2WWXA

Crystal structure of the sidm/drra(gef/gdf domain)-rab1(gtpase domain) complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGIKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into the Dual Nucleotide Exchange and Gdi Displacement Activity of Sidm/Drra
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords RAS-RELATED PROTEIN RAB-1
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wwxA00
1SXJC 1ZD1A 3A1SA 4U02A 2A5FA 1TPZA 3DOFA 1E2PA 4YMTA 3P4YA 3W6NA 5LPNA 2PT7A 1GTVA 4DIEA 1IN6A 3QENA 1E99A 3PUWA 5FPHA 2J59A 1Z3IX 1M6NA 1MKYA 3JVVA 4MYHA 1P6XA 2FSGA 3KFXA 4Q48A 4XD7D 2WSSD 4PC3A 1G291 3DOEA 3IHWA 4QBGB 2JASA 1SXJD 1F5NA 2ZAMA 4BLOA 3LWNA 1JEDA 3QEOA 4OHVA 3WBJA 3QEJA 4GI7A 3AF1A 1SKYE 3GEHA 3O8CA 2C9YA 2ZRNA 2JLUA 2VHJA 3REGA 3OFND 4ZDJA 1GAJA 2WTUA 1CULC 3T1QA 4QL3A 2PJZA 4BRWA 3NH9A 4Q9IA 1JR6A 1NY6A 3DM5A 4V03A 4QM7A 1G7SA 1QDEA 2Z0MA 3EZFA 1N6IA 2D3WA 1YR6A 1LVGA 4QFMA 5BN4A 3EAQA 2C78A 4JL8A 1SHZA 3FYHA 4LI0A 3TW4A 2FFQA 5KU1A 3QPUA 2C95A 3LD9A 1BYIA 2CK3D 2W2VA 3CX6A 3DMNA 2FEOA 4AD8A 1P9NA 4A9AA 3ASYA 2GCOB 3QPWA 1KK3A 2JLVA 2XZPA 3RDPA 1GNQA 1M34E 3QF7A 4MRNA 1N6PA 5CYPA 3VKHA 4TQUS 3PEWA 2CCGA 1ZUHA 3QVUA 4Z8XA 2RGCA 4LWZA 2AWOA 4C30A 2VYFA 2QAGC 2WPDA 1U9IA 1G8FA 1KO8A 5C4MA 1F2TA 1Z6AA 5CLLA 1U81A 3MAAC 1MO3A 3AQ4A 5DLQC 4URWR 3KQLA 4ZIRB 2YKGA 2O8FB 2GRJA 4QG7A 1M7HA 1W4AA 4M4SA 3IIMA 1AS0A 3NBXX 5EZ5A 5DYIA 4WZAE 2Q6TA 1G17A 4TL9A 2L0XA 1TL7C 4P4TA 3T5GA 1IHUA 3EIEA 4B43A 3GEEA 1LV7A 2OM2A 3NH6A 4GP6A 4UJ5A 1SVIA 4AG6A 4ZI3A 2PLFA 1KI9A 1L2TA 4LJ6A 1BMFD 1X8JA 2BC9A 2PLRA 2ZR9A 2ZYUX 3ZS8A 4BLRA 1HH4A 3PIRA 4BFXA 2P6RA 1FTSA 4Q9JA 4EQ6A 1ZRHA 1VG1A 1DAFA 2F3TA 1HE8B 1E9CA 4M21A 4NE2A 3UIEA 3UWKA 1NN5A 2WOOA 1G6HA 2XTNA 5HCIA 2YC4C 1CXZA 4I99A 4Q1DA 4Q47A 3HP1A 5LD2B 5FI0B 1OE0A 3IILA 1LW7A 1P60A 1AIPA 5EXXA 5L3SB 2R65A 3TIFA 1AS2A 4FD2A 4Q7JB 5FOUA 1RC8A 1DPFA 1DTSA 3BWDD 3VX3A 4LYHA 1YZNA 1M74A 1P7CA 4RD1A 3IPXA 4A2WA 1YRAA 3BGWA 3W3ZB 2PH1A 2BWJA 4D81A 1Y3AA 1YRBA 3CO5A 4FCWA 4MKGA 4LDJA 3M1IA 4M8NE 4OK6A 5FR2A 4TTPA 3BD9A 1AM4D 2QGNA 4I1UA 3GFTA 2ZR7A 1LS1A 1VPLA 1GNRA 1RZ3A 3ONWA 1VDZA 2IXEA 4LJ7A 3RANA 3RS5A 3O8RA 2XXAA 1HY3A 2CEAA 2B21A 3VNVA 5KUTA 1IY1A 1ZUIA 1PUIA 4B6EA 4E07A 1Z06A 4CZ2A 3ND8A 1FX0B 1JR3A 2IYUA 5KSYA 3K9NA 2CLSA 3LW8A 4DUGD 3OEHA 2IEZA 3W6OA 1AZTA 2CLDX 3KQKA 4N0EA 4BFYA 3LV8A 1Z2AA 4ARZA 1QHXA 1SGWA 1XMIA 4BECA 4RFSA 2HEIA 2RGNA 2EFCB 2KE5A 2ORVA 1G18A 2QE7A 5EZ6B 3L82B 3FOZA 4M9XA 1YHNA 4IFBA 1P75A 3CF0A 3SC3A 3A58B 3BB1A 2FU5C 2IUUA 2OG2A 4Q18A 4NYJQ 2ZI9A 4I4LA 1E94E 1OFUX 3QG1A 5AUQA 3PV0A 3B60A 5LB4A 4A6PA 2Z5FA 4L9SA 3KJEA 3MRSA 1JJVA 3AP1A 1N5KA 5GVSA 2EQBA 1GSIA 1F2TB 2WWGA 2ZJ5A 3VR4A 1U2RA 3LQQA 4KSBA 1CLUA 3I92A 3DDCA 1IXSB 4HLUC 3MG9A 2FPMA 3DKVA 4LBYA 2B7CA 1I4DD 4OKSA 2GK6A 3T15A 2XNSA 4V0LA 4NHOA 1KHTA 3VU9A 2ZUCA 4DIDA 4OK3A 1U99A 4CT4B 1J2JA 2FZLA 2IYZA 2ZRCA 1NG9A 3T61A 3ZD7A 2O8CA 4TL7A 4Q4JB 1VG9B 3GP8A 2QBYA 1KKMA 1KI6B 2MSDB 3A1TA 3THOA 1B0UA 1N6OA 4F4JA 1XTJA 3TQCA 3U61B 1H8HD 3CNLA 2PBRA 1FQKA 2J45A 3BORA 3PEVA 3OIYA 3WNCA 4EPWA 2RGBA 1EFTA 5JMTA 3T34A 2Q3HA 2GESA 2QMUA 2MSEB 1XD2A 2CNWA 1TADA 2GHIA 4IW3B 2QAJA 1XCMA 2KWIA 4JT2A 3PITA 1COWA 1KAOA 4V0MA 1KKLA 4F7WA 2IXFA 4YMVA 4OHYA 3BERA 3TVTA 1TQ6A 4B44A 5CITA 3WYAA 3CLVA 1RW4A 1U98A 1AKYA 4G5QA 3AH8A 1G19A 3BJIC 2W0MA 4NYIR 3P20A 4L5BA 1DAHA 4PR0A 5FOWA 5H68A 4NYMQ 2H92A 3L0OA 4UJ3A 2AR7A 1WMSA 5CJ2A 1S9HA 1KO5A 1WB9A 4Q21A 4DJTA 5HKKA 2QT1A 4MUBA 3JZMA 4ZCLA 1A5TA 1PJRA 2BMJA 1N2CE 4LHZA 2O8CB 5G40A 3DM9B 4LOAA 1DAMA 1OXUA 2QBYB 4BZPA 1XTIA 4HZUA 1J8YF 2FGJA 2I3BA 4NYIQ 5E4FA 4QBHA 2NGRA 4DLRA 2QUZA 2WKPA 4ILEA 3K70B 2QN6A 2DWQA 2WV9A 4P4SA 3TR5A 4HLQB 3THYA 4RVCA 3Q72A 1E2LA 2OCPA 4NONA 2VP6A 4IFEA 5KDOA 2HJGA 5J4KA 5B57C 1E1RA 1ZM3A 3FHCB 2ZUBA 4GT1A 4P4UA 2PMDA 4JLPA 2EVWX 4JLDA 4A1FA 5CJPA 2QA5A 4C0LA 1E2HA 2DBYA 2W6JA 2ZJ8A 1XEWY 3LA6A 3P26A 1ZU4A 4UQOA 3ETLA 3AVQA 3HWSA 3LRPA 4V0KA 1E79D 4M1OA 1CR4A 3B5JA 2ZJZA 5LBIA 3VR6A 3D8BA 4YLGA 2OAQ1 2LWIA 2DFLA 2QRNA 2G1KA 5CK4A 1UBCA 3B1ZA 2R9VA 4FXPA 1E9SA 1VMAA 3HDTA 4KYUA 3PG5A 1U0LA 1KZGB 4IXMA 4HAUA 1Z8FA 2TMKA 1FP7A 2R6AA 3OIVA 2PEZA 2BOVA 3F5FA 1G16A 1XXHE 2QGZA 2IWHA 2G1JA 3SBDA 3FE2A 1AS3A 4RD0A 5SZJA 4DCVA 5AJYA 4TYPA 3D7MA 5A5GA 1FFHA 5BW8A 4R7ZA 4AI6A 4Q7LA 1R2QA 3LQRA 3CRW1 4KCGA 5HTKA 3EG5A 4JJZA 2YWHA 1GKIA 1QHIA 5FPYA 4JLNA 1XTQA 4XIGS 1QHYA 2EWWA 3W34A 2QP9X 4DLVA 4G0NA 1LS6A 2NG1A 4KSCA 3GJ3A 1Z83A 3O8BA 4DSNA 2A30A 3W8NA 2AFIE 2VLIA 3A4LA 4YQFA 1OB2A 2FNAA 3K09A 2HCBA 4A4DA 5AK0A 2QTFA 2WAXA 4WIAA 4FMCF 4DLSA 3OE7A 4I1OA 1XD2B 4M9QA 1P9WA 3AUXA 2YINC 5IF9A 3IBGA 1AK2A 1P4SA 3ZIAD 1II8A 4PSKA 1FOEB 4UNQA 5SZIA 4IOLA 5EJEA 2GA8A 5DSZA 2IYWA 1CR0A 3C5HA 3EA5A 2FG5A 1II0A 2DB3A 2WWHA 4Y0VA 1UADA 2BMEA 2X1VA 1ZAKA 2DFNA 1UM8A 4KVAA 3FKSD 2PT5A 4JLKA 2F1IA 4PC2A 3ZIAA 1XXHA 4NL4H 1G8GA 5L3QB 2ZXUA 1G3QA 2ORWA 2H8KA 1ZM7A 5GADl 1KAGA 3ZGXA 1KIMA 2C2HA 4D26A 1CEEA 3LX5A 2NO0A 5KDLA 3A6PC 2KBEA 3RSOA 1YJ5A 1EG7A 1T0HB 