1VYHA

Paf-ah holoenzyme: lis1/alfa2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
218
Chain Sequence
b'SNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB BETA SUBUNIT
publication title Coupling Paf Signaling to Dynein Regulation: Structure of Lis1 in Complex with Paf-Acetylhydrolase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 72
structure length 218
sequence length 218
chains with identical sequence B, E, F, I, J, M, N, Q, R
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1vyhA00
3KVNA 4OAOA 4JGGA 3U37A 3MILA 2WAOA 4HF7A 5BN1A 4JJ6A 3SLRA 1BWRA 3DC7A 2WABA 2VPTA 1J00A 2Q0SA 4H08A 3RJTA 1PP4A 1VJGA 3DT8A 1ESCA 3DCIA 3BZWA 4Q7QA 1IVNA 4I8IA 4IYJA 4PPYA 5HOEA 4TX1A 1ES9A 1FXWF 3C1UA 4JJ4A 4K7JA 4LHSA 4S1PA 1ESEA 4K3UA 2W9XA 3SKVA 1JRLA 2APJA 4RSHA 1DEXA 4RW0A 1ZMBA 3W7VA 5CD9A 1U8UA 1YZFA 1WABA 4DEVA 5A4AA 3DT6A 3P94A 1BWPA 4K9SA 1K7CA 3DT9A 1Z8HA 2Q0QA 1VYHA 2WAAA 2HSJA 2O14A 3HP4A 4M8KA 4XVHA 1FXWA 5JD3A 1DEOA 1V2GA 4NRDA 5B5SA 4JKOA 4OAPA 4K40A 1BWQA 1ESDA 3PT5A 4HYQA 4Q9AA 4JHLA
chains in the Genus database with same CATH superfamily
1JKMA 3V9AA 5H80A 2QS9A 1T9AA 3FDZA 3I64A 4O8CA 5H81A 3VC1A 4F2PA 5LOVB 2YFHA 2VTDA 2JEZA 1KDVA 4BNYA 4G5XA 5BR8B 4NNOA 4F2HA 3T5DA 2VATA 3WIOA 3G8BA 1Q1BA 1R2QA 4W9MC 5BRNA 3UG6A 5JZMA 1N2CE 4Q3BA 2VP5A 1WCWA 1PGPA 3RU2A 1AGRA 5F12A 5B3JA 4EB3A 4QTYA 3TAHA 3TKAA 2G0TA 2XBUA 4JD5A 1Z0ZA 2GXUA 4DPKA 2Z6VA 3S8MA 3SLGA 4LFCB 5CB4B 3CXRA 2DHEA 4HR7A 3NHPA 5AKXA 1BC5A 1UMCA 3KJZA 5DYWA 3UJCA 4J4BA 3E3NA 1FFAA 3T06B 2ETVA 3EC1A 1DEHA 4UM5A 5CB0A 1DBQA 3K0CC 1Q7BA 1RYYA 1XWIA 5LL6P 2ZUTA 1R0YA 2ZLBA 2WSSD 3RT9A 4JUCA 3ADKA 1OBCA 4G56A 2A9FA 4Z3OA 1KYYA 3DE6X 3GR6A 3I62A 4RQTA 3H2JA 2Z6UA 2W2NA 4B6JA 5AMXA 1QAMA 2QTMA 3CPJB 3HA2A 4O6VA 3ZTYA 4IDHA 4EVIA 4NZPA 3FR7A 1A8HA 1I2CA 1ZOOA 1EXDA 4XJTA 4FNAA 2YJ3A 2JPDA 4J7UA 5IDQA 2AI1A 4IXTA 3CUTA 3E82A 1C7IA 1PLJA 1T36A 2AVNA 1QIEA 2H48A 2QPOA 2PR7A 2ZSJA 3CR8A 3N0WA 4JP1A 2YWEA 4NVRA 5J4HA 2XIQA 3CZMA 2ZWVA 4M87A 1RXWA 1AY0A 1L9XA 1QIKA 2NO0A 5AW9A 3S55A 4MR7B 2ADOA 3SOPA 5DNCA 2QAJA 3I83A 1CRZA 2VHTA 5AJVB 1WF6A 4DIDA 3BFXA 3BE8A 1KSHA 3RHFA 2VHYA 4Y30A 1LA2A 1PL7A 2R1TB 1PX0A 4UMVA 1U8YA 2AZMA 1F12A 2FEWB 4HEJA 1UBUS 4RJIA 1LFAA 1WLSA 3WDMA 3WNCA 5ECDA 4KK4A 3ZUPA 1WWKA 3GT4A 4Y9SA 2BGKA 2FYTA 2VJMA 4L4YA 4WY2A 4B7ZA 1SVUA 3LDFA 1FFEA 1DBIA 2W8ZA 3LM8A 3Q1KA 4L6IA 4X3OA 4DJJA 5LLTA 2DP4E 3UMGA 5K2OA 1N2XA 1U8CB 3W05A 3RJ5A 1UDBA 2WUFA 2H7VA 3AEUB 3R0JA 3FFBA 1E0JA 5IJXA 4H0NA 5BQPA 2F1OA 7MHTA 3AL3A 3AVQA 4W9RA 1YA4A 1Z6AA 2J85A 6CHYA 3DTVA 2V8BA 3HKEA 1Q6ZA 1KARA 1TAHA 2G77B 2FPPB 2YNMA 3CLRC 2JBAB 5TRTA 4HATA 5ETJA 3UEOA 3U7FB 2E5LB 1DMSA 4CETA 3BMXA 2R7NA 1RWVA 3WZMA 4DQVA 4MYTA 1GRVA 1XVLA 4B3JA 3DHNA 5KSWB 3V46A 2RB5A 1Z29A 4HNRA 5AVVA 1BO6A 3L1KA 1WXHA 5H82A 3PDWA 3L4KA 4BC1A 1XA3A 3KQOA 3M1IA 4ZZIA 1VHQA 3BGDA 1CJTC 3GJ4A 1HQDA 2YZKA 3L8HA 4Q47A 5EKSA 3FKSD 3RJ9A 4LY6A 1M67A 1U8ZA 1LSOA 1TKAA 1T1JA 1V41E 3MLEA 4UMDA 2DXIA 4O3MA 2F64A 1WX1A 2GESA 4GECA 5JANA 2HMTA 1SKYB 3K0HA 1U7DA 1GXSA 4I6GA 1DKPA 4YP5A 2A88A 4DPLA 5CB4F 3PF9A 3T94A 1URPA 1S4MA 1NVVQ 3ZHBA 3NWJA 1LPOA 2P9ZA 1Y1SA 1GTL1 4GQAA 4ZYXA 3KB6A 2BEWA 2VTVA 2IPMA 4PAMA 4POAA 2P91A 4BKUA 3BZBA 3H3XA 1QVAA 3OA0A 1Y4SA 3V4RA 4BY9E 4AKHA 3U31A 1JTEA 3LYAA 1JIXA 2H65A 2GAFA 1Y34E 1P60A 1OGJA 3CINA 3KL2A 4M9SA 4BFSA 1ZNWA 4F91B 3U1TA 5BN3B 3VHLB 4OX9Y 3U39A 1IFXA 1QAQA 1LPMA 3RIYA 3ZIUA 2J3MA 1NYRA 1PFVA 2R5WA 3H8VA 5I4BA 3NV9A 3N2KA 1R0XA 4NE2A 2HJSA 3DTTA 1AGNA 2VOJA 3LAWA 2WVAA 3ON5A 3IVCA 3UFXB 5C5IA 3IO3A 1QTRA 3BMOB 3KUDA 1KOJA 1NSTA 4HEA1 3TNJA 2ZYGA 3GLIA 3O47A 1TO6A 1L5GB 1JIIA 2YH2A 1CQJA 3HV0A 4HDRB 3ZK7A 1RXEA 1SCUB 3QPCA 1Z68A 4HP8A 4O5AA 1PR2A 4ND4A 4BVHA 1U90A 4GM0A 4D79A 4EENA 1GITA 1RFLA 4IRMA 4EMBA 1T0BA 2YHAA 1VBMA 4Y0VA 4QULA 3FUUA 2PKRA 4TMWA 3R7LA 3IQGX 1N0UA 2NU6B 3RG2A 3FYUC 3I9MA 1F6DA 2C3UA 2QN1A 1VXRA 2IJGX 5L51A 2YOFA 4BDTA 1G20E 4QUGA 3W0LB 2JAPA 