2WWXA

Crystal structure of the sidm/drra(gef/gdf domain)-rab1(gtpase domain) complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGIKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords RAS-RELATED PROTEIN RAB-1
publication title Structural Insights Into the Dual Nucleotide Exchange and Gdi Displacement Activity of Sidm/Drra
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wwxA00
2QTFA 5DO9A 4XWOA 3VU9B 1E2FA 3U3MA 4WW0A 4C0JA 2BC9A 1NVXQ 3W8RA 2FF7A 2A7QA 5F3WB 4DSOA 4EPVA 4A0GA 1G6OA 3ZS8A 5TY0A 4XSHA 2XXAA 2ZRHA 1O87A 4JLJA 3THYA 4AYTA 3NVAA 1VG0B 5CITA 4MITA 1XF9A 2DFLA 1FTSA 1E32A 1JXMA 3SZRA 1XTSA 3AP1A 4QBHA 2ZEJA 4YMSA 2ZSEA 3LRPA 4D0NA 4BWYA 1EWRA 1XMIA 4B3DA 1QG4A 5DI3A 1DBSA 3TAUA 3QENA 5IK2D 3NH6A 2FG5A 3PIRA 1PLJA 1YKSA 2Q6TA 2FZ4A 1GUAA 1HURA 2ZYVX 2V1UA 1E98A 2R2AA 5DN6A 1G3QA 3FB4A 1G8YA 1L2TA 3QKSB 4TLEA 4BLTA 4HAUA 2JJ1D 2C77A 4HLCA 1AGRA 1GNPA 1VYVA 1E0SA 5LD2C 1KKMA 3GJ6A 3CX7A 3GCGA 1IBRA 2GVZC 3BK7A 3IIKA 1RYHA 1Y3AA 4HUQB 2O0KA 3MMPA 4B6FA 5BWMA 1TPZA 2W0SA 5J4KA 2ORWA 1RJ9A 3BAFA 2ZS9A 4BPBA 2YC4C 5IF9A 1IN6A 5FFMA 1ZM7A 1NMXA 1ONBA 2EWVA 2OG2A 5LPNA 1NN1A 4OI0A 4DCUA 2QM7A 4W9MC 1VHLA 2DFKB 4ASUD 4IVPA 4A2WA 1N0WA 3C7KA 2UVQA 4B3GA 2Q3FA 1CKEA 2VPPA 3QXXA 2EWWA 4CDGA 2O8FB 3R9WA 2J0UB 3RSOA 3AKEA 2OCAA 3RWMB 3QG5A 5L3SA 2A78A 3AKYA 5SZKB 5IDVA 2FSHA 2ZUCA 3LH5A 2CJWB 3NKVA 4BASA 1EX7A 4UQOA 4EPWA 2KB0A 2IHBA 4PPNA 1OH8A 2G88A 3C5CA 4HEJA 3TW4A 1IXRC 2VP5A 3AVYA 3L8ZA 1F60A 2IL1A 1DPFA 3U4QA 2OBLA 5TB5A 1BO6A 2PMDA 1JBKA 1MKYA 2F1RA 2ZJYA 1MO3A 3LQQA 2OUKA 2WOOA 2EFEB 2IBMA 2OXCA 3H86A 4AC9A 4EDHA 2VP0A 5CK5A 1E9EA 3BB1A 2X19A 5UKDA 4Q4LA 1XJ0A 2XOKD 1G5RA 2VSFA 2W2VA 1NSFA 5C4GB 4EFNA 1YVDA 4M1KA 4HLDA 1MRNA 4US1R 3QBVA 3SJBA 1Q57A 4A2PA 4H1VA 3HR8A 4PPFA 1IN8A 4FXPA 5JCPA 2IC5A 1G19A 1KSJA 3AP3A 5JZVA 1X3SA 2CLCX 3CWQA 1NBMD 5FR1A 2XSZD 1TQ2A 2ZSBA 3GJ7A 4Q9LA 1GAJA 2YZ2A 3CPEA 4NU0A 4BZQA 1CJVC 3T1QA 2RGEA 2KE5A 1W0KD 2FSIA 2AD1A 2FA9A 4DUGD 2REOA 2WIBA 4EFLA 4IDPA 4L8GA 4I4LA 4TYNA 4XD7A 2ZJ2A 1VG1A 4JVSB 3KB1A 2YWHA 5CLQA 1MABA 2I4IA 4KFUA 1F2TB 1KI8A 3E70C 4TZ6A 1CP2A 4M4SA 5FOSA 1EFHA 3IPXA 3U44B 1E1QD 4UNNA 2NG1A 4Y0AA 1LTQA 2J7PA 4OHXA 4UXIA 3OIWA 2WKRA 1OH7A 1I4DD 3PXGA 1U0HC 2BBWA 3THXA 2RGBA 4IDOA 4CVNA 1RPZA 3BERA 4A0RA 1TTTA 2IXGA 1G5PA 2O8BA 2OM2A 1NF3A 1M7BA 3WXMA 1ZC3A 5LBIA 3QF7A 3V9PA 3ZH9B 4U00A 3SOPA 1QVRA 4KFTA 4B2LA 1RRPA 1JI0A 1KO4A 5EUQB 1ZM4A 2HEIA 2GAOA 5GVRA 4EQ6B 4AG5A 2GAAA 4DIEA 2QY9A 1HUQA 4BFXA 1KZGB 1W36D 2QPOA 1KI3A 4C0BA 1IJEA 4M53A 1GRNA 1M8PA 4TQUS 1DVRA 5DLQC 1XEXA 2OILA 2QAGC 5FPTA 3P1JA 4KBGA 1YJ5A 2ZVPX 3HPRA 1I4TD 5AUQA 5FOXA 3MD0A 2QMOA 2ODBA 1SKYB 5F2EA 3GLGB 4Q4AB 1BIFA 1OXTA 3C5HA 1K5DA 2OCBA 4Q48A 3QPWA 2IYWA 2Q9CA 1KMHB 4DLUA 4Q4HB 2G0NA 2W6ID 5EE5B 4ACAA 1AM4D 3NXSA 2HDNB 1E2HA 3NDPA 5EXTA 1Z63A 3W9YA 4B71A 1FMLA 4FCWA 3A4LA 4V0ME 4CEJB 4A36A 2ZITA 4M1OA 1FPMA 3RHFA 2QSYA 3AF2A 4QBGB 1DAFA 4XSGA 1T3HA 4NCKA 2NO7A 1XD2A 1ZJ6A 2XEXA 1E96A 1JJ7A 4QOSA 4Q9KA 1KK0A 4B34A 4URYR 4CT5A 3E2IA 4BFZA 3WMFA 5J4YA 3V4RA 3SYLA 1G4UR 2KWIA 3BFVA 4QNRA 3RDPA 1J70A 4DZZA 4OHVA 4X8LA 5FOWA 4K46A 1T3SA 2YOHA 1KI4A 4TTQA 1ZCBA 521PA 2FJUA 3E5HA 4XOIA 2CL0X 1WQ1R 4JMPA 1II0A 5KOYA 3AVUA 1CRPA 3FKSA 3KB2A 4MGYR 3OZXA 1ZU5A 4G0NA 3QQ5A 5K8UA 4PQRA 4E03A 4YMVA 5F9HA 3WMEA 3ZYCA 4KU4A 1G64A 1XDBA 5DYGA 3UG7A 3IKJA 3GEHA 1XJCA 1TAGA 3L43A 4PC2A 3ZVMA 4D80A 4TYYA 2EFGA 5H68A 1T8UA 4FCTA 3OFNA 4D81A 3LA6A 1GNQA 2WIAA 4LV5B 1LB1B 2GA8A 3FMFA 3U3KA 4FI3C 1XCMA 1YZQA 4QFMA 1GIAA 4OKSA 2JLYA 2ZRBA 2X2FA 4O25A 1E2EA 4A0HA 5JWOA 2GHIA 3TR5A 1S9DA 4BFVA 1XMJA 2FSFA 1FX0B 4HI0E 5FBWB 4GSYA 1KJZA 4BGDA 4GMDA 1B23P 3WNDA 4LJ9A 1GKIA 3VNVA 3RVBA 3RABA 2QORA 4C0LA 3KTAA 1L8QA 2RAPA 1D2EA 1ZUIA 1ZCAA 2FNAA 1C4OA 2QT0A 2NZJA 1ZU4A 4I81A 2PJRA 3AVVA 3ZIAA 1VECA 3R7WB 1MO5A 4HAYA 3U7EB 4NYIR 4MH0R 3MUFA 4QHSA 3H0KA 1P3JA 2WSMA 5HCIA 1TQ4A 3F3YA 1E4VA 1OFUX 2WPDD 5E7IA 2BJWA 4E07A 1JR3D 3VQTA 1J90A 2PEYA 3DKVA 2QRZA 3MWYW 5JECA 3PEWA 4DT1A 2D06A 1XMSA 3WBKA 5DIFA 1U9IA 4D2IA 3ETLA 3FHCB 1OJLA 3LW7A 1BMFA 2RMKA 4LHZA 3UIEA 4DKXA 3CZPA 1UBGA 4HZUA 3MLEA 4LBZA 3D31A 1OT3A 4YXWD 1EXMA 1OYWA 2FV8A 1W0JD 3KXKA 4EPRA 1S0UA 2IUTA 2OEPA 3NIBA 3GLHB 3VHLB 3IIJA 3R9IA 1E9AA 3KJGA 4G1UC 5DE3A 2VO1A 1AJEA 4LJ8A 5LDDC 1IY0A 4QBFA 4YONB 2P6NA 3K70B 2A30A 4QG7A 3AP2A 3ADCA 5FOTA 4ABYA 2V9PA 3HYRA 3ZZTA 2H5EA 2VQSA 3EG5A 3DHWC 4YLGA 2G77B 1U81A 1FQKA 3K0FB 3Q7QA 4B3FX 5GVSA 1JEDA 1M6NA 3VKWA 4A6PA 2IYTA 4MQBA 2WWIA 4IKEA 3M1IA 3SBDA 4DCSA 3B5JA 3KDSE 4MYUA 5FTMA 2BWJA 5J5CA 2PL3A 3ZD7A 3BH0A 5KPDA 1VHTA 3KL4A 2ZYWX 1F6BA 4Y0VA 5CB8A 5K8IA 2Q0HA 2IK8A 3R8CA 2D2FA 3NBZC 4L16A 4QGFA 2JATA 1B0UA 4Q66C 2V3CC 1NLFA 2G0TA 4J0QA 2V6IA 3VNUA 1OYYA 3GLIB 4CYMA 4A82A 1T0JB 1OLOA 1N5KA 4KV9A 1II8B 3TVTA 2EYUA 4QKQA 3K9GA 1NN5A 2D7CA 3FFAA 4DSNA 3O8BA 4DDWA 4JLVA 2G83A 2F9MA 4B2IA 1Z2AA 2FWRA 2B7CA 3K9LA 3OIVA 4LJ6A 4PSVA 5JFGA 1OIVA 3RLFA 2VHTA 3LX8A 4IHQA 2D7DA 1AQUA 4EJSB 2H18A 2P6UA 3RRZA 3J81k 