2WWXA

Crystal structure of the sidm/drra(gef/gdf domain)-rab1(gtpase domain) complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
b'YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGIKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED PROTEIN RAB-1
publication title Structural Insights Into the Dual Nucleotide Exchange and Gdi Displacement Activity of Sidm/Drra
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wwxA00
4M53A 2CJWA 3OAAA 4HDCA 2EFCB 4UJ5A 5AJVB 3TJZA 5G40A 2OM2A 1OFHA 2YC4C 4JSTA 2FSFA 2XXAA 2W2VA 2NMVA 4IXNA 4TYYA 1CKEA 5JRJA 3KUDA 5DGXA 5GJBA 3FHOA 2UVQA 3RANA 3THWA 2DWOA 4AYWA 1OIXA 1YZUA 4BLPA 3ADBA 4B3GA 3WXMA 5C2JB 4ZPXA 5F9HA 3SQWA 2NO0A 3BH6A 4Q1CA 1K6MA 1U8ZA 1S3GA 3DL0A 4M1WA 3QG1A 5G3YA 1TX4B 2CL0X 4C4PA 3QIAA 121PA 3IEUA 4Q19A 3QF7A 2PEYA 2OO7A 1RIFA 3TVTA 4B76A 5FBRB 1RJ9A 3I5YA 1P5ZB 1JALA 2JLVA 1SXJC 1N5IA 3FGNA 3RVBA 4Q9JA 1EFHA 2AR7A 2XNDA 2OUKA 3VKHA 1T4GA 2WAXA 3GJ3A 3ZIAA 1ZM2A 3G0HA 2WMOB 3U6BA 4KVAA 4QGHA 4X8MA 2PMKA 5D3MA 2PEZA 1VTKA 1GOTA 5KYKA 4LJAA 4UXHA 1UKVY 3QKTA 2GZHA 4TQUS 1VCIA 3MMPA 5CLQA 4W5JA 2HUPA 2NO9A 3J81k 3SOPA 1E94E 1HQCA 4D80A 2WWYA 4KFRA 2NO1A 2FA9A 3V4FA 4OJQA 3B8HA 4B44A 5JRZA 2Q6TA 3PEYA 3G5UA 3ZGXA 4JS0A 3EPKA 3EC1A 1S0UA 4MA4A 2Z43A 1F2UB 4A92A 1R5OA 1JR3E 4KCGA 4LYAA 5EP2A 3ND8A 1BMFA 3FTQA 2ATXA 1XTRA 2BEJA 2ZE5A 3CWZA 2FGJA 2PX3A 1P2UA 1UEJA 3V4RA 5FOXA 4CEHB 4B3DA 2HCJB 4G1UC 1Q1EA 3AEZA 3TKLA 4B6EA 1MRSA 4YC7A 4C0BA 1N25A 1ZNXA 1YZNA 1LW7A 4EJSB 2GXUA 5TDHA 2ZS7A 3RS3A 1AM4D 3QKRB 1XEXB 4MRSA 2FSHA 2VSOA 4HZUB 1G3MA 4V0NA 1QF9A 4C9BA 4RD1A 5HCIA 3CH4B 2IS1A 3I62A 1VIYA 3QE0A 1ZNWA 2Z0MA 2G0TA 1F2TA 4NBSA 2P5SA 3QXJA 5KDOA 3W6NA 4RD4A 2RGGA 2QI9C 3KTAB 1T6NA 4LJ6A 1ZW6A 2OCYC 1XTQA 5KO2A 4NCIA 4TLCA 4PPNA 5AJWA 3PXGA 2GAOA 3HPRA 2IEYA 1EFUA 2PX0A 2Q3HA 1TL7C 5EXPA 1Z6XA 2HV8A 1XD2B 3BERA 4O3MA 2VEDA 5H1YA 2GZAA 2QMUA 1Z47A 4LBWA 1NY5A 3WYFA 2FU5C 4GDFA 2OCBA 3OFNA 4URVR 3V9PA 1DADA 1YRAA 2HEIA 3U3JA 4MUBA 3HWSA 4FD2A 2ODEA 2F9MA 4JVNA 3A8TA 3PJRA 3BD9A 2XZLA 2IW3A 4V0LA 1KY3A 1W4AA 4D82A 4B34A 4A15A 2C95A 1R4AA 1AS0A 2OT3B 2J3EA 3TMKA 2ODWA 3F0TA 3VR1A 5FTNA 2P6UA 1UJ2A 3LH5A 2V7QA 4MYCA 4XTCS 1CP2A 5LBIA 2ORVA 2YV5A 3MGCA 2IF2A 5AUNB 1WXQA 2BBTA 1FOEB 4GI7A 3TLXA 3MWJA 3E2IA 1E2KA 3LVQE 4IDHA 3QI2A 1E2GA 1OXUA 4L4UA 4PSKA 1W4BA 1E0KA 2GETA 1TNDA 2R9VA 1VIAA 4P32A 3LFUA 5TMPA 5E7MA 1A4RA 3GLIE 1LB1B 1FTNA 1JBKA 1E4VA 1DG3A 3BC1A 5ANRB 4TL6A 2Z4RA 2G88A 2QMHA 4EUNA 1DO2A 1NIJA 1IM2A 4P33A 3KKNA 4MDFA 3SFVA 3BFVA 4TMXA 2PH1A 3IPYA 4OBEA 2J7PD 2HF9A 1SXJA 3AF3A 1VPLA 3B1ZA 4LJ8A 4DCUA 1YZTA 3PR1A 3QXHA 4EQ6B 4RZ2A 1X1SA 3CNOA 2BEKA 3D8BA 3F5FA 3FPAA 4QHYA 2HXYA 4BLTA 3LAWA 5KPJA 2AXPA 4PXAA 4IOKA 3SU8A 1V43A 2GKSA 3W3ZB 3EZ6A 3HU3A 2XTZA 1E96A 1KI6B 1MV5A 4BZXA 4A0FA 1VG0B 2V54A 3REFA 2C2HA 1ZC4A 4ZDWA 2J9RA 3CNNA 2OFOA 3W90A 4DVGA 1IBRA 4DBLC 2GA8A 3WYAA 5KHOC 4DLZA 4LPKA 1PUIA 1TPZA 2EW1A 1BYIA 3RS5A 4TYQA 3KB1A 1AK2A 5FOWA 5IT5A 3PIRA 3E5HA 1YE8A 1FX0B 1FUKA 5CM8B 2GVDC 5KSOA 3KJIA 1OW3B 2FFQA 4GZMA 4AK9A 2J5XA 3VMFA 3UKDA 3X1XA 4AD8A 1DAGA 3AVVA 1F5NA 4LV6A 1P2VA 3E1SA 1DAMA 4PR0A 5KNCA 3BK7A 1NNEA 2QRZA 4U7DA 1E79D 1I4LD 1R2QA 1E32A 4II7A 1Q12A 3A4NA 3IQXA 3NEJA 4KBGA 1QZXA 2QORA 4ZCMA 3MJHA 1U94A 2XSZD 2ZE6A 2BHRA 3NBYC 4WZ6A 1EG7A 5L8VA 3CWQA 5A0FA 1VYUA 3AP3A 2PLFA 1P4SA 2WWGA 1G6OA 4GBMA 4LDJA 4WAUA 4QKQA 1ZMXA 1NMXA 4CF7A 3FHTA 3CF6R 2A2ZA 1T3LA 4NYMR 1TQ6A 2CNWA 4E22A 1YQTA 3Q5DA 2ANCA 1F2UA 2ZS8A 1CU1A 3AUYA 4LV5B 4C0KA 1OV4A 5IK2A 2QMEA 3IHLA 2ZSAA 1QHHA 1KO8A 4S2EA 2JJ2D 4C0SA 1R5BA 2IYUA 2O0JA 3BBPA 3HR7A 4KODA 1G4UR 1HY3A 2Q21A 1QRAA 2C96A 2QGNA 3AKEA 1EESA 3A37A 4PQRA 3AKCA 4CEJB 2HF8A 3CRQA 3IHWA 1KI9A 1DAKA 1N6RA 5FOSA 4D26A 1OF1A 1QHYA 4RFSA 3BOSA 2ZRJA 1P9RA 3H1TA 4PZZA 2MSEB 5FL7A 3CRRA 4Q4JA 1GSIA 2OCPA 4XJXA 3X2SA 3UMSA 4MRNA 1Z0DA 2BC9A 3FMOB 2P0EA 5AUQA 4PPQA 2FFBA 4OI1A 1FP7A 2QSYA 2WSSD 3RLFA 3T1OA 4BFWA 4R7ZA 1ZVQA 4Y0VA 2HT1A 3BS4A 3QOFA 4OI2A 3U3KA 1FL9A 2C8VA 1N6IA 2F1HA 4LJYA 3THYB 1FFHA 1VCMA 4FCWA 4KI0A 5JMTA 3RS0A 2GXAA 2WWWA 4DIDA 3TNFA 3LWNA 1F60A 3P1JA 5HE8A 5BYKA 4RCYA 1ZIPA 1OXXK 3AVQA 1G5TA 3H2YA 4JBYA 3TSOA 4AKIA 1G3UA 3AKDA 3FKSD 2F3TA 1XMJA 1SVLA 2R6GA 1IXZA 1E0SA 4NH0A 4JLJA 4AKHA 2ZXUA 4FW9A 3B82A 3LXXA 4PO8A 1G8FA 2FWRA 1Q20A 3NH6A 3I72A 4UNPA 4E03A 4XH9B 4EKDA 3SYNA 5EXXA 4TYNA 4GPTA 3VNVA 2IK8A 3TIFA 2ZUBA 1AZTA 1G19A 1KKLA 2NZ8A 4C7OB 1N5JA 5C4GB 1KDPA 4A8JB 3UMFA 4QNRA 1T5LA 1ZD8A 3ADCA 1Z6GA 2HLDA 2QUZA 3WMFA 1KO7A 2FEMA 2ODNA 3W34A 5JI2E 4UJ3A 2Z5FA 1YVDA 1E2FA 3K0CA 3GLFE 1ZUIA 2ZSFA 1IY0A 2FX3A 2H7VA 5FBQB 4ZKEA 1XTSA 2H16A 4QXAA 2IC5A 2PCLA 1XJQA 4A4DA 4BFVA 1KSGA 1GP2A 2BM1A 4R9UC 3L8YA 1NJFA 2GEUA 4BECA 4KU4A 1FMLA 1XB2A 2W6IA 3ASYA 4RCZA 5KSZA 4OYHA 5DO9A 2N46A 1G3IA 5EE9A 3B9QA 1U8YA 3DKPA 4M0LA 1DTSA 3L43A 1IY2A 1VG8A 4O2LA 2RH5A 2BMDA 3PEVA 4DLXA 1EFRD 1G8HA 3FFAA 3UIEA 3CF0A 3K0AB 5C1BA 1SHZA 4ESHA 4F93B 1TU3A 3M1IA 4PC2A 1GRNA 4KXFB 4DUGD 4POAA 3OEED 2RAPA 3BORA 3X1YA 2YZ2A 