1W46A 1NMXA 5DP2A 2RGEA 1DAKA 4BNFA 5LKAA 2E4AA 3A4YA 3CF4G 1LRKA 1RKBA 4EITA 4Y2TA 5IRCD 2OVBA 1QHHA 4ROSA 4E1AA 3CCBA 2WIBA 1ML4A 4YONB 1EZ4A 1QC5A 3RSFA 1U5BA 2VSNA 5DM4A 1I2DA 2VQSA 1P1HA 1B0ZA 3FOAA 3AY3A 3L7JA 3OURA 4YCMA 4IDAA 4NBTA 3TXXA 4FE7A 4J4HA 4GI2A 1TKRA 4M7OA 4NEGA 4BO3A 2FW8A 4DLTA 4EF5A 4F6RA 1FXSA 2GD1O 3P0HA 2HW8A 1U7XA 4TWIA 1Y6RA 3IL2A 4YCDA 5B1HA 1F8FA 1R0BA 1R4ZA 1T2DA 3ZQJA 2E4WA 3LQ1A 1E2DA 2WRZA 2WIAA 3HFGA 3PQ2A 1QZZA 4WZAB 5JDCC 1V3QE 1T25A 4X20A 4DV1B 4H7EA 1P0PA 9GPBA 3U9TA 1IRIA 2FEXA 4XDGA 4C2UA 2CN1A 5F9FA 3DUFB 3Q88A 1TJ5A 1USKA 3NKLA 4BFUA 1WUJS 1EYZA 2B21A 4H7DA 3MBOA 5KTYA 2GT1A 3ETJA 3BD8A 3FG9A 4K81B 1A9RA 3HDYA 1AMNA 1GTSA 3IUMA 5IUNC 2HNKA 3QUSA 1SUCA 5AI5A 4Z4IA 5DM2A 2ON6A 1GSHA 4IUYA 1SR8A 1H1TA 2Q9AA 1T5LA 1RCUA 1U04A 1MN6A 3D0QA 1FP4B 3V4VB 1U6IA 4OFWA 1BWQA 2RFLA 4RD3A 5AI4A 3X0DA 2QUJA 1ZN2A 4CQNA 5M2QA 4B74A 1CRQA 3G17A 3TLGA 1TCAA 2X7HA 1T5OA 3NIDB 4O4LF 2E5FA 5DWDA 3WTCA 4JNKA 2O8BA 3WDSA 3S2UA 3WAGA 1AQJA 1Q7TA 1NATA 2EBUA 4XCQA 4Y7DA 3AY0A 3I28A 4IQFA 3PWSA 1CE8A 3QKSB 3FTDA 5L3ZA 4CPDA 4DM7A 1Z07A 4Q3OA 1JAYA 2G6TA 2CXSA 2JIBA 2IUTA 3OTGA 1TO1E 3TQSA 2W2LA 2QRUA 2FPOA 3MG9A 1BHSA 3MS7A 3LPCA 1R74A 4IF4A 4JC0A 4Y0AA 3I0MA 2ZIZA 3OIWA 4MRPA 3F9CA 5CM2Z 3AFOA 3MT8A 4I1IA 4UBLA 4YUWA 3BCSA 2N46A 1KL7A 2CL0X 2QVZX 3V3TA 1YQXA 4CF6A 5HFAA 3SOZA 5LWQA 3RGGA 3LPDA 3H04A 1O95D 3R3JA 5AUQA 1QGAA 1W94A 3FN4A 1K6EA 4OFZA 3CG4A 2I7XA 4V03A 3UJNA 1VMKA 1I4LD 4R9NA 1SCNE 3SDBA 1K1EA 3W9BA 3C7KA 1B7GO 1VSTA 3TW8B 3O0TA 4ZYZA 3D8RA 1OTXA 3BHNA 1EK1A 2QZJA 4A8JB 2P40A 4X1KB 4PIVA 1LBTA 4K46A 2PS1A 3A6JA 4QBIA 2BYTA 4EHDA 1EUCB 1EFUA 3MS2A 4RVUA 3THXB 3VPCA 2HXYA 2E48A 1WZCA 3EVAA 3F0TA 2BI7A 4QTTB 4MVJG 5DOZA 5C1BA 5CVTA 2CNNA 3FOWA 2OK7A 3AR5A 1T29A 3HB4X 2GPYA 1X13A 3C1UA 3GGDA 4B4OA 3HEAA 1XTSA 3IA7A 1P31A 1RE1A 2EV9A 1P81A 3F7TA 3SFZA 4EJ2A 5FFMA 1EFRD 3JVEA 3T8YA 4YT5A 3EFOA 1FMJA 1EE9A 2H1SA 4RESA 5EY5B 5TC4A 2ZZNA 3SSNA 4MW5A 1H4QA 3P9KA 5CRIA 1A7JA 4AO6A 4CF4A 1DADA 1KO8A 2Y77A 5G0VA 4A2WA 4E11A 2JIMA 3HVRA 1DNPA 3L0ZA 3EJ6A 4K9PA 4OQ4A 3RLFA 1TEVA 2QRVA 2VTEA 4ZZ1A 2QBYB 3LUBA 4CM1A 3RFCA 1BEZA 1YL7A 3GC6A 1BE8A 1SU7A 1ZONA 4JJEA 4K28A 1TO2E 5UKDA 4ZVRA 1GZ3A 4BNHA 5A05A 2J32A 3OFNA 1KU0A 3ILVA 1RDFA 2B20A 1Z3IX 2D5LA 3KZNA 4MRVA 4YC7A 4ZAZA 4ZOLB 2QIPA 4TXJA 4CMGA 3K3PA 3NRBA 3VNVA 1R8XA 2AOUB 3NLLA 1OHHD 1R9NA 1VFPA 3NB0A 3R20A 3JD3A 1NNUA 1V8BA 4LSZA 1EMDA 1WV1A 1NAHA 3LT2A 4I1UA 3F90A 1Z08A 1Y7PA 3ESYA 3NCTA 4IZHA 4MVJF 4PXAA 4E3WA 2SBTA 3EUWA 2QMQA 4CE6A 5HTOA 2JEYA 1KHHA 4AECA 4BJ1A 3EF0A 2ZUCA 1HFJA 4UVDA 2RGCA 2PMBA 3ZH9B 4C1BA 1W1UA 5BWOA 4C4SA 4NFHA 4PHFA 1QORA 5SZKB 2GRUA 3GCGA 3OVMA 4BQRA 4Q19A 2F55A 2P79A 4J49A 2EFHB 3DJYA 4GLBA 4CLOB 1PL8A 3IV6A 4BAUA 1NXVA 1ZGBA 1EE1A 1HDCA 2YMPA 4KP7A 4XA8A 5EE1A 2QTAA 4JUFA 4R6WA 1IBKB 2DFPA 2FZWA 1JDBB 2WM8A 4K2HA 1L5NA 4DB2A 2G08A 2HQSA 1JLHA 5BNIA 2CLDX 3HABA 4FBGA 3W2IA 1LWNA 1V16B 4K1XA 2V0CA 3DBLB 1JPNA 3DZCA 2GN8A 1YDEA 2AJ8A 2XDWA 2W0SA 3IIKA 3P9SA 3WA6A 5A2QA 1UBEA 5F64A 2Q3EA 3KJGA 5C0OE 4BGUA 1N2EA 1RBZA 1W9HA 5IKPA 2R6R1 3GAAA 3SAJA 4NS4A 3AF2A 4P7FA 1X8XA 2NVOA 2ZSIA 1YVUA 4MUMA 4MYHA 4UULA 4CLHA 3IDFA 4NHEA 4DCGA 1CU1A 2HUPA 4HEQA 3K9HA 1ORDA 4GWGA 1E69A 3IKVA 1RRGA 2C3PA 2PMWB 4BNIA 3SGLA 3RYIB 2I34A 1QGYA 2GFHA 3L02A 1RXCA 1RR6A 5TQJA 5FLYA 4OG2A 4BMPB 5D5QA 4UCFA 3U5ZB 4LNHA 4JOCA 5ALIA 4B76A 4LJAA 1U81A 2CUKA 2PSFA 4CIWA 5JRDS 5CT6A 4ZCQA 1V8ZA 2P3LA 3VNBA 4D4MA 4YT8A 4S1OA 4JI0B 1OXKB 3ZWCA 5IVDA 1KI8A 1MIOB 1NF3A 2B0JA 3IT3A 4MRMA 4PN3A 3HB1A 5CXUA 2YVAA 2IP4A 1ZXXA 5JRZA 1FU7A 1KS2A 2ZULA 3K5HA 1RI5A 3E03A 4UC0A 5B3KA 4Q03A 5FCDA 1J8VA 4NE7A 1GU0A 4A03A 4NOMA 3F5DA 2XXBA 3UWDA 1YU6A 4PLWA 1WMEA 5HQ3A 4XGNA 4LGMA 2AH5A 2XEDA 3P4YA 4P4GA 3ONNA 4D8UA 2BZSA 1TYCA 2IKSA 5ALTA 2B8EA 3GH1A 4KPUB 3UJ3X 4TKVA 1RXSA 5IHPA 4KVGA 2GZMA 2L18A 1H2AS 1Y48E 3QIVA 1KMHA 4OL0A 2IUUA 2RGDA 3FBGA 5C8DA 5IFKA 5LU8A 5AK6A 1WB4A 3WP1B 3D2CA 