2ZTVA

The binary complex of d-3-hydroxybutyrate dehydrogenase with nad+
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
260
structure length
260
Chain Sequence
MLKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISALAEKNGVDQETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
publication title Closed complex of the D-3-hydroxybutyrate dehydrogenase induced by an enantiomeric competitive inhibitor.
pubmed doi rcsb
source organism Pseudomonas fragi
molecule tags Oxidoreductase
total genus 98
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ztvA00
2ZTUA 3FPCA 3IJPA 1NHWA 3DAPA 2H63A 2QIOA 2CD9A 2GR9A 3F4LA 4IDEA 4KQXA 5LDHA 1GYPA 1JWBB 1R4NB 3ADOA 4FSHA 4GPD1 2AW5A 4Y6PA 2HMVA 1GDHA 4BNUA 4H3VA 1A71A 2Z1MA 2HMUA 2ZB4A 3DBRB 3E48A 4JXKA 3SJUA 3WSVA 5T57A 1HE3A 2YV2A 3LLVA 1CETA 2PA3A 1UZNA 2E6UX 2ZB7A 4CM7A 4TVOA 3KYDA 1E7MA 3CIFA 1GV0A 5G0UA 4Z6KA 4KWIA 3M1LA 4ZVVA 3H5AA 3KLPX 5K0ZA 1YL6A 2WD8A 3RAJA 1HSZA 3EZYA 2X0IA 4BNFA 4FDAA 3QY9A 3ICPA 3B1JA 3DL2A 4ESOA 2HU2A 3I9NA 4J1SA 1ZKMA 3TQHA 4YR9A 3Q2KA 4IDDA 4PLZA 5F21A 4I5FA 3VH4A 2G82A 5F5LA 3ADPA 4BKOA 4I5DA 4RZHA 5A9SB 4BO3A 4QECA 3RUAA 3WGOA 3OIGA 5JMPA 1V3VA 3B1FA 3ZZNA 4XWYA 4CV2A 2UV8A 2EG9A 4JCOA 3AK4A 4GMGA 3TZ6A 2R00A 2P91A 3ZWXA 2FPPA 5FFFA 3DOOA 3TJRA 4WCFC 3WIDA 2VUTA 3FNEA 1GZ4A 4YTEA 4YBZA 5GZ1A 1KOLA 3IL2A 2Y1CA 4QO8A 2X4GA 3PHIA 3VKUA 3M6IA 4WPGA 4ZQGA 1UJMA 5I7FA 3Q6IA 3NGLA 4DTIA 1PZFA 1CERA 4ZN6A 1PS9A 2NU6A 5ER6A 4JBGA 5C5IA 4J1TA 4RCVA 1YB5A 4FOOA 4G2NA 2PGLA 4Y6RA 3RD5A 3S2GA 1NAIA 3ZH2A 1X7DA 1IHXA 1KBZA 2HCTA 4XIJA 5A03A 5JDCC 3IUSA 2O7QA 2DU8A 2DVMA 1RM4A 1IZ0A 2IRWA 1YKFA 4CV1A 2C59A 1LSOA 5J23A 4CLXA 4YEDA 4NK5A 4FOSA 1NWCA 4IS3A 1I33A 4MVJD 5IXYA 2WM3A 3IC5A 1ISMA 2ZTMA 2VUSA 4YACA 1EVZA 4CUZA 2VTDA 2GN9A 1P1JA 1PJBA 3TN7A 1N92A 3V1TC 1EFLA 1K6IA 4XX0A 2ZCUA 4E2YA 2IXAA 1JA9A 2Q1SA 4FPXA 4XB1A 1XLTA 4IDGA 1Y9EA 2X23A 1V0JA 4FC6A 3ANMA 4PRKA 4R9RA 3T4XA 2IZ1A 2C2YA 3A4VA 1M2WA 3MJEA 1UDCA 3RJ9A 1KYQA 3MEQA 1EVYA 1Q1NA 1R16A 3QQPA 4UVEA 2J5QA 3L9WA 5L7YA 2CDCA 5DT9A 1HYEA 3Q9UA 4NFSA 2D3TA 4INAA 3OHSX 3FWNA 2GUGA 4WJZA 3G3EA 4PLTA 4XQ9A 3H3FA 1QV6A 1FDUA 1LC0A 1MGOA 3TFQA 4YAKA 2XXJA 1T2DA 3LDHA 3OH8A 3F5QA 1L1FA 3WYEA 4BMSA 1Z75A 3PYXA 1XSEA 1Y8QA 3OIDA 4O63O 3TL3A 3RBVA 2X8LA 4CMJA 1O8CA 3ZWOA 4DLAA 4MO2A 5EQFA 1YS4A 4KDEA 8ADHA 3N7UA 2Y1GA 4KTVE 1QV7A 4D41A 3CSDA 3NJ8A 1BXGA 1TEHA 2DTDA 3QE3A 3HDHA 3DZFA 2HUNA 2O50A 1ZK3A 2WYVA 4Z0HO 4XKJA 7ADHA 1R66A 1LUAA 4AJLA 1EVIA 1NASA 1AHHA 1U8FO 1NYTA 2PD4A 3ASVA 1SB9A 1MFPA 1U7HA 4BHTA 4PLWA 4B4OA 1VE9A 2VNAA 3HJAA 4M87A 3TZKA 1DJQA 4XQEA 4E12A 1ADGA 2PR2A 1D3AA 4BO1A 4EUFA 3KTDA 4JJIA 5EMHA 1B8VA 4N5LA 5AVOA 3GLQA 3D1LA 3I9MA 1NQAO 4D46A 2VQ3A 3TSCA 2BFAA 3KLMX 2QZ9A 1IUKA 5KTKA 4L0QA 4XYBA 4DQVA 3MWDB 4R3WA 3PDUA 3WYBA 1IHYA 4B3IA 1HLPA 4UUNA 3GPIA 3FCOA 1PR3A 2WWRA 4R1NA 4RLSA 4OSPA 4UEOA 2IE0A 1M76A 4EI2A 2PGJA 1PL7A 1E5LA 5THQA 4XJSA 2HKIA 3UN1A 2D4AA 4HFJA 2O48X 1Q7GA 3JQGB 3ZWVA 4NFHA 3EDMA 4DIOA 4JNKA 5L4SA 3DEYX 3ETDA 1EUZA 4GH5A 4L76A 5DP2A 5EJ2A 2BKAA 1NFFA 5A05A 4D43A 3GMSA 2J3HA 1N1GA 4KWHA 4UVGA 5DOZA 3PQDA 3JYLA 5LCXA 4A2CA 3WMXA 4XA8A 2FMUA 1H94A 4NQZA 1Q7BA 2YW9A 4C7JA 3P5SA 4YT4A 3GZNB 4WCFB 5TSDA 4C4OA 5T6BA 4R68A 4DUPA 2B5WA 2NLOA 2YHUA 3O9ZA 3UGKA 1ZK4A 2EKLA 1SEVA 3KO8A 3JD4A 2LDXA 2PLAA 3DTYA 2YZ7A 1C1XB 2RHCA 4RLHA 3QA9A 4O5OA 1ISFA 3S2FA 4J16A 2IODA 2EGGA 3KEQA 4PIVA 5FI3A 1HXHA 2JJYA 3I83A 4N7RA 5EPOA 3TZQA 3OJ0A 1FK8A 1ZEMA 4AJJA 2RH4A 3RBZA 3GNQA 4CMGA 1DC5A 1X15A 1IE3A 1MG0A 2Q1TA 1MA0A 2EEZA 4OOEA 4TZKA 4E0BA 4NFYA 5AOVA 3DOCA 3OA2A 3PZBA 2IXBA 4IDBA 3JD1A 4BO6A 2WSBA 1FDTA 1MB4A 2X0JA 3H8VA 1G6KA 3A14A 5FWNA 4LMPA 1I3MA 1M75A 2H9IA 3FSRA 3ETEA 1PSDA 1PJSA 5ADHA 2FSSA 2V6MA 2NU9A 2VHVA 4QFDA 3JD3A 1E92A 2ZYAA 5F5NA 1ORRA 1BRMA 5ILOA 3DZJA 3QSGA 4CMKA 1R12A 3FR8A 4J2OA 4XGKA 1I3LA 2PZJA 1KVQA 1WDMA 3TZHA 1M6HA 3AOEA 4XZ3A 3BTSA 1DBVO 1I2BA 1GYQA 4E5KA 4A7PA 1CJCA 2C29D 1HRDA 1M67A 4ZU3A 3I23A 4M54A 3AUTA 1J4AA 3M2TA 4URFA 4YAEA 4BNYA 4CQLA 3OBBA 1ENOA 2PH3A 4OKNA 4YT5A 2DKNA 4ALJA 3ZI0A 3BTVA 1QYWA 2DUUA 2Y1FA 4PCVA 3WLEA 4CLHA 4CPDA 1LQUA 3DFZA 1R4MA 2GERA 2JCVA 1BMDA 1OFGA 1TT7A 3A06A 4RPJA 4UVDA 3U4HA 1SPXA 4S1VA 2O4UX 3VZRA 1Y6JA 2VRCA 4CUKA 1JVSA 1XIVA 4FGWA 3AJRA 3FI9A 3FNGA 3C8MA 4EUEA 3JQ9C 1QMGA 3BMOB 4NZ9A 5TT0A 1GAEO 1SBYA 3SEFA 4RDHA 4ZA2A 4XQGA 1FDVA 1DRWA 1YGYA 2W2LD 3SX2A 3NTQA 1WWKA 4CV0A 5BNIA 5HWSA 3JQFC 3TF5A 4FBGA 4BNVA 3WLFA 1ZUD1 3IQDB 2OBNA 4ONEA 5F1PA 4OHUA 4YJGB 4U6QA 4YJHB 3MJ4A 1T26A 3VZSA 1CDOA 3KZVA 5K6AA 1BW9B 1B8PA 4OIMA 4BNKA 1NXQA 2VYND 5L9AA 1IOLA 1Y7TA 1NFQA 2Z5LA 2A4KA 2GRAA 4WLVA 1I8TA 1Y8RA 3VH1A 2ZB8A 4JP2A 3EZLA 2JFFA 2NTVA 2VHWA 2VHXA 2EWMA 3A28A 4YT2A 1R0KA 3BA1A 4JQCA 3UCFA 5EQDA 2F1KA 1YQDA 3KYBA 4Q3BA 4OM8A 2P9CA 1GPDG 2X5JO 3C85A 3MJCA 1NVMB 3PXXA 4WOKA 1B3BA 3DC2A 3JQ8A 5U4QA 1ONPA 3JCZA 2V65A 3DBRA 1G0OA 1G0NA 3K92A 2C20A 1A4IA 3ETGA 4OAQA 3ROQA 4BGVA 4B79A 3DZIA 4CMEC 5IJZA 4OGWA 4CM9D 4DIFA 4JBIA 3F4BA 3V8BA 4BV9A 