2ZTVA

The binary complex of d-3-hydroxybutyrate dehydrogenase with nad+
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
260
structure length
260
Chain Sequence
MLKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISALAEKNGVDQETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Closed complex of the D-3-hydroxybutyrate dehydrogenase induced by an enantiomeric competitive inhibitor.
pubmed doi rcsb
source organism Pseudomonas fragi
molecule tags Oxidoreductase
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
total genus 98
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ztvA00
3BTVA 4JBHA 4HADA 3GFGA 4JNKA 4LMRA 3WGHA 5T57A 4A0SA 5ILOA 1HRDA 5BSGA 2I3GA 2X0JA 1B16A 5L9AA 3AY3A 4ZD6A 2J3IA 2VUSA 4FB5A 4CQLA 4FFMA 3TZ6A 3O03A 3PYMA 3N7UA 4J9UE 1O95A 4RPHA 1X1TA 2PKQP 2Y0EA 2YHIB 2B4RO 4CMBA 1SAYA 3SJ7A 2IRWA 2ZYDA 1UXJA 4XIJA 3CTMA 1U7HA 4B8ZA 1Y9AA 3HDJA 2DM6A 3TOZA 4FPXA 2AXQA 2GN6A 4MKXA 1ADCA 4ILKA 1GYQA 2NSDA 3INTA 5A02A 4DGSA 2PZJA 4DBZA 1XR3A 3EDMA 3T4XA 2VHVA 5JNLA 3S2FA 4GLLA 2XOXA 4C7JA 3RJ5A 4A10A 3P7MA 1GV0A 1I24A 4HWKA 4MPDA 4BMNA 3DAFA 2PKRA 3SBOA 1WAMA 1EK5A 4BNTA 3B1FA 3KXDA 2Q1SA 4NFSA 3KOUA 1GEGA 3CIFA 3Q1LA 2F1KA 1TLTA 3CUKA 3EGOA 3AJRA 2X9VA 3E82A 5A9RA 2E48A 2ZYAA 1DSSG 2PD4A 4RVFA 1BMDA 3GGPA 1QKIA 4NG5A 1NQTA 3K5PA 3KSZO 1LDGA 4O59O 4ZRNA 3AW9A 3ENNA 2O3SA 3JD4A 4ZN6A 3ITKA 4FFPA 2BD0A 1Y81A 2Y1OA 1J4AA 3OIGA 4EJMA 3JCZA 3E9NA 5EQDA 2OGUA 1BWSA 3AY7A 1ZK0A 4MP6A 1E1MA 4Z0HO 5JMWA 1NPDA 3GNQA 3FNEA 4RORA 4MVJI 1ID1A 1P33A 2OXIA 2WYVA 2DBRA 1SB9A 2BRUA 4TZTA 4Q3NA 4FCCA 5ITVA 1MXFA 2X6TA 3PTZA 4QTZA 3M6IA 4A26A 2Y67A 5C3MA 5IZCC 5JCXA 4ND5A 5ILGA 3SXPA 3PIIA 4BO6A 2AW5A 1V3UA 1QV6A 3GMSA 4JN6B 2IZZA 1SZJG 3KHUA 2VWPA 4NQZA 2VHZA 4XIYA 4XGNA 4DMLA 4GWGA 4MVJG 2ZQZA 3L0DA 4AJ2A 4R16A 2QW8A 4KWHA 1AXEA 4MVJH 1I33A 1TA4A 3DOJA 4IJVA 4R4JA 2FPIA 5ITWA 2DPGA 1XWFA 3DDNA 1UR5A 3DZHA 4ZICA 3C1AA 4WNIA 5DOVA 4J0FA 2VHYA 4MIEA 4BNKA 1ORRA 2GGSA 2B5VA 5A9TA 5KJFA 4MP8A 1RPNA 2OORA 4J6FA 4CM5A 1RYDA 2GSDA 3H9EO 3Q6IA 5A05A 2YFQA 1E0DA 1FDWA 2PH3A 3ZNPA 2B0JA 4GLOA 3DC2A 4XX0A 2CVZA 3U4HA 5COAA 5G0SA 5HWSA 1PU2A 2Q49A 2CUKA 3JQBA 1LEHA 2X8LA 4ZA2A 1PJ3A 4NFYA 1WVGA 3KRTA 3S2EA 3ETDA 4CLXA 4OM8A 3TFOA 1P1FA 3AI3A 3V8BA 1PZEA 3Q9UA 1IULA 1ULSA 1HDZA 5JYEA 4YRBA 1Z73A 1S7CA 4J1SA 1C1XA 2NTNA 5DBGA 3F46A 1NQAO 4ALLA 2OP1A 2ZIZA 1VKNA 4GGOA 4KUGA 8LDHA 4J2OA 3P2OA 3NJ4A 2I65A 3D1LA 1P1RA 1VE9A 5DDIP 1SEPA 3KUXA 5IF3A 1A7AA 3DZFA 4PIVA 1HTBA 2IXBA 3DMTA 1H2BA 1Z45A 2Y0DA 1ZJZA 3FNFA 2GN8A 5ER9A 1BTOA 3GDGA 3Q2KA 5IDWA 5MGBA 1HLDA 3VHRA 5C5IA 1DXYA 1UP6A 1PJTA 1R0SA 2W8ZA 3K2BA 2VYND 4DC0A 3TL2A 4Y8VA 4ITUA 1U4SA 2V6GA 5K9ZA 2H63A 1QR6A 3ROQA 5JS6A 1XU9A 3KV3O 3PHJA 3GG2A 4O5OA 1QMGA 1NVMB 4BO2A 3ZI0A 4B3IA 4CM4B 3DZKA 1NVGA 2NVBA 4W7IA 4J7CA 4WUVA 2G0TA 1HE4A 3DO5A 4TSKA 4DQUA 4AJ1A 3NT5A 3PZRA 4JJIA 5EPOA 5CDYA 4M49A 1PSDA 1PJQA 2FOIA 3ULKA 3AWDA 4E21A 5I9LA 4CM1A 1IY8A 3TZKA 1XU7A 3GHYA 2AE2A 1FDSA 2D2IA 2QHXA 5DNAA 3GG9A 3WSWA 4I8XA 4PLFA 3GA0A 4CMEC 1LX6A 5F1PA 3ZWYA 1GY8A 1SNYA 3H9JA 2ZCUA 1ONPA 2UVDA 5L45A 1XA0A 1IOLA 1CDOA 3C24A 3VPFA 1O94A 3K2EA 1F06A 1ADBA 3L4BC 4W99A 4E5YA 3EYWA 3PJFA 4MIOA 4BGIA 2VTEA 4CM7A 1DLJA 2VOJA 2WTBA 3DL2A 5A04A 4B4WA 2PFGA 5CDTA 4CQMB 4R3WA 1XHLA 1BSVA 3AM3A 3LSYA 3BYZA 4B7UA 4YXFA 5C7OO 1KY5A 1DIRA 4NMHA 4CUKA 1ZZEA 2IYOA 3LVFO 1YWGO 4H3VA 1U5CA 2DT5A 3I9NA 4RF4A 2JAHA 3RUCA 4BB5A 3K96A 1E7MA 1LNQA 4PVDA 3W6UA 1PGJA 4RDIA 3UF0A 3QWAA 1GFSA 2E4AA 4CR7A 4RQTA 4KQXA 1NR7A 2AE1A 3JQ7A 1WLYA 1SEVA 1N7HA 3VH4A 2WDZA 3ZNQA 4PFJA 3D5TA 4PLTA 3WGYA 3Q11A 1WWKA 2DC1A 4QEDA 1BXZA 4TQGA 3H7AA 2F00A 1NM5A 3H5AA 2GUGA 1GL3A 2Q1UA 3GPDG 3BMQA 3JQ7B 1KBZA 1YGYA 4JROA 4ALMA 4YAIA 1ZK3A 2CMDA 4NBRA 1OZAA 3RBVA 1C3VA 4F45A 2VWQA 1R4MA 3CSDA 4A73A 4AJLA 5AOVA 3RC7A 1YB4A 1C0KA 4GKVA 2JCVA 2GF2A 4NK5A 4DYVA 2YUTA 1MP0A 4NDNE 3RFVA 1GEEA 2DQ4A 4E5MA 1Y6JA 1GQYA 4XWYA 1DJNA 4N7RA 1YONA 1HE5A 3E5RA 3I3OA 2GYYA 3UCXA 4ESOA 3ZU2A 1F17A 3RI3A 4YT2A 4PLCA 2DBZA 3ZCXA 2YYYA 4PLWA 1R15A 4CQMD 3PDUA 1HYHA 3IP1A 1HSZA 5CPFA 1MC5A 3C7CB 4R5MA 4JLWA 2NLOA 2Y93A 3DBHB 3IDSA 1JWAB 1ZBQA 3ANLA 4LW8A 3S55A 3F1KA 2EHDA 3QRWA 4XYMA 5K0ZA 1C1DB 3KYDA 1UP4A 3PZBA 3QWIA 4BNXA 2G82A 2EIHA 1HDGO 4OSPA 1VL6A 3WG9A 3BHMA 4M86A 2WD7B 3ANMA 2VWGA 4U5QA 4FC7A 1P74A 3C85A 5COQA 2VZ0A 4J4BA 1UDBA 4I08A 3RUDA 4UEJA 5JAZA 1D4FA 1N2SA 2J5QA 4IS2A 3EVTA 1NAHA 4H15A 4KDEA 1DOHA 1PQPA 2BKAA 1EUZA 4GPD1 4BNLA 1Z82A 3I52A 2JCYA 1E7QA 3NDIA 1HDXA 1YRLA 3BTUA 3RJ9A 4BMSA 3WIEA 2G1UA 3UOGA 4DL9A 5KJEA 3E8XA 1R6DA 1E6UA 1MXHA 5AXDA 1ARZA 3VAZA 3HNPA 2RCYA 1BXKA 2OMEA 3JQGB 2DKNA 2GERA 5B4TA 2QYSA 2PV7A 1ZUD1 4O63O 2BGLA 3JQ9C 4GMFA 1VM6A 3JYLA 1T2CA 3DONA 4E32A 3WGTA 1P3DA 4GX1A 4PG4A 4AJ4A 3C7AA 3GMDA 4MOWA 4Z9FA 4RVHA 2X9NA 2J5KA 5L4SA 1QLJA 3RUEA 3JQGA 4ND3A 2C2XA 3DBLA 3JD2A 4NK4A 1IZ0A 4WLUA 3F3SA 3ZGYA 1BVRA 3NDJA 3OIDA 1E92A 2VOEA 2XAAA 4R69A 1KYQA 3CINA 5TLSA 1I2BA 2NTVA 3D4PA 3KSDO 1FDTA 5IN5A 1MG0A 1Y7TA 3VH1A 4J1NA 1NWCA 3E1KA 