1E0KA 2G77B 4H1UA 1QRAA 3SDZA 3WRXC 4NCJA 1B23P 3C15C 3U7HB 1ELOA 2R44A 2ZI6A 2DWOA 3C5CA 3FFAA 2JEOA 2CJWB 4HZIA 4I1SA 2OHFA 4DSTA 4HDCA 4HUQB 2ZRLA 3QKSA 2Z6VA 1QHHB 1HT2E 4G3XA 4OJQA 2QAGB 3SJAA 4GOXA 4TL6A 4PC6A 1W0KD 4Q9HA 1RPZA 2FV8A 4IVQA 4O2RA 2QTVB 2SHKA 2IUTA 5FBWB 1VIAA 5DI9A 3KQUA 3BOSA 3FMPB 4MYTA 1N3BA 5GJWC 3TAHA 2O8EA 4JLAA 5C4GB 4R98A 1US8B 4GNKA 2D4HA 3GJ4A 2QZ4A 3GQBA 2I1VB 4TYWA 5JJLA 1MRSA 4P33A 5L3QA 4IEIA 1JXOA 3PENA 4DUGA 1KGDA 2RGXA 4Z8YA 3THXA 2W6IA 2IYSA 1D9ZA 5DH9A 3E5HA 1E1QD 2O52A 2VF8A 4V0ME 4JMPA 3QE0A 1OFTA 1OPXA 4KO8A 1UAAA 3HPRA 1E1RD 4LJ4A 3HU2A 1NY5A 4CYMA 5ANRB 4EJSB 1GG2A 1U94A 1KJWA 3GPLA 2VSOA 4IEEA 3NEJA 5TARA 3EW9A 3MD0A 5HPYB 2JJ1A 1R5BA 3TAUA 3PCRB 4GMDA 1N25A 2ZRFA 1HQYE 3TW8B 2A7QA 1CJVC 2OAP1 5E95A 1XJCA 4II7A 4M2LA 4ARZB 1IY0A 1KI1A 1YZLA 4FCVA 1WCV1 4HSEA 3C41J 3DO6A 3SR0A 3U60B 3UANA 2J0SA 1SXJB 2NO1A 4JS0A 1T6NA 2P6UA 2GXSA 1EX6A 1COWD 1Q20A 3I61A 2BKEA 1DS6A 4LJYA 5C2JB 4CDGA 4AK9A 2A2ZA 4ASUA 5CB6A 2RKOA 3CM0A 1E0SA 2C5LA 2IF2A 2F1HA 3MCAA 4D80A 2HDNB 4QC2A 3SOPA 5JHGB 1SVSA 1UKEA 5IDVA 1GRNA 4BFUA 4HYYA 5HZKA 2IYXA 2VQSA 1OLOA 1MABA 2ZIAA 4YDHB 5K8LA 5DNYB 1GM5A 4J0QA 2PMKA 3BS4A 2PCJA 3D6TB 3MWYW 3HR7A 3IHLA 4MYCA 1DAKA 3N2IA 3BH6A 4D0GA 3AVOA 3GLIE 4Q4HB 1XXHB 1W0JD 3B9QA 2F9LA 1Z28A 2YHSA 1G8HA 3EZ6A 5FBLB 2ZITA 4JVNA 2O0HA 4M53A 4Q1EA 4BFZA 1R4AA 4C3ZA 4E03A 5KOYA 4L15A 821PA 3WP0A 1G5TA 4LX0A 3NIBA 1RVDA 3KB1A 4JL6A 4Q4JA 1P5ZB 2NMVA 4DSOA 2OXCA 4YMWA 4I81A 1IJFA 5B58C 4Z1MD 4C0BA 1ZNWA 3MFYA 2OUKA 1NLZA 3MWKA 1NBMD 5K8IA 1GKUB 2C98A 3QUSA 3AVUA 2GWHA 3AB3A 5KPDA 1F2UA 5C46F 2PCLA 1PVOA 3NG1A 2J3EA 4P31A 5BQ5A 4OHWA 3IO3A 4IOMA 1AQUA 2VA8A 2A5GA 1YE8A 2F1RA 1W4CA 2UZ3A 1S1MA 2FX3A 1LFDB 2QROA 4PHGA 3TLXA 3KJHA 4TYNA 4CVNA 1VG0B 4O25A 2DHRA 1J99A 1OXSC 3U7GA 5CM9C 5TY0A 1BS1A 1F6BA 3VHXA 5F9FA 2ZTSA 4G5SA 5EE1A 1R8QA 1KY3A 1ZVQA 4L16A 3TSZA 1Z0KA 1Q3TA 2CK3A 2VP0A 4PZZA 1EESA 2WSMA 3QXSA 1Z0JA 4M22A 4UXIA 3UMSA 3MLEA 4B71A 3G0HA 3B2EA 4OK5A 5DI3B 5AUOB 4HAVA 3AF3A 1YR9A 2FN4A 4HZUB 5JI2E 4Q7KA 3QKTA 1FPMA 2JLQA 4KFTA 3LH5A 4EJSA 3B1WA 3K09C 4BLSA 2RCNA 4B3FX 4IDQA 3R9IA 1N5LA 2FSHA 2P3SA 1SVOA 2ZSEA 1HQCA 3ZDQA 2FH5B 3EXAA 3L2OB 5KNDA 1RKBA 1N6NA 2V9PA 4RD6A 2RHMA 1ZYUA 3L43A 3EX7C 1AA9A 4KFUA 4HB0A 1ONBA 4I1VA 3X1XA 4Q1BA 3KJIA 5JEDA 5DISB 4BFVA 5G3ZA 2H18A 2GEVA 4KITB 5JCPA 2ONKA 4DC9A 1N0UA 2ZANA 4MGZR 3J81k 4BLTA 2Q3MA 4LJ5A 4NCIA 3IPYA 1KDTA 1YU9A 4R9UC 5EP2A 3T1OA 1CJKC 3VR2A 5FUXA 1ZBDA 2GETA 3B82A 1NJFA 1E32A 1F60A 1BMFA 4HLDA 4A8JA 2XXAB 4WXRA 3HYRA 1Z63A 3X1YA 4LV8B 5BWMA 4F93B 1R10A 2FEMA 2A5YB 2D74A 4A0RA 5JSZA 2OLJA 4UNPA 2WKQA 2YC2C 4LGMA 1YZGA 1Q1ZA 4MGKR 1L4YA 5AUPB 1VG8A 3AVPA 4RZ2A 4KU4A 4XVQA 4DT1B 4A36A 4ACAA 1P3JA 3CKLA 1KI7A 4TSFD 3I73A 5FBQB 2VTKA 2OZEA 5JRZA 1HEIA 3GJ0A 3I5XA 1V5WA 2IF0A 2OESA 121PA 1VYVA 4G5OA 1LY1A 3BH7A 2IEYA 2ONJA 4A0FA 1E0JA 3QG5A 5DO9A 1C4OA 2ZEJA 2ZYWX 4Y0AA 2ZRDA 1KSHA 2EFGA 1NI3A 2OFXA 4TLEA 5H1YA 4EAQA 4DDVA 5F9HA 3OAAA 1XX6A 3FB4A 4MKFA 4CEJA 1E2KA 2W2XA 1Q0UA 3Q7QA 4TSFA 3TR0A 1GZSA 4QJ4A 2ZM5A 3B1XA 1JI0A 3ZZTA 2FZ4A 2JLWA 2G3YA 1CS4C 2GF0A 1S0UA 4PC7A 4M1SA 4DLZA 2H7VA 2WIAA 3ZQJA 2YOGA 1GP2A 1R6BX 1AN0A 4UKDA 3LLUA 4D0LB 1T0JB 4BLQA 4G5GA 3ZVRA 4QGFA 2NIPA 4BFSA 3AVXA 2FA9A 1YZQA 4K46A 2AXPA 4WZ6A 2GBLC 4IHQA 2FGKA 4EPVA 4LYFA 5JS7A 4CEIA 4WVFA 1ZIOA 1DAIA 2HLDD 1Z08A 2DR3A 1JEEA 1UFQA 3A4MA 2G83A 4RZUA 5GVRA 5A4JA 3CH4B 2REBA 4OHXA 2JJ2D 2QMEA 2G0TA 3CF2A 1XTRA 1JQLB 2BIFA 2VHQA 3KUCA 4JVSB 4TQAA 4WXPA 1KO4A 1OF1A 3TBKA 5EE5B 1D6JA 1NNEA 2IYVA 3WHLA 2KSQA 2R6DA 1K5DA 1ZP6A 3RSLA 3U44A 4DHEA 5L3VA 4S35A 3A4NA 1YR7A 4JYBA 3ZVMA 2IS2A 4QNMA 3U4QB 4JKYA 2B92A 3K70C 3RYTC 1UBFA 3UPUA 4FMDB 5FUVA 3BIFA 2WJHA 3RWMB 4FINA 1P62B 1D8TA 3FPAA 3LX8A 4KYIB 1WQ1R 4H1VA 2C9CA 2XOKA 4IDPA 4NYMR 4X8HA 4ZI2A 4O3MA 1E2MA 4UNNA 3CWQA 3L8YA 4A0GA 2ZAOA 1C9KA 3V4FA 5D3MB 2JJ1D 1E9EA 2MMCA 3UK6A 2FFHA 1LNZA 1TF5A 1IAQA 2WZQA 4JVLA 3H86A 2H16A 2ZRIA 4BZXA 3DL0A 1G5RA 4URZR 2ZYTX 4IJMA 1OKKD 3OEEA 5HR5A 3M4YA 4WW0A 2GJSA 2WAYA 1UDXA 1NBMA 2AKYA 2WWFA 3AM1A 3CRMA 4XVUA 1N6HA 1KI6A 2H1LA 2ANCA 1CR2A 2JATA 1T3HA 4Q5IA 5EXSA 4MRRA 4LV5B 4XSGA 3TKLA 3WHKA 3WNBA 1XFAA 2CJWA 4RCZA 3TH5A 3ZS9A 1VCNA 4PO1A 3ZYCA 2QG6A 3GLHE 5KSOA 2XB2A 3DMDA 2QAGA 3ASZA 3T06B 3WMFA 1RFLA 5J4LA 3CNOA 2OSBA 4B3GA 2EYQA 3AGPA 1TUIA 1I4LD 4QBIA 4W7SA 2F9MA 4GMXA 4XTRA 1WA5A 4D0NA 3P1JA 2Y8EA 2ODWA 3R8FA 2QY9A 4CEJB 4Z1MA 5EP4A 1V43A 3SE0A 4WBSA 2E9SA 4QOSA 2R6CA 1AGRA 2RH5A 2ZVPX 5FTKA 5KHOC 3GLGA 2PZGA 2BBTA 1IXZA 4RD3A 3GD7A 4B75A 3OESA 1NIPA 4K81B 1UEJA 2J0UA 1KMHA 4EFNA 4PPFA 2ZETA 2GJKA 4BUJA 4LSGA 3L0SA 4AKGA 3CPJB 2QP4A 4HB4A 2QU8A 4GOJA 3CUEF 3FKSA 3UMRA 2ZU6A 4O2LA 4MUAA 2PZFA 1YR8A 3GFPA 3Q85A 2CNWD 1ZM4A 2J0VA 3VKWA 1NMXA 1I4TD 1C1YA 1KK2A 2QSYA 2DWPA 2NO6A 2ZI5A 4JLOA 2VP9A 2P5TB 4WAUA 1XNJA 4PHHA 2HJVA 4B2LA 4FI3C 2A3RA 3AUYA 3Q7PA 2V1XA 1WP9A 1HURA 4TQ9A 5KNBA 3QF4B 1YZUA 3BC1A 3NXSA 3CPEA 3SEAA 3VAAA 4DKXA 3CF6R 4V0OA 1OV4A 1LF5A 1O3YA 