2ZTVA

The binary complex of d-3-hydroxybutyrate dehydrogenase with nad+
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
260
structure length
260
Chain Sequence
b'MLKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISALAEKNGVDQETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
publication title Closed complex of the D-3-hydroxybutyrate dehydrogenase induced by an enantiomeric competitive inhibitor.
pubmed doi rcsb
source organism Pseudomonas fragi
molecule tags Oxidoreductase
total genus 98
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ztvA00
2AEJA 4CLOA 1VRWA 4K6CA 5B37A 3LLSA 5TIIA 1HETA 3ZW9A 2PH3A 3F3SA 4IJKA 4OL9A 1OC2A 2BI8A 1YGYA 4XQEA 5JCJA 2EW8A 2RH8A 3T4EA 4XB2A 3PRJA 3LT2A 3OICA 1X15A 2AEFA 4B79A 2DTEA 2BFOA 3MWEB 4H16A 1KVTA 4ZGWA 3MTGA 3QP9A 1HE4A 2I66A 4L73A 5I8WA 4I5FA 3UXYA 2WWRA 3BMCA 2Q4BA 5BNIA 2VOJA 2EIHA 4OHUA 4H7PA 3RQSA 3ZHYA 1H2BA 5DP2A 1P3DA 2HDHA 4BGVA 3WNVA 2C07A 1DFIA 3T4XA 1I3NA 2Y66A 2QX7A 5ENDA 3PGJA 1LDBA 3QWBA 2VCYA 4TVBA 1LDMA 2VQ3A 5JXWA 5KJ6A 5DBFA 1QSGA 4PG5A 5AXCA 3W6ZA 1UJMA 3ORFA 1NPTO 3H7AA 1E3JA 2HCTA 2XOXA 3NT2A 1O89A 2IYPA 1DSSG 2V65A 4UVIA 4BNIA 5JDCA 2FZEA 2GGSA 1Y6JA 3C7CB 1NWHA 4CM6A 3ZHXA 1WZEA 3ASUA 2GN9A 3GT0A 1Q1NA 3NTQA 4BNMA 1NQOA 1SZJG 2EKPA 5TSDA 3TSCA 3RU9A 2X86A 2HO5A 4FFMA 2NV6A 2UUOA 4YQYA 1LTHR 3RBVA 1I10A 1I3LA 3P2OA 2O2YA 3W8DA 2PD6A 2QYSA 2D5CA 4M49A 1G1AA 3M1LA 2FMUA 4PLGA 4J0FA 2Z5LA 4PLZA 4Z6KA 3GVHA 1PJQA 2C5AA 4E5NA 4XGKA 4NR0A 4NFYA 5A02A 1J0XO 1RYDA 2Y1OA 5FYDA 4DIOA 4J90A 3AFMA 4Q3NA 3KVOA 3MCVA 3GR6A 3AUUA 1SOVA 1P1HA 2A9FA 3HFGA 3HNPA 3JQ7A 2BGKA 5L4LA 2E37A 4AJ4A 4FFLA 1HYHA 3FF4A 3ZNOA 4N18A 3HDHA 3SJUA 3RJ5A 5HA5A 4OXNA 4D7AA 1P9LA 1Z7EA 1QYXA 1TI7A 3ZV4A 5IXYA 3KO8A 2AG8A 3FI9A 1CETA 4ALLA 2NU9A 2XPCA 1Y8RA 5B4TA 4AVYA 1HRDA 1LNQA 2BF7A 2BHLA 4H15A 1OAAA 1LUAA 5KJ1A 2E48A 4MVJF 4MVJI 4YJGB 3WIDA 4J1NA 2LDXA 4J4HA 4DTIA 2X7HA 3X2FA 1YKFA 1Y8RB 2HUNA 3EVTA 3I5MA 3Q9NA 5FFFA 3JD3A 4E5KA 3AI1A 3A28A 4M55A 1BW9A 1CIVA 2Z1NA 4DPKA 2W98A 4EUEA 3E48A 3U62A 2R00C 2AE1A 4JCOA 3JSAA 3V1YA 3GVXA 1XELA 3O8QB 2V7PA 2R2GA 2YHUA 1N1EA 3UUWA 2G82A 3JV7A 3JQ9A 1HF3A 1BW9B 1YBAA 3NDJA 4WLFA 3EMKA 2FR0A 4BKUA 1BDMA 3I3OA 3NDIA 2OORA 5EN4A 3IP3A 2AEMA 2JL1A 3UCXA 1F17A 3WBFA 1DIGA 4FJ2A 1WDKA 2G0TA 1D4FA 4IGFA 3H5RA 5ILGA 3RASA 1YVEI 3JD4A 3TOZA 3K96A 4FC7A 2PNFA 2PZLA 4ZVVA 4XGIA 3UF0A 2VHYA 3GLQA 3I9MA 4E2WA 2YV2A 4WLOA 3GUCA 1B2LA 3ZV3A 1GPJA 1Z82A 1NBOA 2ZB3A 3DOJA 1V6AA 4JLWA 1C1XA 4LVCA 1DHTA 1XA0A 3WTBA 3OM9A 5FF9A 4FSHA 5CEFA 2OZPA 3DR3A 1GV0A 5F1PA 5TJHA 1NQAO 3RU7A 3PHHA 2ZYGA 1TT7A 1J6UA 3PJDA 5TT0A 5ADHA 1EZ4A 4XQGA 4BO9A 2WMDA 3HN2A 1Q7GA 3V1TC 3H5AA 2W2KA 4YJFA 5A4DA 1ONNA 2VWQA 3TZCA 3CE6A 2VYVD 2G76A 2I5PO 3EY4A 4O6VA 3VPFA 3NX4A 1YRLA 4BNUA 1LSJA 3FR7A 4EJ6A 4OJNA 1ISHA 3S55A 3WXBA 5I9NA 3C1TA 3OEWA 4BV8A 2IEDA 2B35A 4YJFB 1LSUA 4J3FA 3L6DA 2GZ2A 4BOYA 4I9UA 2I3AA 1WDMA 3WGOA 1E1KA 4ALJA 1E1LA 4BKPA 2UV8A 1E7WA 4CR7A 2PGDA 3ADPA 2V6BA 4A27A 4B8ZA 2BMAA 4IY1A 3R0IA 2VYVA 3H5NA 4N5MA 1VL6A 2OHXA 3AUSA 4OSPA 1NHWA 3CXRA 4PLYA 2IYOA 3AOEC 4ND5A 3ROMA 4CUZA 4WCFC 2RBEA 4KWHA 5CHEA 5I8ZA 4IPTA 4NBTA 4KUEA 3W6UA 1HDGO 3AOGA 3WSWA 2G1UA 4Y6PA 4ESOA 3PQFA 4LSMA 2CDCA 3VKVA 1ZEMA 2AW5A 1O94A 3JYQA 1P74A 3Q2IA 3Q2KA 2EKLA 4PN3A 1Z73A 1QV6A 1K89A 3COSA 1ONPA 3UKOA 3BIOA 3WGZA 4XR9A 4EW6A 2EXXA 3OECA 4RVDA 2DKNA 2POQX 1IPFA 3TL3A 4R4JA 3WMWA 5G0UA 2ZTMA 3MTJA 2PV7A 1I32A 3FTPA 3B1FA 4DC1A 1IHYA 4R1SA 2GASA 4NFSA 4GSLA 1H2HA 4Z0TA 4ZD6A 3S2EA 1W73A 4FS3A 2GLXA 4OSOA 4YWJA 5BR7A 4LISA 2WD7A 2WYVA 3QVWA 5IZ4A 4CM8B 4M86A 4A10A 4EBFA 4QQRA 5IFLA 1I5RA 3LT0A 1L1FA 2H5LA 5C3MA 5I9MA 2VRCA 4OH1A 2DT5A 3EUWA 5GZ6A 1QLJA 3TL2A 1NR1A 2IZZA 3OJ0A 4PG8A 4JIGA 1FJHA 2O3SA 3D3WB 4YT2A 2WD7B 3QLJA 4C4OA 4CQMB 3PIDA 7MDHA 4XDYA 1BXKA 5G4KB 2Y0CA 3HDYA 4B3IA 3L9XA 3VKUA 3OQ6A 1G0NA 4J0EA 4UVDA 4BGUA 1P45A 3UN1A 5ER9A 2J8ZA 1NX6A 1NTOA 2QZ9A 3ZU2A 1NFQA 3H2ZA 3JYLA 3L6OO 3NJ8A 5JDIA 5G0SA 4URFA 3IL2A 4J1SA 2YFHA 3D7LA 3JYPA 2DU8A 2ZATA 4AJPA 1N9GA 4RVFA 2CFCA 4TVOA 4JJIA 1GZ3A 4XJTA 2BD0A 5KWEA 1KEUA 5I9LA 1ZJZA 4DPLA 3K5PA 1TXGA 2A4KA 2HAEA 5K6AC 4OM8A 4HP8A 5T57A 3DBVO 3L07A 4D45A 4PG4A 1IY8A 4CM9D 3DWFA 1P33A 3KYCB 3H4VA 1IB6A 4JX8A 2C20A 1V3TA 2UUPA 1VL0A 3NGLA 3DHEA 4Z0PA 4YB8A 2YZ7A 1U4SA 4R1UA 1NP3A 4J2HA 3KEOA 3E5MA 3O26A 4XX0A 4J9VA 3NGXA 1B8UA 3OP4A 4LSWA 5H83A 3FD8A 4MVJG 5L51A 3FWZA 3GMDA 5F1OA 4IDAA 2E82A 4NZ9A 4EYEA 5IG2A 1P0CA 1H9AA 3BMNA 1WMAA 3NKLA 5DBIA 5JO9A 2C7VA 1U3UA 3JQAB 3MJTA 3AWDA 1YOVB 4BO1A 1NAHA 3ULKA 4KWIA 3OHSX 4XGNA 3Q0EA 5BNFA 2FR1A 4DQUA 5IZCA 2ZYAA 5B4UA 3QVOA 3ZZNA 4TSKA 4Y67A 4U6SA 2BKAA 2OBYA 5F3RA 3OF2A 4GL4A 1IPEA 4O63O 1R4MA 3A06A 4E2ZA 2YY7A 4LCEA 1F8GA 3ANMA 3GY0A 2O7QA 2ZCVA 5DT9A 5A9RA 1V0JA 4O5OA 1I3KA 3FBTA 4LMRA 3GVPA 2GSDA 2D1YA 1RJWA 3G3EA 3GA0A 3ZW8A 3GQVA 1PS0A 3VZRA 1SCUA 3JQ8B 3EK2A 3QWFA 2W8ZA 4E5PA 5HM8A 4DWVA 3ADOA 3VH3A 1OMOA 4JP3A 3DZKA 4RCVA 1YJ8A 2FOIA 3IKTA 3ETGA 1IOLA 1T4DA 4K1LA 4MVJH 4M87A 1CDOA 3T7EA 