2WWXA

Crystal structure of the sidm/drra(gef/gdf domain)-rab1(gtpase domain) complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGIKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into the Dual Nucleotide Exchange and Gdi Displacement Activity of Sidm/Drra
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords RAS-RELATED PROTEIN RAB-1
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wwxA00
2ZR9A 4G5SA 1VG8A 2BOVA 3ZH9B 2VA8A 3CRW1 4A8JB 4DDVA 3CB4A 2WJHA 1BIFA 4DCSA 4AG5A 4F7WA 2WWHA 3THWB 4LJ8A 2CNWD 2DBYA 1G7TA 1KO4A 4NYMR 5KUTA 1U81A 2QE7D 2W2VA 4OHZA 4A1FA 5FH9A 3SYKA 4EJSB 4PZLA 1XD2B 4ARZA 1FQKA 2H17A 4EPWA 3Q5EA 1JECA 3L8ZA 2W2XA 3U2QA 5JMTA 2Y8EA 1XTKA 4Y0AA 5DIFA 2RHDA 3DVLA 1D5CA 5GADl 4PHHA 3L0SA 4N0EA 2GHIA 1YZLA 4TL7A 5KNCA 1W0JA 2AL7A 5JWHA 3QPWA 3NG1A 3LLUA 4TSFD 3AEZA 1ZINA 1CLUA 4ESVA 4C7OA 2WMNB 1QZXA 5EXSA 3RLFA 1RYFA 1ZM2A 2RGCA 3KB2A 2OCAA 4NTZA 1WF3A 2H18A 2ZI3A 3RWOA 1JXMA 4Z51A 1G4AE 4CW7A 1G4UR 1JJ7A 3GJ5A 3T5GA 4URVR 1UKYA 4ZDJA 4M1MA 1KI6B 3QUSA 1E96A 2XTZA 3FMIA 1Q12A 2AD1A 1GSIA 3CRQA 5SZKB 3RRZA 4JLJA 4D6PA 1MV5A 4BLRA 1NKTA 1OF1A 721PA 2CHQA 1YRBA 2B8WA 2NO9A 3TW4A 4UNNA 2IYVA 2V7QD 4UQOA 3AF2A 2O0HA 4OJKA 3QG1A 1KMHA 1ZC4A 1GAJA 5TB5A 4XH9B 4JLVA 2P5SA 4F91B 2FN4A 1PZNA 3W34A 5KDDA 1GG2A 4PPQA 4DLRA 1S96A 4RD2A 3U3RA 2EQBA 4HUQB 2C77A 1W0KD 4MYUA 2WBLC 3A1UA 3NC1C 3TAHA 2IF0A 4ZIRB 4BEJA 2QORA 1NLFA 3THYA 1QHXA 5TXGA 1Z47A 3FTQA 4EDHA 1CJKC 5AUOB 5IRCD 4MH0R 2VP0A 4UKDA 2W6JA 2ANCA 3W6NA 2JLZA 1VYUA 4D81A 1XCPA 2IL1A 2F43B 2H1LA 1D6JA 3VR4A 4X8OA 2OAP1 1VHLA 5EQTA 4R7ZA 1PJRA 4G3XA 1NN1A 2YWHA 4IDQA 2FFHA 3W8NA 1R7RA 4URUR 4EPVA 4AI6A 3VNUA 1RRPA 4HLCA 1HY3A 2FH5B 3PUWA 4LZZA 4X8HA 5HE9A 5HKKA 4QOSA 3NBFA 3PVSA 4LJ9A 1N6HA 4UXJA 2P6UA 1G16A 2J0QA 4JVNA 4XWKA 2VL7A 2VP4A 4ZI2A 1Q0UA 4M2LA 1O3YA 1XF9A 3F3YA 1UEIA 3PITA 4DLWA 3I8XA 2FGJA 3QKUA 4U00A 3CBQA 1TF2A 5EE3A 1XB2A 1ZW6A 5D3QA 3UATA 5L3QA 4HDCA 1Z07A 2ZETA 3VNVA 2DR3A 4B74A 1NY5A 3QVUA 1OT3A 2R9VA 4M0LA 4Q7KA 2P67A 2ZRCA 4LJ4A 2KI5A 1OFIA 5JEDA 5FOWA 3MJHA 4PAOA 3CH5A 1SVLA 1J90A 4L5BA 1MKYA 2V6IA 4UNSA 5H1YA 2FMXA 3OFNA 3FOZA 3VHXA 3R7WA 3FDIA 2GK7A 4HATA 4PR0A 4XD7D 3VR1A 1FFHA 4TZ6A 3OESA 3IHWA 1B0UA 3T5DA 3JZMA 1BKDR 1YQTA 5K8LA 4FCTA 3K70C 4GMDA 1E2IA 1KKMA 4Q21A 2XTNA 1F5NA 4HLDA 1EFHA 4RZXA 4DCUA 4KVGA 2YNMA 5IDVA 3DZ8A 2H16A 3PUXA 3ADCA 3MMPA 2G0TA 4C9BA 4CT4B 1OKKA 2F6RA 3NKVA 3ZZTA 2QP9X 3LBHA 3WNDA 2VHTA 3CONA 2ZSDA 4B33A 2CL0X 2QM8A 5E7JA 2J0VA 1ZJ6A 2BVNA 2W0MA 3B1YA 4M1KA 1VPLA 1WDTA 2FFBA 4WXRA 1Z2CA 4M9XA 3RAPR 2GETA 4US0R 4JT2A 4HI0E 3KQLA 2QMHA 4HAUA 1TU4A 4E22A 2GXQA 1P9WA 3VU9B 1QDEA 3LX5A 5JHGB 3EPKA 5EXXA 4FXPA 3CWQA 4JKYA 2GK6A 1KI7A 3MD0A 4BWYA 1BMFD 2JDIA 3RYTC 1D9ZA 3ZD6A 1G9XA 3TVDA 4B2LA 2QROA 4LJYA 3UG7A 1ZUHA 3LAWA 1II8B 4YXWA 4C7OB 2IHYA 1FOEB 5CYPA 4C30A 2ZRHA 1Z8FA 4HUTA 1EG7A 2BJWA 3AVVA 3LY5A 1JQJC 4Q9HA 3CIOA 1G20E 4JVSB 4LPKA 1DAIA 4UXIA 4ZDWA 3CO5A 3TQCA 3KQHA 3QXCA 1G5TA 2R6DA 4B2PA 4M9SA 2OBMA 3SJBA 1E79A 2CLDX 3QKRA 2E1RA 4C3ZA 1KO8A 1IHUA 2ZRMA 5DGXA 3SR0A 1M34E 3IHLA 2F3RA 1E4YA 4AK9A 1WXQA 3K9HA 3N2EA 1B23P 5JWRA 4KO8A 5CM9C 3CR8A 1PLJA 2AWNA 1E6CA 3P32A 2GXUA 4C0KA 2ZI7A 5EZ5A 3SNHA 1DAKA 1Q22A 2CDNA 4NH0A 5JHHB 4DIEA 1NIPA 3EZFA 2WJVA 121PA 2ERXA 4GP7A 2HEIA 3KZ1E 3QOFA 1BYUA 4OJQA 3D6TB 1RYHA 1XEXB 1U9IC 1NVXQ 1ELOA 2ORVA 2IS6A 5KNDA 3IGFA 1R8SA 5FTNA 1G5PA 2O0JA 3GJ7A 1KDTA 3PQCA 5DI9A 2LWIA 5C4MA 4QBGB 3IPYA 1UDXA 3I73A 1LV7A 3LVQE 3SHWA 4PPNA 1HV8A 4N0DA 4DCVA 4RKEA 1KI6A 1G19A 2MSDB 4DBLC 1E94E 1CJVC 1GFIA 2ZITA 2CVHA 4AKIA 4XVUA 4HAXA 1T6NA 5JWOA 4MRSA 3S1AA 5FPYA 5EJEA 2IEZA 3O8DA 4QNMA 1N2CE 3KQNA 1QBKC 4FN5A 4RD1A 4GNKA 5IHPA 5L3SB 1HTWA 3CPEA 3NWJA 4TLAA 2GF9A 2QSZA 5IT5A 2IC5A 1GKIA 1ZM9A 4EAQA 3H1TA 1N6NA 1R6BX 1D2NA 1N5LA 2J0UB 4LHWA 2HCBA 3PFIA 2O8DA 4RZUA 3R8FA 1P5ZB 3Q7PA 4IVPA 1OE0A 4PPGA 4DHEA 2JJ1A 1TMKA 3QEOA 3SBEA 1S9HA 3TUJC 2QG6A 3KKPA 1DVRA 1R5NA 1LW7A 5FTKA 3ZS9A 1G8PA 1QHHB 2CE7A 1YR7A 1R0XA 3JZAA 1NVVQ 4FI3C 1KI1A 3AKEA 3VFDA 4NKRA 1Z08A 3A1VA 3CM0A 3OFND 1OH7A 2NO1A 3LWNA 3LBIA 5HE8A 5GJBA 3K53A 1IJEA 2EW1A 3U7EB 4AYWA 2ZR0A 3SOPA 2GEDA 1G1MA 3PR1A 4HAZA 1E2FA 3Q5DA 1KIMA 5KNBA 2F55A 4B47A 1OB5A 1YR6A 4PAQA 1XPOA 3AVUA 1U99A 4B2IA 1GKUB 4C0QC 3Q72A 1TF7A 2ZS9A 4A92A 1ZNZA 5CIQA 3VR5A 1JPJA 1EFUA 4IXNA 1CTQA 2ZRKA 4OK5A 2FU5C 3KUCA 1QRAA 4TMWA 1MRNA 5EP1A 2I4IA 3AP1A 1DG1G 1Z6GA 4GRAA 4ILEA 1BS1A 2PT5A 4GOKA 4GPTA 5J4KA 2ASEA 1FP6A 2DY1A 4E09A 1NIJA 2AWOA 5JFGA 1W46A 3I8SA 2BHRA 1UKZA 1N0UA 3D7MA 4Q02A 3MJRA 1WBDA 2VPPA 1ONBA 1Z0FA 5DI3A 2OLKA 3KQKA 3EPLA 5GJCA 4DEYA 2P2LA 2O0KA 1HT2E 2RB4A 1KK3A 3QNUA 4JMPA 1Y63A 2QEQA 1JAIA 4L9SA 4M22A 4JYBA 4RFSB 4ZDKA 3DL0A 1EGAA 3QE0A 4EPRA 3AKCA 2HT6A 2FFQA 1OIXA 2YV5A 3EC2A 4F93B 1SVIA 5SZHB 2QP3A 2UZ3A 1XXHB 4NE2A 1KI2A 1T8UA 1DBSA 3TR0A 5FR1A 5D3MA 5JS8A 1E9DA 3R9WA 2GF0A 3KKQA 3UXMA 3H84A 2DCUA 1KSJA 1Z3IX 4YXWD 5KPJA 1WCV1 3I92A 5DE3A 4V0ME 5LD2C 3KJIA 3THWA 1JR6A 1KK1A 2RGAA 3AVYA 1ZAKA 3CPHA 