3QF4A 5FFMA 1D2NA 1Z0AA 4XD7D 4V0ME 3IQWA 4LBVA 4A8JC 4DDVA 2FG5A 3TSWA 3N5CA 3RSOA 2QGZA 2JA1A 2P6RA 1Z0JA 5C46F 2GJSA 1KI6A 1NKSA 2F7SA 3WYGA 1UDWA 3I92A 4ACAA 1AGPA 1US8A 4RKFA 1XPUA 5JJKA 4GFDA 3O47A 2R6DA 2GJ8A 1ZU5A 4ZI2A 5J4LA 1E0JA 2P2LA 1WP9A 1S9DA 1NVXQ 1N6NA 3QPWA 3FFBA 1N0UA 3MD0A 4IOJA 4LGMA 2KB0A 4MRVA 4LSGA 4ZCLA 4DT1B 1S9HA 3T1QA 1YJ5A 1EWRA 2HJVA 2HYDA 1CRQA 3DMDA 5FUWA 4AWXA 1TUIA 5LD2B 3GFPA 1XZQA 2EFHB 3Q3JB 3SBEA 2CE2X 3L0IB 1AQYA 3FE2A 3UK6A 2BBOA 3DVLA 4GP6A 3GLGB 3DDCA 1DAEA 3ZYCA 4YMUA 3THWB 4E5UA 1DARA 4LBYA 1GUAA 1Q3HA 5EP3A 5DNYB 3HU1A 3ZVLA 1SQ5A 3L82B 4B32A 2C9YA 1WCV1 4FWIB 2QBYA 3I8XA 2HXSA 4NYJQ 2ZR9A 1OT3A 3LDAA 4OHYA 1ZD9A 4PX9A 2PCJA 3VKWA 1NIPA 2V8OA 3EZ9A 2P67A 2QTHA 1YHNA 1X86B 3PUWA 4NPHA 4Q5IA 1KY2A 2JDIA 3QXXA 1RJ9B 3CKLA 2W58A 4AURA 4PO1A 4Q7LA 2GXQA 4H1UA 1KAGA 4JLAA 4RY2A 2VHCA 1YZGA 2CL6X 5AK0A 1WQ1R 4G5OA 4LV8B 1GZSA 4LC0A 2W0SA 3BB4A 4YDHB 1P75A 2ECKA 3KJHA 5D3MB 4FXPA 4F38A 2W0MA 2Q3MA 2I4IA 1LF0A 4JKIA 2WV9A 1LF5A 2CEAA 2ZI4A 2ZRNA 5LD2C 1QHSA 2OXRA 3QKSB 1II8B 5K8UA 1MRNA 2CBZA 2ORIA 3ICEA 2D62A 2GVZC 4IDPA 5FR2A 4LC1A 3AP2A 1Z07A 2O8EA 1A7JA 2YYZA 3QPUA 4L5BA 1H65A 4DKXA 2EYUA 1U2RA 3A1WA 3HU2A 2IHBA 4QHSA 5SZJA 2EFEB 2EQBA 3VX3A 1TQ4A 1C9KA 1P3JA 4ESVA 3WY9A 4A6PA 3A1UA 2YOHA 1E1QA 3PENA 1ZAKA 1EGAA 2QNRA 3RRZA 3BH7A 3Q7QA 5GADl 3TSZA 4IFBA 4WIAA 4CYMA 2JLWA 2X77A 5CM9C 5F3WB 1N6HA 5B64A 4WA7A 2ZSEA 4QJ3A 2J0QA 1JPNA 4M1TA 4PHFA 4WXRA 4PHGA 1KO5A 5CJPA 1W5SA 2OE2A 2QTFA 4LI0A 4URWR 3TR5A 3BFKA 1T8UA 1VYVA 2P5TB 4DDUA 3PQCA 1QVRA 2QROA 2C03A 4XVUA 5DSZA 2PT5A 2G9NA 2O8BA 2N42A 3SZRA 4HUTA 5DN6A 1AA9A 2P65A 5FPHA 1Z28A 2ZVPX 2XOKA 1UBEA 2YNMA 1GNPA 2ZPTX 3QPVA 4DJTA 1HV8A 2UZIR 2VH5R 4EIWA 1KJWA 1W4RA 1HT1E 2R8RA 1R5NA 2D2FA 1OIVA 2XB2A 4BUJA 4HYYA 2VTKA 1P72A 3A36A 2FSGA 1HH4A 1L8QA 4HLCA 1AN0A 4HB0A 1I4DD 3LO5A 4D4MA 3B7GA 4IOLA 1DAFA 1Z0IA 1CJVC 2QTVB 3QKUA 2J7KA 3I73A 4KSCA 2ZYVX 5CYOA 1OXTA 2BCJQ 4FCTA 1XRJA 2IBMA 4IHQA 4PFSA 1W46A 3K1JA 4TTPA 2CK3A 1IN7A 2FMXA 3CR8A 2HYIC 5E3HA 4GT1A 1HT2E 4PSAA 3K70B 2IWRA 1TEVA 2WJYA 3FDIA 4CW7A 2XAUA 1N0VC 1YR9A 4JVSB 8OHMA 4M1KA 1NRJB 2KSQA 1XJCA 2LCFA 3ZH9B 5HZKA 1W48A 4TMWA 1LTQA 4IKEA 2VPPA 4PAOA 3R9IA 3AVWA 1MT0A 4OQLA 1UBCA 5GJWC 2CHVA 1JI0A 3NBXX 3NTUA 3NBFA 4EAQA 3DM5A 2F55A 1NG1A 2JLXA 4DSTA 2DBYA 2VA8A 4RD3A 5BN5A 3I1FA 2WTUA 2Q9BA 2GHIA 4YMTA 2DWPA 2F43B 3SJCA 4N0DA 4GMXA 2FGKA 3Q5EA 3U3RA 4A6XA 4D0NA 1GFIA 2E9SA 1ELOA 4WBSA 1E2DA 3VAAA 3M6AA 1SXJE 2GCPA 4QJ5A 1NLZA 4JJZA 5EUMA 2IS2A 1A82A 4OHXA 1NG9A 3CH5A 2VO1A 2GBLA 1H8HA 2JCSA 4Q9HA 4M1SA 2DWQA 1PLKA 3MAAC 1GDDA 1Z6TA 4WXPA 3K70C 1AGRA 3SQXA 2O8CA 4X8HA 5L3QA 2JEOA 4L9SA 5CK4A 4OK5A 5JECA 2BBSA 2QAJA 4YXWA 5P21A 1KI4A 4DLVA 1CRPA 2KWIA 2IYZA 4NDZA 3UWOA 3OEHA 3CPHA 1G18A 4AY2A 2NOAA 1L7VC 1ZNYA 1L2TA 2GCOA 3JZAA 3U7EB 2BV3A 1IONA 1SKQA 3FMFA 1KK1A 3SJZA 2FE4A 5CJ2A 4EFNA 5L3VA 4HB3A 4TL8A 3LV8A 3U7FB 4YLGA 1E9SA 4LHWA 3SBDA 1ZIOA 4MKHA 3GLGA 1N6PA 3WNBA 1IY1A 4QBHA 1IQPA 1JEDA 1G5PA 1OFTA 3JVVA 2KI5A 4HAUA 4L16A 3THOA 2IXGA 3KQLA 1G17A 3LLMA 3SHWA 1NJGA 1DAHA 5G53C 3K9GA 2GESA 3SHFA 4RD0A 3MLEA 5HZHA 2VSFA 3HDTA 3SNHA 4BFYA 5L3RA 4G3XA 4DSNA 1W0KA 2IYVA 1ZBDA 4LJ5A 1DBSA 1GRRA 2CE7A 4B3FX 2WPDD 4QBFA 2JJ1D 1QDEA 3AM1A 1P9NA 1ZINA 1FTSA 2IYYA 1D9ZA 3I5XA 4JZKA 3QBVA 5BW8A 3X1DA 1VMAA 2PJZA 4A1FA 1SGWA 4IEEA 2EYQA 1S2MA 3RC3A 3MFYA 1H8EA 2G83A 4LOAA 4YMVA 2P3SA 1KK2A 1NBMA 2FNAA 3QKSA 3B1YA 1OLOA 1II8A 4ZI3A 2ZSDA 1M1YE 1QHNA 1GNRA 3AF1A 1IXRC 1UADA 3R8CA 3PUZA 4YDSA 2YOGA 4KYUA 4ON9A 1JNYA 1OHHD 1OYWA 2Q3FA 5M04A 3RRMA 5KNDA 3R9XA 2ZREA 1P2SA 4KJZA 1TADA 2VL7A 3ADKA 3MG9A 5FTLA 3GEEA 1E9AA 3I4LA 3SFZA 4DZZA 3P4XA 5EJEA 1GWNA 2X19A 2ZSBA 5FL3A 1NVWQ 4FN5A 4FWTA 4NTZA 1Z2AA 1QHHB 1PJRA 2OG2A 1E2LA 4LCBA 1Z29A 5B57C 1E2QA 2VP0A 1ZJ6A 4TZ6A 5AUOB 4MYHA 4KVGA 5G3ZA 4TYWA 3OIWA 1X3SA 3IKJA 2CLDX 2FN4A 2ZJYA 4RFSB 4OQXA 2WAYA 1PUJA 5LPNA 2IF0A 2REXB 4C3ZA 3LRPA 1E4YA 1U81A 4XSGA 4BFXA 4BWYA 3WRXC 5JEEA 2C5LA 2GAAA 4Q4JB 1X8KA 2OFXA 1WE2A 2IYLD 1XEWX 5CDFA 1S4QA 5JHGB 2FEOA 4DCVA 1D2EA 5BXQC 2CVFA 3T1VA 5JCPA 3T1TA 2GDJA 2PL3A 2J59A 1E3MA 3U61B 3LLUA 1XXHA 4DLWA 1WMSA 2WKPA 2O8FA 1W0JA 2CHQA 4Q03A 4V02A 2QPOA 3B2EA 1SVOA 1DO0A 4B74A 4IJMA 1NN5A 4MYUA 4ZDKA 1ZM4A 1Z22A 5GVRA 2VLIA 4LRWA 4NYMQ 2NIPA 2J0VA 2QM7A 4LJ9A 1P62B 4TQAA 3NKVA 4Q7KA 5KSYA 2ZJZA 3E70C 2R65A 3OE7A 3EXAA 5A5GA 4B33A 3GFOA 4H1VA 2J45A 4ACBA 1NVVR 1YZKA 2FZLA 2CCKA 1UPTA 3VTKA 1TU4A 2ONKA 4HLUA 1XNJA 3GEHA 3MWKA 3GD7A 4HAYA 4JL6A 4GZLA 1YR8A 1M74A 5FPTA 5BYJA 1GVNB 4D6PA 4M9SA 3KB2A 1SZPA 4TT3D 2OBMA 1RYHA 2VF8A 3KKOA 4X8OA 4EPRA 1XPOA 2R6AA 1ZM3A 1NMYA 1C1YA 2FPKA 2IA5A 3PUYA 2HJGA 1UF9A 3F8TA 1NSTA 5DI3B 3EZ7A 3K09C 2O52A 1XD9A 4P31A 1CS4C 4PPFA 3TQFA 1R10A 4PC6A 2EFDB 4E07A 2CLCX 3WMEA 2F43A 1WBDA 4OQFA 2ZIAA 3T5DA 1Q44A 3U4QB 4D0LB 1T0JB 2IYWA 4LK2A 1Z0FA 4BRUA 1CLUA 2NG1A 1G8PA 2ZRIA 1VCOA 1HA3A 5AUPB 3KXLA 2FDCA 2QZ4A 2ASEA 1BH2A 2DYKA 4B3XA 4MRRA 3OAAD 4DLRA 1TTTA 2BMEA 2ZAMA 3GJ7A 3Q85A 3REGA 