3CE6A 5C37A 1Y8QB 1V8BA 4MVJE 4G81A 2GF2A 1E6UA 1QYCA 3EVTA 3ZWCA 1MX3A 3FBGA 2O3UA 4FJ1A 3WWYA 4OXKA 3LLSA 1HTBA 4D44A 3ZNNA 4OXNA 3DTTA 4YQYA 2I66A 1NR1A 4R1TA 3H9JA 4GBJA 4II3A 3SC4A 8LDHA 5KJ6A 1R0LA 2I3AA 1Q7CA 2P9GA 4TSKA 5A9SA 2Z1NA 1P3DA 4MVJM 3UCEA 2TMGA 4MIEA 3RUDA 1WZIA 2W98A 4U5QA 3ST7A 4BVAA 1QR6A 5ES3A 3DAFA 3U9LA 2WJPA 3R0IA 1XKQA 4FQ8A 4WECA 4LVCA 4GX1A 1NFRA 4BB6A 1GUFA 4DA9A 4I9NA 1UP7A 3O4RA 4EITA 2QQ5A 5L3ZA 2P2SA 1BG6A 3GEDA 1RYEA 2C5EA 2X7HA 4J6FA 2Z95A 4MP6A 2P4HX 5T8KA 3VPHA 2OBYA 4R5MA 1LLDA 3GVCA 3ZWYA 4Z0PA 3GC6A 5CFZA 3WWZA 5C7OO 1MV8A 4KUHA 2OO5A 1NHGA 3VPXA 6ADHA 1S7CA 3D5QA 3FRJA 3BXXA 4XCVA 3WIEA 2YQ4A 2WE8A 3MJVA 2ZB3A 1NVTA 3ZDFA 4A03A 2VZ9A 4CQMA 4J9UE 2GGSA 1BVRA 3M2PA 3RUHA 3X2FA 3G0OA 1HZJA 1YWGO 2UAGA 3EVNA 3EUWA 4JP3A 3PP8A 4CM8A 4PLHA 4U0JA 4WLNA 4ZQFA 4B8ZA 3UICA 4ND4A 4BB5A 2RIRA 4D42A 2PH5A 2CF6A 1XYGA 1EE2A 1WP4A 1GZ3A 1E7SA 2D5CA 2PFGA 4WE3A 2ZKLA 2BGKA 3UCXA 5IN5A 1NR7A 3L4BA 3LF1A 3D7LA 5IZ4A 1M6WA 2GASA 4DPMA 4DPLA 2BMAA 2GDZA 4RVDA 1P0FA 4TKLA 1ISGA 4E30A 2D8AA 4Q9NA 2GN6A 4PZDA 4GGPA 1C3VA 1YB1A 4IJKA 4YRAA 3GHHA 3QVWA 1B2LA 1ZSYA 1B16A 2AEJA 4NJMA 3LYLA 3Q0EA 5AXDA 4XEHA 5JAIA 2CDBA 2OZPA 1R15A 4U6SA 3D3WB 4BO4A 2RH8A 4Z9XA 3W6UA 4RPLA 1ID1A 4P4NA 4KUGA 2IEBA 2O3TA 4AJHA 3CEAA 1AXGA 2PKRA 3OF2A 5KVCA 3S2IA 2AXQA 3I9KA 1GCOA 5L51A 2GNAA 3GFBA 2Q1UA 4NK4A 2VHZA 1W8DA 3UKOA 2AEFA 3KSUA 4PZEA 4ND5A 4BNTA 3NT2A 3JQDA 4ND3A 1DIRA 1TT5A 1P31A 4K9DA 2PZLA 4CM6A 3FTNA 1LRKA 3WNQA 1D1SA 2BI8A 3GUYA 3H7AA 1ONNA 4N18A 4TRMA 4WCDA 3VDQA 3ZHZA 4WLEA 2AA3A 3NT5A 1XA0A 3OEWA 4YRDA 3WMWA 3ZHYA 3GGOA 4NBVA 1ZJYA 1NM5A 4J7CA 3QLJA 1XEAA 3ZU3A 1VC2A 4HP8A 5EINA 1A27A 5CDGA 4LRSB 4E3ZA 4AVYA 1KC1A 4PG8A 5AXBA 2UUOA 4J91A 1V35A 3BYZA 4UVHA 1MUUA 3AU9A 1Z82A 1ZZEA 3W8EA 3NT4A 3BMCA 3PHJA 5JE8A 4B7XA 4CMCA 1PZEA 1JW9B 3L4BC 4CQLB 4IINA 3AM5A 5L40A 3PYLA 5DP1A 3GPDG 2VZ8A 3C7AA 1T1SA 2AQ8A 1E1LA 4BIIA 3NRCA 3TDKA 1I36A 1PWZA 2OUIA 1YBAA 2VRBA 2YV3A 3GMDA 3MJTA 1LDMA 2OL4A 3M1AA 1R4MB 4FS3A 4LRTB 3WB9A 1RM0A 1T2CA 2Y05A 2ZQZA 3CXRA 4L4RA 1U1IA 3CUKA 3GGGA 3RKRA 3ZNPA 4HXYA 1UZLA 3RWBA 1D4FA 1RPNA 3JQGA 4KZPA 1CIVA 2HO5A 2W2KB 4J4TA 3L07A 4L9RA 2H5LA 3RUIA 4IZIA 5CPBA 1C14A 1SC6A 3PPIA 4YWJA 1ZXBA 2C82A 4IQ8A 5C7IO 1GQYA 1ISIA 2Q4BA 1N8KA 4XYEA 3U4CA 4UAGA 1EUDA 5BSGA 3RVDA 4HY3A 1SO8A 1GZ6A 2P4QA 2X5KO 3W4JA 4EBFA 1WMAA 3WQRA 4CMIA 1N5DA 1PJQA 2J3IA 1T2FA 4CMHA 3ZV4A 3AY6A 5HBRA 3I9OA 4F45A 5JDIC 5I9MA 1LDGA 1P1IA 3JYPA 5L53A 1LDYA 2X0RA 3VZPA 4MIYA 2QHXA 5HS6A 4MVJI 1GCUA 3MTJA 4DMMA 4CR8A 1WXDA 3NUGA 3TZCA 4E2XA 5LDGA 3I1JA 4MJLA 2C2XA 2X9NA 4W7HA 4ZD6A 3JQ8B 5JDCA 3PJGA 1ARZA 4RGBA 1A5ZA 2E37A 3CINA 2GN4A 1HKUA 2ZYDA 4TRRA 5JCJD 3ZU2A 5ICSA 5TC4A 2GZ3A 3U62A 4R51A 5H81A 4LVUA 1P9LA 1PZGA 3ON5A 1KVRA 2VOEA 3PFFA 2I65A 1ZK1A 3B70A 4RVFA 4XJTA 2NQ8A 7MDHA 4IIVA 1EFKA 5KNLA 1DPGA 4IS2A 1YDEA 4KOAA 4IGEA 3ZWWA 5HM8A 4TRJA 3AU8A 3IAHA 5DZSA 5CG1A 3ZWPA 1UDAA 4WLFA 4BNZA 3F3SA 4MVJG 4R1UA 4BO7A 1JTVA 1ZSVA 2JL1A 1X0XA 4P38A 1JWAB 1O0SA 5IDXA 1P1RA 2C7VA 3G1TA 3WGIA 4MKZA 2JCYA 2AMFA 1KERA 4IJUA 2HK9A 2FR8A 1MG5A 1E77A 3E9MA 1GTMA 1MXFA 2DPGA 4D79A 1XHLA 4LCEA 1EE9A 4CJXA 1K89A 4CM3A 2NU8A 4HUJA 3ANNA 2EGHA 1KC3A 3G1UA 3LT0A 4XB2A 3WG9A 4IDFA 3DBLB 1NVGA 4K26A 3NTRA 3SXPA 3DONA 3KBOA 1IB6A 4XIYA 2Y0DA 4B3JA 1GUYA 3PWZA 4RZIA 3RASA 4CQMB 4MDHA 5KJCA 3HUDA 1O89A 5I8WA 3BMOA 3MCVA 4RPKA 3ASUA 4UULA 3ZW8A 3F1KA 3K96A 5KOIA 4CM8B 4QUKA 3GVIA 4CLRB 1WZEA 1PS8A 3KOUA 1DJNA 3D4NA 4RF4A 1LI4A 3N58A 1PGJA 6LDHA 3CPSA 1KEWA 2W4QA 4YJGA 1ISJA 4YJHA 2VRCD 3DFUA 5IDYA 1BW9A 1PU2A 1Z6ZA 4R41A 3T7EA 2FP4A 5JY1A 4ITUA 2YV1A 2BGMA 2O7SA 1O5IA 5KWEA 1S6YA 1WNTA 4Q3AA 3COSA 3W1VA 4NIMA 4W7IA 4A27A 4YDRA 5TLSA 3F1LA 3GVXA 2EERA 5CEJA 1B3RA 4Y8VA 3OQ1A 1LLCA 3ZWBA 3H9UA 1H6BA 4GL4A 5DOVA 1W4ZA 2NV6A 3UVEA 2BRUA 2G1UA 1WAMA 1ISHA 4ZHSA 4I9HA 3JV7A 4AL4A 1BGVA 1P45A 3ONEA 4NJMB 4GLLA 5T64A 1JDJA 1LJ8A 1JAXA 1F12A 1UAGA 2WDZA 2Y1EA 3D4OA 4HFNA 4LSWA 4FIZA 4P4LA 2IYOA 1EQ2A 4YQZA 2VZ0A 3P2OA 3DZHA 4RORA 3E9QA 5BSHA 4PLPA 1H9BA 5DCUA 1X14A 2GN8A 9LDTA 2EKQA 4MP8A 4AJPA 3AUAA 1PL8A 4Z3KA 5LC1A 3GN2A 3OQBA 4DC0A 4DRYA 1YE3A 2HRZA 4KUEA 5KJ1A 3UAGA 3P19A 1AUPA 3QWAA 4YT8A 2BHLA 4J1QA 1XG5A 3O8QA 1AN9A 4FFLA 4LSMA 1SOVA 1TT5B 3TNLA 4BNXA 1QYXA 1DHRA 1FDSA 2VHYA 1LX6A 3EMKA 2RAFA 1DHTA 3PGXA 2ZTLA 1E1NA 4H7PA 3WGZA 3WFIA 3WGYA 1BSVA 3KEOA 4Q39A 1HDZA 2Y68A 3WICA 4W99A 2CDAA 1C0LA 2VT2A 2D2IA 4K6CA 3V1YA 1Y5MA 3AI2A 4ROSA 3AI1A 1VJ0A 2HSDA 5IF3A 5IXSA 3BMCB 4CLOA 3OIFA 4U7WA 3RFTA 5IZCC 3WQSB 2HJSA 2ZJ0A 3RU9A 3AM3A 2XOXA 4IMRA 1T2AA 1XWFA 3PQFA 4IJVA 3PHLA 4BNNA 3HWRA 3QHAA 3WBBA 1XELA 2I3GA 3UUWA 2B69A 4YYZA 1LNQA 3DWFA 2BLLA 1EZ4A 4TMFA 5DDIP 2D5AA 4OQYA 3W4IA 1VM6A 3L77A 4FJ2A 2GO1A 3GK3A 4DQXA 1UUFA 4E2WA 1GL3A 2ZCVA 5JS6A 4LGVA 3W4KA 3TOZA 4XYGA 1U5CA 1YONA 3LSYA 5CDYA 1PGPA 4BS9A 4NNJA 2I9PA 1BDMA 2Y93A 4Y67A 3DDNA 2DC1A 3FPLA 2E48A 3AW9A 4ALIA 4RJTA 4M86A 4CLEA 3H2SA 1U8XX 3IJRA 4WKGA 1PJCA 1PTJA 5DCYA 4J49A 1HDOA 4CQMD 2Q3EA 4UEJA 