2W43A 2FK8A 2CL7X 1SOWA 3OEHA 3PJGA 2Q3HA 4CI9A 4RHXA 4RTRA 4CMEC 1XA4A 3AF4A 2NUTA 2NSLA 2BHRA 5D84A 5DXAA 1CTQA 4YRLA 4ENSA 2D59A 3AR2A 2Q3CA 4FHDA 1QCDA 1YI8A 1FDVA 1ZUNB 2AFRA 1ONSA 3OSZA 1YS9A 4L0QA 2I9KA 1NQWA 2C4KA 5T3YA 1VYUA 4YYEA 4OYYA 1Z63A 2HA5A 3UA3A 5BXYA 5DLEA 4B2YA 1CJUC 3OEEA 2FA9A 1CEEA 4OQQA 1P1BA 4FMBB 3TSYA 2J48A 1XMXA 2C1EA 4X6YA 1RS0A 1V5IA 1D9ZA 5L3SA 1N5DA 2YINC 3I6QA 3AI7A 2MSCB 4O3FA 1MQ8B 2BFPA 2AMLA 5DYGA 3PNSA 3WNQA 2VK1A 2WD9A 1KBOA 3IUNA 3QG1A 2QPTA 4TM8A 4O4HF 4UBJA 5LUBA 2CJWA 3NORA 4XDYA 2R84A 3VJMA 2IH2A 3AY7A 3A6DA 1WDLA 2G5GX 3PBKA 2GCEA 3HUUA 2OBMA 4N8DA 5CH3A 3UUWA 3WZ2A 1N92A 4QSMA 4BUCA 2PNJA 2EWWA 2DCMA 1NW6A 5FBWB 2YRFA 3NP9A 1BKSB 4RZ3A 3O3NB 2VYNA 2YR0A 3CC8A 4AICA 5JBQA 1ATZA 4RYDA 5L7YA 1JUDA 1XEAA 5JSKA 3GN1A 4U7FA 1Z47A 3OZCA 2EP5A 4G8JA 5G3ZA 4Q4JB 4NSNA 1XZHA 1DXQA 1SVKA 3D5QA 4NZOA 4NDNE 3ZU4A 5FBHA 4ZYLA 3A31A 1N75A 1CDDA 3IVGA 3VNRA 3HBNA 4R2JA 4RMIA 5B6JA 2EERA 1X7ZB 3EDYA 1EP9A 4TVOA 2C03A 4W6ZA 2WUGA 4IHKA 4PGFA 4PX3A 2FEMA 3HA5A 2IPAB 2ZIXA 2GARA 1H1LB 3ICCA 1NKTA 2DUMA 2QVCA 1N4DA 2QM8A 3QWBA 2O6LA 1LS1A 3KKPA 1HDRA 721PA 4UD2A 1DFIA 2OHFA 3VR5D 5B2FA 4KRYA 1F06A 1ZNQO 5ALXA 1N1EA 1OH6A 5GZ3A 1RE0A 1ANKA 1MFPA 1EE2A 2X2EA 4M8SA 5DBOA 3C7TA 3T7EA 3Q3GE 4N9QA 1SHUX 3NH9A 1XWWA 3GWZA 5TVGA 3VYTB 4DMMA 4W1QA 4P5EA 3H3JA 1Q0RA 3KOZA 4LKOA 1HDYA 1NONA 4FMDB 1CF9A 4Q4HA 4RGYA 3KKNA 2JFNA 3DOCA 3IP8A 3TM4A 5DYYA 1IRXA 2CW5A 2BM8A 2X13A 2A0WA 3D0RA 5FLEX 3WL4A 1G5RA 2PRIA 3EVBA 5IAJA 1TB4A 3L93A 2B83A 2ZDGA 1NBMA 4MGIR 5DNAA 4UTZA 5M7EA 3WLHA 2RHJA 2VSQA 1X1CA 2Z1DA 2AKEA 4H6WA 3LI2A 3AWIA 1OFGA 1Q2XA 2C9OA 2HMYB 1EU1A 3ZOZA 5JBIA 1DC8A 5AXBA 4O5OA 2ODBA 2W6ID 2I54A 2PKYX 1LQUA 2J46A 2VKTA 4IXDA 1NVMB 2ZYAA 4AP9A 5ITSA 3MTAA 1BXRA 1UFKA 4DIEA 3EIUA 3L1IA 5JT1A 1E8MA 1ULHA 2D8MA 1OILA 1SB9A 1G0OA 1ND5A 2ZWIA 3CLTC 4G9EA 4TXMA 1JR6A 3VH4A 5KQGA 4MS4B 3LLMA 3SX0A 5C52B 4B84A 4CBVA 4BX9A 3ZCPA 3PC3A 3IAAA 1DG9A 3ZU2A 5A7HA 4WOCA 3L82B 1MVNA 1A5AB 4PGMA 3QTLA 2CGEA 5LYJA 1DKOA 2V1UA 2DUJA 3Q3CA 3H2HA 4Y6PA 3MRXA 2ZBQA 2QLJA 2QD5A 2O2JA 4MV9A 1E0KA 4UM9D 4E0BA 1KJYA 4LJ4A 1AHNA 5ALSA 4GP6A 2YC4C 5DM0A 4DRXB 2HLDD 3GVXA 1NU6A 3PICA 2R7MA 4U39A 2OCKA 5JD3A 3T5PA 2QMEA 5H4GA 3HUTA 2REXB 3I8OA 1SO8A 1UBJS 3PXCX 3URMA 4DN6A 2CZGA 2NUAB 3ABIA 3A9TA 4XIYA 3IAXA 3RYHA 2XIJA 2OAP1 3Q9NA 4MROA 1J1ZA 1Y80A 4C6SA 1RQ7A 3K1YA 4EW2A 1TZJA 5I9LA 1NWCA 2VDQB 3DVAB 3U5TA 5GONB 3ZZ0A 1ZGGA 3Q3EA 2VF7A 4H6PA 1UKYA 1T15A 5FTJA 3OIVA 3W5CA 4BNKA 4KR3A 4DNXA 5ALYA 4OK6A 5FKJA 5I7SA 5HJ5A 2ZFUA 4AUKA 4A36A 4FJ1A 3DKVA 4IGIA 3F9RA 5JASA 1MG0A 5JTTA 4KAXA 4KNYA 4FONA 1JWLA 2PX5A 3QYFA 1RTTA 5KBYA 3A3NA 2XWSA 2YDXA 3QELB 4F92B 1IN8A 3OZIA 5LCXA 3C3WA 1W25A 4GKVA 1OI4A 5JS8A 4S05A 3QUTA 4BB6A 3K6SB 4FS3A 5ICFA 1ZVVA 2PCLA 4JU9A 5FOUA 1CZKA 3Q2KA 5ALOA 4MCJA 1HPLA 4NCBA 1M2EA 1JDSA 1MB0A 2XMGA 3JAKA 5AVOA 1BRTA 2WYWA 1IOWA 2P1ZA 2P9JA 3N7UA 2F17A 2EAUA 4I4CA 3HJTA 1GL9B 1X74A 1UBMS 3H8WA 2X42A 1GTZA 1A9YA 3FCCA 5EGSA 2C2XA 4HZUB 2OCBA 4TSKA 1VCIA 5JNLA 4ISBA 5KYUB 2Z58A 3P9QA 5F73A 1JHOA 5K51A 3RC7A 1IBLB 4M89A 5JQWA 2L82A 3IHLA 4MA5A 4GYJA 1T2FA 3DE7X 2J4CA 3TKLA 1XJQA 2WHPA 2IU0A 5B53A 1J22A 2HO4A 1ZKMA 3EMDA 3QVTA 4HTFA 3T12A 4PLVA 3V7UA 4EHFA 2WTNA 3OLQA 1NJ2A 4HWSA 5ICCA 5E4FA 3V4LA 3ZW7A 4HDAA 4RV9A 3PT9A 2PRSA 3ECAA 1ZC3A 4I1YA 4UTRA 2C92A 3IHTA 4TTPA 3Q6NA 2JKZA 3VH3A 1QFJA 1QQ5A 2JJYA 3UGJA 3TRFA 1HTTA 1E6EA 4NATA 1E3DA 1R27A 2P0YA 3AY6A 3H0EA 5LQKA 2C7QA 1YOVB 1CR0A 1DJNA 1XMOB 2X23A 3L79A 4HKTA 4NMXB 4UE6A 4Q0MA 1KC1A 2QVXX 1W88B 3C8MA 5KCMA 3VTKA 4EG7A 5JRJA 4FLEA 1K7FB 1Y4DE 2XYHA 1OXSC 2UAGA 3L8MA 4HNUA 4CLXA 3PJRA 1L6RA 3EXFB 2O8VA 3I4CA 4QGAA 3KQYA 2AQIA 1FNDA 3CN9A 1VG0B 4P3OA 1NVXQ 1LC3A 2HK9A 2ACKA 3V9PA 2J6BA 3NTVA 3OJ0A 1SUDA 2WG0A 4RTPA 4V1CI 2M6RA 2NTEA 2EW1A 2NZ2A 3JWGA 4M0MA 2IGTA 3GRPA 1IC6A 4TT8A 1EDOA 1M1NA 1OLXA 3BWVA 1GY8A 4MSUA 2PZAA 5THXA 3VTAA 4NPCA 3JATA 3QKRB 3SXPA 5HGXA 4JR0A 