1VYHA

Paf-ah holoenzyme: lis1/alfa2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
218
Chain Sequence
SNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling Paf Signaling to Dynein Regulation: Structure of Lis1 in Complex with Paf-Acetylhydrolase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB BETA SUBUNIT
total genus 72
structure length 218
sequence length 218
chains with identical sequence B, E, F, I, J, M, N, Q, R
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1vyhA00
4H08A 4S1PA 1BWRA 1J00A 3HP4A 4HF7A 2HSJA 4JJ6A 1VJGA 4TX1A 1IVNA 3MILA 3BZWA 4K7JA 1DEXA 4Q9AA 3DC7A 4JJ4A 4NRDA 4JKOA 3SLRA 4XVHA 1BWQA 3RJTA 5A4AA 1ESDA 4PPYA 1VYHA 2WAOA 3DT6A 4RW0A 4LHSA 2Q0SA 1JRLA 1ZMBA 1Z8HA 1DEOA 1YZFA 1BWPA 3DCIA 2VPTA 3DT8A 2WABA 4DEVA 2WAAA 4HYQA 1FXWF 3C1UA 3SKVA 1U8UA 4RSHA 2W9XA 4IYJA 4OAPA 1V2GA 5CD9A 4K9SA 1PP4A 5B5SA 3DT9A 4OAOA 5BN1A 1K7CA 4I8IA 4JHLA 4Q7QA 3P94A 2O14A 1FXWA 4M8KA 4JGGA 3PT5A 3U37A 3KVNA 5HOEA 2Q0QA 1ESEA 1ESCA 4K40A 1WABA 2APJA 1ES9A 5JD3A 4K3UA 3W7VA
chains in the Genus database with same CATH superfamily
4RYDA 1JSRA 2EX0A 2IL1A 1SXIA 4LI0A 2PMCA 3ABIA 4WIAA 3WICA 5JUWA 3CUSA 1N5DA 1FPMA 1U5BA 4TLDA 3DUWA 3RRXA 2GEFA 1MVOA 4INOA 5CIYA 3CISA 1LDGA 4P3NA 3H2JA 3F74A 1ZGHA 3CKYA 5DX8A 3CRW1 3KZ1E 4J9VA 3ZE6A 4AMVA 2JFWA 4WLOA 1T36A 3QKIA 5JCJD 1B42A 1CZHA 5PGMA 4B71A 5IAJA 1Y7PA 3R9XB 2PRJA 1A5ZA 2ZIEA 4LZAA 1UZUA 2IZOA 1H8HD 1EBFA 1U7XA 1UINA 3C4VA 3O4VA 5A3QA 2Y3IA 2PX0A 3KSDO 4UMFA 3ZDBA 4DM3A 2FQWA 1KH1A 2EYQA 3TNDA 1V3TA 4GW3A 5DHFA 4AQDA 3C6XA 5AK3A 4LRTB 1PSZA 4GOND 4Q48A 2RGGA 2EFJA 2HMVA 3WL3A 1MKYA 1OHHD 3AMVA 4HN4B 1JTEA 3RR2A 3IUPA 3L7NA 4TT3A 3KBBA 3S1AB 1ECLA 4R31A 3W5BA 4AZTA 1XMPA 2DJ5A 3EZ7A 4W6ZA 1SNYA 2Z5VA 4GOLD 1ZHFA 1ENOA 1JLRA 1I1OA 1BFDA 3PNYA 4FGLA 4Q4HB 4DDWA 1R5OA 4BYMA 5M7EA 5C81A 5E2BA 1Y3IA 4E08A 4JC4A 4IJ6A 1RZ3A 2VK2A 3JAWA 4L8GA 4XFKA 4TQGA 1C1XB 3JARB 3DO5A 3JYOA 4Z4CA 3MWJA 2NQ2C 3PJDA 3FUWA 4JBIA 3WYAA 4AY3A 1P17A 5B2FA 5HF9A 5JNSA 2NXWA 5U4XA 3QFCA 3I58A 3AUKA 4LDNA 4I55B 5AKKA 5E0OA 1NDHA 2GPYA 4AXBA 5AW6A 1OH7A 1Y4UA 3TXXA 4XWOA 1FLDA 1NBME 3F9IA 1D1TA 1JU4A 1RBYA 1SXJA 3GJ0A 5J2UF 3DP9A 2QJFA 4LF5B 1GU0A 5DLPA 3OTOB 3AINA 2X8JB 1HDOA 1AKVA 1DAIA 1PJAA 1TQ2A 3A3NA 3FGNA 3N87A 4FYMA 4INZA 4MYUA 1RT9A 2V7UA 4LDAA 1P1BA 5KHAA 4B8ZA 4R0VA 2AVDA 3V8BA 3E3MA 5HM8A 3KL2A 4IHJB 4X6YA 2PX2A 3OPQA 1CZNA 3RKSA 4LF6B 2JD0A 4KWIA 2QMZA 4MR9A 1GVHA 3T5MA 3RTEA 3QVSA 1FFHA 4RSMA 3M6LA 1K3UB 1TQ8A 4GLJA 3V1NA 3ZHYA 2ZU0C 1UBSB 3AUYA 2Q5EA 3NHYA 4GLBA 5DEIA 5JCJA 4CG3A 1FX0B 2ZPUA 1Y6RA 3E0XA 1G59A 5EWLA 4G4JA 4Y2PA 4R83A 5GM2A 2QE7A 3BMQA 4LBVA 4CQMA 4REQA 3ZW9A 1E59A 1YR1A 1ZOSA 5AKZA 3IEIA 1FZTA 4JVMA 4D81A 2D2IA 4GUDA 4Z54A 4JI0B 1NLFA 1UZMA 4YAOA 3R7DA 3ILYA 1IMJA 2KM1A 4RTJA 3O95A 3G8DA 1AVTA 2B1QA 2Q0HA 2REOA 3H83A 3KD3A 4RH3A 3TZEA 2OENG 4DG9A 4JSTA 3A3YA 5BORA 2QVYX 1QCDA 3FRJA 3RC8A 3RYFB 3GRPA 1UZNA 2MINB 4MRNA 2IGTA 4GHWA 3UB4A 1QS0A 1BVHA 1CR6A 1HURA 1T1GA 1WVIA 4MKRA 4NENB 1F14A 2PK3A 2BGTA 1J0DA 1Q0RA 4RDHA 3DXZA 3TPZA 2MWMA 4O4IB 5K0NA 4OCZA 3SQDA 1UBRS 3IX7A 1W4LA 1WW3A 3ZK7A 2ZRNA 1XU4A 2PRZA 2Q5LA 3KO8A 3L6EA 1ZJ4A 3I76A 4B33A 1J5PA 1EHYA 1H2EA 3IEMA 2BR3A 1HR0B 3L1IA 4GOKA 1XEXB 1Y6GA 3KPUA 4CNBA 3JZAA 3DVLA 1E2HA 2CNLA 1L2TA 1YONA 2FRDA 3FCYA 3F97A 3OM8A 3ODPA 4R2IA 5FX2A 2D5IA 1BYUA 4FKBA 2DU8A 3AF4A 2ROQA 3M2PA 3QFTA 4JX9A 1K2WA 1VBMA 5EWMB 4GMKA 3EGCA 4BQQA 2F3UA 2EFDB 4WE3A 5TQ2B 2C2MA 3ZHQA 3WLOA 1DXYA 3HZRA 3OC6A 2EL7A 4MV3A 1DAGA 4FFBA 3SHQA 4KAJA 2D7DA 3KLOA 1JBKA 1Z2OX 3LP5A 1TAGA 5L3RA 4RD6A 2CK3D 1IWOA 3CJQA 3FCOA 3P9YA 4IZIA 4F38A 1M0EA 2DYKA 3STYA 5K3OA 1YIAA 1PZGA 2BFNA 2IKQA 1Z0AA 4IP0A 3TVDA 3WNQA 1J39A 4YCLA 1Q77A 1SC1A 1NW6A 4BNMA 2QXYA 3F7NA 4KN6A 4P6VF 3NOOA 2ODPA 5AVRA 2WJVA 3KUCA 1QH8B 1ILWA 2FX3A 4RW0A 3U3ZA 1NJ5A 4C0LA 4M0EA 4O08A 4Y98A 3NONA 2OCGA 3Q8XB 3L9XA 1X7YB 3KXDA 3H1BA 1L4BA 4R98A 1O8BA 3G5AA 4RLHA 4XASA 3D5TA 5CK5A 1O5TA 1RMTA 1XU9A 1Z4KA 2FAXA 2H48A 2YZ7A 4M46A 4L22A 4NKRA 3DFMA 1Z4JA 1KK2A 2PFKA 1CEXA 2V96A 1TFRA 1VZ2A 2JS7A 2QLMA 3FDFA 2JRCA 3K9GA 1K6MA 1M34B 3M33A 4M9SA 5IK2A 1ZOOA 1YJQA 2WRZA 3AEZA 4X20A 1YQ9A 3GL9A 5JARA 1B6GA 3DZIA 2ZBPA 4PVDA 1GA6A 2GF9A 1OIWA 3EEYA 5C32A 4RD3A 2FRXA 1X87A 4TYNA 3BB4A 3DFFA 1QFXA 1VRVA 4LYAA 4YR9A 2R8RA 1GN9A 1CZUA 4OJTA 3F6PA 4XJTA 1DQRA 3PPXA 3QHPA 3CB2A 4KLAA 3U6BA 2RAPA 4ZEXA 2H2AA 4GC9A 4Q21A 1Z4QA 3RUHA 3WQBA 2WU0A 1VC2A 2BKXA 4EGCB 3AVXA 1CEQA 3E0QA 1TK3A 5A05A 2JIZD 4GOJA 5BMOA 2X0RA 4P7KA 5H3CA 2Q1UA 3QVGA 4F5DA 1ID1A 1MQSA 1XYVA 2H1VA 2KB0A 1VYVA 1MX3A 3F6RA 4Q4AB 1HGXA 5LB4A 1TA0A 5IH7A 1RLMA 2YS6A 3GGGA 5ESRA 4UW9A 5K8TA 2HRZA 2Z2KA 3JZFA 1BE8A 3NAQA 3PGJA 2ANBA 2EW1A 4ES6A 3BD8A 2DHQA 1R8XA 3THSA 4I81A 3AQIA 5TGTA 2EHJA 3AERA 3IO5A 4UC0A 1PWYE 5CEFA 3NJ8A 2I2DA 2PKRA 4B80A 2J4FA 1JLKA 1FVHA 3OQJA 3U7QA 5JV5A 1JQEA 1L7XA 2QZZA 4M1ZA 2IHTA 4ZOCA 1WHSB 4EMTA 2ZRPA 3ADBA 1VKRA 1LV8A 4ZMSA 4AF7A 3AUXA 1YZHA 2OZLB 1HI9A 2V59A 3GEMA 3AV3A 4MPJA 1E96A 2D3WA 