1DRUA 3ZU5A 4GBJA 4EW6A 1L1FA 4A5OA 3N58A 4ZGWA 1Q2XA 3G0OA 3JQFC 1B2LA 1EBUA 1R66A 4QSMA 4WEOA 1JTVA 1KERA 4XYBA 1Z7EA 4M55A 3RIHA 2JKVA 2ET6A 4E5KA 3AOEC 2AEMA 4M87A 1PJ2A 4FN4A 1QG6A 5DP2A 3DEYX 2HMTA 4CMJA 4B4OA 1GV1A 2NWQA 3L6EA 3QLJA 1QYDA 3UH1A 2J6IA 3GN2A 3NYWA 1RYEA 1U8FO 4CLEA 4Z3KA 1X1EA 5A06A 2WM3A 3I1JA 1E1LA 3Q0EA 4DVJA 1KVSA 3GVHA 1WZEA 4BO7A 1NXQA 2EG9A 4IS3A 4WCFA 3W8EA 1FXSA 4BNZA 3DB2A 4CPDA 4N18A 1WNTA 3PFWO 4FR5A 4EUFA 2YZ7A 4TWRA 3DZJA 4QUKA 4KUEA 1PEDA 1XQ6A 3KTDA 3MJVA 5G4KA 3ZN2A 3BA1A 3CZRA 1Y1PA 3JQEA 1DHRA 3I6QA 5IAAA 2W2KB 3VVCA 4RGBA 2Q45A 3I9OA 3OHSX 5H82A 3IL2A 2ZTMA 4YT4A 4YR9A 4J1TA 4D43A 5KVQA 3A14A 2IZ1A 3F1LA 5BNTA 5KCZA 3U5TA 5T8KC 2HJSA 5T67A 3GZNB 4FSHA 2HU2A 4R1UA 1GUYA 2GZ3A 5AQ1A 3GC6A 2OP0A 3FD8A 3ROPA 5U9CA 3HDHA 3NGLA 1YXMA 3UAGA 1I3NA 4BNWA 3FR7A 4DTIA 2BI8A 1QSGA 2JHGA 1AXGA 4E5NA 1ENOA 2NACA 4U0KA 3TZCA 3TZHA 3GF4A 4EJ6A 5DBFA 4FBGA 3PDJA 3L6DA 3KVOA 3OJOA 3DZGA 4UUPA 4G2NA 3PJEA 2HLPA 2YHUA 4IM7A 3R1IA 4BNFA 4YAJA 3UCEA 3V1UA 3E9MA 4UUNA 4I5EA 3NT2A 3AI1A 1VLLA 5JLAA 4YACA 3RKRA 4XJTA 1R0KA 3COSA 1KEUA 3PQEA 5TGDA 5I7SA 1IZ9A 1LTHR 2Y1EA 2OL4A 1PWXA 3A9WA 3OEWA 3ONDA 1PZHA 1EVYA 3JTMA 4WE3A 1E77A 3ZWVA 9LDTA 1A9YA 1G6KA 1HLPA 2R00A 5AXBA 3QA9A 1GCUA 4IZHA 3ZHXA 4DXHA 2V7PA 1C14A 3GVPA 3OJ0A 3K31A 3GN1A 3D4OA 4NR0A 2HO5A 3DMYA 4XEHA 1P0FA 3H3JA 2C2YA 1BG6A 3F9IA 3LLVA 4HNHA 5L4LA 3G1TA 1DIGA 1H5QA 4B4UA 1N1EA 3QW2A 3M1LA 5H83A 2PLAA 2NUAA 3DWFA 4HUJA 4W82A 1BW9A 1GYRA 3DQPA 5GZ6A 1WPQA 5JO0A 1QYVA 4PLZA 2NU9A 3HJAA 5DP1A 2FR8A 1ISMA 2EGGA 1UXHA 3BHJA 2EKPA 4IXWA 4QFCA 5B4VA 5ICMA 1ISIA 1DFIA 2CNBA 1IYZA 3JSAA 3QVTA 1VJTA 1ZSNA 4TVBA 4CV3A 3H6KA 5A03A 4O0LA 3RBXA 1ZEJA 2QG4A 4F46A 1SBYA 5AVOA 1K5HA 2JD0A 3SX2A 4GMGA 2DVMA 3OH8A 3HQ4O 2CDCA 3GAFA 3PLRA 4DPMA 5KOIA 5MDHA 4RF2A 4MKRA 4K9DA 3HUDA 3QV1A 2VT3A 3H9QA 3ZWCA 4BS9A 3GRKA 3LDHA 2VZ8A 3ICPA 1VPDA 2W2KA 4IPTA 3G79A 1M66A 2FMUA 3N74A 2Y1FA 4J7XA 4WPGA 2W2LD 4UAGA 2ZKLA 3KO8A 1DO8A 1B0AA 4H16A 3RC9A 4WGGA 3RUAA 3WWYA 1Y8QB 4K6CA 4CR8A 4DREA 1E3LA 2B35A 3RD5A 3C7DB 4BB6A 2EKQA 3WGGA 4TRNA 3WTBA 1GCOA 3PQDA 3P19A 3OIFA 3OFSA 3M1AA 4LSMA 3C3XA 1M6WA 1ADGA 1JQBA 1PGOA 2JHFA 3D3WB 2QRLA 4KTVE 1ZO8A 3WBFA 1Y8QA 1FK8A 4PG6A 4XB1A 3BMCA 3UFXA 2PD6A 4BKOA 5KNLA 4CM9D 3LYLA 2HMWA 5L7WA 2Q46A 1H93A 1EQUA 4NZ9A 1B8VA 2ZJ0A 3INRA 4NJMB 4ONEA 2FZWA 4DPKA 4NBVA 1U3UA 2DTXA 3DFUA 2I3AA 4Y9DA 3S2IA 4EJ0A 4GX2A 3I5MA 4PZDA 3F5QA 3HSKA 4WOKA 3HB4X 3CZMA 3B6ZA 5TNXA 4MP3A 4BO8A 3MOGA 2GLXA 1G0OA 4QECA 1O0SA 1PS8A 2X7HA 1ZK2A 4CODB 2NQ8A 3U9LA 1BDBA 1DC4A 1N8KA 3RFTA 1ENZA 1YH3A 2PD3A 1QV7A 2Y66A 1JAYA 5A5FA 3LLSA 4OL9A 5JY1A 2GNAA 3NTOA 4CL8A 5IDXA 2FSVA 3KLMX 4E12A 2O3QA 3TN7A 4YVFA 2B37A 3AY6A 1J0XO 4BV9A 5TT0A 2B69A 4RF5A 1HT0A 2YV1A 3EMKA 1EMDA 1BGVA 3W1VA 5H81A 2BFAA 3U4CA 4HBGA 4XR9A 5L3ZA 5FWNA 2XXBA 4HKTA 3WJAA 1BW9B 3FPLA 3DAPA 1QLHA 2I66A 4R01A 1Z74A 4II2A 3VZQA 4B7CA 1L7DA 4IIUA 1K2WA 4CLOA 1NBOA 3PVZA 1I5RA 5ENDA 4NH4A 4J9VA 2RIRA 3L6OO 4YJHA 3ABIA 5CEEA 1XIVA 1PZGA 2DFDA 3ZNOA 5BNIA 3OETA 4CL3A 4N5MA 3LT2A 3H65A 1YDEA 3NKLA 4CLOB 3AUSA 1GD1O 1HE2A 4RQUA 2VN8A 1VRWA 2NM0A 1NPTO 4YT8A 5K6AC 1LDNA 5F5NA 4XQGA 1KY4A 3GQVA 1D8AA 4PZEA 5DF1A 5I8WA 3GUCA 5BT9A 5DULA 4YRAA 1E6WA 3W6ZA 3S8MA 2CF6A 3WTCA 2YQ4A 3OQ6A 4BO0A 4CUZA 1MG5A 1FJHA 4YWJA 1NR1A 2JFGA 3F6YA 3ORFA 4Q3AA 3UKOA 4L73A 5BNFA 5G0UA 4WECA 3UVEA 1YE3A 3T4EA 2IEDA 3ZHZA 1Q0HA 2W2LA 2P4HX 2ZJ1A 5JDIA 2VNSA 4R3NA 4JBIA 5TSDA 1LDMA 4MVJD 3SC6A 1EFKA 1C0PA 4RVUA 3WOHA 3WWZA 3OECA 4DIOA 2HMVA 3I9MA 1E3IA 4KZPA 4BQRA 3NJ8A 4M1QA 3WMWA 1P31A 1I3KA 4OYRA 2OFPA 3DAGA 1HDYA 3E48A 3OQBA 2ZB8A 2O50A 2DUWA 4GSLA 1LSJA 1ZXBA 4I5GA 4MVJF 4J91A 3V1TC 2QQ5A 5C37A 2C5EA 4E6PA 1FMCA 1GDHA 3RC2A 1PQUA 1AGNA 3IC5A 3ZV3A 1P1HA 4NJMA 3ZU4A 1LDYA 3VZRA 3E5MA 3ZWNA 2YY7A 2CDBA 2QRKA 4HXYA 2HMUA 4WLVA 4XDYA 1C0IA 1OC2A 2C07A 2Y0CA 2VTDA 4WCDA 1BXGB 4YA6A 1MX3A 3DHNA 2O3JA 2Y99A 1ZMOA 4A27A 2NV6A 2O7SA 4LRSB 2D0IA 2POQX 3C1OA 3RWBA 3H5RA 3IOYA 4KTTE 1YBMA 5LDHA 2J8ZA 3HFSA 1RWBA 2X0NA 5L7TA 3VTZA 1VI2A 5HTOA 4LMPA 2NQTA 3W8DA 4BKUA 3PHLA 3ZWPA 4J1QA 3OMLA 1HKUA 2V65A 4AFNA 1DHTA 1NYTA 4LN1A 1X7DA 4Z9XA 2NU7A 5I7EA 2ZCVA 5L4NA 1A4IA 5TT1A 2PY6A 3DMTC 4YJDA 2PH5A 3IS3A 3NDRA 1DC6A 2AQIA 4BGVA 3OJLA 4WOJA 4BNGA 2FN7A 4CM9A 2WD8A 1LLDA 4J90A 4DYDA 5JDCA 4JP3A 1PS9A 5JBIA 5EINA 2FRDA 4GVLA 3FI9A 3GOHA 4IXTA 3RASA 2UUPA 4BQPA 4IINA 5HS6A 1O6ZA 3OICA 1UUFA 4C4OA 4IDDA 1X0VA 5TJ9A 1XSEA 4BNJA 5IZ4A 1E3JA 1K89A 2Y1DA 1ZW1A 3U4IA 4D0RA 3W8FA 5DN9A 1YQGA 2X4GA 5F5LA 3FWNA 4LVUA 3QWHA 4UUMA 3IKVA 3DZBA 1ISJA 2QIOA 4CLHA 1P44A 1HZJA 5CAEA 5HM8A 3MOIA 3QP9A 2OO5A 3JQBC 4A2CA 3OJEA 2ZYGA 4IDGA 3H9UA 1ISFA 2HJRA 1DFGA 3ICCA 4IQ8A 1LUAA 3ZWWA 3PRJA 2UAGA 1XEAA 4YAKA 2HSDA 4XRGA 4KDFA 3HN2A 2W98A 1X0XA 1R4NB 2WEKA 3I4CA 2IZ0A 1U28A 3IJPA 3JYQA 4J2HA 1R16A 3PK0A 1I0ZA 2AQHA 3WYBA 3SEFA 4WCFB 5CP8A 3WDSA 1ZSYA 2CVQA 3H2SA 3HHPA 1SC6A 1VKOA 1DPGA 5FF9A 4GKBA 4KP7A 1GU7A 2X0IA 1R4NA 2Q99A 2WYWA 3G17A 1PJLA 2SCUA 4UVIA 1I3LA 4I9NA 4XQ9A 