2NM0A 2G17A 4NU6A 4OGWA 1RM3A 4EUHA 1I2BA 4ND4A 3AI2A 2P4QA 5JDCC 2PGJA 4P8RA 3SC4A 1BRMA 1WW8A 3V1UA 1DC6A 2C0CA 2X0RA 2WD8A 2WM3A 2GN6A 1P31A 1ULSA 4GLLA 3JQEA 4OXKA 5I7SA 1SAYA 1EE2A 3PQDA 1WLYA 1M67A 2OUIA 1UDAA 1I8TA 3I83A 1LJ8A 1EQUA 2PKQO 3IP1A 2VUTA 5T6BA 2QG4A 1RYEA 1UXGA 3H3JA 5C7LO 3F1LA 4HKTA 4P22A 4CMKA 5HTOA 1AXGA 4M54A 5DCYA 1YB1A 4BS9A 5FEUA 1SPXA 2NQ8A 1GZ4A 3KYDA 2NACA 4GKVA 4EGFA 5A05A 4I08A 5IDXA 3PJEA 4BNVA 2HLPA 1NM5A 4N5NA 3GEGA 1UP6A 4PZDA 1Q0QA 4CR8A 4CMHA 2OL4A 2LDBA 1DDOA 1T2CA 4R69A 2ZYDA 4TWRA 2YDYA 1H6AA 1CYDA 1Q2XA 2NNLD 4GBJA 4GWGA 1F14A 3C7AA 4BNWA 4FC6A 1ZSVA 2NLOA 4LRSB 1GUFA 2J5RA 2P5YA 3ZH2A 2BGMA 1RM0A 1DB3A 1AN9A 3AI3A 1U2DA 2W90A 4R3WA 3RVDA 4DPMA 4RGBA 5HS4A 1Y8QB 2VWHA 1ZIDA 5A5FA 4MIEA 1RM5A 4PLWA 3GN2A 2OBNA 4IJWA 1J5PA 4KDFA 1YJQA 4CMCA 3C85A 2Q2VA 1LC0A 1UDBA 2JFFA 4G81A 3OBBA 4CL3A 2NQTA 1MFPA 1PGQA 3FR8A 4A0SA 3L4SO 1JKJA 1LXCA 4B7UA 4BNJA 3EDMA 4GI2A 3QIVA 5EQFA 2FN7A 4EEZA 4BO3A 3O03A 3V2UA 1IE3A 1PGJA 3OMLA 1W6UA 2HK9A 4G2NA 3NT5A 4BHTA 1HXHA 3LK7A 2JFGA 4II2A 3TRIA 1HSOA 4AJOA 3CEAA 1PS8A 5DOVA 3ANLA 2H6EA 3UFXA 5KCZA 3BA1A 3MWDB 2VWGA 1E7SA 4GMFA 4J1QA 3ONEA 4HWKA 1DHRA 5T67A 1HE5A 1ZMOA 1Y9EA 1KVRA 4YTEA 2Q45A 1VLLA 2ZB4A 4BIIA 1R0SA 3FNGA 1I36A 5JAQA 4E2YA 2OOSA 1DLJA 3JQ9C 3GF4A 1IZ9A 5CPFA 2JHGA 1GU7A 5TF4A 4GKBA 1JAXA 4WUVA 4Z9FA 4CMIB 3DBHA 2PZJA 3NTRA 4CM3A 1WPQA 4FFOA 4FN4A 2AMFA 2WE7A 1EFKA 1XIVA 2F00A 2C5EA 4D3SA 4I5EA 3L4BC 3B1JA 3D4PA 4PZEA 3N58A 4YT4A 3B1KA 4QECA 3P5SA 3DZJA 4J6FA 3WYCA 4RZHA 4UULA 1U7TA 1GPDG 3KRTA 4UVGA 3WNQA 3B20A 3F5QA 2GNAA 2P5UA 5LCXA 4K28A 4RPGA 4QEDA 5TLSA 3QV1A 4CV0A 1DIHA 2D3TA 4MVJE 4Q3DA 1T4BA 3GZNA 3OQ1A 4E32A 2DTDA 3DFZA 3JYOA 4AJLA 2F1KA 4DLAA 3ZGYA 4JBHA 1EEHA 4FJ0A 3KZVA 3TOXA 2CZCA 3W4KA 1GD1O 1UXJA 2PZMA 4CLHA 4XR4A 1DRVA 1DAPA 1PJ2A 4R01A 4GQAA 4II3A 2E6UX 1ORRA 3SEFA 1I33A 3GZNB 2ZCUA 4E21A 4RVHA 5JNLA 1OFGA 3JQBA 4HUJA 4MKXA 4ZU3A 5CG2A 2BELA 5JCJD 1R0KA 3R6DA 2PGLA 2P9CA 4Q39A 1YL5A 4YJDA 2DBRA 3JCZA 1UZLA 1C0LA 3OJOA 3HB5X 1K6IA 3K9QO 1C0IA 4RV9A 5IF3A 2Q1UA 3UICA 2P9EA 4INAA 2Y05A 4ROSA 4YVFA 5IDQA 5DN9A 1YH3A 1BVRA 4ILKA 4BNLA 3LC1O 4IDEA 4BKQA 1LDNA 4E6PA 3I4FA 4E2XA 3PWKA 4KTVE 4E4YA 4CM4B 1Q7BA 2QYTA 4NNJA 1QYCA 1HDYA 1XQ6A 2DFDA 3DEYX 4GLOA 3MEQA 2D0IA 5L40A 4ZHSA 4FGSA 1NXQA 1VL8A 3EZLA 2Y0DA 5G0VA 6LDHA 1VC2A 3W4JA 1ZW1A 4KDEA 4BMNA 5T8KA 2O7SA 2O4UX 1KVQA 1JKFA 5KOIA 2EP7A 3IJPA 2D8AA 2O3QA 4J49A 5F5NA 3MJCA 1B7GO 4GWKA 4ZJUA 5COBA 3PYMA 1X7DA 3CZMA 1YBMA 4WLEA 2A94A 1E77A 4QFDA 3KSUA 1PEDA 5KKCA 3PTZA 3TJRA 3I9KA 3O38A 3FNEA 4YACA 1PZHA 1KC3A 3DQPA 5CEEA 4UEOA 4RF5A 1U7HA 1W8DA 2V6MA 3JTMA 3RC2A 1HLDA 3QY9A 4GX5A 3EZYA 1R12A 2DBVO 5F5LA 3WICA 2VZ0A 3RWBA 1K6XA 4DMLA 1EMDA 4XZ3A 3GNTA 3FCOA 1ARZA 1LQTA 3QVXA 2GN4A 1NPDA 1Q0LA 4IXTA 1T26A 3AUTA 2DVMA 3PJFA 3EYWA 4XD2A 3V2GA 4Q3CA 4ID9A 1ENOA 4MVJP 2WDZA 4ONEA 4Q3EA 2J3KA 3WLEA 1F06A 5JE8A 4NIMA 4MVJD 1JVBA 1YB5A 4DIFA 2QQ5A 4N5LA 5GZ1A 1GFSA 2W4QA 3QE3A 5L7TA 3DC2A 3Q6IA 3H8VA 1H6DA 2C82A 1XDWA 1FMCA 1XQ1A 3ONFA 4FBGA 5JDIC 2HJRA 1QKIA 2HMTA 2OGUA 2Q4EA 2Y99A 3GUYA 1ADGA 3MOIA 1X7GA 4NH4A 1JU9A 1KERA 1U3VA 3O4RA 4PCVA 4MVJA 4XYEA 1Y5MA 3WMXA 3HHPA 2HMVA 1PTJA 4PLVA 1FDSA 4WNCA 3H9GA 5CDSA 2Z1MA 4F46A 1SEPA 2I65A 1E3SA 1ZZEA 1C1DA 1VJTA 4PRKA 3RUFA 4Z3KA 1N7HA 3BHMA 3GRPA 4TZTA 3ZHZA 4OO3A 3QQPA 3FTNA 2EHDA 4YJGA 9LDBA 1KY4A 4A73A 2AA3A 2PKRA 3S2GA 3WWZA 1ENPA 2PD3A 1BWSA 3BMOB 1GCOA 3WWYA 4MP6A 4F6LA 1C1DB 1ZK1A 3U4HA 4XQ9A 1EVYA 4I9NA 1H93A 3PP8A 1GTMA 1NFFA 1IYZA 2PH5A 2UVDA 1N7GA 1N92A 3VOSA 4EZBA 1NAIA 1CJCA 3U09A 3O8QA 4W4TA 3KOUA 4HNGA 4R5HA 4YAJA 1UXHA 3UVEA 4YQZA 3DOOA 2ZTVA 1RWBA 1UAGA 1LLCA 2I6TA 5TJ9A 4UUMA 3LT1A 3E8XA 3JD1A 3DHYA 3IS3A 2C29D 3UOGA 4NMHA 3U4DA 3VAZA 1H94A 4E30A 1OBFO 2ZJ0A 3KEQA 5IZCC 5C5IA 1DRWA 2YYYA 4Z9YA 3CIFA 2BGLA 2C2XA 2QRKA 4OXYA 2EERA 4WE3A 4QSMA 3VDQA 2CF5A 1LC3A 1YWGO 2BLLA 4RF2A 3F47A 3STHA 3DMTA 1E1NA 1PS9A 5ILOA 4ZICA 1ZNQO 2HSDA 2GZ1A 4FJ1A 5JY6A 1EFLA 1R37A 2J3JA 5EQDA 3VH4A 3VTFA 3SVTA 3B6ZA 5A04A 4UUPA 3ZWBA 4S1VA 1BG6A 1HYEA 3G17A 4JQCA 4QFCA 2EV9A 4RF3A 5EINA 1Z45A 3WS7A 2UDPA 5A03A 4Y8VA 4W7HA 1I24A 2AQKA 1K5HA 3WG9A 1CQIA 2R6JA 4NK5A 2VNSA 3ENNA 4MP8A 3L4BA 2CDAA 4A26A 3RIHA 4XIYA 1D3AA 1ENYA 4E13A 3DL2A 4MJLA 1Y1PA 1YQGA 4D0RA 1ZK0A 3CKYA 2YHIB 3NTOA 5A9TA 1BMDA 4JJGA 3AU9A 2XAAA 3LU1A 4W7IA 3E9NA 1T2FA 2HQ1A 3D5QA 3GRKA 4IDCA 5ER6A 3W1VA 4PRLA 3AM5A 3D1LA 3ICCA 1U1IA 2O2SA 3AFNA 4MOWA 3WQQA 3DMYA 3D4NA 5BSFA 3NV9A 1XU7A 3I52A 2Q1WA 3GGPA 1W4ZA 4IXWA 4OOEA 3VZSA 2WYUA 3ZDFA 4BMVA 4H3VA 3T7CA 4BGIA 1EE9A 4ALIA 1C3VA 1LSOA 3E6AA 1E6WA 3JQFA 3U4IA 4ITUA 3NRCA 4DBZA 1C0PA 4HBGA 4DLLA 3CH6A 4PFJA 4AJEA 5A3JA 3GAZA 3DB2A 3TDKA 4HFMA 2HKIA 4DRYA 3M6IA 1YDEA 3KM0A 1N2SA 4J7XA 5EIOA 1PU2A 3PPIA 1S6YA 3DAGA 3PFWO 1GADO 5IN5A 5TX7A 4MVJM 1DIBA 1JWAB 3AU8A 4K9DA 5DOZA 4A5OA 1HDRA 1HDCA 4XDZA 3OETA 1O0SA 3SLGA 2ZTUA 1WAMA 1LI4A 4PG6A 1PQPA 3DZHA 5CDUA 1WXDA 5L95A 1JQBA 4IQ8A 4CQLB 1SMKA 4NDNE 3WB9A 3OA0A 2A35A 4HY3A 4D79A 3D4OA 