4WXPA 4OXYA 1ORIA 5DGIA 2IPMA 5KC8A 1I3NA 2PGLA 4B87A 2VBCA 4QTZA 4DR7B 4J90A 1EFVB 3WLJA 3QJYA 3EN0A 5B7PA 1UEIA 1PI3A 2DFTA 3BDAA 3I52A 1YC5A 5GONB 1CUAA 3HDVA 1ADCA 3MTDA 4Z1MD 4JI1B 1D7OA 3EZ6A 3J7TA 3QKSA 2I4MA 2VDMB 1N2BA 3GFOA 2PSSA 4DWJA 2VYVD 4M60A 5CCDA 5K0BA 1UR5A 3H1PA 1BN7A 2JAUA 4CF5A 4POOA 5LDGA 4EO4A 4H59A 1BHQ1 1DRJA 5AW2A 4CT5A 4JP1A 1DIBA 4C7VA 2C2ZA 1G64A 4HEJA 2FI1A 2ZK7A 4OEHA 3TR0A 1JKJB 2UU9B 2ID9A 3H9GA 2VS1A 1NU6A 1WQ4A 3BXZA 1N78A 1DPGA 2HMTA 3CBQA 4RYLA 3ONWA 3TZQA 1QV9A 5JDCA 2ZWPA 4D56A 4JH0A 4JFAA 4PZCA 3NIFB 2P9BA 5K03A 5I48A 1U9JA 4DV4B 2HKIA 2F90A 1XTZA 2PT9A 5KSOA 2YV2A 4I4IA 3ERCA 3CMCO 4WJKB 3RUEA 4DIEA 2IELA 4P8RA 2FEWB 3OWOA 2QL6A 1RYYA 3VMFA 4QPNA 4HP8A 3AB3A 5EKDA 1Y1LA 4EFMA 3ZOZA 2YWDA 1ORDA 2BHRA 2PMKA 1QDEA 1M2VB 3LO5A 4I4NA 1KOGA 2G7MC 2VPPA 5DO9A 3TTUA 3K70B 5DHSA 2AI2A 1AGNA 1CUHA 2QX7A 3V1MA 3KJNA 1SQFA 2Q62A 3SE0A 1DAPA 2X8JA 4M8LA 1AS0A 3TTYA 4MW6A 2B7LA 3A0RB 3OTGA 2I2FA 3T7IA 4K6GA 1GGKA 4IS2A 3W78A 1NQAO 1DAEA 3ORFA 5HDBB 2W2XA 1IN5A 5KNBA 5AO9A 1XDWA 1TMKA 3D0KA 4D3SA 4KE7A 1B3BA 1NN1A 3LNCA 4EG6A 5LLTA 2R9VA 4WAUA 4ZQBA 3EXAA 1AZLA 4FNAA 2CJWB 3ZDEA 4WNCA 1A9QA 1FS4A 1S4MA 2VUSA 1D7AA 2B7CA 2JLWA 4G1EB 1XALA 5ALNA 4QQ8A 1ZUNB 3ZV6A 1LPBB 1YA8A 2PLFA 4IHKA 4QHYA 1HNWB 2G4LA 4EYKA 2PGDA 3OEYA 4JVLA 2HAEA 2VH2A 4Q6WA 5AKHA 3WRXA 1EE9A 4KMMA 3WGNA 3OZFA 2AL7A 4KVFA 3GFGA 1MF7A 5A1JA 1A7UA 3HJTA 4ZVRA 2AJDA 3TQFA 1IRXA 1T8WA 4O2LA 4YLYA 4S1WA 4MDEA 3LX6A 3OE7D 2IUSA 4R1TA 3L46A 4LVCA 1UBGA 2OMEA 3PTLA 5AXBA 1MXFA 2A67A 3I2IA 1LK0A 2QY6A 4QXMA 1E6KA 4HGNA 4YAUA 1H05A 3A7EA 1H8HA 4UAJA 4FW8A 1SEPA 2D4HA 5AESA 5CNJA 1T8PA 4YUYA 4JLMA 2ZWMA 1OWPA 3X1MA 5JJLA 3CLHA 4HG2A 3B52X 4QJBA 5L3QB 3GW8A 4PINA 2UZ1B 2V7QA 3FGPA 3VZDA 2DAPA 4OYLA 4TKLA 1KJ8A 3GCDA 1DJMA 3NAMA 3O8OA 3G2NA 3C7TA 2XB4A 1GEGA 2Q49A 4TKMA 2FOXA 2ZS7A 3IHKA 3SFVA 2WSSD 2W43A 5CB8A 3AEQB 2IXEA 4YJFA 1XZKA 4FGUA 4BPRA 4CI0B 1N5RA 3GLTA 3I30X 4LWOA 5K0ZA 1VMIA 1K8YB 1I1HA 2AZ4A 3GRVA 3MHPA 4H6WA 1PU2A 3H9EO 4WMLA 4BGUA 4UUQA 2JCBA 2ALJA 3PFWO 2HO5A 5EZYB 4F4UA 1NZDA 4N0QA 5CDSA 5B1EA 3LHDA 1FFDA 1J1ZA 3VYWA 1F2TA 1OD6A 1W94A 3RFTA 1ZD8A 1P72A 3CE6A 3FG9A 3QFRA 4ZQHA 5JCOA 1LW6E 3TOCA 1U0LA 1HDCA 3IUBA 4ZGWA 4K26A 4NSNA 4XWWA 4OO3A 4AFNA 1G38A 3PDUA 2FUG6 5J3JA 2BYTA 5H8WA 1HE3A 1S3GA 1RKBA 2JDIA 3CC8A 3JTMA 3KP1A 4FFBB 4PG6A 2VYND 3A1UA 2C8LA 4ZI2A 2FFRA 5JSUA 1R8QA 5BV7A 2HQBA 3Q1LA 1W5AA 4BDTA 2IE0A 3NO4A 3I8SA 4Q1VA 3S81A 2QAJA 4YRCA 3FXAA 4PC3A 3WMXA 4NFHA 3OAAD 3LBNA 4JEIA 4S24A 1ST3A 1NLMA 4H6XA 4DPKA 2WLTA 4CT4B 3SWWA 5FL7A 1FMLA 1CNEA 2FJUA 2YHIA 2G25A 2N47A 1IL0A 1DCKA 2JGDB 3S2YA 4DBVO 4N7RA 3RH0A 4L5AA 3OP1A 2D0IA 1WBJB 1VYTA 2Z58A 3TRJA 3TXAA 3WB9A 3O74A 1N32B 4B44A 4B48A 3OT1B 3WGIA 1LJLA 2YFKA 3R0QA 1OXMA 3H2SA 5D3KA 1IQRA 3TWOA 5ENVA 2AC2A 1GJRA 4ZGGA 2BY4A 2QG6A 5IT4A 1DRKA 3K0EA 1W25A 1HA3A 1FNMA 2FK7A 1Z2EA 2IHUA 3NOXA 3Q1KA 3RC7A 4QASA 3I9LA 3TCKA 2PUAA 4KQEA 5BW6B 3ETHA 4Z51A 4I4TA 3ZS9A 3NM4A 1XFDA 1Z2CA 2VJLA 4KO2S 1SQSA 1I7LA 2GZDA 4IMJB 3JYPA 1E0AA 2XMGA 1QZZA 2I2BA 2JKYA 1AMOA 3WV5A 2YY6A 2PG3A 2VBGA 5FBLB 5DKFA 1QIEA 4CV3A 1PD1A 2PZJA 1S3IA 1U0BB 1P0MA 1P1IA 2HA7A 1IQPA 3EF3A 3QVGB 1L8AA 4PAGA 2XQGA 4PBSA 4BQFA 2QMQA 3PQ3A 4WBSA 4YMLA 3CJTA 2WZBA 2OQVA 4G5QA 3G2MA 1NIJA 1QV6A 2QW8A 4NK5A 1WMBA 1I0ZA 4G37A 1WF6A 1TIKA 4ZICA 1URPA 3HN2A 3KU1A 3NT4A 3ZPXA 4L6IA 4V1CA 3EX7C 3ZQJA 5EEHA 1BXRA 2I2CA 3QEAZ 3KLPX 1N6HA 1CDDA 1AN9A 1NP7A 1VG9B 3BXGA 3D64A 2CXRA 2J3MA 3P2IA 4QOFA 4WKPA 5AJYA 5DNVA 4BO9A 5JE8A 3KAKA 1K2VN 2QUIA 3NHSA 1K06A 1GRNA 1NZJA 2G9NA 4B8WA 3NYIA 1K7EB 3DMPA 1M1XB 2AJBA 3WTCA 4WK0B 4CMCA 3WIOA 1U11A 1MU0A 2JGJA 2C95A 1AO0A 1OLSA 3HFRA 4DHWA 5T4FA 1ZX1A 1WSDA 2C96A 3UMFA 5BSWA 5FL7D 1OFVA 3B3QA 4QE3A 4DZTA 4N3BA 1O0SA 1JIUA 1K5DA 1V47A 1EHCA 1CJMA 4JJFA 4DVGA 3ISVA 1WOMA 2HDOA 4A0GA 2UVQA 3F3KA 4N3NA 4QOJA 5IC6A 4Z3KA 3D4LA 1RAHA 3OZXA 1OYOA 2GVZC 4R9NA 2CV0A 2H52A 2GM3A 4H7HA 3Q7TA 3C4QA 4MKZA 4RK1A 4U7GA 1KTVA 3MUNA 4ZQCB 3MWGA 5ECGC 3Q3CA 2O52A 3DOHA 4ZTZB 1ICEA 1N2XA 2YZ2A 1KI9A 3LT2A 4N39A 3UCEA 4M0CA 3ADOA 4OHVA 2R8OA 2LNDA 2WAYA 3EQ2A 3IXQA 4UXHA 1YZGA 3U4HA 3ZI4A 1NU8A 1NRWA 3SGLA 4YV2A 5AK0A 3KQVA 5HVNA 2AW3A 4IDQA 1X9GA 3C4JA 2JLVA 2DUJA 1OXVA 2KI5A 3M4NA 2FWNA 1CF2O 3ECAA 4ZAFA 4O1HA 1G3QA 4AMZA 2BT4A 1DAFA 5DHRA 3LFTA 2YN4A 3EFEA 1IHYA 2VFAA 3DZCA 1FSGA 5ADHA 3SE7A 1FIUA 3MK31 1NF9A 2JA2A 4JVOA 2QMUA 3KHKA 4MAMA 4XDGA 2PLWA 1ISJA 1S5PA 3BBPA 1YNOA 1P29A 1WIWA 1XZPA 3T12A 4OYYA 1U6IA 1DZIA 3OO1A 2H18A 4JDPA 4HRYA 5AK4A 4ZV9A 1A4RA 4DQKA 3ACDA 1CUGA 1XF9A 1WDLA 3OZSA 2BH2A 1V8DA 2PIDA 3LCUA 4WCDA 1UK7A 5F2KA 3UOWA 1GNTA 5A62A 1TC1A 3F47A 1FXSA 3M89A 4NS1A 1QIHA 5CB6A 1FNCA 2K6GA 2UKDA 5KYGA 3MVEA 2P4SA 1LX6A 3BDVA 2RBGA 1XHEA 3IVAA 1IBLB 1Q0SA 1CRLA 1NBEA 1WV1A 3DF7A 1AQ6A 4BQRA 1XGKA 1Q57A 2JCSA 1GKKA 2I4IA 3I39X 1KP9A 5F23A 1M0TA 1KMNA 3D54D 2O8DB 3G0BA 3KQKA 1BROA 5IAGA 4D0LB 2JA1A 4IDEA 3X2SA 4BQPA 2ZVDA 5FNVF 1X7YA 4YRJA 2GX6A 1VIDA 3A6DA 4H4DA 3IHWA 3MWEA 1N0UA 