4E2YA 1BDMA 4BKPA 3EUWA 4TRJA 5U4QA 1OC4A 2O4CA 3H9GA 5G4LA 3HB5X 3U0BA 3U09A 1TEHA 1KEWA 1KVRA 2VHXA 4LGVA 1Q7GA 4F6CA 3OA2A 4D45A 3NT4A 4YT5A 4H7PA 3WJ7A 3U49A 1T1RA 4JP2A 4Y6PA 5KVSA 1GQ2A 2FR0A 3EZYA 2QYTA 2VUUA 4IQ0A 4OIMA 1JAXA 2VYVD 1T26A 5FYDA 1EE9A 5ES3A 4E3ZA 5CG2A 2WD7A 5JC1A 3BMOA 4J3FA 4NU5A 2VRBA 5CFZA 5TS3A 2WJPA 4CMEA 3AFMA 3GGGA 3LT4A 1K6JA 3KZVA 3O8QA 4DLLA 5G0TA 5KTKA 2JD1A 1ULUA 4CM8A 3VPGA 4XYLA 1U3VA 4RPJA 4P4GA 4U6QA 4XGIA 3GY0A 1PGNA 1LLQA 2PK3A 4IIVA 2GO1A 3EVNA 3EHEA 2GZ2A 3FPCA 3D0OA 2VT2A 3A06A 3EY4A 4MINA 4IJUA 4RPLA 4E33A 4RLHA 3FHLA 4I5FA 3FR8A 1YJQA 3ONFA 1Y8RB 3PWKA 3QWFA 4TRRA 5DOZA 1VJ0A 4FC6A 1WXDA 4Q3DA 1ZXLA 4G65A 5TQVA 1A7KA 2QRJA 3NGXA 2UYYA 2JFFA 5EMHA 1Y8RA 3PP8A 4FFNA 2C54A 4HFNA 1F8GA 2FWMX 4LRTB 5G0WA 3ON5A 4BO9A 2BI7A 3DBLB 4NU6A 1SB8A 2CZCA 1KVUA 1GR0A 2VHWA 1E3SA 1WP4A 5F1KA 4BNMA 4ZQGA 4N54A 4ZQFA 3JQAB 1V6AA 2A92A 4JJFA 3GGOA 1B14A 4P38A 4NBUA 1OBFO 1ZK4A 1TT5A 2HKIA 3GFBA 4E2ZA 1WDLA 5HRUA 1MB4A 3DZIA 2Q4EA 3PGXA 4I5DA 4JGBA 1DB3A 4OKIA 2PR2A 4NI5A 1IPFA 2IXAA 4XR4A 1Q1NA 5DZSA 4HFJA 3SJUA 2C0CA 1LQTA 2HK7A 4PLHA 4CV0A 2O23A 3S2GA 2IEBA 1XG5A 4PG8A 2O3UA 1PJCA 1E3WB 4JXKA 1LJ8A 1P77A 3ZZNA 1I2ZA 1OMOA 2A94A 2FHSA 3WGOA 2DBQA 3RAJA 2UV8A 2WYUA 5DT9A 3NTQA 3AUUA 3B1JA 4DPLA 4XYGA 1XGKA 4F6LA 4UVEA 4XDZA 1B8PA 1UH5A 1LLCA 4R1SA 2VYNA 4E4YA 3VZSA 2CD9A 2JFHA 4XRRA 1WMAA 4Y98A 3FTPA 2O7QA 3DBVO 1EEHA 3L07A 4TROA 1RJWA 3CPSA 3KEQA 3PGJA 1VSVA 2J3KA 4TZKA 1T24A 2HMSA 1LQUA 1Q0LA 1LLUA 1H6AA 1O89A 1K3TA 4PLGA 4E13A 1HE3A 4FFOA 3ZWBA 4O6VA 4II3A 4PLVA 1CQIA 5ER6A 4NBWA 4QX6A 1I2CA 5AXCA 3MZ0A 1G1AA 4CR6A 5EIOA 1YO6A 4DC1A 3S1LA 3BMCB 4ZQEA 4R5HA 4DIBA 2P91A 4CM8B 3OM9A 1U1IA 1I01A 1ZCJA 4TKLA 3HADA 3ST7A 4RV9A 5HS4A 4PVCA 2X1HA 1UJMA 4NFHA 3GT0A 3WLFA 3PHHA 2Z95A 5DBIA 5I7VA 1A27A 3OP4A 3IKTA 4CV2A 3B70A 2QZ9A 4QT0A 1R37A 3PLNA 4GVXA 1HF3A 1U7TA 1AE1A 1IHYA 3FNGA 4EGFA 4KUHA 2EKLA 1T1SA 3SLGA 2R2GA 3BTSA 3KSUA 5BR7A 5J23A 2C5AA 3OQ1A 4CM3A 4B8WA 4IDCA 1R12A 1IHXA 1QXSA 2FPGA 2C7GA 3TWOA 1J6UA 3I9LA 3INGA 4NIMA 2HK9A 4BGEA 2BLLA 4IMPA 2YHIA 3I4FA 4OAQA 5KVVA 3CE6A 2Z1NA 1VL8A 3RQSA 1ZVMA 3GR6A 4UVHA 2GN9A 4RDHA 4B4VA 1GUZA 3QVOA 4PRLA 3JQAA 4CMHA 4UVDA 5ENVA 5FI5A 4ZQBA 4BO5A 4CLRA 3E18A 5EN4A 1EBFA 4WLNA 2BFOA 1W0CA 1WDMA 3SVTA 3I6IA 3MTJA 4M89A 1DAOA 2PWZA 3AFNA 5COBA 3E03A 3TZQA 1E1KA 4C7KA 4CMAA 1HL3A 5ICSA 1QP8A 1HYGA 3HE3A 1UAGA 2B5WA 1DDOA 1IPEA 4DRYA 3PQFA 2BFPA 3IMFA 2B4TO 5LC1A 4BNUA 1H6CA 3WNVA 4XYEA 2X9GA 4FD3A 1XDWA 4J16A 5THKA 2CDAA 3GRPA 3UN1A 4G5HA 4OJNA 5FEUA 4BUCA 1M67A 4GQAA 3ZWMA 1SPXA 5CDUA 1A9ZA 2YFHA 4GL4A 4Z0PA 3WMXA 3X2EA 1NASA 2WE7A 3RVDA 1SO8A 1ZEMA 1ISGA 1Q7BA 2JL1A 3HZZA 4AJEA 3WBBA 1U2GA 3UGKA 4IUYA 3STHA 3NV9A 3L9WA 1ONOA 3IUPA 1SCUA 1CQJA 1J49A 1PJ4A 3DBHA 1A72A 3AU8A 3FSRA 1HXHA 4GI2A 3FRJA 3DOCA 4AJPA 1TI7A 4KMSA 4OXYA 5BQFA 3QVSA 1X15A 4CLDA 1VC2A 4XJSA 2DPHA 3JD1A 2Q2WA 1U5AA 5CPBA 3RUIA 3WICA 4ND1A 7ADHA 5THQA 3Q9NA 5JCJA 4DLAA 3RCBA 1T4BA 2JD2A 3MEQA 1SMKA 3UHAA 3JYPA 4B3JA 3RFXA 4N5NA 2B83A 4BO3A 1KVTA 3D7LA 3K30A 2PTGA 2X0RA 3O4RA 2DTEA 5JPIA 1RM5A 1PZFA 1GYPA 5L40A 4DLBA 4BO1A 1GAEO 5B37A 3G3EA 2GASA 3HFGA 4BV8A 2YDXA 1HZZA 1IB6A 2J5RA 2DFVA 3QY9A 5CDSA 1V3VA 2VRCD 5TF4A 2D5CA 2FR1A 2Z1MA 4IGEA 3TOXA 4WNCA 1GZ3A 2NVWA 3DOOA 5JC8A 1I32A 1EE2A 3JQ6A 3RSHA 4Q3EA 1Y5MA 3MJCA 5TRTA 2ZK7A 2W90A 3G1UA 1E3EA 1G0NA 4PN3A 6LDHA 1I10A 4W9NC 4JBGA 3DHEA 4WLOA 3GEGA 4IBOA 7MDHA 4IGFA 4BOYA 2C29D 3K6JA 2I67A 3WSVA 2OZPA 1OOEA 2P9GA 3ENKA 1F8FA 1I30A 4PG5A 4PCVA 2Q1TA 1DC5A 2BGKA 2NVUA 2PNFA 1EQ2A 4WLFA 3WXBA 1A5ZA 2D3TA 3KBOA 3RUFA 1QYCA 1LXCA 4ND2A 3BMNA 3ROMA 3F4BA 1EVJA 1RM4A 4PRKA 3VDQA 1UDAA 2DLDA 2I5PO 5GY7A 1OFGA 4IJWA 4ZHSA 3WB9A 4AJKA 1NQ5A 1GADO 1NHWA 2P9CA 2PZLA 2NU6A 3C1TA 3BMNB 8ADHA 4CMIA 3JQAD 1H6DA 3MCVA 3VZPA 2ZTUA 4YJHB 1DAPA 4ALJA 2O2SA 4AJHA 4B79A 1DJQA 4F3YA 2I99A 2CF5A 5AXAA 5A5EA 3FBGA 2W4QA 1Q7CA 4P8RA 2E6UX 2IYPA 2YJZA 4NNJA 4E2WA 1LSUA 4LISA 5T6BA 1TVEA 4J4HA 4RJTA 4J43A 1SOWA 1BVUA 1V0JA 3ONEA 1JN0A 1VL0A 4DMMA 2PGLA 4OSOA 1A71A 1E7RA 2P5YA 4CJXA 2RHCA 4Z0TA 1UDCA 5JDCC 4DUPA 1CWUA 4EITA 3FCOA 4GSKA 4EUHA 2OUIA 3GPIA 2C7VA 1GPJA 2EGHA 4RPKA 5IG2A 3DR3A 4LSWA 1LBEA 2X23A 3H3FA 1LRJA 4CM6A 4TRMA 4OXKA 2FSSA 2DAPA 4FDAA 2AQ8A 2HDHA 4R1TA 4AG3A 4ZJUA 5F21A 2CY0A 4QQRA 3AOGA 5L95A 1M75A 1VJ1A 1J5PA 1PX0A 3H2ZA 4X54A 5IXSA 2LDXA 4XQCA 1MC4A 2RH8A 4OOEA 4YEDA 1NP3A 2VQ3A 4HFRA 1EVIA 2Y1CA 4J7UA 4D79A 1B3RA 1YDWA 3HDQA 1FDUA 2FPPA 4BIIA 2Q3EA 1JLLA 4AICA 2GRAA 3P5SA 1B15A 4NHEA 3B20A 4UEOA 2AMFA 1B26A 1LRKA 2AQKA 3VC7A 3KLPX 5JYDA 1MFZA 1QYWA 5JY6A 1PTJA 2GDZA 1GQQA 1BXGA 2XXJA 3LQFA 1WZIA 4MJLA 3CKYA 1YOVB 4ALIA 1NFQA 5TIIA 4L74A 1V8BA 4TKMA 3K8ZA 5JW6A 2D4AA 3A4VA 4RZIA 5B4UA 2ZB7A 3KYCB 1XCBA 4JCOA 1T25A 2AG5A 5KKAA 1MLDA 3O8QB 1U3TA 3H5NA 4E31A 4EBFA 1NWHA 1P1IA 1ZSVA 5JAQA 2EV9A 4CMKA 4FJ2A 2E49A 4TVOA 1YBVA 3LK7A 2CSUA 1T2FA 1YL5A 3K92A 2HQ1A 4D41A 1N9GA 5A9SB 3WR5A 3CXRA 3WIDA 1RKXA 1XLTA 4FOOA 3VPXA 3WYEA 2CVOA 3DHYA 4E2XA 4OH1A 2ZTLA 5A3VA 