2WWXA

Crystal structure of the sidm/drra(gef/gdf domain)-rab1(gtpase domain) complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGIKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED PROTEIN RAB-1
publication title Structural Insights Into the Dual Nucleotide Exchange and Gdi Displacement Activity of Sidm/Drra
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wwxA00
3TSOA 1W36C 3SYKA 1E94E 2ZYWX 1BO6A 1Z08A 3E5HA 4MQBA 4QBIA 2IS1A 2ZSEA 3RRZA 5A0FA 2FA9A 4PC7A 3AVQA 2BCGY 1YKSA 4HI0E 3RS2A 2X2FA 2BJVA 1P2UA 2XZPA 1OYWA 2F1RA 1GNPA 5FOVA 4H1UA 3IHLA 4A4DA 3IKJA 1FMLA 521PA 4KFRA 1NY6A 3OIVA 5FPTA 1NVVQ 5LD2C 1Q1BA 2N1BA 4NKRA 4MA4A 4AI6A 1TNDA 3QXCA 3AVPA 2QM8A 2ZR7A 4RKFA 1Q1QA 1KO1A 2DFNA 2E87A 2VP9A 3AV0B 2O8DB 1DVRA 4RZ3A 2XEXA 5EP2A 3WNDA 2GTPA 2XXAB 1AQYA 3UXMA 4Q19A 4LJ9A 2YOGA 1W2GA 4D0LB 2J5XA 3B1YA 2XOKD 3CLVA 1GZSA 1P6XA 1KDPA 3SJAA 1T9HA 2WKPA 1U9IA 1WBBA 2WICA 3AKYA 4FINA 3GJ6A 1U81A 1VMAA 1CR1A 4LJ7A 3LH5A 3DOEA 1QVRA 4FXPA 2OSBA 2GXAA 2LKCA 2QBYB 2CJWA 5FBRB 1ZYUA 3DOFA 1KNQA 4LJ8A 1AKEA 3EPJA 2GKSA 1W4AA 1F6BA 2VRWA 2DWOA 4DKXA 3SR0A 4OJKA 1ZIPA 2WPDA 2R9VA 1FL9A 4TTRA 1TEVA 2WMOB 4TTPA 1KJYA 1XD2A 1KI6B 4KBGA 3SS8A 3UWOA 2H8KA 2ZRKA 1SVMA 2ZREA 5J4LA 2P5TB 3P27A 4W5HA 1U2RA 3B2EA 2FG5A 3SZRA 4B48A 4NMMA 2EVWX 3BAFA 2W6JD 4TLDA 1KIMA 1X8JA 3LW7A 3QNUA 4L9SA 1TMKA 4ZI2A 5L3RA 4B34A 1EGAA 4NCKA 2AK2A 3ZD6A 4GOJA 4Q4JB 4M9SA 4XVQA 2WWXA 2ATXA 3GPLA 4V0OA 4ZDJA 2JATA 3KXIA 3SOPA 3TH5A 3T35A 2Q3MA 2AD1A 1JALA 2WJYA 2YINC 3OEEA 3DPUA 2ERXA 5EZ6B 3PJRA 1M7BA 1IY1A 1HTWA 1FNNA 1N6PA 1R10A 4UXJA 3F5FA 2ZAMA 3SJCA 5TVKA 4A6PA 1SVLA 4RD6A 1DARA 2PZEA 1H8EA 1ZC4A 3GJXC 3WYGA 4LHVA 2OCPA 1U99A 2I3BA 3WP0A 2GEDA 2JGNA 1NSTA 4BZPA 1WCV1 3K0FB 4OKSA 2HF8A 4L9WA 3VR4A 3CX8A 1E0AA 2VHUA 4JBWA 1QRAA 1YZGA 3W6OA 2OE2A 2W0SA 1RPZA 1KK2A 2WKRA 3WYAA 1RIFA 1V43A 1G21E 4C30A 3QXHA 2CVFA 2OAQ1 3RC8A 1IY2A 3U3OA 1TADA 2ZROA 2ZYUX 3FE2A 3NVAA 5C2JB 1NLZA 3GLIB 5AJWA 2Q3FA 2ZJBA 2J7PA 1R8SA 2C03A 4HUQA 3E2IA 2JA1A 1XZQA 1N5JA 2WWFA 5JJLA 4C2UA 2FF7A 2WIBA 3LAWA 1RZ3A 2Z83A 3B1XA 3WXMA 3EIQA 4X8OA 2CNWD 4EFLA 1LS1A 5KU1A 1ODFA 1YVDA 2FGJA 2HLDD 1E0KA 2IHYA 4BLSA 4DDVA 4V0KA 2BHRA 3GFOA 3QBTA 2AWOA 3G0HA 3QXSA 2E9SA 4ZDKA 1XDBA 1C4OA 4FMCF 1DE0A 3PUXA 1R0YA 1VCIA 2GRJA 1DOAA 1U9IC 4GT1A 4CYMA 2FX3A 3G82C 1AS2A 1CR0A 4TL6A 2P6UA 1W4BA 4DBLC 1E0JA 4LHZA 4DCTA 1PUJA 2CK3A 4IVPA 3W6NA 3M4YA 5CLQA 4JYBA 3GLHA 5DI9A 1OIWA 3Q7QA 2V4ZA 3KJEA 3QUSA 2ODEA 4NU0A 3AF0A 3N70A 1GIAA 2IWRA 2XJ4A 3TJZA 3U3KA 4I1SA 3KQLA 4WZBE 2O8CB 2KI5A 1GRNA 4OBEA 2B7BA 1GKUB 4AYXA 1WDTA 3B1WA 3A4LA 1N6KA 4IW3B 2J0SA 3RS4A 1OH7A 1VG0B 1L8QA 1N5LA 5KOYA 1ESNA 3NBZC 2C9CA 4JJKA 4S35A 3D7MA 4AURA 4ZIRA 5KNDA 3F0TA 5K8IA 3I8SA 2YWHA 5B30A 1NVWQ 1P2VA 4E07A 4HLCA 3A1WA 1I2DA 4CDGA 1U98A 4PPFA 4YXWD 3KUCA 1G6OA 3P4YA 5GJWC 2QMOA 4BGDA 3CX7A 3CZPA 4G3XA 3V4RA 4B2LA 1VIYA 1JNYA 2OXRA 2G9NA 1ZUNB 5L8VA 4AIIA 3BWDD 3X1DA 3U3JA 1NJGA 1X6VA 5JWOA 1LF0A 2MSEB 4BFZA 1G7RA 2BM0A 5SZKB 1DAGA 4JKYA 2JJ1A 4G5GA 2WAYA 3QVVA 1COWA 1MOZA 2WOJA 1CLUA 3KUDA 2Q9CA 3KQNA 2OFWA 3BFKA 2IC5A 3QVUA 3WRYC 2CLDX 3CNNA 1OH6A 1UDWA 1XX6A 2ODBA 4XTRA 5JWHA 1AS3A 1KY2A 4K46A 1F60A 2XAUA 2D06A 1ZM7A 2QENA 4GZMA 5KSZA 1E9RA 4XVRA 2GK6A 4WBSA 4A92A 4IDOA 1AIPA 4Q9KA 2IUTA 3PXGA 4A0FA 2H57A 1TF5A 4HLQB 4XD7D 1P4SA 4AG5A 4FD2A 1E2LA 1RC8A 2EU8A 2OCAA 1G7SA 4OJQA 4M4SA 3PEUA 2YOHA 4HLUC 5CYPA 1SZPA 2IYLD 4QOSA 5KNBA 4II7A 2YHSA 3T06B 3K70D 5BYKA 2QG6A 3ZJYA 5JRZA 2P0EA 1NL3A 1FW6A 3PVSA 4JJZA 3NXSA 2FH5B 4WIAA 1KGDA 3KKOA 5AUPB 5G3YA 5AJXA 2XNDD 2YVUA 2BWJA 5JHHB 4ZCMA 4MRNA 4XSHA 4FMDF 4LZZA 3T1TA 1ZMXA 2IEZA 3RSLA 1ZD1A 1HY3A 1G19A 4GNKA 5FTKA 4BRWA 2WSMA 5HKKD 2ZIAA 2IBMA 2OLJA 1A82A 4WXPA 5FOUA 4P33A 1XTRA 1KNXA 1UKEA 2CXXA 1OXUA 3AVXA 4PXAA 4DB2A 5EE5B 3T15A 4QJ4A 2FFQA 3TUJC 4PAOA 2WOOA 4Y0VA 1OLOA 1N0UA 2PBRA 1SXJA 1B0UA 3LBIA 4I4LA 5FPYA 4JZKA 4L16A 4BZXA 1W0JD 2V6JA 5TY0A 4E09A 3HR7A 3OESA 3PFIA 1FPMA 1ANKA 4OHWA 4D0NA 2A5FA 2C5LA 1P75A 3QENA 1G41A 1Z5ZA 4I99A 5D3MA 3UATA 2WBLC 5HR5A 3UK6A 3GLIE 3LW8A 4P4TA 3LRPA 2CL7X 3V9PA 2P6RA 2QAGC 3FMIA 1Z0KA 2C78A 2REOA 1GL7A 3GFPA 4Q4AA 2QTFA 4BEBA 2VO1A 2PH1A 4GP6A 1DAHA 4I1UA 3KQHA 3C16C 1YZTA 1N6RA 421PA 1F2UA 4EPWA 3VMFA 2IW3A 1XXHE 4DIDA 4KXFB 1AN0A 1TUIA 2GWHA 5CM9C 3PQCA 4UXIA 5FH9A 4DDUA 3CF0A 3RS0A 5JCZA 3WMGA 1NI3A 3QKRA 2DYKA 4JSTA 1K5GA 2IUUA 3VX3A 3R8FA 3KXKA 1N2CE 4WA7A 3HU2A 2O8FB 1OV4A 2D62A 4NL4H 4NP6A 1J70A 3BC1A 4TTQA 5UKDA 4QKQA 2WKQA 3MJHA 3B1ZA 1P7CA 5HCNA 1QDEA 2Q9BA 1L4UA 4OI4A 4PZZA 3W5JA 5BWMA 4PAMA 2GVDC 1Q20A 5DYIA 2YV5A 3J81k 4KSCA 4PC2A 1KAGA 1G7TA 5E3HA 2WJJA 1CJMA 3WNBA 1IY0A 2DPXA 4IHQA 1CXZA 5BN4A 2ZM5A 4N3NA 5KHOC 3M6AA 2ORWA 1Q21A 2HYDA 1K8RA 2QUZA 2ZRIA 1W36B 1OXTA 4ZV4A 2V7QA 1LNZA 4PHGA 1KI8A 1X8LA 1A7JA 1NKTA 4AKGA 5AUNB 1OSNA 4OI0A 1G3MA 1XJQA 5JEEA 4KHZA 3PUWA 4XWKA 1A2KC 3AKEA 3GFTA 2O0HA 3T1OA 5LB4A 4ARZB 3BB4A 3NBYC 1MKYA 3LD9A 4EQ6B 1G3UA 5BYJA 2ZYVX 3PEYA 1FQJA 5DSZA 5GJCA 1R5NA 4Q7MB 