3PGVA 4ND8B 4BV2A 4FFVA 3BSSA 2D7CA 2VTBB 1RJ9B 4BZPA 3LLSA 2HSGA 1BX3A 3QOXA 4RESA 4EW6A 1U8TA 4QM7A 3ZK9A 1PV1A 4OQPA 1PG2A 4RZSA 2AXNA 3O8NA 1UWVA 2RHWA 5KYYA 3CF4G 1CJUC 2BCJQ 4PHFA 1KYZA 4KI0A 5KI6A 2GEDA 3EG9B 5DK4A 1D5CA 3R7AA 4GZ3A 4D8YA 3LXUX 3MZ0A 4RTRA 1XI2A 2B3TA 4OOEA 2FP4A 3GLSA 3UJ7A 2EDCA 2HX1A 3MQFA 5A0VA 2VTVA 2IZ6A 3GEGA 2P3LA 3HJGA 2X0DA 4ZDKA 4C1BA 1H6DA 2ERCA 3OF5A 4YRSA 4IEFB 3DF9A 2O6HA 1N3BA 3VR2A 2ISQA 1A1VA 1UQTA 1DC4A 1X92A 3SBDA 3TX6A 4ZVNA 2W93A 3PZRA 3LC7O 4QXPA 2R8XA 3L6RA 2ADOA 5TPZD 3JQRA 1IMOA 4FONA 1XTJA 4P54A 2F43A 1ZH0A 4CR7A 1UC8A 3DKKA 4A8HA 1CZOA 3G7NA 2BUCA 1F0KA 1IDN1 2VF5X 1VE7A 2CC2A 5C8DA 3HXMA 4N7BA 4JXKA 3KYDA 3UYKA 1GQYA 4P36A 4OFBA 3GX1A 2Q5HA 4BIMA 3BB1A 1VBKA 3F96A 2RHRA 2LV8A 1C4WA 2B6HA 1AKMA 1D1PA 1A7KA 3OWXA 2HF7A 5CX1A 5KVCA 3MLBA 3B36A 4AUEA 3MTIA 4U39A 1C80A 1MJGA 1DBIA 4MYSA 3OCCA 4NYMR 4QPZA 1GGVA 4BWYA 5MN6A 4EKNB 4P3KA 1JPVA 2C5AA 2HQ1A 2PCJA 5EE0A 5EG5A 5AKJA 5FH9A 4KQCA 4F4JA 2VSXA 1T5BA 2B25A 1MOQA 1V5IA 3TLAA 5H4HA 4I19A 4N49A 1GDDA 3B8EA 1E5DA 4YBRA 1XTVA 4J16A 5AM1A 3TZBA 3HM2A 3W3AD 4WEQA 4XVHA 1TZKA 1U5CA 2RCNA 1QCZA 1C4KA 3NGLA 4TWAA 4RS3A 1N33B 3FPKA 1B1AA 1HT3A 3NEAA 3TZCA 4RKFA 5EIXA 3NASA 4UCQA 3HN6A 5JNTA 2Y0PA 1VJ0A 3N2KA 1Q1BA 1G7TA 1WZCA 4N7JA 1GG5A 4D4HA 1FPQA 3GLVA 5I7OA 4PSUA 5B12A 2X86A 1SXGA 3GZTB 3STUA 2EJUA 2ZUBA 4KV7A 1OYVA 4Z0TA 4KYVA 3AYXB 1G6OA 4II7A 4NZMA 4ZAVA 4YJ3B 5GY7A 5HX7A 4KWHA 3WLSA 1SC3A 3DH0A 1GXSB 2P9FA 3OLQA 4ZCLA 2G1PA 3V2UA 3EEIA 2EFYA 4O2AB 1E2KA 1HZZC 3I1FA 3V80A 4OHWA 4ZCTA 3LBAA 1DX9A 4OATA 2CLMB 3DNPA 2H63A 5B3JA 4ETIA 2X3YA 1PJTA 4U6SA 1MOPA 3B1KA 2QMOA 1R0LA 4FDUA 4WEOA 5E95A 2FMIA 3DHEA 1Y8CA 3RVRA 1PNTA 2RHJA 4Z0NA 3MAAC 3H05A 3LBHA 4IBOA 5C8XA 3Q11A 2IGBA 3OEED 3MSCA 4KQ9A 4ZVOA 1QG4A 1LSSA 1SUWA 3NCHA 4B3BA 3N5KA 2WLSA 1BRTA 3K9BA 4L1KA 4LTNA 3MJVA 1T1EA 4HX9A 2JEZA 3BK1A 1XFAA 2FLVA 2FPPA 2H11A 3PNBA 3ZIAA 4BQNA 4FHGA 2B21A 2AFHB 1SRRA 3M6FA 4BQOA 1N2CB 2IY9A 2EGUA 1KH2A 3D1VA 2X0KA 3MFYA 4HC4A 1BWSA 1R0SA 4HH4A 5HMMA 3TO5A 4ZI7A 4BFSA 2JAQA 3U37A 2MU1A 3QTTA 4C0JA 1P0PA 4BGVA 3KVNA 2XMBA 5H0IA 1Y4DE 1CIPA 1ZOPA 4F2PA 3R4VA 1JF8A 1H65A 2VXOA 4EJ0A 1OGJA 2YQ5A 2REQB 5FDFA 1T8RA 5KYNA 5BW8A 3TZLA 3IKTA 1Z83A 4KHZA 3MB5A 3RCBA 2BE7A 1MGOA 4LZJA 2ZTVA 2Y8EA 4ZIRB 4RPGA 3GRYA 2IT1A 1WHSA 4KFRA 3GUYA 8LDHA 1OIXA 3PVZA 1BS9A 4B43A 1JQ3A 2XZPA 3OJXA 2F3QA 5DBIA 2AMJA 4M0FA 4Q47A 1UMDB 3OO0A 2ZGVA 2ZU6A 4YAJA 1TZMA 4ZAGA 4MS3A 2NNLD 3ZGZA 4OA5A 3GP5A 4H35A 2AOWA 5JADA 1AA9A 2WSYB 3B3FA 2P6NA 4V0QA 2P9JA 1Z74A 3AVVA 2I8AA 5GONA 4N41A 2GBLC 3VR2D 4MQFA 1RTKA 3QWFA 5I7AA 1U28C 4B6SA 5I4BA 2QRQA 3C2QA 1EVLA 1Q44A 1TYEB 4X8HA 3PXUA 2FUNB 3KQMA 1V9CA 3NC1C 1Z22A 4A2PA 1E32A 4QSHA 4YUZA 3EPLA 4HX5A 2ETXA 3D2LA 4QA9A 3W7BA 1JFLA 4BYGA 4DLYA 3HY6A 3KJIA 3ZD7A 1UIRA 3ICOA 2LVBA 2R65A 3G5TA 3LL7A 4IGAA 4PYOA 4B3CA 2XVZA 1W36B 2V7XA 5KOIA 1CUUA 1W59A 3Q7QA 2MMGA 1FUKA 4IUBS 1JT9A 3GRCA 1C3XA 4LQCA 3DMFA 3ONEA 1MXHA 3LY9A 3SSOA 1JEEA 1OI3A 1E7QA 2X9GA 1TB4A 5TRTA 3QVMA 4GGOA 3GLUA 4GUAA 3RROA 3VTAA 2O0JA 3WLIA 2HLPA 1L4MA 3NFRA 4JB3A 4KVZA 4LKOA 2A9KA 3DWIA 3SOZA 3P0EA 4QFDA 2RGBA 2PZBA 4HGQA 5IW8A 3HRHA 3MT8A 2H16A 2FG6C 1UBKS 4YMVA 2MYTA 4HQ0A 1MOSA 2Y2VA 2C7RA 1T4MA 5K09A 4F4IA 2P5SA 3FDZA 4OD0A 4OA8A 4XWGA 3JVVA 3VR6D 3VVBA 4AS3A 1KI6B 1W46A 2QTCA 2HMAA 5CIQA 3SQXA 3KTDA 3L8EA 3AK4A 3IDSA 2AD5A 4F4DA 1JN0A 1ONPA 3EIQA 3FLMA 1GY8A 2BM1A 4RQBA 5IVDA 3HTXA 1O9BA 3D3QA 3EZGA 4M22A 1OXXK 5F1YA 5HK8A 3GGPA 5TLSA 3F49S 2VSFA 4ILKA 1F3OA 3IJRA 4NBTA 1QPZA 4JXXA 5IJ0B 3P26A 1CJKC 2B78A 2QRVB 3QVJA 2DBYA 1MJHA 3K8QA 5IHXA 3CJRA 1PJ3A 3GO4A 3DBRB 2HRDA 2W8BB 1E2IA 3FM9A 4M0KA 3ZZ0A 4RTQA 3ZXIA 4ACAA 1E4EB 2RI0A 5EVCA 3JQGA 2OXIA 3ZNPA 3FWHA 4IUCS 4A2QA 3LLCA 2V1XA 1RXVA 3NWJA 4EK9A 1MN6A 2OG2A 4GM4A 2UUCB 5AR1A 1I2ZA 3TSYA 2FSVA 1UBLS 4Q9KA 5J58A 4LA4A 4N12A 1FSPA 2BWJA 4AUNA 3CUTA 4AY5A 5BWOA 1O96A 4GXQA 3DGFC 2CJPA 2EFEB 1P62B 5INTA 3K9WA 4GR9A 1G4AE 1F7UA 1CG6A 3GAFA 4RY2A 4UPEA 3C6YA 1OXUA 2NTNA 3BF8A 3K2QA 2QI9F 4RGVA 1QO9A 2PTHA 1DRWA 5JALA 1MNQA 1HFKA 5D3MA 5EFZA 1F12A 4PC1A 1ESCA 1Y9ZA 4XLTA 2Z83A 3FB1A 2NLOA 2NO0A 1DWUA 2GNPA 5HKKD 4ZQEA 5ALSA 4JNKA 3G5LA 3KQYA 5JYBA 1TD9A 3GRAA 5DE3A 3GROA 3O38A 4XM1A 1RBQA 3A0UA 3MCTA 2RGRA 3LOQA 3I83A 1EG2A 3FSEA 4IOKA 4Q16A 4UU7A 3UJ9A 7YASA 2AEJA 3STWA 3E2MA 4U7TB 4DL9A 1WPQA 1N3YA 1TVKB 1POWA 3AFNA 3RYIB 2GZ3A 2HCJB 5C53B 4L9SA 1T1SA 2BAGA 4OXIA 3ZZ1A 1A27A 1V1MB 3ASYA 2Y9MB 3RSOA 5JASA 3LWBA 3WE7A 4BV8A 1Z7YA 1Z8NA 4EHDA 3H9CA 3IAHA 4Y2SA 1VRCA 3LA6A 3ZH2A 3V7YA 4JOBA 1P61B 1P9WA 1QOZA 5CA1A 1XRMA 1J23A 1OW3B 5FWXA 4CR6A 5C2JB 4PLCA 2ZXFA 3R5KA 5CT6A 3SS8A 5L45A 1FRVA 1SQ0A 2FYTA 3HSKA 2WVGA 1XRJA 5EUCA 3AYZB 4Q9NA 5HS6A 1K9SA 1P81A 3T5AA 2HCBA 3LT1A 3NBYC 3UNXA 3S99A 3UUFA 1BH6A 1EWVA 4GEKA 3TECE 2FGKA 1W34A 1BFKA 3JYLA 5DFAA 1LPPA 1YZLA 2ZUTA 1W8IA 1NRJB 4DB2A 1ONNA 3HG7A 3AEUA 3S8EA 2V98A 4N0EA 2EZ9A 4P31A 4M4SA 4MARA 4QWWA 4U2CA 2JGDA 3WKAA 2IP2A 3UGKA 1ILEA 3PFBA 5E6RB 1XQWA 3SEFA 