5IJWA 3PE3A 4MI3A 4QT4A 5JNTA 2OL4A 4OBEA 3GNLA 5LIRA 5CVDA 1MO5A 1EWYA 4QM7A 2OO5C 1S2OA 4PPQA 4ZANA 3AXTA 2GZSA 1QB7A 4BX2A 3CKKA 4D41A 4MX8A 2NXWA 4G5OA 1XUOA 3N70A 2ZETA 4CMIB 2IHJA 1VIVA 1ESDA 2Q1YA 4N7JA 4F7WA 3KXDA 3TRIA 4CL0A 3AHGA 3VU9B 1HRDA 2II6A 2H08A 3FNQA 3OZVA 1TZBA 1GR0A 1E4EA 1EWKA 2ZJ5A 4BNMA 3THWA 2IYOA 1U4SA 3EF3A 3ZE0B 2I1VB 2WWTA 5EIOA 1ZUIA 5E7JA 5TPZD 3C4VA 5ESRA 3IT0A 5T57A 4US2R 3F73A 5LOVA 2FPLA 3WKEA 1OI2A 2KW5A 5AKLA 3S2FA 3IB3A 1Y89A 5G0SA 3JD0A 3D7NA 3E8MA 1DBSA 2EL7A 1YNSA 1FRZA 1YZYA 3JSAA 4IQ0A 1Z2AA 2ORED 4ML3A 1P9WA 2LTAA 3SE0A 4B0PA 4JYAB 5B4TA 1JG3A 2FJ0A 3F3MA 2Z09A 4RIEA 3MWEB 4GGMX 2EJWA 2A1IA 3TQIA 4L78A 1PRYA 2YHIA 2J09A 3IDOA 1D8TA 3K16A 4UCWA 4HDNA 2AG1A 2X1HA 1Z2DA 3CRQA 1A98A 4UNRA 5LP6C 5L4NA 1UBNA 5DEIA 1G8GA 1Z25A 4KO8A 4OQNA 1GEEA 4YIKA 4RVHA 3DOUA 4C2AA 1XDGA 2DR2A 4FFWA 4WNCA 4R2HA 4G0PA 1ZZGA 4K05A 4BWVA 4PX5A 4WRRA 1AVTA 1I6WA 4FOTA 3KO8A 4YP0A 2WTAA 4RF2A 3TLMA 1JAZA 3ELWA 3I9JA 4PV7A 2W98A 4YAGA 1VE3A 3BWXA 3Q7IA 1FDWA 2FFBA 5T6BA 2C7RA 3PYMA 1TRHA 4EEZA 2G5CA 1RZRD 1DVRA 1XLUA 1NW3A 2D4AA 3IUEA 3OE7D 4C6HA 3EXG1 3JVUA 1A04A 1MVLA 3ODPA 4F6CA 3EX7C 2AJTA 1XMSA 4C03A 2E85A 2IYPA 4EA6A 1B8VA 2HJWA 3D5EA 1T2AA 5B7QA 4NBSA 3MINB 3DBHB 5DBGA 1BA3A 3EZ9A 4PLGA 2PYIA 4KQIA 1PZXA 1G64A 1NFFA 5KAPA 3DD5A 1M7GA 1IN6A 4KE7A 1QIGA 5TQ2B 5ENZA 2QX6A 3L8EA 1T3SA 3KLNA 1RYBA 1TU3A 1E9SA 3JYQA 4UASA 3VZDA 2DQYA 1WXIA 1ZMBA 1K63A 3PDHA 3HYCA 5ALQA 5AVJA 1KDYA 1UPFA 2VAWA 1T9ZA 3W04A 4RK7A 1S7GA 1SHKA 3AHHA 1J70A 3EZGA 2JIRA 4WN3A 2WZDA 3SR3A 3CU5A 2J87A 3NHSA 2VPZA 5DHQA 5HIMA 1JAXA 3ZD9A 4X24A 1YDGA 3JY6A 1J23A 1MAAA 4IZ6A 5AICA 2A9JA 1F0PA 3EZLA 2RGXA 4YV7A 4COOA 1AMOA 2X9GA 4K6OA 4AKEA 3HVUA 1PF7E 1I14A 1ZESA 2MR6A 1PFWA 2ONYA 4OMCA 3HKBA 2P67A 4EBFA 1FUKA 5YASA 4XLLA 2YIVX 4RBNA 4F6LA 3LH5A 4IJQA 3X2EA 3Q6MA 4ISCA 4DMUB 2JF0A 4MUEA 4Z4GA 3VSCA 4WBNB 1CNEA 2NO4A 4TSFD 4QWMA 5LP1A 3ESBA 3BAZA 4FWTA 3NDJA 1DT3A 1XK6A 2QX4A 3CHYA 5KNLA 1HBJA 3QU4A 1K6JA 1PZGA 1UMBB 4I9HA 1FNBA 4M8IA 2IYNA 3RSCA 1E79D 1M9NA 3DR3A 3IELA 1XTRA 3IQXA 4KRGA 4ZRNA 3VHQA 4J07A 1EM8A 5IVIA 1BEUB 1BXKA 3EVTA 3B48A 1C0PA 4LVUA 3M3DA 2QZ4A 3ZU5A 4H18A 4OQYA 1L5HA 3ZGVA 5EIFA 1GARA 4NZNA 3T3NA 1PS8A 5JXHA 5FWXA 2D1RA 1TEZA 2ZQYA 4B09A 2PE5A 4ZT2A 1YO6A 2QL9A 2I1WA 1Z33A 2IZ1A 3F6CA 1BW9A 3A26A 2XECA 3SSAA 4YO8A 3TRKA 5DN6D 1T1SA 4DA7A 1M34E 2Y93A 2PVSA 3FGZA 5KYTA 1U1CA 3FNIA 1PWZA 1W7AA 4XVRA 2C7OA 3BVPA 1QHGA 2RHCA 1H8EA 5KQPA 3LC0A 3HY6A 3NAGA 3ZJYA 2C5LA 5KKNB 2BPOA 5IKEA 4UAVA 1H8HD 2ZJ0A 5BYAA 3I37X 2ZM5A 3HLTA 1MOSA 3P2OA 1N8NA 1G9SA 1L5YA 2ECKA 2CB0A 2KM1A 3BMOA 5E7IA 3WWYA 2PYDA 1VOTA 1GQYA 3FUXA 1ODFA 1RYEA 4BLTA 1ZGCA 3QVLA 4JH0A 3X1XA 2BBOA 2MYTA 4NPHA 4Q15A 5D3KA 4HMPA 3V8MA 3VRHA 3WRVA 4QUBA 1VKJA 3F74A 4XB1A 4YMWA 1SCBA 2BGNA 1MH9A 4L7QA 1Y1RA 3DNFA 5EN4A 4EJSC 5KPDA 1UMDA 1ZEMA 3DLPX 2PGJA 3A4NA 1QHNA 2GSDA 3QNWA 1G1MA 3QOFA 4PZEA 4TMYA 3VTFA 4HQ0A 1GQ2A 2ZUSA 4AN4A 1L5VA 3OWOA 2M6KA 5BQOA 1U2GA 3DZJA 4FOLA 2OMEA 1TM2A 2PY6A 3G9ZA 4H0FA 4JQYA 3RK0A 5ITZB 1AO3A 2VDOB 5H0IA 3VYUB 2GM4A 8ATCA 4XWKA 3UCEA 3A3KA 2PEZA 4ARIA 2F1JA 3DTYA 1YKSA 3QLVC 3VUFA 4L85A 2RGBA 2A0UA 3K0AB 4FX5A 4AYWA 3A6GA 2NSJA 2X7JA 2R44A 3KALA 1Q22A 5AJTA 1ZHOA 4LXYA 4XUDA 2BJVA 2JIZD 1S0UA 4YJFB 4JLPA 2ZRBA 3ZX5A 3DVQX 3RRFA 2GEDA 4EW1A 3S70A 2I3GA 4LDQA 5JD5A 4TYPA 3KTDA 1D2GA 1YBFA 2YZ2A 1Q0HA 3JU3A 3OE5A 2HIGA 1UOPA 2O3UA 4IGEA 2WY2D 3QTBA 1U94A 4PXYA 2OFOA 1E1KA 2WKRA 4MEAA 3MM4A 2RAPA 3GK3A 5FPKA 3QFHA 1SD2A 1Z16A 4N6GA 2RGAA 4BWFB 4C22A 1I3NA 1GZ7A 1R00A 1FZTA 4AP5A 5LD2C 5KHOC 1OZFA 2EW2A 3B7WA 5AM1A 3DT6A 4G0OA 3V4ZA 1B2LA 5K8JB 2HMAA 3OM0A 4IKOA 2ECOA 3AJRA 4IDNA 13PKA 1W5FA 1XL0A 2EKDA 3TQTA 1JTFA 5BSVA 3RUCA 3OTIA 5T3UA 1SUWA 5HKAA 3NTQA 1BHO1 1QCYA 1QGDA 4KJXA 2QRKA 3COVA 3DAFA 2UV8A 3KYDB 3QKUA 4N5MA 2WWIA 4RDHA 3VR6A 1NUAA 2ODWA 1VYHA 2NYVA 2WAAA 3EZ2A 5DGHA 1F4LA 4UM7A 5BV7A 4RACA 1RJFA 2V9ZA 4JMLA 3FSEA 2V3WA 1PFUA 4ZHQA 