1XX6A 3CLVA 1GL7A 3PUVA 2CL6X 1I4LD 4TMVA 4LC0A 1US8A 1Z63A 1J2JA 3UWOA 2DB3A 2G3YA 1BYIA 4W9MC 1ZBDA 2QRZA 4RZ3A 3HYTA 4V0NA 2YOGA 3IIKA 4I1UA 3OE7A 4D4LA 3AM1A 1P75A 2RH5A 4LBVA 4B76A 1FNNA 221PA 4BFSA 1FMJA 2V8OA 3CPJB 4GZMA 4Q9IA 5AJWA 2XOKA 2OV2A 3I3SR 2O8FA 1S1CA 2Q9BA 3KJHA 2FPKA 1IN8A 2ZRNA 3IUYA 3HU1A 3QY0A 5FOXA 5KYKA 3P27A 4L4UA 4LGMA 1T3LA 4B3XA 5DN6D 4DLYA 4TTPA 3C5HA 3PIRA 2FPMA 4XIGS 4LBYA 5G3ZA 2AXPA 5EP4A 2UKDA 4UJ3A 4DSNA 1XXHA 4IRUB 1YKSA 2ZEJA 4IDPA 1I2DA 3X2SA 2B7CA 4P31A 3TVTA 4DLVA 3BWDD 1W2HA 3BBPA 4Q4AA 1TF5A 1GITA 3AVQA 3I4LA 1N5IA 2J7PD 2PX0A 1T91A 2VIIA 1Z5ZA 1IY0A 5JJKA 4LX0A 2FG5A 3SJCA 4QC2A 3NXSA 4Q9KA 3B8HA 2GCPA 2ZRFA 4EQ6A 4BLTA 4PZZA 3CRRA 1FW6A 1NMXA 3E1SA 2Q6TA 4G1UC 2GCOA 3GLGA 4NYIR 5LPNA 1GP2A 2TMKA 3WMGA 3B9PA 1EX7A 4NHOA 2ZIAA 4WIAA 1AQUA 3SN6A 3I5XA 3M0EA 4TN1A 3DO6A 1VCIA 1TQ4A 4Q66C 2RGNC 5CDFE 2ANBA 1CF4A 3VKWA 1M7HA 1YZGA 5JCZA 2WZQA 3TQFA 1KAGA 4O2LA 2GNOA 2FX3A 3PEUA 1M2OB 2OFXA 4FCVA 4JLNA 3T1QA 2ZRDA 1CKEA 3B1WA 5JJLA 1U8YA 3A58B 4MYHA 3ICEA 2WWGA 4R2IA 1G3RA 1R5BA 5JI2E 3MFYA 2IHBA 2UZIR 1OXVA 1ZM4A 5L8VA 1DTSA 4LJAA 4LHVA 2JDID 2VLIA 3QXXA 1S0UA 2DWOA 2CCJA 4YLGA 3FVQA 1SXJB 4PC2A 3PJRA 3SJAA 5F98A 2FEOA 4QGFA 1AQYA 1W1WA 3LD9A 5E95A 2NO7A 2XTMA 1EESA 1R0YA 5FTLA 3GFOA 1UF9A 2X1VA 3WRXC 2ZPTX 1NN5A 3WP1B 1HT1E 4I1VA 4FMDF 2IS4A 1AM4D 2AXNA 3ZS8A 3B9QA 4ITRC 2VH5R 3AVOA 3ZGXA 2QSYA 4BLPA 1DAFA 3I5YA 1OH8A 4NMMA 1E79D 2C95A 2ZREA 3CNLA 4AIIA 4II7A 2YC2C 1U0LA 1CIPA 3THOA 2O8EA 3OZXA 1XFAA 4D0LB 4LWZA 4HZUA 4DLXA 1ZVQA 3X1XA 3OF5A 2RGGA 2BMFA 2GILA 1DELA 1X8JA 3N5CA 3VQTA 4EKDA 4BFTA 3UKDA 1F2TB 1T3SA 1OFTA 4V0OA 4KU4A 4W5WA 3CNNA 4A2PA 1YZNA 3EW9A 4MRVA 3FGNA 5EE1A 1CRQA 5TVKA 4QJ3A 2REOA 2REBA 4V0KA 1OHHD 3WYGA 1QHIA 2J0UA 3E5HA 3QIAA 1Q44A 1R4AA 1KJZA 4F4CA 1QF9A 2G77B 2YKGA 2F7SA 1KMQA 4PO9A 2FOLA 5CM8B 1Z29A 1S8FA 1VCOA 3GJ6A 4HAVA 4TTQA 1T5IA 2XNDA 1AS0A 4IFEA 1DAGA 4JVMA 1NBMA 1FP7A 4XWAA 4NDZA 2JJ8A 2VO1A 3CZQA 4URYR 5BYJA 4TYWA 4AD8A 3FKQA 3TW8B 3BB3A 4LCBA 1XPUA 4L9WA 3BS4A 1VG9B 2BCGY 4QGAA 1VYVA 1YRAA 4XSHA 3RSLA 1ZYUA 421PA 3K0SA 1G5RA 1Z0AA 2ZYUX 3NIBA 3K0CC 3EPHA 2JLVA 4YDHB 3DM9B 5F9FA 3LFUA 4IW3B 4JYCA 4AG6A 1W36D 1KNXA 4XJXA 3RS0A 2IS2A 2QTVB 4JBXA 2JJ1D 4KFTA 3WBKA 2WTUA 1JJVA 1H65A 1U94A 2GAOA 2KSQA 3GLHA 4AY2A 1KK0A 5FOUA 1CRPA 4JL5A 4QHSA 2WOJA 3GLFE 1GVNB 1UEJA 1A1VA 1XBTA 1TAGA 4JLAA 4JSTA 3SZRA 4NCNA 3R7WB 4PSVA 1KJYA 1TTTA 2D2FA 4OHYA 3SFZA 1A7JA 4Q1AA 2Q9CA 4XD7A 4EJSC 1LS6A 1RJ9B 2WOOA 3P26A 2F9MA 5C1BA 4HAYA 3A1SA 1GRRA 3I1FA 1JEEA 4M8NE 2Z5FA 1IAQA 3L43A 4LYJA 4PC7A 3SC3A 3SEAA 3TSWA 2PH1A 3A4LA 4Q5IA 2A3RA 1S3SA 1HURA 1CXZA 3GEHA 4V03A 3RWMB 4GP6A 2UVQA 3M4YA 3X1YA 2AK3A 4MITA 1A5TA 1KO7A 4TLDA 4YMUA 1H8HD 1N5KA 3QXHA 4IJMA 1OSNA 4MUBA 4NYMQ 4ZIRA 3SQXA 3BOSA 4JJZA 2ZJAA 2RMKA 3THXA 1ZCBA 2VTKA 2D06A 4L16A 5FPSA 1XTQA 3QKTA 5KSZA 1UBCA 2GVZC 1D2EA 4GBMA 5K8TA 1DO0A 3EIHA 2VQSA 3KX2A 5EE5B 1CJTC 1SXJA 4FCWA 4KFUA 4TYYA 3K1JA 4MRPA 1YVDA 1JALA 3AF4A 4V02A 4A2WA 1G8GA 3C8UA 5CB8A 1IQPA 4BFWA 5E7MA 2GEVA 4O3MA 1P7CA 4Z8YA 1XTJA 3T12A 2V9PA 5FUVA 1S2MA 2CJWA 2IEYA 2QZ4A 1F6BA 1OXUA 2EWVA 1SULA 4MKHA 2ZSAA 5JZVA 4KLNA 3NHAA 1RJ9A 2R6CA 5BQ5A 1DS6A 3HPRA 3AUYA 4W7SA 1E2LA 2GESA 3PXGA 3RABA 4HAWA 3FE2A 3MWYW 1P9RA 2VRWA 3RS3A 1L4YA 4BGDA 1OB2A 1OYWA 4QM6A 1XP8A 2JIZA 2WPDA 4CIDA 1NY6A 2W58A 4QHYA 1LVGA 2GZAA 3BD9A 4ZI3A 2PL3A 3D31A 1Q3HA 1EFRA 4TQ9A 1KMHB 1RKBA 1EWRA 2OILA 2J46A 1IN5A 2GXSA 2FF7A 4M1WA 1FTSA 3QBTA 2MSEB 1KGDA 3TUZC 1VCMA 2IYUA 2ZU0C 3AGPA 2IBMA 3NH9A 4URWR 1COWA 4AC9A 2GTPA 2B21A 5HCNA 4B73A 3IEVA 5KPDA 4Q03A 1COWD 3DDCA 2DWPA 4PQYA 4Z1MD 1E98A 2OO7A 5DI3B 5KU1A 1ZMXA 3BE4A 4Z1MA 4KCGA 3HWSA 2A5JA 4OK6A 3K9NA 3ADBA 2GBLA 4O2RA 3EPJA 1Z0KA 2IT1A 3LNCA 3CZPA 3BIFA 5DN6A 5DSZA 2IUUA 4GL2A 1P2UA 2PMDA 2O8BB 5FPHA 1E9CA 3RS4A 2XJ4A 1LF0A 3QPVA 1OPXA 4LV8B 4D25A 1OXTA 1SZPA 2N42A 1XXHE 3WHKA 1DEKA 1N6PA 3A37A 2NPIA 3C5CA 2ODNA 1XU4A 5F2EA 1E0KA 1Z22A 4BE7B 1JI0A 2QT1A 4A0HA 2BMDA 4QGHA 1HQCA 5G41A 2HJGA 2XZLA 3L0OA 4RD6A 4PSKA 3R8CA 2XNDD 3TR5A 3L8YA 5C4GB 1XEWX 1DADA 3ZZUA 1T5LA 1W4AA 5FUXA 5J40A 4HSEA 4Q1CA 3K70B 2R44A 4B48A 2BEKA 2CK3D 2RGDA 3CW2A 4DDTA 2A5DA 3Q9LA 3KJEA 4IDNA 4D0NA 3U60B 3U4QA 2F43A 2YC4C 1R8QA 4NYIQ 5CB6A 1DARA 2KBFA 3OAAD 2ZROA 2IF2A 3LW7A 1NSFA 3W8RA 2VSFA 2AHOA 2GVDC 4CEIA 5CIWA 2FZLA 2X2EA 1FL9A 1MABA 2QY9A 2WJGA 4MDEA 2B7BA 4WZ6A 2OXRA 3ASZA 4DSUA 4Q01A 4XTCS 3R20A 1TQ2A 4A6XA 2C96A 4OQNA 1F2TA 3KL4A 4LJ7A 5FPTA 3DHWC 2BBWA 5CYOA 2H5EA 4B32A 2BM0A 1J7KA 1GRQA 4B34A 4PX9A 2QAGB 5HCIA 1ZIOA 2ZSFA 3G82C 4FMCF 1QG4A 5KSYA 3SQWA 1WP9A 4DT1B 4Q48A 2FFAA 2QRNA 4KYIB 1ZU5A 3BFXA 1Q57A 4A6PA 4WA7A 3EA0A 1ZUIA 2O8EB 5DISB 2KE5A 1ZNXA 4JLPA 2BDTA 5IF9A 1W5TA 2J59A 1CR0A 1E9RA 1A82A 1E9EA 3A1TA 1UAAA 2IYZA 1E1RA 1Q3TA 1TUEA 5IK2D 2DFNA 4MGIR 1ZD1A 1F48A 1H8HA 3WHLA 4ACAA 1NF3A 1P72A 4DCNA 2XGJA 3RHFA 3QKSA 1JPNA 1XEXA 2WKRA 4TL6A 1VKJA 1A2KC 4UNPA 1UM8A 2PCLA 2X2FA 2BIFA 5JRJA 1VHTA 2OXCA 5DHFA 2WSSA 3W6OA 4ASUD 