4OQFA 2ZRHA 5BN3A 4IOKA 3RS0A 3CX8A 4B74A 1W36D 3IBYA 5FL3A 2XZLA 1F48A 1QHGA 3QY0A 3D31A 4FW9A 1KMHB 4B2PA 2F6RA 1G7CA 4A6XA 4C0QC 1IBRA 2P6NA 2OLKA 3V9PA 1PZNA 2PL3A 3ZH9B 2BCJQ 2BEJA 1G4AE 3B85A 3HPQA 1DEKA 1D2NA 5JWOA 1Z6GA 4GZMA 3E1SA 1H65A 2ZRGA 5K8TA 2WVJA 4M1YA 3KL4A 4PHTA 1GNPA 2GJAA 1TQ2A 4LYJA 5CDFA 3WYFA 1TNDA 4JBXA 3L0PA 2YWFA 4MRPA 4OBEA 4Q9LA 4ZO4A 4PC1A 4LPKA 2HF9A 2W6ID 4E22A 3I4LA 2QP3A 1GILA 3I72A 3PEYA 4NKRA 2BKUA 4POAA 3W5IA 1CRQA 1T3LA 521PA 2AD1A 1XDBA 2ODEA 2QE7D 4B48A 4XOIA 1ZD8A 3IQWA 1K5GA 2BBSA 3NDPA 2W2TA 4TL8A 3CWZA 3LFUA 4Q4AB 2I1QA 3RRNA 3W6PA 4BASA 4URXR 5FH9A 1GFIA 3RAPR 4GL2A 2IHBA 2YVUA 3EZ9A 1XZPA 1NF3A 2ZU0C 4HB2A 1MO5A 2ZI7A 1W36C 5B30A 2C96A 1DADA 4D2IA 2NZJA 3R20A 3DEFA 3AKCA 3RS7A 2X8AA 1FQJA 1FW6A 4E09A 5KSPA 2Z4SA 4BGDA 1S3SA 2C9OA 2V6JA 1II8B 1QHNA 2AWNA 3SJBA 4AIIA 4U00A 2OCBA 3U2QA 4KVGA 1ESNA 1DELA 1FZQA 1W49A 1D2EA 4XWOA 5IK2A 1U90A 1EGAA 4CW7A 1D9XA 2V55B 4L8GA 2WBLC 2ZSBA 3QNUA 1K6MA 3TQFA 1GVNB 2CCJA 2AK3A 4YMUA 4ITRC 4OI2A 2O8DB 1E9FA 3CZQA 4FIDA 4IDHA 3VR3A 3M0EA 5TVKA 2O0JA 3K9LA 1MT0A 1HUQA 4B47A 3CRVA 2PX0A 5CYOA 1E9RA 4B33A 1ZNZA 1ODFA 1W0JA 4DVGA 4NMMA 2UVQA 1W2HA 4IVPA 1S2MA 1W2GA 3B9PA 3T12A 3AVTA 2A78A 5J4HA 2KB0A 2WJJA 4F92B 1Q1QA 2RGGA 3OIWA 4UXJA 4C2UA 4C0HA 3KDSE 1W5SA 2XZOA 2X2EA 1JNYA 3ADBA 5FBRB 2R62A 5E3HA 3EC1A 5KO2A 3IO5A 2QMOA 4JSTA 4HB3A 1KO7A 1X8KA 4KJZA 4KXFB 4EPRA 1KDRA 1XP8A 5EXTA 1WE2A 3QXJA 4TTQA 3IEUA 1WBDA 4GZLA 1WBBA 4G01B 1AQYA 1E4YA 1IOZA 2GK7A 2WMOB 1JBKA 1ETUA 2H17A 3SS8A 3TMKA 1BO6A 3U5ZB 4Q00A 4PQYA 3UG7A 2REOA 4ABYA 1X3SA 5BN5A 4CF7A 3TUZC 1N5JA 3GLHA 4ZCIA 1A1VA 5JBQA 3MWLA 4OI4A 1X6VA 1AGPA 3U3MA 1ZM2A 3G82C 4Q4HA 2A5JA 4MGYR 1Q1EA 5EXPA 2QQEA 2Q9AA 4GP7A 1P2SA 3FVQA 3THXB 1G41A 2WWXA 1G3MA 4PSAA 4PTLA 5JJIA 2VP4A 3AVVA 4DB2A 3KFVA 1RJ9A 2VRWA 3LO5A 1E9DA 5JFGA 4M1WA 2WICA 2JA1A 2ZS7A 1E9AA 2DPXA 2I4IA 1HYQA 1P2UA 2W58A 3DPUA 5JZVA 4CEIB 2J7PA 4LJ8A 4WOPA 2QPOA 2ZUDA 4XH9B 4KV9A 4L4UA 4DDWA 2FMXA 4BRUA 4LHXA 3QPVA 5EUQB 3TSOA 1J8MF 2G0NA 3K0CC 4LCBA 4QGGA 4GOKA 2ZE5A 1XTKA 4R2IA 4UNSA 3VMFA 4EKDA 5JRJA 2RHDA 1KY2A 1TEVA 4OHZA 1JPJA 1PLLA 3TNFA 1NVVR 1Q22A 1VTKA 4DT1A 2JLXA 1YZKA 2OT3B 2GEDA 2XOKD 4A0HA 1E2DA 3BBPA 4LK2A 4X8MA 4C7OA 3R7WA 1OKKA 3BB3A 1SVKA 1KSJA 3F8TA 1RYHA 3GFOA 1P2VA 4RSGA 2D2EA 3FMOB 3FGNA 3X1WA 4M9SA 2WOJA 4MA4A 3MSXA 3R8CA 1GL7A 5CIWA 3SN6A 3A1VA 5KNCA 1S96A 1ZCBA 4CIDA 3RVBA 2YOFA 3MUFA 2CE7A 1IJEA 1Q12A 1TX4B 1Z0FA 2FSIA 2YWGA 4RD2A 2YJTD 2QPTA 3ZVLA 5D3MA 3B78A 3QOFA 5G53C 1D5CA 3OEHD 3Q8XB 4TMVA 3KKPA 5IT5A 1OH6A 1RE0A 4B35A 3QJYA 2JDIA 5FOXA 2ZSAA 1Z0AA 5GJCA 2ZRPA 4MDFA 1G6OA 2OFOA 1RIFA 4JZKA 2YZ2A 3KUDA 2Q21A 4BQSA 4AC9A 2V7QD 3KB2A 4C0JA 3GLIA 2ZS8A 3B7GA 4PFSA 4DLTA 4DRZA 1SULA 1H8HA 1Z0IA 3K0CA 2V54A 1NG1A 2FOLA 4CEHA 4QXAA 4QKQA 2B6HA 4PO8A 2C77A 1Z22A 2FPLA 2QT0A 2IA5A 5EP1A 4A92A 221PA 2ANBA 2CHVA 1M1YE 1RRPA 4D4LA 3EPLA 4LRWA 4GBMA 5E7MA 3X1DA 3KQNA 5EUMA 3AGQA 5FI1B 2JIZA 3C4JA 3GLHB 3H2YA 4LHYA 5L3SA 5D3QA 2J41A 3H1TA 2IW3A 4OQNA 4PO9A 4Q9KA 3PFIA 1XB2A 1IXRC 4TT3A 5FL7A 1E2FA 4N0DA 1IY2A 1W7AA 3REFA 3VU9B 2XSZD 2R6GA 4CRWB 1MO6A 3T5DA 1UKZA 2FSFA 2F7SA 3A1WA 1GRQA 4KLZA 3PXGA 2E87A 1R7RA 3K9HA 3CONA 3UXMA 1P9RA 4JLJA 3VNUA 1E0AA 3WYGA 2QM8A 1MOZA 5AWFC 1T91A 3GJ7A 3DKPA 4M9ZA 3VR1A 5DYGA 3WRYC 3PUYA 4HUQA 3WMEA 2D7CA 2RB4A 3O47A 1IQPA 2ODNA 2J0QA 1Z6YA 3VR5A 3U7FB 3NBFA 3VHLB 4B32A 3QXXA 4X8OA 1CJMA 4ACBA 2NO7A 1BKDR 4GDFA 1E3MA 3KKNA 2JLSA 4PAQA 2MMGA 4C9BA 1NLYA 2WWWA 1CBUA 3NBYC 1KK0A 2V8OA 4DLXA 3K8YA 4H9GA 2WWYA 1ZU5A 1XEXA 2JLRA 1KYIA 2YOHA 2OFWA 5FOVA 4RZXA 2X2FA 1GOTA 1S8FA 2HUPA 2PZEA 5UKDA 4DBLC 2W83A 1SVMA 2H57A 4TLDA 3SFZA 1T9HA 1E2GA 2ZREA 2V4ZA 2ZRAA 2JCSA 3EASA 2VSXA 3X1ZA 4BPBA 5BYKA 4ZKDA 4BE7B 2XITA 4C0KA 3PUXA 4TWZA 4CT5A 3WXMA 4KODA 3NHBA 5TDHA 3TRFA 1Q57A 2YNMA 1NLFA 3IIJA 3GLGB 3C14C 2AKAB 1RYFA 1GUAA 3AP3A 2XJ4A 4A8JB 2JLYA 3ZD6A 2K5UA 1IN4A 1OXTA 5H70A 3IEVA 1SVWA 1KDOA 4EFLA 1E69A 2MSCB 3SBEA 1E98A 1NRJB 1Q1BA 2KBFA 3K9GA 3P27A 5HKKD 1DE0A 3A36A 2Q0HA 4ZDIA 1G8PA 2B8WA 1NVXQ 2AX4A 5C18A 1VCMA 2BCGY 1JJ7A 1TAGA 3KKOA 4BEJA 3I8XA 4YONB 4DLUA 3HYTA 2FFBA 4DDTA 2JLZA 3EARA 1QVAA 1ZM9A 4OI0A 2W0SA 3MJRA 3I3SR 4HUTA 1RRCA 2P2LA 2Q9CA 1ZCAA 2WM9B 3DVLA 4HDOB 4F4CA 1DBSA 4LHVA 2BDTA 4A2QA 2R6FA 2EWVA 4U7DA 2ZJYA 3BE4A 3RRYA 4AYTA 1E2NA 3BK7A 3QF4A 4GSYA 3SHFA 1E6CA 2QRZA 3V00A 2HLDA 1KI2A 1XMJA 3I1FA 1NSFA 1OIVA 3RNLA 1G5PA 3QQ5A 1XJ0A 2B7BA 2YV5A 1M7BA 2RAPA 1OFIA 4TMZA 1U8ZA 1I2MA 1TEXA 2ZE6A 4NZYA 1SKYB 4NBSA 2DCUA 1K8RA 3QKRA 4RZ3A 2GVDC 2GXUA 5FPSA 3RRMA 4F4IA 2LKDA 4LYAA 4Q19A 2IC5A 4OQMA 2HT1A 2EFEB 3BAFA 1WDTA 4PX9A 2EFDB 1G7RA 2D62A 2UKDA 2AXNA 5F2EA 1MR3F 3T35A 3FHTA 1DAEA 1KMQA 5AJVB 2ORIA 2HT6A 4PPNA 3GLFA 2WPDD 3OAAD 1CU1A 2ATXA 2ZI4A 5JECA 4IDOA 2IYYA 1BH2A 1NN1A 3FFBA 4FWTA 1OFHA 1G3UA 4E5UA 2CMKA 5E7IA 1VKJA 1XEFA 1OHHA 4B6FA 1Z07A 2ZROA 4HATA 3TE6A 2ERYA 1F2UB 5KSZA 3T1TA 3BFKA 3QXHA 4TLCA 2XAUA 1M7GA 4JSYA 4Q1FA 2ASEA 3SYLA 1L4UA 4B3CA 1CR1A 1R0XA 1R5OA 