O5IA 2WM3A 1N9GB 4MVJI 3RJ9A 3VOSA 1C0PA 3OFSA 4ZICA 3PFFA 2FSSA 3SBOA 3DTTA 2YDXA 4IY1A 4CMAA 2R00A 3ICPA 3IUSA 2JAPA 2HMWA 2Q99A 4QXMA 3JQ9C 2YUTA 4KUGA 1TI7A 4K1LA 2D5AA 1KY5A 3OHSX 5EN4A 1PGQA 3BAZA 3IP3A 4U7WA 5EJ2A 5EESA 3LF1A 1B8UA 1QYVA 1Y8RB 3CMCO 3FN4A 1KOLA 1DJNA 5A3VA 1XU7A 2JFGA 5DCUA 4OXYA 4TVOA 4R01A 4NBRA 1FMCA 2NACA 4GSKA 2EW8A 5AOVA 4WKGA 1H6AA 3QP9A 4DRYA 1YDWA 3GRPA 4B4OA 4JBGA 4DXHA 1LC0A 3W8DA 2VTDA 1HYGA 3DOOA 4GBJA 4GKVA 4AJIA 5DOVA 4PG6A 5AVOA 2VHYA 3GVPA 3Q2KA 4ESOA 3AU8A 3AFNA 1DB3A 5I8ZA 3WQQA 4R16A 4AICA 1P1JA 3RSHA 4DMMA 1Y1PA 2D8AA 3GLQA 3NDRA 3UH1A 4ZQFA 4JX8A 4RVFA 1RJWA 2YQ5A 4BB5A 4WK6A 3F1LA 1R6DA 5COBA 3U3XA 1B2LA 4L74A 1ZXLA 3OJ0A 3GHYA 1IL0A 2P68A 3BMCB 3AU9A 4CM9D 1XIVA 1YL5A 1DEHA 1V3UA 2HDHA 4DLAA 3H5NA 1NQAO 2VHWA 1XDWA 1ORRA 3DXFA 3C8MA 4KUEA 3H2ZA 4CQLA 1EVZA 4KWIA 1X7DA 2DPGA 3DFZA 3ONEA 4NNJA 4UAGA 1L7EA 4N5NA 4HNGA 4PLFA 3VZQA 4CQMA 2Y1OA 1NWCA 3FNGA 4KWHA 3KXDA 1JKFA 5C7OO 3SC4A 2QHXA 3WWYA 4R41A 2O3UA 3TZKA 1P3DA 3WQSB 4FC7A 2NU8A 3B20A 3ZCXA 3TL2A 5A03A 2NLOA 4CV0A 4JROA 4PN3A 2X7HA 4BNVA 3JQ7A 2ZYGA 3A06A 3EK2A 4J2OA 4OQYA 4CLRA 4RPGA 4I08A 2QRJA 3LT4A 2P9CA 3MJTA 3OIFA 2QIOA 3MWDB 3PYLA 1PGOA 3KV3O 3G49A 4OGWA 1GCOA 5A9SA 4PIVA 5COAA 1NP3A 3QQPA 5B12A 3VKVA 3TOZA 4DPKA 3AUAA 3VZPA 4NJOA 1EDOA 3RVDA 1GZ3A 1R4NA 4Z3DA 4FOSA 1LEHA 4K9DA 1EUDA 2AG8A 1ZH8A 3QE3A 1N1GA 2DTDA 4G81A 3ENKA 4IJVA 4ZQEA 2AE1A 3GPDG 3ZV5A 3OETA 4AJOA 1I3NA 3LQFA 2QZZA 3KBOA 5F5NA 2OMEA 5LCXA 2VZ9A 3O8QB 4IIUA 1UDAA 2UDPA 5IFLA 1K6IA 1PWXA 3C1TA 2QG4A 4IZHA 1ONPA 1W6UA 5FI5A 4PCVA 1B15A 1LLCA 4RF5A 5JDCA 4AL4A 3BZUA 1V8BA 5MDHA 3DBHA 3QWHA 4PLCA 4QO8A 1YBAA 2QQ5A 5AXDA 2X0IA 5CAEA 3GF4A 1ZXBA 1GQ2A 3K2BA 4ZGWA 1D4FA 2O50A 1H9BA 2AQKA 4N7RA 3DOCA 5AXAA 4NK5A 4ALIA 2OGUA 4FJ2A 1J5PA 4Q39A 1DFIA 4BB6A 4YBZA 1AGNA 3PQFA 1JAYA 2O3QA 2ZTLA 2Q1WA 1IYZA 4FB5A 1PJBA 1KEVA 3PHHA 5JCXA 1WMBA 1QV7A 3NT4A 4KQXA 3WGGA 3SEFA 5CPBA 1NWHA 1HYEA 1C1XA 5JXWA 4OIMA 3UICA 2B5VA 3I9OA 3MZ0A 4LCEA 3PWZA 3PTZA 4G65A 3JCZA 4OQZA 3RUEA 3FNFA 2NU6A 1ZK1A 2TMGA 1U4SA 4CMCA 1AN9A 2BGKA 1KY4A 3JQFC 1KBZA 4ROSA 5DF1A 3MWEB 3PPIA 5HS6A 2PK3A 2O3TA 1X0XA 3S2EA 4GWKA 2Y1CA 2W2LD 2UV8A 4TSKA 4BNJA 3VZRA 2VRCD 4II2A 5I9NA 5L7WA 4YVFA 1TEHA 4FFOA 5F5LA 1NX6A 2O3RA 2AMFA 2GASA 4L9RA 1MLDA 2WYWA 3K9QO 4Q3AA 3EHEA 5FEUA 3H9UA 4PG7A 2DAPA 2FHSA 1G6KA 4RV9A 3TPCA 1ADCA 5H82A 5TJ9A 1GV1A 5JDIC 3GGGA 3OIDA 3ZWXA 1EQ2A 2GZ2A 3DWFA 3FR8A 4E2YA 1BXGA 1QYDA 3MOIA 2GPTA 3VDQA 3AUUA 3C1AA 5JAMA 1AXEA 1QLHA 2PGLA 5DCYA 4CMIA 3EUWA 1NFRA 3KYDA 3ZHYA 1UZLA 3ZU3A 3DBLA 2B35A 1D1TA 3GNTA 2YQ4A 2FY8A 3AI1A 4HFRA 4EW6A 1YOVA 3BMNA 3ONDA 5L3ZA 1I24A 5JNLA 1F06A 5BNIA 5KJ1A 4A27A 4KQWA 4XYEA 4PVDA 3U49A 1I36A 5A1TA 5DULA 1YONA 3MJEA 3PLRA 1BVUA 1HDXA 4MP8A 3QJ5A 1XHLA 2I5PO 5EIOA 4CM7A 3U9LA 3K73O 4D0RA 1LRKA 1Q0HA 1I30A 1IOLA 2PV7A 3RI3A 3T7CA 2AXQA 1LDNA 1KEWA 3BTSA 1NPYA 4GI2A 1Z7EA 3WBBA 3WFIA 4BO7A 2Q50A 4IS3A 1GUZA 4RF2A 2GSDA 3IL2A 4WLFA 3GZ4A 1AUPA 4AJEA 3ZH2A 4PRLA 1T4BA 1PTJA 5L95A 2UUPA 4IDDA 5JW6A 4NR0A 4GMFA 4L4XA 3F46A 2P5UA 1DFHA 4IJWA 4LMPA 1DSSG 3PZBA 1MA0A 2J5KA 1LDBA 4DIOA 1H94A 4RPHA 2NU7A 4RLHA 3X2EA 4YQYA 1A9ZA 6LDHA 1EDZA 2X8LA 3AOEC 3QHAA 2GDZA 2EGGA 4Y98A 4RZHA 5L40A 4M1QA 1BDBA 1VL8A 4IMPA 3T7EA 1N1EA 2JCXA 4BS9A 4MINA 3ZWVA 1E5LA 3L6OO 2GGSA 4O59O 4B3HA 3I9JA 2B5WA 4HBGA 4L4RA 4IUYA 3V1UA 1L7DA 3GVHA 3JQFA 3TL3A 4GX0A 1P74A 3ANLA 3ZWYA 5U4QA 4RGBA 1ARZA 4ND5A 3VPHA 4P4NA 4L8VA 4M87A 3JD3A 4XYGA 1EVIA 1VM6A 1WAMA 1V9LA 4ZRMA 3UN1A 2OO5A 2CSUA 