1XN4A 5AM4A 1NBHA 4J76A 4C7KA 1YBAA 2EFCB 2ZT8A 2H1CA 3U56A 1WXQA 2ACWA 1GYPA 1R6TA 1S0UA 2G9VA 1U7UA 4MZXA 4XOIA 4PPGA 3UXYA 4C7OA 1TLTA 2IZ1A 3SEAA 1E2DA 3LBIA 1GFWA 2ZUCA 3Q2KA 3NTUA 4TLAA 1ZY2A 2WIJA 3QXHA 1V8FA 3QVXA 3KSZO 3ZI0A 1J56A 4PQGA 5ICCA 4GOOD 1W5EA 4WXMA 4X8MA 4RD1A 4AP6A 5IM4F 4QUBA 3QA3E 3Q3JB 3FAZA 1EX9A 2CKMA 5E9QA 1GTVA 3NWPA 4C3VA 3WMWA 5ADWA 1H0RA 2M9MA 1A9RA 3QPBA 2YIJA 1HE2A 3QTLA 1CJCA 2PJZA 2V4UA 3E2PA 1JI3A 2BGMA 4ND7A 5LZ7A 4HYYA 2JLRA 3RYHB 3ESBA 1MO2A 3KB8A 2FN8A 4GLFA 4ZO6A 1F6BA 4CKCB 1SQ6A 3KALA 4DA6A 5A3SA 3M2TA 4YJGA 1E2JA 5U1PA 1ZMTA 3OOWA 1N9ZA 2E87A 2JFPA 2XMCA 3R3ZA 1S8FA 4JVSB 3RYFA 1KNXA 3ST7A 821PA 1XDUA 3JQCA 4Q12A 5AKLA 1Z47A 2QUAA 4RTPA 5D3ZA 1JZSA 4HZIA 3OKFA 2HZBA 2J3JA 3C45A 2GM4A 3QOFA 1FBTA 4L4RA 3PBKA 4JC8A 2F1HA 3GFRA 3IOYA 2H4HA 4HAZA 3GFTA 3WHIA 2P1RA 4L8FA 2NPOA 5FPSA 2XITA 4KLRA 1ZRMA 3NZEA 4DC9A 2D2VA 4EELA 3EXEA 4I5EA 4PN7A 2ENWA 4LRUA 4FYXA 2PDAA 2WHRA 3C48A 3ZDYB 5LN1A 1AKUA 4Y6GB 4C4TA 3S44A 3TUJC 5LQKA 1IK6A 2B0CA 2O3UA 1HC7A 2PXAA 5KNDA 3ZCSA 4GR5A 2UXDB 5J2TF 3IDQA 1ZIDA 4L7VA 4BTEA 1YA6A 3BFPA 1Z17A 3CUVA 3T1QA 2LRHA 3K35A 1SM4A 2WWTA 4XGRA 4C20A 3GT0A 3B70A 5KINB 1YFZA 2FP4B 1O57A 3O1JC 2Z9BA 5GWXA 3PQCA 1BH2A 2PR7A 1BDBA 1CV2A 2VYFA 2WPNA 3BMCB 2CNOA 2RGWA 2RH9B 3GN1A 2IU0A 3UJBA 4E21A 4W5RA 1KETA 2P0YA 1CUSA 1E9CA 4XR9A 4YQYA 5T41A 1IDOA 2ACKA 2GARA 5H5JA 1IJFA 1KDPA 3I9V1 2YXBA 4W9NA 3FNIA 2A0XA 1SKAA 3FMGA 4JEMA 4RE5A 4CFSA 4DUGD 1EFDN 2HQSA 2HDHA 3ZS8A 2GLUA 5A04A 3A32A 1LX7A 5H59A 4BNFA 5H9VA 4KR0A 5DWDA 4DR1B 3L0IB 4YP6A 1RSZA 1WMSA 1G20A 4BIIA 1IU9A 1P9LA 3GA7A 4D82A 4ECAA 4F4FA 2RD2A 1X1DA 1UFVA 4WZAE 5LUBA 4BTVA 2O5RA 5LSAA 4P4SB 1JEYB 1XYYA 2AN1A 4XWKA 2AN9A 4LHVA 4QYSA 1EHIA 4OH7A 1NW7A 3MWDB 2DKNA 4PBRA 3NLLA 3EZXA 1U0EA 1E2LA 3ZWVA 3UWSA 3AIMA 2DTEA 1QX4A 3ANMA 5JECA 1Z5WA 3UA4A 1NPYA 3EGDA 2BGUA 2XMDA 2XJ4A 1CNFA 3ILSA 5JYEA 4RF5A 5ALPA 3ES9A 3OTHA 2O2ZA 4AJPA 2EV9A 5CPFA 3X1KA 1PJZA 3TAXA 4CTJA 5I7RA 4JI5B 4DWVA 3SJAA 1YVPA 4TSFA 2FEPA 2IDZA 1CE8B 4D44A 3EB9A 3N8HA 2JZOA 3CCCA 5C1DA 4Y2VA 5FPKA 2GCIA 2EERA 3M6MD 1BX1A 3WDKA 3AY6A 3LKBA 4GWLA 2WG2A 5TVKA 3IE2A 3L6BA 3LQRA 2GKOA 2I33A 3R3XA 2WAXA 4PNPA 4DCUA 4BGDA 1ZD1A 3W05A 3MJCA 4WDRA 5B6IA 5GOZA 1IE3A 1PT5A 4RY9A 4S35A 4A0RA 1G9SA 1DOZA 1E6EA 3U44A 5JD5A 5ER6A 1ZEMA 2HK9A 7ADHA 1SVSA 4TXNA 5FI3A 3WOHA 1UP4A 2LE0A 1LBEA 1Z0DA 1ZP6A 1KRXA 1XZMA 4TXMA 2QJWA 4TQUS 4FGSA 2HJRA 3GFSA 1NM5A 3N05A 2GM5A 3H2KA 1YK1A 4DJEC 2XVYA 1JU3A 4R54A 1QVRA 4DEYA 5JS6A 5KTKA 4B4UA 2LWIA 3DDHA 3P4XA 5HMLA 4B34A 1Z2NX 1D4AA 2AG0A 1UBFA 1HTTA 1K5GA 1TTHA 2ODBA 3D2CA 4QUJA 4FQ8A 4V0KA 2AV6A 1XTTA 2GK3A 2QU7A 3SK0A 4CV2A 1N2EA 4EHJA 4ZTUB 3G9QA 3U3RA 4ZA2A 2VA9A 3NBZC 5KTOA 4Z4IA 1RCFA 4QRDA 2DPHA 2H06A 2KWIA 3BA1A 5FYDA 5LP1A 3ZIDA 2VCYA 2J1LA 5HOEA 4RL6A 3ZG6A 3QXJA 4A26A 3WWEA 3Q98A 5IAOA 1P5JA 4XQEA 1Z4MA 3ETJA 1UJ5A 2PZFA 4UVHA 1E5TA 1E2FA 1WUKS 1KA9H 2TRSB 4HXEB 3GJ5A 4MA0A 2P2LA 4K40A 4DCTA 3CUUA 4UM9B 1LVUA 6ADHA 3QX7A 5K5EA 1N6OA 2L2QA 4R5HA 4NNOA 3IV6A 2VZLA 1GCIA 1E2GA 1P74A 4P4NA 5CG2A 1KDTA 2ECKA 4WLVA 2Z9DA 2GESA 2Q41A 4ZO4A 5DASA 3G9UA 3R6DA 1KFCB 3GFVA 3BTUA 4OK5A 4X1YB 2PZKA 4C6TA 1L6IA 1ZGGA 3UJNA 2QGNA 2XDQB 4R9UC 1JDZA 3H11A 1G60A 2HPAA 3WNBA 5BMVB 1VPWA 1MJNA 2PS3A 4YRDA 9ATCA 1HKUA 5JTTA 4CFYA 2J09A 4OYRA 5ALUA 5GQSA 3MG9A 1KFBB 3G0DA 1NXQA 2P75A 4FEAA 1I7PA 4K0RA 4MUKA 5CB4F 3WL6A 2AR9A 1JE1A 4D3ZA 4D41A 3JTEA 1TTPB 2FY8A 4M1WA 2OXCA 4OREX 5BT8A 4QZVA 1COWA 5HZGA 2WVJA 2Q3DA 1SUDA 2ZRJA 3TLXA 1QQ6A 2OCKA 3W8NA 4DCPA 4YQFA 1YFLA 2GHIA 1SHTX 4TYWA 3DYVA 3MT0A 4IIHA 2A1TS 2JVJA 2DC1A 4JI4B 3P0RA 5JZSA 3GUCA 1FEZA 2R0QC 4BN4A 2AE2A 3T3NA 2PL5A 1PGNA 4JLVA 3UZUA 2ZT7A 3QUBA 4DA7A 5CBKA 2A1UA 1QR6A 4DTCA 1RC8A 1QH0A 3TRDA 3QUSA 3BMNB 3RAJA 4W5OA 1PDVA 4F9TA 3PLAE 1NXTA 1R4MA 4N7MA 3FN4A 2EGHA 5SY9A 5LP6F 1DS6A 3LPCA 4ID3A 4GH5A 3FUXA 3WWZA 4WK6A 1NXVA 3ZJVA 4UVIA 3H18A 4UQLA 4WKNA 1ND5A 2AK3A 3EGXA 4B79A 1Z0UA 3TLGB 4ARZB 4Q1AA 2J5KA 4E7PA 2WKWA 3RUFA 5EESA 2F3SA 4NOKA 1Z16A 3WZLA 2LUOA 1XQ6A 3C5HA 1IXRC 3DR5A 1XWWA 3DT8A 5D6NA 1TO2E 3EGIA 1C50A 5JMPA 5G1NA 2IOYA 3AFHA 1E58A 1OXTA 4YB8A 3H2GA 3T8YA 4Y9UA 3ZBQA 3GGSA 4II2A 4CMAA 1QANA 1KZ1A 5DSXA 2OHVA 1MB9A 1U0SY 1C1XA 2IXAA 3A27A 1V1RA 4JOSA 4DMMA 2HPZA 2X6QA 4KQGA 5CPBA 3S2GA 4JQCA 1IXSB 5EFOA 1EFAA 3OVMA 5AVQA 2YL2A 1Z4NA 4C9BA 3UAYA 5AHXA 4DCCA 3TOXA 4ENPA 2MTBA 1KI6A 5GAJA 4B3IA 3KB1A 4R71A 5HA5A 3GJ3A 4QYTA 3EGEA 4A0FA 2E1RA 1KR2A 2O8FA 4P34A 3BWBA 2C5BA 1C9JA 4UBLA 2RG1A 1RXCA 2OO5C 3HJHA 3PGA1 4Q39A 4JR1A 3ZLVA 5ITZB 1SXQA 1KU0A 3H5WA 1BYIA 5I9MA 3FSJX 4IHJA 4ZHQA 2N46A 2C4KA 2GPTA 2NWQA 3FOCA 4KQ1A 2OM6A 2XUDA 3VYUB 3ZEAA 4EQ6B 1DP4A 1RI3A 2FH5B 1K6EA 1J2YA 1V11A 2AFHA 4ETWA 5AHOA 4KQHA 4NTZA 1P1JA 1RJEA 2A2ZA 1T0JB 4DTIA 5FPPA 3MMXA 4INAA 4P81A 4UM5A 1W5TA 2CL6X 3FPBA 4D8UA 4X7MA 2R1UA 3AVQA 5BR1A 1PTJA 1RCTE 5HGXA 2XNDA 2FF5A 4LJLA 1XQYA 2PSDA 4JLWA 1IBCA 4E03A 1ZC3A 3CR7A 2REQA 2AEMA 4O4HA 3T7TA 2AX4A 4IINA 4FWTA 3AHJA 1ZBQA 4B35A 2PGIA 