3R3SA 5KVSA 2FPIA 2JKVA 3PHIA 2C7GA 4RVUA 3WYBA 1DO8A 3DHNA 4D3DA 1UR5A 3GFGA 4W6ZA 3IKVA 4Y6SA 3VTZA 4BVAA 1I01A 3HJAA 3DBLB 3H3FA 1A27A 5KIAA 5G0TA 2C54A 1QXSA 1FF9A 4NBVA 3SBOA 3FPCA 3HSKA 3NUGA 4CPDA 3ETEA 4YAKA 8LDHA 1P0FA 3B70A 3CPSA 3WLFA 4IIUA 4YAIA 4CQMD 3I9OA 4LMPA 4KUGA 2P4HX 4BMSA 4CMJA 5KTKA 1PJ4A 4MO2A 4CMEC 4EDFA 3I23A 2VRCD 3QVTA 4CM8A 1OZAA 1F12A 1GQYA 1CEQA 1I3MA 2BI7A 2XF8A 3PVZA 3LQFA 4RPKA 3I4CA 1M66A 4D42A 4XRRA 3C1AA 1GYPA 3C1OA 1Y9AA 3DZFA 3KUXA 3D3WA 1FXSA 1NHGA 4IS3A 4IJUA 3VPSA 4CQMA 1DC4A 4J7UA 5G4KA 2YDXA 2Q2QA 4PLFA 1ENZA 3L9WA 2O48X 3GDOA 1KOLA 1R15A 3AW9A 2Q1SA 4OAQA 3W8FA 1M75A 3RI3A 4FDAA 2YV1A 4M89A 4FGWA 4BQPA 2FSSA 4KP7A 4MINA 1XU9A 3NYWA 4RORA 3H9JA 3M2TA 3DXFA 4BO4A 1BXZA 5U9CA 2PLAA 3G1UA 5ES3A 3WDSA 4WLNA 2EF1A 4W9NA 3GDGA 2OO5A 4AJJA 1I30A 1SB9A 1XHLA 3AM4A 4KMSA 1KVSA 3KETA 2X5JO 3FBGA 3KLMX 1XYGA 5CDTA 4ND3A 2QRLA 5EL0A 3WQRA 3WGTA 2EGHA 3DZGA 3GNQA 1PGNA 1N8KA 1SBYA 3KYCA 3GHYA 3HDJA 3KLPX 3AJRA 1FK8A 2C2YA 1U4OA 4YT5A 3ZWNA 3JQAD 5DNAA 5CDYA 2VTDA 2RH4A 4XJSA 1VM6A 4WPGA 4PZCA 1PL7A 1Q0HA 3TZ6A 4UUOA 3U5TA 1M76A 1WVGA 3VC7A 2X9GA 3VVCA 5JC8A 3H9UA 1PWXA 5COQA 3V8BA 1QRRA 3UHAA 4NJMB 2PFGA 4E12A 1NWCA 4ZRMA 3E03A 2WEKA 3BTSA 1YBVA 4B7CA 5K9ZA 3F4LA 3JQAA 4R68A 1YOVA 4YEDA 4BB5A 1JKIA 3MOGA 4RDIA 2Y93A 4DUPA 3JQBC 3RJ9A 1MXFA 2IZ0A 4D44A 4EJMA 1NNUA 4DIBA 4LCJA 3KV3O 2I99A 4R1NA 3LYLA 4XYMA 4YJHA 2YFQA 3IUSA 3RFTA 3Q11A 2FP4A 1KS9A 4DVJA 1D7OA 1PR3A 3N74A 4JNKA 4R9RA 4UEJA 5AOVA 5CAEA 5L9AA 1PSDA 3FRJA 2VT3A 2NVUA 1MV8A 4D41A 5BT9A 4TQGA 3F1KA 4IQGA 1QLHA 4TRJA 5JMWA 2VTEA 4NFHA 4ND2A 2UYYA 4YJHB 1I2ZA 4GX2A 4Q9NA 3KBOA 3U9LA 1I2CA 1NASA 1ML3A 1DRUA 4OQZA 4D3FA 1GZ6A 3JQ8A 5BSEA 2VHVA 5JW6A 5AQ1A 2VUSA 3E9QA 2X9NA 4P4GA 3BXXA 2NVUB 2DPGA 4L8VA 4ZA2A 2QHXA 1NYTA 5JCXA 2D4AA 3LF2A 5I7FA 1V3VA 3QWHA 2JFHA 4YAEA 2P2SA 4AJ1A 4GX0A 4NBWA 5AXAA 5JYDA 3JYNA 5T8KC 1P1KA 5TQVA 1ADCA 5EMHA 3ZWXA 2J3HA 1WNTA 3GK3A 2ZK7A 3CMCO 4BQRA 4IZIA 4CUKA 4QTZA 4DREA 1RKXA 4UAGA 2CD9A 2CVZA 4ALKA 1ZH8A 4RQUA 4LK3A 4NU5A 1NVMB 2X0IA 3P2YA 3GMSA 3ZV6A 1MB4A 2HMUA 2XXBA 3EC7A 3GVCA 3RUIA 1AUPA 1O5IA 4J2OA 2AXQA 4BGEA 3K73O 1CRWG 4GVLA 1B26A 3ZN2A 3IQDB 2J5KA 1C0KA 1DBVO 1E0DA 4LRTB 5IDYA 2FY8A 5C37A 2E4AA 2QZZA 3CINA 1B3BA 1D1TA 1ZXLA 2DC1A 5THKA 1XGKA 4KTTE 1E92A 1EBUA 2X8LA 3PHJA 2GERA 4MKZA 4TRRA 5EJ2A 3VZQA 5TNXA 4XRGA 1XG5A 4DQVA 1PIWA 3GEDA 3ROQA 3K8ZA 3DTYA 3TPCA 4BNKA 4LVUA 3I9LA 5ICSA 4XKJA 4N7RA 3WJAA 3PWZA 7ADHA 2YQ5A 3GC6A 1Y8QA 1B8PA 2EW2A 3RROA 1PL8A 3R1IA 2O4CA 3QWIA 4CR6A 1T1RA 2B37A 3DBRB 2HK8A 2A92A 3WSVA 3VHRA 1GEGA 1GQ2A 2VWPA 4I1IA 1KETA 1XLTA 2B5WA 1C14A 2DM6A 2HK7A 1ZJYA 5L4SA 1ZSYA 1J49A 1U8FO 1AGNA 1MXHA 1IL0A 3LDHA 4GGOA 4DYVA 1BTOA 3VDRA 5T5QA 3PHGA 5KKAA 3OQBA 3F9IA 1T2AA 2CDBA 3RUDA 1K6JA 3HB4X 3VPHA 4JXKA 1AE1A 1WP4A 4DYDA 2CVOA 3IOYA 3AY6A 3INRA 2ZKLA 4CMEA 5ENVA 1MX3A 4M8SA 2Q3EA 3G49A 3QSGA 2CNBA 1HWYA 5H81A 4BKOA 5JS6A 1E3WB 4L74A 1YS4A 2EWMA 3EAGA 1YL6A 2V6FA 2Y1EA 4WCFB 1O95A 3IAHA 3I9NA 3E82A 1T2DA 4CMIA 4FW8A 2CUKA 4YRDA 1LX6A 5A06A 3G1TA 3ON5A 4J91A 5G4LA 4RVGA 3WGQA 4JBGA 4WLUA 1ISJA 2V6GA 2WTBA 3AK4A 1ZCJA 5GMOA 3DMTC 4RZIA 4RLHA 3UW3A 8ADHA 3RUEA 2RAFA 1UAYA 2PD4A 4CODB 3L77A 1A4IA 4BB6A 3ZHBA 2ILTA 2X5KO 4GSKA 2VRBA 3K2BA 5THQA 2YJZA 4IIVA 4WCDA 4BNYA 3ASVA 3DDNA 3IUPA 1U3WA 4OOFA 4RPLA 4WEOA 4BNFA 2GDZA 3OEYA 1PZEA 5A9SB 4JP2A 5BSGA 4B4WA 4GMGA 4LN1A 4JN6B 2B36A 4KQXA 2PA3A 4HNHA 1GAEO 4FPXA 2Y1FA 4WECA 5L45A 3ZWMA 3OH8A 3OSUA 1UXIA 1EK6A 4CV1A 3U3XA 5CFZA 2J6IA 4NG5A 1LLQA 4J4BA 1PQWA 2FSVA 2H63A 3TQHA 1HZZA 1WMBA 3SC6A 1Z6ZA 4C7JA 4E33A 2Y1CA 1ZK2A 1ZVMA 1JAYA 3A1NA 1MC4A 1ZFNA 3FPLA 3JQGA 3I9JA 2O23A 1HDOA 1IHXA 4IUYA 3GZ4A 4FIZA 3JQFC 3CMMA 5DCWA 2FZWA 4IJVA 5EESA 3RUHA 3W4IA 4RVSA 5AYVA 3U0BA 5L3ZA 4A03A 5EERA 5CDGA 2YW9A 2NVBA 1H6CA 2ZTLA 3BZUA 3PJGA 3K6JA 2GO1A 4R3NA 1ADFA 1FDWA 3JQGB 4GPD1 4DC0A 3HZZA 1MUUA 1GV1A 1TA4A 5B1YA 5C7IO 4L75A 1LRJA 4J16A 3RFXA 2X0JA 3QVSA 4RPJA 1X0XA 1U9JA 1P44A 1YONA 2SCUA 3K31A 1PJSA 5DULA 1B3RA 4CM4A 1DIRA 4QUKA 4EJ0A 4AJ2A 3GFBA 4YR9A 4NPCA 4EITA 1GR0A 3BMQB 1V35A 1U2GA 3MJ4A 4RDHA 3RUCA 4DGSA 1HE2A 1LQUA 3MJSA 4IDFA 1SC6A 3DZIA 3E1KA 1GYRA 3LC7O 1DOHA 1R66A 3RC7A 2B4QA 2PZKA 3HG7A 3UH1A 1EVIA 1PR9A 2Q99A 4BNHA 5KNLA 1N5DA 1PZGA 1EVZA 1GEEA 1P1IA 3VVBA 1QYVA 3NEPX 2DBZA 2IDZA 4ZQGA 3CTMA 4WOJA 4DMMA 5JSFA 3RAJA 1HE3A 3ITKA 5FI3A 2ZQYA 2FWMX 3FN4A 1R4NB 3ZU4A 5B12A 1EUDA 2ZB7A 4J43A 5J23A 2YUTA 2DFVA 4IBOA 4IM7A 1VSUA 5JAMA 3CUKA 3VH1A 3OIDA 1E1MA 1JTVA 1WWKA 3A9WA 2BH9A 2EJVA 3K30A 2NU6A 4CLOB 4IZHA 3EVNA 5CG1A 1PGOA 4LW8A 3ABIA 5L7YA 1M6WA 5JAIA 2X4GA 3DZBA 2VZ9A 3GHHA 4CL8A 4CLRA 3QRWA 1XEAA 4YPOA 4GX1A 3GAFA 4DL9A 2Y0EA 4J9UE 4RPHA 1KBZA 1BGVA 5HWSA 2E49A 2HRBA 2JCVA 2Y1GA 1KEVA 5DBGA 2JAHA 1DFGA 3BMCB 3VPGA 1E7MA 4PGFA 4CLRB 4TKLA 2GN8A 4ZQHA 1YQXA 4YAGA 4W9NC 5KJEA 1Q7CA 4UREA 4J7CA 4L76A 1YL7A 1Y7TA 1ZK3A 3TNLA 3KSDO 4F45A 4AJHA 4U0KA 3F6YA 3WR5A 1ULUA 4GAEA 4E3ZA 4N54A 3TZKA 5L7WA 2EGGA 3HE3A 4IMRA 1NR7A 4EUFA 2FHSA 4R5MA 