2B8TA 3W90A 4R2HA 4UNRA 1UAAA 1K6MA 4H9GA 5J40A 1PVOA 3Q3JB 3IHWA 4FWIB 1T8TA 4Y0AA 1XMJA 2CLSA 3R9IA 3VU9B 4CEIA 3ZDQA 1TU3A 2OLKA 2NZJA 1U0LA 1S9HA 4WOPA 4P4UA 3NBFA 2SHKA 3DL0A 4A0RA 4RFVA 1CJTC 5H70A 3EIHA 3EAQA 3TR5A 4RVCA 2CL0X 2XZOA 4EKDA 5LD2B 2KBEA 4UKDA 2P5SA 1LB1B 2QROA 4JLAA 1G5TA 3SBEA 4IKEA 1XD8A 2J0UB 4BZQA 1RRCA 1E2FA 2DFKB 1SXJC 4DWJA 4BFUA 1EXMA 1KI2A 1RVDA 2WJIA 3LX5A 2QSYA 5JS7A 4LYHA 2HV8A 4Q48A 3DHWC 5L3SA 2O5VA 2BBTA 4G5OA 5E7IA 1SKYB 1G6HA 1KI9A 3SYNA 4C0HA 1E0SA 4MITA 1IHUA 3BS4A 3QPWA 5AUOB 4M9ZA 1HT2E 1J7KA 1TAGA 2XB4A 4Q00A 3LWNA 3QPUA 4TLEA 4TMKA 3R20A 5FOSA 2QSZA 2CEAA 2HT1A 1UKVY 5FBQB 3X1WA 4DEYA 3NEJA 1T4GA 3CIOA 2B8WA 3EXAA 2RGAA 1AK2A 4DB4A 2FJUA 5CIWA 4OYHA 3F3YA 3X1ZA 4PQFA 2CLCX 2HEIA 1FP6A 3RWOA 2ERYA 3N2IA 3E1SA 3QIAA 3OEED 4YXWA 4HUTA 4YMSA 2DBYA 1U8AA 2W2XA 2CDNA 4L15A 3UPUA 4KVAA 3DMNA 1GG2A 3FMOB 4RY2A 2GCOB 2OT3B 4KYUA 2R8RA 2DHRA 3GEHA 1WBDA 5FPSA 3KKNA 3QI2A 3W8RA 2Z4SA 4OI2A 2CCKA 2BBWA 1H8ED 3K0SA 1Y63A 4JL8A 4LRWA 4TLBA 3C41J 3CONA 1W49A 121PA 4HSEA 4B47A 1ZM2A 2WWHA 1R5BA 5H68A 1DO2A 3KTAB 4MRVA 3WRXC 2EFGA 4C0KA 4DXAA 4OQNA 3VQTA 1P9NA 1Z2CA 3FFBA 1PLLA 1YE8A 4D6PA 3OHMA 4US1R 1T5IA 4DLUA 1XWIA 4YC7A 4WZ6A 4AKIA 2MSCB 1N25A 3I4LA 1Z2AA 4P4SA 3R7WA 4XD7A 5DYGA 3AP2A 4TT3D 4EJSA 1KDOA 1TEXA 4Q9HA 3ZGXA 2F3TA 3TUZC 2PZGA 3GCGA 4TQ9A 3SJZA 4U5XA 3Q7PA 2VPPA 2YC2C 2J7PD 2X77A 3ICEA 4FMCB 3BB1A 3GJ5A 3VR5A 4C0BA 2GAAA 3IUYA 2OBNA 3T34A 2KE5A 5GADl 4M1KA 4LUCA 4LV6A 1U8ZA 1TTTA 2P65A 3S1AA 5IT5A 2FEMA 1S8FA 2IA5A 2REXB 2UKDA 3OZXA 4LYAA 4A36A 2GHIA 1GL6A 4C3ZA 2G3YA 2QTHA 1I4TD 4MH0R 1KK0A 1XMVA 4AYWA 2BVNA 4BFVA 3EW9A 5FTMA 1F48A 1Z0FA 1AKYA 3EZ6A 1XEFA 3P26A 4HB3A 4JIMA 5AJVB 4BWYA 1WE2A 4C0SA 2Y8EA 1XBTA 3L0IB 2JJ8A 1GP2A 3JVVA 1JEEA 1M2OB 8OHMA 4CGZA 2JLVA 1W2HA 3A4MA 3A1UA 1E2JA 3IBYA 3W34A 3BK7A 2RAPA 2QPTA 2XTZA 3AVVA 2Z5FA 1JPNA 5EUMA 1EFRA 4JLKA 2CJWB 1BOFA 4JYCA 5HCIA 3BH7A 1E9BA 4FW9A 1EFUA 2ASEA 5CDFE 1SKQA 2A5DA 4X8HA 4MDFA 2RGNA 3B13B 1D2NA 4D2IA 3NEYA 1NIJA 3I1FA 4L5BA 1Q3HA 1ZJ6A 5KSOA 1LF5A 1YR7A 1N6OA 2V8OA 1TPZA 1XD2B 4OHVA 3QG5A 1Q44A 4IOJA 2GCPA 3CM0A 4LHYA 5FL7D 3OAAA 3U4QA 2IYWA 2FPMA 4FCTA 5E4FA 3TIFA 4QNMA 2Q0HA 4B6EA 4IJMA 3K09A 3D31A 5EP3A 1FZQA 3ZS8A 1G291 2ZE8A 1GILA 3U44A 2A5YB 1J8MF 2XX3A 4JLBA 2OAP1 2Q3HA 1KOFA 5FBVB 2OFOA 3AEZA 4A2WA 2BMFA 1E96A 4CVNA 1YR9A 2RB4A 2ZUBA 1ZC3A 1UBCA 5IK2A 1NSFA 4XWAA 3REGA 1DPFA 2W2TA 1E32A 1OFUX 3DEFA 4HLDA 4KVGA 2IXFA 4BLRA 1DG3A 3P1JA 5M04A 1E9CA 4DSTA 1IXZA 1F5NA 1GOTA 3I3SR 3LQRA 4OHYA 3BE4A 1ZINA 5SZHB 3HP1A 1SKYE 2HXSA 2QT1A 1KZ7B 5AJZA 3O8CA 4M8NE 1JB1A 4ESVA 4FWTA 2WV9A 3LVRE 3NIBA 2CMKA 1UBFA 4CT5A 4QNRA 3FHTA 5DLQC 3W3AA 4BASA 3FHOA 5CYOA 3C8UA 2HT6A 1XMIA 4PAQA 2RKOA 2CHGA 4IXNA 5FUWA 2F7SA 4ZI3A 1E3MA 4V0MA 2VIIA 3QY0A 4FMDB 2DY1A 4YMVA 1WQ1R 1KSHA 5JJKA 3VR6A 1N3BA 3KB2A 1PJRA 3MSXA 4V03A 2UVQA 4JS0A 3TRFA 2YKGA 4DLWA 2ODNA 2WWGA 2NO9A 4EJSC 3RS5A 2RGBA 2IYSA 4WXRA 1BMFD 4CIDA 3HPQA 3K70C 4R98A 3KL4A 4DJTA 4YMWA 2WAXA 5AJYA 1ZNYA 4G5RA 4HUQB 4ESHA 1TQ2A 4B3XA 3FGNA 1EK0A 3QOFA 3CNOA 5HPYB 1PLKA 2GJKA 4LBVA 1IJEA 1JR3A 3H84A 3NKVA 2ZJYA 2PLRA 5L3VA 2C9YA 1D5CA 3L43A 3PITA 4W5JA 1U0HC 1M1YE 1SXJD 3H4MA 5L3QA 3N2EA 2QP3A 3CW2A 2EQBA 3I72A 1TQ4A 4DUGD 4F92B 1XEXA 4JLVA 1NKSA 2Q9AA 3GLHB 4A82A 1CBUA 2VBCA 3AVUA 2RGNC 4EDHA 3VHLB 3DVLA 4IVQA 1I4DD 2ANBA 3TQFA 1E2GA 1DAIA 2KWIA 1US8A 4TL8A 2WWIA 1N6NA 1FFHA 4OI1A 1ONBA 1UFQA 3A1TA 2GAOA 2WHXA 3QKSA 3THWA 1TX4B 5FFMA 4J0QA 4TL9A 3RABA 3U7HB 2AK3A 1NF3A 3FWYA 2V1UA 2W2VA 1Z3IX 5JECA 1OXVA 4AKEA 3L2OB 2QP9X 3EZFA 4DLSA 4QM7A 1QBKC 2IYZA 2GBLC 4ZIRB 4HB2A 3K09C 3U7FB 2FFAA 1BS1A 2Z4RA 4LC0A 3TSWA 3TBKA 3CWQA 1HE8B 2VLIA 3TW4A 3NHAA 1IONA 3MFYA 4TMWA 1XEWX 1E98A 4O25A 4UNQA 1OIVA 3QBVA 4JBXA 821PA 1KZGB 2IYQA 3U3RA 4NZYA 4B3BA 1M6NA 3U6BA 3Q72A 2IYVA 2IYUA 3IBGA 2FV8A 5FTJA 1JQJC 1O3YA 2EYQA 3BH0A 3CRRA 3VKWA 1X1RA 2PT5A 3CPEA 2GZHA 3K0CA 4EFNA 4BRUA 3ZD7A 1E2EA 3LY5A 4POAA 4BLQA 4PSKA 4RJLA 3K1JA 1E2MA 4M0LA 1ZM3A 1NVXQ 1IXSB 2EW1A 1N6IA 3CO5A 3SQWA 2V7QD 4M2LA 3U60B 1GVNB 1SULA 1KSFX 2GDJA 3VFDA 3X1XA 1E1RA 4JVMA 3FTQA 1HQYE 2FSIA 4RZUA 2ANCA 3BBPA 4HLUA 2QU8A 1VHLA 1VYTA 5FUXA 4YMTA 3K9LA 2J7KA 2ZYTX 3CRW1 3B7GA 3K0AA 2PLFA 4TSFD 1GKIA 1OYYA 3MCAA 4TT3A 5HZHA 3CR8A 1QG4A 3VNUA 3ZS9A 2P67A 3IQXA 4A9AA 1G5PA 3QG1A 1Z29A 3I61A 3AVTA 4F4IA 1AZTA 1J90A 4LGMA 2FFHA 2BBSA 2ZJ5A 1Q1EA 2FEOA 2GESA 2DWQA 2ZANA 1VTKA 2XITA 1SHKA 2IUSA 2QP4A 2BM1A 2QGZA 1MABA 1MRNA 2F1JA 4MGIR 2NPFA 2AD5A 3UWKA 621PA 5F3WB 4B43A 3EASA 2JLRA 4NCIA 3FHCB 1HA3A 2OEPA 1D8TA 2A5JA 2EFCB 1QF9A 2GEVA 1ZRHA 2PZFA 2ZE6A 1KO7A 2VEDA 1QHSA 5EP4A 2WJGA 5G53C 3LO5A 2C8VA 4B71A 2V54A 3EPLA 3ADKA 4Q5IA 1DAFA 3RVBA 1SXJB 2A30A 4M53A 3C5HA 2VH5R 4RD2A 1ZNZA 3MGCA 4XH9B 1QHHA 2JAQA 4P32A 2VTKA 2FWRA 4QHYA 3SJBA 1QHNA 3OIYA 3TAHA 2RMKA 2C04A 2K5UA 2QAGA 4Q1DA 5D3MB 1VCNA 2J45A 2BKUA 2FSHA 1Z0AA 2CCJA 4PC6A 5EE0A 3I32A 2FPKA 4B3FX 4JL6A 5GVSA 2W00A 1E2NA 2C95A 3PR1A 4Q4AB 3HU1A 2OXCA 4EPRA 4TMXA 