1GTVA 1GKUB 1KSHA 1UDXA 5KOYA 4AG5A 4Q00A 3RRNA 2QPTA 3D6TB 3WBKA 1G9XA 3L8ZA 1E1RA 2ZRLA 5FOTA 4OK3A 3TE6A 3MUFA 2JLSA 2B6HA 5J4VA 3QF4B 2ZJAA 2QE7A 3HR8A 1OH7A 4NCKA 2KBFA 5DHAA 4A36A 3UWKA 3TGPA 1WRBA 3ZZ0A 2ZYUX 3RS7A 4B3BA 4QM6A 4DLUA 2X2EA 2XZOA 3RS2A 3C14C 5JFGA 3SC3A 5GVSA 3THXA 3I3SR 4HATA 3K0CC 1IHUA 1ESMA 5GJCA 1W36B 3H86A 1US8B 5JS8A 1VHTA 2DB3A 1ZD1A 4EPVA 2XNDD 3BWDD 3O8DA 3IDQA 3C4JA 4RJLA 4W5HA 4JMPA 3ZIAD 3GCGA 5J5CA 3B6EA 4TLDA 1T9HA 5EZ6B 5CIWA 3LBNA 3RWOA 1UBGA 1XDBA 3AF0A 5KPDA 4JYCA 1ODFA 3KXKA 1H8ED 4QHTA 5TXGA 1UBFA 2A9KA 4B48A 3K0SA 3OZXA 4LHZA 2B92A 1Y3AA 4Q7JB 4DRZA 2QSZA 3TAUA 4HLDA 5H8WA 4HDOB 1K5GA 1IN5A 5HPYB 4FCVA 2DR3A 4CRWB 1N6OA 4AG6A 2QBYB 4PAQA 2GZDA 1Z3IX 4EFMA 3LQRA 3LX8A 3R7WA 4A2QA 4O2RA 2C98A 5AJZA 2RKOA 1J8YF 2V4ZA 4LJ7A 2GF0A 4Z8XA 4R71A 4JVMA 3N2IA 1BMFD 1I2DA 1ZCAA 4IDOA 1Z06A 2AHOA 3CBQA 4B71A 1X6VA 3TUZC 1XF9A 3GJ4A 3CM0A 4LUCA 1W36C 1I2MA 2ZYTX 3ZD6A 3W3AA 4IVQA 4JBWA 2GJAA 4Q9IA 2MSCB 5DISB 1XEWY 2JJ8A 5BWMA 1Q57A 2D4HA 3EZFA 2XGJA 1AIPA 3EC2A 2VP9A 3DKVA 1CXZA 4Q9KA 3EIQA 4F92B 2IYSA 2FH5B 2AL7A 4KBFA 1ZP6A 4C2UA 4NU0A 1BKDR 1G64A 2H8KA 4HSEA 3VU9A 1G7SA 2WJGA 2ZJ5A 2Y8EA 1ONBA 3Q72A 2JIZA 4BRWA 2F1JA 2ZJBA 2ZJOA 2GK7A 3OIUA 2O8EB 4K46A 3EWAA 1X1RA 5H68A 1N6LA 1KSFX 4IDNA 4S35A 2WOOA 5DE3A 1T5IA 3KQNA 2CLSA 2ZRPA 2WIAA 2FJUA 4RZXA 2V55B 4JKYA 2WWFA 4DB2A 3KKPA 2AFHE 1JPJA 2F6RA 2ZRFA 4EPXA 3FHCB 1DS6A 4P4SA 3GEIA 4LWZA 2QT1A 5J4KA 2ZRBA 1OB2A 2O0KA 2F1RA 1YZQA 1E2PA 1SVIA 3WP1B 5TARA 2JLRA 4L8GA 4OJKA 3OFND 1JR3A 2OAQ1 2GK6A 5C4MA 1AS3A 1G7RA 1TMKA 4QG7A 3K09A 4A9AA 3NEYA 2W6JA 2OLKA 4DHEA 3K70D 2DY1A 2CMKA 4GMDA 3TW8B 2IX3A 3U5ZB 1RRCA 3NDBB 2Q0HA 3QEOA 3CONA 3QVVA 1S1MA 4OK6A 2O8BB 4NCHA 4LYHA 2F1IA 2REBA 1DOAA 4CEIA 2OAP1 2ZU6A 1R8SA 3CX6A 4PANA 2QP4A 4GOKA 3ZDQA 2V7QD 3CF2A 3U6KA 1OKKA 1LNZA 1RRGA 3IIKA 3QBTA 1Z83A 1U0HC 5A4JA 3C5CA 3CIOA 5DHFA 1ZNZA 1SVSA 3ND9A 4TLAA 2GJKA 4IDQA 3DO6A 1CJTC 4PC1A 1C4OA 1U98A 2NPIA 4ZDJA 1KDTA 1T91A 1TEXA 1U90A 3K0FA 5JBQA 4W9MC 2BVNA 3C7KA 5KDDA 4HB2A 2H5EA 3BRWD 3ZD7A 2CDNA 5K8IA 3ONWA 1E9FA 5FOUA 2GEDA 4Q9LA 5CLLA 2G6BA 2FFAA 4Q4HA 3AB3A 5DI3A 5J40A 1KIMA 4BPBA 1SXJD 4JLNA 1KI2A 3FOZA 4C2TA 1KK3A 2QE7D 4ZCIA 1GILA 3IIJA 3U4QA 1S1CA 5B58C 3T5GA 4DCSA 1L4UA 2I3BA 5KDLA 5FUYA 5EZ5A 4BEBA 4URXR 5EP1A 2GNOA 3OHMA 3LBIA 4M21A 4ASUA 2VYFA 3RYTC 1FQKA 2ZI3A 5BQ5A 1E2NA 1QHIA 4MKIA 3ZVNA 4NZYA 5JCZA 1N2CE 2F9LA 2W00A 2IUUA 1M7GA 3CRVA 2VRWA 4V0KA 2QT0A 5IRCD 1DVRA 3LX5A 2O8DA 3DOFA 3CZPA 1T3HA 1DPFA 1W1WA 4QOSA 3NG1A 4ZKDA 3K53A 4KFTA 4G01B 4ITRC 4ZDIA 2WM9B 4ILEA 1KTVA 1E2JA 4HAZA 3KFVA 2EU8A 3A58B 3UMRA 3GJXC 4NP6A 1OE0A 3GLIA 2H1LA 1NP6A 4R2HA 3IBYA 1HQYE 1KI3A 3PCRB 4FIDA 2O8CB 2J0UB 2QP9X 5DYIA 5L3QB 4DEXA 4CT5A 1E9RA 4OHVA 2RMKA 2BOVA 4Q1DA 1XD8A 2FV8A 2QAGB 4BFUA 1GM5A 4BLSA 3K9LA 2AFIE 2GCOB 4RZUA 2B21A 3NIBA 3GLGE 2D7DA 1XU4A 1P2TA 5BN4A 3U3OA 4C0LA 2Z4SA 3N70A 3GJ8A 3CZQA 2VIIA 1G20E 3MRSA 2QL6A 4X8LA 1XTIA 2VBCA 2ZE8A 1XP8A 2CNWD 1XWIA 2WZQA 1UKYA 2YHSA 2NGRA 4LPSA 4PZYA 3SI7A 4IVRA 2RGNC 1E2HA 3UG7A 5HKKA 3CX8A 5IK2D 2C04A 4LHVA 1KO1A 2V6IA 2XTMA 4BQSA 4Q4AA 2GBLC 1YZLA 4TSFA 5B2ZA 3UANA 1W7AA 3S1AB 1S3SA 1SVWA 3AF4A 4Z1MA 4M9QA 2NQ2C 3EASA 3UPUA 1NVUQ 3P27A 4Q7MB 3SJAA 1CF4A 2QAGC 5EP4A 4B2LA 1NBME 5E7IA 1GL9B 3CO5A 1JQLB 5DLQC 1B0UA 1EFTA 2XJ9A 3H4MA 3FMPB 3KQKA 5E95A 2W2XA 5FL7D 3VKGA 5GJVC 4ERNA 2PZEA 4OHZA 3T06B 1AKEA 4TLBA 2Q9CA 1MO6A 1UAAA 1E9DA 1MO5A 5EXTA 1MO4A 1W4CA 3KX2A 4TLEA 1IJEA 4V03A 2QP3A 2XJ4A 3GJ5A 2YJTD 2ZI5A 1R8QA 4TN1A 4EPTA 5EE1A 4I81A 2D74A 2NTYC 2RGBA 1X8LA 4W7SA 2B8WA 2TMKA 3PITA 4XOIA 4IVPA 1JJ7A 2E87A 2VF7A 3QG5A 4TL9A 1AKYA 2ZI9A 3TH5A 3AUXA 3VQTA 1OH5A 2RGXA 2V1UA 2L0XA 4BZPA 3ICQB 1Z2CA 1Z6YA 4NONA 1S96A 2WMNB 3LXRA 2R2AA 3PVSA 1EFCA 5CYPA 5F98A 1KNQA 1P7CA 4JBXA 3W5IA 4PHTA 5CDFE 4FINA 2DCUA 1TF5A 3PEUA 2HLDD 2LKCA 4DEYA 1XXHE 2MMGA 3R9WA 1NKTA 2VQSA 3IILA 3HP1A 4TWZA 3LQQA 3OF5A 2YKGA 3OIYA 2J1LA 1XXHB 2D06A 4QNMA 2ONJA 2O8FB 2YVUA 3BAFA 3I32A 1UM8A 4GOJA 2C78A 4F4CA 5JS7A 4NYIR 3GFTA 4B47A 1QG2A 3GQBA 4M22A 1AS2A 4A0GA 2W6ID 4NCNA 4KFSA 1BOFA 3D31A 1G6HA 1Q21A 4PC7A 1QHXA 4OI4A 4L15A 2I1VB 3NVAA 2J0SA 4D2IA 2C9CA 3GP8A 1TAGA 1CTQA 2AKAB 3K9NA 2G3YA 4BLQA 5CB8A 2IYTA 2IL1A 5FBVB 1DE0A 3DPUA 4QRHA 2H57A 3Q8XB 4M1YA 1R0YA 1OPXA 1W2GA 1VYTA 1N5KA 3UG6A 1FW6A 2RHDA 1CJMA 2PZGA 4PQYA 3B1XA 4FMCB 4JIMA 4O25A 1CJUC 5EQTA 4UQOA 3K8YA 1IOZA 3QXSA 2OXCA 1CJKC 4PPGA 5UKDA 4OKSA 2VHQA 2ZETA 2IS4A 1IJFA 2KE5A 5FH9A 4Q1FA 4B35A 3GMTA 1Z5ZA 2BKUA 2XITA 1RRFA 4N3NA 2VHJA 1L4YA 1O3YA 1W36D 3PFIA 2G77B 4XWOA 2WVJA 2DFLA 3SJBA 1E6CA 3BXZA 5IF9A 4A0RA 3P26A 3LVRE 3GLFA 4BLRA 4XSHA 1GRQA 1JXMA 4FMCF 1PVOA 1RE0A 1XMVA 4Q4LA 1XCMA 1D6JA 4M9XA 4M1OA 2G1KA 3X1WA 2RGNA 2Z6VA 4GRAA 1QG4A 1R6BX 4NHOA 3TVDA 1FZQA 2GRJA 3EPJA 3CR7A 1Z6AA 3B5JA 4AI6A 1OIWA 221PA 2VP5A 5JI3E 3ZLJA 4NYJR 1JEEA 1E9EA 2J0UA 4ZIRA 3Q7PA 4HLUC 2JASA 4JVLA 4DIEA 3ETLA 5KTYA 3WP0A 2C77A 2QAGA 1COWA 3H84A 3NH9A 2JLZA 1TF7A 2FFHA 3AQ4A 4HUQA 4JLMA 