5B1EA 2VJNA 3UA4A 2AN9A 4LXQA 2GPSA 3EPPA 4BZQA 3VO9A 3L0OA 1K0FA 5G1OA 1FSFA 1HLFA 4RSRA 4AY6A 1GIAA 5DSZA 4GR5A 2QV7A 2GZ2A 7ADHA 1U8EA 4QPPA 4N41A 2F62A 3CF0A 3RUDA 2IYUA 3FE2A 4XWTA 1KP3A 1P4RA 3JASA 3T9FA 2G71A 3EEYA 1L1RA 3QKTA 4GRAA 2OBXA 2BUBA 1HUQA 1O57A 2V74B 3JQ8B 4LV5B 4DLVA 1P1FA 1DAFA 2GWHA 2NVUA 4JBYA 3LGAA 2XYRA 1YTLA 4RQUA 3TOSA 5K0GA 5KYWA 4DE5A 1QBKC 3WY9A 2A1UA 3C3XA 2XX3A 5AVXA 2H4FA 1QQTA 1C7EA 4IIEA 2FWIA 5AKGA 3S27A 3FX2A 1L7BA 4RHTA 4LC9A 4MPJA 4MCAA 1O8CA 1WNTA 4PCAA 4HDOB 4KSCA 3VO2A 1PP4A 2E0IA 5BR4A 4O25A 2CJXA 2GSWA 2Q4TA 1T0UA 2IS4A 3ZU3A 4Q3NA 2ISCA 4OI0A 1D5CA 4DT1B 1D5WA 3KZMA 4GVPA 5HXAA 2OFWA 3NTRA 2GERA 3QZUA 4GOJA 4M76B 1NXPA 3VOBA 4ALNA 4PYLA 3GAZA 2YIMA 5I7WA 5JXJA 2W42A 1WP4A 4F4CA 2WT8A 1IIRA 2JAUA 4X1KA 4HWPA 2O2EA 5K5EA 5LXTA 4KH1A 3TEFA 1B43A 4KZPA 1IOVA 1GQOA 1ZA2A 1EAYA 4AYXA 3HO1A 3F96A 4ZXFA 5DK4A 3D31A 1QR2A 2FOIA 1L5KA 3CR7A 3I92A 3UHFA 1EUQA 3JARB 1KZ9A 1YRWA 2GILA 3V5NA 1AMUA 3T1HB 3DW1X 1M54A 1TAQA 2P2YA 4LOIA 1U0GA 4GYKA 4MGKR 1FSZA 1OW3B 4TLDA 4IMIB 5BOVA 2BF4A 3A6HA 1UBHS 1MC8A 3QU5A 1E89A 4CMEA 3I8XA 2DC1A 4BQOA 4DCVA 4B40A 3T9AA 1I2AA 1C4XA 1YASA 2AMJA 3I0NA 3RO7A 1W36C 2D06A 5EG5A 4HBZA 4QJBA 5IC6A 2DGDA 1TQHA 3IBYA 2QL5A 1NP3A 4IWYA 5LA6B 3EXEB 1DX9A 1J2UA 2AB0A 3VH2A 2ZJ8A 5HBRA 2AKYA 4QYMA 2P6RA 2WIGA 1CDEA 1Q83A 3VC2A 2O2GA 1Q84A 1XZFA 2WK1A 3IUSA 2BFEB 5EKXA 5DI9A 2YMQA 3L7MA 4OKNA 3AGQA 2XA9A 4Z0HO 5KVQA 1K4KA 2AFHB 4EL5A 4JOSA 3DKPA 4WKPA 5DRYA 3F46A 4B82A 1I1HA 3ENWA 1AS3A 1ODLA 2OLEA 1QO7A 2XOKA 3EFHA 1A2KC 2WWWA 3FRIA 4O1MA 4PZ0A 5FTWA 4MKIA 4DXHA 4K6GA 4R4JA 4EECA 4NQZA 2X41A 4G41A 4A0HA 1OFTA 2R6DA 2EATA 4ZO4A 2ZI6A 4EUKA 4KMOA 3HUDA 4XGIA 4LJLA 1TL7C 3TW0A 4RTSA 4UOQA 2D1FA 1VMEA 3UMRA 3LUAA 3FGOA 2BDEA 4UXJA 4MQEA 4DR7B 1CJBA 1HFWA 2ORYA 1B41A 1SCQA 1CR1A 3P9CA 1Y81A 2AX3A 4ARUA 2B4RO 4IDGA 2C59A 2JGIA 2ALJA 3IP5A 5ALFA 5E4JA 1DAEA 2YWDA 4D9GA 4Q1CA 1YWGO 3AR4A 3PD7A 1RMTA 3D4PA 3LDGA 2DPHA 2O2XA 2Z83A 5MGNA 4OLAA 1H2BA 1F2UA 3D02A 4U8HA 4B6PA 3ZCRA 3TVTA 1NURA 3W1VA 1CSEE 2PT5A 3LGSA 4PC7A 3VJLA 2FMTA 2E82A 1JR3D 2K4MA 1VHWA 4OMUA 3DWFA 1IB6A 5K8VA 3CWCA 1GZVA 3HGTA 1FF9A 1CY8A 1M74A 2I4NA 5D86A 1F0KA 3E58A 4RD4A 3LVRE 5TF4A 3UCXA 4XXHA 1IYZA 5LDHA 2C4WA 4JI5B 3SMVA 2WJ4A 1ENYA 3N07A 4QYIB 4XRGA 5FI0B 2ZKIA 3DFMA 3I6MA 2XE8A 4PSDA 3FFTA 4AFNA 5C8ZA 1PSDA 4EKDA 4H4DA 1TE2A 4FXPA 4QEDA 4C08A 3JQ7B 3WMRA 3AONB 3DHEA 4BMDA 5HKLA 3FCXA 1IUOA 3RVDA 2C7GA 2FW1A 4L5BA 4WKNA 2PA0A 1EA5A 2JGMA 3CN7A 3KT3A 2CE2X 2O2YA 4PHTA 3M6VA 2VWQA 4RGQA 3Q87B 4ZT4A 3ZS9A 1EGMB 2QLBA 2CYCA 4R1UA 1CNFA 1M6VB 5EUCA 3JAMA 2AG6A 1A9OA 1X3SA 3GLSA 3OX3A 4HLUA 4RY9A 5LA6F 1IAQA 3DBRA 3GVHA 2B8NA 2X9VA 3CLRD 1KAQA 4JBHA 3PWKA 2IE0A 1WQ4A 2RHLA 2DHDA 4OV6B 4CN8A 4D3XA 2NZJA 2QAGB 4EZBA 3IBTA 3KFVA 4FW9A 4R68A 4F12A 1XQWA 3HFSA 2BFMA 4ZV9A 1UDRA 4CLRB 1QYDA 1PJ2A 1Y8CA 4LOLA 1ZWLA 2CXXA 5CYPA 2PZ8A 1G0NA 3GFQA 5EHZA 1RCFA 4G4SP 4RY0A 1BG6A 1OGIA 4OGGA 5B12A 3D2LA 3EPLA 2H2WA 3EZFA 5TT0A 4DSTA 3CVYA 2BFCA 3D3NA 3EDQA 2QX9A 4E5VA 2VHJA 1IONA 1N6HA 5KS2A 1JT9A 2C8LA 2JGLA 4U7GA 4JJKA 5TV2A 4LFAB 1JN0A 4ADSG 5EERA 2OV2A 3JR3A 4M4SA 3UJDA 4ABYA 3KDPA 4FGZA 4IINA 3ICQB 4M21A 3NBYC 5HUHA 5KB3A 4ZVVA 5I7EA 3IH5A 3G5MA 3IOYA 1E8NA 2Y2UA 1F20A 1LXCA 2BZ0A 3A1UA 4DL9A 1KFBB 1TOAA 1G6Q1 4YH1A 5EWJB 5KJFA 5LWHA 3VPAA 2V4ZA 1MU0A 2P7HA 3ABQB 1FE8A 3N59A 3SJZA 2GYWA 3L7AA 5CLGA 3LX5A 3WO1A 3I5YA 5KYXB 1Q0QA 3NNSA 3CNQS 4Y6RA 4Y1FA 3DAGA 1D04A 1KE1A 3A3OA 4OXXA 3MSXA 3RRNA 3RS7A 1YMVA 2TYSB 4EGJA 2F3PA 1KTIA 1VZ3A 1YFZA 3BK7A 2DETA 2A6PA 2VPIA 4Q1DA 1A8QA 4GH5A 3OX1A 4MV1A 4PPFA 3A1FA 3JD4A 4LS3A 4Q3EA 3NYWA 3SVZA 3W8RA 3QVGB 1WRBA 1WZ2A 1MB9A 3VU0A 2IUSA 4JXZA 1EFTA 4R9SA 1QQBA 3DS8A 2IYAA 2XRYA 3DVSX 2EVWX 3QYPA 1L5SA 4I2NA 2KJQA 1NM5C 4CCWA 1UP4A 1BGXT 2CLLB 5EMJA 1E98A 2P65A 2ZB2A 1TUIA 1JLLB 3E8SA 3F47A 3N0VA 4GL4A 2QD3A 3O95A 5JC8A 4RDCA 3W4KA 1LDYA 3FWNA 3L0CA 2C3YA 4O2BB 4OXNA 2ZKLA 4YNBA 5IHXA 4TROA 