4PHFA 5EP2A 1Z47A 2B21A 3IQWA 4OQXA 2VH5R 3EPHA 4AKEA 1U0LA 3SJZA 1V43A 3BIFA 4IOKA 3KUCA 3CRMA 2GXSA 2ZS7A 5FI1B 5KSOA 2ZJAA 2QPAA 1XP8A 3M6AA 1XTKA 3IILA 1XFAA 4QGHA 1OKKA 4C3ZA 2FN4A 3T34A 1Z6AA 4DJTA 2NZ8A 2CVFA 4JZKA 5DI9A 3EXAA 4C2UA 1R4AA 2BM0A 3ZZUA 3W5IA 2BVNA 3MWKA 4R9UC 2ERXA 1KO5A 3A1TA 2O8DA 2ZI4A 4LBWA 3RRNA 1XCGB 1MOZA 3X1YA 2WWXA 3QF4A 1PVOA 4JSYA 3TBKA 4IDNA 2WOJA 2GCPA 3AH8A 3LX5A 3IGFA 2ZE8A 4PPGA 1ZM2A 4AWXA 1FOEB 3CRVA 4PC7A 5AJWA 5JJKA 3C14C 1ZBDA 1RIFA 1CIPA 1T5LA 2ASEA 1KAOA 2YWFA 3AKCA 1IAQA 2CCKA 1AS0A 1DO2A 2IYZA 2RCNA 721PA 4GNKA 3WP1B 1W47A 4DLYA 1MH1A 2Z4RA 3BFXA 4PFSA 2J0VA 4YMUA 1W1WA 3AVTA 3K9HA 3WBJA 3OIUA 2JLXA 1EK0A 4DCNA 1WMSA 4A2QA 2GKSA 1E9SA 3H2YA 5G53C 5FR2A 3WHKA 3G0HA 1XTQA 3WNCA 4M8NE 3SBEA 1G7CA 3W5JA 4PC3A 4WBSA 4I1OA 1HQCA 3PUZA 2CE2X 2JAQA 2VHQA 4PANA 1SVWA 4UKDA 3Q72A 1GFIA 4WXPA 4I1SA 2VL7A 2ZAMA 221PA 1KDPA 1NNEA 1E79D 4EAQA 3ECCA 1AS3A 3EW9A 3EZ2A 1IN5A 5J4HA 1GM5A 4C7OA 3AQ4A 2D2EA 4O2RA 1R0ZA 2OFOA 1GILA 2HXSA 2WVJA 4ZKDA 2ZQ5A 1G3RA 4Q9HA 2R44A 3TLXA 3N2IA 1R7RA 1VIAA 2BBOA 4I1UA 3FMOB 5FOVA 3RANA 3KQLA 1R8SA 2OZEA 3SN6A 4A8JB 5HKKD 4Q4JB 5K8LA 3A6PC 1GKUB 2B8WA 1Z0IA 3GLFB 2QTVB 5JEEA 1G41A 4TMXA 5EE3A 1P7CA 3HJNA 4OJKA 4PQFA 4TN1A 4CRWB 4LCBA 2KSQA 4F4IA 2C2HA 5C4MA 2WWGA 3VR6A 2BBTA 4EKDA 1CXZA 2QE7D 3ASZA 3B8HA 4RKFA 4DCVA 3QOFA 3X1DA 4RD1A 1MRSA 4FIDA 3AGQA 4PXAA 3KFVA 4JIMA 2NOAA 2JJ2D 1N6KA 3U7FB 5KUTA 2PZFA 5B57C 2Q9AA 3B82A 4RCYA 1IXSB 4PX9A 2BBSA 1YE8A 2E9SA 3FHTA 5M04A 3HYTA 4WOPA 1TQ6A 3B7GA 4GZMA 4KITB 1SXJC 4KFRA 1XTJA 3VR1A 2ZRMA 1UPTA 3CRQA 1ESMA 2H1LA 3W3ZB 5EP3A 1XEFA 2GJSA 3TKLA 2GZAA 3WYFA 1NG9A 3PV0A 1YZKA 2FE4A 3IHWA 1XCPA 4M9QA 5DGXA 5F9FA 4JVLA 5B58C 1DTSA 1E2PA 2IHYA 3NHAA 3MJHA 2QAGA 3W6NA 4BLRA 4F91B 1XTIA 4A6XA 2LWIA 4F38A 2MSCB 4CEIA 4QJ5A 5JHHB 2CHQA 3PUYA 4JL5A 1MO6A 4ZIRB 5TXGA 4RKEA 1TMKA 2XZLA 3HR7A 3EX7C 2IS1A 1NJGA 4M9ZA 2O8EA 1TADA 3I4LA 4MKFA 5CIWA 4DLSA 2PLFA 2VRWA 4M9SA 4FCVA 3GJ3A 4IOJA 2V4ZA 3HU2A 4WA7A 4ARZB 4OI1A 2QEQA 3CNLA 3MG9A 3VTKA 2VHCA 1DG1G 3BH7A 4BFWA 1Z0JA 4DEXA 3GPLA 1ZNYA 2AHOA 4DLZA 1NVVR 2CCJA 3W8NA 4OK6A 3THWA 3VX3A 2DFNA 3ZVNA 1N6RA 2E87A 2IYXA 2ZIAA 5E3HA 4DDUA 4JL6A 4H9GA 2V6JA 1UKEA 5KNCA 4AK9A 4LC0A 2QPTA 3HP1A 1E9FA 2I1QA 1SQ5A 4BE7B 3L0OA 2W2XA 2ZI9A 4Z51A 1KTVA 4PR0A 2FEOA 2REBA 2W83A 4AIIA 4L5BA 4NPHA 5J4LA 2Y8EA 4PHHA 3NEYA 3OE7D 4DSUA 1MT0A 3JVUA 1KI6B 1YZUA 3TJZA 4P0TA 2MMGA 5C46F 1U0JA 3EAQA 3EC1A 1KMQA 2WTUA 1KKLA 4AG6A 4NONA 1NKTA 3QKRB 1FP6A 5CJ2A 1CS4C 3SQWA 1K8RA 4YDHB 4NZYA 3TNFA 3IDQA 1KSGA 2WHXA 3W34A 4ESHA 5JCZA 3K70D 3EARA 1NLYA 4IW3B 4S35A 1X8JA 1EX6A 1X6VA 2MSEB 1UKYA 3CUEF 4G5RA 4AY2A 2IF0A 1AN0A 3BB4A 3PENA 4G5SA 4HAVA 2Z6VA 2QA5A 5E4FA 2GCOA 3TSWA 1E9BA 2A9KA 3LD9A 1H8ED 4UNQA 4HAZA 2J7KA 1L7VC 1KI9A 1R5NA 3FFBA 1YZTA 5EZ5A 5E7MA 2YWGA 3K0EA 2ZANA 4RD2A 2VTKA 2WPDA 2XXAB 3LQRA 1KY3A 3K09A 4ITRC 3TW8B 1TX4B 4FMDB 2PX3A 1DAKA 2PX0A 5C2JB 2JLZA 2YOGA 1P62B 2J5XA 4MRNA 3EZ6A 3PCRB 2ECKA 3MGCA 1G7TA 1EG7A 2XITA 5HE8A 2A5JA 2PZGA 3IBYA 1ZW6A 2BMDA 2JDIA 2V54A 4A92A 2J45A 3IO3A 2W6JA 3K9NA 4AYWA 1VG8A 2ZRFA 5DI3B 2WSSD 3M0EA 5FTKA 3SEAA 3ZGXA 1ODFA 5EP4A 3BWDD 3I1FA 3HU3A 4WZ6A 1E2LA 2A5YB 3QEJA 3D8BA 2CL7X 2ZR0A 2PZEA 3ZVLA 4BFUA 4RZ2A 5SZHB 2H17A 2PT5A 5G3YA 3PR1A 1UJ2A 1TEXA 1VCIA 2RGDA 4PPQA 3ZQJA 2JASA 5KU1A 2ZI3A 1Z0AA 2VP2A 4XTRA 2PBRA 1Z6GA 2IT1A 3F5FA 5EP1A 3I8SA 1RJ9B 4LPSA 2BMFA 2AK3A 2KBEA 1X1RA 3OEHA 4ZI2A 2I1VB 1U8AA 2O8FA 5A4JA 2HJGA 2J0UA 2JLRA 4EFMA 5HTKA 1S9HA 2V7QD 1NIPA 1Z0DA 1J99A 3DMDA 3S1AA 5JJLA 4YMTA 1VCNA 2VLIA 2IEZA 4HATA 1QHHB 4TT3A 5L3SB 1G3MA 3CF0A 1M1YE 2ZRKA 3BB3A 1P4SA 2GVDC 1G6HA 1G17A 2ZI6A 2CLDX 5AJXA 4CGZA 2JLVA 1D5CA 3VMFA 2XTNA 3C16C 4RZUA 1T5IA 2ZVQX 4IFBA 2IWRA 1Z07A 4MYTA 3VKHA 3KKQA 1JXOA 3U4QB 3W90A 2IYRA 3VFDA 3GP8A 4V0MA 1P2VA 2H8KA 2FFQA 1T91A 1SVIA 2NPFA 3EIQA 3HWSA 3REFA 4K81B 4LV6A 5AK0A 4JJKA 5AWFC 4BEJA 1EFUA 1OPXA 1ZNWA 3I5YA 4R71A 4OQFA 3N2EA 1G8FA 1P2UA 4JLNA 1W36C 4NCHA 2YNMA 1R2QA 5B2ZA 4LBVA 1YR8A 1G8GA 2A5DA 2R8RA 4UXHA 4RZXA 3TQCA 2XNSA 1G1MA 5EXSA 2NIPA 4EUNA 1CTQA 4DB2A 2A5GA 2HT1A 3BH6A 3CR8A 1N3BA 4F7WA 1AK2A 2N42A 1P9WA 3GFTA 3RS7A 1O3YA 1CEEA 1VG9B 5TARA 4LZZA 1YU9A 2ZRDA 5EE1A 2WJVA 4V0LA 3IBGA 1R5BA 4PZYA 2CLSA 4Q7MB 3SC3A 2EVWX 3U44A 3FMPB 1KDTA 1ZVQA 2ANCA 4OYHA 4ZDWA 2JGNA 2F43A 3A4MA 2QUZA 3T1OA 4EIWA 1F2UA 1MABB 3DVLA 1J8YF 3HDTA 3KKNA 1ANKA 3ZS9A 3GJ5A 3K53A 3NHBA 1H8HA 4PQYA 1E0AA 1FUUA 1ZIOA 2IYLD 2VF8A 1U90A 4PC1A 3K0AA 3TAHA 1KJWA 1RVDA 1E69A 1WXQA 3Q5DA 4NMMA 3I5XA 3THXB 2ZR7A 1NVVQ 1E1RD 3BORA 4QHTA 2OFXA 4GDFA 2O8BB 1D2MA 1C1YA 4XTCS 2QP9X 1JALA 1COWA 1SZPA 1N0UA 3U60B 2PJZA 3EWSA 2RHMA 3PUXA 1P9RA 1ZNZA 3LBIA 3O8CA 1S4QA 1DS6A 1HY3A 2HLDA 1HH4A 2AFHE 2WJGA 1ZM9A 2R6DA 3EWAA 1DELA 3K1JA 1Z5ZA 4LJ7A 4ZDIA 1FZQA 2ZSDA 5ANRB 4IXMA 3UWOA 2OSBA 4FN5A 1TU3A 5H70A 2BJVA 4C0KA 4ZDKA 2N46A 2FEMA 4Q47A 2DBYA 1CBUA 4TYWA 3GLGA 1XMVA 5IHPA 1XEXB 3LNCA 4URUR 3U6BA 2PT7A 3A36A 1HYQA 1PUIA 1Z22A 2QMHA 2QN6A 3M4YA 