3GEDA 1MX3A 1SB8A 3CE6A 1DRVA 1VL0A 1VL6A 4D45A 3TZ6A 1BG6A 4K6FA 4D43A 4BO6A 1GYRA 2HLPA 1SEPA 2O7SA 2P4QA 4FDAA 4HV4A 2LDBA 2WWRA 2AEJA 4INAA 1TA4A 4R1TA 4UUNA 1JLLA 3ZGYA 4DA9A 5CEJA 1PJQA 5TNXA 2QX7A 2Z95A 2X5JO 5EERA 4RPJA 1H9AA 2I6TA 3HUDA 3ZNQA 4XYLA 3DR3A 3AY7A 2I76A 1IULA 3KLMX 1GR0A 4FFNA 1Y9EA 3JD4A 4J91A 3HADA 3CEAA 3W4IA 2IYOA 1M6WA 2WEKA 4HY3A 4ID9A 2J6IA 3MTGA 3OIGA 5G0UA 4I5GA 3VPXA 1A27A 1DC4A 3OP4A 4BNXA 2I99A 2FSVA 4NIMA 1QV6A 4EJMA 1ENOA 4YJFB 3JQBC 3EVTA 4BNLA 4CM8A 2YHIA 2YJZA 1PS8A 3QWIA 3FBTA 5ICMA 4CPDA 1W4ZA 2Y66A 4CR8A 2IEDA 3AM3A 1CEQA 3DZGA 3UVEA 4DLLA 1HYHA 5HA5A 1WDMA 2DBRA 3JQAD 1H6DA 2ZQYA 4AJHA 1LC3A 3MCVA 4PZCA 2I65A 3AK4A 4I9UA 2BGLA 3LC1O 5JAZA 4Y6PA 4B3IA 5G0SA 3WSWA 1HEUA 3P2OA 4BV8A 5A4DA 4QTZA 4RDIA 1PGNA 4OHUA 5BSFA 5BNTA 5KJ6A 2PZJA 2DC1A 3BHJA 1QYCA 4IDCA 4HADA 4D7AA 5IXYA 1WNTA 4E5PA 3W8FA 2W4QA 1PJCA 3F9IA 3HHPA 4AJLA 2O2YA 2Z1NA 3W1VA 3ZV3A 2RAFA 3KYBA 4FIZA 4GVLA 3LF2A 5CHEA 1WMAA 1UXJA 2EF1A 1VRWA 2Q49A 2O3JA 3ROKA 2ZYAA 5BT9A 3LC2O 3GQVA 1O95A 1T4DA 5FI3A 1CJCA 5CDSA 4N5LA 1KS9A 2VWHA 5DP2A 4ITUA 1NFQA 3NT5A 1F0YA 3AOEA 4TQGA 4E2ZA 1OC4A 4MP6A 2PGDA 4DVJA 3JTMA 3TZCA 4J7XA 4E5NA 5A06A 4WJZA 3RUDA 3WSVA 3FRJA 3G1UA 4QFDA 5CFZA 3N7UA 3JD2A 3OMLA 3EZLA 4ZHSA 2FPGA 2O48X 2PZMA 2ZB4A 3MTJA 1BW9A 1GPJA 1E7RA 2VWPA 4FOOA 3S1LA 1MFPA 3B1JA 4BNIA 1YB4A 1EUCA 1MG5A 1E3WB 4XQEA 3AWDA 4HWKA 3RU9A 4RQTA 3RKRA 2X1HA 4NZ9A 3A9WA 3FHLA 5KKCA 1J49A 1CETA 3U09A 4J1NA 5DT9A 2GN8A 3DZHA 5T57A 2BRUA 1ADFA 3WYBA 1HDOA 2NVBA 3DZIA 2VZ8A 3O4RA 4IXWA 3RUHA 1R66A 4OSPA 9LDTA 2VYNA 2DBQA 3AOGA 2WSBA 4BIIA 4CUJA 5KJCA 4UVGA 4W4TA 2PD3A 3IDSA 5EMHA 4FN4A 3D3WA 3KLPX 1DIBA 2BELA 5HBRA 2Q2WA 4ALNA 2E49A 2A4KA 5IF3A 3WS7A 2IZZA 5KTKA 1GZ4A 4I1IA 4KTTE 1T2EA 4NHEA 2ZQZA 2R00C 3GMSA 4XIJA 3ZV6A 1U3UA 4NH4A 2C5AA 2NVUA 4UEJA 1Z82A 2DLDA 4ZVVA 3U62A 4YYZA 3ON5A 1JDJA 2AQ8A 4QX6A 1PJ3A 2CNBA 4BNUA 3ST7A 5K6AA 4H15A 4E3ZA 1MP0A 4J7CA 4YRBA 2VZ0A 4BGEA 4TVBA 3NGLA 2EWMA 3GGPA 3TFOA 5JCJD 4YCAA 4OAQA 4W7HA 3PDUA 5GZ3A 2JKVA 4XWYA 3C1OA 1KVRA 3RIHA 2J3HA 4GSLA 2WYUA 1MUUA 3WMXA 3JQBA 4IIVA 4OO3A 5CG1A 5L9AA 2FN7A 4YPOA 3WFJA 2OBYA 1ZW1A 2AG5A 3UOGA 1RYEA 4S1VA 2YDYA 1XKQA 1ISIA 1NNUA 1E3LA 4ZQHA 4FFMA 2NSDA 4R1NA 4WE3A 3OICA 2GERA 5TC4A 3EVNA 3BTUA 4ZN6A 3FTNA 3BYZA 1CWUA 4W82A 2EKPA 2Q46A 4J90A 1KC1A 4IDAA 1BXKA 3S2IA 3BMQB 3L9XA 3EZYA 1QKIA 2NM0A 3CTMA 3OJEA 3Q3CA 3DAFA 4P8RA 1VKNA 4IGEA 5T5QA 4MVJP 4DYDA 2NTVA 2W2KA 3FR7A 2Q1SA 4D3SA 3I5MA 5DCWA 4W7IA 4BO3A 2RH8A 1DIGA 1HL3A 2W90A 1JN0A 2J3JA 3JYQA 3PK0A 3HB4X 3P7MA 1OOEA 2HUNA 4XZ3A 1DO8A 4R68A 3LU1A 2VOEA 3PDJA 1NPTO 1A7KA 2CMDA 5KVCA 4Z9XA 2Y0DA 2Y1DA 2CF6A 3ASUA 1ZNQO 1Q7GA 1RM0A 2DM6A 3GEMA 3E48A 2J5RA 4EUHA 3KSUA 4XB1A 4DQUA 3DHEA 1UDCA 1Y8QB 3R6DA 4R1SA 1I32A 3ZI0A 2ZK7A 2DQ4A 5GMOA 2B36A 4CLOB 1TT5B 1VKOA 3GZNB 1GUFA 3AM5A 3JD1A 2X23A 1FDSA 4IGFA 4MIEA 4H7PA 1Y8RA 2B0JA 3QRWA 3ZZNA 2P4HX 2VUUA 1MFZA 1E1LA 1KVTA 1MV8A 5IDXA 1I8TA 3ETDA 4E5MA 4P22A 5ITVA 1HE2A 2JCYA 2FR1A 3HQ4O 4BNFA 4NMHA 3WGQA 2POQX 4KMSA 1B0AA 1Q0QA 4E12A 4R5MA 4CLHA 1B26A 4GPD1 4NQZA 5DBFA 2RCYA 1IHXA 4LSMA 2HMVA 1Q7BA 3TQHA 3NTOA 3WJAA 2FR8A 4AJ4A 2EIHA 3ZDFA 1C1DB 5U9CA 1Z45A 3RBZA 4BKUA 2PKQP 5KNLA 2C59A 1X0VA 1UXIA 3IC5A 4XR4A 1ENYA 3FSRA 1PL7A 1U4OA 3F5SA 1R0KA 2GRAA 2A94A 3LLVA 3M6IA 1DFGA 3BTVA 5JYEA 2D1YA 3DHYA 1HXHA 4M89A 3V2GA 1HE4A 4WPGA 4XYMA 3GG2A 3V8BA 1CDOA 3GUCA 1KETA 1N2SA 2BFOA 3BMCA 5JDCC 3RC9A 1SPXA 4B8WA 3GFGA 4LGVA 4WLUA 4DMLA 3MOGA 2CD9A 4BV9A 5G0TA 5JLAA 5I9LA 1UUFA 