4GOXA 2IL1A 5FL7A 1OH8A 1XTJA 2RHDA 2FDCA 4QHTA 1NRJB 1U0JA 2VA8A 4C0QC 3A36A 4PQRA 2ZRGA 3AP3A 1Z0IA 3T5DA 1F2UB 3ZZ0A 2ZU6A 4AG6A 4DLYA 1YZKA 5JFGA 4C7OB 5TV2A 1H8HA 1MH1A 4NE2A 3ASYA 4EFMA 4I81A 1OPXA 3SN6A 5EXSA 1CEEA 3W8NA 4BEJA 4LCBA 2ONKA 1G8PA 3AF4A 3QKRB 4A15A 3FVQA 3PCRB 2VHJA 4Q1CA 5HTKA 1II0A 1Z22A 3JVUA 1ZD8A 3GLGA 1RYFA 4X8MA 2VHCA 2ZAOA 3BFVA 2V1XA 4TYNA 3GLHE 5B57C 3A37A 1GITA 3RRNA 1L2TA 4AKHA 2FMXA 1QHXA 2PJZA 4PPGA 1NBME 1Z07A 2JIZD 1R7RA 4HZUA 2OCBA 3K8YA 5JRJA 4GL2A 2VYFA 1KI3A 4Q4LA 1H65A 1GWNA 1S9DA 5TXGA 3K0CC 1HEIA 3EC1A 2GCNA 2LWIA 2D7DA 3EZ9A 3MWKA 4HYYA 3U7GA 1OFHA 3DDCA 1N6HA 2ZRLA 6Q21A 3IO5A 2JLZA 4GZLA 3KXLA 2ZI7A 4A2QA 3HYTA 1E79D 1ZUHA 1E4VA 5C1BA 4JLMA 2O8EA 4V0NA 1YZQA 5J5CA 3ZQJA 3B9QA 4D0GA 3I92A 3RYTC 4MKFA 1W4RA 1QHYA 3WMEA 3EPHA 2WSSD 4PTLA 5CM8B 3W5IA 4O2RA 3THOA 4F4JA 4PSVA 3RAPR 3IEUA 1JEDA 2D3WA 4NHOA 4BE7B 2WJVA 1BMFA 1C9KA 5EP1A 2W58A 4O3MA 3R9WA 3QPVA 2RGCA 3HJNA 3UMSA 3MLEA 1FMJA 3SYLA 1Z0JA 3TMKA 5H8WA 4CEIB 4GMXA 4GMDA 5KSPA 3RLFA 4Q9LA 4B76A 4G1UC 5FR2A 5KYKA 3VX4A 5DNYB 1E2DA 3QKTA 4Q7LA 4M1WA 2F43A 3W6PA 2G88A 1NG1A 4GSYA 1T3HA 1EFRD 1KKMA 2VP2A 1E9AA 3B60A 3E70C 1LW7A 3LXRA 2JLWA 1YR8A 2HJVA 3AKDA 1KJWA 3L8ZA 3DKVA 2JCSA 3PEVA 5K8LA 4DUGA 3NG1A 5F9HA 4IDHA 2ORIA 3VNVA 4DLXA 4CZ2A 1R0WA 4Z51A 1Z6AA 4G0NA 2CVHA 1VYVA 4US2R 4TZ6A 2FN4A 1FX0A 2ZTSA 4NBSA 2FSGA 1XXHA 2YWFA 1LFDB 2HJGA 2FFBA 4HEJA 4YONB 5GVRA 4CF7A 3THXA 4TZ0A 3TLXA 1ZAKA 3OAAD 5L3SB 1PLJA 4LI0A 3THYA 3ADDA 3TE6A 1Z28A 2ZRJA 3BORA 4TMVA 3SDZA 3TSZA 1RRGA 1P9WA 4WAUA 1JR6A 1E9EA 2VHQA 1IJFA 1E2QA 4WW0A 1IAQA 1WXQA 3MWYW 3W9YA 3GJ7A 1CJKC 3AQ4A 4QXAA 1NN0A 2RGDA 5F9FA 1TQDA 4FCWA 1HH4A 1W47A 4NCNA 3SFVA 4ZPXA 5CIQA 1YRAA 1OT3A 5KUTA 3UMFA 5CB8A 2V3CC 5FOXA 5IK2D 5KO2A 5EZ5A 1SXJE 1DG1G 3SE0A 2ZRMA 4FI3C 4B44A 2EFHB 1IQPA 2B92A 2ZRCA 2C9OA 3FKSA 3VTKA 1OXXK 5EE9A 1CR2A 3WMFA 4BFYA 2VP6A 4LX0A 1XD9A 2QMEA 4GPTA 1FUUA 4IDNA 5FPHA 2YYZA 4MKHA 4QJ5A 2I1QA 4S2EA 1TUEA 1GNRA 2GJAA 4JLOA 1VPLA 3OEHA 4Q1FA 1R6BX 4LC1A 5C46F 4DT1A 3M1IA 4RD3A 3KFXA 4Q18A 4XWOA 5K8TA 2QZ4A 2AHOA 1OFTA 1FP7A 1XRJA 3ZYCA 3BIFA 4AY2A 3AVYA 4URYR 4KYIB 2HCBA 2XZLA 5FOTA 3KKQA 4QFMA 4AYTA 4YDHB 3R7WB 4ZO4A 4FCVA 2IF0A 1TL7C 4EJSB 4LPSA 3QEJA 4K8OA 2NO1A 4M1TA 4UXHA 2IS6A 4HAWA 2H18A 5AUQA 3TVDA 4KODA 4W9MC 4NYJR 3P20A 2BIFA 4TSFA 1S96A 3K70B 4Q4HA 4MGYR 5K8UA 2BCJQ 3PIRA 4NONA 4Q7KA 3ETLA 3VAAA 3BH6A 3K0EA 4URWR 3DM5A 3A6PC 3MMPA 3S1AB 4HDOB 1HV8A 4P3YA 2ZQ5A 3T12A 3LA6A 4D80A 3CPHA 3GJ8A 3CF2A 1GUAA 1W48A 1HQCA 2GZDA 1MRSA 4HAYA 3L82B 1JR3D 1XCGB 2EFDB 2GZAA 2JLSA 2H5EA 3DKPA 1AM4D 4TLAA 3WP1B 3QSYA 2D74A 1OHHD 2IS2A 3AF3A 4QBGB 3GMTA 4KAXA 2JLQA 5B58C 1W44A 3K9HA 1T5LA 5TB5A 2ECKA 5AK0A 4DEXA 4NYJQ 1DAEA 2EWVA 4BPBA 3CPJB 1A4RA 4RFSA 3NDPA 4V0LA 3FDIA 2O0JA 3UKDA 2FZ4A 1HE1C 2XTNA 2IYRA 1W4CA 3ZLJA 3CZQA 1TU4A 4BECA 5SZIA 1WA5A 1AQUA 4QHSA 1GSIA 1SHZA 3PV0A 3U4QB 1CRPA 1P3JA 4GP7A 1JECA 3VKGA 3LXXA 1EFHA 4LBWA 5BN3A 3CUEF 3NH6A 3U44B 3EZ7A 1OW3B 4DZZA 5DI3A 2WZQA 1XJ0A 1T6NA 3EIEA 3NC0C 1IN5A 1BH2A 2I1VB 2H1LA 2NTYC 1SGWA 4TYQA 1JXOA 3SEAA 1GTVA 2F9LA 5CB6A 2IS4A 5BW8A 5JLJA 1FQKA 2G6BA 3SNHA 4QBFA 2RCNA 4TQAA 3WNCA 4D4KA 4F91B 1UBGA 1G9XA 2W6ID 2WWWA 2UZIR 2R2AA 3KJGA 2QMHA 4C9BA 1XMSA 4IOLA 2R6FA 2Z6VA 5JI3E 2JIZA 2QT0A 3L8YA 2AL7A 3LQQA 4X8LA 1P61B 4W5WA 3KJIA 5IDVA 4DSUA 1GRRA 4IFBA 1E1RD 2G83A 2GXSA 3T61A 3CRMA 3MUFA 4JVLA 1IOZA 4TYWA 3SC3A 1QZXA 4IVRA 4A1FA 1R2QA 3K53A 2ZRHA 2D2EA 1Q57A 4U02A 2MMCA 1G3QA 4D25A 1WP9A 1ZCBA 4JLDA 5FL3A 3WHKA 4LV5B 1E79A 4QG7A 4CEHA 1BIFA 4QRHA 4Z1MA 4PO8A 2D7CA 5G3ZA 3TVTA 1D9ZA 2J87A 2PL3A 4LHXA 5CITA 2ATVA 2WSSA 4QM6A 3PENA 1X3SA 4CW7A 3CRQA 2REBA 2JLXA 4P0TA 2ZITA 4LYFA 1DBSA 2DB3A 4BFXA 1D9XA 1T91A 3B1VA 4YQFA 4KSBA 5FUVA 4BLTA 2Z43A 1DELA 1XTQA 1Z83A 1Z06A 2XNSA 4IRUB 5CDFA 1XTSA 3BFXA 4Q1EA 4ASUA 2C96A 3ZIAA 3NC1C 1GKYA 5IF9A 1KK3A 5JJIA 3I62A 1JQLB 4U00A 4NDZA 5FTNA 1ZU4A 5GJVC 5L3QB 1VG9B 4HDCA 3I73A 5DO9A 1DTSA 3GLFA 4XOIA 4DC9A 1W1WA 4B2IA 1T3SA 1T3LA 1XEXB 1CU1A 2WWYA 3SU8A 4PO1A 4PR0A 4DCSA 5KPJA 2GEUA 4E03A 4C2TA 1S0UA 1PUIA 1SVKA 3LNCA 5JMTA 4UNSA 1EFTA 2EWWA 2QORA 4FN5A 1BKDR 1VDZA 4OHZA 2XJ9A 4DDWA 4B74A 3MAAC 3AUYA 1US8B 4HB4A 2IYTA 3QXJA 1ZM4A 3EA5A 4OL0A 3GEIA 3QKSB 3THWB 1N6LA 2BEKA 1VG1A 2RH5A 4DCNA 3EC2A 4EPVA 5JEDA 2AWNA 1KK1A 2GBLA 1G4AE 3FYHA 1H8HD 1YQTA 4D82A 3QJYA 3RS7A 1IM2A 1GFIA 4LOAA 2HUPA 5KDLA 3BRWD 4EPTA 4TMZA 1EG7A 4OQXA 5DHAA 2KSQA 5C18A 1N0VC 2QTVB 1HYQA 2C98A 4LHWA 5KTYA 5GJBA 1UEIA 2BEJA 1NMZA 1OFIA 3A1VA 4CT4B 5JSZA 2L0XA 4QGAA 1XEWY 5ELXA 3FPAA 4DVGA 2OG2A 2F9MA 1G5RA 2YJTD 2VF8A 3DZDA 1W7AA 1A5TA 2QQ0A 1Z0DA 4IOKA 4Q02A 2O8BA 1YZNA 1XPOA 2QPOA 3TNFA 2QA5A 1N5IA 1OB5A 1VYUA 1ZD9A 3MRSA 4IFEA 1UKZA 3Q5DA 4ZKDA 2R6GA 2QE7A 2IX3A 3OIWA 1F2TA 2GXUA 5FBWB 1G17A 4B3DA 3IIKA 1IN8A 3H1TA 1II8A 4DSNA 1Z6GA 1ZNWA 1G8FA 4PSAA 4ZKEA 2G0NA 3EX7C 3NBXX 1XCMA 4HAXA 2QEQA 3CRVA 4K81B 1D6JA 4RSGA 2OBMA 3F8TA 4A0GA 1UEJA 1FTNA 3K0AB 4A8JA 1RRPA 1A1VA 3C15C 2A5GA 1SVWA 