4D0RA 5ENVA 2X5OA 1JU9A 4CMIB 1HE5A 2C07A 1CF2O 1TXGA 4L4XA 5JCJA 2YFQA 1U5AA 3OP4A 4PRLA 5FI5A 1SCUA 1VSUA 1E0DA 3ENNA 4DVJA 1NTOA 1PJ2A 3MOIA 1DIHA 2UYYA 3PLNA 2A94A 1GEEA 2VUUA 1YH3A 4P22A 4HV4A 2DBVO 4TKMA 2FPIA 2X0NA 1J49A 3D64A 1ENYA 2E49A 5C3MA 2GD1O 3PQEA 5TGDA 3D3WA 4YXFA 1XU7A 3JQ9A 3UOGA 3NDRA 1U7TA 3LVFO 1O94A 3F9IA 1LEHA 3GDGA 4R4JA 1ULSA 3ZU5A 2JHFA 2EIHA 1EDZA 4UEKA 2C54A 5L4NA 1LSUA 5CEEA 4TWRA 1HEUA 1XCBA 4DC1A 1HDYA 3AWDA 3JQFA 1PGNA 4WUVA 2DM6A 4UREA 4E5NA 4BMVA 3U0BA 4IDAA 5L7WA 3KM0A 3JTMA 1DC3A 1H0KA 4I5GA 2Y67A 1E3SA 2JFHA 4FFPA 3IUPA 3R3SA 4F46A 2DAPA 4IMPA 1U28A 1QYDA 4L74A 2J5RA 3RJ5A 4BOYA 1BVUA 1TI7A 1E3IA 4ND2A 1KEPA 4EJ0A 5ITWA 5C7LO 4QEDA 3RQSA 2O2YA 1UP6A 4F3YA 4D0SA 3HADA 1MP0A 1K6JA 1GADO 3EC7A 4PLVA 1N2SA 3KUXA 2D1YA 4MVJP 1KY5A 5EESA 2VYVD 4CMEA 2BFPA 2OFPA 1P1HA 3LC1O 4GI2A 3KVOA 2FY8A 4Y9DA 1EK5A 3KV3O 4EEZA 2X9VA 1T25A 2YY7A 4FD3A 5JMWA 5U9CA 2JD0A 2X58A 3PLRA 4M89A 4GQAA 2VWHA 5L4LA 2FOIA 3JYNA 1D7OA 1IPFA 2IYPA 1ZSNA 1G1AA 2HRBA 2W2KA 5JXWA 1IY8A 3RC1A 3RSHA 4WNIA 3UW3A 1UXJA 1NNUA 4O1MA 1BDBA 1OI7A 3BTUA 3WTBA 5GMOA 4YAIA 1O95A 2G76A 1LRLA 3OJFA 1E7WA 3DO5A 3BZUA 3NX4A 1E6WA 3K73O 3I6QA 5TNXA 3R3JA 4XDZA 5AXAA 1EBFA 1I5RA 1QLHA 2FN7A 2QRLA 2J3JA 5KCZA 2B37A 5T67A 4E13A 1GQ2A 1ZIDA 5KVQA 5AYVA 1IYZA 3DZBA 1NAHA 2W90A 1Y5RA 1NBOA 1YL7A 1B15A 3OJOA 2CVQA 3PHHA 3WOHA 1ZW1A 3QV1A 1PGQA 3BMNB 3FTPA 2I5PO 3I52A 4QX6A 4E21A 3QWHA 1SAYA 1YB4A 1ZNQO 2D0IA 2G17A 3SC6A 1VL0A 4DPKA 3F46A 1HYGA 2AG8A 1F0YA 5DBGA 3VPSA 1D8AA 5CP8A 2VN8A 4PG5A 2ET6A 4YPOA 3DAGA 1K0UA 1JAYA 5F3RA 4AJ4A 4AJNA 2ZIZA 2B5VA 3PK0A 4GAEA 5A3VA 4TVBA 5JNLA 5JBIA 5JCXA 1I32A 3ZWMA 2EF1A 1K6XA 2DPHA 3LU1A 1T2EA 3GNTA 3WX0A 4N5NA 5GZ3A 5G0TA 3LF2A 4B4WA 3I4CA 4XRRA 2J5KA 2DBRA 3G49A 3O8QB 4YJFB 4E6PA 5IDWA 3EAGA 1VL8A 5GZ6A 1E3WA 3GRPA 1KIFA 4PVDA 1V3UA 3C1AA 1SZJG 3CZRA 2ZYGA 5CHEA 4TQGA 1ZEJA 2HLPA 2Y1DA 4FW8A 4XGNA 4J43A 5JW6A 2VT3A 1GYRA 4FGSA 2AE1A 2NACA 1QORA 4JROA 1ADFA 4JJFA 1C0IA 3DMTC 4B7UA 3EK2A 1MXHA 5ICMA 1ZK0A 4CLOB 2Y0CA 3RUCA 3GVHA 5THKA 4Q3NA 2NVBA 5TF4A 1WDLA 4E5PA 3HB5X 3VTFA 4ALKA 5B4VA 1PGOA 4NG5A 4YRBA 4HNGA 1SNYA 3E5MA 3I6IA 1EBUA 3DBLA 2O3JA 1OC4A 1KY4A 2O23A 3B20A 4CM5A 2DFVA 3GHYA 2IZZA 1TVEA 3INTA 2DLDA 3A9WA 3AOGA 1BWSA 4HKTA 1GFSA 3Q1LA 4KQWA 2FZWA 3HNPA 3OSUA 3HZZA 1JQBA 5I7SA 1LLUA 4ZQHA 4GX5A 9LDBA 3C3XA 4D3SA 5JPIA 1AXEA 4GWKA 2Q2VA 4YAGA 2VTEA 1HL3A 1Q0QA 2AG5A 4CLRA 1P1FA 2F00A 3O03A 1E1KA 4RF5A 1OOEA 1V6AA 4R01A 1W73A 4NHEA 1QSGA 2Y66A 5I7VA 2UDPA 1CWUA 3V2GA 3WQQA 1AHIA 2NWQA 4ALLA 4JN6B 2EV9A 4J3FA 1OBFO 4ZGWA 5IDQA 1B8UA 2UUPA 1BXKA 4BV8A 5TIIA 4FFNA 1P77A 5TT1A 5JO0A 2E82A 2WYWA 4IZHA 5AQ1A 3WYCA 4LCJA 1WW8A 2X86A 4E31A 3FN4A 1ZMOA 3GG2A 1YL5A 4IXWA 5CDSA 1ZO8A 5HA5A 2OORA 3ZW9A 1XQ6A 3NKLA 1U3WA 1PL6A 3L4SO 4K1LA 1RYDA 3I4FA 3QVOA 3TL2A 4JK3A 4CR7A 3PEFA 1DAPA 4DWVA 3CTMA 4O0LA 4E32A 3LQFA 4Y6SA 1OC2A 4BNIA 4ZICA 3C1OA 1C0KA 1E7RA 4NBRA 5G4KB 2Q46A 3WS7A 1Z74A 3RBXA 3OEYA 4BKQA 3ROPA 4DYVA 2Q49A 3OJLA 1B14A 4WEOA 5G0WA 3SLKA 1LLQA 5I9LA 2JD1A 3DQPA 4J0EA 3NV9A 1WMBA 4IUYA 4Z9YA 4BKUA 4HADA 1B0AA 5U1PA 2QYSA 3GVPA 5G0SA 3JYOA 4C7KA 2Q2WA 2D59A 5K9ZA 1J0XO 4MIOA 1U2GA 3RU7A 1DC6A 1HETA 1YJ8A 2JCXA 2YHIB 2VYVA 3ITKA 2B36A 3P7MA 1T24A 3VPFA 3D0OA 2Y0EA 5A4DA 5JDIA 3OETA 3TPCA 3K2EA 4PG6A 5A5FA 3WJ7A 3RUEA 3WXBA 2EKPA 2I67A 4DYDA 4EEXA 4R54A 4Z3DA 4EYEA 3AY7A 4RQUA 3VAZA 3JQ7B 4LISA 1RJWA 3BHJA 2ZATA 1A9YA 2TMDA 4IY1A 4WNCA 5DBFA 4W9NC 1Y9AA 3GZ4A 3NDIA 3Q3CA 2PTGA 4E5YA 3X2EA 1PS0A 1HDCA 2BF7A 4W82A 2J8ZA 5A06A 1Q2XA 1IULA 5ILGA 4J4HA 1R37A 3W8DA 4R69A 1VKOA 2EP7A 4RL6A 3H5RA 3IP1A 4HX5A 3RFVA 4F6LA 1MFZA 3U49A 1E5QA 1ENPA 2AQKA 2NVUB 3ZN2A 2CSUA 4ZQBA 4CUJA 5TQVA 3HFGA 3HN7A 1FDWA 4Q3DA 2NTNA 1DOHA 1QP8A 4D7AA 3PIIA 3GEGA 4J9VA 4CM4A 2GLXA 1DLJA 3H9GA 3VTZA 2P68A 4DXHA 5I8ZA 1DIGA 3JQCA 2XXBA 2GZ1A 4YB8A 4ZQEA 5A9RA 3PYMA 1HYHA 3ITDA 5COBA 1GD1O 5F1KA 2OOSA 1H5QA 2YFHA 4GVLA 4PLYA 4RVGA 3D5TA 3FF4A 1QXSA 2JAHA 2BELA 4ALMA 5B1YA 4BKRA 3GY0A 4NH4A 3IKTA 4QO7A 1DFHA 1NP3A 2FHSA 3H6KA 5MDHA 4EUHA 3RCBA 4B8WA 1U4SA 2GSDA 5I7EA 3HE3A 4CL8A 1NQ5A 2AQHA 4U8GA 1LBEA 1QLJA 1U9JA 2H6EA 3PJEA 1LTHR 2I99A 3V5NA 3F47A 3CZMA 2QX7A 3ZCXA 1WPQA 4BGEA 1YBVA 4X54A 3RROA 3S1LA 4CM1A 4RF3A 4RO0A 1ZBQA 2O3RA 3LT2A 2R6JA 4WGGA 1UAYA 3HSKA 2QRKA 1W6UA 4FJ0A 3QWFA 1QG6A 3V2UA 1EEHA 2VWQA 2Q2QA 4DL9A 2BFOA 4B4VA 4OQZA 3E03A 2PGDA 4AJEA 5DF1A 5TS3A 3ZHXA 5CG2A 1E3WB 1I2ZA 1GR0A 4NDNE 5ENDA 1ZCJA 2GCGA 3ANLA 4NU5A 1NWHA 1XR3A 4DLBA 1I01A 3TFOA 2SCUA 3F5SA 3K8ZA 4KTTE 2YQ5A 5COQA 1CYDA 2G0TA 1DIBA 1C0PA 2V6FA 4XYMA 4MKRA 2DFDA 3P2YA 4A10A 3HQ4O 4RVHA 3RIHA 5EIOA 5TX7A 1EK6A 1DLIA 5L7TA 4Q3CA 4N5MA 2CMDA 5A3JA 4MKXA 1HZZA 3UF0A 4LW8A 1IZ9A 1XU9A 1PJ4A 3L0DA 2CNBA 1VRWA 3V1UA 1TLTA 1H2BA 3PVZA 1U4OA 2NSDA 4PG4A 2HK8A 4WEQA 1AE1A 2AEMA 5FEUA 1XDWA 5ITVA 4GLOA 4JLWA 3KYCA 4NU6A 3FHLA 3BIOA 1TB4A 4G65A 1PQPA 4CMAA 4P8RA 4XQCA 1BHSA 1CEQA 4TROA 2HAEA 3FBTA 3ICCA 3U4DA 4N54A 4WLUA 3KETA 5A04A 1DEHA 4Q3EA 1XQ1A 3K5PA 1F8FA 2CF5A 2NQTA 