1PLKA 2WSSD 1UADA 3KQUA 1TX4B 2GKSA 1XZPA 1NKSA 4O0MA 3H2YA 4EPYA 1KO1A 1OXXK 4NU0A 4KSBA 3P20A 3EA5A 3EARA 3K0EA 4LYAA 3NDBB 4AYTA 3WP0A 3GEEA 5FTMA 3GLGB 4D82A 4DCTA 2ZUCA 2BM1A 1N6KA 4A9AA 2AKYA 1GOTA 3H4MA 1AZSC 1MABB 1U8AA 4TMKA 3CWZA 1N6OA 2H7VA 1QHNA 8OHMA 4Q9LA 3UK6A 2ZSEA 1BMFA 3V9PA 2ZRJA 3X1WA 2CHGA 1K8RA 3CX7A 2QMUA 1F2UA 4HLUA 3QF7A 2VSXA 3CF2A 4FINA 3IILA 5FOVA 5FL3A 2VYFA 3GLIA 1I4TD 1LB1B 2HXSA 4G01B 5DNYB 1TQDA 4I1SA 3CX6A 3BC1A 2A78A 3O8BA 1NI3A 4EUNA 1RIFA 5LB2A 3U5ZB 1IM2A 5AUQA 1U2RA 4RY2A 5FR2A 4KJZA 5L3SA 4KITB 1T0HB 2WIAA 1OYYA 4I4LA 2DFKB 1S3GA 2B92A 2YWGA 3B2EA 1ZCAA 2ECKA 3GJ8A 3GFTA 1H8EA 5AUPB 4IVRA 3GLFA 1R2QA 4PFSA 1UBGA 4MKIA 5FFMA 4ZV4A 5JSZB 3ZD7A 1OIVA 2JEOA 3B1VA 5G3YA 3I62A 2NZJA 4DB2A 2XSZD 3QVVA 4BFVA 3GLIB 3GD7A 2AFIE 2F1HA 3MCAA 4ZCIA 2O8CB 4OQMA 1N6IA 3FPAA 2ZRLA 3GCGA 3OEED 4HLQB 4PHTA 3P4XA 3EG5A 3C4JA 2RGXA 3TUIC 5A0FA 2OCPA 3TKLA 4DC9A 1GTVA 3W90A 2HLDA 4IFBA 3U6KA 3KFVA 2CEAA 4AWXA 4TZ0A 3HR8A 1XJ0A 1XRJA 1G7CA 1ZUNB 3VX4A 2IX3A 1E2MA 4G5QA 2XZOA 4EPTA 4GSYA 1V43A 1Z0IA 3LX8A 1DE0A 1YJ5A 2Z83A 3IEUA 1Q1QA 1Y3AA 1E2PA 1T4GA 1EWQA 3VR3A 1GM5A 4XVQA 4JKIA 3VHLB 1CR1A 4POAA 5EE0A 2P0EA 4DWJA 1ZD9A 2BCJQ 1Z6AA 4O25A 2DFLA 4WZBE 4L15A 2IYTA 1SKYB 3AVXA 4MRNA 3FMFA 1LF5A 1DO2A 2IYLD 2VHJA 2WAYA 1CBUA 2CMKA 4A8JC 1NG1A 2IYRA 1T3HA 4QBHA 4IDOA 1KI4A 3Q8XB 1D9XA 4CEHB 4B3BA 1BO6A 4BRWA 4MYTA 3F0TA 3RVBA 5HTKA 4TT3A 4Z54A 2AKAB 1MO3A 3ZIAA 1XWIA 3NBYC 4OHXA 1OH5A 2IW3A 2XJ9A 1TPZA 3BAFA 4RD3A 3SYLA 1KSHA 1W49A 2ZRBA 2A9KA 4JBWA 3NVAA 2C78A 4DT1A 4C0JA 1IONA 3A8TA 2O8FB 1E2HA 1CJUC 4D0GA 5CK4A 4KXFB 4OQLA 2JLUA 1JEDA 1LTQA 5UKDA 2XXAA 5P21A 3U3KA 2P3SA 4GMXA 2IUTA 4TLEA 2WWFA 3AP3A 1JR3E 3KDSE 3BH0A 1IY1A 2ATXA 4QBFA 4DXAA 5JJIA 2OEPA 4MGYR 4LHYA 2WWWA 1XPRA 4AKEA 4URZR 1RW4A 2V7QA 2ZVPX 821PA 4IVQA 1X3SA 3BJIC 4NP6A 2ZANA 3EX7C 1Q20A 3VKHA 2IYWA 4PHFA 1QVRA 1AZTA 3PUYA 1FPMA 3ZVNA 2BKEA 4YMSA 4NCIA 4BLOA 3QF4B 5E7IA 3KUDA 2FE4A 3ZVRA 3K70D 3EZ7A 1G8HA 3QSYA 2DWQA 4MDFA 4LHZA 4B6EA 1GIAA 4HZUB 1IBRA 4JT4A 3UMSA 2I3BA 4DVGA 2PJRA 3THXB 3ICQB 3N70A 3SU8A 4IEIA 4P3YA 2J87A 3OIVA 1XCMA 1XD8A 4JL6A 2C9CA 1II9A 1J8MF 3VR6A 1HYQA 2I1VB 2CXXA 3B85A 1XCGB 3MWKA 5FI0B 2PZEA 1V5WA 2O5VA 2O8BA 1GILA 3TGPA 3ZYCA 4CT5A 4P33A 2CE2X 1VG0B 2IYSA 3WNCA 3L2OB 3NBZC 1AJEA 1SKYE 1MO5A 1W4RA 4Q4HB 1P9NA 2WJIA 5TMPA 4JLDA 3EXAA 3RDPA 5KDOA 3S1AB 1D2MA 3B5JA 3LLMA 2ZE7A 2Q9AA 2X8AA 4NCHA 4KSCA 3IQXA 5LDDC 2C03A 4YMVA 2ZE5A 1KZ7B 4HZIA 1J99A 2G1KA 5BW8A 4WOPA 2BBSA 1YZUA 2NO0A 1NVWQ 2WMOB 4Q47A 5H8WA 5CK5A 2FV8A 4BLSA 4DUGA 4DDWA 2QENA 4HB4A 3NTUA 3OIYA 3DZDA 2WM9B 5AJXA 1E0JA 1XTSA 5DO9A 5J4VA 2IUSA 2O52A 1MO4A 2CJWB 4H1UA 1SVOA 2O8CA 1MO6A 3Q85A 4QJ4A 4CYMA 2OCBA 4FW9A 4QG7A 2W6IA 4LJ6A 1W48A 2I1QA 2ZJYA 5K8IA 3SDZA 2JJ2A 2GRJA 4KFRA 3FKSA 1CEEA 2JAQA 2KB0A 4LV5B 2JLRA 5B64A 3T35A 2HXYA 4J0QA 4YQFA 1Z2AA 2PEZA 1G7SA 3PUZA 1KKLA 3TSOA 1Z6XA 4XWOA 2ZAOA 2WV9A 3D3QA 4IOMA 1G291 4DSOA 1SHKA 3L0PA 3X1ZA 4D26A 3AH8A 4DJTA 3AGQA 4IXMA 4PXAA 2IXFA 4OYHA 4URXR 3VTKA 5IK2A 2HLDD 2ZS7A 2J7PA 1MR3F 2LKCA 3K09C 2Q3HA 2YJTD 2HDNB 2VHQA 1OKKD 4RSGA 2BMJA 3DOFA 3BXZA 4M1SA 2CHVA 1N5JA 1QHGA 5FUWA 2MSCB 3CF6R 1O87A 2EYQA 2JATA 3C7KA 1F2UB 1YU9A 4B3DA 2EU8A 3T1TA 4KVAA 4ZKEA 4CGZA 3BK7A 3E2IA 1L7VC 1FNMA 2YINC 4Q7JB 2EWWA 3O8RA 1AS2A 3K8YA 4FD2A 5EXPA 2RKOA 3IKJA 1C4OA 2KJQA 1M74A 1MT0A 2ZRPA 1ZC3A 4YMTA 3WY9A 2QN6A 1KOFA 4NZYA 3BRWD 2V1XA 3SJZA 1KHTA 4DLUA 3RNLA 6Q21A 4TYQA 5H68A 2AR7A 2ODWA 2V4ZA 3K0CA 2ZE6A 3A36A 4OI0A 2PT7A 4DIDA 3AVTA 2WWXA 2RCNA 4H9GA 1W44A 1W0JD 4IDHA 4DEXA 1N6LA 1TNDA 1IN4A 2YVUA 3RSOA 4B43A 2GCNA 3HR7A 5FUYA 4M21A 2WPDD 4LY6A 1PUIA 3RANA 3IDQA 3FHCB 2C9YA 3UMRA 2EFDB 1XMIA 2FSFA 4A8JA 3K0AA 3C14C 3CNOA 2ZE8A 4DSTA 3Q3JB 2D2EA 2L0XA 5EZ6B 2FSIA 2LKDA 2ZUDA 2HJVA 5GJWC 521PA 2KWIA 3ND9A 5L3RA 4C0HA 3PEYA 5EP3A 3B78A 2GJ9A 3EZ2A 5KOYA 5HZHA 5AWFC 1HQYE 1M1YE 4QJ5A 4LV6A 4EJSA 1FTNA 5A4JA 1F3OA 4BLQA 1S9DA 3HPQA 4QM7A 3HYRA 2MMCA 4RFSA 3DKPA 3G0HA 4Q4LA 3T34A 2V3CC 1FUUA 1L4UA 5H70A 3ETLA 4BZXA 2VP5A 3BFKA 3IO5A 4ZDIA 3PEWA 4QBIA 4P4TA 4QGGA 1UBEA 4PO8A 1XD2A 3BFVA 1H8ED 4P0TA 4OQXA 1HUQA 2OLJA 2GWHA 4ARZB 2OHFA 1YR9A 1U9IA 2NTYC 3GJ4A 2Z4RA 4OHVA 1Z6TA 4B3CA 1XD9A 4ZKDA 4EIWA 4ABYA 1QVAA 1ODFA 1W5SA 2WJYA 2ORIA 3H0KA 3OIWA 4Q9JA 4US2R 3QJYA 1HEIA 4Q4HA 3EWAA 1Q1BA 1WB9A 2AN9A 4BPBA 3KB1A 2H8KA 3NH6A 5TDHA 2ZRIA 2G9NA 1K6MA 1P62B 3BERA 4GOJA 4QRHA 5AR1A 5FBWB 3SFVA 4A4DA 1KO5A 2ZAMA 3ZVMA 2EFHB 3VU9A 4JZKA 4TL9A 2W6JD 5FL7D 2ZSBA 3ADKA 4PO1A 1EX6A 2IA5A 3BGWA 3L0IB 2G6BA 1XZQA 3PCRB 4B35A 1N0WA 4OL0A 1R10A 3F8TA 2ZI6A 3GLGE 1RPZA 1Q1EA 1OXSC 1ZNYA 1KNQA 1XJQA 2PZGA 2WKQA 5KSPA 1RC8A 3M6AA 5F9HA 4Q1BA 3QXJA 3I61A 2FA9A 3MWLA 1T8TA 2F1RA 3FHTA 4HUQA 4Q19A 4TQAA 3O8CA 4XOIA 3SI7A 1MRSA 4FWTA 5BYKA 3OHMA 1PLLA 4MKFA 4EFNA 2C5LA 5FOSA 2AD5A 3AF1A 2ONKA 1XEFA 2IXEA 2RHMA 3PEVA 3T06B 4LI0A 2ONJA 5JBQA 3QI2A 2CVFA 2PJZA 1FX0B 4B6FA 4CDGA 2SHKA 4LSGA 5C46F 4HLUC 4TL8A 2NMVA 3AQ4A 4XSGA 1C9KA 2A2ZA 2QMOA 3TMKA 