2FWRA 1XD8A 4GRAA 5BYJA 2F3RA 4IRUB 3DHWC 2XJ9A 4XD7A 4TTRA 5AJZA 2PEYA 1UDWA 4EPTA 5J4VA 4NCNA 4NTZA 4XTCS 4LV6A 5BXQC 1JAIA 1EX7A 5TV2A 1BYUA 5C1BA 2RMKA 5FOSA 1PLKA 2V3CC 1VIYA 2A5DA 3ZLJA 2NZ8A 1GIAA 4AURA 5H8WA 2ZSFA 5TB5A 2IYTA 5AR1A 4ESVA 2DY1A 4OQXA 5FUWA 5AUNB 3IQXA 3ECCA 4QBFA 1LTQA 4C0AC 5JLJA 4TZ6A 3HJNA 1Z6XA 3CRQA 4KFSA 1YVDA 4JKIA 3B13B 4ASUD 4IVRA 2NQ2C 1ESMA 3QKSB 4XSHA 3CR8A 4PQFA 3W5JA 3U3OA 2J7KA 2FDCA 3KQHA 1YQTA 1XBTA 3MMPA 1AZSC 2UZIR 2IX3A 1ZJ6A 4D82A 4GFDA 4W5HA 2AL7A 3D3QA 4LJ9A 1IN8A 2R2AA 5HCNA 4MGIR 2O8EB 1JPNA 4DLYA 3RC3A 1US8A 3KKMA 5DGXA 3VKGA 2P67A 3WMGA 2VP5A 4DDUA 2OILA 3AVYA 1ZC3A 3NC0C 4DEXA 1VCIA 2OBLA 3QXCA 4XVRA 4URUR 1JB1A 4HAZA 1NMZA 421PA 3FMIA 2WJIA 3CBQA 3KZ1E 3OF5A 2RGDA 1P61B 2ERXA 1DVRA 1HT1E 1Z6TA 4FWIB 3ZVNA 4KBFA 3L8ZA 3EZ2A 2GAOA 4Q03A 3FMFA 5DIFA 3SJCA 2J5XA 3EA0A 1OYWA 1KJZA 1P73A 4FCTA 1GDDA 4PHFA 1CJTC 2GBLA 1T8TA 5EP3A 1ZIPA 2XX3A 3LXRA 2FJUA 2XSZA 5CLQA 1KJYA 3AF4A 1ZNXA 4DSUA 2OO7A 3RS4A 4EPXA 4M1MA 5M04A 2WIBA 1X86B 1W4BA 5LDDC 1E4VA 1I2DA 3LDAA 3EWSA 4DCTA 5L3RA 1EFRD 2IHYA 1GWNA 4QM6A 3K53A 1FNMA 1NJGA 2E1RA 5E7JA 5EQTA 3VX4A 4BWYA 1W48A 1WF3A 2CVFA 4G5RA 2JIZD 2GNOA 5FTMA 1CF4A 3IUYA 4NH0A 4TMKA 5FPTA 5JHHB 1EWRA 3GJXC 4MRVA 1W0KA 4D4JA 1QHSA 1G4UR 721PA 3SNHA 1ZINA 4F91B 5LD2C 3NBZC 1GITA 4LBZA 3KX2A 2W00A 1QHHA 3Q5EA 3QIAA 4BFTA 1DOAA 1Z0DA 4KLNA 5FL7D 1W46A 4ZDWA 2IS1A 3TUJC 1T8UA 1KSGA 2IWRA 3FHOA 4QJ3A 5DN6A 4LBVA 2C8VA 1E96A 4EPYA 3CB4A 2G6BA 2ATVA 1M8PA 2HYDA 3KXIA 1UF9A 1MABB 1QBKC 1T4GA 4US1R 4G1UC 2EU8A 1CRPA 4PZLA 3SU8A 1UKVY 3BRWD 4DEYA 4EFMA 4V02A 3A8TA 1VYUA 3CPHA 3AP2A 2GCPA 5L8VA 2O8FA 4JL5A 1E2JA 4D25A 4ZV4A 2C99A 2P5SA 3H0KA 4GPTA 1TF2A 3FTQA 5JJKA 1L7VC 5JWRA 2VH5R 4AKIA 1OT3A 1A2KC 2JAQA 3EWAA 3L0IB 5IHPA 5EE3A 3DZ8A 2QMHA 3TGPA 4B3BA 2IXGA 3K0FB 1XPRA 4DCSA 1N5IA 4NCKA 2EYUA 1NMYA 3QSYA 5A0FA 4YXWD 3MGCA 2V7QA 3W3AA 2IS4A 4W5WA 5CB8A 5JCZA 1EFCA 2AHOA 3KXLA 4FN5A 4OQLA 3AF0A 5TMPA 4AY2A 1CJUC 4B73A 3OE7D 3K0AA 1XRJA 1H8ED 3MWJA 3RS3A 5SZHB 4EQ6B 1GKYA 2XB4A 4RCYA 1U9IC 3SQXA 3PEUA 4IKEA 4Q4LA 2ZRBA 3S1AB 2JDID 4ON9A 2RGEA 2ZSDA 4PQRA 2QEQA 3ZZUA 5JI3E 4QHTA 2XTMA 3DZDA 3IIKA 3PVSA 3X2SA 4TYQA 4D4KA 3W90A 1J70A 4RKEA 2YWEA 5IK2D 5FUYA 4NDZA 4PPGA 2HXYA 4Q4AA 1W36B 2QPAA 1CIPA 1ZUNB 1FMLA 3RWOA 1G7TA 1JECA 2VO1A 2FE4A 4JBWA 3M6AA 3VFDA 3V4RA 3U6KA 1RRFA 3E70C 5DHAA 1R0WA 4KHZA 4HLUA 4LPSA 3B1YA 2BBWA 1BIFA 1KK1A 2OXRA 5CM8B 1IN5A 2OEPA 2Z83A 3EIHA 5P21A 1KI8A 2IYLD 4NYJR 4ZKEA 2BMFA 2W6JD 3P32A 3A37A 1R5NA 1RJ9B 1XEWX 2DFKB 2J87A 1N0VC 3PUZA 3THWA 1TU4A 2IT1A 2QORA 5HE9A 4URVR 1E1QA 1FUUA 1MV5A 1QVRA 1TUEA 4ZIRA 1UBEA 1QG2A 2X19A 3EPKA 1E79A 5HE8A 2GEUA 1Z5ZA 1S3GA 3KTAB 5CK5A 4ERNA 1FX0A 2O8DA 2BJWA 2WWIA 5AJWA 1CKEA 4OYHA 2IBMA 1NN3A 5GJBA 4JYCA 5FOTA 2N1BA 2WJGA 3IDQA 2GXQA 4O0MA 4R71A 2ZYVX 4PSVA 3MJHA 1ZNYA 2J7PD 2ZRMA 4LC1A 4RFSB 3TK1A 4PANA 3CNNA 2CL6X 1AJEA 5J47A 2BM1A 4UXHA 4Q1CA 1OXVA 5F98A 4C7OB 1BOFA 2IS6A 4HAYA 4YC7A 3E2IA 2HV8A 1Z47A 3N70A 4AWXA 2ZVQX 5J40A 5FTLA 5FR1A 4BFWA 1HTWA 1CTQA 2ZJBA 3LAWA 2ZS9A 1JALA 1G1MA 4B3DA 2GKSA 2CBZA 1EWQA 3KXKA 4JVMA 4TT3D 1AKEA 1GL6A 1G9XA 2Q3FA 2AFHE 1UEIA 3HR8A 3U3KA 4A82A 1G20E 1P2TA 2BJVA 2QNRA 3NDBB 3BXZA 1XEXB 4HAXA 4U5XA 1KOFA 2O5VA 4LUCA 2GF9A 2OBNA 4EUNA 1GL9B 3H84A 1F3OA 4DB4A 4IDNA 3NWJA 3R9WA 1OIWA 1XJQA 4NCHA 4KAXA 4IOJA 3TSWA 4P0TA 3C7KA 1XCPA 2GJ8A 3HU1A 3N2EA 2GVZC 3AVWA 2OCAA 1CP2A 4DXAA 1UPTA 2ZE8A 3KJGA 2GJ9A 3I8SA 1HE1C 4JIMA 4LJAA 4EIWA 3IGFA 2IK8A 3FDIA 2NOAA 3LW7A 4NPHA 3U3JA 1TQ4A 4K8OA 1QZXA 4OJKA 1UBGA 3CRRA 3W8RA 3HU3A 1Z29A 1OIXA 4RKFA 1XTSA 3S1AA 3TUIC 3SHWA 1U8YA 3CIOA 2J1LA 1NL3A 3QVVA 2IYQA 3GEIA 2N46A 5G41A 1NP6A 1KDPA 4TMTA 3IKJA 3AKEA 4Q1AA 3GMTA 4BZQA 4N1AA 2GILA 1TQDA 5JEEA 3O8DA 3R7WB 1LB1B 3ZJYA 1SKQA 2GZAA 4XJXA 1FUKA 3VTKA 4N3NA 3B1VA 2VP2A 4FMBB 4EJSC 1TMKA 4MRSA 3SI7A 1N6LA 4XWKA 1OXXK 1PUJA 1Q44A 1OYYA 2D2FA 4W9MC 2AN9A 5J5CA 1HA3A 2AD5A 2GDJA 4M1KA 1VCOA 1FL9A 2IUSA 2REXB 4LZZA 4PPQA 3SJZA 3OIUA 1E2QA 1MH1A 3JVUA 4M0LA 4D4MA 1WRBA 2VBCA 3THWB 3Q5DA 1DO2A 4W5JA 1U8AA 1X8LA 2VHTA 3GJ5A 4URYR 2PJRA 2ZE7A 1O87A 4JLMA 4Q01A 1KSFX 8OHMA 1T5LA 3QKRB 1NKTA 3SYNA 2RGAA 1FTNA 3AF2A 3UG6A 4P4SB 1X1SA 2J9RA 4KI0A 3THYB 1JXMA 4D6PA 4F38A 2HXSA 3OZXA 3BFVA 5CDFE 5J4YA 2RGNC 3H4MA 1OJLA 4XWAA 3GLIB 2HCJB 3FKQA 4HDQB 1LF0A 4FMCB 3ADKA 1DAGA 3AEZA 3GLFE 1DG1G 5FBVB 2CL7X 1E2EA 2XNDD 3BB4A 2PX3A 4QGHA 1NVWQ 2WHXA 1QF9A 3C8UA 4CEHB 4OL0A 5KDDA 5KPJA 1R8SA 2JGNA 2BBOA 4QHYA 1OH8A 4TLAA 1ZD9A 2CCKA 2VEDA 4HI0E 4JJKA 5FFMA 5KTYA 2HYIC 1Q3HA 3GJ8A 1W5TA 1H8EA 621PA 4MH0R 4AKEA 3GCGA 3WBKA 3SQWA 1S1CA 3QI2A 5TXGA 5CIQA 2ZRJA 2NO9A 4A8JC 3Q9LA 4AKHA 4LBWA 4QGAA 2FF7A 1PV4A 1D2MA 3CX7A 2VHUA 4PAOA 1U0HC 2LKCA 3SZRA 1MO4A 1NBME 1NVUQ 2OE2A 2WMNB 3F3YA 3LNCA 4TN1A 5K8UA 1TTTA 2CHGA 2CXXA 2P65A 4MQBA 1JR3E 4AYXA 2VIIA 2WJYA 4P3YA 3EIQA 2ZJ2A 2Z43A 4YDSA 1ZC4A 3G5UA 2NPFA 2KI5A 1L8QA 4YXWA 5LB2A 1QG4A 4PZYA 4QJ5A 4ZDKA 2OBMA 4X8LA 1IONA 1WXQA 3AV0B 2XEXA 1P72A 4QNRA 2QSZA 