2GZ3A 4PLTA 4D43A 3OIFA 5L4NA 1ZSNA 3KHUA 1JLLA 3JD2A 1KEPA 4Z3DA 5B4VA 3BAZA 5ICMA 1MG5A 4IMPA 3BMOA 3ZWVA 3LLVA 3BYZA 1LRLA 3TFQA 1DEHA 4B3JA 4CV3A 1NPYA 1Z7BA 4FR5A 2NU8A 2JHFA 1EUCA 1O8CA 5LDHA 1JDJA 4TZKA 1EUZA 1E3IA 3AM3A 4KQWA 3KSZO 3L0DA 4HFJA 1A4UA 2OP0A 4DBVO 4ND1A 2VOEA 4S3MA 4OKIA 3N7UA 1SEVA 4EEXA 4ZQBA 3ZV5A 1MLDA 4XB1A 1O9BA 4U0JA 1UH5A 4DXHA 1LU9A 1IULA 3ZWPA 3ZWCA 2BRUA 3AUAA 5IJZA 5JC1A 1DAOA 1M6HA 1ID1A 3RD5A 3PYXA 1JN0A 2AQHA 3GOHA 4F3YA 2OFPA 3IIEA 3JQ7B 1DC3A 2O3JA 1ISMA 1QG6A 3Q3CA 3S1LA 3UCEA 4IDBA 3BTVA 5DF1A 2D5AA 4OYRA 1LA2A 1QR6A 2GUGA 1E7YA 4E31A 1ISFA 2NSDA 3F5SA 2OP1A 3PLRA 4GGPA 4IQ0A 3Q9UA 1BDBA 4OIMA 4UVHA 3TZQA 1JW9B 1MG0A 1XWFA 1VPDA 2NU7A 1X14A 2X9VA 4AFNA 3PWSA 5I7EA 4IDDA 4R9SA 4FOOA 4Q3BA 1T2EA 1T24A 4XCVA 4BO7A 3FSRA 2YHIA 4XYGA 1F0YA 3INTA 4FFRA 5TGDA 4FB5A 3INGA 5JAZA 1TVEA 2I3GA 1PJCA 2OMEA 3FNHA 3NT4A 4Q3AA 3TWOA 2BFPA 1KVUA 2RHCA 1LLUA 2ZJ1A 4GH5A 3VPXA 2JAPA 1H5QA 3E9MA 1X0VA 3BTUA 3D3EA 1GCUA 2ZIZA 3M2PA 5JPIA 4O59O 1ZXBA 1NQTA 3ZWWA 4BUCA 4O1MA 4B4VA 3PK0A 2FRDA 5GY7A 4HV4A 4YA6A 3FWNA 4IINA 2CMDA 3JQCA 3SLKA 1VI2A 1ZBQA 2B5VA 4L9RA 3Q1LA 2UAGA 1XR3A 2JCYA 3V5NA 1V9LA 4U5QA 4Y6RA 2Q2WA 4HFNA 3CSDA 3DOCA 3HQ4O 4BO2A 3C8MA 5L53A 3BTOA 5FWNA 3PXXA 3LVFO 4DLBA 3RFVA 4NBRA 2X58A 2IXBA 4DQXA 1JVSA 4BO5A 1L7EA 2NTNA 2QIOA 1TB4A 3ZNNA 1EBFA 1T1SA 3VH2A 2GCGA 1PJ3A 1DXYA 1TT5A 3OFSA 5AVOA 4FQ8A 3I1JA 3WOHA 2NVWA 1V8BA 1AHHA 3GVIA 4RL6A 5CP8A 3NAQA 2VZ8A 1W0CA 4U6QA 3LT4A 4ZQEA 3RBZA 2HJSA 5JMPA 4E0BA 5MDHA 3D0OA 2IZ1A 3RBXA 1VE9A 3TFOA 1ZKMA 2AQ8A 1MFZA 2H9IA 4CQLA 1BHSA 4BNNA 1TT5B 1UDCA 3ITDA 1EK5A 3ETDA 4OQYA 1C1XB 2DLDA 1SOWA 1U5AA 4YRAA 2P9GA 4YT8A 3PZRA 4XQCA 2GPTA 1E7RA 3OIGA 1DJQA 1GL3A 3DBLA 1A7AA 3DO5A 3WGIA 3GPDG 5TRTA 4FFPA 1B15A 2NUAA 4L4SA 2ZQZA 1MA0A 2IODA 3WYEA 3KTDA 1PZFA 3RSHA 4JK3A 2W2KB 3PI7A 2FR8A 5CPBA 4I9HA 3A4VA 4WASA 4O0LA 4KUHA 4TMFA 5DZSA 3DTTA 4CMGA 2CF6A 3CZRA 3E18A 4CMBA 2IXAA 1HDXA 3F4BA 1VJ0A 3HWRA 2W2LD 2I9PA 4MIOA 3LSYA 4R54A 4MP3A 1P1JA 3UGKA 3G79A 3GGOA 3L6EA 3PZBA 3PEFA 1B14A 3WTCA 2DAPA 4JBIA 2X23A 3UCFA 4QX6A 1EQ2A 1G6KA 1QP8A 2PTGA 1NVTA 4IS2A 2FPGA 3ONDA 3KXDA 2Q1TA 4RF4A 1EDZA 2VHXA 1HTBA 4PLPA 1OC4A 1JA9A 3ST7A 5COAA 2W2LA 4G5HA 1DPGA 2GYYA 1O6ZA 1IZ0A 1D8AA 4HX5A 2VUUA 1J4AA 5JY1A 4NHEA 3ZU5A 5IXSA 3A14A 3BHJA 5EPOA 2VNAA 1X13A 1Y5RA 1Z75A 3K2EA 1YXMA 4ALMA 3AY7A 4KOAA 4FOSA 2CVQA 3HUDA 3H2SA 4B4OA 3DAFA 4FCCA 3H9EO 1U3TA 1HSZA 2RIRA 3QW2A 1ADBA 5AXDA 1PX0A 4DA9A 1BSVA 1QV7A 1PJTA 3F46A 2JD0A 2X6TA 4ZRNA 4PLHA 2AE2A 1T25A 1TEHA 2HRZA 2Q50A 3GG9A 3LC2O 1UZMA 2B4TO 2ZB8A 3E5RA 1EDOA 3GH3A 3PIIA 5JLAA 1E5QA 5KVQA 1HT0A 3ZWYA 3S8MA 1BVUA 3I6IA 4NJMA 2I76A 3WJ7A 4CUJA 2GRAA 4BKRA 4UUNA 1X7HA 3DFUA 1VKNA 2O3UA 4ZN6A 5CEJA 3GGGA 5TC4A 2PKQP 1MGOA 1GY8A 4GVXA 1QYDA 1HKUA 1E6UA 1YB4A 1E6EA 3I6QA 2Y67A 5JYEA 1K3TA 1N1GA 2DBQA 3PGXA 1WZIA 3NDRA 2IEBA 5KJCA 2G5CA 2P91A 4QXMA 5A1TA 1LDGA 3H9QA 4I5DA 5G2OA 1ZK4A 3IDSA 2DUUA 4NI5A 2D2IA 1ISGA 3HDQA 4CJXA 1SO8A 5TS3A 3PDJA 4BO8A 3EHEA 1Y81A 4U8GA 1A7KA 2WJPA 3PFFA 4CLXA 4YCAA 3X2EA 4B3HA 1N9GB 4KZPA 2BFMA 1HL3A 2JCXA 5FI5A 4X54A 1LDYA 4UEKA 4BNZA 4PVDA 4CLDA 4TROA 4K6FA 1L7DA 1AXEA 3ZI0A 4CMAA 1U8XX 3C3XA 3H6KA 3ZNPA 1HEUA 3GG2A 1MC5A 1P1RA 1QORA 1DC5A 3WGYA 2X0NA 4RQTA 2O50A 4WK6A 1PJBA 1QMGA 1ZUD1 2EKQA 4MIYA 4QT0A 3AY3A 4Y9DA 4M1QA 4CM9A 4I5GA 4BNTA 1UP7A 4JROA 4BO6A 3ROPA 3V2HA 1JWBB 3WBBA 4XYLA 5IN4A 4D0SA 4P4LA 2NWQA 3KB6A 1NFRA 4XYBA 1UZNA 4CM1A 4PLCA 4A2CA 1PWZA 2R00A 5F1KA 1X1EA 5KVVA 2DPHA 2PK3A 3WQSB 4CM7A 3ROKA 1U28A 4NJOA 5DDIP 3BMNB 4W99A 2EEZA 1A9YA 4K26A 1YE3A 1QYWA 2EP5A 1KIFA 4XEHA 4B4UA 4OMUA 3ZNQA 2EJWA 4CV2A 5BQFA 1A72A 2B83A 4YDRA 4OKNA 4FFNA 3HADA 1XSEA 1KEWA 5A5EA 2AG5A 4BNGA 1E7QA 3UAGA 2HU2A 3GPIA 2RCYA 2J3IA 2VN8A 1OOEA 2H1SA 1LDEA 3PDUA 3GNSA 4L0QA 1R4MB 3IMFA 1KC1A 1NQ5A 2PY6A 4ALNA 5C7OO 5BSHA 4YBZA 1PL6A 2Q49A 4A7PA 4AICA 2QRJA 3ZWOA 3DAPA 5KVCA 1BXGA 4MPDA 3U4CA 1E3LA 2YQ4A 2O3TA 4CLEA 2D59A 1U5CA 5BNTA 3HFSA 9LDTA 3MJEA 4UVEA 1FDTA 3DBRA 1F8FA 1MP0A 1DJNA 1P1FA 1WDLA 4FD3A 2NADA 2GF2A 2AQIA 4F6CA 2CY0A 1BXGB 4B7XA 1A9ZA 5LDGA 1OI7A 2NTVA 4TRMA 1RM4A 5T64A 4E5MA 5DP1A 1K0UA 5K0ZA 1B0AA 4Z9XA 4R16A 4YXFA 3OJFA 4TRNA 3MZ0A 4TKMA 2TMDA 2Y1DA 3FHLA 3QJ5A 3PLNA 5HS6A 3GN1A 2HMWA 4JGBA 1IUKA 3WX0A 1M2WA 1A71A 2GR9A 2WYWA 2X5OA 3JQDA 4NK4A 3WGHA 5IDWA 5JO0A 5A3VA 1E3WA 1CQJA 1PQUA 3JQ6A 3ZU3A 1XKQA 2P68A 3WFIA 1YO6A 3KYBA 2O3RA 2EG9A 3GEMA 5G0WA 2X22A 3AOEA 3GDFA 5U4QA 4WCFA 3KYDB 4L4RA 3U49A 4HADA 3S2IA 5DCUA 1ZMTA 2C59A 3EW7A 1P77A 5JBIA 3G0OA 5KJFA 1GUYA 3ICPA 3RCBA 3RC9A 3OJEA 4Z0HO 1KYQA 1HDZA 1VKOA 3SJ7A 3SXPA 2PR2A 1NVGA 3LF1A 1GQQA 1LLDA 4R41A 4HFRA 4BO0A 2J5QA 1RPNA 1D1SA 1UP4A 4RLSA 3PHLA 2NTJA 5JFOA 2JD1A 2JD2A 3D5TA 1HYGA 5ITVA 2OXIA 3PQEA 2Q46A 3DONA 4AJIA 1HZJA 2X1HA 4P38A 1X1TA 3C24A 2DQ4A 2XXJA 4PVCA 4QO8A 3O9ZA 4YRBA 1GUZA 4P4NA 1B8VA 4L4XA 1GYQA 5A9SA 1FDUA 3ANNA 1ZEJA 1DFHA 3WIEA 1KY5A 3TF5A 4WEQA 1YQDA 4QO7A 3SX2A 1LSSA 4D46A 3EGOA 1GDHA 3RKRA 1E5LA 4XA8A 4WNIA 2VHWA 