3R3SA 3AU9A 4FFRA 1UXKA 1D1SA 2B4QA 2XF8A 3HWRA 3ZWXA 4AJNA 3PWSA 3C8MA 3WLEA 4E0BA 4XGKA 2ZQYA 3UXYA 1P45A 4RVDA 4BL5A 5C7IO 2JJYA 1NFRA 3NUGA 5IDYA 4HY3A 2YW9A 2IE0A 3PYLA 4UREA 5F1OA 2RAFA 1QRRA 4A7PA 4DQXA 4IDBA 3H8VA 4FOSA 3RU9A 1PR3A 3W4KA 3F4LA 2YV2A 3GEDA 4KWIA 2TMGA 4XZ3A 5TC4A 4K28A 1ZIDA 6ADHA 1EDZA 3I23A 3Q3CA 1T2EA 2BELA 3NX4A 1V35A 4OHUA 3TPCA 1YQDA 1PL6A 3WFJA 2GPTA 1H6BA 3JQCA 3ZV5A 3TSCA 4BNHA 3GHHA 4UULA 2EEZA 3K73O 4D0SA 3MJTA 5DCWA 3MJEA 3ASUA 1W4ZA 4PZCA 3UICA 2C20A 3FN4A 3MWEB 2VYVA 4UVGA 4L76A 5KJCA 2FZEA 1NTOA 1VSUA 4J4TA 1B3BA 1XELA 4GH5A 4PG7A 3AI2A 3MJ4A 4MVJE 1NHGA 3E6AA 3DXFA 3ETEA 1Y9EA 3PWZA 3WQSB 1O5IA 3GVCA 3FF4A 4PLPA 4HP8A 1IL0A 3WGQA 3PJDA 2H5LA 2O3RA 3OJFA 3VKUA 1HSOA 3ZNNA 1ZJYA 1DIAA 2GR9A 3PJGA 1JU9A 3I9JA 2VWHA 5CEFA 4R54A 1UXGA 2ZATA 3GNSA 4Z6KA 4YJGB 3Q2IA 5CHEA 4L4SA 1CETA 5JAMA 1YQXA 5JXWA 4P4NA 4EZBA 2NNLD 3LT1A 2AEFA 2A4KA 3VTFA 3KM0A 1YKFA 1ZKMA 1E7YA 1RM3A 3T7EA 2Q50A 2EJWA 4EEZA 3PEFA 1Z7BA 4JIGA 2PZKA 3JD0A 5DCUA 1D7OA 3ZV4A 2OHXA 1C0LA 1NX6A 4BHTA 1AHHA 4M54A 1YL7A 3ZV6A 4R51A 1HDOA 1F0YA 2A35A 4OOFA 3RU7A 1E5QA 1JDJA 1P1KA 1TB4A 3ROKA 3JQ8B 4HFMA 3GVXA 3V2HA 2VZ9A 1EUDA 1YB5A 3VOSA 3ITDA 4IMRA 3V2GA 3W4JA 3BMOB 2V6BA 1KC1A 2NADA 1KETA 3CH6A 1LU9A 3IP3A 2VNAA 4CMCA 2G17A 2I76A 1N9GB 5A9SA 1ENYA 1DBVO 1V3TA 2BFMA 2HK8A 1L7EA 4NPCA 1CRWG 1LC0A 2RBEA 4RZHA 4CMGA 2RH4A 1E1NA 2PGJA 4CQLB 1U3WA 1YJ8A 3PFFA 3M2TA 5HBRA 3QSGA 3FNHA 1UXIA 1IUKA 4OMUA 2Q2VA 3ZDFA 1XQ1A 1P0CA 3JQDA 3VPHA 5F3RA 1X7HA 4W4TA 1E7WA 2C59A 4CV1A 3LC7O 5EL0A 5FFFA 4Z9YA 5G2OA 4D3SA 3H4VA 2HRZA 2G76A 3HDYA 3QVWA 1EZ4A 4FFLA 5L51A 4FJ1A 1F12A 2HAEA 2VRCA 4Q3CA 5EESA 1QORA 3GK3A 1ADFA 3PHGA 1PWZA 2FP4A 3LF2A 5KJ1A 1HEUA 3QE3A 4ND4A 4UUOA 2AA3A 3KETA 1I3MA 4KOAA 3F5SA 3JQFA 4CLRB 4XB2A 1V9LA 3K9QO 3TNLA 2X58A 1E5LA 3ZWOA 2GD1O 1A4UA 4YAEA 1CYDA 3ADOA 1BHSA 4K26A 4AVYA 3D3EA 3CEAA 1LDEA 1D1TA 2EP5A 4R68A 4RO0A 1MGOA 1TT5B 1LDBA 3WX0A 3TQHA 1PJBA 2Y05A 2D8AA 5LCXA 4S1VA 2JCXA 4CM4A 1O8CA 4W6ZA 4D42A 3ETGA 3TRIA 4U6SA 4FGSA 2DTDA 2H9IA 3AM4A 4Q3BA 2YV3A 1LA2A 2R00C 1OI7A 2I9PA 4YRDA 3AM5A 1ONNA 4J0EA 5JE8A 4PLYA 4XA8A 2J3JA 2H1SA 3A1NA 1DRWA 1E3WA 4GAEA 1N5DA 2ILTA 4XQEA 3GDFA 4Y6RA 1H94A 3OEYA 4FGWA 4NJOA 4QO7A 4A03A 4OQZA 4YJGA 4ALKA 4FQ8A 4ZVVA 3D5QA 2V6MA 2OOSA 2D1YA 5CDGA 4R9RA 5I9MA 3TL3A 3A28A 1W8DA 3U62A 1FF9A 1MA0A 1DLIA 2IODA 3EK2A 3EZLA 3QQPA 5IDQA 1DEHA 4Y6SA 3KEOA 2EJVA 2GN4A 1U4OA 3ANNA 4FW8A 2UUOA 1UP7A 4ALNA 5K6AA 1P1JA 1YL6A 4K6FA 3I9KA 4WEQA 3MTGA 1PJSA 4YQYA 5GMOA 1M6HA 4ID9A 3ZWAA 5GZ1A 2GZ1A 2WSBA 1HYEA 1DIHA 3HN7A 1YBAA 3CMMA 3L77A 4MO2A 4P4LA 4MVJM 1N7GA 1W6UA 4OKNA 1CIVA 2E37A 3JQ8A 4K1LA 3MJSA 1HETA 4ZRMA 1K6XA 1WW8A 1AHIA 4YQZA 3IQDB 5JAIA 3EAGA 3WNQA 4EDFA 4EYEA 5T8KA 4IDAA 1NQOA 3BHIA 4CUJA 2DUUA 2YDYA 3BIOA 4MDHA 4BNVA 4XD2A 3GH3A 5LDGA 2VUTA 3UUWA 1MFPA 1PGQA 4L4RA 1PGPA 3PI7A 2BF7A 3DFZA 3GZ4A 2P68A 1ZNQO 4JX8A 3GDOA 2LDBA 1N92A 5C7LO 3KYBA 2Q1WA 4OO3A 5DCYA 3ZW9A 1KIFA 1EUCA 4HNGA 4RVGA 4YYZA 1KEVA 1BRMA 1UAYA 4YTEA 3GNTA 3PHIA 4AJJA 3GAZA 5I9NA 4IDFA 3BTOA 1EFLA 2G5CA 2EERA 1MUUA 3LU1A 5G0VA 1DIBA 4RLSA 4AL4A 4WCFC 2NVUB 1LSSA 5BSHA 5KWEA 2BGMA 2Y1GA 4BO4A 3QWBA 4OGWA 1C1XB 2WWRA 3PPIA 1W73A 2OBYA 5KJ6A 1UZMA 3HG7A 4D44A 2I6TA 3PIDA 1CF2O 2AG8A 4TMFA 4IDEA 1ZK1A 3TDKA 4BKRA 5JSFA 5KIAA 3TJRA 1OAAA 2HRBA 1X14A 2P9EA 4DBVO 1WMBA 1PL7A 2DBVO 3WQQA 3I83A 4JK3A 4ZQHA 1T2AA 2PKQO 4RVSA 4I1IA 4YDRA 4L0QA 4WK6A 1PR9A 1Q0QA 3VDRA 4BMVA 1CEQA 1LI4A 2O2YA 4O1MA 2QX7A 1DFHA 1X7GA 4E30A 3DTYA 3JYNA 2WE8A 2O4UX 5I8ZA 4KQWA 5JMPA 2D59A 3D64A 5B1YA 1JW9B 4E5PA 1KEPA 2X5KO 3RUHA 1Z75A 1DRVA 2PZMA 1HDCA 4AJIA 1I36A 4DWVA 1H2HA 1I8TA 3EW7A 2P2SA 2X22A 5KVCA 1T2DA 2IDZA 3WGIA 4LK3A 4S3MA 3WS7A 2EWMA 4W9NA 3IIEA 2HCTA 2UDPA 3AUTA 3PXXA 4GWKA 1PS0A 4GX0A 3MWDB 3RBZA 3VH3A 4DIFA 5JDIC 3OA0A 4MKZA 4BNYA 5BSEA 5JFOA 1U9JA 2AHRA 1NVTA 3IAHA 5IN4A 2V6FA 1H0KA 3JQ9A 4BVAA 4IJKA 5IXYA 3U3XA 5L7YA 1C1DA 1PQWA 3D3WA 3KYDB 3L9XA 4L75A 5CEJA 4FIZA 2E82A 5AYVA 2FY8A 4OXNA 4RCVA 1ISHA 2OBNA 2PGDA 1QYXA 2ZB3A 3O38A 2WMDA 4LCJA 1S6YA 1JKIA 4M8SA 4YAGA 2BH9A 1MV8A 4L4XA 4I9UA 4BKQA 3VH2A 4BGUA 4PGFA 3KB6A 4LVCA 3BXXA 1K0UA 3NEPX 2P5UA 1PIWA 3QJ5A 1KOLA 4DQVA 5A1TA 1KC3A 2EXXA 3LF1A 4FJ0A 1E7SA 5EERA 1M2WA 4QFDA 4R9SA 3V5NA 4D3DA 3JD3A 3U4DA 3CMCO 1K6IA 1ZH8A 2XPCA 3O26A 2R6JA 3BAZA 2P4QA 1GZ6A 2J3HA 4N5LA 3T7CA 1U8XX 5IJZA 4I9HA 1Y5RA 1GPDG 1D3AA 1ZFNA 2JAPA 3QHAA 1ZMTA 1N1GA 3RROA 1UZNA 1WDKA 1RM0A 5TX7A 5BSFA 4RL6A 2Z5LA 1GUFA 2NTJA 3UW3A 4BNIA 3G49A 3ZW8A 1YVEI 4FS3A 4ZU3A 1AN9A 4CQMA 2D5AA 1EK6A 3FWZA 1LSOA 1TT7A 3GVIA 3FBTA 4Y67A 2X5OA 2YQ5A 4INAA 3D4NA 3L4SO 4Z3DA 5B12A 1O9BA 4LCEA 3BMQB 2GCGA 1M76A 4JQCA 4J49A 5JO9A 4Q9NA 3E9QA 3IJRA 4CMIB 1FDVA 5EJ2A 3LC2O 4U8GA 2A9FA 2CFCA 5FI3A 3QIVA 4ROSA 3ZHYA 3R0IA 4QO8A 1UZLA 4WASA 2TMDA 3DTTA 1ENPA 2EW2A 2Y68A 3ZU3A 4RF3A 2ZTVA 3RKUA 5GZ3A 5I7FA 1KS9A 4Q39A 1B8UA 3OF2A 3LC1O 2Q2QA 2X5JO 1Z6ZA 3QVXA 3NRCA 3ASVA 4P22A 3WFIA 2AEJA 4QXMA 2EF1A 1JVSA 4D7AA 1CERA 1E6EA 1LC3A 4URFA 1H9BA 