4WA7A 4JBYA 4DLWA 1XF9A 5B64A 3WP1B 1TF7A 1RRGA 1NKSA 2YYZA 1A4RA 1T5IA 2BVNA 1T3SA 3CZPA 2VL7A 3NKVA 1EXMA 3AKDA 3WNDA 3SFVA 4BEBA 1KNXA 2O0KA 4M1TA 2CE2X 3BFXA 3RRZA 4HAWA 1OH7A 3EPHA 1M2OB 3B8HA 2V6IA 2ZR0A 4C2TA 5G3YA 4A15A 3UWOA 2FFAA 2OV2A 1OH5A 2WKRA 2XNDA 4Q66C 1EFUA 1HV8A 3K0EA 1NN0A 5B2ZA 4YMSA 2A9KA 1GRRA 4DZZA 3ZZ0A 3WY9A 5EE9A 5HZHA 3RS2A 4LC0A 3U4QA 1VYTA 4MYUA 2QI9C 3LLMA 4IXNA 4JLVA 4AYWA 1YZTA 4FMDF 1IM2A 2C03A 2GXAA 1J7KA 3PQCA 3I5YA 5FTJA 1JQJC 3C16C 3LBHA 4Z54A 6Q21A 1MRNA 2F43A 4AG5A 4DCNA 3A1UA 1J90A 1XPUA 3Q3JB 4QHSA 1JAHA 1X1RA 3K0FA 2NTYC 4MKIA 2C04A 1ZMXA 2EW1A 1NVVQ 5DI3A 1YKSA 3TJZA 4R2HA 2P0EA 4NP6A 3QBVA 3ADCA 1DO0A 4HEJA 3RLFA 2IYRA 1A2BA 4DCUA 2IL1A 3AKYA 3B6EA 2GZHA 3UKDA 3U3RA 1EK0A 3I32A 2LCFA 3F0TA 2F1JA 1JR3D 3NC1C 4MITA 2CLCX 3PJRA 3JZAA 3OHMA 5EE0A 2OCYC 3K1JA 1XZQA 4C4PA 3LBNA 4TMWA 4KFRA 1S9DA 2CDNA 4CGZA 2BEKA 2CL0X 2XGJA 3ICQB 2QQ0A 3CW2A 1VECA 2BHRA 3SYKA 3W9YA 1XWIA 2XTZA 2D7DA 2ECKA 1Y63A 2GCNA 4US2R 4OI1A 2JJ8A 3NVAA 3OFNA 1XD9A 1G8YA 1XU4A 2QENA 4P32A 5KYKA 4US0R 2CHQA 1SZPA 2QM7A 2VHCA 5FPKA 1G64A 1N6KA 1FNNA 1FP6A 1UKYA 3NTUA 5DE3A 4LY6A 4UNRA 2F43B 1Z2CA 2QL6A 2G9NA 3UMFA 1W1WA 4RD4A 2Q9BA 3ADDA 1ZW6A 1E2IA 1Q21A 5DHFA 2J0UB 2DYKA 4BLPA 2GAAA 1TU3A 1KI4A 1G21E 2DFTA 3LY5A 4B2IA 4Q7MB 2JJ2A 4JLBA 4QRHA 1DG3A 1W4RA 2D06A 5JSZB 4MDEA 1XCGB 4RJLA 1SVLA 4LHWA 3GLGE 2ODBA 5AJXA 4NU0A 1E9BA 1IN7A 5JS8A 3QKUA 4DWJA 1OB5A 5FTNA 2FPKA 3I62A 2ZJAA 4MKHA 1R0YA 2G88A 1XMVA 3PUVA 4V0NA 3RC8A 5ELXA 1XPOA 3GLFB 3ZQ6A 1DARA 3K0AB 2ZRKA 1U0JA 3LBIA 2KJQA 3TVDA 2R8RA 2GCOA 3CH5A 3P4XA 1OHHD 5DN6D 2ZPTX 1EFHA 4WZBE 1EFRA 2VPPA 2BV3A 3T1VA 3EZ7A 4L9WA 4S2EA 4B76A 1KO1A 2VSFA 2ZI3A 3K70D 3KKQA 1KZ7B 1N6RA 4B34A 2O8BA 3LXXA 3EPJA 1OSNA 5JWHA 5F3WB 4ZPXA 1SHKA 1SXJE 3LVQE 4KBGA 1S4QA 1W44A 2ZQ5A 2NPIA 3BH0A 1II9A 4ESHA 1NSTA 5GJVC 5IRCD 2GZDA 3RABA 4PXAA 4C0SA 3VQTA 2WJVA 1UJ2A 1KTVA 3K0SA 4JT4A 1G3RA 2VF7A 3NHAA 3OEED 1SQ5A 4Q02A 3CR7A 4ZCMA 2X77A 3EC2A 2V1UA 1KI3A 2Z4RA 2GTPA 4TMXA 2F55A 3R9XA 2CVHA 4TLBA 3FWYA 2J46A 2B8TA 4HLCA 4TYYA 1PLJA 3PR1A 1A7JA 3QBTA 3UATA 2BMDA 3NEYA 3N5CA 4TZ0A 1VHLA 4RY2A 4A2PA 1G3IA 1W47A 3KTAA 1ANKA 3GJ6A 2EFHB 4EDHA 2N42A 4B3XA 2BM0A 1KNQA 3ICEA 1R0ZA 1A82A 2ZJOA 2H5EA 2QTHA 3LVRE 3ND9A 4PAMA 5SZKB 2O8BB 4Z51A 3U6BA 2HF8A 4RFVA 1NIJA 1OW3B 1SXJA 1VHTA 1N0WA 3RHFA 1FMJA 1XMSA 3U44B 2WSSA 3U7EB 2AK2A
chains in the Genus database with same CATH superfamily
1N2JA 1ZD1A 2A5FA 5FYDA 5I7UA 3DOFA 1QG0A 2FTKE 3AR6A 4WNYA 3I9OA 2V9CA 5CVDA 3KQVA 4LF5B 3W6NA 5LPNA 1G6Q1 2PT7A 3DNPA 3GGDA 4JA2A 1H4TA 5L6LB 5HVNA 3EZXA 5TRTA 3H1AA 4PGMA 3IBCA 5H7XA 1E99A 3PUWA 4PQEA 5EIHA 4IILA 4PBTA 4MEBA 2NM0A 5CA0F 2I7TA 2J59A 1Z3IX 3ZH2A 3Q5GA 2C7PA 3E2PA 1P6XA 1RE1A 2NQTA 3FBTA 3QVMA 4HXEB 2AFRA 4CM6A 1Y34E 2XYPA 2VDUE 3A28A 1F5NA 2ZAMA 1S6YA 3QEJA 4GI7A 3ZC3A 3DOUA 1VI5A 2OXFA 3AF1A 3GEHA 1MQSA 3N07A 4AF8A 3QEAZ 5KKCA 3TX2A 4ZDJA 4XPIA 4CR6A 5CEJA 1I80A 3BEOA 2Z08A 1FU7A 4YBRA 4B3HA 4UMDA 5F12A 1YRHA 1CULC 3RRXA 4DJDC 3EMVA 4PONA 1PEAA 3DL7A 1Y7HA 5A0VA 3EF0A 4QM7A 4FYKA 2H63A 1Z4NA 4F9EA 1N6IA 3OUUA 1LK7A 1N1DA 1LVGA 1YR6A 4N5LA 4Q3OA 5DT9A 3MT8A 2VAVA 4RMGA 2C78A 4JL8A 3VPHA 2F00A 4I2VA 1GU0A 1JG3A 4DDKA 2PXAA 4D1YA 3UFXA 1RQGA 2C95A 1Q6ZA 1KPGA 3AYZB 1UPXA 1JLLB 4IEFB 2OGUA 2W2VA 1U9YA 3CX6A 5EWMA 3OQOA 1L8LA 1P9NA 3N2GA 3SC2B 4OYLA 5LQJA 4D02A 1KK3A 1UXKA 2XZPA 5KYUA 3OCCA 4JASB 1M34E 3L1HA 3PXDA 4LY0A 4XGRA 3CSDA 1R3UA 3BDIA 4M89A 3GNTA 2CCGA 3RVMA 1ZUHA 3QVUA 4YH1A 4Z8XA 5EFZA 1E7RA 2YZMA 2QRJA 4HRVA 2C61A 2Z30A 3PC6A 3LA8A 1A27A 4WE3A 1QC5A 4G1CA 3ZEAA 3HYLA 3U19A 3O74A 1DKPA 1G8FA 2C2MA 2PSSA 1KO8A 2QNBA 2XHZA 3CUYA 3GFQA 3PIDA 4JENA 4NJMA 2I22A 2VJBA 3EEYA 1F2TA 2EJTA 1DX4A 3MAAC 1MO3A 5DU2A 3RVDA 1QAQA 1WHSA 3DQZA 1XZFA 1FFCA 2YKGA 2VPYA 1SIBE 4G67A 5SY4A 3G49A 4F1KA 4HJRA 1NATA 1VRVA 4J94A 1QIHA 5DYWA 1DC3A 1KF0A 3AJDA 4ZVPA 4F2HA 1G17A 2L0XA 3EGVA 4MSUA 3T5GA 1XSEA 1IHUA 4Y2QA 2PQ0A 3KSRA 4GC9A 3EIEA 1IZ0A 3ZHVA 2NXWA 4YREA 1YS2X 4UFOA 3TMYA 1RI4A 3FUXA 4UUNA 2RC5A 2WABA 4GP6A 3REQA 4KVZA 2P0AA 3VH3A 4ZI3A 2OUIA 4OXQA 3PCTA 4LJ6A 2J5QA 2ZR9A 1KMCA 3ZS8A 1NBWB 3FYCA 4N3GA 1S2NA 4I50B 1M73E 4X45A 2P6RA 1KEUA 4MUKA 4DG9A 1VG1A 4KAFA 2IOYA 3E9RA 1J2YA 4PVDA 1JG1A 3UIEA 1NN5A 2MYTA 5CBKA 5HZGA 4DV5B 2XTNA 4QUGA 5HCIA 3TX6A 5HRCA 4Q39A 4IYRA 1X9HA 1V8BA 3ISJA 3BF7A 2V6GA 4GUAA 5A3QA 1LU9A 5HJ7A 1A8SA 1OE0A 3AR9A 4HEHA 2VHVA 2EG9A 1LW7A 2DSTA 2OC4A 5AI9A 3VPCA 3SP1A 3I01M 1E7SA 1E1NA 1I0IA 2DM6A 5JARA 2ERCA 2GPSA 3FR8A 1AS2A 3NUGA 4FD2A 4KQ1A 4Q7JB 3ON5A 1DTSA 1JDBB 4QUJA 5FOUA 3BWDD 3CA8A 1PR0A 3H2BA 2UZAA 4RD1A 3U62A 1YZFA 4MUJA 3LFHA 2DWCA 3A4IA 3QTLA 1BD3A 1PT8A 2GRUA 3KOXA 1HZZA 1QLHA 2WU8A 1YRBA 3VYSB 3LI2A 3GRUA 4ZP1A 5FR2A 3W9SA 1JYEA 1R8XA 2O7RA 3N9IA 3AXSA 5JZMA 2QGNA 3EQ8A 1Q7BA 3U48A 2QXTA 3GFTA 3N0WA 4RHXA 4OA5A 1I24A 1RZ3A 3LCUA 2WJPA 1VDZA 4YRTA 4F4FA 4V1CI 3RANA 1ZN2A 3JD0A 3RS5A 1KDYA 3MGGA 3W2TA 1WKVA 2ISSD 3OWHA 1W85B 3VC1A 4BMSA 1LRLA 1CDZA 3FCXA 2VF2A 