2CZCA 3LC2O 3RI3A 2OP0A 4FFOA 1ZFNA 1O6ZA 3L6EA 2QYTA 1NQTA 1UZMA 4BQRA 1W0CA 2ZQYA 3WFJA 4D3DA 1GQQA 2Q99A 3EHEA 5BNFA 5BR7A 1QYVA 4GX2A 2PK3A 5CDTA 3OM9A 3VOSA 1YOVB 1ZXLA 5A5EA 3JQAB 4J7UA 3E8XA 1SB8A 4L73A 4W6ZA 2NM0A 3MTGA 1T4DA 2WMDA 2YUTA 3H9QA 1KEVA 5IZCA 4RPGA 4J1NA 3EYWA 4I8XA 3H65A 4AJIA 3CMCO 5I9NA 3SVTA 3PWKA 3O38A 4CODB 4MINA 3BMNA 4M55A 1UXKA 4EJ6A 3ZV6A 1DAOA 4ZRNA 4AG3A 3BHMA 2PY6A 3LT1A 2FZEA 1N7HA 4RVUA 2PKQP 3Q2IA 3K30A 4BO9A 1KS9A 1MC5A 3S2EA 3HFSA 3FWZA 4QSMA 2C7GA 4J0FA 1YQGA 1QRRA 1RM5A 4Y98A 4HWKA 1JLLA 4TRNA 3QVSA 4OL9A 4RQTA 1SEPA 2DQ4A 1B7GO 1XGKA 4YCAA 1KVUA 1DXYA 2R00C 3IIEA 4YVFA 3GQVA 5FF9A 5IFLA 1E3JA 2P9EA 3ZWNA 3B6ZA 3QVTA 3KXDA 5JC8A 4UUPA 3L9XA 1P44A 1DFGA 5EN4A 4AJ1A 3C1TA 3H9EO 1NPTO 2RHRA 2FSVA 4YJFA 4JGBA 1RKXA 3AFNA 1L7EA 4FC7A 4DBZA 2EW8A 2EXXA 4ZJUA 3INGA 1PJTA 5BSEA 4NPCA 4XGIA 4O59O 5KVSA 4MPDA 3DXFA 1SOWA 5BT9A 5HTOA 1K2WA 3QRWA 4AICA 3GAZA 3I9LA 3SJ7A 3B1KA 5KKCA 2B4RO 3QWBA 1YJQA 4FFMA 4XR4A 4BNMA 3ROKA 3K2BA 3CKYA 1ADCA 4IBOA 1NPDA 2CY0A 1E3LA 3PRJA 3NEPX 3GDFA 4LN1A 5T5QA 4EJMA 3INRA 1WLYA 3C7DB 3PWSA 3IOYA 3PDJA 1BXZA 3ORFA 4L8VA 4GSKA 2PV7A 3R6DA 4M1QA 3JQBA 5JLAA 4K6FA 5CEFA 3VHRA 3NGXA 5L45A 1H6CA 3S8MA 3G79A 4EDFA 4FCCA 1KETA 1J6UA 3BAZA 4CLDA 3JQ6A 1MC4A 3ULKA 1UDBA 3EGOA 1FF9A 1OZAA 2BI7A 2YDXA 3JQEA 1LQTA 3VVBA 4BO5A 3OICA 2IDZA 4I1IA 4GWGA 4D45A 5TJ9A 1N7GA 4IXTA 4BUCA 1T4BA 5BQFA 1I30A 2OXIA 2VNSA 1UR5A 1Z45A 3DHNA 2IZ0A 3EW7A 1X13A 4PFJA 4YA6A 1A72A 3WBFA 4B7CA 2V7PA 1Y8RB 3UXYA 2H1SA 1C1DB 4CM4B 3NAQA 4DMLA 4DLLA 5GY7A 1LDNA 1E1MA 4AJOA 3DMYA 3WTCA 4OKIA 2R2GA 3FR7A 1KVSA 4I08A 5JFOA 1V9LA 1DC4A 3ZWAA 3RFXA 2WD7B 2I76A 2POQX 2UVDA 1DDOA 2CUKA 4GKBA 4AJKA 2QG4A 3AY3A 3BMQA 5A1TA 1B26A 3JD2A 3HHPA 4KDFA 2J3KA 3H3JA 4YAJA 3IP3A 4IPTA 4NBUA 2GZ2A 2FPGA 1Q0HA 4OH1A 2X22A 3Q9NA 1CQJA 2PD3A 1N9GB 3VC7A 3UHAA 3JQAD 3NJ4A 4NBTA 5KIAA 1HT0A 3PHGA 2EW2A 4J2HA 1H2HA 4GGOA 1NPYA 3IDSA 3FD8A 2OGUA 3N74A 2O2SA 1WVGA 3PI7A 4MP3A 5G0VA 3PFWO 2XPCA 5KJEA 2WE7A 4IQGA 2VWGA 3OA0A 1NQOA 2HDHA 1X0VA 2FR1A 1CRWG 1Z73A 4PZCA 5G4KA 4Z0TA 1V3TA 4BL5A 2V6GA 2QZZA 3JQBC 1F8GA 1Q0LA 1VI2A 4KP7A 3ABIA 4OXYA 1LSJA 4ND1A 4QFCA 1EQUA 4UUMA 2NADA 1U3TA 2JD2A 3E18A 3WNVA 4E4YA 1R6DA 3R1IA 1E7QA 2NTJA 4S3MA 2CVZA 2VWPA 4IM7A 1SMKA 4IIUA 4AJ2A 4R1SA 4PN3A 4BKPA 1VSVA 4BMNA 3PTZA 3JSAA 4L4SA 4TZTA 2YHIA 1IL0A 3PJDA 3QJ5A 3K6JA 4OMUA 4HBGA 3E6AA 4WOJA 3DZGA 3Q11A 1X7GA 3KYDB 1JVBA 1PX0A 1A9ZA 2E4AA 4GMFA 4I9UA 1E6EA 4EGFA 1YDWA 4JX8A 5F1OA 4I5EA 5ER9A 2GPTA 2ILTA 2GYYA 4O6VA 4A26A 4FB5A 4ILKA 4QTZA 4MVJF 2W8ZA 5IG2A 4GVXA 1N1EA 1U3UA 2EJWA 3RC7A 3NTOA 3JQ7A 2X1HA 5TRTA 1WDKA 2G5CA 1VPDA 1A7KA 2DUWA 2WTBA 2BGLA 3E5RA 1PJLA 3RUFA 2O3QA 1HE4A 4H16A 3OQ6A 5A02A 3GNSA 3KYCB 1GEGA 3L6DA 2Q4EA 4NMHA 4AFNA 4B3HA 4W4TA 5DULA 3RKUA 4WASA 4HNHA 3O26A 3S55A 3ROMA 2NVUA 4A73A 1Y81A 2DBZA 4E2ZA 1ML3A 2HJRA 3DB2A 1I0ZA 4A0SA 5EERA 4MVJA 3V2HA 1HDXA 4WK6A 2YJZA 1P33A 3GN1A 2OP1A 1Z7EA 3G17A 1DRUA 2Y99A 1NX6A 4PG7A 2CVOA 2FRDA 1P1KA 1I3NA 4OO3A 3TOXA 1KEUA 1VL6A 1D1TA 1EMDA 1AGNA 5DNAA 5B12A 3DBHA 3HB4X 4OSOA 3DMTA 3KSZO 2Y1OA 4UVIA 2B4QA 4QXMA 1UXGA 2AHRA 4L75A 4ZRMA 4U0KA 4IQ0A 4BNWA 3T4EA 3T7CA 3WSWA 3GG9A 1ONOA 4LK3A 3VH3A 3VVCA 4DQUA 3FNFA 2PNFA 4G5HA 4CV3A 3QVXA 3KSDO 3GDOA 3GEMA 3F6YA 3ZV5A 5AXCA 2OHXA 1UP4A 3DR3A 3EY4A 4RPHA 1EDOA 4R9SA 3GH3A 4J4BA 3TRIA 4ID9A 3U4IA 4MOWA 3C7CB 4FFRA 4ALNA 4H15A 1HLDA 1LC3A 3ENKA 5HS4A 4DGSA 3KRTA 3NDJA 3WR5A 4XD2A 3WGGA 2X9GA 4RDIA 1MLDA 2AE2A 5JYEA 4OYRA 3VZQA 2XF8A 3AOEC 1PEDA 2DTEA 4M8SA 3GUCA 4R16A 4BO8A 5CDUA 1LRJA 2FR0A 2XAAA 1X1TA 1H6AA 4NR0A 3JYQA 1R4NA 3AUSA 1YRLA 3AI3A 4FN4A 5JY6A 5L95A 1H93A 4BNLA 3OFSA 5H82A 2YYYA 4II2A 5JAMA 3GF4A 1GV1A 4PVCA 4QT0A 2FWMX 4K28A 1LDEA 2B83A 5CPFA 1U3VA 4PGFA 1GUZA 1ZK2A 2A9FA 4J90A 1P0CA 2NNLD 1HDRA 1BXGB 3U09A 1DIAA 2PKQO 2JAPA 5DBIA 3HDJA 4DBVO 3MZ0A 1F14A 4LMRA 3H4VA 1RM3A 2LDBA 3GA0A 3ZHBA 1GPJA 4BO2A 4WLOA 5FYDA 4XR9A 4KMSA 3WJAA 2NVWA 4RF2A 3ZGYA 3UFXA 1LA2A 2EJVA 4NJOA 4UUOA 1JKIA 5JAQA 1TA4A 2P5UA 5K6AC 4E5MA 1YO6A 2NUAA 5KJFA 4BQPA 1KVTA 4JIGA 1GU7A 3DHEA 1L7DA 1DRVA 2DT5A 2RCYA 3DZKA 2QW8A 2C5AA 1K5HA 5JO9A 1DB3A 2HMTA 1A4UA 1FXSA 4M49A 5B37A 3OMLA 1YOVA 2BFMA 2WEKA 1I24A 3GOHA 2YDYA 3JQAA 4JBHA 3PZRA 2OMEA 1ZH8A 3KHUA 3RC2A 4BNJA 3SLGA 1FMCA 4D3FA 5IAAA 2PWZA 3OECA 1PIWA 1X1EA 1HE2A 4IDCA 5IN4A 1DFIA 3ZNOA 1Y1PA 1JN0A 1Z7BA 1I10A 5JC1A 3C24A 3GGPA 3BMQB 4CMBA 3FNHA 3LT4A 4GSLA 4W9NA 3MWEB 1EVJA 2QRJA 4XRGA 1A7AA 3I9JA 1GY8A 2C0CA 2HK7A 1ZMTA 2B4TO 3UH1A 3HN2A 2V6BA 4GX0A 3BHIA 3DHYA 3U3XA 1PR9A 4OJNA 4PLGA 4DIBA 1ENZA 2HMWA 1LSSA 3IS3A 1HWYA 1UXIA 2VOJA 3E82A 4HFMA 1O9BA 2RBEA 1QKIA 2I6TA 5BNTA 1U2DA 4CR6A 3DOJA 2HQ1A 1DSSG 2J6IA 2HMSA 4R3NA 1VJ1A 1E7YA 1FJHA 5HRUA 3HDYA 1PQWA 3ONFA 1YBMA 3AFMA 3WGHA 2CFCA 3L6OO 2AQIA 4B4UA 5KVVA 4RV9A 2JHGA 3WGQA 4E33A 3E1KA 2JKVA 3D3EA 5COAA 3VH2A 2PZMA 3PGJA 5A9TA 1VLLA 5G4LA 4Z9FA 5T8KC 4EW6A 1ULUA 4OOFA 2PD6A 1J5PA 1T1RA 5CAEA 2IEDA 2ZK7A 3D4PA 4CL3A 1OMOA 3LC7O 1RWBA 1VJTA 3MOGA 3OJEA 