4D3FA 4DA9A 1EVZA 3X2FA 3R6DA 1XYGA 2X86A 5T5QA 5T64A 5TJHA 5L53A 3JV7A 4MVJA 3O9ZA 1JWBB 1R4MB 3DBRA 1NPYA 3IUSA 3VPSA 4WKGA 5A3JA 1TXGA 2VCYA 4YPOA 9LDBA 3V1YA 1JA9A 1HDRA 3F47A 2B36A 3LZ6A 3W4IA 2ZB4A 1B7GO 4U7WA 4G81A 1IE3A 4U0JA 2RHRA 3VKVA 1P9LA 3DBRB 4L9RA 1AUPA 3UCFA 1GTMA 4EEXA 3GZNA 3M2PA 4B7XA 3ADPA 1HWYA 4R1NA 1X13A 3WYCA 3R3JA 4B3HA 1JVBA 1F14A 3SLKA 3WGZA 4IY1A 3EC7A 3GEMA 4YJFB 5HA5A 5G4KB 1T4DA 3ZHBA 4L8VA 3WQRA 4HV4A 5A4DA 2EP7A 5ADHA 5JCJD 4EUEA 1XKQA 2Q4BA 3NTRA 3P2YA 1YB1A 4WJZA 3LT0A 2O3TA 1NAIA 3B1KA 4RPGA 3AK4A 4YB8A 4XCVA 4EI2A 4GX5A 1R0LA 1ML3A 4IQGA 4MVJP 4YJFA 4R41A 4YBZA 4UEKA 4YCAA 1H9AA 3OBBA 3AUAA 3L4BA 4HX5A 2PA3A 1NFFA 4XKJA 3RC1A 1EDOA 3TF5A 1SOVA 3FTNA 1LRLA 2C82A 5IZCA 2NU8A 3SC4A 2BHLA 4OQYA 3GLQA 5IFLA 4GGPA 2H6EA 4MIYA 5CG1A 3KYCA 1NNUA 4D46A 1CJCA 3V2UA 1JKFA 1JKJA 4JJGA 4W7HA 3AOEA 1KVQA 3ZH2A 3JYOA 5KKCA 1PL8A 2EW8A 3GUYA 4BNNA 2BMAA 3BZUA 1DC3A 2QZZA 4AJOA 1U2DA 2O48X 3OSUA 3VVBA 5EQFA 1YS4A 2DU8A 1GZ4A 4NBTA 1YOVA 3PYXA 4IZIA 4WLEA 2HUNA 3TFQA 3NAQA 5U1PA
chains in the Genus database with same CATH superfamily
5LB4A 1XAHA 4HADA 3VYVA 3MERA 1A9QA 2YHSA 2QRZA 1QBGA 3KOXA 2ZB2A 5CTJA 2MR5A 1QLWA 2OAGA 3VC2A 5ILOA 1HRDA 1YJXA 1THGA 2I3GA 1GTVA 4K3VA 4N6OA 5BUCA 3AY3A 1ZA2A 2IOQA 3CJQA 2OHIA 4CZ2A 3QM1A 4YN3A 3DDWA 2FMKA 4O3FA 4RPHA 5DV9A 1Q1QA 4J6EA 2ATCA 4QELA 4JLJA 2GAFA 2HIAA 3AP2A 3FCSB 3HXPA 3PGLA 4COKA 3AHHA 3DFFA 1KO5A 1UM8A 2JJMA 4XIJA 4UOEA 4ZVNA 3HDJA 3K2QA 1D2MA 1FDOA 4WFIA 1M0SA 1RRGA 2YWXA 4FMDB 4J0JA 4IIEA 1TCVA 4B32A 1G55A 5B55A 1QIMA 4TGLA 2UZ1A 3FYSA 2ZRFA 3TD9A 5LQCA 3DE1X 1E94E 1FFDA 4ILKA 5D8DA 3KOMA 3THYA 3E9YA 4NCNA 4JI8B 1UC9A 5LNK1 4YIHA 4DBZA 2JLSA 3QXSA 1B0ZA 2QRHA 4WH0A 5AJWA 2VHVA 4M22A 3S2FA 3IP8A 1FUEA 2I1QA 3FFAA 1LBTA 2CGEA 4GLLA 3WLKX 3RJ5A 3MHTA 1AURA 1VE1A 3SC2B 4LS3A 3DAFA 1REQA 1WW3A 2I6GA 1T1JA 2PKRA 4DV6B 4QPZA 1S96A 2CV2A 4OH7A 1HLGA 3MWGA 5J2UF 1KFCB 3CIFA 3L7NA 4OHPA 2QNRA 5LFAA 3PTLA 2Z2IA 3CUKA 4KO2S 4D9CA 3AJRA 4X7BA 3VV2A 2X9VA 3FCEA 3TLZA 3EPLA 2EF0A 5ELXA 4RXTA 2P9JA 2SICE 1RDFA 4CEJB 5TE9A 2QTFA 4PNZA 3SVLA 1L5WA 1NQTA 3H1EA 2A7QA 3KSZO 3BRSA 4M1SA 1XRLA 1QCCA 4INOA 1R6TA 5LOVB 2C4WA 4O59O 4F11A 4D6PA 3C6MA 3SG0A 3KAPA 2BD0A 2QVLA 1KYTA 2I54A 3TECE 1A04A 3VYTB 2IH4A 1J4AA 3EWNA 3OIGA 1P72A 3JCZA 4WBNB 3QUTA 5K5EA 5AHOA 3VNVA 3IOEA 1FRVA 4OQPA 1ZK0A 1W36B 4Y1RB 4Z0HO 1TKRA 4UFOA 2JGAA 4YP5A 2OXIA 4DIKA 1SXPA 1SB9A 1BZYA 2Y2VA 3QFSA 1MNQA 3HHEA 3ZYZA 3MT0A 1MXFA 3AJAA 4UTPA 3B9PA 3JVIA 4EO7A 1CQZA 3M6IA 5KSPA 4A26A 5C3MA 1O2DA 1EGHA 1GFIA 4ND5A 3W2HA 3SXPA 2NNWB 2ZI5A 3PIIA 4AUNA 3KQUA 1WMEA 1QH9A 3I2YX 1T8YA 1ZGAA 5SYNA 4MXDA 4BO6A 4EMTA 1FVOA 1V3UA 3HWX1 4CN9A 1GKYA 4XIYA 4NQZA 1CHDA 2IYVA 2QRNA 2VHZA 5B1HA 4GWGA 5EZYF 3ZE0B 2IHVA 2ZQZA 5AVWA 3PXGA 4CF6A 1RPJA 3BOSA 2R8RA 3MTEA 2C7QA 1P4JA 5ITWA 1XWFA 2NPOA 4WZAA 3ZGLA 4QHTA 5H59A 4OJYA 3X1MA 2QZ4A 2DHCA 5IVIA 3STYA 1DL5A 4DCVA 2BR3A 2G1AA 2Q0QA 2VHYA 4J0FA 2CL7X 3C5EA 1F4LA 1Q22A 5I6DA 2J0EA 1MO3A 4MK4A 4MP8A 3IT2A 4Q7QA 3L7BA 1S9DA 2R8ZA 4JB2A 4HRAA 4D8TA 2B9VA 1KKMA 1H05A 2AFHB 2GSDA 2A7XA 3H9EO 3Q6IA 1U28C 3FPFA 1UEIA 3DCIA 4KH0A 1JHOA 3CNEA 5LR6A 3QF4A 2ZUSA 3GMTA 1DBWA 4XX0A 3DKRA 1NE7A 2SKDA 1V25A 2YWRA 4BVEA 1FYVA 1DO0A 2Q0XA 3Q1KA 2ACWA 2Q49A 4FD2A 3A04A 3EB9A 1PJ3A 2FA9A 1WVGA 1PR0A 3C8ZA 2VS1A 3A0UA 3AF3A 3TFOA 1P1FA 1NP6A 3LNTA 2BGJA 2IYTA 5J58A 3T38A 3SBEA 4FHGA 1QO0D 1X7YB 1KYIA 2GN0A 4PX9A 3ZQUA 1IVNA 3I64A 4IUCS 1FW8A 3HZOA 5KQMA 1P39A 4YRBA 1IJEA 4TN1A 3T94A 1D9ZA 2PWYA 4KC0A 4K9QA 2XKAA 4OSEA 3PWTA 4RWEA 2C83A 4TLCA 3CPHA 1C1XA 2NTNA 5DBGA 1X1RA 1E2BA 1A77A 3JARA 4FKMA 2XQVA 4JI1B 4MUFA 5H9VA 1I3CA 5H3LA 2Q8PA 4DCJA 4PTYA 1IMOA 3DNPA 5LWQA 4RTKA 1DOAA 3E22A 1ZMRA 3T1HB 1Z8DA 1KDOA 3OHMA 4W5RA 1KI1A 4JVMA 1J9GA 10MHA 1A7AA 1QO7A 3N76A 4L3WA 3N39C 4PIVA 3FKSA 1EVEA 2IXBA 1NBMD 1IG0A 3DMTA 3NBYC 1Y37A 1Z45A 2BKLA 1ZJZA 3FNFA 2FQXA 5ER9A 1BTOA 2R8BA 3Q2KA 4EMSA 5CA0B 2BSXA 2H8KA 3TOVA 3SICE 3DHVA 1HE1C 3VC7A 2VT7A 2XVYA 4G0NA 1DXYA 2WHPB 5C81A 2J0UB 3OQPA 2DWQA 2G04A 3PUXA 1COZA 2H4FA 3U48A 1JG2A 3TL2A 4Y8VA 2I7VA 5JNSA 2JAQA 1SD2A 3BWBA 4KLRA 3HLYA 3OUTA 7REQB 1NN0A 4EPRA 3HBFA 1K7YA 4OHMA 4ZVLA 4PN7A 1I2MA 1U4SA 1JGTA 2V6GA 3D3KA 3DTNA 4MQEB 2WLSA 4QJ5A 1QR6A 4WVFA 5JS6A 3PHJA 3C39A 4WACA 4Y2YA 3GP8A 1TD1A 8ABPA 2ZIXB 3I01M 4ECEA 1KK3A 4I19A 4X64B 3VJKA 1L5YA 2NVBA 4JYZA 2QBYA 2G0TA 3DO5A 4DQUA 1RYFA 1GZSA 4M1TA 1GFWA 2WUDA 1VLZA 3AUFA 1U8YA 4NYMR 2OQRA 3HJNA 2FOIA 3ULKA 3AWDA 3RG2A 3W7VA 3WRYC 4E21A 1M54A 3CVOA 1H85A 2JB9A 3TZKA 1JLMA 2FAXA 1FDSA 4JZKA 4WKNA 5DNAA 4K6GA 3MXTA 1PT6A 2VP2A 4RY8A 1NBWB 4PLFA 1YQUA 3GA0A 1LX6A 1A2BA 1UMDB 1E2JA 2OHJA 3A9TA 3MILA 2A5DA 1T5IA 3WIUA 4A8JA 1D4AA 2OUKA 2EG5A 2ZCUA 3CUSA 4ZXFA 1QYIA 2AXNA 2RI0A 3RK1A 5FTMA 3NW9A 4F72A 5M7EA 2AZDA 2II6A 1IUOA 4NAUA 4DUGA 4Q7LA 4F5WA 4KAJA 1ZDMA 4E5YA 3C3DA 3FPBA 2QE6A 3EYWA 5J4LA 5BN5A 1MEEA 4CM7A 2WTBA 3NBAA 1I7NA 1P75A 1XE3A 2HA5A 4MAMA 3BT7A 2CNLA 3HVHA 3TS1A 3HZRA 4CQMB 2PHZA 1YZVA 1D5CA 2YOFA 4REQB 1I13A 