2PEYA 4URXR 5JS8A 3KB1A 2ZRNA 1G16A 3GJ4A 4PPNA 1L7VC 4F4CA 1XTKA 1JXMA 2LKDA 2GA8A 1II9A 4JT4A 2X2EA 4Q9IA 2AKYA 3B5JA 4PPQA 2Z0MA 2DFLA 3KX2A 3AVOA 3CR7A 5EQTA 1DS6A 2AFIE 4C0JA 2ZUCA 3H2YA 1BYUA 1I4LD 1ZVQA 1MABB 5SZJA 3IPYA 5BN5A 1UM8A 4PHTA 4R2IA 2JJ2A 1NY5A 4QC2A 3O47A 2QRZA 1G8GA 2RHMA 4ITRC 3RHFA 2AX4A 4R9UC 1ZW6A 1KY3A 3IEVA 2F1IA 1OHHA 1XJCA 4UJ3A 1KDRA 1NIPA 3QKUA 4M1MA 4V0ME 3TAUA 2GJ9A 4BFWA 2WMNB 2RGGA 2BMEA 3QF4A 2AXNA 1P2SA 1WB9A 4GDFA 1VIAA 2GF0A 1RJ9A 4QGHA 5DN6D 1QHHB 2XTMA 2ZJZA 1Z63A 3TK1A 2QAGB 3QE0A 2ZI6A 4URZR 1T0HB 2QMUA 3X1YA 2NMVA 3AF2A 5FTLA 4IXMA 2ZJ8A 3NTUA 1WRBA 2OHFA 5CJ2A 2NQ2C 3KDSE 1U90A 1OXSC 3TW8B 4P31A 1G7CA 1R0ZA 1N0WA 1F3OA 2JDID 1RFLA 5E7JA 5TARA 4EPXA 3GJ3A 3TKLA 2VSXA 1KMHA 3KFVA 5KSYA 1XCPA 4ZDWA 3WHLA 1JR3E 2BOVA 2PCLA 3QQ5A 3UMRA 1Q1ZA 1JJ7A 4H1VA 5JBQA 3KKPA 1XP8A 2ZU0C 4R7ZA 2ZRFA 1W0KD 3HWSA 4TLCA 3B78A 2OCYC 2ZEJA 3ND8A 3FKSD 3GLGB 4DLRA 2GJSA 2V55B 2QQEA 5TDHA 4DCUA 3CH4B 5C4MA 1TQ6A 1W5TA 1UDXA 1EWQA 3ADBA 5J47A 3KKMA 1M74A 1UADA 3IQWA 2GJ8A 2W6IA 3K9GA 4Q1AA 2DWPA 2QI9C 2F55A 2H17A 3OEHD 4HZUB 4Q7JB 3DM9B 2ZI5A 3CBQA 2PCJA 5LPNA 1S3GA 1X1SA 5EXPA 3TR0A 3Q9LA 2E1RA 2C77A 4HAUA 4KLNA 1S1MA 1KJZA 4JLPA 2ZJ2A 1ELOA 4JBYA 3HYRA 3HDTA 5FPKA 5E7MA 2NZ8A 2G77B 1J99A 3CB4A 5JI2E 4CEJA 4EPYA 2O8EB 1KO5A 2OV2A 3KQUA 1Y3AA 1E9SA 1MR3F 3SHFA 1AGPA 3RC3A 4A8JC 3BXZA 5FBLB 1MO5A 1XB2A 3FB4A 1GDDA 4FIDA 1E2PA 3EG5A 4EAQA 4JLNA 2BKEA 1KI4A 1JAIA 2H16A 3VHXA 4A0HA 4E22A 2ZXUA 2N42A 3C14C 3SQXA 2NO0A 2A2ZA 1CS4C 5IRCD 5AWFC 4IEEA 3LFUA 3HU3A 1C1YA 2ZR9A 5J4YA 4B33A 5ANRB 4OQLA 1XPRA 4F93B 1Q3TA 3AF1A 1UJ2A 5DE3A 2J59A 4ACAA 2GK7A 1Q22A 5KNCA 4M1YA 2G1KA 3A58B 1YJ5A 1AS0A 2OUKA 3LLUA 4JVSB 1IXRC 1RRFA 2F43B 1Z6TA 2OBLA 1QVAA 2QN6A 2ZJOA 4XJXA 4XSGA 5EXXA 3EPKA 4B32A 2FE4A 2IK8A 1NN5A 5FI0B 4QGFA 3EA0A 1CRQA 2ZI3A 3L0SA 4CRWB 2O8DA 1NP6A 1OJLA 4LDJA 2XXAA 3G5UA 2C2HA 2YWEA 1TF2A 1ZIOA 2VSFA 3H0KA 1YZUA 3IIMA 4TMTA 1MO6A 4HAVA 1NJFA 4RCYA 3PG5A 2PJRA 2F6RA 1FX0B 4IEIA 4LJ6A 1M8PA 1XXHB 1W5SA 1Z6XA 1O87A 2AR7A 3MWLA 3THXB 4G5SA 1E1QA 3Q8XB 3UIEA 4URUR 3THYB 2F1HA 1OIXA 4D81A 4KV9A 3CKLA 3LBHA 2QBYA 2IYXA 3UG6A 1SVOA 2LCFA 1GRQA 1X86B 4M9XA 1CF4A 3C7KA 1W46A 1UBEA 3IO3A 2FZLA 3AVWA 4MRPA 4ACBA 4DSOA 3IILA 1R5OA 1G8YA 3IIJA 4KLZA 3W3ZB 5DIFA 1NBMA 1GL9B 4RD1A 1KI6A 2A9KA 4ERNA 3X2SA 4UNPA 5HE9A 1WF3A 721PA 4PZLA 2NO6A 1Z6YA 2J9RA 3EARA 3GQBA 4PX9A 4WVFA 3EWAA 2ZETA 4QL3A 5KDOA 1R0XA 3LDAA 2PMDA 5EXTA 3RWMB 3LLMA 5JCPA 4MYCA 2OM2A 4MUAA 1UKYA 4JT2A 2XSZD 3FFAA 1JJVA 2XB2A 1Z8FA 3OF5A 4DDTA 1XFAA 3ZH9B 3ZZTA 1YHNA 5LDDC 2GETA 4PC1A 4LBYA 4Q4JA 4QGGA 4KCGA 1EX7A 2P6NA 3NDBB 5DGXA 2NIPA 3L0PA 3ONWA 4DT1B 1KSJA 1DAKA 2AN9A 4KITB 1JPJA 1CR4A 3ZVMA 3PUVA 1MV5A 4IDQA 2CHQA 4KFUA 4D4JA 4U7DA 1QHGA 5FUYA 1VG8A 1AJEA 2CE2X 3AUXA 4Z1MD 3WY9A 1LVGA 4LBZA 4Z8XA 1XF9A 2WIAA 1W36D 1IN4A 3GLGE 1YRBA 2J46A 2VP4A 3JZAA 3KJHA 5P21A 4BUJA 3GJ0A 1NN1A 4RZ2A 1U94A 4Q9JA 2AXPA 4Q4HB 2J3EA 2F3RA 5LBIA 1VECA 1E2HA 1JI0A 4TL7A 1X8KA 1LV7A 1KI1A 3K0FA 4PANA 2Q6TA 2G1JA 5FOWA 4ZDIA 4NYMR 1P2TA 4M1SA 4MKGA 2KB0A 2R6CA 4UJ5A 1DAMA 4AC9A 2ZSDA 4ASUD 3U3MA 4HATA 3ZIAD 3FMPB 3RSOA 3D8BA 4BFTA 5FI1B 2ZR0A 3R8CA 4G5QA 3UANA 1CTQA 4PO9A 3H86A 4G01B 1RYHA 5B64A 3B8HA 3I5YA 1CIPA 2BBOA 5CK5A 1FOEB 3GLIA 3BGWA 3B6EA 4KFTA 1MT0A 2NGRA 2HYIC 1E2KA 2CCGA 3PUYA 3O8RA 4GRAA 4RKEA 5LB2A 1OKKD 2B21A 5DH9A 4M21A 4DLZA 4E5UA 3U2QA 1G1MA 4RFSB 4GFDA 1G64A 2VL7A 4MRSA 5DN6A 1E99A 1OH5A 1Q0UA 2R62A 5D3QA 2IXEA 2FSFA 4NYMQ 2ZSFA 2XOKA 3ADCA 2FU5C 4BQSA 4ILEA 2HDNB 4Q03A 2VF7A 3V00A 1PV4A 4DIEA 2QPAA 3OE7D 2DR3A 3LV8A 4MKIA 5JHGB 4MUBA 3P4XA 2JDIA 4RCZA 1YU9A 3P32A 4A2PA 1KO4A 2VP5A 2VQSA 4N1AA 2O0KA 5DI3B 5FR1A 3WBJA 2EYUA 4AWXA 2GF9A 3WBKA 3D3QA 1P72A 1KAOA 2OFXA 2ZE7A 2O8CA 4QJ3A 2B7CA 4PQYA 1W0KA 1S4QA 2JLYA 5JZVA 4DCVA 1GAJA 1KKLA 4LSGA 2ZUDA 1VKJA 4B6FA 2HF9A 3RRYA 3JZMA 4LY6A 1QHIA 3IGFA 1LTQA 1P5ZB 2W6JA 3K9NA 5BXQC 5A5GA 3PEWA 2X8AA 4C7OA 2JASA 2NG1A 2QE7D 3LVQE 4MYUA 2YOFA 3DO6A 2R65A 1DEKA 1CULC 1B23P 1G3RA 5J4HA 2Q21A 3AH8A 1KO8A 4QBHA 4WZAE 2JEOA 2VSOA 1E9FA 2BMJA 1EX6A 3RRMA 2QY9A 4BLPA 4BFSA 1KYIA 3ECCA 4RD4A 4DLVA 1E6CA 2C99A 2PMKA 4I1OA 4OK5A 2PX0A 3TUIC 4HAZA 3A4NA 4MYHA 3C4JA 2GILA 4B73A 1XNJA 4P4SB 2H92A 3QXXA 5EJEA 2NPIA 2YWGA 5DHFA 3KZ1E 2WJHA 4CEHB 5KPDA 4Q01A 1PZNA 2D4HA 2OILA 1NNEA 3IPXA 1J2JA 3OFND 1ZUIA 4Z8YA 3REFA 3WYFA 2ZVPX 2CE7A 4MYTA 2J0QA 3VKHA 2P3SA 2ZSBA 1DADA 3CX6A 3GD7A 1NN3A 2A3RA 2GNOA 4A6XA 1VHTA 4GI7A 2NOAA 2ZS7A 4PHHA 4MRRA 4URVR 2JJ2D 4M9QA 2OO7A 2WVJA 4I1VA 4ON9A 4KFSA 1R8QA 5C4GB 1AA9A 4TQUS 5EE1A 2YC4C 3T1VA 3CNLA 3SFZA 1E69A 4L4UA 1ZP6A 1P60A 4LJYA 4PHFA 1CJUC 4US0R 3BERA 3U6KA 2KBFA 2ZS8A 4OK6A 4UQOA 2BJWA 3VR3A 3GLFB 3KQKA 3ICQB 1JBKA 4V02A 1RKBA 2BDTA 2PX3A 1G8HA 3MG9A 2IWHA 4AK9A 3LX8A 4TYPA 2CNWA 1I2MA 2HLDA 2XGJA 3ZVNA 2EFEB 2CBZA 1FNMA 2QRNA 3IDQA 3N5CA 3O8DA 1ZCAA 3L0OA 3MD0A 4NCHA 3TGPA 2ODWA 3T1QA 2ZI4A 2YNMA 1EWRA 3RS3A 2J0VA 2JLUA 1J8YF 4JMPA 2WPDD 1ESMA 3AGQA 4D4LA 4YLGA 2BV3A 