5FL7D 2A3RA 1LY1A 2ORVA 1QZXA 4TLAA 2BM1A 3DM5A 1EFRD 1Z6XA 3CX6A 3SHFA 2XNDD 4W5WA 2FDCA 2DWOA 5FOUA 2FFBA 2F55A 5FPSA 4W5JA 1HQYE 4C2TA 1ZP6A 1AKEA 3PUVA 1Q3HA 4RD3A 3JZMA 1K5GA 2UZ3A 1KIMA 3FPAA 2ODEA 5H1YA 1YR9A 3B1VA 2QQ0A 4R2IA 4ZI3A 1XX6A 1XD2B 3TUZC 1Z2CA 3NBFA 5HR5A 4UJ3A 4Q18A 5JS8A 4F92B 1M2OB 4RJLA 4MUBA 4HSEA 3L2OB 5A5GA 1UDWA 5CIQA 2OAP1 2J41A 1G9XA 4BRUA 3UWKA 4E22A 4TTRA 1N6PA 4PHGA 1WE2A 1N0VC 1N6IA 2ZRCA 3UATA 5EXPA 3AVOA 2CNWD 1KO8A 3A4NA 3RSLA 3KZ1E 1Q3TA 5B64A 4M21A 3PVSA 4DDTA 5JBQA 3TK1A 1M74A 4DBLC 3RS0A 1XEWX 1QHYA 4PTLA 1W7AA 5EE0A 5DISB 4NE2A 2IA5A 3R8FA 1FTNA 1M7HA 2VSXA 1YZNA 2RGXA 3OEED 3P32A 2HF8A 1WCV1 4X8MA 1AS2A 3RYTC 4IFEA 4C0SA 5L3VA 3ICEA 1WRBA 1Q1EA 3OF5A 3K09C 3SJAA 2IYUA 2R6FA 1SVSA 3B78A 4Q5IA 2DY1A 2ZU0C 3WP0A 5FBVB 2GZHA 1AQYA 2XJ4A 3CR7A 3EASA 3K0CC 3OAAA 3QXSA 1UEIA 3TH5A 2XB2A 2HCBA 5G40A 2F9LA 1J8MF 3IIMA 3SYKA 1SKQA 4Z54A 3CH5A 3CONA 2IYSA 3B1WA 1CF4A 2R6GA 1P5ZB 3EPLA 2P5SA 1NVWQ 4RFSB 1CJUC 2ATVA 2R6CA 4LJ4A 1S3GA 1Z6YA 3BJIC 5DHFA 1Z3IX 2RHDA 4RZ3A 5HCNA 2B6HA 2O8CA 2OFWA 4KXFB 1XBTA 2BHRA 4M1SA 4OJQA 1UBEA 4Z1MA 4YDSA 5HZKA 3GLGE 1ELOA 4RD4A 5CM9C 3A1VA 4B3CA 3A1SA 1G4AE 3D7MA 4HB3A 2CHGA 2EYQA 2PEZA 3FVQA 4QL3A 4KSCA 2ODWA 2YWEA 4KBFA 1E9CA 1OFIA 1QHGA 4Q7KA 4RD6A 3KTAB 4JBWA 2AK2A 4WZBE 1JAIA 1HEIA 4P31A 1WBBA 4R2HA 2YOFA 1SVOA 4TMTA 4TQAA 2BIFA 2KJQA 3UXMA 1SXJA 2AXNA 1A1VA 2VHJA 2GESA 2JLUA 1Z83A 1ZD9A 2FU5C 2I3BA 1GRRA 2QNRA 2F1JA 3QEOA 3QUSA 5TDHA 3AVWA 3VX4A 3E1SA 2CXXA 3I32A 3U7GA 2DB3A 821PA 1IQPA 1W48A 3W6PA 5BQ5A 2EQBA 4BLOA 3QE0A 2IYYA 1Q12A 3IQXA 4NYJR 4M1TA 4JLDA 4Q01A 3OE7A 1S1CA 2H7VA 3GJXC 5AJVB 4B43A 4DT1B 1UKVY 4ZO4A 5AUOB 1RW4A 1E2JA 3KX2A 4HB4A 1ETUA 5DN6D 4ZCIA 3ICQB 1E2IA 5FTNA 2WAYA 2AD5A 2CMKA 1JJVA 4HZUB 3LBNA 4DLXA 4K8OA 4JSTA 1YQTA 4BFSA 5L8VA 1KSHA 4KFSA 5CYOA 2ANBA 1LVGA 2ZS8A 4TLDA 1NG1A 2FH5B 1KO1A 2HYIC 2ORIA 3AVQA 1ZIPA 1QRAA 3HPQA 1UBCA 4US2R 3AF4A 1CJMA 1XB2A 2GJ8A 1NY5A 2FMXA 3ADBA 2Q9BA 1NY6A 1LNZA 4E09A 1EWQA 1DAHA 5IK2A 1KI2A 1OSNA 1A7JA 5JRJA 4KODA 3VR2A 3AEZA 2V1XA 2XTMA 2ZROA 2J9RA 4IOLA 2JJ1A 2C96A 2FSGA 4II7A 2CDNA 2SHKA 2BOVA 3B9QA 2IUSA 3Q9LA 3JZAA 4HB0A 4AI6A 3QVVA 1GKYA 2C98A 1OV4A 1GOTA 1U8YA 5EE9A 1UFQA 3QXJA 2ZM5A 1CULC 4DLTA 2RGAA 4ILEA 4PAQA 4PO9A 4IEIA 4QC2A 4BECA 4OI2A 2G9NA 3DDCA 4ASUA 2NO6A 4OQNA 1Z28A 1SXJE 4QXAA 4QRHA 2QENA 1S2MA 2WWYA 4IDHA 3GFPA 4EPTA 4TMVA 1JAHA 1E2MA 5FPKA 5DHAA 1R0YA 3H1TA 4MRVA 1W5TA 4KLNA 2DWPA 1NMYA 2ZTSA 3AF1A 2GK6A 1NRJB 4B48A 1U99A 4OQMA 2D62A 1XPUA 1FP7A 2GILA 4DC9A 4NHOA 5DYIA 4Q1BA 3AUXA 2H92A 4Q9JA 3U3OA 3QXCA 2OE2A 3U6KA 2FGKA 3FOZA 3TRFA 1WA5A 3PJRA 1ZD1A 4MDFA 4FMCF 3GLHE 4KO8A 1EFTA 3AM1A 8OHMA 2XOKA 3N70A 4IVRA 4XD7D 2AN9A 3GJ8A 4Q7LA 4XVQA 4LOAA 1OFHA 3Q5EA 4JVNA 3ONWA 5LD2B 3KKMA 2IWHA 1ESNA 1BS1A 1FNNA 1RRGA 4OK5A 1N5JA 2NPIA 5G3ZA 4OHYA 3QY0A 4U7DA 1YZLA 2J7PD 3FYHA 3C8UA 1I2DA 1NBMA 2QROA 3TUIC 2C99A 2MMCA 2XSZA 3QF4B 4Q9IA 1I2MA 2GJ9A 3QXHA 1VYTA 4R7ZA 1CJKC 4MRPA 4LHYA 3PG5A 4FWIB 4B32A 5L3QA 2ZE6A 1OHHD 2GEDA 4TL6A 5K8TA 1PZNA 2V8OA 1W0KA 2OCPA 4DUGA 3X1XA 1G291 3THOA 1G20E 2X1VA 3BC1A 4BQSA 4V02A 1H65A 1NP6A 2BEJA 3CZQA 4MKGA 2QBYB 3CBQA 4GZLA 4HYYA 1I4LD 3FDIA 1US8A 4M22A 5CB6A 2Q3MA 1E3MA 1UKZA 1S1MA 2PH1A 4P33A 3P4YA 3PEYA 4B35A 2ZRPA 4LRWA 1OIWA 1E1QA 1Z08A 4BZPA 4TQ9A 2JIZD 4B2PA 1KK1A 1UEJA 4LHWA 4AYXA 2HV8A 2PMKA 3TVDA 1QHIA 3CPJB 3CLVA 1KI7A 3I8XA 5HZHA 1T6NA 4PSKA 4Q02A 4D82A 3IUYA 1BH2A 3KJIA 4N1AA 4NYIQ 4BRWA 1W2GA 4CIDA 5GADl 4MA4A 4P4UA 1YRAA 4YQFA 3X2SA 1FQJA 1WP9A 2JLWA 2GTPA 4JBXA 2J1LA 5KDOA 3H4MA 1DADA 1TF5A 4NKRA 1HA3A 4HDOB 2PCLA 2XX3A 1PJRA 5FUWA 3FHOA 1N2CE 3G5UA 2WM9B 1FMJA 4TL7A 4V03A 5CM8B 3MCAA 2ZSFA 3SYNA 2A5FA 2W2TA 3O47A 5L3RA 421PA 1RE0A 3IO5A 1PLLA 1KGDA 5D3MB 2E1RA 2DPXA 1Q20A 4Q4JA 3P27A 3VR3A 2WICA 2ZJBA 5KYKA 1KJYA 2ONJA 1JQJC 1DAGA 3TGPA 5FPHA 5GJCA 4DXAA 4GMXA 2ZXUA 4NDZA 4DWJA 2P0EA 3AGPA 2WV9A 2AX4A 3GEIA 1N25A 4UXJA 2ZE7A 4MYCA 4F93B 2W6IA 5EZ6B 4A15A 2V55B 4QM6A 4LY6A 3P4XA 4N0EA 4AKGA 3FKSD 3SFZA 5JI2E 1OB5A 5JJIA 2ZUBA 4ZCLA 3SHWA 1NBME 1CR0A 3TIFA 2O5VA 2WKQA 5FUXA 1DOAA 4OHWA 4JLMA 2YC2C 1GL7A 2QMEA 5J47A 2OCYC 4CF7A 5FUYA 2WKPA 1JECA 3ASYA 3RAPR 1NL3A 1XXHA 4MUAA 3CWZA 4URWR 3BOSA 4B73A 1MR3F 2ONKA 1G8PA 1P73A 2B92A 2O0HA 1FUKA 3OFND 2RGNC 2XTZA 3ZD6A 1NKSA 1WDTA 2EW1A 1G21E 4LC1A 4IDQA 3DMNA 4Z8XA 2VBCA 4KYUA 1ZAKA 1N6HA 2A2ZA 2FPMA 1GP2A 1VKJA 5JSZB 3UPUA 4YMWA 1QG2A 1TF2A 4LYHA 1CLUA 1P75A 3NH9A 4HLUC 4ZIRA 3A1WA 4S2EA 2QAGB 2QSZA 1XZPA 4MRRA 3CRW1 1TL7C 1W4AA 4EPXA 3QSYA 1N6NA 1LF0A 3K70C 4CEIB 3QIAA 4UNSA 2WBLC 1OXVA 5E95A 2VHUA 2JJ8A 1CR2A 1E0KA 4N3NA 4CEHA 2O8EB 1Y63A 1LS6A 4PHTA 4TMZA 4LI0A 3OESA 5LB2A 4PSAA 3ZIAD 1IHUA 2C95A 4LJYA 4LPKA 4B6EA 2IX3A 4G5QA 2ZRGA 4M0LA 3AUYA 2IS6A 1T9HA 3KQKA 3QPVA 1F3OA 2X2EA 4YC7A 3THWB 2G3YA 3U61B 2CL6X 4MKHA 3LLUA 4L15A 3X1WA 1L4YA 1GRQA 4JLBA 1S96A 1EFCA 5DNYB 2WJJA 1MO4A 4FW9A 4UNRA 2CE7A 1KI6A 3DM9B 4P4SB 3SU8A 4WIAA 3IEUA 3IEVA 4B47A 1ZD8A 1E2QA 1TEVA 2CHVA 2FGJA 3QKRA 