5K8LA 3NC0C 1WF3A 3MCAA 4EPYA 1G3QA 3EX7C 1SVKA 1N3BA 1SULA 4I1OA 1HE1C 3NHAA 3THXB 5FPSA 4V0MA 2WWIA 4LYFA 3EZ2A 1OFIA 1VECA 3WNCA 2JDID 2IXEA 2CCGA 2J46A 3EPLA 4ARZA 2W83A 4LBZA 4I1VA 1N0WA 4D25A 1UEIA 4LHYA 4YMSA 4IFEA 2VHTA 2XEXA 5EUQB 1W49A 2QY9A 2OLJA 2DPXA 2B7BA 3C41J 2KJQA 2ZR7A 4F4JA 4MGKR 5DH9A 1R7RA 2PLRA 1JAIA 3C15C 1R0XA 1YR7A 2WICA 1KDRA 2AK2A 1LV7A 3H0KA 2AKYA 4IOMA 1N5LA 4WW0A 4WZAE 1U8AA 1ZUHA 5EXSA 1FNMA 4GP7A 1K8RA 1P6XA 2J7PA 3S1AA 3QNUA 4F91B 3ZZUA 4HEJA 1ZCBA 4PTLA 2B7CA 3ZVMA 1U0LA 4BZQA 2ZI7A 2EWWA 2BBWA 2I1QA 4JL8A 1KDOA 1OXSC 3R7WB 2AN9A 1SVMA 3PV0A 1WDTA 3T34A 1E1QD 2VP6A 2X1VA 1XEFA 2R6FA 4NCJA 1OYYA 4JLDA 1FMJA 2UZ3A 6Q21A 2QPAA 3QSYA 4P0TA 1PZNA 1KMHA 3A4LA 4JL5A 4CIDA 1GKIA 1MR3F 2ZRCA 4U02A 3ASZA 3NWJA 2RGEA 3U3MA 2R62A 2GTPA 3VU9B 4KHZA 2QRNA 3P4YA 2ZRAA 3RWMB 2Q9AA 5DN6D 1JAHA 1T0HB 3QXCA 2O0HA 3IIMA 4MDEA 2XOKD 4CVNA 4ZV4A 2C9OA 3VR2A 4AYXA 3EIHA 2NPFA 1XX6A 1YR6A 2BMFA 3I8SA 2D2EA 3JZMA 4BFZA 3A1SA 1ZYUA 1EXMA 3ADDA 2E1RA 2WHXA 2IS6A 4B6FA 4DWJA 2ZI6A 4AKGA 2BDTA 1E79A 2ZS9A 3OESA 4P4SB 3CNLA 2OEPA 3PEWA 4RVCA 4N1AA 2XB4A 2WJHA 3RS4A 2XSZA 3NBZC 1KI1A 3AVYA 2AWOA 4TTRA 2GWHA 2YOFA 4US2R 3QVUA 4C0JA 2RGDA 4XVRA 1GL6A 2CK3D 2YWFA 3U7HB 1M7HA 5JSZB 3U7GA 2AXNA 3Q9LA 1HYQA 3TRFA 1T8TA 5SZHB 4F4IA 4DDTA 4TQ9A 1KAOA 4LY6A 4H9GA 4US1R 2IEZA 2FSIA 3EAQA 3FKQA 4XWAA 4CEIB 1XMSA 3HPQA 4MYTA 4XIGS 3NC1C 2VP4A 1G8YA 4RZ3A 3KKQA 2ZRHA 2A5DA 2GF9A 2JJ2A 3LNCA 4IRUB 1B23P 2OZEA 4HLQB 3N2EA 3VNUA 2QG6A 3KQUA 1SHKA 3B9PA 2BM0A 3WMGA 1ETUA 1FQJA 1KJZA 1GITA 4F7WA 3FMIA 1ZM7A 1TQ2A 1XJ0A 1E9CA 1G4AE 3KZ1E 2C99A 4YQFA 4Q1AA 2JATA 5SZIA 3K0FB 4BASA 4Q01A 1TUEA 4GL2A 1Q22A 5FTJA 5E7JA 1JQJC 3RAPR 4KYIB 3SEAA 1Q1BA 1CULC 5JZVA 2D3WA 4DCNA 2J41A 4UNRA 5AR1A 1XTKA 2OFWA 2WSSA 4JJKA 4HAXA 1P9WA 5FUVA 5FOVA 1H8HD 4Q4HB 2BKEA 2X2FA 1M7BA 1KI8A 3MWLA 1J2JA 5DIFA 5HE9A 2IWHA 4EJSC 2G0NA 2IYXA 4DLTA 2XX3A 1E9BA 1E99A 1MABB 2NO6A 1IN8A 4YXWD 2OESA 621PA 3BJIC 4URZR 1JXOA 5EE3A 1COWD 2KBEA 3OEHD 4WVFA 3RDPA 2CCJA 1LS1A 4Z51A 4OI0A 3FKSA 4HDQB 1N6KA 4D4JA 3GLHA 1JJVA 2X8AA 2ZYWX 4LZZA 4PQFA 4BLOA 2PJRA 2IHYA 4CT4B 1RFLA 1ZC3A 2WWXA 4V0OA 2AX4A 2HDNB 5FBLB 4KLZA 3T35A 3W9YA 4CDGA 2IXFA 4BGDA 2QU8A 1JR6A 2FZ4A 3U60B 1KI7A 5TY0A 2O8DB 1G41A 2R6CA 5CIQA 4W5WA 5TV2A 5F9FA 4M9ZA 4XVQA 2BCGY 2FPMA 2ZITA 2PZFA 3KJEA 2OSBA 1Z0KA 2QENA 4FI3C 2MMCA 3KUCA 2P6NA 3AGQA 4AIIA 4PSVA 1HE8B 3DZ8A 3GLIB 1G1MA 4KSBA 2ZR0A 1W0KD 3W8RA 4JLBA 3U44A 4PAMA 4JT2A 1XCPA 3SR0A 4DLYA 5CITA 3LA6A 5L3SA 1CIPA 4MITA 1KNXA 1FP6A 4K8OA 1HEIA 821PA 2VP2A 3QENA 3CB4A 3HYRA 1EX7A 1XCGB 4Q47A 1W5TA 4WZBE 1ZM9A 1KKMA 1WB9A 1NN0A 2QQEA 1NBMD 4P4TA 4EDHA 1BIFA 1EFRA 1G7CA 1MKYA 2UKDA 1V5WA 4UXJA 2AD5A 2GXSA 3ZS8A 3A4MA 1OH6A 2QQ0A 5SZKB 1OJLA 3EIEA 3PUXA 4DUGA 3TAHA 4US0R 4U00A 3OEEA 4ZO4A 3VHLB 3R8FA 2RCNA 1AQUA 4XD7A 2IUSA 2PMDA 1IN4A 4A0HA 3G82C 4KAXA 2WJIA 2RB4A 4OQNA 3KL4A 3VR4A 2H18A 3DZDA 1SKYE 2CVHA 4LJ4A 4PZLA 4Q4AB 3A6PC 4KLNA 3AP1A 2WSMA 2ZJ8A 1CBUA 2R44A 1KMQA 1OFUX 1Z08A 1SKYB 1E2IA 1IXSB 3AKYA 1Q1ZA 3GJ0A 4G5RA 4I99A 4M2LA 1T3SA 3LW7A 4FMDB 4N0EA 3ZQ6A 4Q1BA 3ZZTA 2ZRDA 2WKRA 2IUTA 2QA5A 3RHFA 1GL7A 4Y0AA 1QHGA 5C18A 2YC2C 3L2OB 1EX6A 1NI3A 4PO9A 3RC8A 4DSUA 5LDDC 1OB5A 4HI0E 3W5JA 2B8TA 3AGPA 1D9XA 2D7CA 5AWFC 1GKYA 3W8NA 4D81A 2YWEA 3F3YA 1DEKA 3MSXA 2NZJA 5FUXA 1NN1A 1W0JD 4MQBA 4I1SA 5JEDA 1M34E 4BEJA 4FMDF 3LBHA 5FI1B 2IYQA 2RGCA 1F48A 3D7MA 3W6PA 3P32A 3B60A 4MGYR 1GNQA 3I61A 2ERXA 4JLVA 5JWHA 1W2HA 1NSFA 3RABA 4P3YA 3IUYA 3QQ5A 4M4SA 2ERYA 3OE7D 1E2EA 1FUUA 2ZRGA 3B85A 4CEHA 3DMNA 3PUVA 4R98A 5JSZA 3B1WA 4QL3A 4EJSA 2OBLA 4QFMA 2CL7X 2YWHA 2OV2A 3QKRA 4UNSA 521PA 1A1VA 1XEXA 5KNBA 4Q18A 3P20A 2CHGA 3KXIA 3VR3A 3WBJA 4HZUA 3WHKA 2RGAA 2GEVA 3W6OA 1NN3A 4JT4A 2BJVA 1Z8FA 3CPEA 5D3QA 4KV9A 1R0ZA 3O8BA 4IW3B 3VR5A 4B3CA 2WJVA 5JJIA 1Q1QA 2ANBA 3KTAA 1NLFA 3DHWC 1LS6A 4MKGA 3ZVRA 3QJYA 1RKBA 2HT6A 4D0GA 2ZU0C 5EE0A 4KO8A 1R0WA 4Q66C 3IO5A 5LB4A 1VCNA 1J7KA 1XD2A 3C5HA 2A78A 5ELXA 4D4LA 1K5DA 4CZ2A 3SN6A 1Z63A 4TL7A 4EFLA 3CLVA 3FVQA 2A5JA 1NLYA 2DFNA 3KQHA 3L0SA 1KZ7B 2OCAA 4QM7A 1BYUA 3ZS9A 1E1RD 2K5UA 4GNKA 4L9WA 1GAJA 4J0QA 2A5FA 1D5CA 1X8JA 1KJYA 1ZUNB 4A2PA 1XBTA 4Z54A 1RC8A 2ORWA 2BWJA 2QMOA 3PG5A 3FWYA 5KU1A 4RSGA 1MABA 2YWGA 3KJGA 4ABYA 3CRMA 5J47A 1TQDA 1EWQA 3IEVA 4AYTA 1A2KC 2WBLC 1VDZA 1XZPA 3BB1A 1QVAA 4HAVA 4PHHA 4YONB 5HTKA 2ZANA 2GCNA 1WA5A 2QEQA 4JLOA 1U0JA 2ZQ5A 1O87A 1II0A 1DAIA 1AZSC 4DCTA 2WOJA 2OILA 4RKEA 3GLFB 4AKEA 4URUR 4U5XA 5JJLA 2ZM5A 1D8TA 1KO4A 1RVDA 1TF2A 3M4YA 1LY1A 2NO7A 2CXXA 4URYR 5JWRA 2G1JA 3T12A 4BE7B 2ZUDA 1YRBA 1PLLA 3K9HA 4NYIQ 5H70A 2FOLA 3CRW1 4UXIA 4A2WA 3AH8A 4M1MA 3QY0A 2ATVA 3AV0B 5JHHB 1Q0UA 5KSPA 5FPKA 1KYIA 3IO3A 3QUSA 3GPLA 3LW8A 2QN6A 4Q48A 3DOEA 4ZIRB 4TZ0A 1G7TA 2ZVQX 1U9IC 1KZGB 1GIAA 5HR5A 3AVUA 4PC3A 4GOXA 4EQ6A 4I4LA 4HB4A 2A3RA 2GILA 4NKRA 4MGZR 5J4YA 1E98A 4HUQB 4Q02A 1G3RA 1DG1G 1LVGA 1E69A 4MGIR 2ZTSA 3O8RA 1CR1A 1S8FA 1U99A 2YINC 3TUJC 4QBGB 3EG5A 4XTRA 3VFDA 5KUTA 2ZROA 3EW9A 