1IBRA 4MGKR 2IHBA 1WMSA 3U61B 1ZBDA 4KI0A 2ZVQX 2I4IA 1AZSC 2G0TA 1Z47A 4LV8B 3QF7A 3U5ZB 4D4MA 3OIUA 1M7GA 2DCUA 2J41A 2OESA 5CJPA 4C0LA 1KMQA 3MWJA 5JSZB 2PEZA 3C5CA 4DRZA 2PT7A 1UPTA 5EUQB 1E9DA 5CK4A 1ZM9A 1SVIA 1D2EA 2O8BB 4DHEA 4NTZA 4OQFA 2BC9A 2GXQA 1XZPA 3Q85A 2XSZA 1OE0A 2NO7A 4DLTA 4Q66C 4KO8A 4Q47A 2J1LA 2ZRDA 2MMGA 2HXYA 1F2TB 2O8FA 1G4UR 3GEEA 1G18A 1II8B 1GNQA 1Q12A 2IYYA 2W0MA 2ZI9A 2V9PA 4MGZR 3RANA 4Q21A 5CLLA 4FMBB 1SVSA 5E95A 4HB0A 3A8TA 3GP8A 3FKQA 3HPRA 4LJ4A 4A8JB 5TMPA 2ORVA 3CWZA 4KJZA 1AGRA 1CJVC 1TF7A 4UNNA 4F7WA 2X19A 3T5GA 4B3GA 1T8UA 3AB3A 4NYIR 1NLYA 4D26A 4JVNA 3A1SA 2QAJA 4KU4A 3BB3A 1M7HA 4OQMA 1BYIA 2WM9B 2CHVA 1JAHA 3QEOA 1D2MA 4TWZA 1EFCA 3B82A 5BQ5A 1EESA 1S2MA 1MO4A 1IN7A 1YR6A 3V4FA 2IT1A 4NCJA 3AM1A 3BJIC 1VCMA 4B35A 2A7QA 2CL6X 1XU4A 5IHPA 4ARZA 5F2EA 2ZRBA 1NMYA 3CF6R 5G40A 1NLFA 3I5XA 2RGXA 1QG2A 2BMDA 4LJ5A 3SHWA 2O52A 2KJQA 3PUZA 1DO0A 3ZVRA 3AP1A 3NWJA 2ZRPA 3EZ2A 4EQ6A 3R9XA 3ND9A 3FMFA 3UG7A 1OB2A 1G3IA 2QM7A 4M1OA 4NH0A 1RW4A 4PFSA 3I8XA 3AGPA 2MSDB 2H7VA 5HE8A 4NYIQ 2N46A 3QF4B 2XNDA 5AR1A 1E2IA 2AKAB 2TMKA 5H1YA 2FGKA 1OKKA 3ZZUA 4PZYA 1RJ9B 1P9RA 4R71A 1U8YA 3VU9A 2ZSAA 1OF1A 2AFHE 1XPUA 1A2BA 4F38A 1UF9A 5DISB 4PC3A 1S1CA 1E1QD 3LBNA 1P62B 3ZQ6A 4B75A 1LS6A 5HKKA 2ZS9A 4RZXA 3SBDA 3VR2A 3D6TB 4EUNA 221PA 1N5KA 1KTVA 2FOLA 2ONJA 4NPHA 2CK3D 3M0EA 2D2FA 1T0JB 2J0UA 1HUQA 2QGNA 3AKCA 1CKEA 2ZPTX 3OE7A 2QNRA 2ZJAA 1SQ5A 1KMHB 1NMXA 5J4VA 2OZEA 3EWSA 1KHTA 1NBMD 1W0JA 3U7EB 4ZCLA 4HDQB 2WTUA 1ETUA 4Q1BA 3FOZA 1P73A 2DFTA 2P2LA 3VR1A 1E4YA 3NHBA 4OHXA 2FPLA 4BLOA 2R6DA 2R44A 3Q5EA 1LY1A 3GLFE 1NG9A 4HZIA 4Z54A 3DMDA 4C0AC 5B2ZA 4TYYA 2UZ3A 4LPKA 4KBFA 1GM5A 3ASZA 1NVUQ 3B9PA 3SI7A 2VP0A 4LWZA 4YMUA 4OK3A 1MO3A 4MDEA 4XIGS 1VCOA 2IXGA 1HURA 3CH5A 1FTSA 3BD9A 1K5DA 3NH9A 1YZLA 2GVZC 4RD0A 1IN6A 5G41A 4LYJA 4XVUA 4ZCIA 4TN1A 1ZU5A 5JWRA 1ZNXA 2B6HA 2R6AA 4YDSA 1CP2A 2YZ2A 4LJAA 4O0MA 4LK2A 3RNLA 4JKIA 4N0DA 3MJRA 3TQCA 1R4AA 4JLJA 1G20E 1FUKA 1S3SA 2VHTA 2W83A 4GBMA 4XTCS 1M34E 1L4YA 3O8BA 1HT1E 4IOMA 4B3CA 1KI7A 4C4PA 2GCOA 4M22A 4B2PA 3B85A 5HZKA 2JJ1D 1RE0A 4O2LA 4GOKA 1KSGA 1KDTA 1COWD 4W7SA 1XTIA 2X1VA 3BOSA 3ZVLA 4EIWA 4IDPA 1V5WA 3HR8A 4CEJB 2V6IA 3DZ8A 5A4JA 1NVVR 2A78A 2RGEA 4JSYA 4L8GA 4AD8A 4ABYA 2FNAA 2IEYA 3RDPA 2IF2A 2QL6A 4N0EA 3KTAA 5EE3A 4JL5A 2ZRAA 2ZE5A 5J4KA 5KDDA 3OFNA 2HCJB 5F98A
chains in the Genus database with same CATH superfamily
3ZDBA 4G97A 5LZ9A 1W36C 1BDMA 1C8VB 1E94E 4RH0A 1J09A 1T0UA 4CM1A 1BO6A 4MQBA 3BJEA 3OT5A 1RMQA 4E5DA 1EFAA 3RRZA 5A0FA 4RE5A 4PC7A 2FMHA 1BWPA 2C5AA 2FEAA 2X2FA 2I71A 2BJVA 1V0JA 4P4LA 1WU7A 1SAYA 3RS2A 3RTDA 2XZPA 3IT0A 1PDVA 4BCCA 1OYWA 1PX2A 4YHBA 3U26A 1ISSA 1V5IA 1BW9A 2BFDB 2XCUA 3H3FA 4IG4A 4MQFB 1KEVA 1UBSB 4JUIA 4FHZA 521PA 2ID4A 2JS7A 2CB0A 3OTIA 4LG1A 1QKJA 3OIVA 2YHUA 1Q1BA 1ZA1A 4C6RA 4NKRA 4MA4A 4QVKA 1WSDA 1Q50A 5L9AA 1T0PA 3VKFA 4OXKA 3R09A 2DPGA 3TLBA 1XA0A 4F6RA 3PA6A 1V3VA 3OP4A 3PXEA 1SPBS 1EWYA 4R01A 5TEVA 1PFWA 2GTPA 2XXAB 4LJ9A 4D0LB 5I47A 4YP0A 1YFJA 3CLVA 4GM4A 5HRAA 1B74A 4KRFA 4BB0A 1GZSA 1P6XA 2Y2VA 2OYCA 1DFIA 1EEXB 3PFGA 4C4ZA 4KWHA 1P91A 2WICA 4BZZA 3AKYA 4FINA 2GCEA 3D6VA 3KLOA 1G59A 1C5KA 3MHTA 3ZDDA 4NZPA 1RABA 2C5GA 2CXQA 3ONFA 1U81A 2H08A 1CR1A 1Z82A 1VC2A 3WADA 3D43A 2G5PA 1QVRA 3DOEA 4EYSA 2GXAA 2QBYB 1IG0A 3DOFA 4NFYA 2RHJA 3TBHA 4LJ8A 1Q6ZA 2W4QA 1SUFA 3EXG1 1ORVA 2QE6A 1W75A 3JQCA 3K8QA 3ZWMA 3EPJA 4DKXA 1BJRE 3SR0A 4OJKA 5KKNB 3OLQA 3AUAA 1LA2A 4PG4A 1V4NA 1S2GA 4TTRA 4MR9A 3TIXB 1GTZA 3ZOKA 4D7AA 1VL6A 4KBGA 1D09A 4M0DA 3STUA 1RC0A 3FTCA 3SS8A 3HYSA 1HDEA 2H2FA 1EUDB 4M9UA 5FXMA 5KVQA 4EQZA 3QYAA 2Q62A 2ZREA 1VFNA 3P27A 4UW9A 2B3DA 3F9RA 2DQSA 3ZZNA 1Q14A 2EVWX 2HM7A 4TLDA 3DR5A 4JI7B 1KYZA 1O94C 1IMJA 4OBXA 2CNBA 1M33A 4RGQA 4X3PA 2Q46A 2WRZA 2BMWA 1KAMA 2FJPA 3MLBA 4L9SA 5KC8A 5C53B 4N7BA 2FQQA 4WJZA 5EQFA 2B1RA 3UJDA 2IYAA 1QO9A 3FZNA 1EFKA 3GA5A 4LXQA 3ZD6A 4GOJA 1XLWA 4Q4JB 3NGMA 1NRXA 1EZ4A 3BUSA 4Y1EA 3NYWA 1GDHA 5T57A 1S7CA 4HLNA 4UDXX 1NHWA 1TD9A 2FKNA 1O6ZA 3PF8A 3KKEA 3RQIA 4RTQA 4ZDJA 5BNTA 3NALA 2AD1A 1JALA 3OEEA 3DZHA 3JAKA 1O5IA 4R84A 2EP5A 3DPUA 3O7MA 4IJWA 5KAPA 5ECWA 3UCEA 3ZY4A 4F9TA 5FLYA 1NJ2A 3PJRA 1HTWA 4FZRA 3WIUA 2YJ4A 3QU4A 3WHIA 2NV2B 4KXLA 5MGNA 2VDMB 2QW8A 3IPCA 4ZT6A 4J0IA 2OHVA 3MT8A 1IJKA 3I09A 3BIJA 1MB0A 2B8JA 1DARA 2LDXA 4GOND 4KXWA 4XX1A 3WDKA 2NUPB 5K2MA 1ISMA 4LHVA 5G1PA 3VZRA 2P9EA 4IO1A 2O4UX 5AVSA 1Z4QA 2Z8YM 3A6JA 2GJ4A 4YTEA 4J2HA 2PUBA 2VG8A 4XR9A 3DE3X 4BKRA 1B0ZA 1QC5B 1R3DA 5ELLA 2RHTA 2IEDA 5KOHA 3CX8A 1E0AA 1QRAA 5AH0A 4NS4A 1PNVA 3PHCA 4QTZA 2AX3A 3JPWA 2W0SA 4QYIA 3AEKA 1RIFA 4C30A 2CVFA 2ROQA 3RC8A 1RXCA 2DTDA 5EIXA 4NBNA 1PJSA 1TADA 2BL4A 2ETVA 2VSYA 2ZROA 3LUGA 3NVAA 5D87A 3D7RA 3A1NA 1ZRNA 2AEEA 3KYBA 4KNVA 2Q3FA 1XEAA 4Y6LA 1HXHA 4NZ9A 2J6IA 2AA3A 2NVWA 4IIYA 2ZJBA 4BNDB 4DUZB 1R8SA 2C03A 1M8KA 3MRTA 4QDUA 1OC2A 2JA1A 5CTAA 1XZQA 2WT4A 2WWFA 1YFKA 4OM7A 1JWBB 4C2UA 3LAWA 5IC6A 2Z83A 1C7RA 3EIQA 3V8VA 1KP2A 1ZAYA 3I6YA 