4AKHA 4DLTA 4A0FA 1N0VC 5C2JB 3U7HB 2RAPA 3DOEA 1SVMA 4PC3A 1G3MA 4H1VA 4GT1A 2WJJA 4BASA 3UG6A 1L8QA 3CRVA 5HZKA 3VAAA 4B75A 2OZEA 4V0LA 3UANA 1IXSB 1ZU4A 5D3MB 2P5TB 4M9ZA 1AKYA 4PHGA 4CRWB 1A4RA 3RRYA 1ZM7A 1OLOA 3TRFA 3V4FA 4QL3A 1E1RD 5KDLA 2OBNA 4TMZA 1P73A 2XX3A 1XMJA 1JR3D 2ZRAA 4S35A 3EIQA 5BN3A 1JR3A 4UXHA 1AA9A 1P4SA 1J70A 1Q1ZA 4B44A 3DEFA 1CULC 2ERYA 4LOAA 4JBYA 3AVPA 2BV3A 1N3BA 2FSHA 3C16C 4U5XA 4RKFA 2CLSA 2QAGA 2WHXA 3PV0A 3ECCA 3PENA 4ZCMA 1GL6A 1SXJD 1U0JA 2F1JA 1HH4A 4D4JA 1HE8B 3GMTA 1I2MA 1KJWA 2J3EA 2VEDA 3AP2A 2HCJB 3ZQ6A 1E99A 1X1SA 1UKVY 1W2GA 1FX0A 2D3WA 4ZCLA 2IWHA 5J4HA 4NCJA 4CEIB 3LA6A 3DKVA 1QHHA 1U90A 2KBEA 4M4SA 5HPYB 3UMFA 4KBFA 5KSOA 3WXMA 3ZQJA 4PTLA 4EFMA 2D7CA 3VMFA 4GDFA 3TNFA 3TIFA 4BUJA 1MOZA 2Q3FA 3X1DA 4C0SA 2FPLA 5AUNB 4Q4JA 2HV8A 3REGA 2F1IA 4NYJQ 2ZI5A 5AJZA 1YE8A 2P6NA 1G18A 3THYB 3CX8A 2GJ8A 2BBTA 2VP9A 4R98A 3J81k 3EAQA 2EYUA 5J5CA 1T0JB 1CS4C 4BRUA 3FFBA 2JA1A 1EXMA 2YHSA 2EFGA 1II8A 1IN7A 2IYQA 4K46A 2J9RA 4UNQA 1Z83A 3DMDA 4LBWA 3W5JA 4IKEA 4C4PA 4CEJA 4AYXA 1EFRD 2C99A 2V54A 3VR2A 1G6HA 1AS3A 5L3VA 3ONWA 1DOAA 4UNRA 2NGRA 4Q7MB 4ESHA 1VG1A 1KYIA 4Z8XA 2QPTA 1UKEA 2FNAA 1XMSA 2XNSA 4DUGD 2HYDA 1WA5A 5KO2A 1LFDB 3MG9A 2IK8A 2R6GA 2GZHA 2DFTA 3AB3A 5AJVB 4E03A 1KAOA 4BFXA 1SQ5A 1LNZA 2N1BA 2QPAA 4UJ5A 1WMSA 3GEIA 3GLHE 4LRWA 5DYIA 1E9SA 1KTVA 1KSFX 3QENA 1IJFA 1YR8A 1W36B 1NP6A 1ANKA 4RZ2A 3QBVA 3MSXA 3ZZ0A 3RRMA 1E9FA 4EPXA 2OE2A 1NVUQ 3ASYA 3VX3A 3LDAA 1J8YF 1JB1A 4JIMA 1P2SA 2PBRA 5FBLB 3M1IA 1N6RA 1EFTA 1HE1C 3A1WA 2XB4A 4KFSA 3AV0B 2QUZA 3KXKA 4B3GA 1ESNA 5JSZA 2WWYA 5LD2B 4W5HA 1KDRA 4KLZA 4M1YA 4PPFA 4FMBB 5EE9A 5FL7A 4G5GA 1KZGB 1E2JA 1E2NA 2X77A 5L3QB 4PQFA 4BFZA 3KTAB 1M7BA 3L82B 2H57A 1TEVA 1YZQA 2Z4SA 2QNRA 3OIUA 4JLOA 1S1MA 4F4IA 2ZTSA 5G53C 5M04A 4GZLA 2A5GA 3P1JA 1UBFA 4JLBA 3E70C 4JLKA 4CEJB 2BWJA 3ADDA 3HJNA 3IIJA 1R0ZA 4RCZA 1WQ1R 3MUFA 4CVNA 4OI4A 1FUKA 5JS7A 2OM2A 1KI9A 5FBQB 3B13B 5J47A 2XB2A 4OQFA 5TARA 5FBVB 1SXJE 2FSGA 3EZ6A 1NMYA 1LS1A 5BN5A 3VKGA 3GFPA 1FQJA 2QE7A 3TSZA 1RRFA 5E3HA 1NN3A 2B6HA 2Q0HA 5TV2A 2C04A 2ATVA 2OT3B 2OFWA 5B2ZA 2FJUA 4LHXA 3T15A 3HDTA 4D4KA 2O8DB 1NL3A 4XTRA 1QHSA 2NPFA 5AK0A 4CEHA 1JQLB 4TT3D 1ZD8A 4MKGA 4N3NA 4I81A 2OBLA 4RVCA 1Z0JA 2ZI4A 4Y0VA 4CZ2A 1VDZA 5FOTA 1W36C 4EFLA 2E9SA 3CUEF 3U4QB 1XEWY 2C98A 4QNRA 3FYHA 2AK2A 2R8RA 4FWIB 1AIPA 3AKYA 4YDSA 2VF8A 1F60A 4V0MA 3LQQA 5DH9A 2Q3MA 5LBIA 3WYFA 4G5OA 5SZJA 4OI1A 2REXB 2EVWX 1AKEA 2WICA 1DG3A 2FWRA 1UPTA 2MMGA 4JL8A 4TWZA 1KY2A 3IO3A 1OFHA 2YWEA 2JLYA 3UPUA 2HYIC 5F3WB 3MWJA 4NCKA 2R65A 2K5UA 2ZJZA 3LQRA 1GDDA 3QKSB 3O47A 1OH6A 1C1YA 2XZPA 4TMTA 4U7DA 2Z0MA 3QXSA 1NLZA 1X6VA 4OKSA 1WBBA 3W3AA 2OCYC 3ZVLA 2A5YB 2BMEA 1P2TA 2Z6VA 1AN0A 3CF0A 5BWMA 5EUMA 1JXOA 3DMNA 3G5UA 5K8UA 2R6AA 3IIMA 1R0WA 5B30A 3RRNA 3IBGA 3RS5A 1TQ6A 1W0KA 3GLHB 3LXXA 4PANA 1AGRA 2QT0A 2GDJA 1G3QA 1U98A 1Z28A 2LCFA 2GZDA 1ETUA 3RC3A 4C2UA 4WW0A 3GLFB 1S4QA 4R71A 3SE0A 1ZP6A 621PA 3N2IA 2PLFA 2GJKA 3W5IA 2J1LA 2HF8A 2GEUA 1G6OA 3AUXA 3H86A 3QG5A 4BQSA 4BEBA 1VIAA 1E3MA 4IOKA 5BN4A 1NBMD 3KKOA 3RS2A 3WMEA 2BJVA 2HT1A 1IOZA 5E4FA 2ZYTX 2QBYB 1ZM3A 2XEXA 1ZNWA 3K0FB 3GQBA 3WRYC 2C2HA 4FMCB 5LB4A 4ZO4A 3KJGA 4JLMA 1FMLA 2AX4A 2G1JA 1SVKA 4P4UA 5HKKD 3U61B 1NMZA 5EP2A 2ZJOA 1N25A 1JNYA 1XNJA 5DHAA 5DYGA 1KI3A 2D74A 5FTJA 4LYFA 1M7GA 2OAQ1 4U02A 2DPXA 1XTIA 3T1VA 3T1OA 5JECA 3T61A 1NVVR 3SBDA 3OAAA 3MGCA 3RC8A 3EASA 3NBXX 4Q1DA 4NPHA 4DZZA 4GFDA 1NLYA 3U3MA 3KKNA 1NG9A 3MRSA 3OE7D 3AF3A 2D62A 5ELXA 1TUIA 1X8KA 2WAXA 3KKMA 4F38A 2QQEA 4NL4H 3U7GA 4Q4JB 2YZ2A 4RFVA 2W6ID 2XAUA 1GZSA 1YHNA 1RFLA 1E2GA 2AFHE 2QPOA 3AF0A 1E1QA 3SYNA 4IEEA 2ZJ8A 1AGPA 2NZ8A 2ZRGA 2PLRA 1G64A 1ESMA 3DPUA 4DLZA 2QP4A 3MAAC 4D4MA 2XSZA 2QTFA 1Z0DA 5FBRB 5A5GA 5KHOC 2ZQ5A 3GP8A 4TLBA 2ODBA 2PCJA 4BZQA 2RGBA 4Q7LA 2OG2A 4YC7A 4B71A 4G5RA 2F3TA 1GNPA 4YONB 3B1ZA 1OV4A 3TE6A 3BH7A 2WIBA 3IBYA 4A0GA 1G8YA 1RRCA 2ZXUA 2ZJ5A 3FHOA 2D7DA 3MLEA 3WMFA 2QBYA 3U44A 1KY3A 1L2TA 1SVWA 4FMDB 2QQ0A 1BOFA 2FEMA 2BBOA 2HF9A 3GJ0A 5AJYA 4C0BA 1YZKA 3W6PA 1PUJA 4DB4A 3QKRB 1T9HA 1U8ZA 2Z43A 1E9BA 1CJMA 4RJLA 2ZUBA 3FB4A 2QM7A 1EK0A 3LO5A 1P6XA 3EZ9A 2ZU6A 1RE0A 3BORA 2CCGA 2V6JA 2G88A 4IOLA 3I72A 2G0NA 3LVRE 1OIWA 2JLSA 4C0LA 2YOFA 2CNWA 2QTHA 5EXTA 2QL6A 4LDJA 1RZ3A 3K9GA 1DAHA 2QI9C 3TJZA 1P3JA 5JI3E 1XTRA 1K5GA 1SXJC 2JCSA 4KI0A 2OESA 3GJXC 3TH5A 3WBJA 4ACBA 1KI8A 1VECA 2J41A 2XITA 4WVFA 1E0SA 3CH4B 1E2KA 4Q18A 3NEJA 4E07A 4P4SB 4M1OA 1X1RA 4F4JA 3KXLA 1PVOA 1VMAA 2X19A 1CR4A 3HP1A 4LJ5A 3ZIAD 4R9UC 3TLXA 1EFCA 1NBME 4B3FX 3U44B 2JGNA 1P60A 2WWIA 2GCOB 3OEHD 3C15C 2P65A 1G3IA 2JIZD 4KYUA 4K8OA 1Z06A 3P4YA 4KODA 5CJPA 3V4RA 2R2AA 3JVVA 4M1TA 2ODEA 5JRZA 4PQRA 3A4NA 5J4LA 1XDBA 2BKUA 4PC1A 4WBSA 1E2DA 4BFUA 1IXRC 4US1R 4W5JA 2ZS8A 5GVRA 3TK1A 2H92A 1VCNA 3V00A 3GPLA 2BEJA 2GA8A 1DAMA 3NHBA 4D2IA 2NIPA 5GJVC 2GXAA 1P2VA 4PZYA 2VF7A 1OFUX 2QA5A 2IYYA 3CKLA 1KK2A 2NOAA 1UDWA 2P6RA 1TADA 1WE2A 1ZRHA 4LYHA 4OHWA 4OBEA 2D4HA 4DLSA 2VSOA 2WSMA 3K09A 