3JQEA 4QUKA 5DDIP 5ENDA 3VDRA 4JCOA 4WNCA 2B37A 1ZJYA 2Y67A 2Q45A 1LDYA 4PRKA 2G0TA 5DOZA 4OYRA 3R3JA 1EMDA 3OA2A 4ND1A 1HSOA 4XGIA 3ENNA 4CMGA 2A9FA 3LZ6A 1LNQA 4TKMA 3WGZA 4WOJA 4PG5A 4RVUA 2DVMA 3WXBA 1BMDA 1YDEA 3RFTA 3D5TA 2QRKA 3QWFA 3MEQA 4UVIA 1X13A 1ZJZA 5JYDA 1WZIA 3F6YA 3PHLA 3PJGA 4K28A 5BQFA 3GG9A 2JFFA 4J2HA 4R51A 3ROPA 2PFGA 5IN4A 1GUYA 2HU2A 4UULA 2VUSA 1B3BA 4N54A 1LQUA 4Y8VA 3DOJA 4DC0A 1P33A 1YGYA 4A5OA 4K26A 4NFYA 2IZ1A 2C2YA 2G5CA 1ZZEA 4HXYA 5EL0A 2Q1TA 4YB8A 3WLEA 4YT4A 2BI7A 4YXFA 5FF9A 3NV9A 4FW8A 4B79A 1KYQA 3ORFA 1XEAA 3O8QA 4P4GA 5L7YA 5L4LA 5TF4A 4GH5A 2CY0A 3PJFA 4TKLA 1IPEA 5T67A 4FGWA 5IG2A 2C07A 2VYVA 4XIYA 4M86A 4FR5A 1N7HA 3O38A 4JGBA 4R9SA 4RQUA 5L51A 1EEHA 1PGJA 5GY7A 3H9EO 4UUMA 4HFJA 1ZBQA 4DIFA 1LRJA 5DZSA 1PZEA 4BVAA 1N5DA 1XQ6A 3RFVA 2CF5A 3K31A 4OMUA 4RVSA 5F21A 2Y05A 5HWSA 4ZU3A 2JD0A 2UAGA 5DNAA 5L53A 1I2BA 3HN7A 4J4BA 1OZAA 3TNLA 3PLNA 4MP3A 4IINA 4MVJA 2YV1A 5JY1A 3JQAB 3UXYA 1H5QA 4HFMA 4JIGA 2C29D 1HLPA 5CDYA 2UYYA 1NXQA 1W73A 3OQ6A 3TJRA 3WMWA 3M1AA 3PQDA 1J4AA 5ILGA 1EK5A 2IYPA 3EMKA 3E18A 4CMEC 1I0ZA 5KJEA 4YR9A 3CSDA 4FJ0A 4Q3EA 2WTBA 4R5HA 2VT2A 4WEQA 2GN9A 3I9MA 1GD1O 3A28A 3SLKA 3DB2A 4LCJA 1P9LA 2AEFA 2OOSA 3NJ8A 3U4IA 4IZIA 4GWGA 1E6UA 5TS3A 4G2NA 2ZTVA 1GTMA 1DIHA 1PWZA 4NBWA 5U1PA 1HWYA 4PG4A 1DAPA 2JHGA 5EINA 4OSOA 4R3NA 4WEOA 1P77A 1IHYA 4WCFB 3LVFO 1ZUD1 2EKLA 3KSZO 5LDGA 1JWBB 2DFVA 3ANMA 5IZ4A 4OH1A 3LSYA 3I9LA 4LRTB 1JU9A 3V2UA 4MVJF 4CQLB 3PYMA 4XDZA 2PKRA 1J0XO 4Z0TA 4W99A 4AJKA 2HMTA 1W8DA 2QYSA 5IN5A 4CQMB 4JP3A 1EUZA 1E7SA 1H2HA 1NTOA 1E1KA 3OSUA 2Q2QA 4ONEA 3E9QA 7MDHA 4Y6SA 3OH8A 3JYPA 5F1PA 1NAIA 1DC5A 5TRTA 4IDBA 3R0IA 4KZPA 3U4HA 1GAEO 1XWFA 1E5QA 2YFQA 3DMTA 3EY4A 3IKTA 1JKJA 4RDHA 4YJDA 1ULUA 4CLRB 2PZLA 1CF2O 2ZCUA 5TIIA 4IMRA 4R54A 1I3LA 3K30A 3N58A 3D7LA 4NPCA 3OQ1A 1E3IA 1P45A 6ADHA 1U3VA 1GYPA 5THKA 5JAIA 2XF8A 3RQSA 1MG0A 3IAHA 1T1RA 4Q3DA 4YAJA 4GAEA 4B7XA 3CKYA 3IMFA 2HMUA 2DTXA 2NU9A 1R16A 3TN7A 2Y68A 2G17A 3H4VA 3NJ4A 4L0QA 3UCEA 1GEEA 1NR1A 3G17A 4ND4A 1GQQA 3ZWWA 1H2BA 1E7WA 1U8XX 1LI4A 3K5PA 4L4SA 4XRGA 3IOYA 3V2HA 1ISMA 1HDGO 3A14A 4XDYA 4QO7A 2CVOA 2FOIA
chains in the Genus database with same CATH superfamily
3RVNA 4TZTA 2IZ6A 3E4CA 1P44A 1TJNA 4XX1A 1U2RA 2FHPA 2H4HA 2V8OA 3CUKA 1CHDA 3KQTA 5JARA 5AFSA 2I6QA 3KOOA 3W6UA 2OV3A 2QVBA 3EVFA 5FBLB 3U4CA 4Q24A 4BVGA 1DEOA 4H1TA 3RSSA 1H0KA 5DBHX 3PRJA 1DWOA 3PEUA 1RYMA 5REQA 1Z18A 2OXTA 2YWBA 4JLJA 2E4YA 1XZGA 2F8SA 3ASVA 3HDYA 1W9MA 2BFEB 2O6LA 4ND6A 3UTCA 4ALKA 2RC6A 2QXTA 5LQJA 5ITZB 1CIJA 5EMJA 1X80B 1BEUB 2IPAB 6PFKA 1YIOA 1PJ4A 2ECFA 3VPGA 4TYYA 5A5VA 1UXGA 3LUBA 5DTEA 4ZI7A 3OPNA 2A8YA 4RPKA 3J7AC 3EZXA 1E7YA 1WLYA 4X8HA 3WHIA 3OFNA 3TQRA 1X7ZA 3WWDA 5HIKA 3JQPA 4J16C 3PTAA 1NURA 5CT8A 3CEHA 1Q1AA 3JQCA 2NQ2C 3W2HA 1OI3A 4KKVA 1T25A 1R0WA 1RZ3A 1VG1A 1RRPA 1G3QA 3D43A 3GRZA 3I5XA 3GIDA 3HL4A 2DJIA 3G7NA 3H2SA 3V4ZA 1FP6A 3U6BA 3I8XA 3PL1A 4G63A 3X1DA 1NVAA 3W4JA 4ZCMA 1U0BB 3VDNB 2NIPA 4TLDA 3STHA 2VP6A 4TTJA 4IJ5A 1MRZA 2NUAB 1UJCA 1A9XA 1KI3A 3D1LA 4M1EA 3RROA 4JLWA 2HV9A 4FC6A 1ZFNA 3MIZA 4N9QA 5SICE 2XDQA 1RBYA 3MOSA 1RSZA 2O7QA 2PY6A 4FD2A 4RMGA 4BLVA 4ZEXA 4MDYA 1B8NA 2JL1A 1X1TA 2ZAYA 1TLFA 2AGVA 3NHWA 3M4JA 3PENA 3P9SA 1YB1A 1NJ5A 5LBUA 1DINA 2GCEA 4U2FA 3LHKA 4M8IA 3WWZA 4I55B 1TCUA 3VC1A 3KUCA 3C7DB 1AK2A 3OOHA 4MJXA 3RC1A 2BV3A 1HKUA 4CXMA 1CZHA 4TWRA 3VSAA 3WO1A 1JEAA 3FPKA 1T3ZA 3MELA 3PX2A 1IXRC 2AVNA 3R9IA 5CB8A 4AJ2A 5BSGA 1H8ED 1E32A 1MF7A 1UWCA 3HY4A 1R9GA 3ROQA 4MTCA 