3UK0A 4BLSA 5H82A 3Q3IA 4P92A 2DPMA 3MCUA 4UDYX 1RKXA 5CH5A 1Y3FE 3CUYA 3EVZA 3FPKA 3H7AA 4GLBA 3G0HA 3QXSA 4LDPA 3ORHA 4BZWA 4OU4A 1ZPDA 1XDBA 3FTNA 4Y6OA 2C7VA 3PUXA 1R0YA 4YK7A 2GRJA 3GPBA 2FX3A 1AS2A 3DOUA 4QT0A 1U0TA 4TL6A 4ALLA 4DBLC 4N41A 1I1NA 4K3VA 3PWKA 1LFAA 1NW9B 2HA5A 4HL6A 4QSMA 4IZ6A 2CK3A 4FIZA 4HVLA 1V2HE 3M4YA 1HLPA 3ETCA 2FP4A 4KO3S 1VSVA 1MENA 4JYBA 4LFCB 5BSHA 2JIQA 3MINB 4IVNA 3Q7QA 4UCFA 3JALB 3KJEA 3SIPA 3MHPA 2ZXEA 3WZLA 4R2MA 5ADHA 2YHBA 3GZTB 2JRCA 5D01A 4CKEB 5IVHA 1JSCA 4WPGA 5HTOA 3EIFA 4BOYA 3U3KA 4P83A 4CL0A 2Q1XA 4E94A 2O8CB 3U16A 2LGJA 5TQJA 4Z9AA 2B7BA 1PFGA 1VLHA 3A4LA 3SYTA 3JRXA 1N6KA 2DHCA 2JH9A 3EDCA 4D8YA 5A9SA 2WB2A 1VG0B 1L8QA 5C3MA 5BORA 3RK4A 4ARUA 3NBZC 1O9BA 2AI2A 2BHLA 2Y71A 1K66A 1JN0A 4WZZA 3DEIA 4GKVA 1GZUA 1ZI6A 2WM8A 2X0FA 3U81A 2XQIA 2C5FA 4GICA 4HLCA 4N49A 4ZAYA 1I2DA 2OXTA 5C8VA 2HMSA 1E1YA 4HDNA 1PZFA 2C57A 4FDAA 1Z3CA 4G3XA 5HF6A 4BAZA 5EWJA 4B2LA 3EIXA 2G9NA 1UT8A 2PIAA 1UMCA 2DH6A 2QD2A 1NPTO 3BWDD 2W70A 4AULA 4D4HA 3SVZA 3W8FA 1NJGA 3G2KA 4NAUA 1LF0A 4KE8A 2PBZA 4QFBA 5H3LA 1V1MB 3PC8C 5AKJA 2HFJA 4G5GA 2XIJA 3I9KA 4TXHA 3ONDA 5BMVB 2XUKA 3UMMA 3PCTA 3BCSA 3T7RA 4J2TA 3DFUA 4BQPA 4OO3A 3G0BA 4YFYA 4ZICA 3KR0A 4J90A 4K3UA 3UGJA 1OH6A 2NUAB 5EIFA 2QLNA 3QW2A 4CM9D 5B5SA 4G0UA 3ZWBA 4ZYLA 3IT1A 3S8YA 2V0GA 3R5TA 4MUYA 1N8SA 4G26A 1CUBA 1E9RA 1NUUA 3P2OA 3H8SA 3KT0A 3P0JA 2GK6A 4WLEA 4EI8A 4DUYB 5K9ZA 1ES9A 3LUDA 2QDXA 5JBIA 2IUTA 3PXGA 3OLYA 1I13A 2P4QA 1U2DC 3BCHA 4HQFA 1CVRA 1V5GA 2AHRA 2X0DA 4L5JA 4LOIA 4RVSA 4OJQA 3ZCUA 2HSZA 4JLUA 3ROKA 4RY9A 1PFQA 1SZPA 2W4IA 3DAFA 3I6BA 4QOSA 4IMJB 3JQDA 4RHTA 4BYMA 3USZA 5JOQA 5KNBA 3ADOA 1XNRB 3UAOA 4BQEA 3B7WA 1C9DB 1NL3A 3PVSA 4FHGA 3NXSA 2MDTA 2NTJA 4MPPA 1KGDA 3KKOA 4IQ8A 1C1DB 4RTSA 2C3MA 1ZIYA 1J8FA 5AJXA 2G1PA 1E77A 3G5AA 2VXBA 2BWJA 3L01A 4CM8A 4ZCMA 1OFUA 3P9PA 3DAOA 4XSHA 5COBA 4MVJP 4XFDA 5JPIA 3S5JA 4II3A 2LE0A 2IEZA 3RSLA 3SICE 3KS9A 2ZW9A 3UJ6A 1HY3A 1VQ1A 1Z4MA 2NADA 4CIWA 5JVDF 4A26A 2WSMA 2VJNA 1ZFNA 2ZVJA 2NPOA 1L7OA 3LL7A 4KAJA 2IBMA 2OLJA 1A82A 2AUMA 2EL7A 5FOUA 4YRBA 3HXMA 3ASUA 1CSEE 4AVYA 4QPPA 2YHIA 5JW6A 3PHJA 4EG5A 4PXAA 4QATA 2FFQA 4PAOA 4PYMA 4RYLA 1OLOA 4Y0VA 2NYVA 2Q6VA 3LBIA 4I4LA 1N2ZA 2H59A 1FP4B 3HDJA 5FPYA 1SOAA 4M46A 3UWDA 1PGPA 1RADA 1W0JD 4WN9B 4BZXA 1OOEA 3MIIA 1QQAA 1EK1A 3OESA 1MPXA 1OWMA 1TLLA 4ZPJA 1Z5ZA 5JG7A 3KQSA 4NNPA 5D84A 4B3IA 2QRQA 3CEMA 4WA8A 5D3MA 1JR4A 3GLIE 3E9QA 1O94D 2FW6A 3LFHA 3LRPA 2CL7X 1QOPB 2R1ZA 4NU8X 2C78A 2Q0XA 4MGHA 1GL7A 1RIIA 2PTHA 2WP0A 2QTFA 3K1AB 2GZSA 1IK6A 4PRYA 2L19A 1UWVA 4G09A 1Z7EA 4MVJD 4KPFC 2VWQA 4B4OA 4I1UA 2QZSA 3KQHA 2GN4A 3AINA 3DTVB 1YB2A 4JUDX 1N6RA 5TS2A 3WGLA 421PA 1DGQA 5DWVA 4EPWA 3VMFA 2QYOA 3AYZB 2YQ5A 3ESQA 5BYBA 4BO8A 1XXHE 1ONNA 1QSGA 2REQA 1JA1A 1TUIA 5CM9C 5H80A 5AKKA 4BE9A 4UASA 4AXXA 1ECJA 3CF0A 3EDOA 5ARCA 3RS0A 3MBIA 4MA5A 3M3PA 5FFFA 1O77A 2ISSD 2VHWA 3BSWA 1T6ZA 2O8FB 2J9FB 1NJ6A 1CYEA 2D62A 5ABPA 3NDIA 4NL4H 4NP6A 4DAOA 2DQKA 2QTGA 1R0KA 4KAFA 2JK0A 2HC9A 2PKEA 1P7CA 4E2YA 1T1EA 2HJSA 3W5JA 3OY2A 5IJ9A 4X1IA 1C9YA 4MP6A 4KX3A 1J2EA 5E3HA 4TKVA 2VT3A 4TTVA 3TTTA 3LKBA 4JJFA 1RCFA 5FCDA 4DR5B 1DJPA 2DPXA 2FLVA 3CMCO 4DIFA 2AZMA 3K7EA 3M6AA 1J0AA 1F20A 1UFOA 1OREA 1TYBE 3OHPA 3WGQA 3N53A 3MS7A 3FF1A 5CFNA 2HYDA 2IKSA 5FBWB 3RODA 3W3AD 2ZRIA 1KEEB 4ZC8A 3H18A 3H1EA 4Z4FA 4ZV4A 2V5AA 1A7JA 1ZSVA 2PWYA 4HMOA 1IE3A 1ZX1A 5FWYB 5J2TA 3N86A 1XJQA 4ZJYA 5JEEA 3S1SA 3MCTA 3U39A 1YDEA 3T0IA 1M2VB 3SG0A 4YDRA 3GRAA 1Z45A 2PKCA 4KW7A 2L18A 4TKZA 3OQMA 3D02A 5LB4A 3HY4A 4Y6QA 1QYCA 5JISA 4ARZB 2D1RA 3EFOB 1RP1A 5EVCA 2BSAA 3KOXA 1TJYA 1YQXA 2A4MA 2C82A 2I78A 3QBDA 5COQA 3AZPA 2F64A 1FUYB 2A59A 4TLLB 3CPSA 1R50A 6REQB 3MWFA 3P94A 3K96A 2C7QA 2ZYVX 1NFRA 4DY6A 3RVJA 2QVBA 5DSZA 1JQ5A 2C9MA 5EA2A 1P19A 1P1KA 2NSYA 1BKYA 4QPJC 5NLLA 4UNRA 3H8JA 4H9GA 5AVKA 5J40A 5EL0A 2H52A 2INGX 5KHAA 3IHWA 1I7SB 4DLPA 4Q3EA 1L5VA 1D4FA 1XMJA 2CLSA 3R9IA 5BQPA 2OBBA 1Y4SA 5IKXA 3REQB 4D6YA 4F4HA 3VPAA 3HSYA 1ICIA 1H4VB 2VDLB 4IP0A 3PC4A 2OLKA 2DEUA 2NZJA 3GLRA 1P9OA 2HMTA 3GCWA 4WOPA 4IYRA 1I4WA 2IXAA 2QMYA 3BMNB 4BQIA 4F0JA 2UYHA 2WYUA 4S3MA 4U6NA 4MUEA 3TQQA 3E22B 3TR5A 1D4AA 2XZOA 4IUCS 1NOJA 2P2SA 3NAZA 1BE8A 4RESA 2QRVA 4F3CA 5DTMA 3H17A 4FBLA 1XD8A 5CVCA 3K35A 4J0JA 1E2FA 4OLFA 2FSSA 4DWJA 1BVYF 1KI2A 4RPKA 5JS7A 3F74A 3LX5A 4OU5A 1V1RA 1GR1A 5AK5A 3D3WA 1LBTA 4EYQA 4PNHA 5G4KB 4AO7A 1NNI1 3PVZA 2O5VA 1DKRA 2PMCA 4MNTA 1SKYB 5E7IA 4N47A 1DCFA 4UOEA 5F7OA 1E0SA 2K4MA 4MITA 2HPZA 3BS4A 4CHGA 4ZMBA 5LMUB 2XA2A 4M9ZA 1HT2E 3S2FA 1TAGA 2R1TB 2F2TA 5L4NA 3QPUA 5AI8A 5BSRA 2VRBA 4TMKA 2PXHA 1YOBA 2CMHA 5FOSA 2QSZA 3V4PB 4ALNA 3W4KA 5BMOA 5FBQB 3THXA 5IAAA 4DEYA 5K0CA 1QJCA 5HCUA 4G0OA 5F12A 1PK7A 1PE0A 4BVHA 1VBKA 1AK2A 4DB4A 5CIWA 4BQNA 1WDMA 3F3YA 4KXMA 4YB8A 3X1ZA 4QGBA 3E1SA 3QIAA 4Y9SA 5GTDA 1LX7A 3EGDA 1N2GA 1VL8A 1UWKA 3EVBA 3OMWA 1VBMA 3T4EA 3OQPA 4RY2A 4IFTA 2EF0A 2UUOA 4RVHA 4BJ1A 3ZXXA 1D8AA 5TPZD 1WBDA 2ECFA 3A9CA 3L84A 5FPSA 3KKNA 