1BMFD 3VU9A 3CM0A 3PITA 5AJZA 2YJTD 1TUEA 1XJQA 2OBMA 3TQFA 4D4JA 2AKAB 1KNXA 4HZIA 5BN3A 2DFTA 3L8YA 4G5GA 2QL6A 1II9A 1OW3B 3KJHA 4B76A 4EJSC 3T1TA 3A37A 4GFDA 1VCMA 1J7KA 3RS3A 1XXHE 3TSZA 2LKCA 2ZUDA 1JR3A 2GZDA 1G5TA 4FMDF 4OHZA 4URVR 4DB4A 3EZ7A 3THYB 4RD0A 3TSOA 2QP3A 3K0CA 4Q1DA 5CLLA 2GCOB 1SVMA 1X8KA 3B1XA 2VP9A 4D25A 1N6LA 4D26A 2IUUA 1HV8A 2OT3B 3D3QA 2CK3D 4W7SA 3QKSA 4AD8A 3B60A 5AJYA 2TMKA 2FPLA 3ADDA 4LK2A 4TSFD 4YXWA 2CBZA 1JR6A 4F4CA 3RRYA 1W0JA 4BZXA 3UMFA 5TMPA 3NTUA 4GL2A 4JLKA 1V5WA 5J40A 5GJVC 4HUQA 2BMEA 4PAOA 4U5XA 5SZIA 3K8YA 4BFYA 4HAXA 1ZC4A 2C9OA 1HTWA 4A0FA 3MRSA 2F1HA 1SVKA 4F4JA 1E2NA 2F7SA 2WWWA 1QHXA 1N5IA 2Z4SA 1DAMA 2YINC 3P26A 4DCTA 5KNDA 2AWNA 4M9XA 5H8WA 1OFTA 4LBYA 4C4PA 2Z0MA 4WZAE 3VKGA 2W0MA 4L4UA 4PC6A 4HDCA 1NMZA 4M1WA 1AA9A 1A2KC 4GRAA 1E2KA 1R0XA 1XEWY 2REXB 2HT6A 2BDTA 3TUJC 3EIHA 5F98A 4TL9A 1J2JA 6Q21A 1GVNB 1RKBA 2CJWA 1KK3A 1NVUQ 1ZMXA 3PUWA 2RGCA 1C9KA 2BEKA 3W6OA 3RS5A 4KSBA 2BCGY 1W49A 1QHHA 2HCJB 2CEAA 2P2LA 4JL8A 3DOFA 1U94A 4OQLA 1QHSA 3S1AB 3SNHA 2G6BA 1OB2A 3NC0C 1OKKD 4B44A 2J87A 1GDDA 1KYIA 2VA8A 2P67A 2NO9A 4JT4A 3HU1A 4ON9A 3C15C 4KVAA 1HT2E 2GXAA 1TF7A 3Q3JB 5BN5A 1T0HB 4D6PA 2IXFA 4KYIB 2BCJQ 2QG6A 1IXZA 2R6AA 1GWNA 2IS4A 3EC2A 1PLKA 3LXXA 1Z6TA 4TMKA 3NDBB 1GNRA 4AKIA 3KXIA 1JR3E 1OXUA 1ZM3A 5JHGB 1G16A 5FBRB 3KQHA 3ZDQA 4LJAA 3UK6A 1VTKA 2VEDA 3R20A 4NCJA 1Q1QA 2GNOA 1XRJA 4JBYA 1JPNA 4GT1A 4FINA 3B1YA 4GBMA 4A8JC 1CR1A 1YR6A 2RGGA 2WJYA 3KQNA 2NTYC 2ZRLA 1ZUNB 2ATXA 1Q1BA 2F1IA 1ZUHA 4NP6A 1F2TA 4TYQA 1JQLB 2IF2A 2QM8A 3RNLA 3LY5A 4BUJA 3B6EA 1A2BA 1IOZA 1JB1A 4HB2A 1WBDA 4O0MA 1QF9A 3C4JA 2NQ2C 4QJ3A 3WHLA 4G01B 3Q7PA 4DEYA 4D0LB 4PZLA 1KOFA 1W4BA 3DO6A 2N1BA 3LO5A 1RRFA 3DZDA 2KBFA 4NCNA 2ZRAA 5IRCD 3MSXA 2QT1A 2IEYA 1KDOA 3CRRA 3C41J 2AL7A 2F43B 2OXRA 2VP6A 4ACBA 3LVRE 1F2UB 4EQ6A 2WMNB 3T1VA 3V00A 1KDRA 3RWOA 1KNQA 2ZYUX 3KKPA 4TLCA 4TWZA 1W5SA 3K0AB 3L82B 2ZAOA 4RY2A 1EESA 1OHHA 3BRWD 5CYPA 2P65A 3AF0A 2OHFA 4Q1EA 1E2DA 1IM2A 4A9AA 1NJFA 4NYMR 3LDAA 3DL0A 4I1VA 4L9SA 1FFHA 2NO0A 1A4RA 1OF1A 1Q0UA 4Q03A 1XTRA 3NC1C 1KO7A 1X1SA 4TZ0A 3LLMA 1IONA 4Q4AA 5IT5A 4LV8B 4R98A 5KHOC 4GOJA 1KI1A 1KMHA 2JIZA 4Q4HA 3T35A 3RC8A 4Q1AA 1D2NA 1K6MA 4BEBA 1P9NA 1HE8B 2ZE5A 4C30A 4QNMA 2R62A 4CEJA 1GITA 2GBLC 4DDVA 2WJHA 1R8QA 1E79A 3DKPA 3GJ4A 3CNOA 3L0IB 1AKYA 3LV8A 4LUCA 4XIGS 2D3WA 1OIXA 2O52A 2C78A 2YV5A 2QTHA 4ZKEA 4B33A 4JJZA 1IN4A 2QGZA 1KY2A 2WWFA 3KXLA 4D4LA 2MSDB 2LKDA 4BLQA 1OH5A 3REGA 3SS8A 3EPJA 1U98A 2B8TA 4W5HA 3WRXC 2D4HA 5HKKA 2Z83A 4MGZR 1SHZA 2AWOA 1Z0KA 3MWJA 1ZYUA 4GI7A 4E5UA 1LW7A 1BYUA 1UAAA 2J0QA 2XB4A 3H84A 3LAWA 3SJCA 3TMKA 2C03A 1DG3A 5C1BA 5GJBA 2O0JA 3AKDA 1GSIA 1F48A 2YHSA 3U2QA 1OXXK 3CKLA 3SFVA 1N5LA 1IN7A 621PA 3Q8XB 4QBIA 1RFLA 3B85A 2QP4A 3T5DA 3I72A 2QE7A 4BLPA 3KFXA 2BKUA 2GK7A 2JEOA 3CF6R 3V4FA 2JJ2A 1RC8A 4UJ5A 4GPTA 3W3AA 3N5CA 1VMAA 4NBSA 1VIYA 2GF0A 4CZ2A 1GL9B 1DAIA 3QNUA 4B75A 2OESA 2F3TA 2WJIA 1A5TA 1R6BX 1VPLA 3NEJA 4URXR 5FBQB 4HAWA 3CB4A 5JEDA 1AZSC 4XWAA 4B74A 2QGNA 2W58A 4JS0A 1FX0A 4O2LA 1XZQA 3RRMA 1Q21A 4KLZA 3BD9A 1QHNA 3BBPA 1XD9A 2VIIA 4ZDJA 1F5NA 2OLJA 3QKUA 1P2TA 2GWHA 1SKYE 2HYDA 1TU4A 4RFSA 3I92A 5DH9A 1D6JA 4PAMA 1L4UA 2GXQA 1XPOA 4FWTA 1X86B 3NWJA 2FX3A 1D9ZA 1R0WA 2ZETA 4QJ4A 3DEFA 3NG1A 4B3XA 3MWLA 1RRCA 4Q1CA 1Z06A 1E99A 4JYBA 3GJ0A 2NMVA 4B3BA 3FKQA 1XNJA 2DR3A 3A1UA 1S8FA 3R7WA 1OE0A 4URZR 4FMBB 5HE9A 3WYGA 4CT4B 2O8CB 3PQCA 4GP6A 3B13B 4I99A 1NLZA 5G41A 1KAGA 1YRBA 2ZREA 5TVKA 2FZLA 2G1KA 1EGAA 121PA 3UG6A 4JYCA 3OHMA 2QRNA 2PLRA 3GFOA 4G3XA 1GG2A 1M7GA 2AXPA 5SZJA 2GRJA 4LDJA 1TNDA 1YHNA 1Z29A 3CPHA 4KVGA 5FL3A 1AZTA 3IPYA 2EFDB 3CIOA 3EZFA 1NIJA 1T3LA 2VSOA 2ERYA 2WWHA 4KHZA 2ZJ8A 2RGNA 3T15A 2QU8A 1FL9A 4LWZA 4HUTA 3EPKA 1ZRHA 3O8RA 1SXJB 1E4YA 1ZINA 5P21A 4ZV4A 1G18A 2ZRJA 1A82A 4Z8YA 4O3MA 1SHKA 3I61A 4BLSA 5KDDA 1IY1A 2F3RA 2JCSA 4HLUA 3BE4A 4PO1A 3GLHA 2GDJA 2WAXA 3WYAA 3FE2A 2JDID 3AB3A 1BYIA 3MFYA 2W6JD 2VYFA 4PZZA 2QZ4A 3P20A 4LYFA 2FFAA 4ESVA 2C5LA 2YYZA 5KTYA 5AUPB 3QI2A 1QVAA 1U8ZA 2FPKA 3K0FA 3EA5A 5BYJA 1DO0A 3O8DA 3WY9A 1H8EA 1E0JA 1P60A 4UNPA 2GETA 5KSPA 1Q1ZA 2CVHA 5FPYA 4ZPXA 4A4DA 2ZRIA 4DLRA 2FFHA 5JLJA 2GEUA 1T4GA 3LXRA 3ZQ6A 3RC3A 3AV0B 3CH4B 1XWIA 4ERNA 4IEEA 4QM7A 3T06B 2BKEA 3LVQE 3U7HB 1VYUA 3OEHD 2CK3A 4N0DA 2WSSA 1PUJA 1ZNXA 4NYMQ 2D74A 2X77A 1RZ3A 2GXUA 3GEEA 2P3SA 4TSFA 2DWQA 1RYFA 3GLIA 1W4RA 1W4CA 5EQTA 1CR4A 4RCZA 3PEUA 1II8A 2DHRA 2GJAA 2Q21A 4LSGA 4OBEA 3UMSA 4DLVA 2JA1A 4TT3D 1P6XA 3GQBA 3CX8A 5BN4A 1SGWA 2JLQA 4NH0A 5TV2A 4IVQA 1G7RA 3CO5A 2IXEA 2VF7A 3QJYA 4US0R 1D9XA 3QBTA 5CK4A 1AIPA 3T61A 4XH9B 1FNMA 4MGIR 2NGRA 4EJSA 4Q7JB 1S3SA 2F6RA 3OIYA 1NN0A 1HT1E 3T5GA 3WRYC 2EFCB 2UKDA 4OL0A 4Q00A 4QGGA 1AGPA 3D6TB 4XVRA 2V7QA 1LV7A 3UMRA 4TL8A 4KCGA 3U3RA 3ZVRA 2XZPA 1UF9A 3G82C 2HF9A 2L0XA 4TLBA 5AUNB 2LCFA 4MDEA 3KUDA 3L0PA 2C9CA 1Q22A 1XU4A 4GOXA 2NO1A 3UKDA 4DHEA 3A8TA 4A1FA 3MAAC 4DVGA 2ZI7A 3SE0A 2QMUA 3ZJYA 1YZGA 1BKDR 1E9DA 2AFIE 3NBXX 5BW8A 2RH5A 