1ML3A 2I2CA 3WDLA 3BSYA 3RNLA 1DRKA 1CS4C 1U2GA 1XEWX 3A10A 3LUFA 4UNNA 2W6IA 1ORVA 3SZMA 3L1VA 2P8JA 2G0NA 3N5KA 3R40A 2Y2UA 3AG5A 4NK4A 4EGAA 3FWNA 2VHVA 2PAAA 1JV2B 1SOWA 1BXZA 2YMPA 4YP9A 3ETEA 4TS4A 3SYRA 1FFXA 2Z09A 3MGAA 1WQ4A 1B16A 1X74A 2YZ7A 1X92A 3L9WA 1CBUA 1XZFA 4INOA 3PCTA 3UA3A 5M34A 4Z5XA 4M8KA 4RTJA 4X85A 4M1ZA 1LUAA 5CDFA 1H8HA 2JAHA 2ZRNA 2GLTA 4M9RA 2VXCA 3D2BA 5L4NA 2D0IA 1ILWA 1CUZA 3NC4A 4AIIA 4PM4A 2PZFA 2IIPA 2QJFA 3MTAA 3ZDEA 4ND3A 3U1TA 5JASA 4K3UA 2RI1A 3WNQA 4C4RA 4UXHA 3D4LA 1SC3A 2ODAA 4M83A 2O0JA 1U3WA 5CT6A 1EWVA 4G9EA 3ZWAA 4EYQA 1B2RA 3PUKA 4RA6B 5JPIA 4DC1A 4FFVA 1YAJA 3EDCA 4TMVA 4UJ5A 3QGMA 2CDBA 3STYA 5BYAA 3SVLA 2GLUA 5EZYF 4FE3A 1UWVA 3HKCA 1EHYA 2VF7A 3I05A 1T13A 4H7EA 2CNNA 1JJVA 3JQGA 3GLGB 3ZVLA 3QU5A 5FWAA 3GPIA 1KK2A 1UZMA 4YEDA 2BFBA 4F5EA 4NOLA 4LE0A 1W9HA 1R0YA 2GN6A 3TCXB 5F12A 5KSYA 3IAS6 2HQ1A 5KINB 4RJTA 3HH8A 4ZO6A 1EX9A 4V2UA 4DGSA 1IXZA 4Z99A 1R6XA 1SB9A 4RIGA 5J1TB 1YS6A 5BT8A 3L8CA 1C9NA 1Q95A 4OGKA 1GITA 1OUMA 3IDAA 2YWCA 3KYCA 2ZSFA 3QNUA 4Q9DA 4X3PA 2P30A 1GQRA 2IU4A 4XJTA 4I6GA 4KOEC 4KMMA 3ZWBA 4EVSA 4RHUA 1FLNA 1NIJA 1YRLA 4IZOA 5PGMA 3CNQS 3ZUPA 2A78A 3IJPA 4RFVA 1ZNZA 6REQB 2C8LA 3PQ3A 5AVZA 4CQNA 2UXCB 4L8LA 2DSTA 3OF3A 3AP3A 2NZ8A 2EKQA 1YE3A 5BUCA 1RJEA 3HWSA 4AKEA 3LP5A 3AHCA 4ZP1A 8MHTA 1EZ4A 3PQ4A 4KVGA 3SXUA 1XCBA 1ZU4A 2WZDA 1H05A 1C0IA 3JZAA 2ZUFA 3PI7A 1HE1C 3DO5A 2NP6A 1J0DA 4NH0A 1KFCB 5JNRA 3CQ9A 3L4KA 2IX9A 2QI9C 1PZFA 1L7QA 3I9V1 4PLPA 1AKNA 1MTOA 1PR9A 1P2VA 5KU1A 5L3VA 3IVMA 4V0NA 2AYXA 1E3WA 1HDYA 3B7PA 4A73A 4KL8S 5JMOA 3EZFA 3QF4B 3P0HA 3DDSA 4QATA 1QLJA 4QSMA 3RSFA 1A1SA 2YWHA 1DKLA 1OGYA 4B3JA 4N40A 2NZWA 5J2UF 2VHUA 1OXSC 1E9FA 1UZUA 4FS3A 5B53A 4AUMA 2QN8A 1L4LA 2BEVA 2IODA 4G24A 3L77A 1AUVA 1DBPA 4TV9B 3UW3A 5A3RA 4MVJG 4GU5A 2RGUA 4X44A 1L6IA 3LT5A 1OB5A 1KRHA 5DM60 3PPXA 4WJKB 2YIMA 4CR7A 4LF7B 2VTVA 1S8FA 2XRFA 1OXBB 2D13A 4FFRA 1BE8A 2WKWA 3RIGA 3U39A 1EDBA 2DY0A 1A9OA 4RANA 1C1HA 4WFKA 1FMFA 3EF3A 2C9OA 4FWBA 4CTOA 3C85A 3RSCA 1VMDA 2JFPA 1VCHA 3GU3A 1GAWA 3RIXA 1QO0D 6NULA 3BWEA 5BQOA 5HQ3B 3D9QX 1U6JA 1F17A 1J2JA 2Z8YM 4BPRA 2WJ3A 5B2ZA 3C4QA 3MWGA 1GN8A 2C78A 2E3JA 4FYPA 1YTLA 2C9CA 1HM5A 4PBSA 2COEA 3HSSA 1I3OA 1LDMA 4GRAA 1VE9A 2X2FA 5J1SB 4Q3CA 2HMSA 4FZVA 5LZ4A 3PCRB 4HZGA 3SYKA 3B9PA 2PX0A 1FYFA 1F8YA 3EYWA 5FBZA 1XDZA 1GIAA 2GJAA 2OG2A 2R1TB 4Q6WA 3CU5A 4DJ5X 4RTNA 1R8XA 4B7UA 2HJGA 2JATA 3ORRA 3TSOA 3HDJA 4EG4A 1A77A 3NXSA 3X1WA 4HP8A 1IAVA 1A4UA 5DVZA 1PSWA 1W46A 2BN4A 4X84A 3VVLA 4MA0A 4CCYB 2OHIA 4EDFA 2WW8A 4D8WA 2Z6AA 4EARA 3PXAA 3QVLA 4LHEA 3TQTA 2A9RA 4HJXA 4KDCA 4M88A 3LBNA 2YHIB 2YYYA 4WXEA 2I3DA 2VK1A 2G3YA 3AKYA 4ZXFA 1D2AA 1U2SA 4OGGA 3CZRA 1VPVA 3MGBA 4H35A 5TF0A 3OJWA 5C5IA 4ZCQA 8LDHA 4AJNA 2HXYA 1XKLA 4ZOCA 5CH8A 3T7TA 3NAQA 1U11A 1TNDA 3BBPA 3OTIA 3IP6A 4HYYA 3F7TA 4I9HA 2F8TA 4G8JA 4J7UA 3DLPX 1VSUA 2W2LA 4Y6LA 1X9HA 3BMQA 3I52A 4NYJQ 4GDMA 5HRAA 4AYXA 1R0BA 4ISCA 5IAOA 4NCBA 1W2HA 5H81A 3PS9A 4O4JB 3RJTA 2P2SA 5A62A 1P1RA 1V9CA 5KOHB 2UU9B 3DBRB 3UJCA 4KPUB 2WJ6A 2C0CA 2GBPA 1RYDA 2QUHA 4NEHB 1N9KA 1YS1X 4KXWA 4DY4A 3N0VA 2JFYA 1N2HA 3RHZA 1NKVA 4ZYWA 2GTIA 2QTZA 3CNBA 1CRLA 3C0KA 2WF9A 3MB5A 2D1QA 4RCVA 1DRJA 4IKPA 2Q8PA 2Z5LA 3WIBA 2H8GA 1P73A 4DCVA 1E4EA 1W76A 3L18A 5CP8A 4J3NA 4MW1A 1ZU5A 2PBFA 2XTZA 4J76A 1TKRA 1S2GA 5T8KA 2XHZA 1BN6A 1UFVA 4LNUA 1NXPA 4BVHA 1HA3A 1E59A 1WLSA 2R62A 4XM1A 4D9BA 3NO4A 1ND5A 3LWBA 3D8TA 3N2GA 1YF3A 5HP4A 2XZOA 4XGKA 3T9BA 2ATEA 4QRIA 3VO2A 4D42A 2BFFB 1KJ9A 4B9EA 2HJVA 4IICA 