2QL7A 3ND8A 3RRFA 3KSBC 1LJUA 4MQUA 4X7PA 1O95D 4NMHA 1DMSA 1JG4A 4MV7A 5IUKC 4BP9A 2ECPA 2IEZA 1UWVA 3WDLA 3JYNA 2VI5A 1ZD3A 4N0EA 3CEAA 5BNIA 2IU4A 3C8DA 3R5KA 5KOJB 4IXDA 2XGOA 2WC1A 5CA1A 4EG6A 2IX9A 3P2OA 4HGQA 1J24A 4MS3B 4RW0A 1P0QA 2CXSA 3L82B 2XODA 4KGVA 3FOZA 1WDWB 4Q93A 1YHNA 3CT6A 1P75A 3CF0A 1OVMA 4WCVA 2DPHA 3SC3A 4HNTA 2FFRA 4K40A 2FU5C 3MD9A 3NU1A 3R4VA 3AHEA 4XB2A 4NYJQ 3L6OO 2CV1A 1NX9A 2GPBA 5TT0A 4C7XA 5BWCA 1E94E 3QG1A 5JFTA 1UH5A 3PV0A 2Y93A 5ESDA 4A6PA 2I8AA 2VNIA 1CY0A 5I4CA 1ADYA 2AVNA 1DEOA 3KJEA 3MRSA 1VDMA 2C5GA 4ZOAA 2R48A 1YK0A 3HXKA 1JJIA 2EQBA 2VJMA 3MJ4A 4M1EA 4WZBB 1GSIA 5AW2A 2Q4TA 2DKFA 3M83A 4G9GA 1PFYA 5C35A 1PT7A 2XUFA 3BMCB 4O3FA 4C4SA 2PG3A 3L8EA 1VLLA 4B4KA 4HLUC 3MG9A 1U2QA 4QU8A 1YI1A 4FFVA 1AA6A 1F17A 1KH3A 2B7CA 2WD7A 5K6TA 4OKSA 1VHQA 3T15A 4AF6A 2XNSA 5JDIC 1Q7EA 1U2DA 3IC5A 3EK2A 4K6MA 2ZUCA 1FUEA 5E1BA 1W9HA 1X7XB 1DZIA 1JIUA 1U99A 2BEWB 2PDAA 2FZLA 3EVCA 3FBWA 3K4PA 2ZRQA 3DV2A 3WIOA 2VYQA 3HS3A 5KYGA 3ZD7A 4D4IA 5IH7A 4TL7A 5JISA 2ZSUA 2GN4A 3JV7A 4H35A 3PS9A 1DC7A 2NU7A 1V47A 3THOA 1QRTA 3LVBA 4MW2A 3SVTA 5FDFA 1TYBE 2J45A 3BORA 4XYMA 2HN9A 3WNCA 3OIYA 2VC2B 4GXNA 1CC1S 1EFTA 2RGBA 5EERA 4N82A 4ZO7A 3G2QA 3T34A 1WDLA 3W06A 1RRMA 1ZRMA 1VSQA 4MVXA 3WLNA 2GESA 5LQMA 1MB2A 4QLAA 1C3EA 1A9XA 3Q15C 3BMXA 3IESA 4XI9A 3Q3VA 4QOIA 3MCZA 1O1YA 4CM3A 1L3BA 1JVSA 4PEVA 4IW3B 4RFLA 4AJ1A 2L82A 4K1LA 3TD9A 1ORWA 1Z4IA 1COWA 1HL3A 1KKLA 1PNOA 2IXFA 4PWYA 1LXCA 1RWVA 5T4BA 3SHOA 5A4KA 2JFBA 3ZGLA 2GN2A 2PPLA 1BJKA 4KTVE 5BSGA 3QNWA 1AUQA 1ML4A 3TJMA 4YUAA 1UL1X 2H1VA 4EK9A 2JGIA 3TZLA 3INGA 3OZSA 1C1XB 4IV0A 5COBA 2P75A 3IE2A 3UO8B 1H4QA 3OVMA 1GTRA 3U31A 1V9SA 1DCTA 2HR1A 1WMSA 2HMAA 4X66B 2DH6A 1EZZA 1S9HA 1A7UA 4P82A 4WADA 5CJ2A 5HKKA 2QT1A 1NXTA 4H6PA 2CT8A 2Z2YA 3K9CA 4IJWA 2BMJA 13PKA 1N2CE 3HMKA 3ICVA 4XJTA 5G40A 4O2BB 3DM9B 4BMNA 5AFSA 3T4XA 1XZGA 1OXUA 3HEMA 3IOMA 2OORA 3C5WP 5GM1A 4D8UA 3ND6A 2IHZA 2X1LA 1WXGA 4IUYA 3T7DA 4G23A 1FSFA 2O2CA 3D5TA 1ZHHA 5T6BA 3L6DA 4YCMA 2NGRA 4JWKA 3URKA 4DLRA 3HY3A 2PKWA 4ILEA 3IBFA 4OP1A 2WV9A 4LDQA 1X70A 3E7DA 4Y9UA 1IXKA 3OT1B 1JMKC 3A32A 1PS9A 5DCYA 4D0RA 3MMZA 2VEOA 5EOVA 1E2LA 3IB3A 3VYUB 5E9AA 4GX5A 4OXIA 3VH2A 2HJGA 4AZ3B 3PA8A 5LQNA 1UP7A 4J6EA 2W6OA 1WPRA 1EBUA 1PW5A 3QNMA 5HW0A 3IUMA 3Q10A 2B4QA 4M38A 2ZUBA 2H2IA 2PMDA 3EHDA 4JLPA 2ZIXB 4PHCA 1NYQA 4B1FA 2FW0A 4JEMA 2QA5A 5CJPA 2HCTA 2DBYA 3NW9A 4QQNA 4UHFA 1P5FA 1B0PA 4BQQA 1ZU4A 4NENB 3EG9B 3HWSA 4XCXA 5G0SA 4XWWA 5EUCA 1CR4A 1RBYA 2BFFA 1Z4LA 2XCIA 1AKUA 4UUOA 5LBIA 3STTA 3UUGA 3NNSA 4URFA 1HM5A 3ZHTA 5JO0A 4MICA 2Z8YA 3T7EA 1J0AA 2VT2A 1TCAA 2NN3C 1Y8QA 5IG2A 1QVWA 4KQ2A 1V6AA 2BMAA 4CXMA 2JLBA 1HNZB 3IBSA 3CE9A 3N3AC 3PG5A 4ARIA 1HTTA 5AI5A 2G1AA 4AN0A 1FP7A 4WVLA 3FMVA 5JAOA 1L4MA 3W2IA 1F4LA 2BSQA 1FRVA 1G16A 2P4UA 1DGQA 5KQRA 4KXVA 3NHRA 3SBDA 3VPAA 3ZXIA 4MV4A 3AWDA 3WRXA 3ZNOA 4B87A 5FAKA 3OC6A 3M6IA 4LVOA 3WYBA 3HCFA 4DCVA 3SVLA 3HU5A 4XKJA 2PJUA 5A5GA 5JUWA 3GRPA 4X1IA 5BW8A 4US1R 3P7MA 1Y42X 4OMCA 3PRKE 4KCGA 1JKIA 1RAHA 3EG5A 4JJZA 2YWHA 4R5HA 3SR3A 1Y1QA 5IZCA 3HI4A 1NW4A 1Y3FE 3H1BA 4GEGA 4MVJM 5CBPA 1QHYA 1WMAA 5JH7B 1ESZA 2R00C 4F8YA 3AHFA 1XRPA 4E5PA 3H65A 1DQRA 1BS9A 1H1TA 1Z83A 3AG6A 3GJ3A 3OM9A 3UK7A 1ZWKA 4E33A 3WBFA 2B3DA 1B0AA 1NVAA 2HCBA 5DHUA 2X0DA 4C6TB 3H97A 2QTFA 1M1NB 2D5IA 4QBTA 1YIOA 3RPEA 1EJ2A 3OZFA 4FMCF 2YFQA 1EBFA 4I1OA 1V6CA 2DMRA 4IIXA 4M9QA 1LZKA 1KOGA 1KBOA 1LDNA 4IBOA 4PSKA 1HQDA 1O2DA 2QJFA 2NXNA 5EJEA 2IYWA 1CR0A 5AYVA 2BUBA 3KFLA 3V5NA 3ACCA 1II0A 1TT5A 4YUWA 2WWHA 4EG1A 2DB3A 4Y0VA 2HADA 3ZIDA 3M8KA 1UM8A 5HDBB 5K3BA 2OA0A 3VRHA 2FPGA 5BN1A 4PCVA 4JLKA 4JBLA 2F1IA 1M2VB 3LDHA 5FA6A 1XXHA 1G8GA 5L3QB 1KU6A 3V8QA 3ZGOA 2PX8A 2ZXUA 4JGBA 4QODA 1KS9A 5BOSA 4N49A 3HB0A 3LZ6A 3QLVA 2PWBA 1OYVA 4XZ3A 2NLOA 5LXTF 4ZTZB 5GADl 2YASA 3YASA 1PZFA 2IDJA 2VAXA 3JU3A 3FW1A 3IT3A 4ZO9A 4D26A 3ROTA 3DWFA 3T6KA 4EEXA 3A6PC 3JQAA 1QORA 3A11A 4JYMA 3D4IA 1EG7A 2XMQA 4G4IA 3WRXC 1PT9A 2Q2WA 2JBAB 4BIIA 1I4WA 3ML1A 3C15C 2BSAA 3EGOA 1E8NA 4DIFA 3VI4B 4NJOA 4HDCA 3ZZMA 2AXEA 2ZG6A 3QKSA 2Z6VA 1V11B 3ZJVA 1QHHB 3NATA 3PT5A 2HSJA 3ANYB 4HNQA 2HGZA 4L28A 1YOBA 4GOXA 4TL6A 4F5ZA 2WF5A 5AHWA 1NDQA 1D5WA 1GZ5A 1W0KD 1A9YA 2XGSA 5D5PA 1OAKA 3MUOA 2ID9A 2ZVDA 3H5RA 4H0FA 4DSAA 1I7QB 2IUTA 4WCFC 1X1QA 4YAWA 1VIAA 3BOSA 3FMPB 1IVYA 1ADBA 1HPLA 1N3BA 3EGXB 1Y4AE 1JP7A 3HFGA 4NEQA 5GJWC 5C8YA 1Q0SA 4ZI7A 4CT0A 4R98A 5AVXA 1PR4A 2D4HA 2QZ4A 1TLLA 1BFKA 1SUBA 3ED5A 4A2CA 5JNVA 1MRSA 4E21A 5K3DA 5L3QA 3KR2A 4L5CA 8ADHA 2Q8NA 3PENA 4DUGA 5FP0A 1L7OA 1ZAYA 1WNTA 1E7QA 4FYXA 4D43A 4IHAA 2GX6A 5EVCA 2IYSA 2HSDA 5DH9A 1U7HA 2Q27A 1BDHA 1LC0A 2VF8A 4K6OA 4AAYA 1W2WB 4JMPA 3QE0A 4Q12A 2I99A 3T9CA 5AVYA 4EECA 4G1MB 1OPXA 1OT5A 2YYYA 3GJQA 4LOJA 4RKYA 2ZBQA 1Y4SA 4KO8A 1UAAA 1H2WA 1QIEA 2YBDA 5I47A 2CWDA 5K0JA 2CVZA 4KBYA 5CCBA 4CYMA 3M1AA 1GG2A 4FC7A 4HGNA 5A06A 3EEBA 2QTMA 4W9NA 4ZOLF 5LIRA 1KJWA 2EHDA 3OIDA 4QPZA 2C8LA 4GOLD 3BRSA 5REQB 3EYAA 1R5BA 3I6IA 3TAUA 2DLDA 3RUHA 