5CK5A 1XPRA 1GG2A 1G291 3TQCA 4ARZB 1WBBA 3ECCA 3L0PA 4DDWA 1HUQA 3SE0A 3TK1A 2PBRA 3B1VA 4CGZA 1QBKC 2GJ9A 2JLUA 5FI0B 2ODBA 3AVXA 1UFQA 1KGDA 3AVOA 3K0EA 2CJWB 4JSYA 1FX0A 4HAWA 4MKFA 2ZAOA 3TBKA 421PA 4WOPA 1XTJA 1II9A 4R2IA 2AWNA 3C8UA 2SHKA 4TMTA 3WRYC 3CW2A 2XXAB 2JIZD 4TMKA 1F3OA 4UKDA 2LWIA 4C0AC 5J4HA 5DYGA 1I4TD 2ZJ2A 1M8PA 3FB4A 4QGFA 1J99A 1KHTA 2F3RA 1UKEA 4IXMA 4Z8YA 1XMIA 1NMZA 3IGFA 1JB1A 4LX0A 3NDPA 5JWOA 1P60A 1RZ3A 2J87A 2BJWA 1Y63A 1KSJA 3EPHA 1AJEA 2JGNA 3NHBA 4HZIA 1JECA 4G0NA 5HCNA 2FF7A 5E4FA 2AK3A 1JR3D 1KMHB 4NMMA 3X1ZA 1MH1A 1NF3A 3RSLA 4DXAA 4TMVA 4E09A 3AF2A 2O5VA 2W6JD 3DEFA 4EPWA 4C30A 1J70A 4OHWA 1BS1A 4Q1EA 1PV4A 1VHLA 4KFUA 5K8TA 5G41A 5CB6A 3A1TA 4JYBA 1OH8A 1CR2A 3EA0A 1G16A 3B78A 5EE5B 4TYPA 1BO6A 3LY5A 3IBGA 5AJYA 4DSOA 1PLJA 4I1UA 4TTQA 1OKKD 1NY6A 3IPXA 4OL0A 2WPDA 3TUIC 4DB4A 3OIVA 4MRPA 2BMJA 2WIBA 2JJ1A 3WHLA 4DLSA 3MWYW 3GJ6A 3SYLA 4CEJA 4C0HA 3BGWA 3QEJA 2DFTA 2ZRKA 2A5YB 5IHPA 2DFKB 3ZJYA 5FBWB 1CR4A 2IYRA 1RPZA 3TW4A 1IN6A 3EA5A 2OHFA 1MOZA 3KDSE 1CEEA 4JLKA 4NE2A 2BIFA 4B2IA 2WKQA 3BH0A 4G5SA 5FPYA 1OHHA 2ZUCA 4JLPA 3T61A 3MJRA 1A5TA 4UNQA 2EFGA 4A82A 721PA 4QGGA 4KITB 3C16C 4K81B 1FPMA 4O0MA 1RW4A 3THYA 2XZPA 3SS8A 3V00A 5JLJA 2FPLA 1ANKA 5TVKA 4G5QA 4BFTA 4P4UA 1F2TB 2Z83A 1OSNA 2N1BA 3UXMA 4ASUD 4QBIA 3D3QA 4LHXA 4QJ4A 1KK0A 5IDVA 5B30A 4M8NE 3JVUA 4C0QC 1YU9A 1VG9B 1RYFA 2V3CC 3EARA 1U9IA 2JAQA 4BFSA 2IT1A 4OQMA 1ZRHA 3CUEF 3EWSA 2V9PA 1ZU4A 4LYJA 2EVWX 4FMBB 4C7OA 4A8JA 4AC9A 5FR1A 3M0EA 1E2MA 2JLQA 4RFVA 3B13B 3KKMA 2ZE7A 5DI9A 4QGAA 2REOA 2H17A 2V1XA 2QM8A 1EK0A 1FNNA 1W47A 3LD9A 2A7QA 3VHXA 1ESNA 4DC9A 5FTMA 3SDZA 2AD1A 5BN3A 1J8MF 1M6NA 1VKJA 5F2EA 4XWKA 2A30A 3GLHE 1W44A 3O8CA 1UKZA 2MSDB 1Q3TA 4YMWA 4NL4H 2WWHA 4Q21A 1RRPA 4TMZA 1G5RA 2ZRMA 3GLHB 4G5GA 5LB2A 3BFXA 3NXSA 1P61B 4QC2A 2PT7A 4B73A 1VG1A 3HYTA 1NL3A 3CPJB 5TB5A 3UATA 3R20A 2W2TA 3T15A 1MO3A 4IEIA 4RD2A 1YKSA 3K0AA 3CX7A 3KFXA 1P73A 3AVPA 2A5GA 1KOFA 1LFDB 4D4KA 2WJJA 1E0AA 4TT3A 1NVVQ 5FTKA 1XFAA 1HTWA 1G8GA 4MH0R 3TR0A 2V6JA 1HURA 1F6BA 1A2BA 4MUAA 5HKKD 1D2MA 1G21E 3A1VA 3BIFA 1IAQA 4B43A 2VSXA 2EWVA 4TSFD 2JLYA 3U44B 4UNNA 3FYHA 3RRYA 2OBNA 1SXJB 1OXVA 3L0OA 2XNSA 2HCBA 3WNDA 4Z1MD 4GSYA 3ZQJA 3HJNA 3SYKA 3U2QA 1DELA 4B2PA 4B75A 3AVTA 3BE4A 3RNLA 5AJXA 5L3SB 1M2OB 1J90A 4RD6A 1CR0A 2H92A 2RHMA 2VHUA 3BB3A 2LKDA 3VR6A 3DM9B 2DHRA 2XTNA 3VX4A 2ZEJA 4DT1A
chains in the Genus database with same CATH superfamily
4M53A 3C3MA 2FE1A 3OAAA 1OD6A 4YMHA 5C7IO 3MJDA 4OHFA 2X3UA 1V6SA 4ZO7A 2OM2A 3Q2OA 2D1RA 4JSTA 4OFZA 5HBGA 3SEQA 4AB1A 4E5NA 1M76A 1I4WA 3I2IA 1KZYC 3NTOA 4MWEA 3X2FA 3ANTA 2B82A 2PSFA 3H97A 3O21A 3ETCA 3FHOA 2WF8A 4KLAA 2NU8A 3WMWA 4CLRA 2GPWA 3THWA 3EGDA 1I3MA 4BLPA 5FT9A 2HRQA 3ZCVA 3CN7A 2HCTA 1QS0A 3DDSA 2VJPA 4CMEC 1GVHA 1BS9A 2NO0A 4Q1CA 3G0GA 3LYUA 2CXQA 3OU6A 3PGMA 2B94A 1S3GA 3DL0A 5EWLA 5C8YA 5TVGA 1BMQA 3QUAA 1U04A 3PXBA 3BXXA 4EF6A 3X1KA 1XU7A 2ZYGA 2D5BA 121PA 3PD0A 3S29A 3QF7A 2XAAA 1WEKA 2XNCA 4PIMA 1RJ9A 5FBRB 1APBA 3I5YA 3FGNA 1V47A 1MLDA 2H4ZA 4LHEA 4MGEA 2WAXA 1N5OX 1ZM2A 3EVAA 3KK0A 4JLWA 3O2JA 2PBFA 3OKCA 2O19A 3SQDA 1CS0B 3M89A 4MR9B 3VTZA 1CJBA 4YJ2B 4ATNA 3W5CA 3D6JA 1QLHA 3PPXA 3BF8A 1A3CA 3T38A 4EVIA 2KS6A 2GZHA 2R00A 1CYDA 2VQEB 5FF9A 4I8IA 3CJRA 1LWNA 2JG3A 1V11B 1V3QE 4QE3A 1M6HA 2HWXA 3E9QA 4JQZA 3UMVA 1HQCA 4D80A 1Q3KA 4K86A 2NO1A 3ZVKA 1CYEA 1B6SA 2Q6TA 2W2KB 1T1EA 1YC5A 5TPWB 3EEIA 2Q5FA 3EHDA 1RQ7A 1WDLA 1T29A 5CCXA 3N76A 2GEBA 2FF5A 2XWBF 3KSDO 4B8YA 1OTYA 4RA9A 3P2IA 5EMLA 2J8ZA 3ND8A 1CNFA 1XTVA 4LDPA 2GCEA 1DFGA 2ZIGA 4D92A 1SRQA 1QKKA 2EBUA 4TVBA 1LK7A 1NXVA 5EGSA 2GBGA 1UEJA 4GHWA 3P9PA 4CCAA 4TKUA 1JLKA 4PN7A 4CEHB 1Q1EA 1GSHA 3AEZA 1UMDA 4BHTA 1ZNXA 1YZNA 3N28A 5ES3A 1C2YA 3HZRA 2Q2WA 4H6WA 4HR7A 2P1RA 1AM4D 1EFPA 1SFRA 1WVIA 2FWIA 3C8DA 2SECE 4JP2A 4RULA 4IHKA 1XZCA 2FSHA 4GPBA 4TLMB 1E9VA 4C9BA 3C3JA 3CH4B 3PF8A 5CDSA 3P0FA 4S1OA 3WLTA 3QE0A 1SBZA 2G0TA 1EMDA 2XMZA 3D8SA 3QXJA 1Z25A 3W8FA 2QG4A 3MVEA 4ZRNA 4YMLA 2QI9C 3I52A 3KTAB 4HY3A 4LJ6A 2JFWA 2PSEA 1WVMA 4GLBA 1I51A 1XTQA 1DHTA 4PPNA 3DZJA 1JH9A 3HI6A 2C31A 3TAXA 1VRCA 1Y5LA 1Q6YA 3HPRA 3P9ZA 4KTVE 2Z1NA 1D4ZA 1EFUA 5KKNB 4XRGA 4NOMA 1BWSA 1Z6XA 2BE7A 2O2ZA 3GFBA 4MEJA 1QH1A 4O3MA 1V16A 2VEDA 2KPOA 1H6AA 4JI7B 3AL0C 4PXSA 1BXZA 5F52A 3W1EA 3JXEA 3HLKA 1CUHA 3DT6A 3FUCA 3W2EA 4WKGA 2G25A 2KX7A 4UEOA 1XEAA 3ZNQA 3G2PA 4BLWA 5K01A 4XX0A 2A9PA 1IPFA 1PTJA 3NB0A 4EGFA 4TVSA 3OPXA 2HEIA 3U3JA 4BJ3A 4XGNA 1QDLB 2ODEA 4L9AA 5JD3A 1YMVA 1B8UA 3BD9A 3QWHA 3Q9UA 4UU7A 1Q0RA 4D82A 3GGOA 3BT7A 4JP8A 2C95A 2DGDA 3BE8A 1AS0A 4BX9A 2ODWA 2VH1A 1U3UA 2WDPA 3NRBA 4QYTA 1PBTA 2C42A 3HKEA 4HYEA 5K2MA 4ARUA 5LBIA 3PFGA 2YV5A 3MGCA 1P1RA 1SZCA 2FRXA 3M4JA 2NUAA 2I71A 1VJ0A 2ZIUB 3ZD9A 3TLEA 4H0NA 4AJ1A 1NVKA 4LQ4A 4BAUA 1Z15A 3ZWAA 2Z98A 1KAHA 1W4BA 5ALTA 3ESYA 1JLMA 3MT7A 1TNDA 3I9KA 5TMPA 1X13A 4ND6A 1L6RA 1RLMA 5TS2A 4AUKA 4CMEA 5C7OO 1IXYA 5AVSA 3JQ8A 3GFGA 5A3JA 3PQ5A 1C4KA 4ZYXA 3GWGA 4NU8X 2FPIA 2HCFA 1E4VA 