2XTNA 4XDHA 2VAMA 3ABRB 3ZWDA 1BHSA 3QW2A 5P8WA 4NG5A 1TT5A 2J59A 2F1JA 4UBJA 2NTNA 1SAYA 3OO0A 4F5YA 4WA7A 4K03A 2MSWA 5EKDA 4RW0A 4ZJZA 1LBEA 4RVNA 3RSLA 4EY4A 5FHQA 1IY8A 1S3GA 5JSFA 4WGGA 4OYYA 2WWIA 4N0PA 3ROZA 3QBDA 3OM9A 1N92A 4PO9A 4G5XA 1EVJA 1V43A 1XDGA 2I2AA 4TLEA 4G23A 3GRYA 3QU4A 4PQYA 3ZJYA 2WYIA 1Y6ZA 4R8KA 4RK5A 5LA6B 2RGYA 1OV4A 3H5RA 3VR0A 5LIPA 4LF5B 3GRKA 4TWJA 3KEOA 1EQAA 4WY5A 3KX2A 3COSA 2HT6A 3WIEA 5B2EA 1DDOA 2Y1WA 3QVKA 4B71A 1Y9AA 5C4MA 1DUIA 2CYAA 2I67A 1S2IA 1M1NB 3PI6A 4L9SA 4OP1A 2RKOA 1FTWA 4LPSA 3UMCA 5KYYA 4ON9A 3ICWA 1DTEA 1NVDA 4X1KA 2X9GA 1C8KA 3GA7A 4X8LA 3D3WB 2VNSA 3F1KA 4O4IF 2I9PA 3TFQA 3WL3A 1SOMA 2V6JA 1R9MA 4YV7A 3NBAA 1KI4A 1XZEA 2EF0A 3QKTA 1N0WA 2EHDA 4LVCA 4N8DA 3DKPA 2LV8A 5IWAB 3OHPA 2BTEA 4XLLA 2IX3A 1EAMA 3S8MA 1AVTA 1UBNA 5BURA 4BP3A 3PGVA 2P67A 2ZGVA 4D3FA 2P2ZA 3AEXA 4PV7A 2DG2A 1AK9A 1Q0LA 3UO8B 4A9AA 1BTOA 2I6SA 2ZJ5A 4F84A 3GCZA 4J0KA 1JLMA 4UHEA 3IIKA 3RC7A 4OOEA 1ZVKA 2H29A 3V7YA 3ENZA 1XMXA 4OD0A 5EXDA 2H1RA 4EX7A 1YI1A 3IUPA 3WLRA 1MPXA 4TS1A 1W87A 1N7GA 1NVEA 1BX3A 3GDGA 4OBXA 4EKGA 2HR1A 3ZE6A 3M3PA 1VI6A 1TMKA 2OUIA 3CVJA 3B78A 1E2JA 3TK1A 5LQRA 3D2LA 4WCFC 3LRXA 1OLXB 3A6ZA 4CM4B 3TWOA 5FOVA 6GPBA 1O8CA 2WP0A 1LI5A 4QG7A 2Q0SA 3L8YA 3NVDA 4TN1A 4XVHA 1FRZA 3RLIA 3WOHA 3WTCA 4HDSB 2PM8A 1G21B 4L5JA 2X0FA 2DBZA 3SC6A 1GKLA 3PEEA 2K7ZA 4DEYA 1QIHA 3LECA 1XJQA 4LYHA 3FUVA 3KKMA 3PZRA 1A5SB 2P41A 5B3AA 1BQEA 1TM7E 1T1GA 1IXSB 2MYNA 2C95A 3DYIA 2WNSA 1GUAA 1OZGA 3ANNA 1IY1A 2CBGA 2XB8A 3BCUA 4D4KA 2XJ9A 4RXUA 5DKFA 2JBAB 3H4MA 3BWCA 2VP4A 3EGXB 2W8BA 5AHKA 5AK5A 5DM1A 1E9BA 4QZVA 2ZRKA 2NPOA 1RPZA 4QDZA 3O1JC 4J1TA 5CGQB 4RSHA 2Q3EA 2IP1A 4IIJF 1Z4PX 2EG9A 2BHRA 3F5QA 4D46A 2ASVA 2WSIA 5BYBA 2V1UA 1FDTA 2ADMA 3QKIA 5B6IA 1RQXA 3RVQA 1PS0A 3M83A 4KQ9A 1LJUA 5EIBC 2XXAA 4C4SA 2NADA 2E48A 1AE1A 4XD7D 3AFMA 2GRUA 2LWIA 3K6KA 4C4XA 4CKWB 1E0JA 2R8RA 3LUGA 4H3SA 2F17A 4FEAA 2DWCA 3HCEA 3ZZTA 1XNQB 2FJPA 3P2YA 2DCMA 2GF0A 2QG6A 5HUJA 5JCOC 1S3SA 2BCGY 1ZVQA 2CYCA 4D3DA 1W96A 1ZNWA 1HBJA 1Z26A 2AC7A 3SLRA 5JQWA 2Q6LA 4UNSA 2ISQA 1F5SA 3PSHA 4IQGA 1SOUA 3BCRA 4UCQA 4JN6B 2XYVA 4ZAYA 2OCDA 2JFNA 2XQKA 5BQ5A 5P21A 5ALVA 4LGCA 5KUTA 3CH6A 1A96A 3PX7A 2HRZA 3PT9A 1M0SA 4KMOA 3MMZA 2I71A 1X3LA 2JLBA 1R4MB 1EPUA 1OLUB 1VSBA 3FCOA 3F7MA 4NU6A 1OXXK 3ENWA 1RLTA 1IZ0A 4X0EA 3I8SA 2QKYA 1WUTA 1XYGA 2QZ4A 2RG7A 2YXLA 3ILXA 2HQBA 4MKIA 1EBUA 3ZY2A 2B25A 3GQBA 4C7XA 2EWWA 3CT4A 4A2QA 1U80A 2C4UA 1PG0A 2PNJA 3TAXA 1NOKA 1S2LA 1K89A 1V16B 2GCGA 1KE2A 3UXHA 4C7OB 2H06A 1VBFA 1JILA 4MO9A 3CZMA 4YJGB 2IZ0A 4MV0A 3DBVO 3SS7X 2PWAA 2H4XA 2Q5EA 1SUWA 4O08A 1R27A 3IKVA 3NWJA 1T3SA 4ICIA 3OHMA 2OHGA 1N5KA 4HDKA 4PC6A 4C6TA 5LUAA 4X1OA 1EQUA 4DA7A 1W49A 3OUUA 2PIAA 4G2TA 1YZYA 3O4JA 4L7QA 4EO9A 5IVHA 2AN3A 3EB9A 3KM0A 1V6AA 3ETGA 1Z6ZA 2I9KA 1TPZA 2CJYA 2YRWA 4RO0A 5EP4A 2PGAA 2QE7D 4CM1A 4EENA 5J2TB 3EDMA 3KIPA 1YR3A 1ISSA 4NBTA 4QYMA 2YWGA 3NDJA 4O0MA 1YQDA 1ZD2P 4UTOA 3WYCA 1PGPA 1LSUA 4J43A 3W79A 1GRVA 1N2JA 1MHTA 4E32A 5I4KA 1L4FA 5FUMA 1U8AA 4KDFA 5AVRA 1NBEA 1JFRA 2FE4A 1EE9A 4B32A 2BW0A 1Z7YA 2P7IA 1GCUA 4CKYA 5AJZA 2VR1A 1L4UA 1RKXA 2EZUA 1HG0A 4IH1A 4ZODA 1OI2A 2GS9A 1EH5A 2JLQA 1BS1A 3OLXA 2C2GA 4X94A 2CLMB 4MCAA 4OYLA 4EZEA 1Z0SA 3M49A 5C1BA 2F8MA 4FVTA 4GI1A 4LNAA 1CZLA 3UCXA 2VYQA 2JRCA 5FBKA 5HBGA 4JI6B 4EY8A 4Y9RA 4CEJA 2HSDA 2IUYA 1LTHR 2ZVJA 3E9CA 3LZDA 1HZZA 2JJYA 3Q85A 4MGEA 4UHFA 3RQIA 2GEUA 2P65A 2GTPA 4GM1A 1O87A 2WZQA 3EJ6A 1IZ9A 2NW6A 5BWNA 4MDEA 4K6KA 1SUEA 1M3SA 4OFZA 2XDYA 