4XJXA 1GZSA 4P32A 3Q85A 4FD2A 2BMJA 4JLPA 1UDXA 4QGAA 4RSGA 2R65A 2OBNA 4LYJA 4C0QC 5KPJA 4D4KA 3GD7A 3PFIA 5CDFA 4DIDA 1WF3A 4XVUA 2ZPTX 2O8DB 2QI9C 3UANA 5B30A 2XZOA 1KHTA 4IJMA 2OO7A 4M2LA 4P4TA 4JLAA 1R5OA 2KI5A 5JS7A 4FMCB 4IOMA 4H1UA 2J3EA 2J0SA 2GF9A 3WMGA 1H8HD 1TQDA 2WMOB 2Z43A 1T8TA 3ADKA 2YKGA 3EZ9A 2OAQ1 1IY2A 3GMTA 4M1MA 2IS2A 1DAEA 4RVCA 2ZRNA 3U5ZB 1W46A 2P5TB 3LWNA 3SQXA 2Q3HA 1D8TA 4KI0A 2QBYA 1COWD 3L0SA 3GLIE 4TMWA 5L3QB 2EFHB 3SDZA 4C0HA 2DCUA 3EIEA 5KO2A 4ZCMA 3R9XA 3EA0A 4MGKR 4Q1FA 2ZJZA 1CJTC 1G8HA 2HLDD 4MRSA 5KDLA 4GOKA 2ODNA 4TYPA 4X8OA 2WZQA 4V0OA 2ZI5A 3LFUA 2C9YA 1US8B 3FWYA 4QHYA 3TR0A 3RS4A 4KAXA 4PO8A 5EXXA 1LF5A 2IYQA 1Z8FA 2BV3A 3KKOA 4EPYA 3KJEA 2FOLA 1NSTA 4NL4H 4C9BA 4AURA 4HLQB 4XWKA 4LGMA 4POAA 1DEKA 3JVVA 4C0AC 1KSFX 3ND8A 1Q44A 5KSYA 3TE6A 1E1RA 5JMTA 4JKYA 5E7JA 1MV5A 2J46A 3I62A 1G3IA 3FMIA 3VR5A 3CNNA 1G7SA 2RKOA 4C7OB 2P6RA 2X8AA 4D4MA 2AR7A 4A8JA 1P2SA 2HUPA 3GLFA 2B7BA 5D3MA 2XGJA 3ND9A 1GTVA 3CW2A 2ZU6A 1DARA 2JLSA 4NYJQ 3RS2A 1W36B 4LYAA 4NCIA 1FW6A 1P61B 1E2GA 5FBLB 4V0KA 5KNBA 1XD8A 4NTZA 1JPJA 1SULA 3NBYC 2HJVA 2OLKA 3FGNA 4JVMA 1VDZA 4L9WA 5EUMA 2AKYA 2GEVA 3VHXA 1JNYA 2IW3A 5CDFE 2VP4A 5FL7A 4Q19A 1EFRA 2OV2A 2C8VA 1DE0A 3B1ZA 3ZZ0A 2J59A 3SI7A 3LW8A 5FI0B 1E9RA 2XNDA 4JKIA 4LHVA 3DOEA 3T12A 4IXNA 4WXRA 3BFKA 2R9VA 5BYKA 3DZ8A 1KZ7B 3F8TA 1YR7A 1X8LA 2K5UA 3QPUA 2ZSAA 4DLWA 3VR4A 1R10A 4G5OA 4LX0A 2IYVA 5HPYB 5C18A 1UADA 5AR1A 1E94E 3QKTA 3U3JA 2H16A 4D0GA 5EJEA 3A58B 3X1ZA 4AKHA 1NI3A 1TUIA 1Z0FA 2DYKA 2PCJA 2ZYTX 3B2EA 3K0SA 3BS4A 1XXHB 2XAUA 5DSZA 3F0TA 4HDQB 3LBHA 3OAAD 3QVUA 5FUVA 5GJWC 1NN3A 1OH6A 2C04A 4P3YA 1SVLA 5JSZA 1N6OA 2H57A 1U9IC 3BXZA 4TTPA 4U02A 3VAAA 2ZR9A 1G3UA 2CNWA 2Z5FA 1E6CA 5JWRA 3FTQA 4LHXA 5LB4A 3I3SR 2XJ9A 1U2RA 1CRQA 5CJPA 1LFDB 1W44A 1CU1A 2RB4A 1M34E 4ARZA 5FTLA 5JWHA 1W2HA 3KQUA 4CW7A 4Z1MD 2QQEA 1UBFA 2GBLA 3I73A 4IRUB 1HE1C 4BFTA 3OEEA 4DSTA 3B9PA 2ZJ5A 3MJRA 4WAUA 1WB9A 3WNBA 2W00A 5J4VA 3SR0A 2HXYA 5BXQC 2UZIR 4OK3A 3PEVA 3AVXA 4LJ5A 3QG1A 1QBKC 1VCOA 4RFVA 2G1JA 5JI3E 3ZLJA 4X8HA 5ELXA 2GJKA 5KSZA 4CEHB 4Q21A 2GCNA 3IHLA 4JT2A 4M1YA 3GLFE 5FTJA 5JRZA 2YVUA 3CF2A 1BOFA 1SXJD 4OI4A 5D3QA 5A0FA 5FH9A 4MYHA 2ZJOA 1JEEA 4WVFA 1LS1A 3AF3A 3AVPA 1PV4A 4P4SA 1XPRA 1GL6A 1OXSC 1KK2A 2QAJA 4KJZA 1QDEA 2CCGA 3BGWA 4V0NA 2EU8A 3DPUA 4DRZA 4GP7A 1P72A 4MKIA 1UM8A 1IJFA 4JLOA
chains in the Genus database with same CATH superfamily
1GN8A 2QTFA 3DEYX 2ZSJA 3KWJA 5DO9A 1QVWA 3G8CA 1NVEA 3FRIA 4G37A 2EZTA 2HM7A 3W8RA 1L0BA 4UPEA 1ECBA 3L4BA 5C1OA 3PRYA 1B1AA 3ZDEA 3GRUA 4Y6QA 2NUAB 3T5MA 6GPBA 1G6OA 3ZS8A 5TY0A 3MUOA 1D2GA 1DHTA 2JIOA 5J2UB 4CM7A 4JLJA 3ANNA 5CP8A 5F4ZA 3ZDZB 4PYQA 4O2BB 3IPCA 3E58A 5AIBA 5CITA 1XF9A 1FYEA 4Q4DA 4UQPA 3SZRA 1N8KA 1HOTA 2HMTA 1XR3A 4ZAVA 1T5TA 5ISMA 2WV7A 9LDBA 1FFEA 1EWRA 1LRLA 1XMIA 1AKUA 2W8ZA 3FX2A 4OLJA 2YFYA 4RA6B 5IBQA 3U40A 1N9KA 2YRWA 3RYFB 3UA4A 5H82A 4E5PA 2DT8A 5IK2D 3NH6A 1GPNA 3PIRA 3RVJA 1YKSA 1WBJB 2GN6A 2OORC 5DXJA 2V1UA 5DN6A 1A9QA 2ZBGA 1JAYA 1HOXA 5KQMA 1G8YA 2O5RA 4PS1A 3PXEA 4KAJA 1Z8DA 1B0PA 4J0CA 3FOAA 3OFKA 3ROKA 2DHQA 2IQIA 3E8MA 1J9GA 3OQBA 1ZXBA 4O59O 1VYVA 1E0SA 3DE3X 2XVXA 1FDUA 3L46A 3GJ6A 1OLUB 3H5NA 3MJTA 2GVZC 1NXSA 4RHCA 1I1QB 4ZO6A 1P18A 3IIKA 1RXSA 3WQRA 1RYHA 1PZMA 3KIPA 2VXCA 4HUQB 4W1QA 2DH5A 3UJ8A 3MMPA 4B6FA 3MCVA 4CETA 4O2AF 4B9AA 5K0GA 5H3LA 1RJ9A 4QASA 2FPPA 1A4IA 2YC4C 3IS3A 2XRZA 1XTUA 4RQUA 3AI1A 5KZMB 2C3PA 1P19A 2EWVA 4Q9AA 4J94A 1NN1A 4C01A 2QM7A 4U2EA 1A7UA 1VHLA 1SHTX 2DFKB 4IVPA 4DKJA 4WLNA 2CXRA 4GKKB 4BPRA 3C7KA 4QQFA 3VDQA 2UVQA 4CHGA 2KW5A 1M2KA 3OT1B 1CKEA 2CKMA 6YASA 5BUQA 3R9WA 1TTPB 3RSOA 3DFKA 2ODTX 3QJ5A 4L8WB 1N4AA 3RWMB 2XMQA 3N8DA 4LQDA 4C03A 1RI2A 3OUTA 1YSCA 1R0RE 5SZKB 4A91A 3BHMA 4E70A 1DQNA 4BASA 2CJWB 2AR0A 1EB8A 3NM5A 4YPOA 4EPWA 2YCLA 2DVMA 4PZUA 2G88A 5BSVA 3BXEA 3AO0B 5BQ3A 3NHUA 3L8ZA 4OYLA 4AMGA 2OBLA 1F3LA 4NI5A 1PNOA 3O2QB 2ZJYA 1MO3A 3QNMA 2COUA 1RZVA 3H86A 4EDHA 2VP0A 2Z8YA 1I30A 2G67A 4N40A 1MOQA 4QEZA 2NM0A 1TW2A 2O2YA 4V2UA 3WLMA 1G5RA 1SB8A 1TUBB 5HZMA 5FUQA 4MUYA 1YVDA 3KYJB 3DP7A 4I9UA 1WIWA 3F8WA 4ZYZA 3SJBA 2H1VA 4JI3B 4O1IA 3WBFA 1EEHA 4FC6A 3N8HA 5JCPA 4N01A 2XB9A 4DG9A 3AP3A 5JZVA 4QE3A 4IH1A 5EIXA 1P31A 5IAOA 1P4HA 1NBMD 1V8OA 1YONA 1WF6A 1QLJA 3BIXA 3IAHA 3KPYA 1N2GA 3KBBA 1BCSA 3A9UA 2FEPA 4OXQA 2YZ2A 4Q9LA 3TPCA 4D9IA 5AD1A 1DQRA 3EZXA 4CE6A 1I8TA 4MVYA 3ERCA 3PXXA 5AFSA 3HM9A 2RGEA 3IQGX 2VTBA 1XV5A 2KE5A 3HCCA 3OKPA 4OLAA 1CUXA 1W0KD 2AD1A 4DUGD 2R48A 2BEUB 2FWIA 1MPXA 3X1MA 3JS5A 2IZOA 1ESDA 1L5HB 1JXQA 4FFBA 4Q7EA 4JVSB 2Q7DA 4BX3A 1ULUA 2YWHA 3Q40A 3CH7A 1P2DA 5B1HA 2C8KA 2ZT8A 4KFUA 4PGGA 1OJ7A 3E70C 5K0JA 3BMQA 4TZ6A 4M88A 4CNBA 2ZUEA 4QARA 5FOSA 2F64A 4BFLA 3AY7A 3F6BX 1E1QD 2D1FA 5BV8A 2Z04A 2ZG6A 3WGJA 4TXNA 1NMEA 4OHXA 1ZMRA 2QVXX 2WKRA 3D3KA 1F12A 1UQTA 2GERA 3IEPA 3V97A 4CXMA 3PXGA 3TOZA 5DGIA 3P7MA 2P2CA 3BERA 5I7WA 5T4BA 3HO1A 1CQZA 2AFRA 2OBBA 5IT0A 1GUDA 1M7BA 4XLLA 1IBLB 1O08A 1OMOA 4J49A 1JKIA 