2D2FA 2MSDB 1TZCA 4MNTA 2XZDA 3D31A 3E4CA 2CXXA 1U0OC 1Z29A 4HDRB 5T67A 5T8KC 4I3HA 5AYVA 3UTCA 1CEYA 4H27A 3L18A 4XGNA 5ALLA 3WGVA 3SDZA 3LUJA 1OAAA 3K9CA 4E2XA 5JH7A 1ZU4A 5BSFA 2AA3A 3L7KA 5DI9A 1ZH8A 1O77A 4PGGA 1B74A 1U2PA 4XJSA 4BRSA 1RLJA 1S01A 2YRXA 3M6VA 1A76A 4CLEA 1NRXA 3B9QA 4JA2A 2IUUA 2MSLA 3H5OA 4RCVA 4XJXA 3GARA 4N3AA 3WXBA 2YWJA 5JTUA 3V8PA 2IS6A 3VUFA 1KGDA 2VNKA 2GTPA 4O4JB 1YR6A 5CDFE 3KZCA 4M0UA 1JNXX 4HDOB 4U00A 4X90A 3E22A 3MCAA 1QGUB 10MHA 4MGKR 4AMUA 3DAFA 3U3MA 1BMTA 3PC4A 2JKZA 4K8RB 2LKDA 4ND4A 1N2IA 1TE2A 2OO3A 5J2UA 4G41A 2BMFA 4BWFB 4D4IA 2CXOA 1N6KA 1SA0A 4RKEA 1N3IA 3KFVA 2AYZA 3DGEC 3CINA 4L3OA 5DV9A 3W6NA 4C43A 4K2AA 4D6XA 3NIWA 5BW4A 2P9TA 4NBRA 5A6SA 2OGSA 2QLLA 4IDOA 4UDNA 5KCMA 4TTSA 5BV1A 2XTAA 3U62A 1N0WA 2II6A 3P9SA 1MT0A 2RKBA 5LBTA 2XEXA 4EPVA 1M2WA 2Q4RA 3I01A 1XTSA 1L5YA 2X1HA 4FS3A 3T5GA 4GKKB 2YN2A 2P6OA 4NWIA 5D86A 1QLJA 1ZRSA 3D3NA 3C8UA 4DWOA 3QI7A 3ON5A 1UKCA 5FA5A 2XD4A 3OECA 1T0PA 3TPCA 2IW1A 3L41A 1FDRA 4BJ3A 4BMSA 1FQJA 4EB6B 1JQJC 3H04A 2N75A 1TKBA 5DSZA 2RHDA 3GG9A 3JQ6A 4II3A 1XL1A 3PC8A 1XZHA 3BXFA 2JLZA 5JCXA 4DY6A 5E6UB 2CVQA 4QPJC 1U9IC 2CVZA 3OICA 3UMBA 4AZ0A 1WU8A 3R5XA 4HB3A 4JJIA 1T5TA 2O7NA 4OGFA 4X45A 3PE3A 3ZE1B 3LT5A 5JSHA 2Q5JA 5HK9A 3UH1A 2CMDA 1QMPA 3P2MA 3P9CA 5EZYF 5FNZA 2R1ZA 3QU7A 3COYA 3W2EA 5C8VA 5A5GA 2CLKB 3RM3A 5B7NA 2OB1A 3AP1A 3QBVA 4N3GA 2G06A 2O23A 3SHVA 4G1FA 4FC7A 5ERXA 4M1QA 1E94E 3JARA 3TQHA 1HWYA 2QMEA 2HJHA 2KMLA 1TI7A 4O8ZA 4AS2A 1XTIA 2QP3A 5GVRA 3UJ6A 4YRFA 4CLHA 3MS2A 1WDMA 5D00A 2WMDA 3GH3A 3C97A 1OYYA 3SIXA 5LYJB 4ZDWA 2C4UA 5DVZA 4B17A 1O58A 2OUKA 2YVKA 2WTAA 3W3AH 1CQXA 4DM7A 1P1RA 1H9BA 3L6OO 3WNCA 3B12A 1YRHA 2QK4A 1ZGCA 1TX4B 4PRLA 1MFZA 4HAYA 4IDHA 2BEWB 4NI5A 3SZ3A 1BJTA 2JI4A 2VKTA 2OY0A 1J21A 4AO8A 4PO1A 4LRSB 2ZRCA 5K4AA 2ZW9A 3L4BA 4AMYA 1XAGA 1B0PA 3H2BA 4R1QA 4G0UA 5HJ5A 2RHCA 3KKZA 2PT5A 4MWBA 1DQPA 1B00A 3T4UA 4EY6A 2NU7B 4IDFA 5AIAA 2C9BA 5KPDA 2RHHA 4XEUA 5FD8A 3QELA 1DELA 2CUNA 4F6RA 1IPFA 5CEJA 1R4NB 3NEJA 1TM1E 2C3YA 2X6RA 4B40A 1ODFA 4F8EA 4CRWB 1JLLB 4LY9A 1X1CA 3MTEA 5DRYA 1OSNA 2PA0A 2X2PA 4XEHA 3R3JA 4I1YA 1ECFA 5A4IS 4MI1A 3G9TA 1QK5A 3OC0A 4RPIA 1WCIA 2Y93A 3HACA 3S2EA 1P7WA 1IBKB 1NVUQ 1KDRA 2DUUA 5COAA 3LBYA 4YO8A 4LSGA 1E9SA 4DCJA 3WK9A 5EPUA 4XYLA 1NRIA 3FZQA 2B98A 3KR1A 4IPTA 3QKSB 1Q1EA 1IPHA 1GPMA 4IL5A 2A6PA 4M7OA 4MQ4A 5FPQA 5FI5A 2Y05A 2AOUA 4U9IS 3SFZA 5LL6P 1JXAA 3K9HA 3VU9B 2YRWA 1UKBA 2PSHA 2YICA 3F7TA 1AHIA 4FHFA 4N9QA 5FOXA 3TGWA 4BZQA 4D8XA 3CTPA 4GFDA 4I4CA 4KXQA 1USUA 1WRBA 4LVUA 5LOVA 3DBHA 2H9AA 4CLDA 4QIHA 4C76A 2P3QA 1U8XX 5LMNB 2AC4A 2WIGA 2ZPTX 4AUKA 3W5DA 1A97A 2XMRA 4MRSA 2GJ9A 1EFRA 4JN6B 4OHKA 1JRLA 1GKIA 1WPRA 3AESB 2VNHA 3TRKA 2JHGA 1SUAA 3TRFA 2FSIA 4RHYA 5HIAA 1F2VA 1XZDA 3IUEA 4FR0A 4GE0A 3ICQB 1V7ZA 5SZJA 4NYJQ 3WI7A 3HFSA 4XX0A 4ZHQF 2CYBA 2M6RA 3CX7A 3WGGA 5KIAA 4S04A 3LTNC 4KQFA 4OU4A 5EUBA 2VHTA 1GGFA 2OD2A 3LHFA 4XDYA 2GDJA 2OD9A 1X13A 4RELA 3WLKX 1M2VA 3JW8A 4Q7MB 1XB2A 4KEAA 1L5RA 3WWDA 1B6RA 4URWR 2XSZD 5DYTA 2WV9A 1ZK1A 5EWMA 3SHTA 3H99A 2WF5A 3DDUA 1KDYA 3N7TA 3UG6A 1U2DA 4BP8A 4R8KA 5IVIA 4YVFA 2WF8A 2WT8A 5EJ2A 1HG1A 2O59A 3IERA 1CUFA 2PWBA 4LJ8A 4YCAA 2A9QA 3EVDA 1QWOA 2IXFA 3VC1A 4TRMA 2CY0A 3ABZA 3IFSA 1DBWA 2P1DA 4XW2A 4ZREA 3S1LA 4B7XA 4F3NA 3LHKA 4R9VA 1O95D 2JBAA 4JY7A 3M34A 3QNUA 4UMVA 2NQTA 3DBVO 3OIUA 2CN1A 3I42A 3PXDA 4C29A 1AU9A 5IN4A 1OQAA 3LSYA 3KJQA 1IOZA 2F1JA 2ONCA 2C57A 3C3XA 1P6QA 2GN8A 2JGRA 1O9HA 1AKWA 1WR8A 1U90A 2J33A 1N5IA 2UYOA 1X7DA 1E1RA 3DAPA 1C1DB 2HBRA 1HE8B 2I7VA 4KC0A 3I6IA 4X71A 3TR6A 4EPRA 3UYLA 3EVBA 1K75A 5C4MA 4Q7EA 1A9YA 2JI9A 2PFGA 3KAQA 4BMZA 2QL5A 4LHEA 3T5DA 5J2TB 5K99A 4LYDA 2NUAA 1DQNA 1M34A 3M0EA 2Y76A 4S1NA 4DZZA 4HLCA 1T25A 3BSYA 3E27A 3GJ7A 4O4LA 3HWRA 3PKZA 3H1FA 4FNGA 4H16A 2OOKA 1LXCA 4L4XA 4U7JA 4UAVA 3UMSA 5C0OE 4G4IA 4KXNA 1XZJA 4R16A 1CULC 4PLZA 2GAJA 3NHBA 5LXTA 3GVXA 2VDWB 1U2SA 3QE2A 3WA7A 1XVTA 3IJEB 3ZV4A 1NI5A 2ZSEA 3IEKA 4FE7A 4UFNA 3PHCA 1WUTA 3EMVA 1H2YA 4LMAA 4RV5A 3WK6A 1YHZA 1NJ1A 1GCUA 1P6XA 1QGZA 5LYJF 5A9SB 4L5CA 5FUYA 1B16A 4MH0R 1EBUA 3TSAA 1U28A 1XMIA 1KQ3A 2C5GA 4IRMA 3FNHA 2C9ZA 2RGDA 4QFBA 3ND7A 5AW4A 3NT5A 3O4HA 3HM9A 3LF1A 2YOHA 5IJWA 1E6LA 2Z30A 2WUEA 1E18A 3S8MA 1CK4A 1QVAA 1GA4A 4IRUB 3IIEA 4RADA 4YDSA 1X1SA 2JFOA 2GD0A 2I6GA 1Y9EA 3KJXA 1OV6A 3FCUB 3OZDA 4IYRA 1WXIA 5EIBC 3FSRA 5DM4A 2I8LA 5CA0F 3KZVA 2EG9A 5EJ9A 1WUYA 5A5VA 1E9EA 4V0SA 1WP9A 2X0JA 1XXHB 5JXJA 1S2LA 1SG6A 2CE7A 5ULLA 3QEJA 1KJWA 4PQFA 5A4AA 2VNAA 1N2GA 5ANRB 1AXEA 3SJ7A 2XCQA 4IJ5A 5L8VA 4KJZA 4N6OA 2HUPA 3RDPA 3W2HA 2BFAA 4CVNA 3ND5A 3URKA 3J81k 4AKIA 1KERA 4IWXA 1CUIA 4MO2A 3RTDA 3U4DA 1XQXA 1C2YA 2YYSA 3LUKA 2WA1A 1KBQA 1G3UA 4E0BA 5CB0A 5J1TB 4HDSB 2BFMA 2A8YA 4K9NA 3RUPA 3K3PA 5EKUA 1UBTS 3GDFA 2YZGA 1O94C 2ICAA 1G5PA 1V41E 2NT3A 2ZAMA 3IP5A 4DR6B 5CLGA 1JHQA 2BCGY 3BK2A 3ZZMA 3ZHTA 2GCOA 4WT7A 1BKYA 1K7YA 3VU3A 3B2EA 1T2CA 4FZVA 3W90A 4P0TA 3IAS1 1BXKA 3V8VA 3SZMA 3VAYA 1YDMA 1MAUA 2PVSA 2VF7A 