3NONA 1DGQA 4R1OA 3QYAA 4I3HA 3ZZ1A 4A2QA 2C2MA 3IDFA 5KTTA 3WMEA 4F93B 1J2TA 4M1ZA 4NMHA 3IUYA 1JIJA 1QRSA 1NXPA 1LH0A 4S1WA 5B58T 3UK7A 4O4HB 2JI6A 5DSXA 3DF9A 1CX9B 3NTLA 4Y1EA 4H3VA 1OVMA 4RF4A 3RUCA 4NHOA 2RI1A 4XX0B 4D74A 3KCNA 5JZMA 3HXKA 4EGAA 1Z2CA 4M83A 2ZRGA 3EAFA 2ZAOA 3NH6A 4RS4A 2J3QA 3UF0A 5ABPA 3O74A 1GFSA 4MCAA 2E4AA 2WVHA 3RJTA 3O83A 4KQXA 2C3YA 4P3NA 3V1KA 5BR4A 4R7ZA 3JQ7A 3GV0A 5EC8A 1SBNE 2MYPA 2G40A 4FMCF 2PMBA 1SBCA 1YI1A 2JKYA 3DP7A 3ANYB 1UC5B 2ZVPX 3FZGA 2XGMA 1RAAA 2ZSJA 1WWKA 3M3HA 3OWHA 1L7BA 2H3EA 2F00A 1NM5A 3H5AA 2GUGA 4HPJB 4RTQA 3O84A 1W48A 3LT5A 4H7DA 4L57A 2QTZA 1HFWA 2FDXA 1L1QA 4M7RA 3P0RA 4GZ6A 4N0DA 5JTTA 2V3CC 1AO3A 4TVSA 4F4IA 1E63A 2DG2A 1QWOA 2WJ3A 3JZMA 4KPUB 4HYTA 1U7WA 1JDZA 3RBVA 2PN1A 2QD1A 3EGDB 2FUCA 1BHQ1 3A1TA 4RENA 4WHMA 4A73A 4BAZA 4B3MB 2J59A 2IBMA 2QENA 2A1UA 3RS0A 3VR6H 1XN4A 4AZSA 3RC7A 4KXYA 3I76A 5H3CA 5A4IS 1RRMA 3IE1A 4XPIA 1QF7A 2QL6A 1Y1LA 1CY7A 3OZCA 4C30A 3T9DA 3WWEA 5HRCA 4DYVA 2A6PA 2FW6A 3UK6A 4NMLA 4ZU6X 2R97A 1FFGA 2WHRA 5C18A 1ZOIA 1OFTA 1GJRA 2V9PA 4OUDA 4IOLA 4EH1A 2H7CA 4MMXB 1H5NA 3UCXA 1DAGA 4ZVOA 4AAYA 1GXSA 1TKBA 1ZGCA 4W5NA 1F17A 4R1LA 4MWZA 3KQKA 5FA6A 5BWOA 2DBZA 4PLWA 3AERA 1R15A 1E60A 3FHTA 3EFOB 1JMYA 5EHNA 4M7PA 5J40A 2MYUA 2QN1A 4U2KA 1DEKA 2NLOA 3ODPA 4JLWA 1QIIA 2Y93A 3GRZA 4HLUC 4IV5A 1U2ZA 2Y27A 1EK2A 4RD0A 4EG4A 2Q5CA 1ZBQA 1D0VA 2W6NA 2PSHA 4D8XA 2YIDA 3KHKA 1L9KA 4XYMA 5C32A 1O77A 2QBYB 4MKIA 1YZNA 4WL0A 1KEEB 1JSCA 3PZBA 4LRXA 3ILHA 4NZNA 5JFTA 1EEXB 4LJKA 1QCDA 4XWWA 4WIAA 3LGXA 2P78A 3BHMA 1PSZA 3GCGA 4M86A 3N6XA 3MNFA 1N5RA 4FBLA 2FUG6 4IAOA 5CU7A 5CT4A 5K3SA 2LWIA 3HBMA 2W2QA 1NVFA 3N0XA 4OQQA 3NTUA 5T6MA 3SIRA 3B1YA 4CCYA 4UEJA 2HGZA 1L4HA 5JAZA 1D4FA 1E9VA 1N2SA 4UARA 4ZZ3A 4IS2A 4U9HS 1FL9A 2H7VA 3ISJA 1PNVA 2D1SA 5L3SA 1BEEA 1Z7GA 1DOHA 1GTZA 1RRFA 2BKAA 1EUZA 2ZE5A 1Z4NA 1H0SA 4IZ6A 1Z82A 3UWPA 3NDIA 5JD3A 5KPJA 1NY6A 2CLLB 5JQGF 1MVLA 1DO2A 5A62A 2G1UA 5EA2A 1S2OA 5JZ9A 2WABA 3PD7A 4N8EA 4UU7A 3AXTA 2M6LA 4D02A 3WV4A 4EGQA 1CZNA 4IOKA 1R6DA 1EQAA 2BEUA 2B7CA 1OX5A 1E6UA 1MXHA 3FIJA 4PAWA 5E7JA 1RQGA 1RXSA 3R3HA 5AJTA 4OV6B 2RCYA 1BXKA 3FTDA 4D2IA 2OMEA 3JQGB 2DKNA 3ZR4B 1M2JA 2P4SA 3Q87B 4G26A 4GLJA 1GPLA 1K6MA 4HSEA 2VTBA 1ZUD1 2PM8A 4EKGA 1T36B 4O63O 5BWLA 4GMFA 1VM6A 4HL6A 5FWYA 3JYLA 5EVJA 2Q4OA 3DONA 2XTAA 4B6PA 5HSGA 3OPNA 3N7TA 3OZUA 5J2TA 1EDEA 2YS7A 3C7AA 4TLMB 5K3FB 3QNMA 1DKLA 1FXWF 2V9ZA 4MOWA 3MCZA 3RWMB 4AK9A 1B6RA 1QLJA 4O2BF 4CNBA 5L4SA 5JSZA 5EKUA 1CJTC 2JFVA 5HCIA 4ND3A 2C2XA 2MSDB 1JJFA 4HEHA 3KSRA 3QEAZ 2Q1XA 3JD2A 3PUYA 3PS9A 3P27A 2Z3ZA 4ETNA 4ERNA 2YXLA 3NRJA 4R40A 3I5YA 4CKBA 1BVRA 4I55B 4L28A 1FLAA 4IGKA 3OIDA 3REFA 3G82C 3P45A 4PC6A 2X5NA 2OV3A 1WV0A 3WLHA 1L8LA 4YAOA 2HIHA 2B8JA 3GFVA 5EZSA 2VJPA 2BEJA 3GB9A 2VPWA 1OAOC 3IUEA 3VSBA 5CCXA 5ALIA 3ZU5A 1U1GA 3G88A 3M9XA 2HBZA 4GBJA 4BQNA 4X63A 1GQOA 4KLCA 1Q2XA 2PH1A 5CVEA 1TK9A 3KLBA 1TZMA 2XADA 4GM0A 5DNWA 5LL6P 2JHCA 3TTTA 2QMHA 4FFSA 4LXQA 4XYBA 4M55A 3RIHA 1KEZA 1RYHA 1UBRS 2JKVA 2Q0HA 3TDNA 4IIJA 1NQXA 3EODA 3OZTA 3PENA 4FN4A 4Y6GB 1QG6A 4JI2B 4HZGA 2FKAA 1XCOA 2WBLC 2GJSA 1WP9A 4KXWA 1SHUX 4EA8A 3KZXA 3MGGA 5K0LA 5CFNA 5FBQB 1R8SA 2RE8A 3ZJUA 1NMXA 3FA2A 4HLNA 3UH1A 5KYTA 1UQRA 1L5HB 1RYEA 4ND8B 4OBEA 4CLEA 4LI0A 4KRGA 4PQGA 4U3JA 3TIVA 4D5EA 4OX9B 1B4DA 4AY6A 3ZTYA 1YU9A 4NARA 3O31A 1H4SA 3Q0EA 5LD2C 3QXXA 4V03A 5ED4A 3VHXA 1NXQA 4QFBA 3D1JA 4P58A 1L9XA 4EAQA 2OG2A 5JSQA 1QFZA 1Q16A 2CXOA 3DB2A 3OD1A 2WLTA 1PBNA 4FKBA 4YP1A 1OV6A 1N0IA 3UAXA 1OFVA 1W5SA 2EQ5A 2JIRA 2QMUA 3J81k 5IKXA 4QUKA 4KUEA 2C5LA 4HUQB 1YRYE 3AGQA 3CF0A 3U3OA 3DFIA 3B7PA 3P96A 1ACJA 3LY9A 1FFBA 3PICA 4CL0A 1J2RA 5IAAA 2AI3A 2W2KB 3VVCA 4Z2AA 4GR5A 2Q45A 1KGDA 3I9OA 3OZSA 3DVLA 4AECA 4KKVA 3OHSX 3A6PC 3GFPA 3WHIA 3U80A 1MHTA 1HV8A 3K70D 4URYR 1Z07A 3SSNA 3GLFB 1DV2A 2J1LA 1Y4UA 1N2JA 3V3TA 1MO4A 3KR1A 2GOYA 4JLKA 1UBKS 1Y3CE 1B8OA 3TJMA 3U5TA 1DKQA 4ZQCB 5T67A 5KOJA 1BX3A 1G1MA 1XTIA 4GYYA 3H9CA 5FRDA 4C4SA 2HQBA 1ZRMA 4DLVA 5JRDS 2VSNA 3TW8A 5AQ1A 3MHPA 1L8OA 4TN5A 3WC4A 2AH5A 2WTXA 3GC6A 3ND7A 2EWVA 3AQ4A 1YZHA 3HDHA 1S0UA 2A30A 4PM4A 1KORA 1NLMA 4Q9KA 1I3NA 4FLEA 1F4PA 4I3GA 1BQ3A 3LW7A 3O8OA 2Z09A 3FR7A 1A76A 2BMFA 2BI8A 1OWMA 3B5IA 3OF5A 4GE3A 4ER0A 2QX4A 2Z57A 1ENOA 1PG5A 3AEUB 2NZYA 4JKYA 4L9WA 4TXLA 4U0KA 4ZP1A 5DBFA 3T7DA 3TZCA 3TZHA 5C4MA 2VF7A 3AHDA 1OT3A 4YPFA 4V0RA 3HR4A 4CKCB 3DTVB 1Y98A 2JJQA 5I4CA 5KTRA 3NNDA 2GBIA 5AK4A 2ZRMA 5DLEA 2DY1A 3D9QX 3PJEA 1HOTA 4U63A 3T7SA 4BNFA 3UCEA 3V1UA 3E9MA 4PGGA 2J31A 3G0BA 1QVWA 5EJ4A 2EARA 1H2ZA 13PKA 1VLLA 1W47A 1ZPDA 2M98A 2W11A 3SS7X 2YXBA 4YACA 4BEBA 5JNRA 5KTMA 2O2JA 1AS2A 1YZKA 3NBKA 3BSWA 3AP1A 1WEKA 3OPYB 3BFJA 3I2IA 2Q7XA 4M8LA 3ONDA 4I14A 3BRWD 4ZI5A 3OTWA 2C3MA 1E3QA 2YL2A 2R00A 4RELA 1XD9A 5ELMA 1HEIA 5AXBA 1PNOA 1RQXA 3QA9A 1KI6A 3DHWC 1GCUA 4IZHA 3UJBA 1J97A 4N3BA 3SDBA 2CMGA 2QQEA 4X3OA 3K31A 1PUJA 3VZBA 4H27A 1ODJA 2HO5A 3DMFA 3DMYA 1PR1A 3M34A 4DA6A 1M2NA 4XEHA 4I66A 2YJNA 1FYXA 1QDEA 3F9IA 3ES9A 3LLVA 1W93A 