5IAAA 4G65A 1UUFA 6ADHA 3D64A 4IGEA 4RJTA 3C7DB 1I0ZA 1VSVA 1LEHA 4ZQFA 3ZCXA 5MGBA 2VT2A 4U7WA 2Z95A 3IJRA 2DTXA 1HLPA 1Z74A 2RHRA 4Y98A 2VHZA 3NJ4A 1PGPA 1SB8A 2CSUA 3TN7A 3WGGA 4BL5A 3HN7A 3RC1A 1R6DA 4NQZA 1DIAA 2GD1O 3ENKA 3M1AA 4MDHA 4AJKA 4RO0A 2B4RO 2HMSA 1CERA 4PG7A 3K92A 4EI2A 2I67A 3QA9A 2DUWA 4XIJA 5HBRA 5GZ3A 3W8EA 4PIVA 1K2WA 5U1PA 1R0LA 5TT1A 4AG3A 3DBHB 3MJVA 3P19A 4I8XA 4BNXA 2WSBA 3WFJA 5HRUA 3RUAA 5F21A 3S2FA 4HXYA 1DLIA 4E5YA 1E3EA 3JD0A 1LRKA 1H9BA 4J1TA 3OJLA 2B69A 2VYND 1UXKA 1AHIA 3TZHA 1LBEA 1S7CA 3IC5A 4J4TA 2TMGA 3ZWAA 3VZPA 1CF2O 3QHAA 1ZO8A 1FDVA 3BMQA 5K6AA 4R51A 1R16A 5H82A 4CM5A 1A5ZA 4MKRA 5AXBA 1G0OA 4AJNA 4C7KA 2YV3A 2AHRA 3BHIA 2IE0A 3FNFA 4W82A 4WGGA 4XWYA 5LC1A 4NBUA 2FPPA 3RKUA 4R1TA 4JJFA 2VYNA 5I7VA 3H65A 3OA2A 1H6BA 3PYLA 1XCBA 4B8WA 1YDWA 1EVJA 2IRWA 2JJYA 2QW8A 3LZ6A 1CWUA 1PJLA 4BV9A 1ONOA 2ET6A 4LGVA 4AL4A 1R4NA 1VJ1A 4WKGA 2BFAA 4WOKA 2WE8A 3P7MA 1H0KA 3QWAA 5ITWA 4WLVA 2Y68A 4IDGA 1TLTA 3R3JA 1B16A 1ISIA 4YYZA 2B0JA 1V3UA 1SNYA 2PWZA 4WJZA
chains in the Genus database with same CATH superfamily
3HGMA 2GQ0A 3D4IA 2XYPA 4CLOA 1L8QA 4M1TA 3HXLA 5HE9A 4NCBA 2JASA 4K9KA 1Y82A 2YNMA 3TDMA 2WIBA 5TIIA 1G19A 2PG3A 4IJKA 4OL9A 5LM3A 4E6EA 1X42A 4MCJA 1Q84A 4QTYA 4XQEA 3ZDAA 2ZBFA 1MEOA 3EULA 3SX4A 1KK1A 2O59A 3T4EA 1EGVB 4XB6B 4XB2A 2FEXA 2D1QA 2VEOA 3OICA 3FCAA 2AEFA 2VR1A 3ZZ0A 3MWEB 4H16A 4ZGWA 5NULA 2HBRA 3G2QA 5EJ9A 4YMWA 4LX8A 3UXYA 4IH1A 1LPMA 1YZGA 4JKIA 2J9FA 5DW0A 2GCOB 4IEIA 5A6SA 4GRDA 5HMMA 3BXOA 1KEEA 5KNCH 1EVLA 2DPYA 1H2BA 4G25A 4JJ8A 3ZHYA 4YRJA 4BGVA 4OFWA 1YUMA 2C07A 3WNVA 3T4XA 4B5LA 2RHMA 4KH1A 2E0IA 3EZ6A 3PG5A 1HYQA 3E9RA 1NZJA 1IVNA 3PGJA 3PKJA 3Q41A 3QWBA 4G86A 4R0NA 2M1ZA 4GLFA 4JUFA 2VQ3A 5JXWA 2PMKA 3FCEA 1P7CA 2RHGB 5KJ6A 1N25A 3PUYA 1ZQ9A 4UXHA 4GLBA 4L78A 1HK7A 2AOUB 1KEEB 1E3JA 4DBLE 2H85A 3A27A 3MS4A 3NT2A 1HYBA 2IYPA 2AYZA 4OU4A 3SOZA 4BNIA 4DGQA 5K0JA 1Y6JA 4DA0A 5LA6B 3ZHXA 2HSGA 3O2NA 3K0HA 1MU0A 3ZCRA 3N0XA 3E2MA 5DNEA 2F4NA 3IT1A 1JG1A 1U2RA 2XXAB 1COWA 4UE2A 1QUEA 2V7VA 4LQCA 5ECDA 5ES4B 3VR5A 1NIPA 4CIYA 3VMMA 3BHNA 2G7ZA 1I10A 2Q7DA 1TQ8A 2O2YA 3P2OA 4MV4A 3W8DA 1FMFA 4OHYA 4FN5A 2G83A 1W4BA 2RGRA 3ZD7A 1KU0A 5FWAA 3ZZ1A 3FWHA 1JXAA 4LXGA 1PHPA 2GAAA 3DFFA 4OMCA 3M1LA 4U2DA 4KQMA 3HB7A 1Y1QA 5C34B 1ZD8A 2D5BA 4Z6KA 4FBLA 4H3KB 4EPXA 5F23A 1RHUA 2YYAA 4ZDKA 1X87A 4FBMA 4XGKA 4GRAA 4NR0A 3RHSA 1RJ9A 1NNEA 1T5DX 3OQNA 2XX3A 1TPYA 1J0XO 1RYDA 4PPFA 5DN6D 4UNPA 4Q3NA 3KVOA 3MCVA 1JFVA 4HWRA 4TMVA 4MGKR 1P1HA 3HFGA 3HNPA 4CI9A 1ZD4A 5L4LA 5E7MA 3ZX4A 1VPLA 1T6BY 1OD6A 4AJ4A 1Q3KA 1QWOA 4I4IA 1HYHA 5FPYA 3LS2A 2JAQA 2V59A 1QH1A 2OM6A 4RHCA 3HDHA 4KQ2A 1Y4DE 1XBTA 1YNSA 3SJUA 1KKLA 4QOFA 2PJUA 3CX6A 3OLWA 1FSSA 2IS6A 3HR4A 4R9NA 1CC1S 1TI7A 1H2FA 5KTNA 2Q2OA 3CRRA 5DV9A 1QAOA 2XR1A 2YCBA 2K4MA 2XPCA 3FNBA 3NBKA 4HZGA 4M9QA 4HDKA 3RF7A 4KAFA 3A7DA 3B1ZA 1HRDA 1AA9A 4LZWA 4HQLA 3OOWA 2BHLA 3KU4A 4OA8A 2FK7A 2XBUA 2QNBA 2RJ3A 3UUGA 3DDOA 2G0AA 1BCRB 4LZZA 4O1IA 4GOMD 4A6EA 5HRAA 1T3HA 2X1VA 2BGUA 4N3BA 2VPTA 5KTSA 4FWTA 5E8RA 1DCFA 5DMHA 4YJGB 5GV8A 4IXDA 2XA2A 1N3IA 5FPTA 4J4HA 1U6KA 1L3CA 2WHXA 1NNI1 1YKFA 3GUHA 1DGQA 1S2MA 1GAQA 3EVTA 3I5MA 3C2QA 2H51A 1U5BA 4QTUB 2GKOA 3AI1A 1KMMA 3IOCA 5DHTA 1CIVA 1PLJA 3N53A 5FO0A 4DPKA 1OXBB 3WKBA 5F76A 4ZAWA 1WB6A 3U62A 4R3UC 5DLQC 1WXWA 4NAUA 1Z5NA 2AE1A 2YKGA 3JSAA 2FWIA 1G7RA 4NYIQ 5F51A 1XELA 2EYUA 2YRWA 3O8QB 3O92A 3QFRA 2YHUA 3CBQA 4RS4A 1N3YA 2H7VA 3PFHA 1QJCA 1EK0A 1QBKC 2UZ4A 3QF7A 4B6SA 2CNNA 2ZRDA 3NDJA 2NVOA 4WLFA 1E3MA 1Y3HA 4LZNA 4OMDA 1G16A 5TGTA 3V4OA 4O2AA 1L4GA 1QIIA 4YCBA 4TTPA 1KE1A 1ZYUA 1WULS 1A69A 2DE0X 3BFVA 3NFRA 3W79A 3EB9A 3K70B 3OURA 3IP3A 1NVVQ 5JNTA 3HEBA 5AVXA 1L5VA 2VJKA 2IEYA 3CUVA 4TTTS 1JIVA 5HJ5A 1DIGA 2D62A 4FJ2A 4MWCA 3RREA 2ZWAA 3U48A 3H5RA 5ILGA 2C04A 2XSZD 2BHSA 3O2SB 2YWBA 1FNDA 1Z28A 3ZVLA 2X42A 2PNFA 1XMIA 5I48A 4OJYA 4XGIA 3SSMA 2UZ1B 3N59A 2Z6AA 4S1WA 2YV2A 3GUCA 3A04A 3SM9A 4Z8YA 2ZR7A 1M0TA 2ZB3A 3KL2A 3DOJA 4YRLA 5ALXA 1V6AA 1US8A 4AN0A 1C1XA 4XWGA 3WC4A 3WK8A 3ZHUA 4LVCA 1XA0A 1YT5A 2J32A 1SQ5A 5LQRA 3T7TA 1VHDA 1WTCA 3LGSA 5FF9A 3SQDA 2XUFA 2GBCA 2HXYA 3JX9A 1G9SA 5D00A 4A5SA 4IQ4A 4M8NE 4TTRA 1NKSA 1WEKA 3KOMA 4MB2A 4MYTA 4ZHQF 4Q24A 4TYNA 1KZ9A 1DRKA 1TT7A 1J6UA 1QONA 2BMFA 1US8B 2OBFA 2Z8ZA 2ZYGA 1EZ4A 4IIJB 2WMDA 4RY0A 3WYDA 5BOSA 2XT9A 1FJ2A 4YJFA 3QEKA 2N46A 1ONNA 3ZE7A 2H2FA 3ANXA 1KAOA 2NO6A 3VPFA 1P6UA 1XTBA 2PO7A 5ESWA 3HUTA 3NX4A 5JWRA 4Z4EA 1M0SA 1YACA 4BNUA 1MIOB 5CGQB 1QGED 1UBLS 1ZM3A 4KNVA 5A7GA 3NVMB 3KEFA 1TEXA 4RH0A 1VKRA 2Y71A 3FMIA 4IVRA 2IEDA 4DDWA 1E3DA 1KZ6A 2CXHA 2J5BA 3PTLA 4NX2A 1GNPA 1FU8A 3L6DA 4YJFB 4EG0A 5SICE 3V8RA 4UZFA 4IZ6A 5ICEA 5LQAA 4OX9Y 1GUAA 4GXTA 2HTFA 4YRPA 3NBMA 4PEVA 3WGOA 2BW0A 1E1LA 1UPBA 1U8CB 1KFEB 3CLHA 4GQBA 5BWBA 2VP0A 2ZBVA 3CZ5A 3LV8A 1YZ3A 3R0IA 1IZYA 4B31A 2QE7D 1R6TA 1IY1A 4TV8B 2CHGA 4MMZB 4ZO8A 4ZOLA 4DB2A 2HNBA 4WCFC 4KWHA 3TLBA 1SK9A 1RPAA 3D8HA 4I9FA 4NV3A 4DYHA 4BRWA 2FDRA 4F9EA 2YJ6A 3W6UA 1F0KA 4ZVMA 4GI3A 