1DG3A 2BGJA 3BC1A 2QRVB 5ANRB 4TL6A 4ETIA 1EK2A 2G88A 2QMHA 1B42A 3KKZA 3VC1A 1DO2A 4YV2A 4YJ2A 1IM2A 4NOLA 3NKFA 2PZLA 3LRXA 4YO7A 3RSZA 4YPFA 5KYVA 3TL2A 3RYHA 5AKZA 5LYJA 3AF3A 1ATIA 1VPLA 3BDAA 3ID6C 3LY7A 4LJ8A 3T9CA 3T1NA 1RCFA 4C0XA 1EFVA 3HP7A 1Q95A 3F5MA 3F5FA 5EJ4A 2OZKA 4CIXA 5CG2A 2YUTA 4MVJH 4QHYA 1RLJA 1BTOA 3EODA 4BMVA 2AXPA 4PXAA 3TQQA 2XTJA 3NHRA 3SU8A 1L1RA 3HCRA 5D6OA 3ED5A 4XAQA 1V37A 1E96A 1JA1A 4S24A 2Q50A 4BZXA 1O96B 2CLEB 2XMCA 4AQ7A 4KLRA 4QU5A 2V54A 4FFDA 2GRAA 2EL9A 1GDHA 1PJ2A 4ZO6A 4JB0A 4FLFA 4W9NC 1BZYA 1EGVB 4N7RA 4TKLA 4HGQA 5KHOC 2BMVA 2B2CA 1ISMA 4DLZA 4LPKA 1GARA 2EW1A 2JJMA 5AW8A 2F3QA 1OU4A 4AUEA 3FNQA 3LU1A 3LX4A 1LV8A 3E5HA 3FOFC 1E59A 3CMCO 4G26A 2A1IA 4W8OA 5DNAA 1B15A 4WHMA 2D8AA 3WBFA 1T2NA 4ZCRA 1OW3B 3V33A 1EGMB 1TFRA 2J5XA 4U3JB 3L1VA 3L49A 1ISGA 3AVVA 3V1UA 3EDRA 2PUHA 3FPFA 1A9OA 5CW1A 4LV6A 1DAMA 1D03A 1CD5A 2QRZA 1ZAYA 1DX6A 4U7DA 2AG6A 4DIUA 5FX2A 4FSHA 1PR2A 1R2QA 2QN8A 1ECBA 3ITEA 2XF8A 4FOPA 2ZB2A 3EIWA 2JGRA 4L4YA 4MVJP 5ALSA 1Q12A 2W6PA 3IQXA 2PQ0A 3O7MA 1UXJA 5F51A 3COJA 3MOIA 3P0RA 1QZXA 4ZCMA 4OD0A 2FLKA 1P5RA 4GKVA 4LMPA 3S40A 4DC1A 2ZE6A 3FOAA 1WHSB 3LGAA 3NBYC 3GVXA 5EIAA 1XHLA 4EY6A 4TWRA 4UHKA 1RWXA 2DTEA 2QTNA 4OQQA 3GP3A 4N76A 1PR6A 1OYOA 1RADA 4W7IA 4FJ2A 1G6OA 1K06A 4H17A 3O26A 3FD8A 1T2UA 4L08A 4RV4A 4WAUA 5J2UB 3VC3A 4ENUA 3FHTA 1BFDA 2A2ZA 1N2HA 1T4CA 3HVHA 1VBFA 3PNQA 6YASA 4IHJB 4MQ5A 1TQ6A 1L1EA 2ACKA 2NP7A 3U4CA 4AX8A 2R68A 3Q5DA 4QU0A 1F2UA 2Y76A 1CU1A 2C5HA 4NC9A 3UAVA 1J0CA 4JYZA 5A2GA 3CT4A 1PNQA 1TA9A 1I2AA 3AONB 1NQ5A 3PTZA 3QEKA 4G8BA 4EI7A 2CVQA 3K2BA 3O4GA 5KB3A 1ZD4A 1HY3A 4RM3A 4DRXB 3HMQA 2BFDA 3RVSA 3A37A 2MINA 3AKCA 4LN1A 4P80A 5TPZD 2B78A 4PGGA 3AB8A 4EW1A 4HNHA 2WTBA 1OI7A 1KI9A 1N6RA 2M6SA 3IHWA 1TIPA 1FRVA 5E6SA 4WOBA 5FOSA 2FX2A 4FHZA 4MQ6A 4D26A 3BOSA 4AJEA 2QAIA 2PRIA 3DR3A 4OKIA 5CFOA 4W1SA 4L51A 3A11A 4EM6A 1TMOA 2R4TA 4PZZA 2GQ0A 2JD1A 1Z5UA 2ZR8A 4XPZA 3CRRA 3G02A 2OCPA 3EW7A 4Q4JA 4YREA 1OH5A 1HOXA 2R25B 1Z0DA 2TSYB 4MRNA 5EN4A 5ALZA 3PX7A 2P0EA 5AIBA 5AUQA 1YTUA 5F2OA 1E6MA 5DBHX 3HXOA 2VQDA 2QSYA 4KIGA 3RLFA 2GZ3A 2GD6A 4L50A 3KAPA 3G2QA 1ZVQA 4D8VA 4ESEA 4C2BA 3O75A 2AVDA 2ASVA 3DTVB 3E8XA 3JV7A 1FL9A 2C8VA 1FP4A 2VYCA 4FMPA 4J49A 2E5LB 4C20A 1QQ5A 4RTNA 1FFHA 1SIOA 1NPDA 1TJPB 5CT4A 1VCMA 2JZCA 2VDPB 3K31A 5CAEB 2J85A 1P9OA 3BFPA 4TUYB 3Q0IA 1WJGA 2WWWA 1QPZA 2RHWA 4U7HA 1F60A 5HE8A 2XA1A 5BYKA 4IDDA 4YAWA 1ZIPA 2G36A 1EVIA 1OXXK 1V95A 1JXAA 2Z2XA 1H0KA 2ZIZA 2E48A 4JBYA 1G3UA 3F1KA 2HK6A 3TSOA 4AKIA 3AEQA 4IHAA 3RUPA 1XMJA 4AKHA 1E0SA 4CR7A 4CDNA 2ZXUA 1KAMA 3FHLA 4PAWA 3WSVA 2FWRA 4S2UA 3KB8A 3TXXA 3W8DA 1Q20A 3ZHRA 2AQIA 3AHHA 3NH6A 3I72A 3TX6A 1J42A 4RGVA 5HP4A 5EXXA 4GPTA 3JX9A 5KX5A 2ZUBA 5IDYA 1AZTA 2YR0A 3GK3A 1G19A 3H5LA 5EIHA 1RNLA 1FP2A 2VKQA 5B7NA 3UHFA 3UMFA 1AZLA 1T5LA 3W7BA 5L3ZA 3ORYA 1J8QA 2WJ3A 3I9OA 3Q9SA 2O48X 4R2WA 3S6JA 5C8XA 4OA5A 2ODNA 1M2JA 1JHMA 1WX1A 3T7JA 5BUCA 1KBZA 1UZMA 1YVDA 3EUAA 3K0CA 2CDAA 4PYQA 2GBCA 3GLFE 1T8SA 1ZUIA 4CFSA 3JQEA 5CR9A 2QOEA 5H81A 5U4XA 5P8WA 2G04A 3DE7X 3QK7A 4QXAA 3K5IA 1JHPA 3HVIA 4A4DA 2VT6A 4BFVA 2BM1A 1W0CA 2GPAA 3AOGA 1NJFA 3I6YA 3PRJA 2BMAA 2W2PA 2B4AA 4BECA 4OAPA 2W6IA 3ASYA 2VDUE 2XKAA 4RDHA 3U9LA 5JVDA 2GD1O 5EPOA 3RKSA 2TS1A 2C2XA 2IUYA 5K3EA 5KOIA 3DAHA 1U8YA 4KQ1A 3MTAA 4WD3A 4X1IB 2CWDA 2PRKA 5KVAA 4U7WA 5HOEA 2EF0A 2Y2VA 3L43A 1F8GA 3GGSA 4WN9B 4V0QA 4XQEA 4PN3A 4O2LA 4Y1EA 3VV3A 2BMDA 1BCSB 3COYA 3PEVA 3QMVA 4J7AA 1G8HA 4LMAA 4M0MA 2P6OA 3TEJA 5B37A 3FNEA 2JFYA 1TW2A 4JBLA 3ZY3A 1GUFA 4F93B 2H1VA 4MKXA 4R8SA 1H5QA 4OOEA 1LDGA 1BHQ1 2CUTA 2K7ZA 4GGPA 2RAPA 2YZ2A 3ESAA 3QF4A 1C3LA 1IRIA 2QTRA 1HL3A 5FWNA 3TTXA 1XNHA 1FDIA 4F8EA 3IQFA 4DDVA 1X7YA 2V58A 3BRSA 4I4TB 3GROA 2NV6A 3FZQA 2B35A 3R6WA 5L7TA 1U9YA 3BWCA 4J3FA 1NONA 3CHYA 3OG9A 4CT0A 1RAAA 2CFIA 3BMNB 5JDCC 2F7SA 3OMLA 2JFGA 3UQZA 1J09A 3C85A 4WACA 3TPFA 5EMHA 3NVMB 2DAPA 3GMDA 1C2TA 1YS1X 1CRLA 1DC4A 4C7KA 2RHLA 3HCBA 1OCEA 4NOJA 4KN6A 2X4GA 4QGBA 1WP9A 1S9DA 1NVXQ 2IIQA 2QVLA 3GIWA 4RSMA 1GYPA 2IDZA 4TS9A 3E23A 3NLLA 2PA3A 1C9JA 4RTPA 3EEFA 3SCZA 3DEKA 3J80A 3R3HA 4CQMB 1YJ5A 3DMDA 2HJVA 3I09A 2H4WA 2IDKA 3T9DA 2CC2A 1NVTA 2EFYA 2PO7A 4X24A 4PNZA 4UPEA 3OOHA 5E1DA 1L7EA 3TOSA 2QN7A 3WGZA 5IT4A 1Q83A 3DVLA 1F0NA 1DC8A 1NVMB 3GLGB 4WZBA 3IT0A 1GPBA 4YMUA 4D3YA 5K20A 2ENWA 1DARA 1U2QA 1XZ8A 1YQ9A 3GP5A 4LBYA 1SBYA 1CVLA 4RADA 1Q3HA 3SLGA 4FGKA 5DX0A 3RYFB 2VPYA 3L82B 4G84A 4G0PA 4B32A 2QBYA 2Z57A 4NYJQ 2ZR9A 3ZE0B 3QE3A 1BX0A 1RU3A 4PV7A 3F98A 5AI8A 1IUKA 4PX9A 4G37A 2V8OA 3W9UA 3KZXA 2Z56A 2QTHA 1QO7A 4UUBA 5EIFA 2UZ1A 3PUWA 4UARA 3SS7X 4NPHA 3SKXA 1VPWA 1VSUA 2I1LA 1AQJA 1O5IA 1CDOA 2JDIA 2ZBRA 4HTFA 1B7GO 4G0MA 2H5LA 2CLOB 1JKIA 3A1NA 5JYCA 1XPJA 1H93A 2JHPA 1RRVA 1WF6A 2FUEA 2GXQA 4OU4A 4DMLA 4JLAA 4RY2A 1XI2A 1Y7LA 2VHCA 2VPTA 4IR7A 1IHYA 3IPAA 2BDUA 2OENG 3MYRA 4LV8B 4Y30A 3LWDA 2P9FA 4LC0A 4LS3A 3BB4A 4YDHB 5C9ZA 2X3YA 5A62A 5BPFA 1QIHA 2AJDA 3OIGA 1NNI1 4FXPA 2IUEA 2FWJA 2JRLA 2IZZA 