1HDGO 1UXHA 3AM4A 2Q50A 5MGBA 4GKVA 1ZJZA 2EHDA 3CMMA 1BTOA 2O4CA 1HSOA 4XYLA 1JKJA 1YVEI 1K3TA 3GT0A 3CH6A 2EP5A 4IJWA 3U5TA 2BH9A 3QWIA 2O3SA 1LDBA 4JJGA 3VKVA 3IMFA 1ADBA 2A92A 1ZVMA 1OAAA 2B35A 3JD0A 4F6CA 1E3EA 2Q1WA 2WYUA 3I3OA 3H2ZA 5DN9A 2Q45A 1PQUA 3A1NA 3ZV3A 2P5YA 4RVSA 5B4TA 3HDQA 1YQXA 4BGUA 5BSFA 2DTXA 5DCWA 5JAZA 5JYDA 4NBWA 2NU7A 2VCYA 3STHA 4DREA 5B4UA 1H6DA 3H5NA 1I3KA 2A35A 3QP9A 1JKFA 4HFRA 3E9NA 3WGTA 3GAFA 3QIVA 4BNHA 2W2LA 3W8FA 4PLCA 3PIDA 5EL0A 2ZJ1A 1UH5A 3GFGA 4R5HA 1PZHA 1C1DA 1F06A 3DBVO 3LZ6A 5KKAA 4EZBA 1M66A 2X6TA 3GR6A 3W6ZA 3TWOA 3ZU4A 3ZNQA 3RC9A 2ZTVA 3VPGA 3K9QO 3DBHB 2WD7A 1CQIA 4A5OA 1X7HA 1F17A 2VYNA 5H83A 1EUCA 1H9AA 4MVJH 1PJ3A 4QQRA 1PWXA 2PZKA 1R0SA 4XDYA 4IGFA 4BNGA 3WDSA 5G2OA 1I2CA 1IPEA 4P4GA 4NI5A 1DO8A 4FR5A 1P74A 2BD0A 3K31A 3BTOA 5TJHA 3ONDA 3I5MA 1N9GA 2B0JA 4YJDA 3IKVA 4PLFA 3PJFA 4BGIA 3VDRA 3GZNA 4WCFA 3NYWA 4BO0A 5JSFA 3MJSA 1YXMA 3HG7A 1VKNA 1LXCA 1HF3A 3GRKA 3SBOA 4CM9A 2DBQA 1LU9A 3AUUA 3LK7A 1C1XA 4J7XA 2JFGA 3KB6A 3QW2A
chains in the Genus database with same CATH superfamily
1U8AA 2ZTUA 4YV0A 3FDIA 4LNUB 4PYLA 4WWHA 3RWMB 5EZ5A 2Q1YA 1QIGA 2CD9A 4E70A 2VNIA 3F4LA 5A6SA 4EQ6B 4G1UC 5LDHA 4KODA 3PUWA 4WDQA 2IXGA 5FWYA 1R4NB 1U9CA 4OLAA 1QK4A 2FVXA 1E6CA 1GDHA 3OZIA 4MJ7A 5J5VA 4RJLA 1U9IA 2Q4RA 2IHUA 2VNKA 3EXG1 4LMBA 4ZKDA 2ZB4A 3DBRB 1I9CA 3ZWMA 1MOZA 4N5DA 4YIHA 2BMWA 4RXUA 2NO5A 5LXTB 4EY7A 2QP9X 2OBXA 4G1EB 4Q1CA 1E8MA 2QLBA 4I1VA 4KR0A 4TVOA 4TWJA 1HYQA 2EKBA 4IZOA 1VPTA 1B41A 2XIJA 2Z6AA 3H5AA 4RTRA 1AQ6A 1YL6A 1QIHA 3OPYB 1Q1ZA 5DTJA 2XMCA 4F84A 3EZYA 1CQZA 1AOXA 2Y71A 4ESOA 3OZVA 3I9NA 4HQNA 4HI0E 4YR9A 3HU3A 3Q2KA 1DDGA 3RNOA 4O2BB 2G82A 3F8SA 3FROA 4X8LA 3D8HA 1JH8A 1NVEA 1SUAA 3ADPA 4I5DA 1AKUA 4RZHA 4UM8B 3T38A 4D9BA 5A9SB 3VOAA 3T12A 5GPBA 1Y1LA 3OIGA 5JMPA 4B6GA 3OEED 2W9XA 2CV1A 2FFHA 4FFVA 4GOXA 3BD6A 2BUBA 4NULA 4J94A 4ZVUA 3DMPA 2K2WA 3MJFA 1E1CB 2COKA 5JCPA 1TZBA 3GEEA 4FYJA 3AK4A 3NAMA 3TZ6A 2R00A 3ZWXA 5FFFA 4KV9A 2VQSA 2IXTA 2J31A 2WIKA 3TJRA 1MO4A 2DLNA 4YTEA 2G0AA 1KAQA 2BAGA 4ACAA 1KOLA 2FPMA 1US8B 3JAKA 3KWJA 2NUAB 5LYJB 3JPWA 4IWYA 3KD3A 5GAJA 3KVNA 3K8OE 2OECA 3G85A 3LXMA 1G7RA 3M6IA 4ZFNA 3C6MA 5I7FA 3ABRB 3AVXA 4GDMA 4C2TA 1GNPA 3THYB 1BO6A 5ERGB 1QLWA 2JIOA 2P69A 1T9ZA 3IFSA 5C5IA 4KH0A 1TTTA 1DQZA 3MUEA 4FOOA 4G2NA 4EGJA 5J2TF 1R5BA 1MORA 2JEYA 4LHEA 4OVKA 4TKVA 1NXWA 5B6IA 1IHXA 2I1LA 2IELA 3LO8A 2ORYA 1GKKA 2P4EA 2IXEA 1Q7RA 2RH9B 3QYFA 4MO9A 1Z5VA 4XTRA 5EMKA 5B1HA 3FSJX 5LD2B 2A5GA 2MIIA 4OXXA 3WO0A 1LSOA 3FSEA 3H86A 4NCHA 1FC0A 1SC9A 2X2EA 4CLXA 4YEDA 3AUKA 1BFUA 1E2MA 4FOSA 1BIFA 4FYXA 2P3OA 2ZTSA 4MVJD 2WM3A 1ABBA 1FP7A 4D8WA 3KAQA 2VSXA 3U5ZB 1MF7A 2C3OA 3G2NA 5HQ3B 4MWZA 2O54A 4GPBA 1QGED 1QAOA 4JC8A 4CT0A 3KOXA 3PUXA 4ECAA 4F9EA 4FE7A 1JKXA 4LA4A 3STYA 1C30B 3V1TC 3OCYA 1U7WA 2ZGVA 2DR3A 1D8TA 2C31A 1FP4A 2VDKB 4FPXA 1HTWA 5DSZA 3RYHA 2PMFA 1V0JA 4FC6A 3DNMA 3OX2A 4IHJB 1NDQA 4Q05A 1B0UA 1GGMA 3A4VA 3BD7A 1XVLA 2DMRA 3O7WA 1TAHA 5JZOA 3ZI7A 1R16A 3NVDA 1S3FA 1E3DA 2BTOA 1M8PA 2GYVA 3L9WA 3OJCA 4OI2A 3MT9A 1HYEA 5DT9A 2J07A 5G40A 1GTSA 1Z13A 4YRZA 3OHSX 1UC9A 2YYAA 3FLBA 3QI7A 4AUEA 3H3FA 2IT1A 4N6GA 1FDUA 1LC0A 1MGOA 4KGZA 4UZEA 4YAKA 1MH9A 1Q0PA 4RANA 2VUIB 4RGYA 4G0WA 1N1MA 2QMEA 3ESBA 3F5QA 3PQ8A 3CH7A 2JH3A 3A36A 4LDQA 4BMSA 3ETCA 3ZDEA 3G68A 3LLCA 4F71A 3RBVA 2X8LA 4CMJA 1CSEE 1G42A 2WZCA 3ZWOA 1PRYA 4QHSA 8ADHA 2P62A 4H7JA 4Q1BA 3N7UA 1SZPA 2YS6A 5C1IA 3CSDA 3A9RA 1BE1A 3DL4A 1NXXA 1ZY2A 1DBSA 4YYEA 1YUNA 4F2PA 5ERXA 2WYVA 4Z0HO 4XKJA 3WIVA 4B4DA 3WLJA 4HPWA 2WV9A 1EVIA 3M7IA 4AJLA 2WOJA 1U8FO 3ZVKA 4UUQA 5JD4A 4XVCA 3ASVA 3N9IA 2B8NA 4WKNA 4XIFA 1SB9A 4HNSA 3WK9A 4PLWA 4M87A 1IUPA 3FCCA 3TZKA 1DJQA 4EI9A 4PSVA 4L1KA 4J0DA 3SIXA 3EIFA 3EG9B 1P0QA 4XDHA 4BO1A 3OZEA 3KTDA 2UVPB 1FFAA 1L4UA 4HEJA 4AP5A 2GYWA 2W6NA 3A04A 3MUFA 4G0NA 2JAXA 3D1LA 1Y8AA 4V02A 3IQXA 3RUPA 3DM9B 3C45A 4BN0A 1Y4AE 1FQJA 2VQ3A 2Q0QA 4KACA 4OQXA 1YR6A 3IHLA 1WVMA 5BOVA 3K09C 3W5CA 5F98A 2CHGA 5DWQA 2EU8A 5KTKA 2MMCA 3BWDD 1L3IA 3GPLA 4MUHA 4D8UA 4DQVA 2VH2A 4ZVOA 3DFIA 3WYBA 3W34A 3GPIA 2GZRA 3HCDA 1Z2AA 1W5EA 3X1JA 2JA1A 2WVAA 1V9SA 1R9JA 4PHGA 1X19A 2C4MA 3FDXA 1IDN1 4IQ4A 2ZSIA 5FOWA 1N6NA 5J2UB 4M46A 1PL7A 3F6EX 4CTNA 5AK6A 3HLTA 1T4CA 2HKIA 3H1GA 3L8MA 4DG9A 4KRXA 2O48X 3SKYA 5CFOA 2WWFA 3QEMB 3LHKA 1K88A 4HGNA 4WZBB 3LCVB 4DIOA 3A6JA 4KH1A 3DEYX 4WT7A 1XDSA 3K5HA 4L76A 4LRUA 5EJ2A 3RSGA 1NFFA 3EGDB 4YV1A 4IRXA 1E9FA 5JNSA 1SFRA 5HJ2A 3TIXB 2HXSA 3GJZA 1SJ9A 3NHLA 3PQDA 3DV0A 2CUNA 4EUKA 3PCXA 3DWGA 3R5JA 2FG5A 3DW1X 3UB2A 3G5AA 4FHCA 4QD3A 2C94A 3FUXA 3MM4A 4KO8A 4PGGA 3TSOA 4QULA 4AMGA 4RH1A 4YCBA 4C7JA 4E7PA 4ZPXA 3AQIA 1F9EA 5EWMA 3GZNB 4YT4A 5BN1A 1TCCA 5T6BA 3LY5A 4C4OA 1CPYA 3HCCA 2QG9A 2NSHA 4IDOA 1O08A 1UC8A 4MVWA 2B5WA 2YHUA 4PWZA 4UTXA 4DUPA 2QGZA 4P92A 4UBLA 3FGOA 4LDAA 1D2RA 3HVHA 1C1XB 2IOYA 1UEJA 3A26A 2A30A 1OYYA 2WG1A 3BCHA 1F0PA 4DT1B 1V48A 1ICIA 2Q9BA 1LBIA 3DTNA 1KNQA 3ES9A 3MBIA 1HXHA 2JJYA 1EB8A 4FHGA 4OD0A 1NKTA 4N7RA 