4I99A 1BH2A 1UJ2A 2N46A 2ZM5A 2FGKA 1GNQA 1E2QA 2YYZA 2C9OA 1DPFA 1JAHA 4C0AC 4HEJA 1M8PA 2VHUA 4A82A 1NNEA 4OK3A 1GWNA 2J0SA 4P4SA 4DRZA 3PG5A 5FPKA 1KDOA 1W7AA 1OHHA 1G41A 4TTRA 1E4VA 4X8LA 1DAEA 2VBCA 4K81B 5BXQC 4N1AA 2QAGC 3JVUA 3DM5A 1XJCA 5G40A 1VYTA 2B8TA 4TYPA 2V1UA 3IQWA 1PV4A 4WZAE 3SS8A 4R2HA 3W3ZB 2QAJA 4CF7A 2F9LA 3BB1A 2A30A 3B7GA 3NC0C 3R9XA 4MQBA 2JLWA 1E32A 4TQUS 4QFMA 2W2TA 1RVDA 3EIEA 3K0FA 3LV8A 3SHFA 3B60A 4JS0A 2G83A 3U3OA 3I32A 2JLXA 4HB0A 3NDPA 3GLIE 2CK3A 2VHCA 2FZ4A 4PAMA 2IS1A 1IN6A 5FI1B 3B6EA 4WAUA 4BFYA 3A6PC 1IY2A 4LBZA 3W9YA 1CP2A 1YZTA 4A15A 1E2EA 2FDCA 5JLJA 2JLQA 3QQ5A 3C41J 4YMWA 4KV9A 3IPXA 2QMEA 2OFOA 1GNRA 1A2BA 1VIYA 4IHQA 1CU1A 2ZVQX 2QU8A 1II0A 2DHRA 1G21E 2WVJA 3FFAA 1R5OA 2JJ2D 1E9AA 3WYAA 1CR2A 2Q21A 4MA4A 3UWKA 3AKDA 3F5FA 3FKSD 1SGWA 4TSFA 3QF4A 1RRGA 3BH6A 5J4YA 2EFCB 1K5DA 4Q1FA 2GJAA 4WXPA 1UFQA 3KXIA 3B1XA 3ND8A 4LUCA 4HB3A 1KSGA 4A36A 2C8VA 1SVSA 4MYCA 1KDPA 3CRMA 4A2QA 5DLQC 1P61B 4RCYA 4Q4AB 3REFA 1OW3B 3TAUA 1I4DD 2E87A 3CR7A 3FMPB 4MRRA 3UIEA 3U3JA 1ZIPA 3A4MA 2BC9A 1FZQA 2ZR7A 5KTYA 4HDQB 2ORWA 1VTKA 1Z6YA 4M9QA 3QPUA 3GJ3A 1NRJB 2RGEA 2JASA 3LBNA 4BZPA 2DYKA 3LW8A 2IWRA 2NO6A 4LK2A 4ASUA 4XVRA 2CBZA 2CCKA 3KTAA 1D8TA 5CDFA 1SKQA 2V55B 1U0HC 1G8FA 3EC1A 5B58C 3WNBA 3D8BA 1Q21A 4EQ6B 4C2TA 4LC1A 4QHTA 4DDUA 5CJ2A 2A7QA 2CL7X 3FWYA 4D80A 1GRNA 3NEYA 1GL9B 2W83A 1NSTA 4I1OA 3BB4A 1XMVA 1QHYA 2WKPA 2YWFA 4TLCA 5JCPA 1G7RA 4PC6A 3TBKA 3U6BA 1US8B 5B57C 4HDOB 3LRPA 2ZJBA 3LXRA 4PSAA 1SHZA 1NJFA 3RS7A 2RGNA 3OEHA 2ZJ2A 2YOHA 4NONA 4GOXA 2VP2A 2ZYWX 4MGKR 2A5FA 3K0AB 5CLQA 3U7FB 1AK2A 4ZPXA 1NN0A 4L8GA 5HR5A 4AKGA 2OUKA 1IXZA 4IOJA 1HA3A 4RD0A 4JSYA 3HU2A 4NYJR 2PX3A 3AVWA 4ERNA 4E5UA 2GAAA 3K9LA 4TMXA 1TEXA 4KAXA 3QEJA 3ZDQA 1W47A 4HYYA 1TU3A 2PMKA 3HU3A 4MUAA 2IYXA 2PZFA 3ZLJA 1W4CA 4M53A 2EFEB 2IXGA 4KBGA 2ZI9A 4FIDA 1JBKA 2ZYVX 1E0AA 4LPSA 2NQ2C 1G3UA 2GJSA 4JJKA 2QGZA 4QXAA 2PEYA 4G0NA 2XOKD 3Q7QA 1E1QD 1M6NA 4Q1EA 5EUQB 4QKQA 4TYNA 1G17A 1W4BA 1X86B 2HUPA 5C18A 1GUAA 2OSBA 4S2EA 2NG1A 3EWSA 4MGZR 5TY0A 4AURA 1OJLA 1X8LA 5SZIA 1LY1A 1TL7C 5ANRB 4P32A 2R6FA 1NJGA 2J5XA 3OEEA 4OI2A 4Q00A 3KFXA 3FMOB 4X8MA 4HB2A 4F92B 2R62A 4KHZA 4A0RA 1GKYA 4NBSA 5GVSA 2QGNA 4BECA 4GI7A 2J7KA 5JEEA 1QG2A 2J45A 1WRBA 2GBLC 1E69A 4JVLA 3ZJYA 2CLCX 2W00A 5CITA 2W0SA 3LH5A 4RD4A 4ON9A 4DKXA 2XXAB 5CLLA 3R9IA 2VP6A 1MH1A 3B82A
chains in the Genus database with same CATH superfamily
2ZR9A 5CT5A 4S2UA 2HJHA 3DBRB 1UDAA 1C29B 1YC5A 2MT9A 3E7FA 3FJOA 3G2OA 2VA8A 5FWDA 3NANA 4DDVA 1NU6A 4FYYA 1CD5A 3O1JC 4B1FA 4TTSA 3MJCA 4FNOA 4Q0MA 2I2FA 1LNSA 3U4IA 2OVBA 4N47A 1KO4A 5KTMA 2PUHA 2V7UA 4K05A 2A86A 1SELA 4NYMR 1XZAA 3OQIA 4XJTA 4OLJA 5FH9A 1D2HA 3SYKA 1XD2B 1CQPA 1KEEA 2H17A 2JJQA 3M6WA 3NTLA 2W2XA 5KHAA 5CVDA 1RWXA 3HBAA 1Y8RB 1LK5A 1XZGA 2Y8EA 2AMLA 4Y0AA 3T3GA 5DIFA 3GCXA 3MWDA 5I7WA 3QY9A 1CUUA 3EQ8A 1JBEA 5D3KA 4MVYA 2GHIA 4TTVA 5HIMA 5HK9A 2GS9A 1B2LA 2JGRA 4J94A 5I9IA 1GQ2A 2AQIA 3RK0A 4PYKA 3E9DA 2Q29A 4FNMA 1DFHA 1NU8A 2VH1A 1VJDA 3SZ3A 3OD5A 1U4SA 1VKRA 5C31A 1QZXA 4EUKA 4PGAA 3VO2A 2CVQA 1IOVA 2V9CA 3ND5A 5EXSA 2OY0A 5F7ZA 2OCAA 4B84A 1L3CA 3HP7A 3RFCA 3RWOA 3PLAE 3PFNA 4EK9A 1G4UR 1U2ZA 2OZPA 3GJ5A 4CKEB 3O4IA 1DDOA 3SS9X 1G8SA 3VYVA 2I8AA 2VS1A 2I3DA 2V7EA 3V6LA 3IV6A 2CBXA 4QDTA 1Q12A 2HB6A 4Z9BA 1KEVA 1GSIA 1H1TA 5B3AA 2G04A 4LECA 4D6PA 3T3NA 1A95A 1O96A 1YB6A 4JBIA 5CUQA 5E1OA 2X4IA 3RRFA 1QB7A 2IYVA 1FFDA 1JSCA 1R6AA 2ACKA 2YQ5A 3AF2A 4P7BA 1E61A 2BCEA 4I5FA 4OJKA 3UF0A 5JARA 1YDMA 1YV9A 3Q8MA 2O54A 3HCDA 1VBNA 3QG1A 1JDNA 5K45A 2ZWOA 5TB5A 4XH9B 5HOEA 4HEQA 1ZI6A 2P5SA 1QP0A 1EP2B 2UU9B 2FN4A 1PZNA 3QVKA 3SX4A 2VDKB 5CTAA 1SBIA 4X61A 4YRNA 3FZYA 2C9MA 1PZXA 2BFNA 3FSJX 2B8NA 4HUQB 4G5XA 1Q7GA 4LW8A 3ZLTA 4CQMB 3MHTA 1R66A 3TAHA 1H4SA 2IF0A 2CKDA 2EERA 5IUNC 2QORA 1NLFA 1MAUA 3DCYA 2I6GA 2DE0X 3C8MA 3PXGA 3WIEA 1Y7IA 3J7AC 2GFHA 3DMPA 3VR6D 5CA1F 3FOBA 3ESDA 3HGQA 3H6HA 4AJPA 5A62A 4DAOA 2R6JA 1Z47A 3L02A 1CJKC 3SQNA 4HFMA 3N9IA 1TLTA 3MNFA 3B1KA 3QYFA 3W6NA 1XELA 5KWJA 1GPYA 2IL1A 1HT0A 4FOLA 4MA0A 4Q7EA 3OVMA 5KJ1A 1D6JA 3VR4A 2XB8A 4OHFA 5CHEA 5FADA 1H1LA 4GOMD 1N2JA 4C03A 1V47A 1CRZA 4AJIA 1HR0B 8ATCA 4UM9B 4MUKA 4X7PA 3WLEA 3MMNA 5ADUS 1QKIA 2GLXA 3F90A 5DCYA 3VU0A 2OCLA 2B1JA 5HE9A 4LZZA 3M5WA 2OZVA 4IF4A 2BH9A 2X40A 1CERA 1ZW1A 2YMLA 4QOSA 4X8HA 3NBFA 4LJ9A 5HF6A 4MXDA 4UXJA 1UJMA 4MGHA 1G16A 3EMBA 4ER0A 1V7PC 4MVJP 1JMKC 3LLVA 4IUBS 4ALIA 1Q0UA 4ZI2A 3S2FA 3F3YA 1Y80A 3D64A 1RNLA 4X85A 2Y1XA 2FGJA 3CG4A 3I8XA 3IDAA 3QKUA 3R0JA 1XB2A 1ZW6A 2ES4A 1X0VA 1CY2A 3UATA 3HO1A 4LXGA 3S2IA 1FDSA 1X7XA 4D98A 2ZETA 5C81A 2WD7A 4CV1A 2J3HA 2XMZA 1Y98A 3RIHA 3B5EA 3TZQA 3QVUA 4JEIA 3WLMA 1TZJA 1QCZA 2NU7B 5DB4A 4L9AA 4E08A 4U2DA 5A4KA 1I1OA 1JLLB 2ZRCA 5GOZA 5BR1A 2GZRA 1TFRA 4RX1A 1XTVA 1GGEA 5FOWA 2GERA 3MJHA 4G81A 4JA0A 4NEQA 5AI8A 4C7BA 1J90A 4C76A 4NMXB 1RCTE 3H7AA 3OFNA 3G8DA 5FBZA 4XGIA 4PR0A 3R7WA 3DUFB 1WSDA 4XD7D 5THXA 3VHXA 3VR1A 5M2QA 3A11A 2X15A 3LBYA 1QIIA 1ZCFA 