3V9PA 1K3FA 2JC3A 2XUGA 3R5XA 4NBVA 2Q2WA 3WC4A 5JSFA 5HTOA 1U3GA 3ACCA 3MSCA 4LNUA 3UUFA 4ZJPA 1JI0A 4C7KA 2A9OA 1CJBA 3OFVA 5A62A 2VC2B 1P7YA 2PRZA 3AFHA 4AUMA 5A04A 2Q1UA 1ZM4A 4OP3A 2GAOA 3CNQS 3L04A 4GGOA 5EGSA 5GPBA 3PCXA 4EQ6B 2JK1A 2ZTHA 5EZYB 4DIEA 2QY9A 5JZ9A 5TC4A 2DUUA 1VMKA 1UPUA 4C0BA 1K2VN 5JO9A 1GRNA 3UWSA 2CLIB 2CD7A 1M8PA 5TQVA 3NNSA 3AR5A 3CLUD 1SKUA 1T1JA 1FRVA 3DVQX 1E5LA 1T35A 2Y1DA 3PLRA 5CLGA 1I7SB 1XEXA 2OILA 2VHZA 3E0QA 4E5YA 3F7MA 3OP1A 3KEQA 3DGEC 2ZVPX 3HPRA 1I4TD 3EIUA 5FOXA 3JQ9A 4E2FA 2QMOA 3MGAA 3TG8A 4D9GA 3DXFA 4TSRA 4Q4AB 2EL9A 3D2AA 3QX8A 4I5IA 4M36A 4A5SA 1ZHOA 1DGQA 4GOND 3IE0A 3KWMA 4Q48A 3VOTA 3FI0A 3K1ZA 3I42A 3DTTA 3JU3A 4YRNA 2PD3A 4K0RA 3UAOA 2R5FA 2NV6A 4PG6A 3QITA 3NXSA 4ECEA 3WDMA 3B3FA 1Q2XA 3BWXA 3LY7A 2A0FA 5JZSA 4CDMA 1U7UA 3ZCVA 4G56A 4OQYA 2ZITA 4M1OA 1DV2A 1X7ZB 1MJGA 4MQUA 1C1DB 3WV4A 4L3OA 4QBGB 1DAFA 1AZLA 4RSMA 5ALVA 3B5EA 2IOYA 4QDOA 1XD2A 1ZJ6A 2B20A 1JJ7A 2F9FA 3JCZA 1PO7A 4ND2A 4RELA 4URYR 4Q9KA 5LOVA 4IHJB 1PR2A 4BFZA 3T7JA 1MAUA 1U1GA 1GCUA 2VWPA 4LZWA 3VH1A 1KEEB 3UV6A 4K03A 1E1LA 5EKDA 2XWBF 4DZZA 4P38A 1D2AA 1X0XA 3ZY5A 2EGGA 2Q29A 3PC6A 1BMDA 1T3SA 1KI4A 2YOHA 2VSQA 4K46A 3TQOA 2PO7A 3PEEA 2FJUA 2WJAA 2BAGA 1CY6A 3QBEA 3G02A 4JH0A 2JI6A 2B99A 3I9MA 4HN9A 3RU9A 1ONOA 4ZHSA 3MOSA 3AVUA 2PNJA 3I28A 1CRPA 1L4EA 4Z2YA 3WB1A 4J8PA 1V8BA 3GF4A 1A95A 3U37A 1P5HA 3N07A 3QQ5A 2F3SA 2R96A 1N0IA 2WA1A 3R6GA 3QVGA 4PQRA 1BWPA 2YRFA 4PYKA 3ABSB 1L3CA 2FJ0A 3RU3A 4YMVA 5LVAA 3CV3A 3EGXA 4MR7A 1G64A 1T4MA 1XDBA 5I8ZA 3UG7A 1KVQA 2ZB8A 2ZSUA 2WKSA 1MN6A 2J6IA 3SHQA 2XUJA 3DFIA 3OPVA 3R5TA 1E6WA 3G9XA 3U5TA 2VWGA 4H4DA 1NAIA 3LA6A 5HGXA 1LB1B 1BHSA 2QN2A 3K8ZA 1KEWA 4HEA1 5ELMA 1U9YA 1YZQA 1B73A 4CMCA 4GXNA 2D5CA 3FTPA 2Q99A 3DSRA 4URHA 3SIPA 2HJRA 2BE7A 4Z0NA 2GHIA 4A0HA 4S2UA 2NZ2A 5EJ9A 4PQEA 4DMFA 1FX0B 3G5TA 2GN4A 5JCOC 2QMQA 4AMUA 1DCFA 2NNLD 3GZ4A 2KLHA 4ZYTA 4XDGA 3E2PA 5DCYA 3I76A 1Z38A 1J8VA 3LIIA 1PZFA 3WNDA 1PIWA 1R0KA 1ZLXA 4J16A 2XEDA 1Z5OA 3HHPA 4LJ9A 1GKIA 1U1CA 3ZNQA 3IVCA 4LCEA 4P98A 3RVBA 1BHQ1 3A31A 2QORA 1H5QA 2GDZA 9GPBA 1ZH2A 4ZRMA 5EHNA 3GZNA 4DMRA 1ZU4A 5CNKA 1P3Y1 3R7WB 3OOYA 1JEQB 3A4YA 1MQSA 1XZ8A 3ABRB 4EHBA 4I3HA 3VNRA 1UWCA 2BFBA 4NYIR 4MH0R 3MUFA 3OT4A 3EY9A 2PLNA 3TQSA 3SC2B 1ECGA 3H0KA 1I4OA 3B1JA 4RIEA 1SCQA 1H4VB 1QZ3A 2OQIA 3JAWB 1YQEA 3NOQA 3NGXA 3RHZA 1JIKA 3W3AH 3WGHA 5GQSA 3TTVA 1VLMA 4MB6A 2BJWA 4IYRA 4AJLA 1ZSYA 2WU1A 2QX8A 3AYZB 1T3TA 3E7PA 5REQB 3QX9A 4OJTA 3VQTA 2X4LA 4FQ5A 1B26A 2IPOA 3LT5A 4Q9DA 3I4CA 2HQSA 1KJ9A 1CUDA 5JG7A 4DT1A 2D06A 1JYFA 3QUBA 3ENWA 4AS2A 1Z7GA 4L4YA 1Z4LA 3DAYA 3HDVA 2CSUA 4YCDA 1A72A 4LHZA 1QH8B 3CZPA 5KTRA 1XQ1A 2FMHA 4LBZA 4MCAA 3U7JA 1B00A 4OGKA 4HGRA 2JFGA 2J3QA 3EFEA 2DUJA 3LBYA 3ORYA 2EG9A 5KTTA 4GI5A 2YWBA 5C0OE 3DE0X 2I7XA 2VQDA 4U3JA 2IV3A 4B7XA 1S0UA 2L18A 1M0EA 5ALZA 3MQ2A 3A7EA 1XA0A 5DE3A 4G1UC 1AJEA 3I9KA 5IDXA 5LDDC 1BEUB 1R9JA 1HKHA 3K70B 2A30A 2R8PA 4QG7A 4OIFA 5ADVA 3ADCA 3EDOA 5FOTA 5LKRA 2ONYA 4MXDA 1YBVA 2H5EA 3GRAA 2G77B 4AJJA 5K9ZA 4ARIA 3H2ZA 3K0FB 1FXUA 5LNK1 5JAIA 5HKBA 5JQGB 3SS9X 2R8BA 1L5KA 4IKEA 2Q7OE 3BQ9A 3M1YA 4HQ6A 4JY7A 2ZP1A 2NZWA 4F56A 4NJEB 3T3HA 2H3HA 4MVJF 4UFNA 1PT6A 2GZ3A 1V71A 2NU6B 4P3NA 2O9JA 3CTMA 2YL2A 4HFNA 2B4RO 4DUPA 3BA1A 2HJ9A 4M7OA 2F3UA 2YNMC 2H65A 3F5DA 1YR3A 3KL4A 2BFWA 2Q1YA 4J0JA 4OQEA 2ZULA 6AT1A 5MN5A 2Q0HA 3QVLA 2QG4A 1SXGA 4L16A 2ACKA 2H5JA 1G20B 4QGFA 2JATA 4RXTA 3UYLA 4Q66C 1N3YA 3KUKA 1NXWA 2BFCB 1KYZA 3BMNB 1WSDA 5JDCC 4BMVA 1NLFA 4OFZA 1GVHA 2RJNA 4FT2A 3DA8A 4JJ8A 4J0QA 4UCXA 4Z1OA 5KOIA 3UT5A 3ZDDA 1CZUA 2WJ4A 2H9YA 3DCNA 4KQ2A 2PQ6A 2EATA 4UUQA 2QRPA 2YBEA 4CYMA 4WOKA 3H6GA 4J7UA 2RAFA 3C1AA 5D84A 3K2QA 4A82A 3CH6A 3Q7TA 1YUBA 5M2QA 3UFXA 4G07A 4C5CA 3K9GA 1NN5A 2JHFA 1TU0A 2ERCA 3FFAA 1XRMA 4YGYA 4ZAGA 3RRJA 1DJMA 4UHEA 3ZU4A 3K9LA 4MAMA 2RIPA 1T6YA 2VHTA 4ZGWA 4FHDA 3H16A 1G1AA 1FMTA 4HRYA 1AN9A 1VDMA 3AW9A 2B21A 1RR6A 2VH5R 3EXIA 3NBUA 4TT8A 1MJHA 1FFGA 1U0LA 5I45A 4YQEA 1VB3A 1X7GA 3KUCA 3QSYA 3RU2A 2GXSA 5FI1B 4DVJA 1GTRA 1RHUA 3G2PA 3WGTA 1U1EA 1U1IA 1XP8A 2OORA 2OO3A 1XTKA 3OZSA 2A9FA 5ER6A 3WZLA 4Z2AA 1RI3A 1YIAA 1QONA 4IHKA 3GDWA 2PMBA 3JQAA 5DTEA 1RVV1 3I53A 1R4NA 1N1DA 2P9CA 3GWGA 4JA0A 1X7XA 4OGGA 5DZSA 4GM0A 1R4AA 4NIMA 3I2KA 4AS3A 1LPMA 2BM0A 4OAQA 3BRCA 1X2BA 3L8HA 4QEDA 1GV0A 3STXA 3PC4A 1FDTA 2ZI4A 3A9WA 1K06A 3T4UA 6REQA 1XCOA 1JQ5A 3DZKA 2CXOA 1LNSA 3O90A 4L4XA 4U2DA 3X44A 4Q7QA 1ISMA 3F47A 3K4HA 2I3AA 3O8LA 3IUPA 4BMCA 1ODTC 1IQUA 4JQZA 4DNPA 4M8SA 4AWXA 4C6SA 3FUCA 4PC7A 5AXCA 3ZE0B 5JJKA 1U5AA 3R77A 2VQ6A 4GMHA 1ZBDA 1RIFA 1CIPA 4YAWA 5BN1A 1K7CA 3KT3A 1ENYA 5JUWA 1E3WB 5F5NA 4EB0A 2R4UA 2ZYHA 1KAOA 4RACA 3AKCA 3S2UA 2VJKA 3UHJA 4E5KA 3IXLA 5HDBB 5IHXA 1SZJG 2D13A 3KAPA 1UK9A 4FHGA 4LZJA 4W5NA 4MVJE 1W47A 1JIQA 3N58A 2H00A 3PQ4A 4EGSA 2EXXA 2VZEA 1IXKA 1JDBC 2YJ3A 5FULA 3S70A 2HCFA 3AVTA 4BTVA 4XVCA 1O1YA 1EK0A 3SKVA 2RC6A 4A6EA 1K5HA 3IX7A 2OGUA 2Y1OA 1USUA 1XMOB 3H2YA 3TJRA 4DR4B 5G53C 4Q1VA 4M6WB 