2X3FA 1W4ZA 1RLJA 2C0QA 4LGYA 4PRZA 4PCVA 4F5YA 4FCCA 1II8B 4I5GA 3GJYA 4FLMA 3RJTA 5J23A 3OY2A 4TMTA 2IKQA 1M8PA 5T4EA 2Q7DA 4RETA 1UWCA 5B1IA 3UK2A 1R4NA 2EYQA 2FH5B 4WLEA 4CQMB 3CG0A 3GCWA 4D6YA 1KEEA 2OHXA 3SYKA 3W7BA 3S8YA 4ABTA 1M8GA 3FMVA 3CJRA 1UH5A 2P5YA 3MF4A 3RC2A 1WULS 4Q7QA 3PGJA 1MABA 2HMSA 3GROA 2YVQA 4QU9A 1HC7A 1RTKA 2GCIA 2PLAA 1CP3A 2FCAA 1HE5A 1CJKC 2KHZA 5E9AA 5HKKD 2GM9A 3DF7A 2FUEA 3RJMA 3AP3A 5BSHA 3MEQA 4LSWA 2XXAA 4X7MA 4CMBA 5EIBC 4TRJA 5CLFA 1DG3A 2JJ2D 1GCUA 4HXEB 1BU8A 2O3JA 4Q3LA 4WL0A 3SC6A 3U3JA 1Z0DA 4M2LA 2B2NA 3F6PA 3M5WA 3V7NA 1YRAA 3FVQA 3L8CA 4WAUA 3VDXA 2CC2A 2PIAA 1G7CA 4XYBA 5CURA 1GYRA 1Y0BA 1IXKA 2B5OA 2RHDA 1NYTA 4R2XA 1ECBA 4CWAA 2VDLB 1LGYA 4DV5B 1S3IA 1KBZA 2JGKA 4LISA 3SHQA 1FK8A 2F48A 4DHEA 4KFCA 2XAAA 1QFZA 4P7JA 1B76A 3Q72A 1NRIA 3EG5A 1IEWA 1XVAA 3L7DA 4G0WA 2WF9A 3QJYA 1L7NA 5D6OA 5DLDA 1CW2B 1I80A 4HH4A 5EMNA 2CLIB 2E87A 4OPMA 3E5NA 3KHTA 4X6LA 1ZVMA 3LD9A 1IQUA 1F4VA 1Y7IA 5JO9A 3UBTA 3H9GA 4MUJA 5BVHB 4KGDA 2G6BA 4DNOA 4ZCMA 4DSUA 1M2JA 4Y0NA 2QRJA 1U8UA 4ESOA 1X7YA 3EGEA 2FJPA 3PEUA 4YRSA 3ADCA 5CFQA 3A1NA 3ZDZB 1QRDA 4G5SA 4LJ5A 1JXMA 3EBLA 2EC5A 1R12A 5JCXA 3D6AA 2HSWA 4HAVA 3DHVA 3LA6A 3OOEA 4M8NE 5J2TF 4D74A 4C6RA 4JI4B 1GQFA 4Q6WA 3RB8A 3PLAE 1SPBS 2XDQB 1PG2A 2NACA 2I67A 4E1BA 2YJ5A 2QD1A 3PNPA 5JG7A 1WDKA 3CLSC 3GXOA 1V1MA 4DRXA 3LQ4A 2IXGA 2ZAGA 3E4DA 2VBIA 3CONA 5K05A 3PSHA 4XUGB 2PANA 2W6OA 1YB7A 1KVUA 1YT5A 3GJ5A 4Q3CA 3SR4A 4JBNA 3MTJA 4R3UC 1RPNA 2G7ZA 4ZT5A 3WYGA 4EPVA 3LPMA 1K8YB 1N6NA 2VSFA 2IW3A 2WHEA 1V7PC 3K1TA 4NCKA 4U02A 3W2TA 3AJEA 5I9MA 1WDWB 1TM4E 2Q1WA 4TL7A 4CFZA 1AHIA 1SA0A 1V8PA 2GJAA 3NM5A 3RK1A 5JDIA 4NCJA 1EX1A 1QH0A 1PUJA 1H2HA 1AGYA 4FN5A 1BX3A 1TIKA 1NVAA 4R05A 5D2CA 4FSXA 1JIQA 5LBIA 2PMCA 2EFEB 1U1FA 4LIPD 3EUFA 4GYWA 4CL2A 4DQKA 3B6EA 3PX3A 1CYDA 1K97A 2RC5A 3KAJA 3ONVA 4MITA 4QPDA 4RF5A 3AINA 2HV8A 4QDTA 4JLDA 3SIXA 5ED0A 4HXGA 3TMAA 5I3ZA 1YZVA 4QEZA 4ZVLA 4HLCA 3CFYA 5DHPA 2TMDA 4LJ8A 2NT3A 4Y67A 4D8WA 3UV3A 1LJUA 2JCXA 3RNLA 1EAMA 3MW8A 5CFZA 2W2XA 1ONPA 4UMEA 1V9CA 2NO1A 4NFYA 2Y1LA 2X3YA 2ENUA 2HSGA 1ODTC 2YY5A 3DM5A 3GEIA 3NAQA 3R6GA 4LV6A 2OA0A 4DARA 5M04A 2XGJA 4AD8A 2RGNC 3C3JA 3TLKA 3OUTA 2Z0MA 1MQ9A 4YJGA 4DADA 3R7DA 1U2GC 3KPVA 1BVYF 5KTSA 3MUNA 4BP9A 3OPYA 3EZYA 4QGGA 2FQWA 2BFDB 1VHTA 3SKYA 2AG5A 4A6PA 4P31A 1ODKA 3BTVA 3UV6A 3B1VA 1P33A 1Z73A 3L46A 4RULA 1S7CA 4HSGA 5GJWC 2PKXA 2QG9A 4YJ2A 4HQFA 2WTMA 4N39A 5FO1A 5BUSA 2X19A 1N2CA 2BFBB 4S0XA 5CP8A 3STYA 4E08A 3QEMB 5FUWA 4I1RA 1LBQA 5JSHA 2G07A 3F2IA 3FF1A 1JQLB 4M0PA 5A62A 3BJIC 2XMDA 2XKKA 3AHFA 4JLWA 4QASA 3LPAA 4U6QA 4AUEA 2R6ZA 5BNZA 1J90A 1GCIA 3OPNA 4RH1A 1GNVA 4AMZA 1M6YA 1FYEA 1K6IA 3HK2A 2Y1FA 5JNWA 1PTJA 3AVXA 4E51A 1PCXA 3KQSA 2XJ9A 3KSMA 3BOSA 4LJ7A 4K6MA 1DRJA 2MU1A 4MQ5A 4ZK6A 5TLSA 4UNQA 1QO0D 4JBIA 2HBQA 1W88A 5CG1A 4NU8X 5CFNA 2DOKA 4LRXA 4ER5A 5CBKA 1KY3A 5MF6A 5L6MB 4I7EA 2OHJA 2Y4NA 3GD5A 3EXFA 1WUHS 3HMKA 3RFFA 3C4JA 5CA0F 3BRWD 1F9EA 1EFVA 1NE7A 2VUUA 1DIHA 1C30A 2BSAA 4MAMA 2V0NA 4RK6A 1RLOA 1ND6A 4QUEA 1LDGA 1UKVY 3T5BA 3WGZA 2CV1A 3UC9A 4YV1A 3JQGA 1QMPA 1ZH2A 2RGUA 3TQQA 1ZQ9A 1JBQA 1H22A 1OXXK 1ZMTA 2FZKA 2B1QA 2DH6A 2VC2B 2R8PA 3AFIA 3QKRA 4HFMA 3WLEA 3GRUA 2X4IA 5BV2P 1V5GA 3ANMA 3U16A 3GLVA 1Y8ZA 4IUCS 4AZTA 2C3MA 4OYRA 3PHCA 1VE5A 4ZD6A 3RF7A 3TF5A 5I3CA 2J3IA 1HGXA 2DYKA 6REQA 4KREA 1FNMA 1T24A 2R4TA 3F1KA 4O59O 3IP3A 2QAIA 3OF3A 4I3GA 3STWA 4QUHA 3WIVA 2P4EA 2ZYWX 5EP3A 1ODIA 1IZ8A 3QLJA 2UKDA 5EZ6B 4ETMA 4B4KA 4AZVA 4LYEA 1EXWA 4X8LA 4K2AA 4JUBA 4GSYA 4HYQA 1GNTA 4JHLA 1SG9A 3R6LA 4IR7A 2ZROA 4X84A 4BUZA 1L0BA 3H1FA 4ND6A 2ROQA 3EVCA 3FFXA 1IJKA 2CEKA 1DWOA 3ICOA 2FFAA 3W3AH 1PL6A 5CAEB 3JYOA 1I2ZA 1P1JA 4HNHA 2XGMA 2Z1NA 3U44A 6AT1A 1ZCFA 2YS7A 4J9UE 2XLCA 3DC7A 1TMYA 2QTHA 4IVRA 2ZWAA 5CH8A 1V5WA 3GN2A 1G18A 1WHSA 2F43B 4KAAA 4CKCA 1NVUQ 4Z0NA 3ROZA 1I94B 3TRHA 1BFKA 2Z98A 3BGIA 1G7RA 4DJDC 2BJHA 1WM1A 1KY5A 4RM2A 3M6LA 4GPAA 5CW2A 