3DBHA 4M8LA 3TYXA 2WU4A 1HQYE 3CZ4A 2JH8A 3OT5A 3KQPA 4I0WB 2ADOA 5B7PA 3U4IA 3KG2A 4ARZB 2WYUA 1KI1A 3WK6A 1WCV1 5GOZA 4HSEA 3KBOA 1C30B 3NTVA 3DO6A 3ORRA 3UJAA 1JW9B 1M33A 1ODTC 1Q11A 1VBMA 2J0SA 4JS0A 5C4IA 4H1WA 4R7GA 4CIBA 4S05A 5E2IA 2A3NA 1KEPA 3SKYA 4HUJA 2XVAA 2FZEA 1H5UA 1ZVKA 3DVAA 2ASVA 2ZB2A 5DTEA 1QSGA 2CLIB 3TD6A 4AK9A 1KFJB 4JGIA 4ASUA 1X39A 4UOEA 3MILA 5JY6A 2Q62A 2RKOA 5AVRA 1E0SA 5F2NA 1A88A 4D80A 1T4BA 2Y1XA 1CNFA 1JPUA 3M3HA 2EARA 3AIIA 4BVAA 5IDVA 1C0EA 2EIXA 4CLEA 4YDHB 1OLOA 1YUMA 5HZKA 5B1YA 2QX4A 1YFZA 4J0QA 3V4SA 3K15A 3D6TB 3MWYW 3B12A 3IHLA 4MYCA 1J7JA 1X7WA 3O1LA 4TWAA 1GUFA 2Q5CA 4P83A 2JLCA 3AVOA 4D0GA 5LOVA 4ZU1X 2B99A 5IDXA 3QFHA 1IG3A 3GJTA 2YHSA 3ZHYA 1OTHA 1G8HA 5E6RB 3VDXA 4F45A 4JVNA 2I67A 1JHVA 4Q1EA 4ND1A 1LSUA 4WNCA 1R4AA 1L7EA 4BFZA 3OETA 4DFDA 3ER6A 3II6X 5KOYA 1Q92A 1U9CA 821PA 1G5TA 4ZCRA 2YFKA 3IT1A 4Z3DA 1SD5A 2WUFA 5CA0B 5HJEA 3KB1A 5AW6A 4HDRA 2LZ0A 4Q4JA 4BV3A 2X0RA 3NRCA 1GSHA 4FSXA 4H3VA 1R4NB 4YMWA 3GNQA 4I55A 5AXBA 5T4EA 4U2KA 1FMTA 1JQ5A 4QPPA 4HN9A 1KS2A 4HDAA 1BA3A 1NLZA 3KJZA 2WD8A 5JXHA 2YUTA 2XBUA 3RBAA 1UK7A 2PX5A 4JC8A 1RLMA 4KQGA 4KR2A 1JSRA 4FD3A 4XPZA 1I14A 3GAMA 3IMFA 2Q4OA 3EWNA 4HO1X 2LCQA 4CIAA 2B7LA 5HXAA 1JQEA 1HWYA 3RFFA 2D59A 1G2QA 4E1AA 1K2WA 2ACWA 4JI1B 4KO1S 4P31A 2J3EA 5BQ5A 1MVNA 3V2UA 4YFYA 1U4SA 2C4MA 3IO3A 5ALYA 1ZDMA 2RBKA 3KU4A 1AQUA 5E3IA 3RUPA 2A5GA 1IL0A 2F1RA 4FU0A 1V8DA 2V9ZA 3EUEA 5LA6B 1LFDB 3FOBA 3WWZA 2F59A 3TLXA 4B79A 2E48A 1YVUA 3IB6A 4FHFA 5HIAA 1UC5B 4TYNA 3INYA 1QP0A 2RGRA 5CM9C 1ZRSA 4XYLA 1BS1A 3TOSA 1WNFA 3K5PA 4G5XA 1P0CA 1KY3A 4BY9E 3MOSA 4MIKA 1I6LA 3U26A 4UU8A 2CK3A 2DWUA 1LBEA 1JHXA 2BKXA 2WSMA 1CQIA 3DGEC 3ESAA 4UXIA 3G0HA 3MLEA 1R0LA 4MB6A 4FDLA 4F8JA 5CU7A 3KDAA 2DTEA 1LBTA 4MWCA 3BWBA 3D9QX 4Q6WA 3VJKA 1YR9A 2FN4A 3IP6A 4HZUB 3NOXA 4I55B 3KJFA 2B5WA 3QKTA 4PG6A 3BDVA 1FPMA 2JLQA 1KAMA 2QOEA 2XB6A 4KFTA 1QTIA 3RFVA 2WUDA 1VJCA 4JQCA 3K09C 3RTGA 5B3JA 4B4DA 4FBMA 2FP3A 1B8UA 2BKVA 1F14A 1ZOSA 2VTDA 3FCCA 5TC4A 4B3FX 4IDQA 5LQRA 1SCJA 4RMHA 4ZMBA 1CQWA 4BO4A 5KTRA 1QYCA 3G02A 2OLEA 4R69A 1K66A 1H93A 2C54A 3EXAA 3HCNA 3B38A 2OHHA 2WKWA 3DV0A 3OJXA 1CUSA 4I5FA 4XLTA 4N3AA 3K2IA 3TQHA 1FRNA 1MX5A 1RADA 3U4AA 1CZHA 3F7MA 1AA9A 1CY4A 4KFUA 4XDGA 2QTBA 4PYIA 2P2ZA 3N58A 1ONBA 2W2PA 4YAJA 4ZVVA 3SF8A 4KHPB 1OFUA 1YE5A 3E3NA 2WU0A 3A6EA 3HGTA 2XD4A 3JZIA 4KITB 2JGFA 3N8KA 3TW0A 4RYLA 4DC9A 1N0UA 1PJ8A 1WD5A 4FYHA 2FHPA 4WZZA 4WBNF 3LDGA 3O4GA 2BFNA 2KYRA 5KVCA 3J81k 2CLKB 1IUKA 4DS3A 4F2PA 4PSDA 5B6JA 1QYXA 1ECJA 1PDWA 2CVOA 4NCIA 3DFMA 3IPYA 4TKZA 2C5HA 3LF1A 4UVDA 2AJLI 2OGZA 2GPYA 3IDSA 3RJTA 2BF4A 4EJ0A 3MNFA 4G0QA 2QVCA 2GETA 3ASUA 3DEIA 4FGZA 4L85A 4U39A 5B3AA 1RYBA 1E32A 3COSA 5IBRA 3T5MA 1U7ZA 3WQRA 3I04M 2Q29A 4JOCA 1Z5NA 3HVIA 4V0SA 1LUAA 3QE2A 4TT8A 2E4UA 4U7WA 5EIWA 4KR7A 3O4FA 5HMLA 3ZHXA 4A8JA 1WUIS 3HYRA 3FYUC 5CTAA 4RA6A 5I7HA 4U7FA 3KVRA 1G2PA 4N39A 1Z63A 1M8GA 4XB1A 4C08A 4QOGA 4PLYA 3X1YA 4E2FA 3TXYA 3VUFA 1SOVA 4RMIA 5E9WA 4I55F 5BV8A 3NHLA 3FWZA 2A5YB 4UFNA 2IHUA 3EDOA 4Y18A 2W71A 3DLPX 1Q77A 2VT7A 2HC9A 2GB4A 2EIHA 2WKQA 4J7XA 4IIBA 1WDMA 2C1EA 4XB6B 5AUPB 1EH5A 3AVPA 3DV0B 2RSLA 3K92A 5EWJA 4FGSA 2AZMA 1P3JA 2D8AA 1KI7A 3Q12A 5DJ5A 3I73A 3TTYA 3LT1A 3ZGZA 2VTKA 2FW9A 2PR2A 2H59A 5AXAA 1IEVA 1HEIA 2BGLA 1FFXA 2C59A 3GJ0A 4ID3A 4JMLA 4QUEA 4E11A 3I5XA 1RACA 5JZSA 2V7GA 5B37A 2IEYA 4AX4A 1E0JA 5AVJA 5DO9A 1OX4B 1C4OA 2ZYWX 3QELB 4C2AA 1FDOA 2ZYHA 2OFXA 5H1YA 4EAQA 5EN4A 2CJXA 1O97D 3MUNA 2NVUA 4M1ZA 5PGMA 4Z3OA 1WBJB 1ECLA 4MKFA 3IAM1 2IJGX 2JD0A 5JQGA 2O2ZA 3RJMA 1U0TA 1D3AA 4RTMA 4LOHA 4KACA 2DJ5A 3PU6A 2JLWA 3OCYA 4I2NA 2PTHA 2BCEA 4M1SA 4MLPA 1YFJA 3HV0A 4OQEA 1GP2A 3HA5A 2YFHA 3C8HA 4UKDA 4OP2A 1T0JB 4BLQA 4EUFA 4M9RA 4TWBA 2HUNA 4OG2A 1W76A 4XX0A 2GEFA 2PAAA 2I6UA 1UZAA 3AVXA 4X63A 1CW2B 1FYVA 1YZQA 3IEXA 4K46A 2CXRA 3WDKA 2NXJA 1H6BA 1E5QA 1H6DA 1N4AA 4YO7A 1TM7E 5I9SA 3K6RA 1TJ5A 2FX2A 4LYFA 4XJSA 4YQZA 2C57A 4EPVA 4R31A 5JS7A 1EDEA 4E51A 3V1TC 1QQAA 4RPHA 2W48A 1DAIA 2IYAA 1NV8A 4OJTA 5TQ0B 5IKEA 1K9VF 1EPUA 5A4JA 3OLVA 4RZUA 4EVQA 2JJ2D 4K6KA 4JVSB 1LKZA 3JQ8A 3KUCA 4BNGA 4WXPA 2PUCA 1B14A 1KO4A 3AUTA 1LDGA 3KZOA 3QYFA 2A1TR 3F98A 1NNEA 3HJAA 4DXDA 1YULA 5T8KA 1DWOA 4RXTA 1V1RB 2R6DA 3B5EA 4AQDA 1K5DA 1ZP6A 3RSLA 3AFIA 1VMKA 1E18A 1O6ZA 2A84A 2CXHA 1EVEA 3V3KA 1CY2A 5DK6A 2BTOA 2A0KA 1J07A 1LC3A 3S44A 1C7FA 4IS2A 3D1JA 3K9BA 3LUKA 4JYBA 5EWMB 1VPEA 1QRSA 1SBNE 4FDMA 4YMLA 5ADUS 3GT3A 4JKYA 3KPJA 3RYTC 3GG9A 2X8BA 5HQJA 1VKNA 3GLQA 4FFNA 2HWUA 2ON6A 3ENWA 2Q5HA 1ZI9A 2CB0A 3K0KA 5HILA 3TAXA 1U9JA 2Y1FA 4IDPA 4KN8A 1L4LA 2C9CA 2XOKA 1HEYA 1U3WA 4C29A 4AJ4A 1E2MA 3M6UA 3CWQA 1DAPA 4PLTA 4WNAA 4MWOA 4ZAFA 2OENG 2ZAOA 2KS6A 2P1DA 3CXUA 4H2DA 1XZHA 5HIIA 1LNZA 3MT0A 1TF5A 3JRNA 3H86A 4ZYLA 3SBXA 2ZRIA 4BZXA 4MUYA 5ESRA 4DUZB 1G60A 1G5RA 4RL4A 4UEOA 4XFDA 4IJMA 3TDNA 2GBCA 1TZJA 4MKZA 5KAPA 3OEEA 2AFIB 1Z15A 2Y1KA 4WW0A 2GJSA 3S7TA 5BUCA 1O7JA 3Q1LA 3NYIA 1XG5A 3GC6A 2AKYA 2ONCA 3AM1A 3RYIB 