3KXIA 1E7SA 2PH5A 1L5OA 4NDAA 3ZVLA 2E4AA 4PRKA 3OQIB 1NLZA 4D3XA 1YZYA 5JMOA 4EX7A 4JIMA 2CFOA 4I4TB 2R1TA 4E5KA 2PQ2A 1TPYA 3PIIA 2GPAA 4E6PA 4QJ3A 5FAKA 1M7HA 3MMPA 3FNRA 4BNJA 2XGGA 2ZBVA 3MOGA 1CR4A 1J70A 5EWJA 1LNQA 3PPYA 1GRCA 3FB4A 1NQ5A 3GQVA 4IVRA 4LX8A 3S2UA 4L2IB 2QENA 2X23A 5JC1A 1RZRD 5DLEA 4ZAZA 4E7OA 1NQVA 4UE6A 5FTLA 4HNSA 3LX4A 1QBGA 3OPNA 3KOXA 3VO9A 2W6NA 1YDGA 1A98A 5F64A 1SBCA 4IH1A 1GOTA 3A1TA 1ODJA 4MWGA 4DSUA 3QYJA 7REQB 1ZL2A 1AQYA 2HU2A 1SC4A 2O0KA 2W58A 2F3RA 2PD3A 3C7KA 3F3SA 3KYCA 3V9AA 3P9IA 1AV7A 4RFSA 4N40A 1BXRB 2FP3A 2XI4A 1PR6A 2LGJA 4QPPA 4EFNA 1DAKA 4PPFA 4C7XA 3ZH9B 5JAMA 1JYEA 2D6FA 1RI1A 4ZGBA 3OTIA 4BNGA 4Q93A 4AY2A 4TKUB 2CXPA 3SSMA 4A6EA 4CQMB 4DADA 1BU8A 5DH9A 1WG8A 4D4JA 5AVXA 1P2VA 3LVRE 1DO0A 1R7RA 4LQ4A 3BDIA 4BNKA 4NY1A 4OLFA 3VR3A 4ER0A 4F3RA 4ZOLB 3K1AA 1RM4A 2ZDHA 3IEPA 1E92A 2G1AA 4QVGA 4WHMA 1I36A 5K0SA 2QTVA 1MPXA 2OLKA 4LNUB 1ZD2P 2P2CA 4A0QA 1DIHA 3K0AB 1OAOC 3P5BA 4BNIA 1JG7A 2IHBA 3UICA 3TKLA 5BQXA 4UBKA 2EFHB 1X74A 1BW9A 2DP4E 2UUPA 4R2LA 4OJNA 4Q3NA 3U81A 4AJHA 5JATA 3AX6A 2WJWA 4M1OA 5LC1A 3KFLA 4MR8B 2XWSA 3QLUC 1XPJA 5D5QA 1G17A 4UQOA 5AP9A 3OPMA 4KR9A 2W6MA 1DAHA 3UWPA 3AEKA 4ENQA 1RM3A 1V37A 2XV1A 2C77A 3CONA 1E79D 3NANA 1C3OA 3NNDA 4GM1A 4W5JA 3P9KA 5ALRA 5MF6A 1JIKA 1Q21A 2H1FA 5TF4A 1XTKA 3AESA 1MABA 4TWIA 3ACCA 1SBTA 3TFOA 4R2KA 4QC2A 2Q7DA 9ABPA 4YJFB 4EMBA 2G04A 1RDFA 4PIVA 5KQPA 4L5BA 3UCFA 5KYXB 4IGIA 1R66A 1FFCA 2AXPA 3F4BA 5A7GA 1DEOA 3JALA 5IK2D 5F1OA 3P7MA 2IEYA 4CCYA 2QORA 3ZNOA 1CQIB 4XUCA 4QVIA 2A35A 4PAOA 1VE6A 5LPNA 5H83A 1DV1A 2WJ6A 4O5AA 1ZIOA 4DJJA 2ZDQA 4P4LA 4DT1A 4BEVA 3COJA 4P0PB 4KK4A 2JH9A 5DHPA 1NXXA 3CX6A 5JJ5A 4IIGA 2CCJA 3AB7A 3CNNA 3DZFA 3O5AA 5B6JA 4YAEA 5J4VA 1QRRA 2JK0A 4DILA 1D9XA 3CG0A 4OMCA 5JI2E 3KPWA 2AD1A 2QZSA 2QQFA 1T43A 4LYHA 3EOAI 4OKNA 2VP9A 4X63A 3LGSA 2QTBA 4KUHA 1DG3A 3TTSA 6YASA 4OAOA 4UM8B 1JJVA 2NPFA 2UYGA 4IGKA 1YJ5A 2JLBA 4ARBA 3N2NA 2B99A 1HYQA 1N8KA 1BD3A 1M1YE 1W73A 1XTBA 2HWWA 2OVBA 2R47A 4MQUA 1O0BA 3F6EX 2LBPA 3N07A 2C8KA 5J4YA 4WX2B 4G1MB 2B34A 1RVV1 2QDKA 2CEKA 3HN7A 4RKRA 4QUIA 1ZJWA 2I03A 1VL6A 1FTQA 2Y1DA 4W7HA 3NVDA 1IXKA 3TSCA 3KSRA 5ALFA 4CUZA 4D79A 2YJTD 1AM4D 3NTRA 1G21B 2FNAA 5AI6A 1AS3A 4BKOA 3K71B 1JHAA 4MAFA 1RKUA 2XCRB 4AJLA 1QCCA 3GDWA 1STOA 4FM9A 1R9GA 1FYXA 5IZCC 2FWBA 1U0HC 5IJXA 1OLOA 1NC1A 2HMUA 3LUPA 4L02A 4RZ2A 2HR1A 1XNRB 4IQFA 1YKSA 4JIGA 5IM4A 1Y6ZA 4Z4GA 3CZ5A 2GDZA 1F1JA 2EF1A 4PQEA 5LXTB 3UMRA 4J4TA 4DMGA 1Y37A 2WWRA 4C14A 4P84A 3M81A 2B37A 2QN8A 4A6PA 5C1PA 1CW2B 2H1OA 3MUEA 3FPLA 4TRRA 4BU0A 1JR4A 2DM6A 1XLTC 4BDSA 1NBOA 1R0XA 3V4RA 3A9VA 3N0TA 1N2CA 1NXWA 3DV0B 1U0GA 1B76A 2GPJA 3C3DA 4OG2A 1PKEA 4Q00A 4OU5A 3TMKA 2DBRA 2HJVA 2I54A 4DHEA 1O8CA 2QXUA 4X8OA 5ALKA 4EDFA 3AUSA 1ZSYA 1RHMA 4TL7A 2NO4A 1Q7EA 3PA8A 2C8VA 1H1LB 4OBWA 1J0CA 2UYYA 1ZVKA 3O8CA 3EXHB 1FYDA 1Z36A 5IDQA 2VK4A 4CQMD 4ZV4A 1J1UA 2ZUWA 3D6VA 3SLRA 1M6NA 1F5SA 1CSEE 3PNLA 5FEMA 1DQSA 4LF7B 3EFOA 4K9DA 3K70D 1ZRNA 4LOAA 4WH0A 1K5HA 3BIXA 3I37X 1JEQB 4JBGA 4TWJA 3ZZTA 3STTA 5JCZA 5A06A 1AOXA 2CNBA 4MS3B 4YR7A 1WZUA 4S1TA 3GLFB 4EYGA 2W6PA 3MTBA 1WHTB 1X1TA 2P77A 2N1BA 1SIBE 2LW7A 4G1UC 1M8GA 4JQZA 2HBQA 1NF3A 3T3EA 3OURA 1U1FA 4XIGS 1E77A 3EW7A 3MCWA 5JJBA 1QYVA 2JIBA 2IYVA 4IVQA 5KEIA 2VT6A 1JA1A 1C7ZA 1OPRA 1QIFA 3D7SA 1HDXA 1ISIA 3SN6A 1AGXA 5GZ3A 3B3JA 4BLOA 2QUJA 1DG9A 4I1UA 3E5RA 1JR3A 3UWOA 1GKUB 1G3RA 1U8UA 3HJUA 1T4CB 2B82A 1THGA 4RSHA 3UGJA 4MDHA 1WWKA 3I8XA 3IA7A 2PXXA 4QXOA 4UEKA 3VSDA 4J0IA 1KY5A 4K1XA 2C0PA 2EKBA 4MV5A 2OLEA 3AKCA 2IYPA 3T9AA 4YJ3A 3GQBB 3VR6H 3VPSA 5ITWA 2VZEA 2ZR8A 4AL4A 1D0IA 2OM2A 4A8JB 3GOHA 5EIWA 2OESA 2GSDA 4LZZA 1FC0A 4LDZA 5CFOA 2QLJA 3TS1A 3E03A 4D98A 1ZM7A 5CXXA 5FUBA 2C03A 2EARA 3Q8KA 1Y89A 2NXCA 2VJAA 1IUNA 1EEHA 3AR5A 3BERA 1VJCA 3T38A 3C3JA 3CO0S 1KJZA 2PYZA 3L2OB 3UW3A 1ESZA 4CDMA 4ED9A 2VF8A 1YOVA 1N6IA 4E4RA 4XRGA 4M9RA 3GEHA 2PGNA 1I4EB 3MC1A 3O8QB 3ZE2B 1DC5A 1FE8A 3ISJA 5CFNA 5JPCA 4CW7A 2QZ4A 4NAVA 4YROA 3TDMA 3U09A 1Y3HA 1ZN8A 3BGDA 3AZPA 1V4NA 1VHWA 1JR3D 3IVXA 2VI5A 3R5HA 2CLLB 1FRNA 2AGVA 3C1OA 4W8GA 1FNSA 2JIDA 5HCIA 5JZMA 1WNTA 3ZTWA 3Q0TA 3ROEA 4MW5A 3V34A 3F8SA 3C7CB 4Q1CA 2QZPA 3H16A 4EY8A 1ORWA 4A1FA 1P4GA 2RGXA 4MK4A 2WP0A 3EVTA 1B8PA 5BSEA 4RJTA 3HBJA 3PGMA 4Y9DA 1VCNA 4R9RA 3WNVA 1NOIA 3O2SB 2A94A 4NX2A 1RJGA 3EPJA 3WK7A 1MH1A 2EIXA 2H5EA 3QHQA 1KDVA 1CRWG 4OJYA 1B15A 2J0VA 4O33A 3L3BA 3UFXB 4DZRA 1HOTA 4REMA 3RHFA 5KYYB 3S40A 1AZWA 2VSYA 4MDYA 2H85A 1JDBC 3K1TA 6ABPA 1Z8FA 2YZNA 4E3ZA 1U1DA 1S8NA 1R5BA 1RWQA 2H0RA 3N59A 2AI1A 3G82C 2C1XA 3PB3A 3TKAA 3BFKA 2JGMA 1LC3A 4WKOA 2WB4A 4GOMD 4QGBA 1J25A 4RIGA 4CKWB 1W76A 3AF0A 2VC2B 3T0IA 3DWFA 3Q87B 4X91A 5FLYA 2FWIA 4HADA 1KIAA 1AQJA 1QB8A 4MMYB 3O3NB 2C0CA 2MR6A 1NAHA 4MYRA 2UYCA 3SX2A 3D43A 1Z0SA 2WU4A 1UT6A 3UAOA 3WLQA 1VL1A 5C1IA 5HFAA 4H3SA 3FNQA 1UJ6A 4AJNA 3Q8LA 4L50A 2HF8A 1EX7A 3DYBA 1DADA 3K5IA 1PLJA 3BA6A 4DRXB 2A3RA 4J0EA 3WDLA 3TMAA 5CW1A 2ZZKA 4OLJA 2ZKLA 4RIIA 2CDCA 4YPFA 4MDFA 