2BGTA 5HSGA 3LDHA 2CLSA 2QE7A 2VNIA 2HWUA 4FFMA 4ZZ0A 4A8JC 2FRVA 2PFSA 3RRXA 1E5TA 5MDHA 1IN5A 2WFLA 4GGOA 1IJFA 1JSRA 1OI3A 2QMOA 3TG2A 2UXCB 4NF2A 2R6CA 4ZI5A 1S2IA 2GXQA 2XUFA 2OYSA 3S2SA 2MDTA 2XZOA 5AI9A 4YT2A 1FDSA 1QGUA 3SC4A 3TZLA 1UBLS 1F38A 3HP1A 4OU5A 1SXJB 2P9BA 2OB1A 5ULLA 4ZCIA 4ZV4A 3O1LA 1SKAA 2RK6A 4LRSB 5IJ0A 1ZJWA 4LFBB 1ZK2A 1EX9A 3DO5A 1HDGO 1TCBA 3H1BA 4ENRA 3DVLA 1DKUA 1PK8A 1K2VN 3ZW8A 1FTSA 2MHCA 4JOQA 1KERA 3PIDA 5DM1A 1GQRA 1SXQA 2HA4A 2WKPA 4OJKA 1TK9A 4TN1A 5JNRA 3W5IA 2IS1A 2P5SA 3L1VA 2JAQA 4M0UA 3UG7A 1EXNA 1A2OA 4MUFA 1K8RA 5ENVA 2OFFA 4CV1A 2CVQA 4MWSA 3PGXA 4IVPA 5EHGA 3QWAA 1YBHA 2IU4A 1MEJA 1NBHA 2PUCA 1SZJG 2AHRA 1Y4ZA 1E1YA 2Q3BA 3QXSA 4MB6A 2I6FA 3BHIA 4KK3A 1IATA 3EGWA 4AZ3A 5AXDA 5C3MA 3MNFA 1TKCA 4RD1A 1B3RA 1N77A 3TLEA 3IBGA 4L02A 4RCYA 1XPJA 3KSRA 1JNYA 2LNDA 4KOEC 2PBZA 4BQEA 4EVRA 1C7ZA 1H2FA 1VRWA 2UZIR 2BTEA 4LMRA 1GZ5A 3I2IA 4Y2RA 3ZHSA 1IQPA 3E7XA 4R6XA 3WWCA 3THOA 4D9BA 1XR3A 5DNUA 3AR7A 4DB4A 1QG2A 4AJHA 1V5EA 1TFUA 1FCJA 1VECA 2XKAA 1ZN7A 3ANYB 3STTA 3BGOS 3ZE8A 1AKMA 1LJ8A 2JAWA 2XNKA 1X7WB 3E15A 4K88A 4G4SO 2H8GA 1GLGA 4YO7A 4CG2A 2GCGA 1IL0A 1K7SN 2EEZA 3WADA 4AO8A 1EQUA 1YK1A 4KIJA 1KI6B 3LO8A 2PCJA 2VN8A 3AGPA 4H2DA 4N5LA 3TKYA 1PT9A 1G20A 2WILA 3C2QA 2PH1A 1E6MA 1KZYC 1PG5A 2I2CA 1ZISA 2VNKA 3DV9A 3F7NA 4GE0A 1FU8A 4N6NA 1CLEA 3O8QB 3O4JA 4X1YA 1KAOA 1HG1A 1U65A 3GA0A 3O2JA 1DBVO 2Y1WA 3R0QA 5A4IS 3QU9A 3TZQA 3PDIB 1NJ6A 2Z5VA 4L3WA 3OIUA 1JDBC 1VL2A 3IQIX 2QRHA 3EDRA 4IJUA 1O96A 1AN0A 1FNSA 4UQPA 4RA6B 2Q5CA 4X61A 3QE4A 4MKFA 1XTKA 1Y8QA 1TQ6A 4G01B 2DTDA 4OSPA 1Q1ZA 1FBNA 4EB6A 3GEDA 3IP1A 4UM9B 1T3HA 2QZ9A 3EQ6A 4CL8A 4QBKA 2EQAA 3X44A 4EFMA 1NV9A 1IY1A 1OX6A 1SBZA 2PFKA 4QTUB 3OCUA 3SF8B 4Q7MB 2XAUA 2GASA 2OXEA 4W8GA 3REFA 4OHMA 2QQFA 3ZCXA 1QV9A 1GTVA 4HI0E 5J59A 1KIAA 3OPMA 1L3BA 5KWIA 4M1WA 3HRKA 4H0CA 1NWHA 2IYTA 5KAMA 3G7UA 4G5FA 2G1UA 1IIBA 3U4QA 4NYMQ 2C3OA 3G0CA 1WL8A 3MRVA 4J7CA 3ZDCA 4ZA2A 3L9XA 2REQA 3KYJB 4BNNA 2RONA 3MS4A 4JBGA 5KU1A 2BGJA 1UK7A 3G7SA 3W9YA 2OGTA 2JFXA 2ZUBA 1D2HA 4P22A 3UK7A 3PPWA 4BVGA 3GDHA 5K0LA 4W4TA 4B7XA 1NUTA 1ENPA 2ZYUX 1V6AA 4EYKA 1VKRA 1D4AA 2WWGA 3R0VA 3AU8A 1WETA 3S68A 3BSSA 1W2GA 4BCCA 1PJ4A 5K3EA 3PX7A 3W1WA 1N7GA 3QWHA 3MFQA 4S1TA 3KHUA 1T5SA 4EO9A 1B0AA 2ZIWB 2Q6LA 1EWQA 4MIEA 3CS3A 4NV1A 4ERXA 5ESDA 1F2TB 1UC8A 2JFWA 2XHEA 3ANLA 4Z54A 4ZVQA 3O5AA 2XCSB 4DR6B 4ZICA 3CLTD 3M7IA 5KPJA 2M6SA 4WH0A 1UBCA 2P4SA 3V2UA 4Z8XA 3GRAA 2GN1A 4CODB 4JA2A 2GH1A 1RBMA 1WTCA 3A11A 2IU3A 3CRW1 4D9JA 4FFVA 1VA4A 5KZMB 4S2UA 2HRBA 1S9HA 2C8JA 4U2DA 2AVDA 5FH9A 1BVHA 4ZJUA 2V7QA 4PQFA 3WQSB 4BX3A 4C89A 1D7OA 3PRHA 5FXMA 4JJ4A 4FKBA 1UM8A 3IAS1 4C7MA 3SPXA 3JYLA 2OZEA 4BLQA 4INZA 4RHUA 3JYPA 3ZWAA 1HZZC 4HQNA 3CKYA 2APJA 4JIGA 4NMMA 2P9QA 5A1TA 5AK3A 1G2IA 1WMFA 2N42A 3K0BA 4CLEA 5CCBA 3ONWA 5EZ5A 3COPA 2C83A 3S40A 5FUMA 4F1KA 4QUDA 4F38A 4JJAA 2I29A 5DF1A 1DO2A 3BD6A 3TPCA 1Z13A 1LW6E 1QYXA 2ZR8A 1UPBA 1GUFA 3IUPA 1QNFA 1VKHA 4FW8A 5JIBA 2QN7A 2QLFA 1BS1A 2ZVPX 3FMGA 3IBFA 3HNPA 1JA1A 3GDWA 4R1SA 1LU9A 1YGYA 1ADCA 5AJUA 3LLVA 3QFRA 3W6NA 5IM4F 1N36B 1KDRA 1NRXA 2XA1A 2FWJA 4Z4QA 3WYAA 1TT5B 3G9QA 3MJTA 2DQ4A 4G5YA 5LZ9A 3KQHA 1JEOA 2A35A 2JFBA 2HLPA 4ZK2A 1QF7A 2W83A 5ITVA 4Y9UA 3MAAC 4YWJA 1G3MA 4GXQA 4YWHA 5F76A 1DELA 2VAVA 3I39X 3MRTA 1ZEJA 5ELMA 5JAHA 5JS7A 3BXFA 3O93A 3OO1A 4L7VA 2I62A 3EXHB 2O8DA 5F2KA 3U4DA 3MWYW 2AUMA 3RWBA 3OIDA 4G24A 4RLQA 1XI2A 5DYTA 4ZVOA 4RPJA 4WJLA 1BYIA 4V1CB 2BLLA 3D9QX 1Z74A 5GV8A 4M1YA 4IXMA 1EFPA 4UOZA 1ZIOA 3OWXA 4Y98A 3GZNA 2H1OA 1LBSA 3WHIA 4YCSA 3FLBA 5IT0A 1ZIYA 3PT5A 1E2JA 1E5DA 1W4RA 4V0LA 4GZLA 1W5SA 3SIPA 4BFZA 1SPXA 3QBDA 3OTOB 2C61A 4EL0A 3BEOA 5DO9A 4YMGA 4EY5A 5CA1A 3IILA 2OC9A 4PINA 5E6SB 1FEZA 2R2AA 5IMBA 3WK4A 4XJSA 5L3QB 1W30A 5DV9A 4DREA 1KE2A 8GPBA 4J0IA 4WLNA 3RS9A 1PZNA 2BCGY 4GIBA 4ETWA 2GZ3A 1GWNA 2F4NA 2B4YA 4F06A 1XZLA 1UP7A 2D5AA 2DSTA 2FP4B 1WOYA 3HCFA 3PQ3A 4RU1A 2FWBA 3SHTA 4EPXA 