3IHWA 1B0UA 2XWPA 3T5DA 3DTVA 5ITZB 1V9LA 3JZMA 3PFBA 4YCLA 4DV0B 2BTEA 1FMCA 1M2NA 1XYYA 4MCIA 1JJIA 4WUVA 4M7PA 2EIHA 4FCTA 4GKBA 5BR8B 3RFUA 3FPGA 1ULHA 2Q2NA 1E2IA 4OX9B 3FFTA 3SZLA 1WMEA 1ODJA 1HPLA 2XTNA 1EFHA 1UKCA 5FEUA 4J91A 3VC2A 1W88B 5EJGA 1GLNA 3LC1O 1XP5A 3GMSA 4BNZA 2GFIA 2OV8A 1SXQA 4XX0B 4TV8B 2VBIA 1AKTA 3P9SA 1WXXA 1OKKA 1M8GA 3K94A 2F6RA 4XZ3A 1YH3A 1O8BA 2BDEA 4BKMA 3ADOA 1EBUA 4CKCA 3BREA 5HUQA 2QP9X 1EXDA 3DZJA 4LZAA 2COUA 3HDYA 3WNDA 2VHTA 3HCWA 3T8YA 4B33A 3RIEA 2WR8A 4JJGA 4MW9A 2QM8A 2R8PA 4Y0NA 1HE5A 5CT9A 5D2CA 2GD2A 1PSDA 2BVNA 2W0MA 3RIXA 4WXRA 1BCSA 3PB3A 4ZOLA 2NU6A 1H2ZA 3H83A 3IDOA 3VHRA 3V1KA 5A4FS 1JLSA 2GETA 5DSXA 4IP0A 2BY4A 4JT2A 5J43A 4O5OA 4U2BA 2ONZA 4X6UA 4OJYA 5A1JA 2QMHA 2F90A 4R16A 4E22A 1UKBA 5JHGB 1P9WA 3LPAA 5AHXA 1YTUA 2XTJA 5CDTA 4WLEA 4ZXFA 3IEIA 5BP7A 2FPRA 4CODB 5EMHA 1Y1KE 2GK6A 3MSCA 4YUYA 1T9GS 4IAOA 4P92A 3I2GA 1KPGA 2Y68A 5CGZA 3IDSA 4XX1A 2PVSA 1M76A 5J58A 4GOOD 5LQKA 1D9ZA 2IIQA 3G17A 3G2PA 3Q3GE 2EL9A 4IZHA 2OYCA 1DWPA 1MC4A 1SOWA 2UXDB 2C2WA 3WGIA 4ZGBA 4LXIA 3OPNA 4P35A 2WZCA 3TCKA 2J0EA 5CT8A 2PGJA 2EEPA 1OILA 1WZEA 5J2TF 2PD4A 5J2TB 2LE0A 3WIVA 3F6YA 2ZRHA 3V7FA 1ULTA 3OOEA 4HUTA 4O1IA 5EFZA 3UK0A 4WK2B 5LZ8A 1MAAA 1YUNA 4IKPA 3H9UA 5HRUA 1JQJC 2FRDA 4G2NA 4WFIA 1EFVA 1V6SA 4BGUA 4D0RA 1G20E 1JSLA 4UXIA 5AXBA 5TPZA 5FTWA 1T1EA 3BJRA 2PWPA 1C8LA 2JD2A 1G5TA 4N4AA 4M9SA 1NFRA 1Z4PX 2W5UA 3EY9A 1F0YA 2JVJA 4XDGA 4EKIA 1EWVA 3V1NA 4MEBA 4C3ZA 2EKZA 1MTZA 2DEUA 1KO8A 1IHUA 3EEQA 5DGXA 3EGDB 2JGLA 3GRRA 3QPBA 1H3EA 3GAAA 4QQ8A 2EGGA 4QYXA 1FSPA 5CNKA 4KIFA 2I6XA 3UWMA 3CR8A 4EA6A 4CFZA 5IVPA 2AWNA 1E6CA 1JLMA 1JXAA 1NW6A 2G08A 3AJAA 3MRXA 1ZIYA 3Q10A 1BG6A 1MIOB 1CQJA 2D0IA 4LXQA 4Y6QA 4EUHA 1K5HA 4G0ZA 1DAKA 3DLAA 4QDXA 4EDFA 3PNVA 3I52A 5IJ9B 3O74A 5FP0A 1NIPA 3NVMB 2WJVA 5HWSA 121PA 4GP7A 4B40A 2W2LD 4U4AA 1YBFA 3QOFA 1BYUA 5ALOA 1TA9A 2W2LA 3D6TB 4EGJA 1SHTX 3NOQA 3BRSA 4RAQA 2NUBA 1AV7A 1U9IC 2GJ4A 3KOYA 5CX4A 5CEFA 3BEOA 4YI5A 3W8FA 5KNDA 3V3TA 1R8SA 3MPOA 3KJFA 1T2FA 1G5PA 2O0JA 2BELA 1R6XA 3PQCA 3ZH2A 4UOZA 2GN9A 2I4MA 5AYVA 4C7VA 1LV7A 4G1BA 2KLBA 1ZEJA 3LVQE 3KFLA 3FCOA 1G19A 2MSDB 4UD2A 3KLMX 4I5IA 3RNOA 1KQ3A 3TIVA 3NVKI 2ZITA 3BXFA 9GPBA 1HMYA 4JODA 1N2BA 2DQKA 1C0EA 4GS5A 4AJ1A 1Y1LA 2CJFA 1AO3A 3RVKA 1FSSA 4QU5A 4UZSA 1LVUA 2ZP1A 2IEZA 3O8DA 4QNMA 1CY1A 1NVTA 1QBKC 4FN5A 1K8QA 4GNKA 4RD1A 4ARSA 3N07A 3C1AA 2QIOA 3CPEA 1DWQA 2I4TA 1XA0A 3PX2A 2IC5A 5L40A 1GKIA 3EEIA 5AKLA 3BL5A 1NQUA 3LCCA 3ZWOA 1NXOA 2J5BA 1U2DC 3Q6NA 3AIKA 3DPIA 3D0OA 1AUOA 2O8DA 2G1UA 3ZWQA 3F2VA 3Q7PA 4BV3A 5H4GA 5HYVA 4C4SA 1TMKA 5DTIA 3RK4A 4OU4A 3LT0A 3TUJC 1TC2A 1TZBA 3KKPA 5AVVA 1T6YA 2ZT6A 1G8PA 2CE7A 1K7YA 4FYKA 1L7XA 1WR8A 3D2BA 4L0QA 3P9CA 1UKAA 5FF9A 1NVVQ 4LKOA 1XRSB 4M1ZA 5KB3A 3KBOA 3AKEA 3DH0A 3QLEA 4NKRA 1Z08A 3L1UA 1WLSA 3C43A 1ZXXA 3QHQA 4DA4A 2DG2A 5LLSA 5KJFA 5HE8A 1AX9A 2I3AA 4FD3A 2QLNA 4QBKA 4UBMA 5DNEA 2GEKA 5AW9A 1R4MA 2EW1A 4XB2A 3U7EB 2ZR0A 1H4QA 1E3DA 4BMXA 3Q9NA 2UYHA 4EZEA 4HAZA 1E2FA 2JBWA 2BUBA 2FQQA 5CA0B 2J6CA 1ZS9A 1OB5A 4PAQA 1C30B 3QJ5A 4TKLA 4BMVA 5ADHA 3W2TA 5L9AA 3L1VA 1YA6A 2W90A 2PXAA 1S6YA 3E22A 3KSRA 3PJGA 2VNHA 2CB9A 3Q72A 3SQOA 1CEQA 3D5EA 1HKHA 3VAYA 4RTSA 3EDOA 3KUCA 2OENG 1RJDA 1ZN7A 4R1NA 4YUXA 4LK3A 2I4IA 1DG1G 1BS1A 1HWYA 1J24A 4GOKA 5KHLB 2ASEA 1CDOA 1U11A 2NAFA 3HUTA 3IUMA 4E09A 1V37A 1NIJA 2AWOA 2YFQA 4C4ZA 2ZBUA 1P1FA 1SVNA 2FR1A 3N6VA 4ZVUA 2FW0A 2WSLA 2I71A 4X5OA 1N0UA 1I24A 3D7MA 4XVHA 1BE0A 4OOEA 4S04A 1PBNA 3I6BA 4DR5B 2P2CA 1SIOA 3HCNA 3ZDCA 3EPLA 4JYMA 4X7RA 5LMUB 3I6IA 3L4BC 3WFIA 1QC5A 2H5JA 2QEQA 4I6JA 3DZKA 4HDRB 1O97C 3F5SA 3T7CA 4ALJA 1YE5A 1M0WA 1YCDA 3I9V1 3LY8A 3SE7A 4IL5A 4BBZA 4DYVA 4D9JA 2RFLA 4OH1A 2C4HA 2IDJA 3TI9A 3ND7A 5AM2A 1HQKA 1OIXA 1Y34E 2PGDA 4L4XA 2UZ3A 3FUWA 1U28C 3KALA 3TZHA 2WFZA 3JQBA 3GJRA 4HPWA 1TCCA 1Z38A 1JHZA 1E9DA 3QMWA 5HS4A 3R9WA 1IZ0A 2GF0A 4G86A 1SOUA 1WCV1 5HX7A 1THMA 1BX1A 5DHQA 2CMHA 3C5EA 3EXG1 4LVOA 4A6DA 4XQ9A 3THWA 1G5IA 1AQNA 1JR6A 1DKLA 4NBVA 1KMMA 2DJ5A 3F96A 5F5LA 1ZAKA 3CPHA 3WOHA 1Z4MA 2GNAA 3B2NA 3CLVA 5GV7A 1GL7A 2FEAA 3T3DA 5BORA 2FXVA 1US8A 4E2WA 1Z63A 1GZHB 3BCUA 1M6EX 2DT5A 2G3YA 4QOHA 4ZVQA 2QRZA 4J3FA 3HYTA 5SYMA 3AB8A 2D0OB 4OGKA 2X8WA 2A4MA 1MB3A 3IPLA 4TKUA 3SK0A 1SCDA 3TEJA 3V4PB 2UZAA 5LQJA 1R6TA 1P75A 2BZSA 3MWEA 1FNNA 5JE8A 4JBHA 2CNKA 1FMJA 2V8OA 1GFSA 1P2FA 5F78A 2XOKA 1JJFA 3BMXA 4RDCA 4D8UA 1DKOA 3VSAA 5IKMA 2Z6QA 5A7HA 3V1TC 2VKTA 4WKOA 3VPAA 4CQJA 3IUYA 1DQZA 4HR7A 1R15A 2H85A 2XWJI 3AQIA 3QY0A 4WOBA 5FOXA 5KYKA 2D8AA 4LGMA 1T3LA 4MS3B 2AE1A 3BIWA 1AKMA 2Y2UA 4RZQA 4GHWA 3C5HA 5G0VA 4XIGS 2DSTA 4WK0B 3TFQA 2WI8A 3H2SA 1YI8A 1XK6A 2R4QA 3RADC 5G3ZA 1QLJA 2YQZA 4KNVA 8MHTA 2X3YA 2AXPA 1GUFA 2O2DA 1NR5A 3F49S 2QVZX 3N0WA 1YKSA 2LCIA 4IRUB 3AF5A 3O5AA 2ZSJA 4P31A 4FQ8A 1F6DA 3CISA 2WU8A 3PEEA 3D6MA 4FLFA 2FMIA 4J1TC 4UCFA 4Q4AA 1MAHA 3KJNA 5C80A 3D43A 3HZOA 2FUNB 4DRXB 3GOHA 4QXOA 4UQLA 5JYBA 2VIIA 3SVLA 2FG5A 3VBEA 3N87A 3SJCA 4CR7A 4QC2A 1VQ1A 