1ZN2A 2Y1LA 4ZARA 2YZMA 1QP8A 4NQZA 3KOOA 2EC5A 5A6SA 1KVSA 1XQ9A 2AN3A 4KR3A 3GP5A 4DS3A 4IH4A 4FC7A 2CE2X 5IULC 3LC0A 4GYWA 1SD5A 2HBYA 3DQQA 1QQAA 4YCAA 1SVWA 1QQ7A 3H1BA 1GFIA 4BQFA 1M34B 4I1SA 2A6PA 4WXPA 3V1MA 2ZAMA 2AE1A 1QQTA 1PE0A 1KDPA 3V8MA 5KTKA 2X0KA 4EAQA 1FQWA 3ECCA 3RLIA 1JPUA 4C7OA 2ON6A 1CQIB 2EP8A 2D2EA 3IBTA 1BXGA 1GILA 3WGKA 4ZKDA 4DWWA 1G3RA 3UWMA 1TXGA 4OHBA 2CNOA 4L3WA 2HRCA 2YR0A 4QLAA 3WS7A 1G0NA 2XADA 4K05A 5IH3A 1YOVA 3FMOB 4I1UA 5FOVA 3RANA 1FRFS 3L07A 4MP8A 4DCJA 2OZEA 3A6PC 4Y2PA 2O6LA 3O3NB 1Z0IA 3GLFB 2HQRA 3VV3A 4PXSA 3F49S 4QFCA 4J0EA 1RTTA 1P1BA 5EE3A 3L7OA 4EY6A 3B38A 3KETA 1P7CA 1GCIA 2C7BA 4OJKA 4YJFB 1VHWA 5BOSA 2AMLA 4LCBA 2A1UA 5EIFA 1T4CA 1NBHA 3OU2A 3SEZA 4F4IA 2X14A 2ZBRA 3K9WA 4Q82A 4I6JA 3W79A 1CXZA 2ILTA 2QE7D 3ASZA 3B8HA 4MKXA 1VSBA 3E6AA 3KQPA 1FP2A 3X1DA 1DHRA 3ZE2B 4I50B 3V4LA 3NR2A 4HJXA 3AGQA 2P2DA 4PXAA 4JIMA 1XKXA 2NOAA 1JLLA 5DWQA 1NVMB 4GMGA 5FCDA 1N6KA 5BUCA 2DBQA 3WWPA 2PZFA 4CG3A 2J9FB 2VK4A 3D43A 4A10A 1KA9H 2E82A 5EPOA 2QD4A 3ETCA 5H9VA 3N2LA 4B3JA 3B82A 5B57C 4GWKA 4R1MA 4AF8A 4CI9A 3SD7A 2BBSA 2E7ZA 4UEOA 5KX5A 4QPZA 2P7HA 3ELYA 4RF4A 2Z3WA 4RH0A 2VDMB 4F9GA 1NT4A 2HIHA 4KX3A 3N7UA 4NC9A 4DJ5X 5C1BA 3RAJA 3CRQA 3PF9A 1XWFA 2GJSA 3IUBA 2EHDA 3TKLA 2NUTB 1KQFA 3BF8A 4XQGA 4X24A 1XCPA 2WU4A 3GLKA 1CFJA 1PS0A 1GPWB 4Y6LA 3BGVA 4Y2RA 3VOSA 3WQQA 2UVPB 2CBXA 1ZGGA 2ONZA 3LLCA 3MJHA 3U0VA 1CVIA 1EXWA 3W6NA 3SHOA 4GYYA 2W5UA 3A3PA 5BV1A 5CVJA 3NBQA 1A98A 2LWIA 3I2GA 3JZIA 3ZHSA 4I0WB 4L5CA 1MFPA 2EKZA 2JBWA 4ZIRB 5FWAA 4HNVA 3R41A 5TXGA 4E6PA 2A1TR 4RKEA 1TMKA 4PAGA 4F5DA 3EX7C 2IS1A 3A2NA 1J20A 3JD1A 1UP7A 5J59A 3M34A 4C3UA 1G5IA 3SGLA 4AVYA 1W4ZA 4H77A 1NOKA 3IP7A 5E2BA 3I4LA 3P9QA 4MKFA 3A2LA 4G0ZA 1Z4KA 4XCXA 2R6R1 3IB6A 1W87A 1O9BA 1RXEA 2QVBA 3GJ3A 4IOJA 4KXWA 3MG9A 4ARZB 2R7MA 4ID3A 1DG1G 2B5WA 1PX0A 3C6ZA 4L07A 1R12A 1MUUA 4KUEA 2FWMX 2C29D 5EWMB 4AZ0A 1NVVR 2XQIA 4Y2SA 3H9QA 5JFTA 1FFAA 2JAWA 2E87A 2IYXA 3EIWA 1AHNA 1U1DA 1XZDA 2ZBEA 4MQ4A 2BM8A 3EY4A 3HEBA 1JE1A 4JL6A 1Q7CA 1A88A 4BO3A 4NEGA 4JA2A 1XJ5A 3L0CA 4D4HA 1N78A 1P4JA 1FYVA 1A9XB 2J9XB 3PUIA 5IAKA 4R51A 4B7ZA 2XF2A 1TJ5A 2R00C 3L0OA 4Z51A 3ZU2A 1KTVA 3TQRA 1Y1KE 1VZ3A 3IFSA 1GQYA 1CG6A 1PG0A 2W83A 3CNHA 2C7VA 3AIOA 4NPHA 2OLEA 4ETWA 3DR3A 1M6HA 2JHGA 1YZUA 3BL5A 4HTFA 1QE3A 4CU2A 1MXHA 4P0TA 4P1ZA 1K7XB 1QGUB 4I5GA 4K40A 4TX1A 3EODA 3NHSA 5LZ2A 1MC5A 2QTGA 3ZZNA 1FP6A 1ML3A 3ASUA 4HFMA 3E18A 3D4OA 1K8RA 4JUAA 1E59A 4NZYA 1KPIA 4GW3A 4YEDA 4ZI7B 4A6DA 1ZSNA 1W581 1QDLB 2BSQA 4NZ9A 1ODLA 1RM4A 1X9IA 2WHXA 1KSGA 1BFUA 1IZ9A 2ZUVA 3NOXA 1NLYA 3K1AB 3PDJA 4MK4A 3K70D 2ADFA 1S01A 4AY2A 4WJLA 1RLIA 2VHYA 2PUAA 1AN0A 3ZE7A 3PENA 3LQYA 2NUAA 1DIOB 2V9CA 5E4FA 5HCUA 1GLGA 1NV8A 3L0ZA 4MV7A 1ISPA 4U2GA 3OLQA 1D1TA 4HAZA 4UNQA 5AM1A 5JMPA 5KIAA 2E6KA 5JH7B 4UDXX 4N0MA 1UZLA 1P7ZA 2B4KA 2IYPA 4WL0A 5E7MA 4BP8A 5DHPA 1LI5A 4WRRA 2PZAA 2VTKA 3JZFA 2PM8A 4CJXA 4HNUA 3H87A 3LQRA 3ITNA 5BVGA 3PT5A 3RAGA 1RJWA 2V7XA 1JKJA 1P17A 1RC1A 3AR4A 4IFTA 5JCOA 1F4VA 2QJOA 2R6JA 4N49A 3ZNPA 2YOGA 1P62B 3RYFA 1AGNA 4I1RA 3GLRA 4FJ1A 1G7TA 1EG7A 1G8JA 1HE2A 2C1ZA 2JGAA 3HA5A 4KLCA 4B81A 4YUWA 1T5HX 1N32B 2PPVA 1PV1A 2JDIA 4A92A 1Z7EA 3IUMA 2VPWA 3IO3A 4RQTA 2G28A 3G2KA 4ETIA 5FTKA 3MTDA 4K7JA 3SR4A 2XD9A 4FLFA 4OUKX 3UT0A 1IUKA 1ZBQA 3BWDD 3I1FA 2OK8A 2ZKLA 4DLAA 2BDEA 4H4CA 3H1PA 3OOEA 3AHGA 3QEJA 3ZJUA 2G72A 2P62A 5BSFA 1E89A 2HMYB 1HZJA 2OAEA 3FUUA 4TM8A 3PR1A 5CXXA 5JCJD 3U17A 1WKVA 2P8JA 4O4IF 5FB3A 1VCIA 4R68A 5AM4A 3G6WA 4FFLA 2F8TA 2JASA 3D7LA 5BV7A 4LSWA 2OHOA 3R7FA 1Z0AA 5KU1A 4RKYA 4IXDA 2AEFA 3A04A 4PNEA 1WUKS 5EP1A 5BR8B 1IIBA 2PLAA 1MXFA 4LGCA 2VJNA 1P1KA 4ENQA 1RAAA 3SEQA 4ZI2A 2I1VB 2JVJA 2R7AA 3HB7A 3Q1LA 4FFPA 2HJGA 1Y4SA 4LC9A 1PSWA 5HTKA 1GU0A 4W9RA 1FU8A 3DMDA 3K1TA 4YMTA 5A6VA 1XZMA 1DJLA 2PUVA 2ZBFA 1E64A 1JHYA 4KE9A 4CODB 4YI3A 4ZVQA 6CHYA 4E4YA 3INRA 3MQ4A 4TT3A 1V16A 4BO7A 2CXQA 3NMUF 2BYTA 3CF0A 1M1YE 2ZRKA 3BB3A 1E3IA 3EXFB 4J0GA 1X14A 5KWVA 2HPHA 3KXPA 3MXTA 3L92A 1AF7A 2R79A 5ESXA 2ZQZA 5AJXA 2PN1A 4RVSA 3PF8A 3ZLVA 2VPXA 4DM4A 4WA8A 4FUQA 4C0XA 3VKHA 4G1MB 1JXOA 1TM7E 1W4LA 1B8NA 3PR3A 5EVJA 5KVQA 4AB1A 1KGSA 3LPAA 3G8DA 3AM1A 2ATIA 1HYGA 1Z25A 1WW2A 2QX7A 3NM4A 4YFVA 1MORA 3R24A 1WSAA 3SMVA 4UVIA 2M6SA 4R54A 1K66A 2NPFA 2XKAA 3MCUA 3REFA 1PK9A 1XRSB 3RJZA 4K81B 4LV6A 4CF6A 3AJ8A 1EFUA 1OPXA 5TPWB 3N2EA 4OXIA 4RS4A 1DEAA 1G8FA 3CZ5A 2BSXA 4Y2JA 3M4NA 5EMLA 4DZTA 4PVCA 4Z49A 1NVAA 1OI2A 4UZEA 1VMEA 1QE0A 3GRFA 1F7VA 3GHYA 4A7PA 3CGWA 2YNMA 2QMZA 3N2GB 4KWEA 4BC1A 2HA6A 4EHKA 1QAOA 4COKA 4PCAA 3UMJA 3ECSA 4FFWA 1ZK0A 3PJFA 4C21A 5EXSA 4RXMA 2NIPA 5JDCA 2AI1A 2B82A 4FSDA 2BEUA 2JANA 2D5LA 4H7EA 4F7WA 3GFTA 3RS7A 1HR0B 3T3PB 4D3SA 2VR1A 4MEBA 1VG9B 1J5EB 4Y6RA 2NSLA 2ZRDA 1AVTA 3PJDA 4KK3A 4ZK2A 3PR2B 4V0LA 3L8MA 4PZYA 4TLMB 1EBUA 1Y0BA 4PZEA 4YP5A 4FB4A 5CXUA 1GUBA 3HDYA 3SC3A 4CTMA 5IS2A 1QRUA 1KDTA 2ANCA 2X8WA 4YJ3A 3T1OA 4ZVOA 2F8LA 2QUZA 1AQJA 4UW9A 3E82A 4RJJA 3DVLA 4P81A 1LLCA 1ANKA 1T1GA 