5EPOA 4DEYA 1FK8A 1U7UA 3NHWA 4MVCA 4AJJA 3HWSA 1V2GA 4CMGA 4QT4A 1DC5A 3O92A 5D8DA 3ICOA 1DKNA 5FAXA 4JMPA 4OOEA 3SAJA 2EFJA 1WF3A 1FVOA 1UBUS 3TEMA 4FI3F 2XYGA 4TKZA 4RHYA 2ETXA 4NPHA 4IDBA 2L0XA 1M7HA 1PUJA 5LZ2A 1O1YA 1MNAA 2H65A 2HUPA 3V1NA 3F4KA 3NUQA 1U02A 1QCZA 4E1AA 4U2CA 2J7PA 2H9IA 1I0IA 4JUBA 2BLNA 3ETEA 4L5IA 3TQTA 2HDWA 1GPBA 1PJSA 4DV1B 1KMIY 2NU9A 3WWCA 1KAOA 1KARA 4M0FA 4KFTA 4R1MA 2ZYAA 4AMYA 1ORRA 2D4HA 3N6XA 3F78A 3BK1A 2I3ZA 3JWHA 5TMEA 1NYRA 4LWPA 1BDIA 4GI1A 2H48A 4XGKA 1MZPA 3QLVA 4N6OA 1FX0A 2PZJA 1Q21A 2A0XA 3GRYA 3HY6A 3KVRA 1T0HB 4OQQA 4UHKA 1FS4A 1RC1A 1HOXA 5DBEX 2XUPA 4XZ3A 3THRA 3U3OA 3V8QA 1XL0A 2QE7D 3IQGX 3AKEA 7AT1A 4IKPA 1DBWA 4EI7A 5JXJA 4HVTA 1YC2A 3AQ4A 5C34B 2BGJA 5JXIA 1RYHA 3DOEA 4M54A 4QDTA 4Q4AA 5ALGA 3T1TA 1M8JA 4X1OA 3NFRA 2BR4A 5AIBA 2PH3A 3UUGA 1R5JA 2JEOA 3G2OA 2ZBEA 4Q7LA 1NC1A 5AVTA 3KKEA 4WVFA 3AFIA 2Y1FA 2ZI9A 5B55A 2I87A 1V43A 1QP7A 1AJEA 1MJHA 1U1DA 4CPDA 4IKOA 4HB0A 4JVOA 4YMVA 3DJYA 4O1HA 1EK0A 2ACWA 3A06A 4RPJA 4UVDA 2AHOA 2ECKA 1NULA 1ZD5A 3RIEA 4KQ2A 3I4LA 4S1VA 2O4UX 1Y6JA 2RGXA 4L4ZA 1B73A 4LYHA 1GITA 4BUJA 1XIVA 2J46A 4CUKA 3AJRA 3FNGA 3IXQA 3C8MA 4KQ6A 4U7HA 4EUEA 2Q9AA 2II6A 3CLTD 5B7NA 3P1JA 1C3OA 3LOUA 3FWYA 1X87A 3ER6A 4COKA 4F3RA 5HF5A 4I3HA 4BAZA 2XJ9A 3NBQA 1VLJA 1G4UR 3I53A 1DRWA 2O0HA 2YWEA 3B1XA 3FNBA 1EXNA 4TXHA 4KQGA 2IYXA 4TS4A 5ENZA 2KSQA 5IJ9A 2G6TA 4MW7A 1F2TA 1Q91A 2OBNA 4ONEA 4P98A 4RD2A 4JYMA 5F1PA 3UKDA 4Q9AA 4JSYA 5AW8A 4RXMA 3AESA 4YJHB 5FHRA 2DERA 1D09A 1E9DA 1G60A 1BW9B 3DQQA 3HCWA 3KR2A 4ZYVA 3THXB 1UPTA 5L9AA 4TYQA 1L6IA 1Y7TA 3ZJ4A 1NFQA 1XRJA 2W11A 4MEAA 4LF5B 1EZZA 5DYTA 1K3UB 5JZ9A 2XDYA 3CKMA 4EG8A 2GRAA 3OVMA 4QRHA 4QXRA 3H1AA 3TB4A 2JI9A 1QZ3A 4Q12A 2MSNA 3H6HA 3JU3A 4Q93A 4RZSA 4B6OA 1YB7A 1KI6B 2VHWA 3A3NA 5EIFA 3RHSA 3IR7A 3V1LA 4YT2A 5JNWA 2AH5A 5G53C 3BA1A 4DJJA 1XL1A 2A7QA 3KJEA 4LJ6A 3T9BA 4AZ3B 4BLSA 3KYBA 4Q3BA 4EQ6A 4OM8A 1THZA 1N3BA 3N5KA 1P7CA 4G67A 4J6EA 4ZCIA 1GPDG 3T1VA 1H2EA 1NVMB 1Q3TA 1SVIA 1YK1A 3DC2A 3PGKA 3JQ8A 2QN7A 3SYRA 5DRYA 4LAFA 2V65A 1ULTA 4C3ZA 1JZTA 3AKDA 3DBRA 3QX9A 5K0EA 4HN2A 5IHPA 5F3DA 4K6KA 5E0KB 1P80A 2CB9A 1A4IA 1F2UB 3ETGA 3FVQA 3TZEA 3H2GA 5CVTA 2WM2A 4Z4GA 3MK31 3FWHA 4CM9D 1LWOA 4JBIA 3F4BA 1QHIA 3D4LA 4JLVA 1N6RA 4BV9A 4G81A 1CHNA 2PBFA 2CLLB 2VYFA 1QH1B 3BRCA 5DHFA 1T1JA 2HU8A 3IEKA 2I55A 1IFXA 3IPCA 4I1OA 4L27A 4G0UA 5LA6B 1HOTA 3VC1A 3GLRA 3R6WA 1F8YA 5CX1A 4OATA 3TDMA 4ZHQB 2BMEA 4GI5A 4I4LA 4XARA 3HABA 5K0FA 3R0XA 2L19A 1U0GA 2A67A 3KLBA 3ZLBA 4ZI5A 1WW2A 3CHYA 4GKKB 1IQRA 3B5IA 1EGAA 3L93A 4BDTA 4TSKA 5A9SA 3O3CA 3UCEA 5HJ7A 1YIDA 4MIEA 5HIAA 3SS9X 3ZWDA 5JPDA 3S27A 1T0PA 4X65B 1SIOA 1EFRA 3O9VA 4RZXA 1E1CA 3DAFA 1U11A 1K4KA 1PD1A 2XVZA 2A4MA 3JSXA 3OFND 4FQ8A 1H2RS 4G5FA 4YQFA 3LUPA 1U7OA 2PH7A 5AP9A 3VR5A 3WDMA 2XB2A 2O8FA 3C87A 1ZCAA 4XX1A 4DA9A 3DEFA 1O77A 1US8A 1JDUA 3AHFA 4PIPA 1MRZA 5LYJA 3SY8A 3NYIA 1RC0A 5L3ZA 1XTBA 1ZLXA 3H2HA 2ID8A 5IW8A 1FVHA 1CVRA 2W2VA 2X7HA 2XTAA 4NZYA 5HM6A 2P4HX 3R41A 2XJ4A 3THYA 1XQVA 3GFPA 3GVCA 2PX8A 2XUQA 3ZUPA 3C41J 3GC6A 1C8KA 5CFZA 5F2NA 1JECA 1PT9A 1MV8A 3K15A 3FRJA 4FILA 4KXQA 4LOKA 3WI7A 2O1XA 4FTWA 1EM8A 2VAMA 4ZKEA 3W77A 4EHJA 3LCMA 3MINB 1F0KA 1XCLA 4ZOBA 2G8LA 2VZ9A 1JE1A 1LK5A 1ZD4A 3A3OA 3G9XA 3QUTA 2Q5LA 4HDNA 1BVRA 3VR1A 3GLTA 3X2FA 1NMXA 3G0OA 3V42A 1NJFA 1I1QB 1L2TA 5LP1A 5KYWB 3VI4B 3OFKA 1D0SA 2UAGA 1ZN9A 4O2AB 5CB8A 2A5LA 3JAWA 5DNCA 5IWAB 2BISA 1UJ6A 1GARA 1LK7A 1NVDA 2ASVA 1P81A 2D2XA 2PKXA 3VJMA 2G04A 3KPVA 3ZDZB 3AVVA 1T3GA 2O2EA 2VJBA 3IUMA 4ZQFA 2AR7A 3NBFA 1FU4A 3NH6A 5HQ3A 2Q1XA 1CDEA 3IIJA 1TPZA 1MZVA 4D42A 4DQ0A 1DV2A 4EZEA 2UUBB 2CF6A 4CETA 1EE2A 3QGMA 3SDZA 1E6KA 4NL4H 2P11A 1C30A 2VPZA 1NNEA 1Y4DE 1PLLA 4WZZA 2D5CA 4L0CA 3SP1A 1N2IA 1S3SA 2HZ7A 2X1MA 4DPMA 3EODA 4IHJA 1P0FA 3DAYA 4YH1A 4EP1A 3GLFB 4D4GA 3C6KA 1JEDA 5KTPA 1PHRA 4CCYA 1ISGA 4IW3B 4E09A 3R3YA 3BOSA 2D8AA 4RFLA 1A50B 3P71T 3VVLA 3BXOA 4INPA 4MRPA 1R8XA 4PGMA 4R2KA 5DHRA 3VMMA 3CVOA 2WF5A 4R6XA 4A6DA 4GGPA 4G5SA 5CTAA 3D8SA 3H05A 1RZVA 4PZPA 1XTUA 4RZQA 3GD5A 1USUA 5EXPA 2QU7A 1B2LA 2Z9DA 3ZXSA 3B52X 1B16A 2AEJA 4NJMA 5DISB 4GP7A 4Y2JA 1JQLB 4XEHA 5HFAA 3PXCX 5ALPA 4U6SA 2QW1A 2FETA 4NCAA 2QSJA 2QUAA 3DL7A 1E64A 2RH8A 3RGWS 4P4NA 5HP4A 1U31A 4KUGA 1XC7A 3E0XA 4LQDA 2W37A 1XTIA 1VIDA 2HFJA 2H4WA 4MUXA 3WSTA 2GBPA 1ZU5A 1KU0A 4AUNA 1OUMA 3D7KA 4RJ2A 3I9KA 3ROTA 2IPMA 2C58A 3Q5DA 3GFBA 5KTSA 3H42B 2BGTA 3TLKA 3UKOA 1ZYUA 2VAVA 2WAOA 4Z8YA 5DI9A 4DF3A 3VO8A 4HC4A 1S2LA 1EU1A 4ND5A 3ZE1B 1RWMA 1DXOA 1U7PA 3K9CA 3U9SA 4MI1A 4ND3A 4C4YA 3DT9A 1DIRA 1GLGA 1TT5A 4CM6A 2GBCA 1PR6A 4QU8A 4C4PA 2QL7A 4ZVTA 4YCCA 2BF4A 3FTNA 1LRKA 3N7AA 3LQ2A 4BQFA 4WCDA 3ZHZA 1FXWA 1FYXA 1HL7A 3PNMA 1CR1A 4CCSA 4BEWA 1FB5A 1V8OA 2ID4A 1W48A 3I73A 3GGOA 4N4AA 1VKHA 1OFIA 3CN7A 1SKMA 1YU9A 3D6HA 4QOHA 4HP8A 1VE1A 1ZH6A 3WO1A 1A27A 1DBPA 1EB9A 4LRSB 5CDGA 3Q3HA 5JYCA 3T34A 2C5FA 3FPSA 1DKOA 2UVPA 1TUBB 4J91A 3BYZA 4ZIRB 1Z82A 1ZZEA 1WCWA 2FN3A 3BMCA 5EA2A 5JE8A 4B7XA 5M5BA 2NP6A 2OG2A 4CQLB 