5DWQA 1IQ0A 1NASA 2W2OA 4IIDA 5JNLA 4BRWA 1PSDA 1VM6A 4TTIA 3RD5A 3VMMA 4BO1A 5FWXB 1OWOA 2JJ1D 2QTFA 4B6PA 4DA0A 4TV8B 1EUZA 1E99A 3OIVA 3Q7IA 1XZNA 2FPSA 2PSEA 2ZB8A 4YRTA 1Q22A 2JJ2D 3PZBA 3PYXA 4B5KA 3DLIA 3PXCX 4D46A 5FTJA 3QFFA 5ICMA 3AI3A 4UEQA 1ULTA 3MMZA 4AKGA 5HKOA 5JZVA 5SY4A 3VM6A 3C7AA 4DR3B 1MQAA 2AOXA 3CEJA 2J9FB 3H5IA 1H8ED 4DIUA 3MWLA 3GT7A 4L8WB 4QEDA 2X0EA 4DLBA 2BEVB 1K8ZB 4N03A 3PU6A 2C4WA 2EJCA 2H4JA 5K0GA 4I4LA 1ZH6A 1MRSA 4OM7A 1QH8A 3ELBA 3SYMA 5F7ZA 1ACJA 1Z39A 3RHSA 1TYDE 4G25A 1IEVA 1PKXA 1IZYA 5LLSA 1MG0A 4GRIA 2G76A 3UATA 4UTOA 2DBVO 3MTQA 2ZRAA 2IV3A 3WSVA 5JD4A 2MJLA 1X7WA 2BFFB 1PN3A 2VZ8A 4CU5A 2X7JA 1SCUB 2ZDGA 3A10A 3V42A 3G0OA 3GUUA 3L84A 4JBWA 1QE3A 1XCJA 3X3HA 4BNHA 2ZI9A 1V5GA 2I87A 1A72A 3SC2B 1XEFA 2ZI5A 2M1ZA 2XUAA 1U3FA 1T4GA 3S1AA 1WMDA 3M1LA 4EH1A 3QU5A 5BYBA 1OFIA 5EMMA 4AQYB 3DOIA 2PFSA 1ONBA 2V3CC 2EKDA 4QLAA 3RS3A 5IZCA 2O8BA 4W5QA 4MP8A 1GXSA 4JCOA 4JP3A 4ZT3A 5JRDS 2Z2IA 1T3SA 3B82A 2APJA 2XLBA 3A25A 3F7MA 1CIVA 3OU7A 3IUMA 1PUJA 1TJ3A 1K7SN 1I9GA 4GBGA 4JKIA 4RUKA 5U4QA 2DPLA 4HH1A 3SQOA 2I91A 4CZ2A 4A91A 1O4WA 2G8NA 5IAKA 2WUGA 1NONA 1E6MA 2I34A 1B8UA 2ZP1A 4QRIA 5CM2Z 4P83A 1CKEA 5U9CA 3AHEA 4NFSA 5FQOA 2FF7A 1TQ6A 1RAIA 1VPLA 3WP0A 1F1BA 1CRZA 1OLUA 4ND1A 1Q0QA 4CM4B 3QVOA 1H2RS 1O6BA 1ZL0A 2PO5A 3NYRA 3ZWWA 3AHCA 3SSNA 5K8JB 4CU2A 4HJXA 2JFBA 2XHZA 4PS0A 3DQPA 5JQWA 5FADA 4B3MB 4FR2A 5EPEA 2WJZB 3W5UA 1RJWA 4S0ZA 2HPVA 3GN2A 1E4VA 1IHOA 1FSZA 2IYQA 3OLVA 2D1YA 4UNSA 2OCBA 4IG9A 3O47A 3W2IA 4D8TA 2WJGA 6CHYA 5I7EA 1BDHA 4HLQB 1OJ7A 1II0A 4EWLA 1TVKA 3K96A 2IIQA 3QUQA 3ETDA 2QL9A 3OTQA 1N2JA 3AJAA 3HCFA 1ZXXA 2YIDA 3TBHA 2JZNA 4S3MA 5BR4A 3FDIA 2Q3JA 2FDXA 4FI3C 4L9WA 4JU9A 1HM5A 2PJDA 1JHUA 1U8CB 1SOMA 1O87A 2GUWA 2HA0A 1H8EA 3LBFA 1N5KA 2VKQA 4IIUA 1AF4A 1GAWA 2HTEA 4JENA 1Q74A 5F2OA 5FFNA 1N5MA 2PH1A 2YJNA 3DT6A 5HG0A 3IQWA 4KIWA 2WYOA 3AKYA 1QUEA 3UUGA 2UUBB 3EVNA 3IBGA 2OHJA 3O1HB 3FTFA 4HEA1 1EIWA 5ALQA 2QP4A 2A84A 4YBZA 1MBZA 4AY4A 3GDOA 1GR0A 2CNNA 1KEVA 4RVDA 2XW6A 2OA0A 1M10A 1RMYA 1OZAA 3GGDA 4HRVA 4QULA 4ZOLF 1J2TA 3DL7A 5A3JA 1W48A 3T7KA 721PA 2GKGA 1AQUA 1DPFA 4F5ZA 1DTWB 4C0QC 3BD9A 3CS3A 1LFAA 3CPEA 3I5AA 1O03A 2WWFA 4O3FA 1MABB 3M1YA 4FEYA 3KTAA 4PYMA 1DIAA 3BWDD 3OMLA 3EQ6A 3GEEA 3TE6A 3A6GA 1UMBA 2WWXA 3IHLA 1BCRA 4DBLC 4PG5A 3SSAA 2A0YA 4WSOA 4X60A 4Y6LA 4ZT6A 1N36B 4D6YA 3I9V6 2ISSD 4EATA 1TCUA 4JLKA 3IILA 1RPZA 4HUTA 2BKEA 2DZDA 4CMBA 5CVUA 3DL0A 4RHUA 4XR4A 5KKNB 1I3MA 1R74A 4FD3A 4FT4A 5SV2A 4DLNA 4IV0A 1AA6A 2H6EA 4XQ0A 5TIIA 1PQPA 1CUEA 2P79A 4H0CA 3RW9A 2WQ6A 4RZUA 4TVOA 4YCBA 2I6QA 2C1ZA 1EQUA 2IOHA 2UZ3A 3IAS6 3A1VA 2HSEA 4MWCA 1YUMA 4JMLA 4CJXA 3EE6A 4EB8A 1VFPA 4IAOA 1FMTA 2P40A 1E8DA 3GLIB 1QIDA 1Q19A 3T1TA 4BNDA 2G82A 2HK6A 2PPLA 2CJWA 2NO1A 5TDHA 2HEGA 2DSNA 5BUZA 1KYTA 4NJMA 2V6FA 2QUZA 2YZMA 5BNFA 3A1NA 2C2OA 4JB0A 1AXRA 5DGHA 3VDMA 5BURA 2ZJ1A 4F1WA 4EL5A 3GG2A 4AYWA 3R3HA 1EG7A 4P5EA 4Q3EA 4BQIA 3KIPA 2XLCA 1RYHA 1THMA 1EK2A 4KR3A 2R7MA 2XUFA 4U3JA 1AK9A 2OAGA 4KJXA 4QLBA 1UDXA 4F8JA 1NIPA 1OTYA 2CE2X 2XIQA 1LDEA 3O9ZA 1WAMA 4DKXA 2Z1DA 1RADA 3QKTA 4TMTA 3NXSA 3HCRA 1Z2PX 2B35A 3NU1A 3PYMA 4OQLA 1OF1A 4PLFA 4WZ6A 3ICWA 4MUHA 3U4QB 1JI0A 4MJ7A 5FPHA 3FCSB 3G1TA 4UATA 3WWCA 1M54A 1U0FA 2H65A 3E70C 4N4AA 5EINA 1A8QA 1USKA 4RY0A 5FUXA 2DQSA 5FWAA 4FYJA 3DOUA 1TT5B 2AWOA 2IYUA 4WCFA 4X5OA 3TLBA 3K2IA 4F96A 2ZUEA 2XZLA 1LBQA 2V8OA 3VKWA 3M1IA 2ABWA 3H97A 4PO3X 3PXXA 4MVJP 4CN9A 3LX8A 3CUKA 2XUKA 2Q27A 3AF6A 2GN9A 5K3CA 1UDBA 1Y5LA 3DXXA 4ZEOA 3IVMA 1TAHA 3KKPA 5E3IA 2F9FA 1DO2A 2Y1OA 1CD5A 5IC5A 1ANKA 1T0HB 4HD8A 3NXKA 3HUUA 5CT5A 1EB9A 1KYXA 5CLHA 1NI4B 1WJGA 4LOHA 4RGQA 1KC3A 5FOUA 2VPXA 4U02A 4DFDA 5NLLA 1XP8A 5DM2A 2XOEA 1WXEA 3RABA 1RPNA 4PC2A 1XCOA 1DLIA 2H2WA 3AUTA 3OQPA 5DGCA 4OFXA 3KQOA 1B43A 5G1PA 3STVA 4BMXA 4D8VA 1MVNA 1E3MA 1Y9DA 1ZITA 3RU9A 3OSZA 5BYAA 3FVWA 1S7GA 5GOTA 4ZZ3A 1MW8X 5T6BA 3OU6A 2FX5A 1P73A 1SHJA 1L0BA 2ECFA 3TFWA 5L9AA 4OH1A 3V4FA 1E1RD 2JHFA 3E5MA 3BMNA 4QO8A 1S7CA 3KL4A 4FYIA 1I1QB 4RTNA 2HNBA 4GSKA 4Q24A 4ZCIA 1R18A 3ENKA 3HR4A 3OLWA 1FFWA 1HDIA 4UCFA 4H7FA 1EFUA 1JB1A 2FW7A 1X1BA 3SU8A 3VNVA 2QX9A 4WA8A 5G4LA 4NK4A 4XD7A 2HD4A 5BSVA 4KFCA 4YY3B 4I50A 3U39A 1FU8A 3KYIB 3U44B 3EMKA 5AW0A 1H2ZA 4WPGA 5KQGA 1CP2A 5A0FA 3CSSA 4JLAA 3LJKA 1OCEA 2JEOA 3FFXA 2A4MA 2QYSA 2OWEA 2V9CA 4L7QA 1A2QA 4MB0A 4PR0A 2VVTA 1GGJA 1SG0A 2BW0A 1L1RA 3L43A 4EGAA 1U3DA 3K6SA 5GV8A 4P1ZA 1ESEA 1WW2A 1ZM9A 2B2NA 4PCVA 4E51A 5KTSA 3I2HA 3AM1A 1YQGA 3NIBA 1RAGA 1ZMRA 4JUCA 4A8JC 5FJJA 1GPBA 1AMUA 1KPGA 3AUFA 3GFPA 2X8LA 1GAJA 4ITVA 2IZ7A 3JZIA 2QIPA 4FSHA 2R79A 3AF5A 4ZJUA 2ZZNA 2A14A 5BNZA 2RI6A 1HLPA 3OIWA 3GV0A 1OLUB 4TLEA 4ZO8A 4HAUA 1DZ3A 1XD9A 1E62A 1VHQA 3BHNA 2BEJA 4JNCA 4NHEA 2EHDA 3LI2A 1R12A 2PMFA 3I2GA 4ALKA 5KUTA 2CMGA 3C3CA 2FLKA 1S1CA 5TF0A 2WHPB 3ZY4A 1QJCA 3PQ7A 5KU1A 3I3OA 5AVKA 1QE0A 1NUSA 3N3AC 3NCTA 5G41A 3EYAA 2I2XB 2Q9UA 1JMKC 3NAZA 2PZEA 4MLCA 3Q3HA 4REOA 4J3NA 3DAGA 2CD7A 5G0TA 4DYVA 1T1IA 1RRMA 2O1WA 2AQHA 