3IEKA 5DWDA 4P4TA 3HKEA 3X2FA 1DEAA 4GKKB 1XRJA 1TIPA 4Z51A 1G6HA 1NDUA 1Y33E 2LNDA 4KOAA 3OT1A 3GWGA 5IJZA 1ZICA 3HR8A 3DDHA 1VMEA 1XCOA 1PR4A 1FUYB 2IUSA 4UXJA 4UW9A 2B1GA 1JGTA 2HIMA 5CURA 1D2MA 4JK3A 3DEFA 3NBUA 3QKRB 5KO2A 2IBSA 1ZGCA 2YVKA 3ZNOA 5B4TA 5DYGA 5KNDA 4KLAA 5F52A 5LB4A 1E66A 1A9QA 3KR2A 2PMBA 5EP2A 3W2EA 2DHDA 3GLFB 5FOWA 5C34B 3I6MA 4FZ5A 3I1IA 4Q02A 1NFFA 2X5OA 3G5AA 4LE1A 2ZUWA 3ZCVA 1WXHA 2QNBA 4G0NA 1BXRA 2JIBA 1DBIA 3LG2A 2O23A 7ADHA 3TQOA 4IOMA 3R5HA 4BQPA 4ZVLA 4RORA 5IP5A 1VYTA 3WGOA 1UZAA 3D3EA 4HS9A 3JARB 3BIOA 1RACA 1YWGO 3HSKA 4IQ8A 3WJ7A 1RWKA 3JASA 4IJKA 4GM0A 4AZVA 3LJKA 4LMBA 2ZJZA 3LGSA 3D8UA 3HDQA 4HL6A 3T52A 4D8XA 2XE4A 3C8HA 2NSJA 3HFJA 3ZHCA 1ORWA 2ZRJA 2PKYX 2GF2A 1O95D 5FNVF 4JBHA 4M1YA 3V48A 3MD0A 3A4TA 1CHNA 3SJAA 1MZVA 1T15A 2BCJQ 2IOHA 4HVLA 1CUJA 5JCJA 1ZIDA 3HXQA 2WQ6A 1GSOA 5FULA 1ILEA 2XRMA 4E7PA 2XA9A 3WYAA 2CDCA 1C7JA 2ZWVA 3ABOB 1ADYA 3FCUB 2BY4A 2WT9A 3KOMA 2OG1A 3PDCA 4QGHA 1D8TA 5AOCA 4RXMA 5E9WA 4I1RA 2C82A 2ZIGA 2R751 1S8OA 4DIBA 1X87A 2WMDA 3EH2A 1SCQA 1P0QA 1ABEA 4S24A 2EJCA 1QYXA 1LPBB 1UP7A 2WU1A 3CURA 3PXGA 4ALMA 3EXIB 4E46A 4QPZA 3Q87B 1PJTA 2FW9A 3R7LA 4AKIA 3HLKA 4UCXA 2PMFA 3EIUA 4IDFA 5K4AA 1NDQA 1U2DC 1FVFA 2OXIA 4DA6A 3BGVA 1K7EB 1RLUA 2C94A 2GMWA 3FI0A 3ER9A 1C8BA 1WKBA 2C4KA 2ZBPA 4OHWA 1SR8A 1FYDA 2FAXA 1U7PA 2CZQA 1DU4A 1PEKE 1YH3A 3E23A 4F1WA 3L8FA 2PRKA 3IODA 3KJIA 4XFDA 4DR4B 1A5TA 3LBFA 4PZ9A 4R2MA 3K8ZA 4KBGA 1JVBA 2XGSA 3DAPA 2Q9AA 3OA0A 4C4ZA 1MX9A 4EPRA 3JSAA 1A4IA 1OWLA 2Z98A 1DMRA 3DVRX 2YWJA 2VPPA 4QSHA 1CK4A 3WICA 2H1HA 4M9CA 1F3LA 4LJ7A 2C98A 2R8OA 5BOSB 1Z7BA 1ZVMA 4HR7A 3GH1A 3OG9A 3F3KA 4Z8XA 4O4LB 3INGA 4TRRA 1M1XB 4CZ2A 4YTEA 3B7GA 3LLUA 3T61A 1VSVA 1LRLA 1V4BA 2OM2A 3K6JA 2VHQA 1UPCA 3UUFA 1T8YA 2N1MA 3BK2A 3FDZB 3HU3A 3AXTA 4FPXA 3G5TA 2Z9BA 1M2JA 2PUHA 1GT91 1MC8A 4P54A 2H16A 3KEGA 1G0NA 3MMPA 3N5CA 2P90A 3S68A 1QNLA 1BIFA 2OD9A 4G5QA 1CQJA 5JNVA 1IPFA 3PR2B 3QFTA 1G6OA 4YS6A 1SUAA 2B82A 4WH0A 4BLUA 2DETA 3SHQA 1KJZA 2GN4A 2RGNA 3OE7A 4R3WA 4BPBA 3WLAA 4OMDA 3KHTA 1TEXA 4ARVA 2Y4NA 2JKYA 5JH7A 3HBJA 1M2OB 1RWMA 2W6NA 4I5FA 4EJ6A 4BL5A 3D6VA 4B8ZA 1HT3A 1KYYA 2Q6OA 3D5QA 4IUDS 1JA1A 4C7BA 3ZC3A 2IS2A 4E21A 2FEOA 2NU6B 2FSIA 2E9SA 3JU3A 1YHZA 3O3OB 1XVAA 5K0GA 4Y1GA 3DHWC 1UKEA 2YJGA 3H97A 2OSVA 1ZL0A 2GO1A 4HDQB 5FPQA 1A71A 1UK9A 1Z73A 1NQWA 1X38A 3T1TA 1LBQA 4DV4B 3OQJA 4ARZB 1FE8A 2JH9A 1QHYA 4PSAA 3WTBA 1XFAA 2MMGA 1N0VC 5EZSA 4DQXA 2HCTA 2O2DA 3CLRC 3NFYA 1JFFA 3HY6A 4LOAA 5J4KA 3H5VA 2FETA 2QTBA 3IOBA 5EXTA 5JS2A 3TSAA 4FDUA 1SGWA 1XJWA 2JGIA 1UPFA 4LYFA 1MO5A 3RLFA 5CA1B 3JQ6A 5CB4A 1RHRA 4EHFA 2REOA 1IHOA 4NU5A 4BMYA 2W2OA 4MS3B 1CEXA 1E2MA 3A25A 2BFCB 2RI6A 4G4JA 3TVYA 4EFNA 1E3DA 1WXDA 1I7SB 1O1YA 1FDWA 1ZNXA 3QG1A 4H0FA 4C2AA 4LIPD 4XVUA 1ZOSA 4JMLA 5CVCA 1UBKS 1ID8A 1M8PA 4P0TA 2X86A 1C2YA 3H5IA 1N0UA 3QLUA 1PZGA 4YLEA 1NQ5A 2J87A 4F5WA 2HU8A 4KODA 1JIVA 2XDAA 5KKNB 3B3JA 2GEFA 4HXFB 2GETA 1DKNA 1W4LA 2ZTMA 1KI6B 3NH6A 5KVVA 3BEOA 3GMTA 3DBLB 3I37X 1TUGA 4DANA 1X77A 2QPAA 2IYAA 3C3JA 3AEYA 2D5LA 5FA6A 3FZEA 3R24A 1J9ZA 3DMYA 2IHYA 1G0OA 2IUEA 2PG3A 2YX1A 3GK3A 2Q3LA 3T41A 1QQ7A 3E70C 1DKOA 4O4HA 4YJFA 5ES3A 3URKA 3F6CA 3K35A 1TMOA 4XQ9A 1FFAA 5AESA 3K0AB 3O6VA 4DV6B 1FZQA 3JD0A 2JJMA 4CIAA 3THRA 3LHDA 2AF3C 1ZONA 3FVTA 2JGAA 4G4SP 5KTNA 4BYGA 3OBIA 2WTMA 2FUG1 3W1EA 4FLEA 1RHMA 5CVVA 3GY0A 1SG6A 3TNDA 2QMHA 1QRDA 4ZDWA 2VHJA 5IVIA 4F4FA 3H9BA 3VAYA 2FWIA 4U2BA 4E6PA 4XOIA 2H1CA 1T0JB 1YJ5A 2XPCA 1UZNA 2FG5A 2CXOA 1CUAA 3AL3A 3DMRA 