4C43A 5BQOA 3WSWA 5DK6A 2G1UA 3EPJA 1MJFA 1ZIOA 4N5HX 3PQFA 1O1YA 2CDCA 4LSMA 3VKVA 1ZEMA 2AW5A 1YDMA 1CJBA 3A10A 4PN3A 1Z6XA 1IFXA 1V5FA 2ICAA 1K89A 2R25B 2RGNC 3RYIA 5B3JC 1W36C 3BUSA 5FTJA 3THRA 4D4KA 3SHOA 2ERCA 1MJGM 5FNVF 5LQJA 1Q95A 1O9HA 6CHYA 3WGZA 1ORDA 2B1IA 2J3QA 3ONWA 4QHTA 1QUFA 2DMRA 2EXXA 4MS4B 1NJGA 3DEAA 5FBKA 4EW6A 4CKZA 4HX9A 3TRKA 1L7VC 1IPFA 1FTSA 621PA 2QN1A 3VKHA 4R6WA 1SZDA 5G0UA 2ZTMA 3RAEC 1WDTA 2XNKA 1UK8A 1VLHA 2PV7A 2QVYX 4UBIA 1JPVA 3RYIB 1KO1A 8OHMA 3B1FA 4INPA 1EJ6A 2DYKA 5EE3A 1HOXA 5BN1A 5KEIA 3ZDEA 1PWYE 2QI9C 1W88B 2QMZA 1GQFA 1H2HA 4ZD6A 3S2EA 4UTNA 1AQNA 3O7WA 4KYIB 4BKMA 3QEBZ 4YWJA 3CJTA 5BR7A 4LISA 3QVWA 4IOLA 5IKOA 4F5ZA 2EARA 3TRFA 2JGNA 3WWDA 1AQJA 4FOPA 4QQRA 1I5RA 4XVRA 3AVPA 1TZKA 4DWJA 2F48A 3BM5A 2AN9A 3FPAA 4OH1A 1W0KD 2QD5A 4AF8A 4BQNA 2ZE8A 1AU9A 1SA0A 3P9RA 5DASA 2D5IA 3AF3A 5E1OA 1KJJA 1NR1A 4LHWA 2IZZA 2GXUA 3OJ0A 3TQIA 2O3SA 1OLOA 1O96A 4Q3OA 1Z6PA 4S05A 3NQ41 1E64A 4W9RA 4U7FA 4C4OA 3P0JA 4CQMB 1BXKA 1E2HA 5EJFA 4RENA 2Y0CA 3HDYA 4FW9A 4KIFA 5JJBA 1GGEA 2B78A 3OQ6A 4P98A 2X0DA 1NXSA 4AZVA 1NI3A 3TEFA 2RHLA 3UTDA 3G5TA 1NG1A 4UFOA 2C42A 2BHRA 1NTOA 1A9QA 3QM1A 1NU6A 4HN4B 1UPUA 4LXUA 4MDYA 3UMVA 2G63A 5TQ0B 1I7NA 3T1HB 1WP9A 4JI8B 1BMFA 1XN4A 2ZAOA 2ECOA 4GMDA 3GBSA 5IF9A 1HFKA 2Z8YA 3MB5A 2BD0A 1QLWA 1KEUA 1FYWA 4IH9A 2XYVA 2YFYA 4DPLA 1DTSA 4HEA1 4C4TA 2K6GA 1U1EA 1XQXA 3R7WB 1HGXA 4EMUA 5ALMA 4BTVA 3ESZA 5CCXA 2ZXUA 4OM8A 4GBED 4MWEA 3GLIE 1Z0JA 4PO9A 2H17A 4PG4A 2JLVA 5CNMA 4KPYA 1Z4MA 3O4VA 1J2UA 3ZCVA 3DF7A 1C50A 1A9SA 3Q3JB 4K03A 4QA9A 4RKYA 2M2IA 2CD7A 4YCCA 2IY9A 3B48A 3A1TA 1T6NA 4TTQA 2QTBA 1VL0A 2Z5VA 3RSGA 2RHOA 4MH0R 1E6CA 2HFKA 4YB8A 5ALTA 4XX0A 3KEOA 2IUTA 3TAHA 4L50A 1EX7A 1Y8ZA 2ZUDA 1ODJA 5CM9C 3EX7C 2DHCA 3ZK7A 2I7VA 5JAIA 4BRZA 3FD8A 4AIRA 1ATIA 4YCNA 3GMDA 1CY2A 1ZBDA 1J8VA 4Q5IA 3CRMA 4DJJA 3SIPA 2CNWD 1TYDE 2WSSA 3GBVA 1CUUA 2OFWA 5LFAA 1I6MA 3D9QX 5ECGC 4DS3A 4XX0B 2X2FA 3CCCA 3RSFA 1B42A 1L5ZA 3P9XA 5D7NA 4BO1A 4CL2A 2VS1A 1IHOA 2ZRLA 3Q0EA 3G2PA 4G8CA 5BNFA 5EG5A 2ZYAA 4LJYA 1V71A 3SIRA 2Q9BA 5BUCA 2DHDA 4U6SA 2PH7A 4QOIA 4DJEC 1ES9A 1HORA 4ZVRA 1CP2A 5CYFA 5C4MA 1QJ4A 2CNKA 2PVCA 1JQLB 2YJ3A 1X7XB 3LAWA 1DX4A 5IFKA 1XZCA 3MBOA 2A0FA 1R4MA 4ARZA 3A06A 4E2ZA 4ZI7F 2YY7A 1IHPA 1X1BA 5BORA 4OXQA 5CHYA 3ANMA 5SZKB 5A9RA 2ZCVA 1OI2A 2V7WA 3AL3A 1V0JA 3BGOS 3PUHA 1JBKA 4NNPA 4PSDA 3X0DA 3E9EA 3FBTA 4OQNA 3GVPA 2GSDA 1UBMS 4QATA 2R1VA 2DJIA 2PA0A 1RJWA 4YALA 1S3GA 4KO1S 1CB0A 9MHTA 3LQ2A 3OQOA 3BIFA 3EXG1 1Z22A 3EK2A 3JQ8B 4JYZA 4URYR 4RTPA 5HM8A 4U2EA 3AR5A 3ADOA 3Q98A 1WETA 3KVNA 2VDWB 3EEIA 2RGEA 2WFZA 3G7NA 1D2RA 1P2TA 2NO4A 3EISA 1CDOA 3YASA 4OHCA 1THMA 5AW8A 3BJRA 2JGDA 3T3PB 3GNLA 3BZWA 3KB2A 3AI2A 2FK8A 2C4HA 4RFSB 4B0OA 4D82A 1XEXB 4KFTA 4F91B 2AG6A 3KWFA 3MYRA 1P0IA 3KPYA 3N6VA 2YY6A 4LNAA 3R7NA 1QHNA 3SC4A 2IYFA 1WW8A 4B46A 4PZYA 5EVCA 1MB3A 2HJWA 4HGQA 3COWA 4UE6A 2O5EA 2GN6A 1E2DA 3JQEA 4TV9A 2ZJAA 1XP8A 2FWNA 3NBQA 4DC9A 2NZWA 4OHZA 2EIXA 4UBMA 4PZPA 1ST3A 1XTUA 4UCXA 1G5IA 2EX0A 3I83A 1XPJA 3H5WA 1DAHA 3HLTA 2C2KA 1I0IA 1XL0A 1Q6YA 1UIRA 2PKQO 3LXRA 3L7DA 4P84A 2O0JA 3WWEA 3DDSA 1VIAA 3H6GA 4HSGA 4IX9A 1OR8A 3FKSA 3EZXA 3Q5EA 3VO1A 4UOQA 1C7RA 4CMKA 1AXGA 2FSFA 5HTOA 1YB1A 1VB3A 1JG3A 4BS9A 4MV1A 5FEUA 5J2TB 4OI0A 3KYDA 4TV9B 5AI9A 4GKVA 3VTKA 4Z4GA 2QMQA 5A05A 2AVDA 4B6PA 3PJEA 1KI7A 5IDXA 3ZS9A 1UKYA 4NOLA 4XAQA 1NM5A 3A8TA 4JB2A 5AKHA 1XDZA 2J0QA 3GEGA 5HKKD 4Y6QA 1W44A 1RQ2A 3VPCA 1V5EA 5JSUA 3IR5A 1ODTC 4IJQA 3AF1A 1PVOA 1F2TA 3I04A 2QK4A 3KKKA 4MCAA 2ZYDA 4RNDB 3CF4G 4URZR 4C22A 2BFCA 3F6EX 1YA8A 2PUEA 3ZVRA 5KYVA 1F14A 1M33A 3WLPA 2BVNA 4UMFA 3IEVA 1ZSVA 5E4FA 4NS4A 4MHTA 4U7JA 3ZH2A 2WPDA 2BGMA 1RM0A 1DB3A 3PGVA 2DQSA 2XGOA 4BX9A 4R3WA 1H23A 1NF2A 2AJLI 2IIBA 4PO1A 2XGJA 3EMBA 3I73A 2VWHA 4M76B 1F2TB 4PLWA 1ODSA 5JXGA 2P0AA 3B3JA 4NC9A 4CMCA 5JS8A 2Q2VA 2C4UA 1WVIA 1LC0A 1UDBA 2JFFA 1SBNE 1RQPA 1LH0A 2ATIA 3A4TA 4M1YA 5JZVA 1MFPA 1PGQA 1KOGA 2HF2A 2HLDD 3ZWQA 4BAGA 1BX0A 4F5EA 4BNJA 2AD5A 4FCWA 3EDMA 3FJOA 3JRWA 5EYPB 3C4JA 3R9XA 1DBWA 5EQFA 2FN7A 1ZU4A 2BUCA 1CF4A 2AB0A 4MUHA 1O0BA 2YVUA 3AR8A 4GE0A 1A9XB 3G9TA 3O03A 4REMA 2XDQA 1UKEA 1W6UA 2HK9A 3NT5A 4BHTA 2B0CA 3NHMA 4D3ZA 2FQXA 3LK7A 4YCMA 3OJXA 3RSQA 2I1VB 2IYTA 4HLUC 4II2A 4HQRA 3UJBA 1NJ1A 3N5CA 3UK1A 1HSOA 1SCAA 1PS8A 2IZ5A 2KWIA 1B8OA 1FLNA 2BTQA 2PWYA 1QP4A 4JODA 2A86A 5KCZA 1JDSA 3BA1A 3FCCA 3L8CA 2C1ZA 4EY5A 2GN2A 4J1QA 4GMFA 3IT3A 3ONEA 1WMEA 1HE5A 4GOOD 1Y9EA 1KVRA 4V2UA 5I3CA 2Q45A 2ZB4A 1E4EB 3G9UA 4BIIA 3LGAA 1R0SA 5MF6A 3PPVA 4E2YA 1XPRA 2I2XB 3OCZA 4JITA 4QUBA 3GF4A 1CEEA 1Z2PX 2EZUA 1UJ2A 3TVDA 1H4VB 2RK6A 2BEVB 3ETJA 3I37X 4Z9FA 4XARA 4RXTA 1AK1A 4UCFA 5E6SA 2XUZA 3H5IA 4FFOA 4FN4A 2PXXA 3L7YA 2AMFA 3C6BA 3WRVA 3QLUA 1CQZA 3L8MA 3LGXA 3E58A 1KMIY 2ODAA 3EDOA 2ZYHA 1CUGA 4K87A 4EAAA 4I5EA 1E96A 3L4BC 4KACA 3B1JA 4G0MA 4MRMB 5MFZA 4MMYB 4F9GA 3N58A 2V0CA 4YT4A 3B1KA 5IWAB 2ADFA 4PZUA 1VHTA 1TTHA 3DKRA 3GLHA 4QECA 4MUMA 4R2MA 5C8VA 4J6FA 4A82A 4CKWA 5JVDF 1FQWA 