2W0MA 4F38A 4BKMA 1LF5A 1PJ3A 2G09A 3TL6A 5IXJA 5IM5A 4ENWA 1H1LB 5EIXA 4BXOB 4FQ7A 2OXRA 3VR5D 5HWSA 3RVQA 3QU4A 5AVYA 1MRNA 1MGOA 3IV6A 5BUZA 5KEIA 1VXRA 5T4BA 4R9NA 1A7JA 4LGCA 1AHHA 5LYYA 4L5BA 5DX8A 1YJQA 4ND1A 4H7JA 5EJ9A 3R9XB 1NHGA 4HH3C 4LXGA 4QHSA 5LFAA 2EFEB 3WL8A 3LQ1A 3HO8A 3OC0A 4KIUA 1C9KA 3CEPB 3TW0A 3CZ5A 4OIFA 5IS2A 1YBVA 4A6PA 1RI1A 3A1UA 4BMNA 1ZAKA 1EGAA 3OZIA 3RRZA 3PDIB 4EKIA 2AFHA 3T9BA 5GADl 4WIAA 3U9SA 4PQGA 3H9QA 1GUYA 4CYMA 3IQEA 2X77A 2SKEA 5SYMA 5CBKA 3M7IA 4TKVB 2ZSEA 4M0KA 3KAKA 4PLYA 4PHFA 2G5CA 2IXTA 4I9UA 4Z7NB 1W5SA 2QYSA 4AWAA 1HLDA 5EJ5A 4KR2A 1CUWA 3TR5A 3R6DA 3W2FA 1T8UA 1XZAA 5E6UA 5JS6A 1Y3DE 1XYVA 1GY8A 2QRGA 1QVRA 3CB2A 3O4VA 3ZX4A 4YHHB 4G89A 4ND5A 3JALB 2POQX 2PT5A 4CQLB 3T0IA 2QTWB 2YIDA 3HDGA 3L77A 3H7AA 4ALMA 4B7ZA 3W2IA 3FA2A 3OZRA 1MC4A 2J6BA 4MSUA 5ICFA 2XOKA 5A5EA 4E2ZA 1LA2A 2FN3A 2NZVG 2UZIR 3KP1A 4P58A 3K2QA 1PBNA 2VYNA 1W4RA 3BG5A 3NW9A 4TRNA 4C88A 3FWKA 1RBZA 2CMHA 2DM6A 4HG2A 4NMWA 5JAPA 4O2AB 4HYYA 4EB6B 1V1MA 1P6UA 3IP9A 1SA0A 4U7PB 4X6XA 5K8IA 4A26A 5CLFA 3UJHA 2GYUA 1I4DD 1ESZA 4MVJG 3ZZ1A 2NADA 4D4MA 4EG5A 1DAFA 2A1UA 1AE1A 1NFQA 4WH0A 3QKUA 1CUBA 1GQ2A 2IKQA 3AC0A 4NRDA 1QP8A 3L8HA 4XGIA 4ZEMA 2JPDA 2P4UA 3E58A 5TEVA 3F73A 1GLNA 2MT9A 5DTEA 2PE5A 3R6GA 4TTPA 5JDCA 1XRNA 4HWPA 4YP0A 2JGDB 5E3HA 5AJHA 4LSZA 3C3WA 1YQXA 3PEFA 5CNJA 4YQEA 4BZZA 2P2CA 2H7CA 2W4QA 2RJOA 3ZU6A 2XCTB 2WJYA 3BHJA 3KEQA 4Q12A 1DKMA 1BA3A 4RPJA 1M5RA 2JFOA 4E5SA 3LLCA 4JVSB 8OHMA 5AKEA 3RIHA 1Q17A 5HRUA 4X41A 3IT3A 1X19A 2GN4A 5IZ4A 2GPSA 2E21A 4IKEA 2IQIA 3KQQA 1I0IA 2WSBA 4PAOA 4AJHA 3LKVA 1MT0A 2DUUA 4TXJA 1UBCA 5EAIA 4D97A 1JKFA 1ZJ5A 2CHVA 4Q3BA 2IBTA 4EAQA 2Q4EA 3DM5A 3G23A 2I34A 5EWJA 2FZ5A 5DZSA 4DSTA 3UBTA 2VA8A 1MFPA 1PI3A 3IA7A 4L02A 3T9AA 3TTYA 4ZTUB 1SQ0A 4P36A 3G2NA 3BCHA 2Q1UA 3SJCA 4LMRA 4ZGWA 3CJQA 3G9XA 2ZBQA 3INRA 4GX0A 3U3RA 4UUMA 3N07A 4A6XA 4D0NA 1GADO 2JKZA 5KWIA 2XVAA 4KWEA 4L0QA 3UH1A 3L8FA 3U1TA 2RSLA 1HNNA 1XLWA 3D7LA 3OZEA 3UTDA 1LBEA 3M6AA 3U48A 3G17A 3ANLA 1ZRMA 3ADPA 4IIEA 1K1EA 2JJYA 3MS2A 4RHEA 2GBLA 2Y4NA 4Q9HA 1ONOA 5A0VA 1PLKA 4CPDA 2CHEA 1TKAA 4WXPA 3GHHA 1NZDA 1AGRA 5AHOA 1RC1A 3KALA 3LVBA 3GLUA 5L4LA 3SIWA 3W9BA 5JECA 2QAJA 3WS7A 1Z4LA 3K9WA 1UMBB 3NATA 1KI4A 4INZA 1M2NA 4CKWA 2ZYRA 5LVAA 2KWIA 4NDZA 2RIRA 4RV9A 1G18A 5JAHA 3OJEA 4M8LA 3WQHA 5D01A 1ZA2A 1ECLA 2VDNB 3T5PA 3OIFA 1N1DA 4UZFA 3FMFA 3SJZA 1SUEA 3WK5A 1GXSA 3M9LA 4Y6QA 3TRJA 1K8ZB 4H7EA 4AC9A 4YLGA 3AERB 3U7FB 3O9ZA 4LHWA 3CUUA 3ER6A 3LUPA 2H2AA 1V7PC 4XQ9A 1N6PA 2ZWAA 3ZE9A 1RWBA 1UBJS 2HSEA 1OFTA 4O8CA 5GONA 1ID8A 4ONEA 2Q2NA 3THOA 1VL5A 2IXGA 3V3TA 3DO5A 3IT1A 1ZN8A 3SHWA 1UFVA 4MVCA 1DAHA 5G53C 3K9GA 2GESA 4MB6A 2NU9A 5KQSA 1IVSA 3MCTA 3MLEA 3OM1A 1G20A 2NYRA 5PGMA 4L95C 3FAZA 1YDFA 2BDEA 1NATA 4MHSA 5A7GA 4G3XA 5IN5A 4H18A 4RS3A 1A27A 5I6DA 4P38A 2CDRA 1DBSA 4UEKA 1ND5A 2DX7A 2GYWA 4BP1A 3L4KA 4B3FX 3IUMA 1SK8A 2PGIA 2WPDD 5EESA 3E3MA 1ECJA 3VH2A 2YRXA 2JJ1D 4B6QA 5A02A 5KWJA 1XC7A 3BZWA 3F49S 4BKOA 1P9NA 2C7PA 1FTSA 2GUGA 2IYYA 2YL2A 3IAXA 3WL3A 4C03A 1D9ZA 3MMXA 1T6YA 4RZQA 4YP1A 5BW8A 2NO5A 2YHIA 1I7DA 2PJZA 2V9ZA 5CPFA 2BHNA 3AU9A 1Y98A 1U1DA 2EYQA 4HO1X 3MFYA 1H8EA 2CLKB 3KJQA 2AJ8A 5LQAA 4L8WB 2IZ6A 4RH1A 1NBMA 4E12A 4CL2A 3B1YA 3CUWA 3ESDA 4Q4DA 5IJAA 1OLOA 1II8A 2I8AA 3SZUA 1L8LA 1TM2A 1YTLA 4JC5A 3W5SA 4D44A 2CXPA 3LYLA 1QHNA 2B61A 3AF1A 1UADA 2VWQA 5HZGA 3R5SA 1N2BA 2G1AA 4KYUA 5EI5A 5FFNA 1OHHD 1OYWA 2GEFA 3TBHA 3W1VA 2Y0PA 4CLDA 3V9AA 3DTVD 1KERA 3AR3A 2VL7A 3MG9A 1OREA 2D3TA 3Q7IA 1KMNA 4NABA 3KOXA 3GEEA 1CIJA 1F8XA 2BGNA 3O8QB 1KEEA 4JI0B 4M55A 1GWNA 2X19A 5FL3A 4FN5A 4NTZA 1Z2AA 3HSKA 1QHHB 1MHPA 2H5JA 4C7JA 4E13A 1E2LA 3RVDA 2PTHA 4OMCA 2YJGA 4S1WA 1P33A 2FRDA 2R86A 3VUFA 4CBVA 2E3JA 2HHHB 5K3FB 4DZRA 4MV6A 4P0PB 1RFGE 4ZA2A 1W30A 2AW5A 5CD9A 3WISA 4TXLA 1DQNA 3ZWPA 2OD2A 3N2KA 3R9KA 3CKYA 1PUJA 1CQIB 2IF0A 5KCZA 3PSAA 2CNBA 4RANA 4C3ZA 3GGJA 1U81A 3R40A 4BFXA 1P74A 2PUTA 2C5LA 3H83A 1JIKA 2E0IA 2GAAA 3PL1A 5DP1A 2VJMA 2B5WA 3TTSA 4UU8A 1NQVA 1X8KA 4ZMRA 4L22A 1ZZEA 1WE2A 3S7TA 1FYWA 2UZ0A 4RELA 1S4QA 1YA6A 3H5IA 2GNAA 1QU3A 1D2EA 5BXQC 3T1TA 5BSRA 1P0FA 1P44A 2PL3A 2RAUA 1QTQA 1S89A 2GBPA 2ROQA 2HBYA 3D2AA 3RBVA 2CHQA 4Q03A 2M6KA 2QPOA 2R8BA 1JE0A 3PSHA 2CDBA 4PX5A 4K03A 2YBDA 4KUEA 4ZI7F 4PRZA 1SQ6A 4QFDA 4B3HA 4Q0MA 3ZCXA 3GA0A 4ZDKA 2PPVA 5GVRA 3VAYA 1JEQB 3Q2IA 5FA8A 3IB3A 3UTCA 4CF4A 2J0VA 2LBPA 1JDJA 1IZYA 1FSZA 1V8ZA 2QM7A 3PFNA 3NKVA 4FBGA 4X0EA 5EINA 5BR7A 3JRWA 3OE7A 4B33A 4KMMA 2IH5A 2G9UA 4JCOA 3PUHA 5FV7A 4I0WB 2FPGB 4PZ9A 5MN4A 4DA6A 1FDTA 1ZOIA 3FMVA 2OL4A 4GLOA 3GUVA 2VWHA 2CCKA 5AICA 5CA1A 1UPTA 3ENKA 3VTKA 4L8YA 1TU4A 2V98A 4HLUA 4BVBA 1J06A 3GEHA 2FR0A 3HN7A 5BYJA 4B44A 5IDWA 1M74A 2C1ZA 2V4UA 2XE7A 4MUFA 2WHPA 3RUHA 1E8MA 3BJRA 3L8EA 4BMOB 2IV7A 2WZBA 4AP5A 2IXDA 1Z4IA 3KKOA 3OUUA 1L7AA 1NMYA 2FPKA 2VTBA 1TLLA 3KS9A 1RABA 4TMYA 3D6VA 1E6EA 1MPXA 3PUYA 5JC1A 1UF9A 2NYUA 1AD2A 2F8LA 3F8TA 3RSCA 5AVZA 2HBZA 3PYMA 4HJRA 4E21A 3CFYA 4QBTA 1CS4C 5EY5B 