3MW8A 3Q15C 4BNDA 5ERXA 3T94A 1DDIA 1UKCA 5TX7A 8ADHA 3ZDYB 4MKXA 2RGEA 2AV6A 4XWGA 2VTBB 3D6HA 1BVHA 1VOTA 3MAGA 4M1TA 1G60A 3AXSA 3P0EA 4PZPA 5JWHA 3AR9A 4NV3A 3AWIA 4I3FA 1H6BA 5ESXA 4CW7A 2A5LA 2PH7A 1UPTA 4TKUB 4BWVA 4BVEA 1COWD 1E9VA 4QJIA 3VR5H 4NU8X 1NN3A 4YCMA 1BH6A 4Q4CA 4TROA 5T41A 1RCUA 2II6A 4S2UA 4PE5B 4ZVUA 3R6GA 2GA8A 2YJ6A 3Q41A 5ANRB 3CUYA 1IUKA 2Z1DA 2PQ2A 5FLKA 2M6RA 2RGXA 1NVMB 3H42B 3I8OA 4DQVA 2PZAA 4H0NA 3V7NA 1CZUA 5B1EA 3E2PA 4M49A 4WK0B 3ZS8A 4EA6A 3ZLUA 4DUYB 3GFRA 3DZKA 5D3MA 1LB1B 2PV0A 2VNAA 4Q0MA 3GLIA 4C5BA 5DO9A 1FY2A 4PO3X 5A6SB 1E7MA 2ZI6A 3DMHA 3JYLA 2XA1A 1OX4A 2E85A 2J7PD 3LVQE 1Y7TA 2XHEA 2Y0CA 3QK7A 4JGGA 4BRSA 5KCZA 2HUPA 3LT2A 3TNFA 5A02A 1HDIA 3IDQA 2E2WA 4OU5A 3DB1A 5FLYA 3O26A 3J80A 3P96A 3QUCA 4V0KA 4G9GA 1DXYA 4JL5A 4WN9B 2ZIWB 2GK4A 2H9IA 4D5EA 2GBLC 1R10A 4LQLA 1G7SA 4LJSA 3UJNA 4TRMA 3AVVA 5EIWA 5AWFC 2C2OA 1MD9A 4XJXA 4A2CA 3W8EA 4CF3A 4CKCB 1I10A 2PIDA 4ZVOA 2QENA 2JFUA 3IQDB 1PLLA 1KDOA 3ZEAA 1LI7A 4EEZA 2CVQA 2PT9A 4CIBA 4FIDA 3R74A 3LY5A 4FBLA 2NZYA 3CUSA 2COKA 3MJVA 5FO1A 3R7DA 5FP0A 1XEWY 3MCTA 3NNNA 2PA0A 4XCVA 4J0JA 4YAIA 1XNHA 1YR7A 1L5LA 3WK4A 1H0HA 4ZYUA 2IU0A 3D8BA 3QUTA 5CVTA 3JQ8A 1NF9A 4URVR 1PR1A 4YRMA 4JJGA 4BRZA 1E1RD 3D6MA 2NVWA 2UUCB 2QR2A 3TZHA 3OTQA 5G3ZA 4BO2A 4N41A 5FPHA 4C4OA 4S35A 7REQB 2Q6KA 1D7OA 2Q27A 2WC1A 1FU4A 1GKIA 1U8CB 1RU3A 1FB5A 2C58A 2QR5A 2Y1FA 4ZJUA 2CV1A 1LF5A 2FZWA 1RAFA 3KB2A 4AB1A 1BDHA 1C3LA 1CUUA 5L6MB 2JDIA 4CHTA 1VP9A 3UK0A 2PR7A 3D6AA 4HNAB 3ZI4A 4XUGB 1EFLA 1UC8A 1GTVA 3I2FA 3AUJB 1OFHA 4FD3A 1WUKS 2IHZA 1SVKA 2E1RA 3RBVA 5BORA 2IXBA 1TCBA 1SBNE 4N48A 3KQWA 3W04A 4HH3C 3RYTC 4B3TB 1FP4B 2BM1A 3F96A 3K05A 1ZUWA 3JYHA 4XIFA 1TKBA 3FKSD 1M1UA 4MMZB 1O96A 2Q5FA 4O2AB 4B8YA 1SVIA 1YRWA 4HD8A 4KQJA 3FPCA 4GWLA 5MN4A 1NZJA 4E2XA 1DX4A 2HJHA 3G5MA 1TYDE 3P5BA 4O2LA 1K8RA 3QY9A 4W9NC 3OFJA 4B81A 1FNMA 4UHHA 3WWEA 4BNGA 2R87A 2X5KO 4XIIA 1AA6A 2EWVA 2FZGA 4OI4A 1DXQA 3M0EA 1T1JA 4LX8A 2QZ9A 4NE9A 1MMFB 3TOVA 1XCPA 2BEUA 2YWFA 4B3BA 1GPMA 4TMFA 1ESNA 3SLGA 4ZIRA 1XZHA 2WU8A 2UZAA 1VJTA 2BJVA 2GAFA 3CR7A 4BV3A 1DNPA 1HDRA 2H1LA 4F56A 4QL3A 4YT2A 1ZCJA 3ZDDA 1FTNA 2WI8A 2M9MA 1PWYE 2SNIE 3SN6A 1MXFA 3V1YA 3ZHQA 4UUPA 1GAQA 3OX3A 2Z3ZA 1PJAA 3HUUA 2N42A 2R8PA 2ZRLA 4U7FA 4L73A 2D74A 5H80A 1TJYA 3K6SA 3NHPA 2D54A 1XGKA 2OHFA 2W6ZA 1KBQA 1LNZA 2RCNA 2IDJA 4KFRA 1MN6A 1P39A 4NFSA 2O05A 3KCNA 1VGRA 3JS5A 2BEKA 4DR7B 1M1YE 3BHMA 2BMDA 5ALNA 3I9NA 4Z2AA 3IIMA 1HRDA 4KRXA 4IF4A 4LV5B 4H60A 4RSGA 4G6ZA 3CXRA 3ET5A 4O2RA 5H83A 1EIWA 4IDEA 4GQAA 1XSEA 3U7HB 4PVCA 2PSFA 1F12A 1NBOA 3MUOA 3EEQA 2VQ3A 1U99A 5FTLA 5JISA 3CVUA 4CF5A 4DBLE 2VJMB 5I3CA 3GDOA 3BXZA 3CF6R 3M4ZA 4MA4A 3USES 2CFIA 5CFOA 2ZAGA 4Q00A 4G84A 4LISA 2E7ZA 3AETA 1KDYA 3LW7A 3NEYA 5FL7D 2P62A 3WA6A 3NTLA 3IQIX 1QZTA 1IDN1 1J23A 3NAZA 2UYGA 2RK3A 4GPBA 1E7QA 5FCDA 3T7KA 4IYRA 3HB7A 5HQTA 3QLVA 4H1UA 3AMVA 4JZYA 1D1SA 1DXHA 1TXGA 4LZLA 3JWGA 3RSGA 1HE3A 2EGHA 1J56A 2BMFA 3HRKA 4KXLA 3THXB 2PX6A 4I36A 5LZ7A 2CXXA 4NV1A 4AK9A 3ZDAA 3PR1A 5ICFA 2XCRB 3HSYA 2AUMA 1R8SA 3MLEA 4C0WA 4G0WA 1JTVA 3ZR4B 2W0MA 4ZDJA 1YVEI 1B1AA 2YHSA 4AY2A 1LTQA 1PLJA 4LK3A 4PLHA 1AKRA 2IOFA 4CRWB 3C39A 4MEAA 5COQA 4X66B 1P2UA 1WW8A 2AB0A 4EB6A 2YZNA 4K9OA 3PNKA 4IDGA 4EQZA 2PMWB 4KAXA 1RFGE 2PPLA 1JI0A 2R6R1 2JD2A 1XXHE 4RLSA 1HFWA 1NTRA 2GUGA 1XD2B 3WNVA 3OKFA 2VNIA 2ST1A 1V8PA 4NZYA 2INGX 2WT8A 2XTMA 1ENZA 2FG7C 2DX7A 2IELA 2J32A 3ZJTA 5DBIA 3HI6A 4EPYA 1LJLA 5BQXA 1PCXA 3HCBA 4NPAA 5IUKC 4M9XA 1PFYA 4QTXA 5AXCA 