3O9VA 4HNHA 4IHJB 4R0MA 1NJ1A 4MGIR 3ZGOA 2IOFK 2HXSA 4JSTA 3GFFA 3U3KA 3G1TA 1ZCAA 1NN3A 2M1XA 1DIGA 3CGGA 3D8SA 2UVPA 3CLSC 3QW2A 1PDOA 1EWQA 3M1LA 1RZVA 2PLAA 3UJDA 3DWFA 3FMPB 4YCLA 1Y9DA 3K6SA 1DAIA 2X5XA 1WUIS 1KAQA 4DA4A 1RMQA 3OKAA 4IHJA 3UFBA 4PINA 1WPQA 2NSJA 2BCJQ 3P4YA 1ULZA 5JO0A 1QYVA 1GDTA 1BEUB 2FE4A 3RHFA 2GK7A 1C8VB 3I6BA 1UKBA 1NSTA 2FR8A 1VG1A 4QBFA 5DP1A 4B6JA 1VFPA 3DMHA 2EGGA 4DIMA 4KDCA 3ZCQA 1ISIA 3W8NA 1ZGJA 2XQKA 2AUTA 3FZEA 1MAAA 2H5JA 2GYWA 1VJTA 4GOND 4P32A 4B3RB 2WRZA 1AF7A 3I58A 3X1ZA 1MOZA 1VG8A 5AI5A 5A03A 1KXJA 2QG4A 2JIBA 4JEIA 1KDRA 2ZIWB 4UD6A 2Q5OA 2B21A 3R44A 1K5HA 3DH0A 4KVGA 5AVOA 4DQDA 1CEYA 4GMGA 3HQ4O 2DSNA 3IURA 4HAYA 5KQPA 1F2DA 4MKFA 5ALKA 4MKRA 5HG0A 3HUDA 1QHHB 3QV1A 2IEIA 3QVJA 3T5MA 5CB4A 3Q8MA 1I6MA 1BXRA 3GRKA 5AOAA 2PMWB 3LDHA 1Y6GA 4Y0NA 1N6NA 3TUZC 1J90A 1Y8AA 3N74A 1M66A 3M4YA 4RX1A 4CDNA 5JXHA 1Q15A 2W2LD 3QNWA 2ASEA 4K2HA 5MN4A 2QM3A 5DX1A 3U0VA 2H65A 3NYRA 3ABOB 3V4FA 1B0AA 3C3YA 3QEMB 1NC3A 4WUTA 3RC9A 1Y8QB 3TSWA 3T1TA 3K4HA 4BB6A 2EKQA 3VI4B 4HDNA 2CXSA 4DV5B 1S2IA 4GG1A 1K8RA 4HD8A 5FPHA 1G5PA 2PLRA 3SJBA 1C3JA 1ADGA 1WD5A 3ZWDA 1JQBA 2I71A 3D3WB 1J23A 1A8QA 3C74A 3VAYA 3DE6X 3D4BA 2YRWA 4KTVE 4D9EA 2OE2A 1SVIA 4DMKA 4ENPA 1E4OA 4PG6A 4XQ0A 1KQ3A 2RJ3A 2WM8A 3T1VA 1RC1A 3VPBA 2PD6A 4BKOA 3K05A 4C5CA 1ZESA 2A0KA 3QKTA 3C98A 1U81A 4Z7QB 3FI0A 2N0SA 1H93A 4CKYA 1SUBA 4LECA 4U9IS 1OB5A 3Q3VA 3SZUA 2HSJA 3R75A 8MHTA 3SF8B 3NKVA 4ONEA 5CJPA 2FZWA 2R6R1 4D0LB 5A4FS 4NBVA 1KY3A 4QYXA 2MINB 4CFYA 3M5CA 2WUGA 1E9AA 2ZSEA 2YCLA 3O2SB 3KDSE 4O8ZA 2XCTB 4OLAA 3PF9A 4G67A 4QU5A 4G1FA 4AP6A 4CT0A 2H4YA 1V7CA 2AX4A 3OLYA 4HN4B 4TL9A 4UBLA 3GLGE 1UOOA 4I3FA 2FSFA 2R3SA 1G0OA 2MTBA 5EJIA 3EASA 3SZGA 1O0SA 4EYQA 5D5PA 3SHQA 1SULA 1U8UA 3UEOA 1OZGA 2OR3A 2X7HA 3U9LA 1MO6A 1SIWA 2X7JA 3AJEA 3OZBA 3T9EA 1DC4A 1N8KA 3RFTA 3MW8A 1YH3A 3LHSA 3WWPA 4ATNA 1T5LA 4D8WA 1MKYA 5KSYA 3I32A 4UMEA 2K2QB 1O58A 1M6YA 3FRHA 3IVMA 4OL9A 3RT7A 5KTNA 3L1JA 3NTOA 2MSWA 2FSVA 1IY2A 2GZRA 2W43A 2ZJBA 4GU5A 5BP7A 1GGNA 4DIEA 4C7OB 4H7JA 5CM9C 3AY6A 1J0XO 2WIKA 1KJWA 4CDRA 3HJGA 5K2OA 3EEOA 1P18A 1U6KA 1GGFA 1NMZA 4ER6A 1KI9A 1RWOA 2CLHB 2C5GA 3EMKA 3M6XA 1HNNA 2HN9A 2VDQB 5FL3A 4DT1A 2H2DA 2J9FA 5JH7A 3I09A 4BFTA 3IAM1 4BFXA 1NVXQ 2A58A 1QE5A 1BW9B 3FPLA 1PW5A 2BMJA 5F2NA 3KQYA 4B7CA 1N2ZA 4LY3A 3C4QA 4ZJZA 1L7DA 5IT9A 3O91A 1TO1E 3SHFA 4ITVA 1M6VA 3CUEF 3RJMA 5FX2A 5JANA 2VNKA 3LZDA 1FNNA 1I5RA 4DT1B 1YT5A 4DV2B 3BCSA 3PR3A 5BRJA 3NHJA 2OO3A 1XIVA 4RMJA 3ZNOA 5KNDD 1L7RA 3KJFA 5EMKA 2BBOA 4NZMA 4X45A 3VXKA 3FDIA 4DC9A 4HB2A 1M1YE 4N5MA 3ACCA 2B8WA 3RC3A 3U7IA 1F6WA 1GA6A 2YFKA 3NKLA 4CLOB 4F8JA 4DSNA 2I6QA 1GD1O 3NIGB 4RQUA 2VN8A 4IICA 1E18A 2QV0A 2XA2A 1XDDA 2GH1A 3C87A 4PGMA 1L5KA 3IVRA 4GRDA 2JARA 5DF1A 4JASB 3A6LA 3GUCA 4KK3A 3AFOA 1A82A 3A11A 5DULA 1QHHA 4BJHB 4JLOA 1BFDA 4X92A 3M6LA 4EHAA 4EY5A 1W2WB 1B73A 1AHPA 3OQ6A 2BFEB 3I5AA 5E38A 1PL0A 1TE2A 4XSVA 2P5TB 4TT8A 4HNQA 2QJRA 4QGHA 5LVAA 1NR1A 3F6YA 4KWTA 4Q3AA 2PBRA 5G3ZA 3EDCA 3UKOA 3EWAA 2YOHA 1VZ3A 3UGTA 1X80B 3LGAA 4L73A 4O2BA 1RBQA 4P35A 4MHTA 3KJXA 1IAQA 5A5VA 4PSAA 4EZEA 3ZHZA 2A8YA 2F1JA 3OQNA 3NKFA 2P4HX 4YCBA 5IUKC 4C4PA 3W5AA 3SHTA 2JBAA 5JDIA 3AL3A 1WU8A 2VPIA 1EG2A 1TAHA 2HREA 2RHHA 4M21A 3SC6A 5E9JA 2O8NA 3U13A 2XVXA 2RGXA 4QDUA 3RS8A 2ZJ8A 1KKLA 2PKEA 3OECA 4DLTA 3AVVA 4DIOA 2ATEA 3I9MA 1OX4B 5KINB 4DOMA 4O02B 4M1QA 4BQRA 5J4YA 1IPHA 5DW3A 2COKA 2DCUA 3KQVA 1U7DA 4GSLA 4UHEA 1TUBA 2ZB8A 3V4PB 1QOQB 4YRFA 4CF3A 1DT3A 1QWSA 4I5GA 4U9UA 1QH0A 2QQ5A 3TTVA 1Z56C 3CB2A 5GM2A 2XUGA 3IC5A 4K03A 4KU4A 3DGEC 1LDYA 2D06A 2YJTD 2BJWA 3DUWA 5CT5A 2NVOA 5G3YA 4WLVA 4XDYA 2OHVA 2WSSD 3QZUA 5T3UA 3CRRA 4R9UC 4YA6A 1FFAA 3KPUA 1Q91A 1THTA 2Y99A 1ZMOA 3ZCRA 4LRSB 2F3TA 2O7SA 3PRKE 4N8DA 2R7AA 3B6EA 2ID7A 3C1OA 3DEAA 2FFHA 2RHLA 3FTQA 4GLFA 2Q7OE 3RWBA 4B9AA 4DFDA 1L4YA 2LPMA 3HBAA 5IASA 2VHCA 1MX5A 1QKKA 2IUTA 5LDHA 2DECA 2GTIA 3HFSA 1RWBA 5DWQA 5L7TA 4GEGA 4RTOA 3WGMA 3O93A 3NIBA 1T15A 1VDMA 1VI2A 2IP2A 3KXKA 3L93A 4LMPA 2GBLA 4MW0A 3GFRA 5A3SA 3F3MA 4KVZA 3TIIA 4LJAA 1GU1A 1HKUA 3CUUA 4P9NA 4MQ6A 3RAPR 1NYTA 3ZJYA 5DFAA 3FZQA 5HZGA 1MJ5A 2Y8EA 3BWCA 1E6LA 3AKYA 3W2TA 1Y82A 4KIJA 5I7EA 4TTSA 2HR1A 1A4IA 4C08A 2ADMA 1JQDA 2ERXA 3LKZA 4L8WB 3THOA 3WJAA 4BNGA 2FN7A 1E89A 1UK9A 2NV2B 4Z4EA 2WD8A 3BGWA 2W4MA 4WA7A 2O2IA 5F35A 2Y0PA 4K46A 1L7AA 3BC1A 3H1FA 1EWRA 3FNRA 4UNRA 2HNBA 1AB6A 2CEAA 1L5HA 5HS6A 3JXEA 4LKRA 4WJLA 1SKAA 2H7XA 4IDNA 2XI4A 2Q3BA 3CNNA 1QIEA 1PHPA 1XSEA 5IZ4A 1R9NA 2HTFA 3HLKA 3UJ8A 4BBPA 5DM70 1FS5A 4Z49A 3VHXB 1PUIA 4YO8A 3DDHA 2GBPA 1BX1A 4BLRA 1RXYA 3A7EA 1E62A 5DN9A 2FW1A 5F5LA 2QJOA 5ARCA 2ZRHA 4LY9A 4UUMA 4RW0A 5E7IA 1O1YA 1H5UA 1GGMA 1MV5A 2NO7A 1ND6A 1T8UA 3FUTA 2QIOA 4U8HA 1QC5A 3PXEA 1U0RA 1HZJA 4WZZA 5CAEA 3BRWA 4MR8B 4LMBA 5HM8A 3CZ4A 1QAQA 2XE6A 3JQBC 4ER5A 2O20A 2ZYGA 4X44A 4U4AA 4FNMA 3E8MA 4MWDA 2AXEA 1LUAA 3N2YA 1XEAA 2AMYA 3HN2A 4XDHA 2W98A 5KMGB 1X0XA 1R4NB 4PGHA 3I4CA 2C9MA 2V7QA 3MWEA 3RSOA 3E35A 1L1EA 3PK0A 3QV2A 1US8A 