3KM0A 1SU7A 4PPFA 3RROA 1QX4A 2CLCX 2JIQA 2G40A 3ZJ5A 5CBPB 4PEVA 1QCYA 1YAHA 1LPAB 2OHHA 3EUFA 1CLUA 1PFQA 4FGZA 1G8PA 2ZRIA 4X9XA 1FQWA 4YGXB 4EAAA 3KXLA 1A8PA 1ULHA 1KZ1A 3NOQA 1G8SA 4CMGA 2DYKA 4XIYA 4CQMD 7REQA 5KAMA 3A7DA 1TTTA 2ZAMA 1CUAA 5FBKA 5JXJA 3IS3A 1KSHA 1UDXA 2FEKA 1C3VA 4H59A 4EF5A 5M7EA 2QPTA 3T1YB 3KDPA 4L3WA 1P2GA 1TAQA 1E1RA 3KLOA 4QO7A 2ZRLA 3MWDA 4ND4A 3HA5A 3OLVA 5AW3A 2JK1A 4E7OA 2HRDA 1YDHA 3QOWA 2C2OA 2J07A 3EVCA 4K3VA 2B6HA 4QEKA 3K9CA 2PUAA 4HV4A 3OCYA 5IZCA 2ZJAA 2QE7A 3QBEA 4NCKA 1ZLYA 4WZZA 4DV0B 3UWKA 4K6HA 4A36A 3RT1A 2F17A 3V2IA 1JFFA 2RJ3A 5F77A 3LC7O 4PLZA 2R84A 2QLLA 5M3BA 3PICA 2XZOA 2RI0A 1QK3A 2YCLA 4IIDA 3DWIA 2VZ8A 4O4IF 2IPXA 5GVSA 2X1MA 3JQGA 2OC9A 3RSHA 2G63A 3EGXA 4HATA 1Z6PA 4F91B 5GJCA 3JAMA 1ESMA 1HNXB 4WERA 5DLPA 1US8B 2YXDA 5CFNA 1SB9A 1TPYA 5T6MA 4E5KA 2QRPA 2ICAA 2K6GA 1UEXC 5FO1A 5SYAA 1A69A 3BWDD 4FD3A 1EBBA 1N4AA 3O8DA 1ZSNA 4W5HA 1A88A 1EYZA 1I2ZA 3CW9A 2BHLA 4G0VA 3KQMA 3A9TA 3DOCA 3VR0A 3AV3A 2IZ1A 4QYWA 5CIWA 1SKAA 4W4TA 4XWYA 5HF8A 3RWOA 4I55B 5KPDA 3AFMA 3LRTA 4E5PA 2XB6A 3OZXA 5CTJA 5K0NA 4GKBA 4J43A 4YA6A 1U7HA 5BN4B 3ZWXA 1JAYA 1G2IA 5B1IA 4PIPA 3R3ZA 1Y3AA 3LUJA 3IX7A 3TAUA 4QDOA 1WXWA 4MUHA 4NVRA 4E46A 1F8UA 1P77A 2DR3A 1O94D 3SAJA 3UHAA 4AG6A 2WJWA 4G07A 2V0CA 5JATA 2NVBA 2D8MA 2Z08A 2P2DA 4UUOA 4M38A 1MV8A 3BX1A 4P35A 3CNHA 1YDGA 3DHYA 3MCZA 5BYBA 1A0OA 5BQ3A 1J8YF 1FDVA 2MHCA 2V4ZA 4UHBA 4R71A 1N8SA 3PXUA 4JVMA 1ZCAA 5EZYB 4B71A 1X6VA 1GG9A 2CFTA 1HFKA 2R1VA 1Q0TA 1DQZA 1W36C 5SY6A 5HUQA 1R0CA 2ZYTX 4NBKA 1Y8CA 3H8SA 4KR7A 2GJAA 4Y1RB 4FZ3A 1R4NA 2P4EA 1DMSA 3EZFA 5BWMA 2O5RA 1EEXB 2VRCA 2B0CA 2H52A 2VAWA 2F62A 1CXZA 4MV7A 5CB4A 3FPHA 3Q3GE 3S2ZA 3DHNA 3P2JA 3ROKA 1ZP6A 3ROGA 4C2UA 4JUCA 1BKDR 1OLSB 3PUIA 4FFBA 3HBLA 4KOAA 4FSXA 3EXFB 4ZZ0A 1UDCA 1DRUA 2FQXA 1GA4A 4OYYA 2Y8EA 4WY5A 3Q72A 4ZVLA 1J2UA 2F1JA 3V32A 2ZJOA 4Y2QA 4Y2HA 1I4OA 2PD3A 2WC1A 3V7WA 1X1RA 5H68A 3TMAA 1RPTA 2PS0A 1QH9A 1BCRA 2JGJA 3ILVA 1T5IA 2CLSA 2PTGA 2XUZA 1YI8A 1JP7A 2G80A 1C8LA 2WIAA 3PWZA 1V3VA 4MJLA 4JKYA 1FA9A 3CR3C 2AFHE 4JR1A 2ZRFA 4EPXA 3D8RA 3FN4A 2P91A 3SC6A 1X7DA 2OK8A 4LWZA 1ID1A 1YKFA 2XYRA 2LUOA 1Q0PA 3CEAA 5KVQA 1PDOA 3GNSA 1Y3FE 4R84A 3WIBA 4EA6A 1OB2A 5AFSA 1JKMA 3T94A 2HXGA 3O83A 1YZQA 1E2PA 3BYZA 5L6LB 1ZSVA 1Z62A 2DPMA 1IYZA 4OJKA 3OFND 1FSFA 1NUTA 4YVFA 3TW6A 3V2HA 1MAWA 5IMBA 1G7RA 1XAIA 3TEMA 3ZDBA 1KYWA 4E30A 4QG7A 3NT5A 2WKWA 4L5AA 4UMDA 4A9AA 3NEYA 3MUNA 4RTRA 1XNRB 3U5ZB 2H1OA 1ZITA 2VDMB 3NKLA 1HLGA 1WQ3A 3QEOA 2Q4RA 1RRCA 4PPYA 3HKCA 2O8BB 4WKOA 2QLBA 1L1QA 4MCIA 2BH2A 4E1VA 2Q1WA 4G56A 5GM1A 2VTVA 3CX6A 3P9QA 4PANA 4WINA 4D43A 2QP4A 2OBFA 4DUPA 5ALMA 2Z9BA 3NBKA 1DXOA 2H85A 1H42A 4K28A 1RJGA 1DJQA 3AUFA 4V0RA 3FW1A 1UFOA 3HY6A 1LNZA 2TMYA 3CUVA 4LOLA 1TYAE 1Z83A 3ERCA 5DHFA 4NXNB 1R66A 1SVSA 1V48A 4TLAA 3AHFA 3L9WA 4XFJA 4CG2A 3KCQA 3N6VA 1UP6A 4MUNA 2NPIA 4ZDJA 1T91A 1U90A 4KWCA 5JQGB 4N5MA 3EXG2 2BHSA 1H4TA 1RKUA 1YUNA 3LBAA 4GEGA 3TQIA 3CNBA 1C3XA 3EZLA 4RY0A 1ZH4A 1U7DA 4M37A 5FUMA 4KN8A 3BMOB 3NUZA 4DR4B 5CFRA 1NBOA 2PVCA 4EL5A 1RR6A 1QDUA 3KDAA 2VP3A 4TTTS 3KSBC 2C5EA 1TO2E 4Q9LA 4G41A 5IG2A 1MQAA 2FFAA 4KV7A 5J40A 5DI3A 1L0BA 1KIMA 5LMNB 4TTAA 1SXJD 2PK3A 3CURA 3PZRA 1HYBA 1HWYA 4JR2A 4PW0A 4DLAA 3MRTA 2I6UA 1A9QA 2CNDA 3C0KA 4HXYA 3T0GA 5CRIA 4ZCIA 1RLIA 1K75A 2W98A 1O2DA 1A5AB 1Y4SA 1S1CA 3EUEA 4LIPD 2FEPA 3Q8KA 4DS3A 1XQYA 4L73A 4DJJA 5KDLA 2B3DA 1Z2PX 2V7PA 5EZ5A 4HH4A 2H06A 5EJFA 1RAHA 5FUYA 1U9CA 3QJ5A 1DIOB 3SJ7A 4BFLA 5A5DA 4LF6B 2ECPA 3I9LA 2ZI3A 3RYTC 4EJ0A 4UBKA 5BQ5A 4LVCA 3LT4A 1MX3A 3PQ4A 1O5TA 2UZ4A 5AVQA 4N5IX 4RTMA 2D1FA 3EFHA 4M8SA 3ZVNA 3QEAZ 2W00A 2OMKA 3G8AA 3VBEA 2C61A 4BE9A 2IKSA 1E3EA 1LKZA 1O03A 2A7XA 1DQRA 2X41A 2QTLA 2B69A 3DP9A 3EMDA 3GVIA 4P4NA 3EFEA 3ROEA 4YYEA 1ZQ1A 3FM9A 4ILEA 3S99A 1KTVA 1URPA 3B2NA 5DTMA 3DBLA 1TZMA 3S5UA 2NO4A 4BVLA 3SFTA 5HK8A 1OE0A 3LUCA 4EW3A 1ZCFA 2ILTA 1ZL0A 4QDTA 1IFXA 1O0SA 1HQYE 2RGYA 4WSOA 2H6EA 3AIMA 3HZOA 3PCRB 1KRHA 5DYIA 5L3QB 3WGUA 4DEXA 4ZCPA 1ADBA 1DTEA 1FVFA 1D3AA 4N41A 4AZ3A 2HRZA 5CTAA 4OHVA 2RMKA 4JYMA 4F2PA 3V8BA 4MV8A 1MEJA 1S2GA 5IX8A 3PGXA 5LJIA 2FKNA 5DW0A 2PZAA 1F2DA 1JU4A 4U6QA 1H2WA 3AO0B 1U7ZA 2B21A 5KWSA 2FPRA 3ZDDA 2N3ZA 2JGIA 3A0RB 1JBEA 3PGLA 1QF6A 5DX1A 2QQ5A 4HX9A 2DKNA 3WQQA 4J7UA 4NBLA 4BB6A 3VDMA 4C0LA 1BE1A 5ALPA 5JSFA 2PV7A 5AXBA 3GJ8A 3ZWQA 4AZWA 4LFBB 3G9ZA 3HJGA 1ZRNA 2COEA 5JNWA 2VIIA 2VBGA 1G20E 4J0DA 3DFZA 3MRSA 2QL6A 3GCZA 3NIFB 1XTIA 2VBCA 2JIRA 3O4HA 2ZE8A 2X0RA 3D6MA 1Y8QA 2Q62A 3L8DA 4MI3A 4ZEWA 2YHSA 1UKYA 2O0LA 2ZIFA 4EYGA 4LPSA 1RI5A 3LC2O 2RCYA 1L7RA 1E2HA 2BELA 3GELA 4U9IS 1IY9A 5I9LA 1XRLA 5MFZA 3CX8A 1ENZA 2C04A 1I13A 5CT8A 4Q4AA 4RNDB 1HK7A 4X66B 1W7AA 4KQJA 3KPUA 2JA2A 4FR0A 3AF4A 2PT9A 2HR1A 3E4CA 3HSSA 3LDUA 3PGVA 5EKXA 3FCUB 4DE5A 1PE0A 4O63O 4OBWA 5G4KA 5ICCA 5LZ2A 2R5NA 2G1UA 2JLBA 2RI1A 5GOZA 2R66A 5LXTB 4L0MA 3SJAA 1CF4A 5ULLA 5EP4A 4B2LA 5E9QA 1NBME 3PJFA 5L4NA 4Z3OA 3AMVA 1FK8A 1ZNQO 4XGQA 4CNBA 4JGIA 4M83A 1JQLB 4MULA