5FHRA 1AO0A 3W05A 1HNXB 3R75A 4OL9A 4RL6A 3KZNA 3HV0A 1ICEA 4NCHA 3VZBA 1UMDB 1Z08A 3ZH9B 1RYNA 3JZMA 2H51A 2IY9A 5FUXA 1RRFA 1USUA 1GA1A 1ONOA 2YJNA 3DUWA 4EO7A 4ZGGA 1OGIA 2I4OA 3DVAA 2JIZA 1U7OA 2P6MA 1GZUA 4EFKA 1MOPA 3LYHA 4B7CA 1HV8A 3AF2A 2KW5A 1Z0JA 1K88A 5CX1B 1YHYA 2VA8A 3GRCA 5G3YA 1G38A 1QG0A 4FEYA 5I4CA 3O7WA 2TYSB 4JOSA 2I33A 4ZOLA 2FPIA 3BE8A 2NUPB 2ZJAA 4PX9A 1A5BB 4BX9A 3FZGA 1EG7A 1QSGA 1YVUA 2EZ8A 4JLVA 4HKTA 1TVEA 2WTEA 4TWAA 1UM9A 2WTXA 3NIGB 5EJEA 1T0UA 4AKHA 2PWYA 2DBVO 2A5YB 3DA8A 2XRZA 3KOZA 4F2GA 4WUVA 4MS1B 1LY1A 1PJ2A 2JGFA 2BBOA 5FLEX 1Z74A 1V4VA 4R2WA 4DT1A 2E82A 1CSEE 4H7KA 4HUTA 3NYWA 4X5OA 4F45A 2CE7A 1BRMA 1XVIA 3KJQA 2FMFA 1OFIA 3QIVA 2CSXA 3GB9A 3OOJA 4JVMA 3KSMA 3PIDA 4E5KA 1XU9A 1MAWA 4UAVA 4QASA 2O8CA 3CIFA 3EAFA 3BMOA 3INTA 2EQBA 4UUBA 5KVQA 3SDBA 4E3WA 2AN5A 3PIIA 1U0HC 4PX3A 4JP3A 2ACEA 5IZCA 4RKQA 1U7DA 4I14A 3LDGA 1ZIPA 1H9CA 1NUPA 2XNKA 4YX9A 1YR9A 3HM9A 2YFYA 4DV7B 2R65A 2E0IA 4AY3A 5FXMA 5IT4A 2VWGA 4MR8A 1O5IA 2WM3A 4MVJI 1THGA 2HRRA 2HT1A 4CKBA 3UPDA 3HBMA 2FSSA 4N0QA 3SBOA 2F3TA 2PKCA 3VC3A 4BQSA 3DTTA 1RXUA 2B78A 4OP2A 4HWGA 1JX6A 2OXFA 4AYTA 4CMAA 1CJMA 4EPXA 3ICPA 3IUSA 1P7WA 1O6GA 3WRXA 3LWNA 2QUJA 5AOAA 2JHPA 1V8ZA 4K9MA 2Q99A 2I2BA 1JU4A 4QXMA 4BATA 2FX3A 3JQ9C 2YUTA 2C7QA 3O0TA 3ANSA 4BASA 4ZO7A 2GCNA 3UK2A 1KY5A 1ATZA 4I4IA 5EN4A 1M1YB 1VA4A 3BAZA 3HFRA 1LVGA 1X70A 3MSCA 1JEQA 3QXCA 2C0PA 2GXUA 4DNQA 4TVSA 5C51B 2Q3HA 4G0YA 3VYWA 4C0LA 5FAKA 3RUPA 5ALHA 3AVYA 1DWPA 1Z0KA 3BSSA 1WB6A 3KEMA 2HHHB 4XUCA 2DY1A 5EMNA 2C61A 3IE0A 2JANA 1EJBA 1WW2A 4B83A 3DOFA 2PMCA 4AG6A 4F11A 5LZ2A 1G5IA 1BX0A 2MJLA 3VMMA 5M5BA 3Q7TA 1FMCA 4HDCA 3FMGA 2EW8A 3QI7A 3JATA 4GSKA 3PD0A 4WJLA 3ESQA 5LLDA 5KYTA 3QPUA 1WJGA 1CVIA 2C4HA 3GJQA 4GQIA 4HQ6A 1M33A 3DC7A 1SZCA 4B4OA 5EQJB 4G0XA 3BIXA 2IE8A 4JBGA 4JI5B 4DXHA 4ZKDA 4QC2A 4FZRA 2F3RA 2XGMA 3MTIA 2B8EA 1E6CA 1BJRE 1CU1A 4UPVA 4Q9IA 4GBJA 4GKVA 1FFGA 3SICE 5DOVA 5AVOA 3FDXA 2YXNA 3LXUX 4YO8A 1IJFA 1LQ2A 3MUFA 3AU8A 3AFNA 5I8ZA 3K20A 4R16A 1P1JA 1XNRB 4F72A 4I4TF 5FNZA 3MBKA 4CIVA 5L8VA 2O52A 3T3GA 3OIVA 4HX9A 1P9RA 5DM70 3CW2A 3FTQA 1SK8A 3WYGA 4CF7A 3HM2A 1HFKA 4JX8A 3BE5A 5BV2P 2YQ5A 3N8GA 4UFNA 5CYFA 3NCTA 3OE5A 1EXVA 2VH2A 2LIPA 2ZPUA 3F98A 4IG4A 2DH6A 5COBA 3U3XA 2QAIA 1OH8A 3FOAA 3PNQA 1MVOA 5MFZA 2FN9A 3NRBA 3ZCTA 3CNLA 3WNCA 3SF0A 2QTAA 2V55B 2ZBQA 3RSOA 4CM9D 4NMWA 4KPFC 3E9EA 2JFQA 3LBIA 1DEHA 3QELB 2FVYA 2WSSD 1DQSA 1KS2A 1V3UA 2QMQA 3AIOA 3CUTA 4DLAA 3IVXA 4TT3D 2X0DA 1H22A 3AQ4A 2J9FA 1L2TA 1P3Y1 1TZ2A 2VP2A 3BB1A 3IQFA 4HUQB 4WXRA 1ORRA 4DQKA 3C8MA 5LDGA 4CQLA 2BVNA 3I9V6 3LDUA 2I62A 3B1YA 3ONEA 1E9AA 4UAGA 4GMHA 5ALWA 2WSYB 2PU5A 1KMHA 5AM5A 1UBFA 3IEVA 5I9IA 3DOHA 2Y1OA 1RQPA 4B3MB 4MI3A 2R48A 1PDWA 1S3IA 3K0CC 3CZQA 3T54A 1XZIA 3SC4A 1NUAA 1AS3A 3ONWA 5JD5A 3F0TA 4DE5A 2WM2A 1HLFA 4E88A 3SYNA 2JIQA 4R41A 2O3UA 3CXUA 3ZE0B 2XGGA 3QMPA 3ZCXA 3SZGA 1YIAA 3VNBA 1XALA 4IIGA 4ZT6A 3SG0A 3ENQA 1JAIA 3VVMA 1P9NA 4BNVA 3JQ7A 2ZYGA 3EK2A 3LXMA 3PC4A 3G2PA 4JL8A 4MWTA 4C9BA 3R9XB 4RPGA 1UQUA 3L8MA 1H2WA 4AS3A 3AR5A 4EELA 2IUTA 3LT4A 3MJTA 3NYQA 2QIOA 3PYLA 3VKWA 1HLGA 3MS4A 3SR4A 3MRTA 4D1YA 3G49A 3KKNA 2Z8ZA 1EFRA 1Y6FA 3PXEA 4KVFA 3BRSA 1RXIA 3RSZA 3EZGA 1Z35A 3U2QA 3HA7A 1U9ZA 4PWZA 2QL9A 4X20B 4G5FA 1I80A 1OFTA 1Q7RA 1EDOA 2Q0XA 1YIDA 1GZ3A 4Z3DA 4CDGA 1JEYA 1UIMA 3KWFA 4AX4A 5H70A 1WHSA 1ZH8A 1I0LA 1F60A 1SKBA 3QE3A 2PUVA 4ESVA 5EIXA 4OG2A 4ZCIA 1G5HA 3M1YA 4IJVA 4RMIA 3GPDG 1LWOA 1OIVA 2DECA 3HLTA 5EXEA 3TEFA 4R2IA 4AJOA 1G6Q1 2P1ZA 3BD8A