4Q9HA 3ZDZB 4UE3S 2JFYA 4UZEA 1ZSYA 2CVQA 1IJKA 5ITZB 2XA9A 1SC6A 2JKZA 2PGNA 1E3MA 2E1PA 3UBMA 4EB0A 1ZHHA 3D7NA 3IBCA 4HRYA 2WYWA 4UFNA 4FR0A 1I3LA 3PE6A 4I9NA 1GSIA 3FJOA 1TIBA 1BDMA 4UNSA 2Q07A 3EUWA 4BFUA 4EG0A 2H2WA 1OC4A 4XAQA 2O4CA 3H9GA 3U09A 3HB5X 1T0HB 1DUVG 2WTMA 2A3NA 1KVRA 2VHXA 4OXQA 1Q7GA 4CQJA 4F6CA 1Y9ZA 1FFWA 3CNHA 3LC0A 5IK2A 1Y1KE 1L4BA 2VJNA 4WOCA 2ZM5A 1EDDA 4H7PA 3GGCA 1NLYA 3G9QA 1TLFA 4MJ3A 4YQEA 2V58A 1NJSA 3L6RA 2RGYA 4PGAA 3ROEA 2C03A 1GQ2A 5BSKA 2RHTA 5CXUA 1CY8A 3EZYA 1RFGE 4I50A 4IQ0A 4JZYA 4M9RA 3ZI7A 1JAXA 5J4HA 1KIAA 5CG2A 3WIOA 1YFJA 5JC1A 3BMOA 4J3FA 2CLSA 3O2QB 4MLDA 2MMGA 3F5FA 1K08A 3QMMA 1MEJA 5TS3A 1JFRA 5IANA 3LT4A 1K6JA 3KZVA 3O8QA 1OLSA 2IXGA 2IEYA 1SKMA 5G0TA 3DLTA 3KT8A 3RYCA 2P27A 1HA3A 4GUDA 4QD3A 5IYZF 4TV9B 1E2HA 4RPJA 1YS6A 4CFSA 4ZAXA 4EDHA 2OV1A 1JG4A 2R6HA 1GITA 3ICOA 4RNDB 4BKMA 1PGNA 2CMFA 2Z4TA 2X2FA 2O5VA 3EVNA 4IIVA 1YASA 4PR3A 1YB2A 4PWYA 2GZ2A 3FPCA 3MGAA 4C43A 2XB6A 4QJ3A 1C8KA 3D0OA 3A06A 3EY4A 2ZT5A 5BQXA 4RLHA 3H2GA 3GRRA 3FR8A 1YJQA 2HZBA 3ONFA 4XD7D 1E96A 2AFHA 2Z5VA 3QWFA 4UTVA 4UBJA 2GK4A 2IIBA 4Z4IA 4F3TA 3K1ZA 3UZUA 1N6LA 1YNOA 1V5FA 3B85A 4UXIA 4CGZA 2ORIA 4G65A 3R0VA 4NE7A 5KU1A 3NGXA 2QRJA 5AP9A 2UYYA 2JFFA 5EMHA 4C14A 3FZYA 4HFNA 4LOKA 4LRTB 5EZQA 5G0WA 3L84A 5F9FA 4HN2A 3L0PA 3ON5A 4BO9A 4JENA 2AF3C 4C1BA 4MV0A 2CLKB 1KVUA 2PRIA 1D09A 2QX9A 2VHWA 3HSYA 1NW5A 3PDWA 4D9NA 1J8MF 1PR6A 2QXUA 4AP9A 4TTAA 3CRVA 2BGWA 3LLUA 1Z26A 2P6UA 2Z9CA 4N54A 1GRVA 4HDRA 3V48A 2A0XA 4C4XA 2ZR8A 3S70A 1W25A 4P38A 2YN0A 5FBVB 1TT5A 1SUSA 4G0PA 2EZUA 1FP2A 2DQZA 2JLRA 5HRUA 3PGXA 5B3KA 2Q4EA 4DM4A 4JGBA 1ZN8A 1DB3A 1H0HA 1SG9A 4F1KA 5DYNA 1BN6A 4NI5A 5DHTA 1N36B 3QE2A 5DZSA 3B1ZA 4HDRB 4YFVA 3IDOA 1H4VB 1RBMA 2G6BA 3VOAA 3UB2A 1MMFB 4CV0A 1H23A 1Z4LA 2H07A 2IEBA 4BIMA 3CZPA 1O96B 4HYYA 1N8NA 4JFAA 1XDZA 4JXKA 1LJ8A 1WF3A 1I2ZA 4MHSA 2GRJA 3DE0X 2LNDA 2A94A 2PL1A 1T4GA 4E5SA 1JT9A 1KJYA 2LUOA 2VRWA 4C03A 4S04A 4DEXA 2QT0A 2ZJZA 3A27A 2Y1XA 3DKPA 5DT9A 2PSFA 2KM1A 4XYGA 1DWQA 2QN6A 1XGKA 2Z2KA 4K87A 2AN9A 3RSGA 4YNBA 4PQYA 3TNFA 4DQ0A 3CLRC 4FS8A 2K4MA 1L6RA 4AZ0A 1OHHA 3BRCA 1TEXA 3EDRA 2C4HA 2FETA 3KQQA 2G9QA 1WMAA 2FN8A 4Y98A 2J09A 2DYKA 5BV1A 1ESEA 2WJVA 3DBVO 4O25A 2B8EA 1GCIA 5ALGA 1RJWA 7AT1A 2X8JA 4I4IA 1D03A 1OLXB 4TZKA 1T24A 1QPGA 4Q9JA 4LDAA 5DX8A 3LBNA 1OW3B 1O89A 2POCA 3KR2A 5C0OE 3ME5A 1G7CA 3LWBA 3K5IA 4NV3A 5JNUA 3HVJA 4KHPB 3U7GA 2B4YA 5GVSA 3UHOA 1DE0A 3C3KA 4V38A 4ZALA 3S5UA 3OZGA 1PW7A 3MZ0A 1G1AA 4MVYA 4ZXPA 2O0MA 2YVKA 3D7MA 1SXJC 4M6WA 2QRVB 2HWYA 2VDWA 1GFZA 4HNAA 1W2GA 5FFNA 3IFSA 1G8KA 3VAAA 3W3AH 4L08A 2D5IA 5KOJB 3BMCB 1JEQB 2EBWA 2BHRA 4ICIA 4DIBA 5E0KB 4CM8B 3HP4A 3OM9A 1O95D 2OTCA 3EDQA 3KC2A 4GXTA 5CYOA 5KOHB 3TCKA 3ST7A 1OH8A 5I9TA 1CRLA 5HS4A 1U94A 2X1HA 1TYBE 3K72B 4GBMA 3QPUA 1FU7A 4IVRA 5EIEA 3GT0A 3WLFA 2P79A 4JJEA 1A27A 1JR3E 3CVYA 3IKTA 2H92A 1HFEL 2QRUA 3QG5A 4KAFA 1P29A 3L5OA 4KXQA 4WD3A 1C4OA 2IU6A 1R37A 3V55A 2FOXA 5JWOA 1N5IA 2I7DA 2HSEA 5KNDH 3FTFA 5DB4A 1E98A 4YASA 4CW7A 2YR0A 3SLGA 1NW9B 4TXMA 2I2BA 5ALJA 2GDJA 3N5CA 2HCRA 1XJQA 1OAKA 1XT6A 3OZRA 2C4MA 2ODNA 5AM4A 4BZWA 4EGCB 2DPXA 4PZLA 3IAS1 4F12A 3EXG2 5IK2D 4OMCA 1V8PA 3UJCA 3HP7A 3INGA 2HK9A 4ROTA 5B53A 3RFFA 2Q3CA 4K9SA 2YHIA 3I4FA 4OAQA 4YJKA 3TSOA 2YNMD 2XQIA 4LWPA 3P26A 3R3VA 1F2TB 1ZVMA 1M6NA 4BVBA 2RGWA 1JYEA 3LWDA 1KPGA 5HKOA 2Y4NA 5EPUA 1GLVA 2GO7A 3KQTA 4ZPXA 2H0QA 3TINA 5CVTA 2UZIR 1U9YA 3GJTA 2HF7A 5KYGA 1VE3A 2UZ1B 4CIVA 3HXMA 3EF1A 3JQAA 4H3KB 3Q9LA 3VGPA 4JI4B 2IS4A 5FI5A 4CLRA 2FSPA 3BERA 4P3XA 5EN4A 1EBFA 3E22B 4WLNA 5EUBA 1G3IA 1WDMA 3I6IA 4KSBA 1KI2A 3IEIA 5CK4A 4I99A 1Y7IA 3E03A 2RONA 4QG3A 5JMOA 3KEFA 3TUIC 5A6SA 4H08A 1JEYA 2O07A 3BG5A 5CFOA 1HYGA 5DM2A 3ODGA 1DDOA 1IPEA 4YP0A 2BFPA 2CFRA 2B4TO 1H6CA 3PGA1 1ZD3A 3WNVA 2X9GA 4FMDF 1C9DB 4EFMA 3BULA 3DEKA 2QR3A 2QN2A 2RGNA 4FD3A 4G63A 5IH3A 2XT9A 4KN9S 1EU1A 3E4DA 3EZNA 1T9BA 1TM4E 4U00A 1TLLA 1TF2A 1V1RA 2CDAA 2QAGA 4PS0A 4W5HA 2EBHX 3MJRA 5E1OA 1UJNA 5THKA 4C6SA 1ML4A 4G5HA 2MHCA 2VFAA 3DM5A 4U6NA 4EMBA 3AR6A 4TKVA 4EJFA 3RU3A 1M67A 4M88A 4C7XA 2Z2YA 3IT3A 4Q19A 5HK9A 4E5UA 2AJBA 2W5UA 3T99A 3W8RA 3ZK9A 2VT6A 4ZV4A 1E9CA 5BVHA 4C05A 1ZRHA 3DULA 4Q4JA 1ISGA 3HZZA 5FT9A 5KTPA 4AJEA 2IT1A 2WMNB 2QTNA 4IUYA 2VHTA 1FTNA 1XZQA 3QBVA 4RJKA 4TLLB 5TQ2B 1IWBB 4B17A 1XCJA 1ONOA 2P2NA 2ZP1A 1PK7A 1T6BY 4G23A 1J49A 5I9BA 4OQDA 3V8NA 1R5OA 3FSRA 3IHWA 2CVFA 4LFAB 5ALPA 4B3GA 2BY4A 1UDRA 3DOCA 3TO5A 4AJPA 1TI7A 2I0FA 3ED1A 4OXYA 4L22A 4CN8A 1EAYA 2AGVA 3JD1A 2AV6A 4KNVA 1I9CA 1ZI9A 4BATA 2H11A 4BVLA 5THQA 3Q9NA 4ASUA 2ZDGA 3V7FA 3RCBA 4K88A 5F98A 4I50F 4PNHA 5DMXA 3UT5A 4UZSA 3MEQA 1SMKA 1UJBA 4GXNA 4K0RA 2C9DA 3TZLA 3UFXB 1MC8A 5BQOA 4LF9B 3Q7SA 1KO4A 3ZZMA 2PSSA 1EJ0A 3UV3A 5IBQA 2QAGC 4QUJA 3K30A 5LP1A 4GNKA 3WWCA 3L7DA 5E6RB 4A2WA 1YRQA 2IBSA 3QELB 1PZFA 4FHFA 4UHKA 5CYFA 1GAEO 4BO1A 3QXCA 3G3EA 1SC1A 1E0AA 1AXRA 3DG9A 1M8JA 2H17A 3GJ6A 5P8WA 1DTEA 3IEPA 4BV8A 2YDXA 5LLDA 1N7IA 3COPA 1VCMA 5K7SA 1M5UA 3PRHA 5TVGA 3QY9A<