1MN6A 1GPDG 3HO6A 2WSYB 4M9CA 1EGQA 4WXYB 4RULA 3NHJA 3BBLA 5LCXA 3UWOA 4HB4A 4ZPXA 5JFGA 1PSZA 1DIHA 4WY8A 3EEQA 4HH0A 2CXUA 4YRKA 3GZNA 4PQEA 3OZWA 4FX2A 3OQ1A 2C61A 4E32A 2OZKA 3CUSA 1PBNA 4EG5A 2DTDA 2BBWA 3KSBC 3DFZA 1W5TA 1GZSA 3JVUA 3ZGYA 2PZ8A 1YQ9A 4KXQA 4JBHA 1EEHA 4FJ0A 3TOXA 3FMFA 3OAAD 3FLMA 4KGVA 2I4TA 1GD1O 3ZWPA 4D0NA 1QWSA 4OLAA 3OCCA 1KO8A 3CO0S 4GQAA 4R01A 3H0KA 4Z9AA 2GF9A 1I33A 3GZNB 3D6TB 3LMKA 1P72A 2Z6VA 1D09A 2SECE 5BSTA 3O75A 5KYXA 1F6DA 3QVGB 5JXHA 1A4XA 1RNLA 4RVHA 5FOUA 5JNLA 3EIQA 5KUTA 4HUJA 4LY0A 1WVMA 4MKXA 4ZU3A 4Q6BA 5H0IA 3HJCA 3KZMA 1OU4A 1F5SA 3OEHA 3P8ZA 1WBBA 4DRZA 1WRBA 4R7GA 2J0SA 1QGUA 2QUAA 2PGLA 4QJBA 4YJDA 1II0A 3LTEA 3NLLA 1F4LA 2CLSA 1UZLA 2CKDA 2PDAA 3GFTA 1C0LA 3TKYA 4Y9UA 4P54A 1R8YA 4FP9A 2PEZA 2GAIA 3HB5X 4F8JA 5K1ZA 2OHIA 5ETJA 3X1WA 1GPH1 3FZEA 2PBZA 2WUEA 3IQHX 5EHGA 4IDPA 3TFWA 1KYZA 3DMNA 5BRAA 2IPOA 1SD1A 4HBZA 4YVFA 3TGLA 3SZMA 1PEYA 1YH3A 3I0ZA 4G0OA 1BVRA 2XYGA 4IDEA 2XDAA 5M34A 5JU6A 1N6KA 3I4FA 4UHDA 3TR6A 1AMOA 3WLIA 4LZLA 1HDYA 3UT6A 5LIRA 5M04A 1XNRB 2B21A 5HBGA 5B1EA 3HU2A 1I7DA 1FQOA 2OZEA 5L40A 1OFHA 3GRCA 4LJ6A 3CPHA 4ZHSA 5DGTA 1VL8A 3COVA 5G0VA 6LDHA 2OO3A 3HCAA 2RD2A 2DUNA 2XODA 3EQ9A 2G36A 1FVHA 3TLGA 4NY1A 5EUBA 1XI2A 1GZUA 1T9DA 2WKRA 3EUAA 2O7SA 4LXXA 5T8KA 2A0UA 3V6LA 2I87A 3B89A 4J49A 3MB8A 2QEQA 2XCUA 2QZSA 5JISA 2OD9A 5AI4A 5COBA 3OCYA 2A94A 4NBLA 1GT91 2Z4TA 1IEWA 1PEDA 3KSUA 3PTZA 3TJRA 4KSYA 1F7UA 5IK2D 4G37A 1KC3A 3CVVA 3IV7A 1W8DA 2V6MA 1HLDA 4GX5A 3WICA 3EZYA 3O8NA 3PEUA 1C30B 2ZJ3A 3RWBA 4B7XA 1K6XA 2GD2A 1EMDA 4FWIB 2P65A 5HZGA 1ARZA 3E15A 4BATA 5LQDA 2H4ZA 2PWBA 1GG2A 1VL5A 2NZUG 3T95A 3AG5A 3AUTA 1M8FA 3PJFA 4EOGA 4O02B 2JLWA 1N4AA 2YIJA 3NTLA 4MVJP 1SOMA 5B2EA 1ZLXA 1ZN9A 3FGZA 1P75A 2Z2XA 1OSNA 5EKSA 2XBLA 3PQCA 2FPOA 3KWLA 3LY9A 1ICIA 4QLOA 2W37A 2W2MA 4NIMA 3TDNA 1YB5A 2WBLC 4ENPA 5CBPA 2QQ5A 4QAJA 3FZGA 2X4IA 5IKPA 2W4QA 3QE3A 3LE8A 4RKEA 5IBPA 4E46A 2ZRQA 1P5RA 1IJKA 2I1QA 2C82A 1ZIYA 3IQFA 1CEXA 1RE0A 1Q2UA 3ONFA 1KI3A 1TYAE 3FMOB 3P0HA 4JT8A 4PZAA 4UTPA 3GP8A 4OFZA 2HJRA 4K0KB 5B6JA 2ZRMA 4FILA 2AK3A 5NLLA 3OPYA 5CBPB 2I2DA 1YFZA 1GARA 3MW8A 4NH4A 2QVCA 1KERA 4GL2A 4N0MA 4MVJA 3G6KA 1C8BA 1YZFA 1LLFA 2R68A 3WMXA 1OYWA 3HHPA 4PLVA 3VC3A 3HA5A 1WF3A 2IS2A 1UMBB 3H9GA 1PVDA 4LYGA 3UJ7A 5CDSA 2JLXA 1UPXA 5FOXA 3O8OA 5ECWA 2PEYA 4BEWA 5KQMA 5GADl 3W5HA 2MU1A 3OPYB 3WO1A 3U6KA 3SYRA 1K6EA 1N7HA 2I29A 3N86A 5D3QA 3VYRB 3W1EA 3EPLA 3HU5A 3K09C 3OUUA 3PUZA 3J81k 3MWJA 1KY4A 1NBEA 2XDWA 5EKDA 4Z4IA 2Z3VA 3HI4A 2AA3A 3EOBI 5BQ3A 2V54A 3PRHA 2D6FA 4V1CA 1USUA 1QIJA 2PD3A 3F9RA 2WNHA 3O8OB 4I6JA 2GAJA 4M0FA 4WK4B 4C03A 3WWYA 1ZK1A 4U7TB 3U4HA 3KT3A 1EVYA 1WXXA 1GTVA 4V03A 1H93A 4ZVOA 1PSWA 1GTMA 1X3SA 1NN0A 2PH5A 1WHSA 4GEKA 3SAJA 2BTOA 2O1XA 4EZBA 1ECFA 3GLRA 4HB0A 4HNGA 4YQZA 3DOOA 3X1KA 1RWBA 1NQWA 2X8JA 1J09A 1LLCA 1O6FA 1EZ1A 2R4QA 1XVUA 5TJ9A 3C0KA 3ESDA 4BFUA 2GO7A 3DHYA 1O97C 2CFOA 4IJ6A 1V96A 5J4YA 1H8HD 3T9DA 1OBFO 2LXNA 4XUGB 2ZS9A 5FD8A 3ADBA 3M6WA 1M10A 2OV8A 4QQNA 3HCWA 1U2SA 3UJDA 1T0BA 5AUNB 3VDQA 1SD5A 1YWGO 2BLLA 2VLIA 4RF2A 3F3YA 1ZHFA 1LWOA 1E1NA 1PS9A 5K0GA 2OCLA 4WT7A 4ZICA 4L08A 5ILOA 3LKVA 5JY6A 2UXBB 2WFLA 1EFLA 1R37A 2J3JA 3FI0A 5EQDA 4XPIA 4C4ZA 1JALA 4QXQA 3ETLA 2W0MA 5EINA 2O2ZA 4JQCA 1X1RA 4QEZA 3OKAA 1Z45A 2O2GA 1FTGA 3T12A 2BTEA 3MJRA 2WJ3A 1ECJA 2SKCA 3KKNA 1K5HA 3WG9A 1UPFA 2XMRA 1FP1D 1KMQA 1LBQA 3MRXA 1DBPA 2I4NA 3FAKA 4NK5A 4ZU1X 4TYQA 1YR7A 3PCRB 4QEKA 3S40A 5CT4A 3H1PA 3GJRA 3RIHA 1DVRA 3MK31 4XIYA 1ENYA 1LJLA 2V96A 3DL2A 2ZRPA 4MJLA 2WUFA 4FI3C 2Y2UA 4MEAA 3PXEA 3TMYA 2C5SA 1KDZA 4F60A 1L7OA 3AU9A 4LJSA 4Q1EA 2ZT8A 4YJ2A 2BV3A 2DGDA 2O1SA 4FVTA 4QNMA 4GOKA 1N1DA 3D5QA 3GRKA 2BFDA 4D3XA 4BZWA 1A9RA 3C8HA 3PDIB 4PRLA 1VMDA 1E99A 2XTJA 4RK7A 3ICCA 4G9EA 1U1IA 2O2SA 2Z8XA 2ZRNA 3OZDA 3R7DA 3DL7A 2PT7A 1C9JA 3AF5A 1L3IA 2Q1WA 3GGPA 3CUUA 4D0GA 1FW6A 1DELA 3CZCA 3C4VA 3HJNA 4OOEA 2WYUA 2EBUA 3HDGA 1QO0A 1SKUA 1ECCA 1KQOA 4H3VA 4MUGA 3F8WA 5FQOA 2BFDB 1EWRA 1R27A 4AECA 4ALIA 1LPBB 1LSOA 4GM1A 4O3MA 1J8YF 3HCPA 5H4GA 3UY4A 4PU0A 4PFQA 3VI3B 2QSUA 2YMMA 4BMDA 4DBZA 3PX7A 1U9ZA 3GH1A 3O4HA 3PUKA 1Q77A 3ZJTA 1A7UA 4AJEA 4DAOA 5A3JA 2GZAA 1IQ0A 2XMSA 2QENA 1V26A 1WKCA 1C9EA 3DB2A 1O6GA 1LFAA 4ZEWA 5MN6A 1O3YA 2RGBA 3KPUA 4F2HA 1YDEA 4KW7A 3KM0A 1N2SA 3QA3E 4LJ4A 2CVFA 1E9VA 3PFWO 1GADO 5IN5A 3HP7A 1V16A 3AU8A 4YI3A 2BFEA 4ARSA 3FH0A 1KNQA 3M9WA 1UJNA 1TYCA 1A4RA 2ZRGA 3A3NA 4MGYR 4NICA 1T8UA 4XDZA 3PQ5A 4BU0A 4Z1OA 1MHTA 2CW5A 4TXMA 3WAGA 3UHJA 2BM8A 3RRNA 4M0KA 1WXDA 5I9BA 1JQBA 2W2OA 3REFA 3VYVA 3LUFA 3H84A 3IIKA 1N5RA 4MA4A 1ZGZA 2BFEB 4HY3A 5ISMA 2HCBA 3D4OA 1PJAA 4P5EA 5KVSA 4V0MA 5K0NA 5A71A 3VNUA 1F3LA 3PHIA 2C7GA 4RVUA 3TCKA 3ZHRA 1UOOA 2IYAA 3DHNA 5F2EA 3D8RA 1GDDA 4PCLA 1A8QA 3VTZA 1GNQA 2YXEA 4IHKA 4ACAA 5G0TA 2FN9A 3N3BC 1Q50A 1JLHA 1FF9A 4K3UA 2NUAB 1PWEA 4R8LA 4YAKA 3ETEA 4HAUA 2ZZMA 2AS0A 4D57A 4YAIA 2IF0A 5EJIA 3THYA 5K6RA 4LMPA 4GYKA 2P4HX 4XD7D 4BMSA 2NTYC 4MO2A 2P90A 3PUWA 5AJHA 4AC9A 5F9FA 1JBQA 3FWPA 