4AB1A 3RTEA 3AM5A 3QKSB 3PYLA 4UCXA 3EFBA 5EJMA 1XKTA 4IX1A 3NRCA 1T8PA 2D1SA 2E85A 2PL3A 5CLIA 1JMYA 5EI5A 4ZI3A 1YBAA 1RBZA 1ZGAA 4EFKA 4JMLA 3M1AA 5FLXA 4QGAA 4RTNA 1HMYA 5JZSA 1I4WA 3WB9A 1N2CB 1RM0A 3QVVA 1T2CA 2Y05A 2ZQZA 3RKRA 1U1IA 2X0FA 2REXB 2IA5A 3KL2A 5E2BA 5J63A 3NHUA 5J2UA 3O8CA 3NBMA 1AUVA 5I9IA 1XDUA 1MEEA 5DGTA 3U7QA 4HMQA 3LECA 1QRSA 5EG5A 2GETA 4WZBA 3P2IA 4FYKA 1E89A 4DR1B 3I2HA 2Z08A 2PLWA 3FXAA 3EGDA 4IZIA 5CPBA 3F8TA 3WNDA 4QGFA 3V97A 1TA0A 2B1QA 2HY7A 1GQYA 1RLOA 2Q4BA 3FOCA 2AUTA 4JA2A 4OI0A 1QANA 1K8YB 2ZRQA 3PC3A 5FBHA 5FH9A 2EC5A 4XIIA 5DYGA 3HYSA 4U1RA 4G5RA 3RVDA 4HY3A 2ISQA 1G8FA 1GZ6A 3E3MA 3RSLA 2CXUA 4JR2A 3LPNA 4NDZA 1I4EB 2VEOA 4YUAA 4DBLE 2WIDA 1QK3A 2CFIA 2OCKA 3KQNA 1WMAA 2XMGA 1LH0A 3GRCA 2EZ9A 3RVRA 1H5NA 3WQRA 3PQCA 4CMHA 1T2FA 2OCPA 1KI9A 3N8NA 3AY6A 2J9RA 2CSXA 4HDCA 5E95A 1PFGA 1T0BA 4F45A 1N5LA 1K66A 1VHLA 4FDMA 1QO9A 3S68A 1T8UA 3G89A 4F21A 1RI4A 2X0RA 4DT1A 1UBGA 5K4HA 1OH7A 4P7JA 5SZKB 2FX2A 4H1HA 3ZR4B 4WA8A 3CLSC 1KOFA 1RAEA 2GJKA 2NIPA 3NUGA 4QJIA 5LDGA 4TN5A 3ZE9A 1GUBA 2ZE7A 5JWOA 1XPRA 2C2XA 1N2GA 2X9NA 3MILA 5ARCA 2ISCA 3B2EA 3BHNA 3PJGA 4KMMA 1DGQA 1A5ZA 4CF4A 2H7CA 4LIPD 1HKUA 4M99A 1NTRA 4LYFA 4N5IX 1U2ZA 1A8PA 1N8NA 4WNAB 1OLUA 4LBWA 3CVXA 3R3HA 4N0MA 4DG5A 3U62A 3OWXA 3JTEA 4ZI7F 2Y9PB 3GBPA 4LJ9A 4CCAA 4JI2B 2I1WA 4LVUA 4XWOA 2JKYA 3RWOA 1P9LA 1PZGA 1TM1E 1ZGHA 3ZY4A 1J25A 2XOEA 2I65A 2FDRA 5ESWA 1P4JA 1Y34E 1ZK1A 3V7YA 2V54A 5DN6D 1VGRA 3TE6A 3V55A 1M1NB 1EFKA 3M9WA 1DPGA 1NMQA 3DZCA 2ODWA 3QG5A 4FVTA 4IGEA 4KOAA 1W1WA 1YRQA 4TRJA 4NU8X 4CTKA 4UMFA 5JSZB 5KOHB 2MU1A 1V5WA 3KV1A 1UDAA 4MGYR 1N3IA 4R0VA 5AKXA 3INYA 1UEXC 4XUEA 4D4IA 4JZKA 3EA0A 2F4NA 1G98A 3ISTA 5IARA 3OQMA 1X0XA 1Y63A 1PUXA 4P38A 3OE4A 4IJQA 1Q44A 3VR3D 3W5VA 1G8PA 4BMXA 4GU5A 2H2GA 4RFSA 1SD1A 1JJ7A 2NX2A 3C70A 5IRCD 1KERA 2XLCA 5DTRA 1EYZA 5FUBA 2YNMC 4RLQA 4EB0A 2BFWA 1MXFA 4D79A 4DR2B 1P91A 1QRTA 4LCEA 1EE9A 4CJXA 1Q50A 2AOVA 3VZBA 4H35A 2NU8A 4WN9B 2AX4A 2AXPA 3S0JA 4X64B 3ZHCA 3RK4A 4HUJA 3ANNA 5L3QA 2PANA 3H3XA 3TR0A 4RETA 4GR5A 2QROA 3G1UA 5IJ0A 1RQRA 3AUJB 1ZNZA 4O08A 3OC6A 1YTLA 3QXGA 1HK7A 4IDFA 4IRUB 1A2KC 1NUSA 3SXPA 3W7BA 5AH0A 4G1VA 4GRDA 3KBOA 2FNAA 1GZVA 1MRSA 2C77A 1QPBA 2HI0A 1GUYA 3LZCA 3PUKA 4XIYA 5F7OA 5CVEA 4L08A 2YWCA 4RZIA 1TC2A 4G9EA 4C76A 1HG1A 3EG5A 3T0FA 5HF8A 1O89A 1QP4A 4A23A 3DVAA 4EWLA 4IF4A 3R76A 3B6MA 6CHYA 4RPKA 3PFCA 3ASUA 1XZEA 4OJKA 4MW0A 2HX1A 1RAHA 4UULA 3BILA 2J6HA 1KPHA 1PEAA 3GVIA 4F2WA 3CVWA 5LWQA 5DGHA 5AI0A 2LRHA 1PS8A 3GPBA 4C88A 1PYDA 2IP2A 1UC4B 4YUXA 2NSYA 3D2BA 1L5HA 1TZMA 3N58A 4BZXA 5EKSA 3L0CA 4YMSA 1ISJA 3QNMA 4MUKA 3VM6A 4YJHA 1OFTA 2WTXA 2FRVA 3O8BA 1V8PA 4RNCA 4ARVA 3DFUA 5IDYA 4JBYA 3VR4A 1BW9A 1FDOA 1Z6ZA 3T7EA 1BH2A 3THXA 2YHSA 3H1FA 3ZBPA 7GPBA 2XRZA 2O7SA 2SHKA 5KWEA 3G2QA 2AN4A 4CKEB 3O94A 5EVJA 4DA6A 1UK7A 3KE8A 4PONA 4Y1FA 1JDVA 3K09A 3E15A 2COEA 4X95A 1KI6A 3PJRA 1YRWA 1Y6RA 2VP9A 4Y8VA 3PEYA 4LRWA 1V16B 4MWTA 4LYYA 4WZAA 4AY3A 1KQGA 4NABA 1UIRA 2ZYIA 3QH4A 5KI6A 4EKDA 1XE3A 3U56A 4JYAB 4KVFA 2ZETA 4NESA 2PN1A 4RHTA 1P45A 2QSYA 1NOIA 4GLLA 5T64A 2I22A 2GAOA 4LSWA 3RSSA 1A3CA 1RBMA 4HFNA 3BX1A 2AK3A 4YMUA 1Q83A 2NMVA 3FDFA 5H7XA 4ACBA 1F2UA 2IYOA 4RHCA 4X7PA 3F2IA 3ZJTA 3KXIA 2ZYSA 4C0WA 2H1RA 1UQUA 5DCUA 2EKQA 2FFRA 1V4VA 2P27A 2PDAA 3GL9A 3LDGA 3LY9A 5LC1A 3GO4A 3QYAA 5TQ2B 3ZGLA 3HGTA 4Z3KA 1TRHA 5E9QA 2G9VA 3IUNA 1J2JA 2GCEA 4JQOA 3DEIA 4LJYA 2H3EA 1X94A 1FLAA 3F0TA 4HQRA 4ZHQA 2BHLA 3QIAA 4J1QA 3WFZA 3L7DA 3O8QA 4F06A 3ZZ0A 3L7LA 4IUBS 4F12A 2XKKA 4R9NA 2OCLA 1D1PA 4M83A 4UU8A 1FZTA 2AYYA 1BE0A 3LV8A 4LVOA 3SQMA 4FE4A 5HMMA 2VHYA 2RAFA 3L0ZA 2QP3A 5IBRA 1GPH1 2W0SA 3QF4B 4XFJA 1BN7A 3WGZA 2R47A 1TJYA 3HA7A 4E2FA 2C1ZA 2QMQA 2W58A 4LHSA 2JIPA 3G2MA 3V1YA 4XCQA 5BPHA 2QRMA 5FDFA 2QDKA 3AI1A 4YRCA 3LIIA 4CLOA 1XEXB 3OT5A 2QD4A 2BFEB 5JECA 2BKVA 3BRSA 2OGTA 3RU9A 2JG3A 2VF2A 3JQQA 1VA4A 2JFQA 1DCMA 2VK8A 3VRHA 4CI0B 4ETIA 1Z6PA 1AH2A 1GG5A 5CW2A 1XELA 3NHKA 1NE2A 4OQ4A 3W7VA 3IGFA 4KKVA 4EY6A 4YYZA 1EZ4A 1EJBA 3RTBA 1G8AA 4H59A 1CF9A 1L8OA 1VM6A 4IGKA 2VXCA 4N7JA 3L77A 5JATA 16PKA 3V7FA 1NI3A 3CM0A 1DVRA 1V47A 3GK3A 3MINA 2BTEA 3ILYA 2ZCVA 2ZREA 3W5SA 1IVSA 1EHCA 2GESA 1ZNYA 2XUJA 5JS6A 2IL1A 5D86A 3R9KA 4Z4FA 1E2NA 5B1SA 4HZGA 1JDBB 3TOZA 4IICA 3OESA 4O2AA 1AQJA 5K8CA 2W5UA 3C14C 3C7KA 3HDGA 4LRQA 4ARAA 5JJIA 3LSYA 4IUDS 1KQ3A 5WRFA 1YBFA 3PQ6A 2P0YA 5E7IA 1AV6A 1PGPA 2CK3D 3RF7A 2MYUA 1V7ZA 2ECFA 3OJWA 3ANYB 4QUGA 3JQRA 2ZKIA 4Y1EA 5CITA 4RJTA 4M86A 1TNDA 3IJRA 4WKGA 4TTPA 4XVQA 3SSNA 1ZR2A 2HV9A 4CQMD 3MSCA 5J40A 4RJJA 3U3RA 4D0RA 5ENVA 3QLUC 4L7VA 2XITA 1F4LA 4CMIB 1L7BA 3L4EA 1CF2O 5BSMA 5JCJA 1R00A 1CY4A 4YCLA 3GLFA 3GLKA 4EHNA 3OP4A 4PRLA 4FQ7A 1ND6A 4X00A 4ZV9A 3AVWA 3L6RA 4XCXA 2X9LA 4DMRA 3EXFA 5J1SB 3FG9A 2RK3A 4ZZ1A 2F3UA 2EJUA 4ZP1A 3V7WA 3PLNA 1SK9A 3QQ5A 4HLCA 1CYEA 3REOA 4R8LA 1PT7A 1XZAA 2P30A 2RHJA 4HV4A 3UATA 1VP9A 4B45A 3D0RA 3VDNB 1T5IA 4TKMA 2PV0A 2FPIA 4QHTA 4BV3A 2E49A 5C3MA 2GD1O 1XZHA 1SOUA 1P1BA 1RT9A 1L5OA 