3B8HA 5DCUA 1BXGB 4UAUA 5K3OA 3VPGA 4MROA 4G1UC 1DKNA 2BGKA 1EYZA 3B70A 4OQDA 3BAZA 5LPNA 2D5CA 1GP2A 2TMKA 2VF2A 4K9KA 2Z3VA 1XYGA 2ZIAA 4GMKA 4WIAA 4AVYA 3A6ZA 3CEMA 5I4CA 2BISA 3ETEA 3LHKA 1K6EA 2Q6KA 5DTRA 2FCRA 2ANBA 3NT4A 5ITVA 5LL6P 5LUBA 3MS4A 2WZQA 3WNZA 1UBMS 1R8JA 1KAGA 3MIZA 2FX3A 5FFFA 4UMVA 1NNUA 4JLNA 4LWOA 3T1QA 3AG6A 4DYDA 2ZRDA 4QVKA 4OJNA 1HRDA 4J16A 3OPYI 1J09A 1PJLA 1U8YA 2GBPA 4MYSA 4S12A 1SG6A 2DRIA 3KZOA 5H9VA 3T9DA 3ICEA 1UPAA 5GTDA 4F11A 4RXTA 2UZIR 1TQ8A 1OXVA 1U2PA 5B7NA 1IB6A 1EKXA 1JT9A 4TS1A 1SUSA 2NSDA 3PHBE 2FWBA 1ZN8A 1LLFA 2LTAA 2CBGA 3IX7A 4FEEA 3O84A 3W1VA 4Z4FA 2JDID 2NNLD 4FGWA 5BRNA 4JBGA 4NX2A 2Q4DA 1D0SA 4HC4A 3F5MA 3HCRA 2AG0A 2OP1A 1HEYA 1RYDA 2A6PA 3KSBC 4I1RA 3B6IA 3QA9A 2CXPA 2XD4A 4PPGA 5D5PA 1Z4OA 2FEOA 1U4OA 3SJAA 1IULA 5FKJA 2CLOB 1W1WA 3FVVA 3JWHA 2YJ6A 1UK8A 3WB1A 4V38A 4G5HA 5HF8A 1CZLA 2X1VA 3WGLA 4PU0A 4KJXA 1NN5A 1TVKA 2OORC 1G6KA 1HT1E 3EFBA 3KZXA 4M87A 2IS4A 4KDFA 3ZS8A 5AW8A 1A98A 2C8KA 1ATZA 4NPAA 2BSQA 1CNEA 2PMFA 1ZUD1 3CT4A 3IP7A 2XI4A 4BLPA 4UU1A 2W2NA 4Y1RB 5DTEA 1NVFA 3F7OA 4NMMA 3TN7A 1O4WA 1ISMA 2ZREA 4BTEA 1ATIA 2GPYA 4AIIA 2PO5A 3M9WA 3PFGA 5LP6F 3NQ41 4RKRA 2UZ1A 2XAAA 2RJOA 3HO6A 3JYNA 1F1JA 2VDJA 1NVKA 4QPJC 3UXHA 4HZUA 3HMKA 1T13A 4QJIA 2EW8A 4W6QA 1ZVQA 2XHEA 4QUDA 5F5NA 3VUFA 4N8DA 1FS6A 5CXUA 1RAEA 2YDYA 3DE3X 1HNNA 1XUOA 2GILA 3IUEA 4FFNA 2R6HA 2WU3A 3VV3A 2QM0A 3HNPA 1IUNA 3OM0A 3OZRA 3QE2A 2W4MA 1R0KA 1F2TB 2NZ2A 2D1SA 4V0OA 4M88A 2RI6A 1BRTA 3AY7A 1NF8A 2SNIE 4FYXA 3FGNA 4MRVA 2Q2VA 1RAFA 1CRQA 3JWEA 2UAGA 5EE1A 4B17A 4F56A 4QJ3A 1GV1A 3WYGA 2CXHA 2GO1A 1SHUX 2DH6A 1K4YA 3DJFA 3LUAA 1JW9B 1FLNA 4N8SA 1BVRA 2GD0A 2I29A 4J0EA 1V2GA 5CM8B 1AUPA 1JB9A 1A5SB 1YACA 4N03A 3UT5B 6LDHA 3BTOA 2VTDA 4CIYA 4TTQA 1AS0A 4IFEA 1MC5A 3C3MA 3FSRA 4RW0A 4OQEA 1U0OC 1DJLA 2CD7A 2JJ8A 1KH1A 2XUGA 3LNTA 4D92A 2VO1A 5BYJA 4URYR 2VJNA 4G4GA 1RM3A 5JNRA 4TYWA 3TW8B 1IYZA 1QIMA 1Q7CA 3BB3A 3E27A 2GZ1A 4YREA 1YNSA 1CUCA 1SRRA 4MI9A 4QGAA 5FNVF 4XSHA 5IP5A 1EZ1A 3HTXA 3ZIDA 5JDCA 4A5SA 4AMYA 1Z0AA 2GWRA 5A3RA 3EPHA 2CFTA 3H5LA 4O8CA 4W9RA 2JLVA 4P0QB 1P74A 1R1DA 3DM9B 4YDHB 4JX9A 1PWZA 5ALZA 1I30A 2OAEA 3ZC3A 4AG6A 1W36D 2V3VA 4TUYF 1KNXA 3JQAB 1OI3A 2VF5X 3QX9A 4XJXA 1W93A 3UGKA 3OQBA 2DLNA 5IFLA 5KOHB 4IVNA 5DP1A 3UJAA 3R7BA 1PZEA 2ZYHA 3IAS6 4C1NA 1JJVA 4QLBA 2UUOA 2KSQA 1OBOA 4CMHA 1CUGA 3BDIA 4AY2A 2G0AA 1KK0A 3L4JA 2QRKA 3NHSA 4CM8A 2AZ4A 5HF9A 5BURA 1A8QA 1SZJG 1X9IA 3I09A 3FTEA 3GLFE 1QHEA 2LPMA 1I3OA 1ZH0A 1WD7A 1RT9A 4FUTA 3R7WB 1QQBA 2DTEA 1KJYA 1YJXA 1TTTA 3K8ZA 3SFZA 4LOKA 4ARUA 1QH8B 4KR7A 1RJ9B 2F9MA 4XEHA 5CDUA 3T3EA 3A1SA 2XQFA 1ORTA 1GRRA 3VTAA 1JEEA 3DOCA 1ZUNA 4M8NE 2Z5FA 3L43A 3SC3A 4UASA 4G8JA 3UWSA 4CUZA 4MB0A 3A4LA 4AY5A 2A3RA 4EHDA 1XXLA 2OC9A 4MCAA 2JHFA 3GEHA 2GPSA 4V03A 1D1QA 2R11A 4MDHA 2Z3WA 3M4YA 3RYHB 1TM1E 2NUAB 4MITA 4EYQA 3VNBA 3COJA 3VKFA 3QXHA 3PQEA 3LKBA 2NWQA 3OOYA 4NLLA 4B46A 2XZTA 2ZJAA 5JMWA 4U1RA 2H4YA 1KBQA 3BTVA 2BGLA 5CCEA 4B09A 3LVBA 2CJXA 4AZ3B 3NFRA 3WL7A 5KSZA 1UBCA 5K8TA 1L5QA 1I3LA 3PHCA 4IIBA 2D5LA 3IMEA 4NJEA 2XA2A 3U81A 1PG5A 2VQSA 1SXJA 4JBLA 1YVDA 1HKUA 5L7WA 3AF4A 4G85A 4ID3A 5IKOA 1TW2A 5KYTA 2YVLA 1I1NA 4Z5XA 2RHJA 1ZKMA 1IQPA 1Y8QB 3CNHA 5CTJA 2PS9A 1A50B 3ONVA 1A76A 1ZXLA 1BS9A 3UGQA 1VL0A 4NR0A 3DNFA 3UV3A 3KXDA 3EVEA 4A3SA 2UVPB 4MWZA 3HR4A 4ADSG 2IEYA 3SNKA 4W5TA 2H2IA 2QZ4A 5IZCC 1OXUA 4XM2A 1AMOA 2NT4A 2X0JA 2UVPA 3BHJA 4RHTA 1Z56C 4A5OA 5BQ5A 1XMQB 3ASUA 4U7JA 4AZWA 4OATA 3AUYA 2AQ8A 1WSBA 3DMFA 3OMXA 4RPCA 3SBXA 4CMEA 4CGYA 4HT3B 1ADJA 1PTJA 2I99A 1EUCA 3LT5A 2H5IA 5E0OA 3ODGA 1HFEL 4L95C 1NKVA 4P9NA 2VRWA 2NVWA 3HY4A 1OYWA 1TM2A 2DERA 1TW3A 4MS1B 3RJ9A 5SY9A 1GHTA 1W581 4ZI3A 2JGKA 3OZGA 3R40A 1LPAB 4FKBA 1O9GA 4O4IB 3UEOA 5CLJA 1O0SA 1Q11A 3KOUA 4GQAA 2DP4E 2Q1TA 3F3KA 1X1TA 3HVUA 4ZYTA 1Q0ZA 1Y81A 3E23A 5A7FA 1W88A 5EPUA 1C0PA 2HU2A 3W5DA 4QSHA 1FTSA 2QYOA 1UPCA 3QBTA 4H77A 3TUZC 2IYUA 2ZU0C 4URWR 1WXGA 2M32A 4E70A 5ALIA 2GTPA 3OF3A 4UPVA 2XNHA 3TECE 1GGKA 2W42A 4DR6B 3R7LA 4S1PA 5JSKA 4OGLA 4KP7A 1E98A 2B4RO 2OO7A 4PLFA 1ENOA 5GINE 4FYIA 4Z1MA 4AFNA 5CLFA 1XDDA 1OPRA 4J07A 5GZ3A 1UUFA 3N1UA 1BJRE 1R74A 5JPIA 4YN3A 3L1IA 3HNOA 1J9GA 5FYQA 3EDMA 4GE3A 5F52A 4CCSA 5EZYF 2O8BB 1E9CA 3RS4A 3S8YA 3FTDA 3QPVA 3ZE7A 4I3GA 4D25A 1DXYA 1OXTA 3A04A 1EWTA 2O7QA 3ACBA 2EDCA 1XTPA 1XXHE 1GRCA 3WHKA 3DYVA 3A37A 2NPIA 1SFRA 5I8WA 1XU4A 2QDKA 1WSAA 3ILXA 3K2BA 1E0KA 1AH2A 2QT1A 2JCXA 4LSWA 4A0HA 1U7UA 1H1DA 3OZEA 1P91A 2GYVA 1HQCA 5JD4A 2JZOA 2Q5OA 1SZCA 2YN4A 3SZMA 1QP4A 1KOGA 2F3UA 4IINA 2XZLA 1QORA 3R8CA 4CL8A 5JBNA 5D8DA 3FFWA 3ZWBA 3ER9A 4UEJA 4L07A 5C4GB 5LQUA 1Y5IA 3URMA 1DADA 2LIPA 3ZZUA 1T5LA 4F4HA 2NO4A 4J8PA 1GZUA 1CUXA 4HSEA 4GWGA 1MDBA 1ZVKA 4PLYA 4AJLA 2AI3A 4DOMA 3AUJB 4Q1CA 1YMUA 3LU1A 4CXMA 5DX1A 2RGDA 4I2NA 2WKSA 1FU4A 4R2JA 4B48A 3OO1A 3ZV3A 5DOVA 5CNMA 3M6XA 3ZHXA 3ETNA 4RNCA 3U60B 2XIQA 3QPCA 3GUHA 4NYIQ 3UK7A 2P9CA 3I30X 3OZ7A 1VL1A 2PTGA 4NH4A 3HZRA 3LW7A 2ZTMA 2VSFA 1GR1A 2C29D 