1SVOA 4UOQA 3DD1A 2Y66A 2AQ8A 3A28A 4FKZA 1M33A 1D8AA 3QF7A 3ZYZA 3NH9A 3BIJA 4U0KA 1LVHA 2HT6A 1CUYA 1H9AA 4MEBA 1DV2A 3CGWA 4BNZA 1KOJA 4A8PA 4M8NE 3O8DA 1IN4A 3SBEA 4DPMA 2E55A 4ALMA 1OWMA 1W19A 3INGA 1Y7HA 3MAJA 3RJ9A 4UEOA 1HZZA 3O2JA 1CQJA 5BSTA 2ZIWB 2QV7A 1UQRA 3U7QB 1A8IA 3SM3A 3AEXA 4H0FA 2VAMA 1UJ2A 2PU7A 2PT6A 3JWJA 1HDZA 3D4BA 3HU2A 4FE4A 4Z9FA 5I9SA 2ZIVB 4C4RA 5JO9A 1JEQA 1G42A 3RK1A 4ER3A 6AT1A 4G0WA 3PC6A 2GOYA 2JLQA 2P9QA 5T4BA 3IQZA 5KAPA 5K0TA 3GB9A 1C1HA 3T5BA 3GA0A 2IHJA 1XCMA 2NACA 1U4OA 3TQCA 2YY7A 2A1UB 2JJ2A 1G3IA 4NBNA 1M1ZA 4ZT4A 4ZJZA 3E4DA 4QUDA 2W6JA 1AQIA 1LB1B 4KDEA 4O4JA 1LWNA 1I94B 1L7PA 1H0HA 3N9IA 1FXWF 2JPDA 3CZAA 4HVTA 2CVPA 4KNVA 3K0SA 1XVAA 3VI4B 4TRNA 4B81A 4EHLA 5JYCA 1KVUA 2HWUA 2H4YA 5BWLA 1ZWLA 3Q7RA 4AXXA 4BVLA 2D00A 1JKJA 1HNXB 2GTIA 4M38A 3T34A 3EVFA 5C7IO 3GC6A 2Y4OA 3A37A 4JKYA 4HDKB 2JH8A 1EFPB 3FOWA 4PXSA 4RMGA 4CTKA 1N6PA 3F2VA 4BVGA 3KKKA 4EZBA 1P8AA 2JEYA 3CNBA 2GO1A 1NW3A 5T4HA 5KQRA 3GQBA 3H9JA 2V6JA 3AM4A 4WXHA 1L8QA 1R8YA 5DISB 4BWVA 1J49A 1PTJC 5TR9A 2RJNA 2Z8YM 1OBCA 3L7AA 3UPUA 3H7AA 3WK5A 1EXVA 1NY5A 2CB0A 2ZYIA 3IAM6 5DU2A 3LPNA 2WTUA 4DJDC 3QVUA 1ZQ9A 2I6FA 3CB4A 3ZV3A 2FVXA 3L4BC 4MYCA 1MIOA 2Q1XA 4JEHA 2DKFA 1FA9A 4EUHA 3KCNA 3LYUA 3MUOA 1EZ4A 3P1JA 4YS6A 3M4ZA 4NJMB 1PS8A 4YXWA 2YQ4A 4KV9A 3TZ6A 1GKYA 3USES 3ZW7A 3NDPA 4RA6B 3EBPA 2J4DA 2AFIA 3O8QA 2B1GA 4IICA 3N53A 3R44A 4MRMB 3TTWA 1UADA 3B1YA 4GIBA 4TT3D 3BCHA 3MWEB 4GZMA 1PWHA 4QGHA 3GRRA 3H4TA 4FVTA 1WO8A 5ECDA 3OQBA 5KMGA 3HMKA 1T9KA 1XTQA 3LGXA 4WADA 3S2IA 1EK1A 3QPWA 2VDNB 3P4YA 3CW8X 2IS4A 2NVWA 4M88A 4A03A 1U3WA 1W96A 2HCFA 4M1TA 3UH0A 4M1KA 1I7QB 3F0TA 4BNLA 1UXIA 5JROA 1QRUA 3G85A 1I30A 2X2OA 3O2QB 3C15C 4W1QA 2K2WA 2W0SA 3HKDB 3IPXA 3PFGA 4ENVA 5FWYA 3UFBA 2L0XA 3KKNA 1ONOA 2YV1A 3SCZA 1L4LA 2BGNA 3EEOA 4IXMA 2WIBA 3SR3A 1PG5A 3W1EA 5BNWA 4UEWA 4TMVA 5LNK6 1ZPDA 2Q21A 3O8LA 1PW5A 1DEXA 2WNSA 2WU3A 5FBQB 1V0JA 3ROZA 2C99A 2O9JA 1T29A 3SKYA 1BIFA 3GRKA 2BFEA 2WT9A 3M5PA 1UFQA 4EHNA 3TL3A 1NNSA 3PFCA 2QT0A 1F6WA 2G0AA 4DQLA 5ADVA 4JEUA 4Z7NB 1W6RA 4HFRA 4KRGA 1C14A 1QYXA 3F3YA 3OUZA 3Q88A 4ONEA 4P3YA 3PXGA 4CDGA 1S3FA 3BCSA 4JSRA 3ZGNA 4QPCA 4E31A 5ITVA 4NPCA 1PK7A 2FFAA 3QKRA 3BRSA 4G86A 3AWDA 3WYCA 3O91A 1LH0A 3JYNA 4OB8A 1B0AA 2CNKA 3BN3A 3T3IA 5CX1B 1BC5A 1SURA 1SEVA 1OZFA 1KZGB 3OZTA 1JB9A 2G36A 3ILXA 1IFXA 3ICVA 1IZ7A 3PQ4A 4NC9A 5G0WA 5L4NA 2O5EA 1XJQA 3AL3A 1OASA 3HS3A 3IQHX 1EDDA 1KC1A 3ONNA 3WFIA 2XDQA 1EGVB 2CHEA 2QUBA 1IQUA 5DOZA 1NNLA 3M82A 1JT2A 3HGMA 3C74A 5B4TA 4PYRA 2NXJA 1U3GA 4GYKA 5JBQA 2H1IA 4JD5A 4MHTA 3RVMA 4WOPA 1R2QA 2FZWA 1D6MA 4QGGA 3RVQA 3VPBA 4HNUA 1GPLA 1AK1A 1SXHA 2J5XA 2QX6A 2I78A 3IAUA 2J3QA 3OKCA 4CTOA 2Z6QA 3G68A 1QHFA 1JSCA 2P5YA 1P9OA 1OY1A 2N0SA 1H1TA 1TZJA 1Z26A 3FI9A 5FORA 3RK4A 4R9SA 1GU7A 1EUDB 1L4HA 1REQA 4E30A 2IYEA 1RPAA 3H9QA 3GYGA 4KE6A 1LDBA 2IEAA 3B85A 5DIZA 4EUKA 2CL0X 5KJ6A 4CM5A 1HFWA 1H0KA 4FMCF 4Q1BA 1GZSA 1Q5PA 1SBHA 5BSUA 2BHSA 4ESVA 5E3JA 3QQPA 2HV9A 4KAAA 2ZREA 2YDXA 3GJ4A 4ZPJA 2BE9A 3JYQA 2YV4A 3KQTA 1X1QA 4UM9D 4QUHA 3I45A 3FUCA 1QP0A 2Q6LA 2DFPA 2HBYA 2WR8A 3EODA 3ZCRA 3RLFA 2QG9A 5BRJA 5LZ5A 1FVXA 1P7VA 4D9MA 1P44A 1QRSA 2ZTHA 5KNDD 4BXOB 4FI3F 1Q0UA 3FBGA 4B1FA 3EUAA 3MCZA 4ZC1A 4KRYA 3B5JA 3RODA 3AVUA 1F20A 1YK0A 1BHSA 2Y1EA 1GT91 1TJNA 4YFYA 1TUBA 3UV6A 2QRNA 3WV4A 4NU6A 1MENA 1NSYA 1R5JA 2YXNA 3GT4A 5KTPA 4I5GA 1GP2A 2IEZA 3W7AA 1HTWA 1QIJA 2IXGA 4P08A 3PC8C 5KSYA 2CK3A 3HLYA 4FEEA 4MVYA 1OXSC 4CEHB 4RTKA 2JFFA 1W2GA 2XOKD 1B1CA 1ENPA 4OI1A 5L4LA 5IT9A 4YP1A 4DYDA 4A5SA 3HXOA 1C7RA 3NTOA 4L8VA 2ZEJA 2DLCX 3ZBTA 3NT2A 1QIIA 2NZUG 2B8TA 3D1JA 4J6EA 4DWWA 5B30A 1EVEA 3FTEA 3GUZA 3GAZA 4H1VA 1R9JA 2W71A 3A04A 4HLUA 3C3WA 3QXSA 3PICA 1R3DA 4TN5A 4ZI5A 4F6CA 3UUWA 2DMRA 3T0FA 3EEFA 5EJ6A 1ZINA 3BGOS 1GZ7A 2YBEA 3B51X 3D4OA 1R0CA 4WLNA 1GZ6A 1OXBB 3TDKA 2BTEA 3VX4A 2VJMA 3CWCA 4HGOA 3VO2A 3ZHCA 3NC0C 1KEEA 3LH5A 1XROA 3ROQA 2VBFA 2FN7A 4F3CA 5B37A 6REQA 2H2IA 1UAGA 1OT5A 2V5VA 3W8DA 4BQEA 1XQVA 5C34B 5THQA 5LQJA 5E2AA 3OF3A 1L7RA 3MT9A 1RCUA 1K27A 3LZDA 2OFXA 5GIPE 3DYIA 1IN8A 1A9TA 1QH9A 4E2WA 1UPUA 1Y0BA 3Q9LA 2A0WA 2EP7A 2FG7C 1ODKA 1JLLA 3FDXA 3LYHA 4KI7A 1NVVQ 4NEQA 1V8OA 4PPYA 2VDWA 3RU3A 3K4QA 2XDYA 4ZQGA 3BZBA 3UQZA 2IBMA 2AUMA 2VATA 3LKZA 4JOQA 1LI5A 3ORYA 3NTVA 1UM9A 3H8VA 3IUNA 1TU0A 4LYEA 2ZBQA 4DUYB 4FUQA 5CJ2A 2EZ8A 1D2NA 1DMSA 1P7ZA 4RA9B 3DTNA 4E2FA 2PUVA 1XG5A 2VT7A 3BHIA 3DMGA 5AVVA 1GO2A 1QH1B 4PYNA 3FCXA 4GLOA 2BFDA 1PSWA 1F4PA 4BFZA 3H2HA 4RDIA 3S7TA 5F1KA 5JH7B 1KBZA 3E2IA 5KDLA 2QD4A 2EEZA 4GMDA 1XPUA 4OQFA 2GBIA 2JZCA 3K0FB 3LHIA 2J0SA 4KQMA 1AHHA 1ISMA 1XUOA 4HDKA 3PIRA 3L8HA 2HMWA 1TUEA 3MLAA 3F9CA 1E89A 3L8GA 1EA7A 1GG2A 2ZJ8A 3HKBA 1QJ4A 4QU9A 5LD2C 2CL7X 1OB2A 5HTKA 1P2SA 4Q01A 3DJFA 4NXMB 3WWYA 1XU7A 1Y63A 3D5QA 4ON9A 4XX0B 3HZZA 1ZJ5A 2QQGA 4JLPA 3D02A 2ZRQA 1UK6A 4J0QA 4EW1A 5HIKA 5HRUA 1ZYUA 4H7DA 4K9RA 2G70A 3QZUA 4JGGA 3FDZB 3QLVA 3O4RA 4FNOA 5I51A 2MCFA 4PZZA 1LDMA 4DIBA 4QM6A 4BTLA 2AX3A 3PC7A 2LIPA