1N6HA 2FZCA 3I1IA 1CJCA 2ANCA 1GKLA 3NALA 3TIXB 2WYOA 2NU8B 1GV0A 3ZY3A 1N7HA 2CJWA 2HFKA 4JLUA 1ODKA 4RCZA 1YA6A 1VCNA 4R4JA 2PVSA 4WOJA 5H83A 2VT3A 4OY3A 3FCYA 1CZRA 4J1SA 2XB2A 3DMDA 2QAGA 3GYBA 4FYVA 1SQGA 5B3LA 3CNOA 4B3GA 2F3SA 3RNOA 2EYQA 3USZA 4WNIA 3WGTA 4EVIA 1I4LD 1KZ6A 4QBIA 3BSYA 4XTRA 2HK6A 1T43A 2IEBA 3SJ7A 5KB3A 4JP3A 1VGRA 3DJFA 4IQ8A 2EXXA 5EP4A 1AKQA 3I6ZA 2BI4A 2BZSA 4J1TC 1X19A 4QOSA 1QJ4A 5IJ0B 1Z6PA 4EZBA 1OR8A 2PZGA 3GD7A 2HA2A 3OLQA 1Z13A 1Z0UA 3CLHA 2ZTVA 3HCWA 3NHSA 3PQ5A 5DCLA 4YIKA 3ZKWB 4AJEA 1IEXA 4DDMA 4DLBA 2JS7A 3JPYA 4RJTA 2FN7A 3GEPA 4UQLA 4B83A 3TIIA 2PYZA 5ICFA 1USVA 4BX0A 1EFDN 3HNPA 5AM1A 2X42A 5E9JA 3R75A 1Y1KE 1V4NA 2X5OA 3F6SA 1NOIA 4U3JA 4EA9A 4GWLA 4NBUA 1NW7A 3BXOA 3FZNA 4GOJA 4RV9A 4FFDA 3UMRA 5L9AA 1OI7A 2ZU6A 2NAFA 3E5RA 4MUAA 3GFPA 2VLBA 3Q85A 4RK1A 1KH1A 2UXCB 4JV5B 2CNWD 1RWNA 2QSJA 3EDYA 3O82A 1NMXA 3SIPA 4BBPA 3MJTA 4XQ9A 5IAJA 1I4TD 1C1YA 2WRZA 4C20A 4UCXA 3NBQA 4S3MA 1Z35A 1HYHA 1S01A 1LWOA 2A3RA 3AUYA 3ZV5A 1MHPA 5B1IA 3NXSA 2J3LA 1ENOA 1EVQA 1W73A 4QATA 4WKOA 5ELLA 1YC5A 1OV4A 3UFBA 4O4HF 1O3YA 2E6KA 4R9RA 1OI3A 3KOYA 3NJ4A 4HWOA 3FSGA 1AB5A 2PL5A 5E1OA 4IOKA 1D1PA 5BN3A 3CX8A 3DPIA 2ZK7A 4B74A 3QWFA 3IBYA 1ZY2A 2NUTA 4ZHQB 2XZLA 1F48A 1QHGA 4GKBA 3PYMA 3ZCQA 5HUHA 4B2PA 1ZESA 2F6RA 1I0LA 4A6XA 5DGHA 4EA6A 1IBRA 3F6BX 4UUPA 2W2KA 1D2GA 2R4TA 4AY3A 2BCJQ 2BEJA 4AJKA 4OX9Y 4LFBB 3G8CA 1DEKA 2F8TA 1MN6A 1D2NA 1KP3A 3BKWA 4LZOA 4ZT3A 4OLAA 1Z6GA 3B1KA 2QYTA 2X8JB 2PFKA 2WVJA 1MH9A 2D5BA 1HFEL 3KL4A 4M1YA 4ZVMA 2YS7A 5BRNA 2V65A 1P4AA 2B2XA 3AEXA 1RLJA 1CIVA 4QUDA 1KC1A 2I2CA 4EFDA 1P1HA 1TNDA 3ETCA 1FMCA 1GQ2A 4OKIA 1JTFA 5EJ9A 5CXUA 4LF7B 1IHOA 2B1JA 4RU1A 2F3QA 4LPKA 4N01A 2VYNA 2GCIA 1PQYA 1CUZA 2FSVA 5IANA 1NBHA 2JJYA 5KOHA 1KQGA 1IZZA 4FR5A 4JXXA 2WKSA 3ESCA 5EI5A 3QUBA 4AW9A 4R2LA 4FCCA 1NYLA 5KMGB 5JT1A 3SXPA 4POAA 4EYQA 4LX8A 1T3LA 2AD1A 1XDBA 1Y9ZA 2ODEA 3GZNB 3KYDB 1QZUA 5DZSA 4WK2B 4RX1A 5FNVA 3AETA 2FKNA 4TL8A 3CWZA 4EATA 3RRNA 5ELMA 1ESCA 4GL2A 5FH9A 2F4NA 3KTOA 3R3WA 4Q9AA 1UBMS 1VFNA 4Y2VA 1QP8A 1XZPA 2V7TA 3RW9A 3N8GA 3VGJA 5IYZB 2R47A 1EFAA 4PZAA 3PLRA 5B30A 4KRXA 2VYND 2R1TB 1DADA 1T2CA 2NZJA 3M5CA 3AKCA 4K3VA 2W2KB 1FQJA 1RHUA 3L7IA 3KSMA 3DMTC 3B6IA 3EVGA 1P4RA 2OMEA 5MF6A 4KVGA 3R5SA 3LDFA 1PJ2A 1R4MA 3LKBA 3OE1A 1U90A 3G5TA 2HFJA 1VZ2A 4MV0A 4N3CA 4CW7A 4N76A 2H9YA 2V55B 4MB2A 2J4FA 2X41A 3I53A 3BPSA 5ES4B 3UOGA 4WN3A 1CQZA 4RHTA 4ZI7F 5I7WA 3UAWA 1GVNB 3DHVA 1AXEA 3DMYA 2VUHB 4ITRC 2PRJA 4OI2A 1E9FA 3M0EA 4I46A 2H4YA 5JPCA 2O0JA 2XY4A 3C1OA 1MOPA 1PHRA 1V8PA 5TMBA 3WKCA 1ZJ4A 4KDFA 3CRVA 1E9RA 1F2DA 1PR6A 3V4OA 4DVGA 5LNK6 2MSWA 2XUZA 2C7GA 2UVQA 2JHAA 5H3CA 1FVOA 2W93A 3B9PA 3AVTA 5LU8A 3K5HA 2H5JA 3PC3A 2KB0A 3H7AA 4HWRA 3OIWA 5B1HA 4C2UA 4Y9TA 5CA1F 3KDSE 3Q2KA 3NOQA 4RE5A 5EUBA 4YASA 2WU3A 1C0LA 3EUFA 5FBRB 3EC1A 3ISVA 4JSTA 1GGEA 3UK2A 4G9EA 3HCRA 4IWNA 1ITZA 3UF0A 4MVCA 2D1YA 1JNXX 4KXFB 3SQLA 5AW7A 3D7LA 1M2OA 1WBDA 4IM7A 2EGHA 2Q8QA 3A14A 1AQYA 1IOZA 2GK7A 1LD3A 1WEHA 5CRIA 5LQCA 1H3EA 1FYDA 4C05A 2Z5GA 4ABYA 4F4HA 1L5HB 5BN5A 4CF7A 3TUZC 2AUMA 1N5JA 2ZWIA 3ZR4B 1P19A 1HSZA 1FFBA 1PGOA 3TQSA 1X6VA 1C4WA 1U5CA 4L3OA 3G82C 2O1SA 3AIKA 4RGVA 1MAWA 1JHDA 1NZFA 1J1IA 3KLPX 4NAVA 4WKGA 3TEFA 1Q1EA 2JBWA 1MJHA 4BQRA 2QQEA 4YQYA 3RU7A 2P9HA 2C94A 1G3MA 2WWXA 4IICA 2VP4A 1CUGA 4GYJA 2QUHA 1E5DA 4M1WA 4C6RA 3HP4A 3W4IA 2ZS7A 4DJEC 1JHZA 3NC4A 1RYMA 1HRDA 4UM9D 3AYXB 1WU7A 3UV3A 3DPUA 5FBZA 4CEIB 1AGXA 1TA4A 1MA0A 4WOPA 4ZI5A 4WY5A 5A6SB 2QPOA 5B7QA 5C53B 3KZKA 4ZAVA 1PJTA 3ZDBA 3CJTA 1D0SA 1T5BA 2UYQA 2M9MA 1OU4A 5FUBA 1YU6A 1FBTA 3TSOA 4YXFA 1ADJA 3V4PB 4HNAB 4X65B 1XP5A 4R1OA 3SNKA 4LN1A 3TI9A 2ZGVA 4LCBA 4QGGA 3I12A 1XTKA 1UR5A 4EKDA 2PUHA 2A1UB 4OQYA 3ZBTA 2RG7A 1QCDA 1PLLA 2CSUA 1ODSA 1NVVR 1XL0A 3EMBA 1RAIA 3GW8A 3TNFA 4DT1A 3AFGA 3MWGA 1ZXXA 3PDCA 4FGJA 4KXWA 2GEDA 5ALLA 4YRNA 4QWWA 3UUFA 3TOVA 3V7UA 1P7YA 3AY6A 4EHHA 1OKKA 3AINA 3KKLA 2P9FA 3GFOA 5B4VA 3VKUA 3VVBA 1T1SA 3TZBA 2YMQA 1WPXA 2WWRA 1ZS9A 3K1ZA 4D79A 5ALRA 2J5RA 3MSXA 4ZODA 1CUUA 4RH3A 2WUGA 1Y7IA 1M6EX 4WPGA 3LY9A 3T7KA 2PUFA 4ID9A 2HIHA 4K03A 2O4UX 4CIDA 5BR7A 3EVAA 4J76A 4UVIA 3TLBA 5ABPA 4TV8B 2YOFA 3TFOA 4JI8B 3MBOA 2HZ7A 2YJTD 5BV7A 4M0KA 4KYTA 4O4IA 4F2GA 4D3SA 3T5PA 4EGFA 2O3TA 1C0IA 3OEHD 3Q8XB 2FZKA 4KE8A 1OH6A 3CRZA 3NTLA 1RE0A 2FPWA 3P97A 2HJ9A 1D8AA 4AXBA 4B35A 3GARA 2XUQA 2VH1A 2IKQA 2ZSAA 4OGWA 3QE4A 4YMGA 1Z0AA 1PNTA 1YRLA 3LP6A 2OFOA 5KX5F 1RIFA 1RJFA 1NF9A 4ESEA 1ZCZA 1TFUA 3P5BA 2YZ2A 3CX4A 1YDFA 4P7GA 2OWEA 3VVCA 4Q3NA 3PKZA 4Y1RA 4ADSG 4Z6KA 2ZS8A 4RZSA 1E92A 3KLNA 5CNIA 3WLHA 4HTFB 1SULA 5DTQA 2XYGA 4DRYA 4F3NA 5JVDF 3M5WA 2EC5A 1QB7A 1GD1O 2VDWB 5JNRA 3EGWA 1VLJA 2XYVA 5D1NA 1NG1A 2PK3A 1UK9A 1UT6A 4IJ6A 2X22A 4JT8A 3WX0A 1YT5A 3P2MA 2B6HA 1EE2A 2JBHA 1Z22A 2B9VA 2HJSA 3DUWA 3PXAA 3WSVA 3G2PA 1H4SA 4LRXA 1JVNA 1P18A 2QVYX 4Q3DA 3GPDG 3RVQA 4ALIA 5J2TB 1M1YE 3KB6A 1RRPA 3SICE 2I54A 1A8PA 3IEPA 4TKVB 1BXZA 4LRWA 4WLUA 1GJRA 4MZDA 3KQNA 1G5FA 2OFFA 5LA6A