5IH7A 1H9AA 3SXJA 1UDRA 1XCBA 2C58A 1YIDA 4LRQA 3OUUA 5L95A 4PX3A 1P0QA 2IOYA 3ILSA 3ASZA 1RMTA 2REQA 4YV0A 3NM4A 3R0VA 4IHJB 3ZWAA 4L5IA 2C96A 4OQNA 4LJ7A 5L6MB 5FPTA 3SAJA 3PDIA 5FV4A 2C7OA 1JAXA 1X80A 1N2ZA 5HCIA 1SQ6A 2WM3A 3OFKA 1KEPA 4FDLA 4DCJA 4DANA 2ZSFA 1GA6A 1OYOA 4FMCF 4G25A 4WPGA 1QG4A 2PYZA 3RUEA 3TLKA 4NABA 2DUUA 4C05A 4C07A 4EHKA 1WP9A 5KSYA 4MVJI 5JIBA 4P38A 2A84A 2QRNA 3DFMA 1ST2A 1TC1A 1ZU5A 3HJCA 4LMBA 4MR8B 4R01A 3UHFA 3C4QA 4ENTA 2YXLA 3DVQX 3SICE 5LJIA 1ZVVA 1UBOS 3EXG2 3E84A 2BDTA 1X3LA 4JLPA 4XM1A 5JY6A 4KH0A 1WS6A 2J59A 5HRCA 1A82A 4PZ0A 1A4IA 3HVKA 4U9IS 1IQUA 1N4DA 4BQEA 3ZTYA 1TUEA 2IH5A 4QFCA 5JZSA 1DFIA 1WW3A 3EF1A 4HMOA 2EFYA 2F3QA 3HFSA 1SH7A 1PS0A 1F9EA 2PWYA 5E9AA 5TQ0A 2XGJA 3V8RA 2NSLA 2APJA 1JPNA 2Q7XA 1XEXA 2PIAA 2QE6A 1KYWA 3GP3A 2ZWIA 1UBTS 1DPGA 1VKJA 3IVRA 3WGZA 2PS0A 1K7FB 1P5FA 1JZTA 1AQLA 1ODIA 3O94A 3W6OA 1JDSA 1JBQA 3PPXA 4FONA 4CMJA 2GKSA 4PAWA 5FWYA 2XMPA 3MXOA 4EI9A 4ENPA 4JI8B 3IELA 1FBNA 1M2HA 3MTGA 4O0MA 4CQLB 4RABA 8LDHA 3WDKA 4IICA 2YIMA 4KSBA 3HZHA 3U3XA 4IQFA 2HD4A 4CIWA 5K3CA 2OGSA 2POQX 3A27A 1O89A 3C3JA 1BN7A 3EARA 3P20A 1W35A 1YA4A 1DXHA 3PEFA 1GCUA 5FTMA 2IW1A 1TYAE 1KE1A 1WPRA 4FZRA 1ZOLA 1N7HA 2ZUCA 2G28A 1NGSA 4JK3A 4YAKA 2AKYA 1XEAA 3VPBA 3AJDA 3EHDA 4OQYA 3PR2B 3QPAA 3RJTA 3CWZA 3UYKA 2J3DA 1BDJA 4IHJF 1QHNA 1Z7YA 3NUQA 3U48A 4XEUA 3ZEAA 2CHGA 1YBVA 4KDCA 3VH2A 2GM3A 3KEMA 4UVHA 2JD0A 2CFRA 1F2UA 2MYTA 3LT2A 5BW4A 1UBNA 3KQVA 2VSXA 3PWZA 4DR1B 3RTEA 2PFKA 1B3BA 5F76A 3LS2A 1T8YA 4HNGA 3GAFA 1X92A 2P4SA 5TQJA 5F2NA 3TNLA 4KSYA 1FP4B 3MT7A 4Y2JA 4JDUA 2H1RA 3TKYA 2HXSA 1EDDA 2RI1A 4N41A 4F3CA 2PQMA 2AN1A 5B1YA 2FPGB 5IAEA 3PNKA 1R6UA 3CX6A 2WSIA 4PZCA 4RVNA 2RBEA 4WD3A 3TE7A 1XVTA 5LB2A 2BEUA 4FFPA 5ER9A 3UBTA 1YJAA 1PK9A 5BNZA 1IM2A 2IXTA 5AUQA 1F8UA 2ZRQA 3IAEA 1U2RA 3AOEA 2HRRA 4N5IX 4GGOA 1VXRA 3MWEB 5L3SA 2QG9A 2ZTHA 3D7LA 3IP5A 3UH0A 4WQMA 1OYYA 3ZWYA 1DEHA 5CBKA 4KITB 3WLRA 2Z2XA 3O2JA 2GD6A 2LDBA 1L9XA 1SCUB 2AJ8A 2WYWA 4K8RB 4G41A 4PXSA 4RHYA 5IPFA 1H8EA 3FZEA 4IVRA 2X0KA 4YT8A 1QB8A 5JSZB 3MM4A 3JQ8B 5BYBA 2VRNA 2IPMA 4L6AA 2P9FA 4L75A 2J5KA 4FYHA 2NLOA 2NZJA 2KYRA 2J67A 5EWJA 3WX0A 4QYSA 3GLIB 4YBZA 2WF5A 1CEXA 4Z86A 4ZCIA 3HQ4O 4X3CA 3EN0A 3E7XA 2GAJA 4UUMA 1AKQA 1T1SA 3BGOS 3GCGA 1O54A 2ZRLA 4P98A 3SD7A 4YB8A 4OXQA 5CT4A 2XUFA 3C4JA 2ZPUA 1QC5B 1U0NA 4WXEA 3C7DB 5A0FA 3WRYA 1RE1A 3JQAD 3R3WA 1D1SA 1J8FA 2Q6OA 1DEOA 1EZZA 3RQSA 2Q3LA 4IJUA 1O4VA 5EAIA 3HR8A 2G76A 4J0GA 1G7CA 3VX4A 3ENNA 3DEYX 1E2MA 4ZCQA 4KPFC 2XZOA 3JX9A 2PYIA 3CLUC 4UTPA 1V43A 2ZQZA 4O4HB 1NUSA 3LX8A 2X0EA 4BX3A 1DE0A 4UPDA 1JVBA 3CLTC 3ZE1B 1E2PA 1T4GA 3HCEA 3NHJA 3VR3A 3FCUB 4FDTA 3VR5H 1GM5A 4XVQA 3VR3D 2YHIB 3UN1A 1PK7A 1Z6AA 1KA9H 4L15A 2IYTA 1SKYB 5A5DA 4MUEA 1UP7A 4L8YA 3SSAA 4NMWA 3LSYA 2YVKA 3R6GA 5CB4B 3O83A 3FMFA 1DO2A 1SM4A 2VHJA 1YR3A 2HAEA 2WAYA 3ZU6A 1Z7BA 3OQJA 1QUEA 2Y1LA 5EWJB 1NG1A 2RIRA 4EO4A 4CL3A 4GI2A 2QB5A 2X3FA 3L49A 5LXTA 5KYUA 2P5UA 1BO6A 1R4MB 4KMOA 4Q1VA 5FA6A 1V8ZA 3F0TA 3MOGA 3RKSA 16PKA 4Z54A 2V03A 4BNVA 3L06A 5CRIA 2E6UX 3BIOA 3ZIAA 5TF0A 2C4KA 4OHXA 2Y66A 4LZNA 1TA0A 1TPZA 1UDBA 3QTLA 4KN5A 5EIBD 2Z2KA 4UU8A 4D99A 2I2DA 1F1BA 4WXYB 3WGYA 2FPSA 2R2GA 2ZRBA 4ZCSA 5JU6A 3I4FA 1MOQA 1M34B 2FPPB 1PO7A 2C78A 1Y89A 4KXWA 5DOZA 5LZ4A 4FGKA 2O8FB 1IEWA 1SCNE 1QS0B 3QU4A 5CK4A 3H5AA 4WDRA 4JI7B 3JQBC 4BTVA 3UAWA 1DIGA 3FLMA 4OQLA 1LTQA 3WGVA 2NU9A 3TFWA 2XXAA 4GMXA 2IUTA 3OPQA 1UT6A 2WWFA 3A2NA 3BH0A 2BGJA 5JNTA 4XGNA 4MEJA 2OQRA 4EYGA 4ENVA 4FDAA 5JJIA 1XZIA 3HKBB 1Q15A 1HOTA 5EMLA 3K6KA 3MHPA 3OZFA 4J0KA 3SX0A 5L4NA 4U9HS 2IIPA 2YW2A 3Q3EA 3PUJA 1T2DA 4NP6A 4AXXA 3FSGA 1QVWA 2IYWA 3HWRA 4PHFA 3PUYA 1VL5A 2BKEA 3EJ6A 4JH0A 1VI2A 4QLAA 3F3SA 3EVTA 3QF4B 3M4JA 4RO0A 3DZBA 2FE4A 4QIHA 5BMVB 1NXPA 3ZVRA 1GFWA 1BDIA 3QBJA 5A6VA 1XLUA 1RPNA 2DWQA 3G9UA 1P44A 4YYZA 3OOJA 4B6EA 4QOGA 1MORA 1WABA 2M6RA 3N70A 4AWBA 4IEIA 5ESDA 1DQPA 1PZMA 1X7ZB 3A4IA 4MSUA 3L7CA 4OMFG 4MKXA 1ENYA 3FPKA 4JFRA 1P7ZA 2GBGA 1S7GA 5FI0B 2PZEA 3DSRA 3EG9A 5C1DA 5AM3A 1BHQ1 3BMQA 3DP9A 4CT5A 2HU7A 5F4BA 4BNFA 4HQ6A 1J21A 1AJEA 2C4UA 2XOEA 5KQSA 4MAMA 2V45A 2WJIA 3NNNA 4CDNA 1JDZA 1DRJA 1D2AA 2P11A 2AT1A 2XCIA 4KXQA 4C29A 5IW8A 1J23A 2BF7A 1D2MA 2XMSA 1HFJA 1XZEA 3D0RA 3OZBA 3JAKA 2GI4A 3HDQA 5DSTA 1N0IA 4X1IB 2I91A 1N2CA 1V8PA 3FNQA 2HLPA 3AHIA 2ZE5A 4HZIA 5BOVA 4BQPA 1R37A 1ODLA 2FSPA 4WOPA 4DR2B 3N74A 3NWEA 2WMOB 4BHTA 2E55A 1MQ9A 5TPWB 4UTXA 3ZWVA 2J08A 4DNQA 3AJRA 4J43A 1L1QA 4PM4A 4QRDA 4DDWA 4H08A 4F72A 3ZCUA 5KWIA 4UCWA 3BN3A 1E0JA 2XUKA 1UOEA 3GCZA 1XNHA 4Y1FA 3GOQA 2O52A 5ALYA 4CM4B 2CJWB 3C3CA 3NHUA 2MWMA 2I6TA 3Q85A 3TPCA 1BAPA 3QX8A 1YI0A 2HHJA 2OCBA 2AYXA 2WM8A 2C7GA 3GY0A 4QG7A 1G63A 2C5BA 2W6IA 1W48A 1UOOA 3AR4A 2H48A 3ANYB 4GZ3A 2ZQYA 4W5OA 3AYXB 3SDZA 2JJ2A 1VE6A 2C7BA 2EF0A 3IBFA 2AUNA 1MAWA 3IUJA 1CUJA 1PI3A 3PGLA 1JTVA 1ZQ1A 2JAQA 3I6MA 4DVJA 3ILYA 5AKEA 5HUJA 3CVVA 3WOVA 2IYPA 2E0IA 4ZV9A 5AVTA 3ICWA 4JDPA 1OASA 4RPIA 3TSOA 4ZHSA 1N2IA 2IV7A 4E6PA 4XWOA 2ZAOA