3NDRA 1U7TA 5SY9A 3LVFO 4Q6BA 4BKMA 4D92A 1U0BB 1L5FA 5BMVB 1ZN2A 1BS9A 1ULSA 1A9RA 2Y92A 3AP3A 5FB3A 4OHXA 4PQYA 5ILQA 1WOMA 1KMCA 4DC1A 3AHEA 2WINI 1HDYA 3PUHA 1GPUA 5F52A 2VPQA 4BCCA 4GZLA 1QVAA 4KU4A 4XM2A 4YUYA 3AH8A 2CT8A 4PY2A 1IZZA 1BOOA 3PXDA 4Q9HA 1DWQA 1SR8A 4E5NA 4BMVA 2FAXA 2QOEA 3OZTA 5L7WA 4AT1A 3AR4A 3BIXA 1DC3A 2WJGA 1ZAKA 1E3SA 3NO4A 5K3AA 3SQXA 1WSBA 4J0KA 2JFHA 3B8EA 1Y6GA 4FFPA 3UOAB 1MDBA 3I2JA 2NPFA 1KMHB 2B99A 5FTJA 4HNVA 4NEGA 4ZAVA 4F46A 6PFKA 2E2WA 2Y1LA 1L5QA 2FK7A 2VPWA 3QFHA 4RKQA 4ZDJA 5IX8A 5KNBA 5GONF 2J5RA 2C8JA 1EE1A 3AF6A 1BVUA 5ITWA 2PUVA 4HO1X 5CTJA 4ZAGA 1M2OB 1TJ3A 4FDLA 1EESA 5GQSA 5C7LO 2DY1A 2Z56A 3CB4A 1UP6A 3N0RA 5DO9A 3W2GA 4D0SA 1GADO 2BEUB 3SICE 3KUXA 1CY2A 1O7JA 1SVOA 1FVFA 1M7BA 4ZGBA 1MB2A 3P0FA 1S02A 2SKEA 2GILA 2PMCA 2XMSA 2JA2A 4GI2A 2WF9A 4JU9A 2FY8A 4KXVA 4MVXA 2PJZA 3WZMA 3U4AA 4DLZA 4TM8A 5EIHA 2YXBA 4RTLA 4PCUA 3COZA 1H23A 4DA7A 1JLHA 1T25A 1OF1A 2OGSA 1QU3A 5U9CA 2QL9A 2X58A 3ZDCA 2GBLC 2ZRIA 3EWSA 5JBNA 4C14A 4C4TA 2PXCA 2FOIA 2FSHA 1P72A 1QBKC 4OBWA 5JUWA 2BUAA 3OLWA 4QPJC 1W88A 3IE2A 1OAOA 2NAFA 3JYNA 2KM1A 3HKDB 3CNHA 2HRBA 3RSHA 3TW0A 2GPNA 3C48A 4LOAA 3UW3A 2NZUG 4ZAWA 1N4AA 4LGCA 2OKGA 4H1TA 3LX5A 8GPBA 4LJ8A 3V33A 5FPHA 1LJUA 4FMDF 1NW3A 3I3SR 1NMSA 4C89A 5AW7A 3K1JA 3H13A 1WXEA 2G76A 3DCYA 1PL0A 2Z5GA 1KRXA 3OJFA 1E7WA 2XGGA 2YC4C 4IIJF 2X2PA 3BZUA 4Y9UA 2F48A 5AXAA 3UWSA 3TVDA 5KCZA 3I6MA 2B37A 4E13A 2R25B 3AFHA 1K4YA 1WUYA 3MQ2A 1G7CA 1SCJA 2ZE5A 3UO8B 4D7AA 1C9NA 2G0NA 2W2MA 5EXXA 1YL7A 4MS1B 2W6JA 2WVGA 2QXYA 1U28C 4M22A 1ZW1A 2UXBB 4G24A 5GM2A 1JHMA 1UBFA 3NG1A 2JIDA 3R0JA 2O0JA 4OFZA 4OHRA 4P5PA 4QX6A 1C9EA 1JDZA 3QWHA 1VPLA 1ZNQO 3RRNA 4AECA 4DPKA 3U44B 4CTMA 2WB4A 2DLCX 3C3BA 3GEPA 2CUTA 3VPSA 4IOKA 4DCOA 3RVSA 4BP3A 2ET6A 4UD2A 4WNAA 5I6DA 4LF7B 4XLZA 1RW4A 3G8YA 5LP6F 1QQ5A 5F3RA 3J7AC 4AJ4A 4AJNA 4B3MB 2ZIZA 2B5VA 4ZO8A 1R3UA 2AJLI 4U02A 4TVBA 2MHCA 5LZ7A 3VDXA 5JNLA 2A5FA 2WMOB 5KO2A 5ALVA 1I32A 5EKTA 1QFMA 2DPHA 1C4OA 1T2EA 3GNTA 3N2EA 4MPTA 2IJGX 4QLOA 3WX0A 5KC9A 4PCAA 4B4WA 1M1NA 3ZQ6A 4XRRA 5AIAA 2J5KA 1EINA 4YJFB 5IDWA 1XAJA 5JSZA 3A37A 3IV6A 3P2MA 3GRPA 3I2YX 2XE6A 1KIFA 1AA6A 5FTLA 4PVDA 5CYOA 3KTFA 2QTZA 3PEEA 4MUBA 4A0QA 5FNZA 2ZI7A 4KI7A 3QENA 4HUQB 2JZOA 4PAMA 5DNWA 2OCAA 2HCFA 4D5GA 1JIXA 3CR8A 2HLPA 3UB3A 3M6LA 3RAPR 1O0BA 2JGFA 3CW2A 1Z56C 1GCAA 3ZIAA 5JW6A 1GWNA 4DANA 1GYRA 2PWBA 1E9SA 4ED9A 2NACA 1QORA 3WP0A 2X8JB 1X42A 1RJGA 3EK2A 3PXBA 3AV0B 2C5GA 5DGCA 1GA6A 2FF5A 1ZIYA 2XWPA 2WNIA 3SBDA 4EGCB 2FPKA 3IMKA 2H8GA 1JQKA 3OD5A 3TPZA 3DXYA 2Q8QA 5F77A 2NVBA 2X76A 4MEJA 4XSHA 3C4QA 2FUG6 3WGJA 4E5PA 1X8XA 1V8FA 1G16A 5DTIA 1PGOA 1IQUA 1KI2A 2AJDA 3I2FA 1I6WA 1Y5NA 2YIJA 2ZUUA 1XVAA 4HNGA 4NG5A 4BX0A 2Q5EA 3E5MA 3I6IA 5D7BA 2RHTA 4H7IA 4D4HA 2O3JA 3WL7A 3RAFC 1REQB 2DFVA 2WU8A 2VK1A 1NVVR 1YQTA 3K0CC 2Z1DA 2OV1A 3GHYA 4FGJA 4K9LA 1ZQ9A 2ANBA 2DLDA 4W9MC 1TECE 5E3HA 1GFSA 3L8EA 3KDPA 4QARA 3USCS 3Q1LA 3X1XA 2FZWA 1WRBA 2PKEA 3KKNA 4TS3A 3HZZA 3MRSA 4CFZA 3RT1A 5I7SA 1X3LA 5JROA 1EXMA 3R5SA 2AFRA 4D3SA 1EK2A 3UK6A 2OO7A 3KTAB 4RMNA 3TPFA 4P6VF 4UXHA 1Y1SA 5LJIA 2VLBA 4D81A 3F73A 4YAGA 2VTEA 3LYUA 4MS4A 3UAZA 1OIXA 5T3UA 4RV4A 3BE5A 4JYZA 5G3YA 5CFRA 2F8TA 4R01A 1XJCA 3UJDA 1QP0A 3Q7TA 3AHIA 4NHEA 1QSGA 3T5TA 2R0QC 3E8MA 2PXXA 3K6SB 4KPYA 3V2GA 4LHZA 1KDVA 3BCSA 1G18A 1D6SA 4OPMA 5DYIA 2NWQA 2Z2IA 4E22A 3FB4A 4AKIA 2I54A 1H0RA 3EOAI 1OLSA 4JP5A 2Q5HA 1UL1X 2FCAA 4HBZA 5B36A 4M9QA 4ZGWA 1XXHA 1B8UA 3G5LA 5ES4B 5IDQA 5JLJA 1AK2A 1WMDA 2E55A 2EZUA 4FFNA 1P77A 2KS6A 5TT1A 3WE7A 2RC6A 5B53A 2OLJA 5JG7A 3HWX1 2EBWA 2HNAA 2VP0A 2X86A 1E32A 3TI9A 4BX2A 5H3LA 3NV7A 1YL5A 2CKMA 4PR3A 2SECE 3AZPA 1Z8HA 3CPEA 3R77A 4TSFD 4B0PA 3DDUA 1XTTA 3NKLA 3WZLA 4DDHA 4DR6B 821PA 2IUEA 3L4SO 2C0PA 3QVOA 1L9KA 4OQEA 5ADWA 3WDLA 4JK3A 3I12A 2F1JA 5FD8A 2P9HA 3R9IA 4ZICA 3C3KA 3C0KA 4NBRA 5G4KB 1XOIA 2JGLA 2Q46A 3WS7A 2B3DA 2MR5A 1GCIA 4UMDA 5TQ2A 2V6JA 4HDKB 4KYTA 5JMTA 2HZBA 1WD7A 5F64A 4BBJA 5I9TA 4Q3OA 1B14A 5G0WA 1LLQA 1W5FA 4OV6B 3HCOA 1SN7A 3VSEA 5ALSA 3NV9A 4BKUA 1B0AA 3Q72A 5G0SA 1KI3A 3MS7A 3WADA 4HEA6 2LP4Y 5JHGB 5BR1A 5REQB 1SUSA 4K88A 4D82A 2JFZA 5LWHA 2XVXA 3U17A 1GTRA 2XNKA 1DC6A 4L72A 1S1MA 4O4IF 3K9HA 3LAWA 4OUKX 4F56A 3FCEA 3H8SA 3OE5A 4GECA 3UHOA 1W5TA 3MYRA 5T4FA 3U7IA 1H42A 2JFPA 3C8DA 5BO5A 3TPCA 1EVQA 2G77B 4P3XA 4PG6A 5K0SA 4UHFA 5AHXA 1KL7A 1IBCA 5M2QA 5CJPA 1RRPA 4KFUA 2XWSA 1RQXA 1VKRA 4TOIA 1J8MF 4Q4DA 4C5CA 2EKPA 4DYDA 4HK4A 1XEXA 4R54A 2HH9A 3FF1A 3AY7A 3VAZA 2RHOA 1FXUA 3BHJA 5DMHA 2ZATA 5HCUA 1E2PA 4EAQA 1FMFA 1SG6A 3HYLA 3JVIA 4KRYA 3P2EA 4M1KA 1XMOB 4P7FA 1OBVA 5DRTA 4E5YA 1PS0A 2JK0A 1OXUA 5ECYA 2FUNB 2J3MA 4W82A 5A06A 5CBPB 2CW5A 1CUZA 2DR0A 2C2KA 2R85A 1PNVA 2EWWA 2VCEA 2Z0MA 3CH4B 3E9EA 3R4CA 3R6LA 3RTAA 3ZOZA 1SKYB 4R2XA 2G71A 2YV5A 3BGDA 2GWRA 3MVEA 2EP7A 2PUHA 3O8LA 3R3ZA 1EJ0A 4FNGA 3B8HA 1DUSA 3K4PA 3IB6A 4RL6A 1R6TA 5CVCA 4NCKA 1RLIA 4ZC1A 1MFZA 4KMOA 2PH1A 3OU2A 3U49A 1GUDA 3DTVD 3MWKA 4IZ6A 1GZHB 2AQKA 2M6RA 3MQFA 4JJ7A