2R6JA 2IPMA 2RKWA 2X0JA 2JA2A 1V8ZA 3JQPA 3QI2A 4HQNA 2FX5A 1S8AA 2HLNA 1H8ED 3T8YA 3K0SA 4JEHA 4BQRA 1CS0B 2JARA 2QD3A 3C41J 1W49A 121PA 4B47A 1LPPA 3RAFC 2WLSA 5KOJB 1BX3A 4D8TA 2VPIA 1Z0SA 3QP9A 4N0MA 3KTAB 4MRVA 1CK4A 1ULTA 4H7IA 1P9NA 1G5FA 3VV2A 3ILXA 1YE8A 3OHMA 1B93A 1T25A 4ZV9A 3I58A 5IT9A 4ZYUA 1IQ0A 4US1R 4XFKA 2O20A 5G0VA 1T5IA 2OY0A 3CSDA 2PZAA 5I7AA 4AKIA 3R5HA 1Z2AA 3J81A 2WF8A 4R16A 2GN0A 2XVZA 1NUTA 5DYGA 3R7WA 4EJSA 4LCJA 4LTNA 2AQKA 2PY6A 2MYUA 2QS9A 5KKAA 4FC7A 1WEHA 2X76A 2WHPA 2W6OA 3C6YA 5KI6A 4K6KA 3SJZA 1F0NA 2PS0A 4C0WA 2ZJ1A 2C2YA 1YA4A 5AW3A 3ICEA 3FWKA 3F7MA 2IGBA 4C05A 2GAAA 4D8WA 4G36A 2KE5A 3CHYA 3NM4A 4YGYA 1KA9H 4LUCA 4LV6A 5HJEA 3ZJVA 1H2WA 3U31A 3S1AA 5CCXA 5IT5A 2YFKA 2IA5A 1NW5A 2REXB 2V3WA 3DDWA 4V2IA 3S2ZA 3ZCRA 4F6RB 2IVFA 2CSXA 1T6BY 3MT0A 2OZLA 1QRSA 1GNLA 2G3YA 2R6HA 1UC8A 1KK0A 4HXFB 1Q0TA 3IYLW 1DT5A 2HW8A 3EW9A 1ZJYA 3KUKA 5FTMA 1Z0FA 4Q3LA 5AJVB 1IATA 4C0SA 5BNIA 3RAJA 2HPHA 1U31A 3L0IB 2JJ8A 3JVVA 1SELA 1B42A 2VT2A 3TQRA 2EZ4A 4CDNA 4F45A 3VNQA 4DR6B 3W34A 1N9KA 2PJDA 2VJAA 2XTZA 3BK7A 3F3KA 4BNFA 3DLHA 5CLIA 4GYYA 1YJXA 5EINA 1W6UA 4ZCQA 2D2IA 5FF9A 4JYCA 5HCIA 2EGUA 3IVAA 2ASEA 5DXJA 3RVPA 5CDFE 2A5DA 2PD4A 3VU3A 3PRKE 4MDFA 2VYVD 1DFHA 1JYSA 3B13B 1O0SA 3NEYA 5EWMA 3OCYA 3I1FA 3QV1A 1ZJ6A 2XF2A 4EW3A 5LQMA 2WJ6A 2RI0A 1LF5A 4MR9B 2V8OA 3WGYA 4ZWNA 3WAJA 2NM0A 2NXWA 1PNRA 3ASVA 2ZWIA 1NC3A 1UZAA 1QAOA 4I5EA 4W7IA 3FYUC 1BKSB 1O94A 2GCPA 5DLPA 2YFHA 4WCFC 5LIRA 3U4QA 4LF4B 2CXTA 1ZDMA 4LXTA 2FPMA 4DARA 4D9GA 3ZQUA 3FXAA 1U3GA 4U0JA 3ZWYA 3MTQA 4EJFA 4MVJA 3K09A 3OQBA 4NRDA 3W5UA 4RPIA 5EP3A 5IKMA 3KSBC 1FZQA 4BO5A 3RQSA 2ZE8A 5CXQA 2A5YB 3QYPA 4DRXA 1J8MF 2HJWA 2QX9A 4JLBA 3WISA 2ARKA 5IH3A 1ZCFA 2Q3HA 3NR2A 1KOFA 3O82A 3V8MA 5FBVB 1TA9A 2CNKA 1NBAA 4GQIA 1JVBA 1E96A 4HWGA 4CVNA 5JROA 3Q6MA 1YR9A 1JL3A 1TCVA 2D00A 3MK31 3S27A 1JIUA 3DXYA 1ISGA 1VSTA 2B30A 2I65A 1ZC3A 2ZUBA 4PXSA 3ZLTA 1L5NA 5JAIA 2VQEB 4Z1OA 3F6EX 1LPAB 4P3KA 4XWAA 5DYNA 2E4AA 2W2TA 3JAKB 4KVGA 1NOIA 1TRKA 1Y34E 4BLRA 1DG3A 1H9AA 4R2KA 5DK6A 2QLJA 1IXZA 3LHFA 1GOTA 2Y1GA 4X7RA 3BE4A 3HB5X 4GMFA 1XQ9A 3WRYC 3HP1A 1UMDA 2HXSA 4HVCA 5AKIA 3Q5GA 1OBVA 2P6PA 2P2CA 2DWCA 5P8WA 2HL6A 4MICA 3A6KA 3TDKA 3O8CA 3LVRE 1SMKA 3B3QA 5MF6A 4FWTA 1P7VA 2CMKA 1UBFA 4CT5A 3CUWA 3FHTA 3U4AA 1XNHA 3W3AA 3Q40A 4OH7A 4DEVA 3O91A 4REOA 5DIZA 5KSWB 4E4TA 5CYOA 2Z2YA 2HT6A 2R47A 1Y7HA 1SIOA 1GPKA 2FN7A 2CNNA 2Q3DA 2C92A 2PH7A 3FOCA 2F7SA 3QXGA 1JA9A 3EQ8A 4I8IA 4Y2RA 5KOHB 4J0FA 4V0MA 3QY0A 2UVDA 2X8BA 2ADMA 1KSHA 2PAAA 3VZCA 4JNCA 1KWGA 3KB2A 4QYIB 4YLEA 1PJRA 4V03A 2UVQA 1QO0D 3AEKB 3M8KA 4JS0A 5AM5A 5HQ3A 4DLWA 2ZT5A 3NM5A 2WZCA 5FHRA 4C88A 1ZGBA 1IB6A 4M8LA 2JCGA 3RS5A 2PWBA 2RGBA 3RU9A 1TTQB 2DUMA 1CEQA 3L6CA 5IASA 5ELMA 4CIDA 1URPA 1K0FA 4LF6B 1ZI9A 1Z15A 3KSUA 1A9YA 3BMOA 3IVRA 4B3XA 2WF5A 1WTAA 3RK0A 2ISCA 4X6YA 3A6LA 1AG9A 3WS7A 1EK0A 3H1AA 2OZKA 1EH5A 4GM1A 2ABWA 5HPYB 3F1KA 4IPTA 3WDSA 4ZEMA 3M4JA 4QSHA 4AF8A 5LP6F 1UDRA 3QEBZ 2PLRA 2C9YA 1D5CA 1FYWA 5AKGA 1E61A 3W7VA 4EKNB 2DECA 1PS9A 2Q45A 2PA0A 3BDAA 3H4MA 4FKBA 2M6LA 3QRWA 3I72A 3Q1LA 4PLGA 2L2QA 4GQAA 2ONCA 2H1SA 4JLVA 1VJDA 1LU9A 3GGOA 1AXRA 2JFXA 3QU9A 3D6HA 4HBZA 4WLUA 4GC5A 4WKGA 5CGQB 5T7BA 4AQYB 1E7SA 2FP4B 4FDMA 4CV2A 3QVKA 4R3UC 1I3NA 1L5WA 2RGNC 4MTLA 3DVLA 4DXDA 1PWEA 3OZFA 1TVCA 2ANBA 3QEKA 2EX4A 4W63A 1K7CA 2NTNA 4HUJA 4BO4A 2A86A 2WWIA 4OI1A 4XDZA 1PGQA 3THWA 3LX6A 5J58A 2LD4A 2ZFUA 2I99A 2XT6A 4BGIA 1E58A 2QK4A 4BP1A 5FBKA 2IV7A 4CLXA 2DJ5A 2V1UA 1I4EB 2AUTA 2QRJA 2P2DA 2ES4A 3R3HA 1H3FA 1C0PA 1ISPA 3UK7A 1SBTA 3PHBE 4EGQA 1UKCA 2VDQB 3BK1A 3ID6C 2YVQA 3IDOA 4JYPA 4EI7A 4XEUA 4PGGA 3ESDA 2GBLC 5BO5A 4HB2A 5C81A 3HRIA 4N3GA 5E1BA 2FFAA 5JPDA 1TC2A 3U7FB 3V5NA 1G8JA 1TIBA 4DBLE 2LIVA 2QTVA 3IBSA 4KH1A 3TSWA 4U2FA 3OCUA 2VLIA 1U5BA 4GMHA 1FUIA 4PSCA 4HDNB 4QTXA 3CCFA 1PCXA 1YDGA 4FJ0A 3HDYA 4OAOA 5EWJB 1OIVA 3QBVA 4ZAZA 5GAJA 1TZ2A 2G4CA 4D3XA 3EDYA 5BSGA 3IA7A 3QFHA 4GOMD 4KUEA 2IYVA 1FQOA 2QRLA 1JQJC 1BU8A 1MJFA 1O3YA 2EYQA 2VNIA 3BH0A 3LSTA 5TPZA 2CT8A 3NP7A 3WL7A 4WUVA 3I0MA 2GZHA 2WHYA 3K0CA 2EHDA 5I6DA 1D2GA 1J49A 4BLQA 1YAHA 1EUQA 1E2MA 2PBFA 4M0LA 1ZM3A 3MF4A 4I50A 3UT6A 2ZBDA 3VH4A 1N6IA 2V7QD 3KYDA 3C8MA 1IC6A 4YJ2A 5IJWA 5CRIA 2ZTUA 5KQMA 4HNVA 5C34B 3VFDA 1U2DA 2OD7A 1SUBA 4O33A 5EG5A 5B7PA 4GGMX 2V3VA 1HQYE 3O31A 2RJNA 2P0YA 3KTDA 4RZUA 1SEPA 2YXLA 5IF3A 4JXZA 1U3UA 3OZIA 2QU8A 4G0ZA 1GY8A 4GLOA 4YFVA 1RU3A 1YVPA 2HZBA 4JC8A 1JWAB 4WLNA 3IOBA 2PKQP 3RIHA 2C3UA 1RXWA 2ZIEA 2C2GA 1JFLA 3HEMA 3IAXA 3MCAA 2JD0A 4BKMA 2A8YA 1CB7A 1QG4A 3I61A 3TO5A 3UV7A 5I7HA 5FA6A 4UHFA 3AVTA 1G5QA 3CVOA 3A6EA 1QGYA 3ZHOA 2BBSA 2ZJ5A 1Q1EA 2BE7A 5JAQA 4KLCA 2DWQA 3I2YX 4MV4A 3NCHA 4BMVA 4CM8B 4HNTA 5F2NA 2ZUFA 4D97A 2W93A 2L42A 2Y1DA 4P6VF 3ONNA 4HS9A 4P58A 1AMUA 2QGZA 2P6OA 2H07A 2R5WA 2NPFA 5DOZA 1FDOA 2I1LA 2EV9A 1JJBA 1ODKA 3H2KA 2D5BA 3OQOA 3FHCB 1HA3A 4ZHSA 5F77A 1D8TA 5DASA 3O9ZA 4CMGA 3QOYA 3AV3A 1M66A 3NOOA 3AJ8A 2VNSA 1N7JA 3DCIA 3G6KA 2VAMA 