2JHCA 4CM8A 2WWXA 4LYAA 1OZAA 3WMFA 4AMYA 1P7WA 4RWEA 1QNFA 4B76A 1FW8A 2DKOA 2XF8A 3PVZA 1VXRA 3HZHA 3KXPA 4HEA6 5FV4A 3I4CA 4FM9A 1M66A 1Z8NA 4MWOA 3C1AA 2WY2D 1MQSA 5MN5A 5CIWA 5E9JA 3AF6A 3ZLUA 4FHZA 4HMPA 2Z04A 3AZQA 4TT8A 1FXSA 1X7WB 4BX0A 2JCBA 1CUBA 3ZIAA 5BNZA 5G4KA 4WZBB 2YDXA 2Q2QA 1IXKA 1BKDR 3L9WA 3BOSA 4PONA 1M2EA 2YOFA 1SBQA 4RMGA 5KNCD 1M75A 1BFUA 4AY2A 3RGGA 3V7FA 1UZUA 4FGWA 2XUIA 4KP7A 3BRCA 4OHVA 1XU9A 2WUWE 1XVLA 1S1MA 1TTQB 1Q1GA 2CE7A 3DXFA 2DX7A 3H9JA 4JR2A 1P2VA 3SDSA 4A3SA 4D9FA 5LVAA 3IOBA 2QY9A 4IKPA 4UJ5A 3OO1A 3WKEA 4LNUA 2CEKA 3GDGA 4FEEA 2OO5A 4C4YA 2JFNA 7YASA 1I6KA 1Z4JA 1I30A 1J9ZA 1N8TA 1SB9A 2BPOA 2CVHA 3DC7A 4FKMA 4G67A 3OEEA 5T3YA 3SSAA 2GEJA 4MRPA 3ZV7A 1RLUA 1N9ZA 1ZNWA 4KMSA 1FFWA 3D54D 3RYCA 2A9KA 3ZLTA 3FBGA 1WCV1 2H4FA 5ALNA 5JEDA 4ND3A 2FG6C 2CL6X 2QRLA 1DCTA 3WGTA 1FC0A 4EELA 4LNUB 2WM2A 4FYKA 1L4HA 4LECA 1UL1X 5ILQA 1SBYA 1GUBA 5F2KA 5B7QA 1Q0PA 3CT4A 3WNCA 1EH5A 2C2YA 3ET5A 4DJ5X 3NHYA 1Y6FA 3JQAD 1VKJA 3AUYA 3SMVA 3I0NA 2BUAA 4GVPA 4WPGA 5FOQA 1OZ0A 2QUHA 3ND7A 5BMVB 5BURA 4IDNA 1RJDA 1Q0HA 2I2CA 3TZ6A 3U5TA 2PS1A 4EPWA 1JPNA 2Q4OA 3U80A 1BFDA 1J00A 3QBJA 2FCRA 3OLXA 1QIFA 2QS9A 4NH0A 2PX6A 3E9ZA 5EMLA 3GLFE 3SEAA 5T4EA 1DV1A 1O97D 1TF7A 5L3RA 3ZE9A 1RHJA 3C97A 4WNAA 1XKLA 4R68A 2AG1A 2B9EA 4MPRA 1YOVA 4P2BA 3HBAA 4J0IA 4PQRA 1UANA 1VDMA 3X1MA 2CLOB 4RDIA 3ZXYA 4L5AA 3JQBC 4DUPA 1GPNA 3RJ9A 3E81A 1FTWA 3FYUC 1MXFA 4ARAA 4Z7QB 4DIBA 5C81A 2IQIA 2WKSA 4YJ3B 3KV3O 5JG7A 1SXJC 2XRFA 3NAGA 4R1NA 4WN9A 2YFQA 3M5WA 3HVJA 3IELA 3IUSA 3L8FA 4MI6A 4WNAB 3Q11A 3I34X 1KS9A 1MV5A 1QK4A 3N87A 1IQRA 4W1PA 3KHSA 4UEJA 5CAEA 4GOJA 3IEPA 1PSDA 1T3LA 4NOMA 2V45A 3PF9A 4TTSA 2DQYA 4UBOA 1XTPA 2NVUA 4ARIA 1U2GC 2EQBA 3F1KA 4IQGA 4BC1A 2DR3A 4F0JA 3T06B 5JMWA 4EGCB 2V7GA 2QMEA 1FFHA 5CD9A 3VYTB 2CVPA 1S2GA 5HF6A 1BA2A 3KBOA 4NJEB 4YQEA 1I2CA 5J63A 1ML3A 3P1JA 1CLEA 3T9FA 1J56A 3B9RA 5BSEA 5AQ1A 2P8JA 5JW6A 2VRNA 2X9NA 2AR9A 2NVUB 5CM8B 2CWWA 1GRQA 2QM7A 3LJKA 1Z16A 1NYTA 3OX1A 1M0WA 5JCXA 5I7FA 2GYWA 4UBKA 3QG5A 2HYDA 3QWHA 1E4VA 2JFHA 3RV3A 5JIBA 1F0PA 2WP8J 4KLAA 4HF7A 4N9QA 2IE8A 3R0QA 5AXAA 4KK4A 4XWAA 3JYNA 1RC8A 3HKEA 1P1KA 1C29B 1CQPA 3W3ZB 5BQ5A 1J39A 2CC2A 2J3HA 2X6QA 3B5IA 3KB8A 1D07A 3GK3A 1ZESA 4JEIA 5BUSA 5FAKA 3KQUA 1QG2A 1U0GA 3KVVA 1E1QA 3BFJA 2YV4A 1F4PA 1WCWA 1VDZA 1RKXA 3I64A 2CD9A 2V7TA 4UAUA 4UAGA 1ZH8A 1KAGA 4Z2YA 2ZSDA 4EQ6B 1AIPA 1KJIA 3PUIA 2BDEA 3ZV6A 3GVCA 4NE2A 1MPXA 4A0FA 1AUPA 2YRFA 4ZMSA 4DCNA 4F3RA 4FMCF 3U5ZB 3K73O 1CRWG 5CT5A 1WTAA 2VAXA 3D3JA 3CEHA 3G0DA 4LRTB 2QPOA 4Q16A 521PA 3ZN2A 2CB9A 3Q7PA 4KXLA 4JI1B 3CINA 4ILEA 5F33A 2IDJA 4GGMX 4EH1A 3UH0A 1D1TA 2VHEA 3NWJA 5AOAA 1ZRMA 2I1WA 4LRQA 1XGKA 5BN5A 4KTTE 5AVYA 2W8BA 3EGIA 3MMSA 3RODA 3VZQA 3RANA 2O2JA 1XG5A 2I8CA 1PIWA 3BL5A 3GPCA 3AHIA 4UEQA 3USES 4BNDA 3DTYA 1DT5A 5TGZA 4LVUA 1T5BA 1Z7YA 5AQEA 1GPUA 3L5KA 4A6XA 4I4TA 2EHJA 4JA2A 7ADHA 3ES9A 3FUCA 3L05A 1SXJE 4V3BA 1Y8QA 4B17A 1B8PA 2W8BB 3RROA 1PL8A 2BGJA 4LZOA 3AFGA 3GEHA 2O4CA 3E35A 3QWIA 3KR1A 3V7YA 4C3VA 5HZHA 3VX4A 2YUIA 4ZI3A 4DWOA 3VO8A 2I62A 5LB2A 1UODA 3C3AA 1ESNA 1GEGA 1GQ2A 4TXLA 4I1IA 3ZPXA 1E2MA 1XYVA 3X1JA 4I4TB 2OEPA 3ZK8A 5AESA 1L8AA 4JLNA 4DYVA 3ZVMA 1W2GA 1IBLB 3K8OE 4KODA 2RHTA 4MR7A 1R9JA 5T5QA 1A5AB 4NVRA 3KELA 221PA 3MS2A 4E11A 5C4GB 3F9IA 4S2UA 4QYIA 4DCTA 2G8LA 2R6HA 2C99A 1AE1A 4KGDA 2ENWA 3TAUA 3B78A 2CDNA 4DYDA 2PQ0A 4NEQA 1G21B 1IK6A 5GTDA 1CJMA 3OX4A 3SR3A 1WLSA 1DEKA 2XQIA 2ZKLA 3AY6A 1YR9A 2H1CA 4LEIA 2Q3EA 2R6FA 4M8SA 3RTCA 5JMOA 1WKBA 2UZ3A 3T5BA 2CNBA 4BKOA 5IYZA 4FMDF 4M2LA 3VNBA 1CQJB 2XV1A 2YJGA 4L74A 5JS6A 1OFUA 3R75A 5TVKA 5CA0F 3R0ZA 1K8YB 1OLUB 4OYYA 1NJSA 4MICA 4CKBB 4QHSA 2Q1YA 1L7NA 3I9NA 3E82A 1FS6A 1PZMA 2CUKA 4FW8A 4YRDA 3OQIA 1NV8A 4JYPA 1YDGA 4F4DA 5JWOA 4J91A 2HH9A 2NTEA 2UYCA 5C1OA 2XCSB 3WGQA 1RBQA 4H1HA 1ISJA 3UMYA 1BHO1 1RAAA 5F9MA 1Q15A 4TWAA 4B9AA 4EY7A 4DV1B 2XVZA 4HPXB 4A23A 2WIFA 4G4IA 2ZRIA 1O58A 3N6XA 3TJMA 4R31A 1U90A 4L5CA 1GKIA 3O93A 3RUEA 1IEXA 3A9RA 3PFKA 5IT5A 1USVA 4MW4A 1IN7A 2R79A 3X43A 4CODB 1L4EA 1WZCA 2RGWA 4F71A 1A4IA 4RUKA 3PNVA 1ZVJA 1Q1ZA 1AKMA 1FP7A 1Z0AA 1Z29A 2AF3C 2QRPA 3K0EA 4F5WA 2GN1A 3GLKA 1NMSA 1QYRA 3KJXA 2YJZA 3DYIA 4LJAA 4WCDA 5EP3A 3GJQA 3SSNA 4XOIA 3TW8B 4OXRA 2UVPB 1PL0A 1XZHA 4DQ0A 4F9FA 5C18A 4CKCA 3MERA 4OOFA 4WEOA 3TOSA 3ISJA 5IAKA 2DUMA 3GJXC 4UHCA 3KPVA 1ILEA 5EXSA 3DVAB 4R81A 4L5IA 5BSGA 4B4WA 4G0VA 1CUIA 4LN1A 1JDTA 3P9NA 1JAZA 1PT9A 4KQXA 5IABA 2C00A 4YXWD 3SQXA 4FPXA 4NOJA 3AKZA 2G5PA 3ZWMA 3OSUA 1UXIA 3OZXA 3U3XA 3EE6A 4NG5A 2ECKA 2ASEA 2J7PD 3TVYA 1LLQA 3Q7RA 3QTBA 2CMFA 3ZLJA 4KI0A 3H11A 1I2DA 5DM2A 1HZZA 4O4JB 3TQHA 4F1WA 4H35A 4KR7A 1EVQA 1EB8A 3H2KA 2WAXA 1ZK2A 4TSFD 3DE7X 1MC4A 4PHFA 1JT9A 5KNBA 1SXJD 3JQGA 1X80A 4GHWA 1Y89A 4IIDA 1CY8A 2EKZA 1OV4A 4KXWA 1JTFA 1J0BA 2A5GA 2VDMB 2MINB 3TB6A 2BH2A 3CMMA 5DCWA 2F90A 3EVEA 2GFIA 4IJVA 4MCHA 5AYVA 2FGKA 3U0BA 3H11B 5EERA 1E9EA 1JQJC 3FCSB 5DCLA 1RTTA 2YW9A 3K35A 2NVBA 3QFTA 1D4AA 4I2VA 4F2DA 3BZUA 5HZKA 4HVTA