1U7ZA 3K53A 3AEQA 4OJNA 4ZQIA 2ZIVB 3LT2A 3SLKA 4RJKA 1TFUA 1XGKA 1ZIYA 3ENVA 4MUHA 3K0AA 5IEJA 1E66A 4XW2A 1KJWA 2J07A 3DBHA 1RVDA 4G0XA 4HX9A 1JQ3A 2X6TA 2OECA 5DCWA 3ELUA 3THXB 3OE4A 2G82A 4QHTA 1RYYA 4BVGA 4GDFA 2O8BB 2RSLA 4RC9A 2PZ8A 4FR2A 4XTCS 3DTYA 1JALA 4M86A 1COWA 4YASA 2O06A 3VR5D 3N9IA 4GVLA 5EJ7A 1KEZA 3U60B 5JYEA 3EWSA 1O5OA 4MCJA 4OATA 5B53A 5ERXA 2ZIEA 1QANA 1UDAA 5KYWB 3AR9A 3EMVA 3FUXA 1I9CA 4U7FA 2A9JA 3ZE8A 3ZR4B 4WFIA 2PXXA 3K1JA 8GPBA 4U6QA 1FZQA 1DKUA 2ZSDA 4R5MA 4HGYA 4F2HA 4FN5A 4BP9A 3DH0A 4UTVA 1FU4A 4ZDKA 5K6AC 3H7AA 1CBUA 5LU9A 9MHTA 4TYWA 4NATA 3NIGB 1P0IA 5IHPA 2X9VA 2IPAB 2LGJA 1YE5A 4G1VA 4K9OA 2QMHA 1CDEA 2NO4A 2W4IA 1ZOLA 3M4YA 4PSDA 4C7BA 2ORVA 3EN0A 4HFRA 4TLAA 2JZCA 1XAHA 1EFRD 1USIA 4JJ6A 4FGLA 4KNVA 2V9ZA 3UCFA 2ZIUB 1VIMA 5H7XA 1WULS 5BT9A 4TLEA 2LW7A 3P45A 4TV8A 1XN1A 4EB3A 1L7XA 1PEKE 3B6IA 5FPSA 3GFBA 4M7PA 1XLUA 4C22A 2MSKA 1I51A 3AUFA 3DBRA 3GT4A 3PUVA 5KVVA 4DV0B 1CHNA 2UZ3A 2ZIWB 1U2GC 2I65A 3DZHA 3IKLA 3GR6A 4H31A 3BMOB 4IHJA 1FDRA 4R2IA 1PV2A 1J0XO 2ZXEA 4LWQA 4MO9A 4Z5XA 1YA6A 1CZRA 3K6SA 2FHSA 1Z2CA 4FYYA 1U4SA 1X8XA 2R1VA 2X0JA 4JGBA 4Q18A 2YY6A 4AJNA 4Q3KA 1OWLA 2KS6A 3PXUA 4BKRA 1YRHA 4B8WA 1X70A 3DULA 3MW8A 5CIQA 3O4JA 5TGTA 4MV0A 3VM6A 4BLUA 1A8PA 1DJPA 1G9XA 2ZAGA 3LSTA 1M2JA 4KO1S 3UWKA 3W8FA 4E22A 4EQZA 4HJRA 1N0VC 1USGA 4HN2A 3UATA 2D0IA 1UBKS 2QRGA 4YB8A 4C6HA 1Q3TA 4PICA 4XQCA 2HDHA 1OYVA 3O38A 4RJIA 3VAYA 2GVNA 4LF5B 1G2QA 4GWLA 1XEWX 3OSUA 3BK1A 4FKMA 2YJ6A 5EE0A 4GEGA 3ORRA 5ALWA 4C06A 3T0IA 3PB3A 4NE2A 5IYZA 2QYSA 2IA5A 3EMDA 3L5OA 3QE3A 4DILA 3R8FA 3GA0A 1M7HA 3ILHA 4YK7A 3R7BA 4JQOA 4P4NA 4KGVA 4JR2A 1I0IA 4QVIA 1WCV1 1RCUA 4IFEA 2G7MC 5L95A 1NWCA 3DUWA 4K9NA 3ZPXA 2R6FA 3RJ9A 3WP0A 1YIOA 2QRVA 4P3PA 2GZHA 2UUCB 3EWIA 4JOSA 1R6DA 4ZODA 1IZYA 3CEAA 5CDSA 1IRXA 1LQTA 1UEIA 2HHAA 2HCBA 1G5HA 2E21A 2F9LA 3QXSA 5K3AA 1SKQA 3SYKA 1Z33A 2PWYA 4Z54A 3CH5A 5K3OA 2W11A 5BWBA 2IYSA 1CF4A 1O95C 2XCRB 4XD2A 2IEDA 2VKQA 4RFSB 2ATVA 4WEQA 2DEUA 1Z6YA 3IBFA 1KY4A 1Z3IX 2QTWB 2G9QA 2VN8A 1KYXA 1LV8A 3NHFA 3PL1A 2OFWA 3KO8A 1JLSA 1XBTA 4Q37A 4Z1MA 4BP1A 1C7ZA 3E9ZA 3KT0A 3QNWA 3GLGE 3WHIA 3RI3A 3A1VA 4B3CA 3A1SA 1G4AE 3VMMA 2YFQA 3D7MA 4IS2A 1SXPA 1JLRA 1NZFA 2CHGA 3ANXA 4KWHA 4CV1A 4CN8A 5MDHA 5LUBA 1E3QA 5DHSA 3UOWA 3DBVO 4YP7A 3KTAB 4R8KA 1JEQA 2JFUA 5CT8A 5CCDA 3LPDA 4MVWA 2C54A 3VNSA 2TS1A 3DHYA 1XDGA 4F11A 3RIEA 5L6LB 3HVHA 1P45A 1PDOA 2Q3JA 3S2GA 2AMFA 4R3NA 1A7AA 3SC2A 5I4CA 3JAWA 2OENG 1KKUA 3PWSA 2I2CA 5K3FA 2KJQA 1JTEA 1C3OA 3U39A 2JLUA 4DUZB 3U7IA 3ZWAA 1Z83A 1ZD9A 4BCDA 5EJ4A 4N3AA 1LK0A 4EECA 3AKZA 3GEDA 5REQA 2F1JA 3T9FA 5BNTA 2JAPA 4XARA 2CUTA 3VX4A 2CXXA 2FUG6 3KG2A 3WR5A 2BTQB 2F8MA 3WWDA 3OTQA 3ZXSA 4MUMA 4BVAA 1SU6A 1U8CB 4EMSA 2NSHA 4BLOA 1COZA 1JMVA 1I6WA 3OQ1A 4X45A 4LDQA 3QVTA 5JR3A 7YASA 1HLFA 2H7VA 4YQYA 3UBMA 3GJXC 1E5DA 2Z98A 3O7WA 4LY9A 2EDCA 4D8TA 3FIJA 3HXLA 2OD7A 1Y3FE 3KX2A 3A1CA 3P8ZA 3U81A 3UJCA 4I2VA 1E2IA 1U6KA 4BO5A 3TD6A 2OK7A 1JJVA 4DLXA 1YHZA 4K8OA 1B8VA 4MR9A 3LKBA 3JALB 4MUXA 4JSTA 4N9QA 3DLBA 2JFOA 1KSHA 2QUIA 3Q2KA 5CYOA 2JH9A 1UT5A 3WBBA 2WJ3A 3B53X 3NIFB 1ORVA 1D1SA 2VNHA 1NG1A 3FCOA 3P2JA 3S28A 4JWTA 1DKOA 3CBGA 1RKXA 2ORIA 2X23A 4RV4A 5E8RA 4E94A 4AY3A 4EA8A 5I9MA 2XDWA 2HR1A 5JQGA 4G2TA 4R7TA 1CJMA 3BVPA 5GIOE 4OU5A 3OKAA 5C8DA 3JYNA 1EG2A 1NY5A 2FMXA 1UQRA 5DNAA 3S8MA 3PYXA 4AICA 4NZZA 3TDKA 3ADBA 4DJDC 1DAHA 1XQXA 2PAFA 2VUTA 5D3ZA 1OSNA 2R00A 3W2GA 2OUIA 2YV2A 4FYVA 3FWZA 2X76A 1LA2A 1O0CA 4WT7A 3GBVA 3TZEA 2V1XA 2XTMA 1GYQA 3QE2A 4H0FA 5KQLA 2J9RA 4IOLA 2BY4A 4LF8B 1PVDA 1AKWA 4HQRA 4REOA 4EO9A 1BEZA 3AY6A 2FSGA 3BGIA 3BMNA 4II7A 3GUCA 3ZWOA 4N3GA 2WUWE 3DLTA 4KRFA 2MYPA 1P0CA 4EO7A 5FRDA 1ZHFA 4F3NA 1WZ2A 4QELA 3SSMA 1GKYA 1DSSG 4LE0A 1M8JA 2C98A 5BN4B 2Y71A 4HDKA 4ED9A 2XWJI 4MWTA 3UYKA 2JFQA 1XDSA 2N1MA 2VG8A 1CULC 1GADO 1AF4A 3OZUA 3Q41A 2C0CA 4ILEA 1VCHA 3O95A 4KBYA 5H0IA 4BVJA 4BECA 2W48A 2G9NA 4AWBA 4UU0A 2FSSA 4ASUA 3FPEA 1Q92A 1QWSA 5D6NA 1L5OA 5EHIA 1Z28A 1EDEA 2MHCA 1F8YA 1GFWA 4KGZA 4QXAA 5F7ZA 4QECA 5EAIA 1T2DA 2YWJA 4YMHA 3L0DA 3UBTA 4EPTA 3MJSA 2BP7A 4TMVA 5C32A 5DHAA 3QUTA 10MHA 1R0YA 2VHXA 2PO5A 1EFDN 1F38A 1LJLA 2RGYA 1UWVA 3GG2A 3H1TA 3LP5A 3KSDO 4PZDA 5IVKA 1JWBB 4F1KA 2ZTSA 1SBNE 1Z4QA 4OQZA 2GK6A 2I62A 1U99A 4OQMA 1M10A 1E6UA 1FP7A 2A35A 2D62A 2GILA 2YW9A 3DZGA 3G9QA 3KYDA 4XYMA 5HDQA 3W5UA 4DC9A 5IMSA 2YHIB 1XRRA 3QXCA 1HEUA 4UAJA 5C5EA 4FHFA 2ZVJA 1TZJA 3DKKA 3QTLA 5K3BA 3DLHA 3GFFA 3TRFA 1WA5A 1GQRA 5C35A 4KO8A 3GAAA 3H9EO 3TWOA 5U4XA 2A0WA 1S7GA 3GJ8A 3ITEA 4XVQA 4JGGA 1Z88A 4CR7A 4RAOA 4JYPA 3CX4A 5I7RA 3OF2A 2JLAA 1WXEA 3W5VA 2BFMA 4Q3AA 2FKNA 4PLFA 2OD9A 5CW1A 1E3LA 2BMAA 5CT6A 1GXSA 2BM9A 3A6KA 5B3JC 5CHEA 1ULSA 2XSZA 2XRFA 4Q9IA 2J32A 1E8DA 3W5SA 3SSAA 4R7ZA 2H9AA 2ABWA 4MRPA 4JR0A 4KWIA 1YCHA 3JR7A 3A10A 5G02A 5IJAA 5MHTA 1SZCA 4XCQA 4KN8A 5BSWA 4QD3A 2AJ8A 1PHRA 5A1TA 1PZNA 2V8OA 5K8TA 2EJUA 3IAS1 2OCPA 2X2PA 3WWEA 3CEJA 1H65A 3CZQA 4MKGA 4EG3A 3VU8A 2XMGA 4GZLA 4HYYA 1TVEA