2YHIB 2ZZKA 4GZ3A 3WKCA 2VRCA 5DNAA 4FC6A 3VC7A 3LO5A 2C8VA 4B71A 4BPRA 3IAEA 1V95A 4MQMA 5K0SA 2A30A 2EERA 3PNKA 3AERA 4AWBA 2A57A 1SC6A 1ZNZA 4ENPA 1QHHA 4XUCA 2Y1WA 1EP1B 4QHYA 1Y9AA 3EZGA 4QQNA 4EGCB 1CY4A 1I7LA 2VYVA 1BFUA 3TAHA 2FUG1 3A28A 4AICA 3K8ZA 5D3MB 2A0WA 4DZTA 5ICMA 3EWNA 1N3YA 1DNPA 3SSNA 1Z0AA 4PC6A 3TW6A 4OFXA 2Y1KA 1XRRA 4M3NA 3LECA 4B3FX 5JZOA 3KPVA 1P44A 1XXLA 1OU0A 2W00A 2GK4A 2QTWB 3L4SO 3D6AA 3U17A 3COYA 4OMCA 1K9VF 1MEJA 2J9XB 4RK0A 2VA8A 2IQIA 2N47A 3D6NB 1S01A 4KRXA 4F7DA 3UA3A 1PBNA 5F52A 1Z0IA 2MYTA 1H2HA 2ZU6A 4DLYA 2OB2A 1FNBA 1V6AA 2AJTA 1GGFA 2REQB 4M76B 4NZZA 3LUKA 3A6HA 1FRQA 1J4AA 1W4LA 1NOKA 3IVCA 3CU5A 2OYRA 4CG3A 1MQ8B 3RROA 3LQ1A 1LXCA 4CQNA 2VHJA 4I1IA 2BYTA 4QUBA 2IP1A 1Z22A 3CRNA 4QXRA 5E4TA 4CMIA 4E7OA 4YYEA 1XAIA 1ZUWA 2X5XA 3IH5A 5JV5A 3GLGA 2VHCA 2F59A 1UM9A 2NWQA 2V6MA 2WE7A 3BFVA 2V1XA 2G72A 2Y92A 3DL7A 4UUOA 5DM1A 5DX0A 3GLHE 3A37A 2FZ5A 4X1IB 2LUOA 1UBKS 3TFQA 2PJZA 5CVTA 3H5NA 3Q3EA 3WK7A 1GPWB 4TKVB 4BNNA 4OFBA 1ZD4A 2PR7A 1AXGA 3B6JA 5K3BA 5I9BA 3K8YA 3LCUA 1T0BA 5GINE 1W19A 1I3OA 4Q4LA 2Q4DA 5TXGA 1Z25A 1R9JA 1UP7A 1I2CA 3EC1A 3ZW9A 2GCNA 1THMA 4XKJA 3M9WA 3FR8A 3EZ9A 3U7GA 2JD2A 5DVZA 2BUCA 2W6QA 1VE7A 2MOKA 1WVMA 2WJPA 2EKPA 5ITSA 1ZOLA 2RAVA 4JYZA 5J2TB 3HJHA 3IO5A 4DCPA 3ZWXA 2JLZA 2OBFA 4A2QA 3L4BC 1GSOA 3S2UA 3JQ9C 1CUCA 3HO8A 4BV8A 1E79D 2W6MA 3ZY2A 1ML4A 2O8EA 3IV7A 1QCDA 4N7RA 3D8RA 3GLTA 3A4TA 1BJTA 5LQNA 3O2QB 3ZQJA 3VVBA 2I7DA 5F5LA 2GVNA 3HGTA 5ERXA 2O2ZA 4DV7B 3HJFA 3JR7A 1KBQA 1KMNA 1QO0A 1LDBA 4GPAA 4ES6A 5LIPA 5LQUA 5CM8B 3EPHA 2UYGA 1A8HA 4Z2AA 5AYVA 3HLYA 3IMEA 3O4JA 4GLLA 1RQXA 2H8GA 4BE7B 1C9KA 4O3MA 2XMPA 4UUNA 5LDHA 3R9WA 2FWPA 3DBRA 2P4SA 2RGCA 5KWSA 4LEIA 1FMJA 1H93A 3FDZA 5HFNA 1GGHA 1Z0JA 1ZNQO 4O4IA 4R1UA 1DWPA 3HKEA 1DT3A 4Q9LA 4EYGA 3R41A 4XGQA 1E2DA 4E5NA 3EMBA 1QQ5A 4ER0A 4ZYTA 4DF3A 4TPKA 4EUFA 1EHCA 2KMLA 1YF3A 3ABIA 1U0FA 2QTCA 2VQ3A 1QYIA 2G88A 3L8EA 3BQMB 1F9EA 2CXUA 2HJVA 1JHMA 1WLYA 4MGEA 4RHXA 1KJWA 2QRVB 1GD1O 2V0NA 1JMYA 4CLHA 3GN1A 3DKVA 1SCBA 3WNZA 3NG1A 1YV9A 5F9HA 3OZEA 2OV3A 3TPZA 1PJBA 4KR6A 1Z6AA 4LW8A 4BNYA 4F85A 4TZ6A 1VYVA 4D8XA 4EX7A 2FN4A 2Z2IA 1V1RB 1VZ3A 2ZTSA 4FNOA 2BKVA 4NBSA 5GVRA 3WGTA 1LFDB 2HJGA 1PR4A 1YR2A 2WSIA 3D3WB 3GVXA 3I5AA 1PNOA 1EVEA 1CIVA 4MP3A 5A3VA 3RKRA 3OPNA 1PLJA 4LI0A 1RLTA 4DSAA 3THYA 4B80A 3ETGA 4DC1A 4JQCA 3SDZA 3F8SA 4WHMA 2XA1A 2J6BA 2GN8A 2WFZA 1RRGA 2Y0EA 3FPFA 1GLVA 3L18A 2OGZA 3QKWA 4QWMA 4U2EA 4V3CA 4WAUA 4MO2A 2QQFA 1T9BA 1WXQA 2QQGA 3HB7A 3NGXA 4NAVA 1K5PA 5DYYA 4ND3A 1C7QA 3GJ7A 1FTYA 2VZ0A 3HZHA 5JH7F 2Z58A 4MROA 1Z5PA 2WP8J 2RGDA 2XWQA 1TYDE 4FCWA 4OMFG 4CKCA 2J0EA 4V0RA 3SFVA 4QYTA 4ZPXA 5AM0A 5KUTA 4I5IA 2P4EA 5FOXA 2Y0PA 5KO2A 1Z12A 1DG1G 3G0OA 4KQFA 4B44A 4UUMA 1XYGA 2P79A 3EC7A 3P19A 2W98A 1IWPB 1IQPA 3EGDB 3JSXA 1WXIA 3S99A 1M9NA 1H2RS 3QLVC 4TRRA 3VTKA 1TLFA 1XAJA 5JAOA 2CXPA 1AGXA 2DBQA 3WMFA 3G1UA 4YIHA 2H1IA 4MARA 4IIGA 2ZTHA 1DINA 3TGLA 2XY4A 5B58T 4GPTA 3VYSB 3WV5A 1YZFA 2YYZA 4S2EA 1F2DA 2H31A 3WZMA 3FNFA 3NT4A 1LWOA 1TUEA 1GNRA 2A84A 2EDCA 2GJAA 2IPAB 2XADA 2YWRA 3ENWA 1X87A 2P62A 3I4FA 3PSHA 2RGWA 4Q1FA 3C3AA 4E1VA 5C46F 4ID9A 3UB4A 2GKOA 3B2QA 1MAVA 4DJFC 4KQXA 1X9HA 3LVBA 1GQYA 2XWSA 3KFXA 2GS9A 4KDFA 1E6KA 5AIBA 5K8TA 2AHOA 4YUVA 1MV8A 1XRJA 4D9KA 2A9QA 4QOHA 5CD1A 1I3MA 2HNBA 3PP8A 5FNVA 2AEMA 5IBPA 1E3LA 1BNCA 2GBFA 5FOTA 3TTWA 2WHEA 5ARDA 3O26A 1ISIA 3AOGA 3R7WB 5CCDA 3MB8A 4EJSB 4NAHA 1GQRA 3QEJA 2Q2OA 5I5EA 4M1TA 3PPYA 4NABA 3NW9A 1XCOA 4KODA 5DBEX 4NYJR 2WHPB 1O03A 3P20A 3PDIA 3RGWS 1MGPA 5AVVA 3OPXA 3Q1KA 4NEHB 2I7CA 4V1CI 3T3NA 1J8VA 3NNSA 2I2DA 3ZX4A 3LIIA 3ETLA 4IQFA 1JYEA 2CNDA 4I9FA 2WR8A 5FDFA 3NRCA 3VM6A 4YO7A 4LC9A 3PNVA 2BTQA 1EM6A 3AXTA 3R5XA 3S1AB 3RBVA 3OZRA 2B4QA 2QN8A 4D80A 4HS4A 4V1CA 1U7DA 1XWFA 3A06A 5DYWA 5C7YA 2OZLB 4UHHA 4WADA 4KGVA 2WAMA 5FI3A 1GTL1 3E9EA 5LYJA 4DQUA 2D74A 1OHHD 1Q7GA 1ZJWA 3AL0C 1NQXA 1HZZC 1FYEA 2Q5JA 2Y9MB 4KAXA 3U7RA 2YS6A 2MR5A 3T3MB 3K9HA 1T5LA 5TB5A 2Q5EA 1LH0A 1M10A 3HGMA 3BRSA 5ESXA 3DVAA 1BJKA 2F3UA 4YCMA 3LU1A 1Y6RA 2EWVA 2JZCA 5EHQA 4DV0B 4BPBA 4HGRA 2JZOA 1WVGA 1BC5A 4NBVA 5GOTA 2F4VB 1QQTA 3KVYA 2O8VA 3FDIA 1QLJA 5EWMB 1ZH0A 2B1GA 2CB9A 2EKQA 1YI1A 1QP4A 2O23A 4MDHA 4AZ0A 3FYUA 4ZAGA 3EF3A 1PZMA 3CZQA 5TPWA 2JHGA 3V8QA 5A5DA 2IOFA 2OHXA 4DIUA 4DV2B 1CF9A 3WSTA 5THKA 2HXGA 4ZEWA 4H35A 3U4QB 4JDUA 2IZOA 1VDMA 2NXJA 5CAEB 1CRPA 1HFEL 3MGKA 3AL2A 3FUTA 1JE0A 4GP7A 2YFQA 2GHQA 3QWFA 2GZ3A 4QGSA 1D6SA 3KOWA 3LE8A 4JP5A 4PSDA 2IYPA 2O2JA 5CCEA 4MCAA 1CY6A 5ED4A 4HWKA 2HJRA 2HY7A 3E81A 3GRKA 4NI5A 4DRXB 3PLRA 4FPXA 4DJJA 2CXSA 5I7FA 3ZW8A 4D45A 1DIHA 1R5JA 4A3SA 1SGWA 1JTEA 1R4NA 3DMHA 1GTVA 4KQWA 3RSHA 5CB6A 1FQKA 1ODSA 1M6VA 3KJQA 3N7AA 2RCNA 3CMMA 4Q3AA 5HHTA 5C51B 1ZHFA 1IVNA 2ZGVA 1Y1KE 5K51A 1IOVA 4MMZB 1HDOA 4E5VA 2WWWA 4AFNA 4C03A 1N75A 3JYLA 4XIJA 2R6FA 2Z6VA 4XYLA 1UMDB 3AR6A 1FF9A 4X8LA 3X1MA 4W6ZA 5T8KC 3HCOA 1G5IA 3KZKA 2OCGA 3T61A 2NYUA 5DMXA 1S5PA 1WY7A 3CRMA 4R1NA 1IOZA 2QD5A 1QCYA