1QZUA 1A5SB 1YMQA 2P3OA 4MLPA 4RZ2A 6GPBA 2RHGB 4YASA 4YV2A 2XNDA 2KX7A 4RA9A 3TVDA 5I5EA 1VJGA 2PVCA 4WGGA 3W5DA 3W5VA 5KX5B 4D81A 4EELA 1DJPA 3ASUA 4LA4A 1WKBA 4X1IB 3H5IA 2EOAA 1QUEA 3KB1A 3E9YA 4KTVE 2VDKB 4I99A 3FCEA 4MUAA 4YPFA 3IQHX 4Z7JA 2MSNA 5EJ8A 3PG5A 2HBZA 2G4VA 3QF4B 4RZXA 3I6BA 2G06A 1NT2A 5LMZA 2W6QA 2PU7A 1S96A 5EJGA 3FD8A 1MX3A 4I6EA 5D01A 3JQRA 3GNQA 4TRMA 2FY8A 2F8LA 1NLMA 2PT9A 5D5HA 3BKXA 4P8RA 3RF6A 5BN4A 1L4HA 1WD7A 1KI3A 2EW8A 1XD2B 2A2ZA 3DDWA 3ZE7A 4MS1B 5KTMA 4MYDA 1C1HA 1EVQA 4Q01A 3KJXA 1YIOA 3PQCA 4RE6A 4DLSA 5DCLA 3T3DA 3AEQA 3LX8A 1HWYA 1P7CA 2VSXA 2ZJFA 5EJ5A 1OX4B 3Q41A 3DDUA 1S2MA 1PWHA 3A9WA 2PPLA 2Y2VA 5FV4A 1U9IA 2XMCA 2C88A 3E2PA 1T2UA 1OV4A 1U2SA 3ETGA 2O8CB 1AZTA 3KWJA 1H2XA 4LHXA 4P9NA 1ZBDA 2FE4A 4G25A 4LRYA 3EXEA 1W0KA 2YCBA 1X1QA 5HFJA 2PRYA 1EWRA 4Q7KA 1KK1A 3HM2A 3MLAA 3SXUB 2AW3A 5LZ2A 2H18A 3OBBA 2FZVA 3A8TA 4N49A 3N87A 1VGQA 4OYHA 1C1YA 1YGPA 4JV5B 2W2LD 5DTRA 5H5JA 2BZGA 4PC1A 1CZLA 3QSGA 5JMTA 5KTPA 3D3WB 3CZCA 1J8YF 3STVA 2AI3A 4OHXA 1C0EA 4EI2A 2GBLC 4DEYA 1Q92A 1XWFA 3AX6A 4HO1X 2FR0A 4H77A 1V7CA 3X1JA 3UPDA 5B7NA 2NSHA 4BO8A 4I50F 1ECGA 2Y1DA 1X1TA 1W85B 1KVQA 3K72B 1GNQA 3M1YA 2ZUWA 4QICA 1FX1A 2DWCA 2X0IA 2AQKA 3GLFE 1SUBA 4G1UC 1I51A 4C4TA 1L7VC 5C4MA 7REQA 4CHGA 1G55A 3JQFA 5HE8A 1OJLA 1RJ9A 3FB1A 3NOQA 1VSUA 3NKFA 5CH5A 1I6LA 2WMDA 2XUQA 1QF9A 2X0DA 4AYTA 2WM2A 5JDIC 4BQPA 1I1OA 2V7GA 5A9SB 4LJRA 1ZINA 3OQVA 4FN4A 4DC1A 2HRDA 5CB8A 5F2OA 2WINI 2JI4A 2YZMA 3A4LA 4RS4A 1PUXA 4YRJA 4R83A 2QQEA 4OHYA 1TM3E 1PD1A 2DWUA 4Q12A 2GFIA 4V3CA 3HCEA 3FPBA 1MW8X 3BQNB 4V3BA 1VLHA 5FWAA 4DBLE 1GYPA 5FBLB 1G6HA 2A5JA 3D1LA 3NIGB 2XUJA 3WSVA 3C3DA 2OOKA 1P0IA 4CIXA 5G4KB 5BWBA 5ITWA 3HCPA 5KX5F 3U40A 2XCOA 2HPVA 4J75A 4NMWA 5A5VA 1KMNA 3INGA 1FLAA 2E49A 1IAVA 2I65A 2ILTA 1TT7A 3DB2A 2YOHA 4QXMA 4RLHA 5CGZA 1E1QD 2OHOA 4HL6A 3IHWA 3VSAA 3UK1A 2OSVA 1MOPA 3UMBA 3T1TA 2FZCA 4BKOA 3ZDBA 1F8GA 1HF3A 1CUBA 1CVRA 4H1WA 3V1YA 3QGMA 3SN6A 4WADA 3M9LA 1GU7A 2VPPA 1WAMA 4NCNA 4QC2A 3NBFA 4BQIA 4M7RA 5H3CA 3CNOA 4REQA 4IILA 4XSVA 3UCFA 1QK3A 2C98A 1IM8A 3IDSA 4M37A 5GJVC 1N9GB 1RLTA 3D8BA 1ZZEA 3LC7O 4LF5B 1GAJA 3JQ7A 1D2EA 1NF8A 1IHXA 1XJ0A 3AKYA 3FGPA 1G5QA 1OGYA 2J5XA 5EUBA 4B0OA 1GUBA 3DWIA 3CEPB 2N1BA 3WHKA 2HJGA 1QNLA 2A3NA 4NOJA 1ZK0A 3ZWYA 1NJFA 5ENDA 3HWRA 1R10A 2V4MA 4WNAB 5A3JA 1OWLA 4DV6B 1T4CA 3JYNA 5IYZA 3MSCA 4QXAA 4RIGA 1Z5GA 3SS7X 1DEKA 2AW5A 4BZZA 1E9DA 1XZ8A 4K7JA 5FBVB 4MZDA 4NE9A 1UC9A 4JSRA 4ENWA 1G8MA 1XRQA 1PTJC 2EZTA 2JHAA 3C45A 3MK31 1I0ZA 3ZCQA 1JF8A 4D45A 1P2DA 1U1DA 2W5UA 3IKMB 2BHTA 1L8OA 3KJIA 1R4MA 4DV0B 2O3QA 3DWGA 5B7PA 2ORIA 3PXUA 4HRAA 2BGIA 3QUBA 4KO1S 3KVVA 5JUWA 1LDEA 3BJMA 2CK3A 3AT1A 1GT91 2DKOA 2F9MA 2DWPA 4MIKA 1M1YE 5F3DA 1XTIA 4ZT3A 3ZCVA 3V1NA 1TX4B 1SXHA 4JVLA 2QN6A 4NV0A 3NETA 1X94A 2Q2OA 3PR1A 4TLEA 1UOEA 5AWFC 1HDZA 3P71T 4AG5A 1XL1A 3VU3A 1IG0A 1SOUA 3QFTA 1QDUA 4CCYA 3KPYA 3KC2A 4PZ9A 4OY3A 3G59A 1AXGA 1IHYA 3I4FA 4HSEA 6ADHA 4ZT6A 3DV0B 2PAAA 1QWSA 3E61A 2A9QA 2NTYC 4OGKA 5EP2A 4HWRA 4P4SB 4UEOA 4TV8F 3CUKA 3P2JA 3TD9A 1TKBA 3IALA 3DYBA 3LHDA 3LUDA 5GGYA 4C0JA 2N1MA 3N9IA 3LK6A 1KWKA 4MLCA 5KYGA 2DPGA 1L4YA 3CEHA 1J2RA 1PSWA 5L4LA 4PIMA 2NT4A 5AHWA 1XF1A 2YV2A 1U2PA 1QKJA 1P4HA 3BQMB 4FYHA 5BWNA 4IDBA 4J0QA 4QHYA 5C18A 5KDOA 2QVLA 4ZEWA 4IZOA 1Q95A 3T5AA 2RHHA 3PRYA 2Z1MA 4LDJA 4OQMA 4P38A 3UF0A 3D4IA 3X1KA 4YCLA 1LV8A 2OQ2A 3VISA 3AJ9A 1AK1A 1ODSA 4DRZA 3OTWA 2OCXA 1GG8A 4J16A 4RQBA 3SZGA 5KMGB 4RKRA 1Q0TA 1HOXA 2W00A 3OOYA 5CEFA 5K8TA 3K4QA 3ZBQA 4OHOA 1KQOA 3E1GA 5EQTA 1BDIA 4QOEA 1I9GA 2YRWA 3BDAA 1JP7A 3KVNA 4PZAA 4U7DA 1KZ7B 1IWBB 4B17A 2IZ0A 4JQOA 4F3NA 1KFKB 2YWHA 2QLMA 1KORA 2DX7A 4URZR 3RGWS 3MB5A 3OCZA 3B36A 1BWRA 1C2YA 3STUA 3Q15C 1G3UA 5H68A 2NYUA 4O2BA 4BMYA 2Y3IA 1OXUA 5CDYA 4QRIA 2AN3A 2VDJA 3OC0A 4AKTA 5CJ2A 1D7AA 3RHTA 1W93A 2QTRA 4PN7A 3KJNA 4ETIA 5D3ZA 3UWPA 1FRVA 4D4IA 3KQNA 3VHRA 5A5DA 3AKCA 5BVGA 4ETNA 4LBYA 1CZUA 2GD0A 5EKTA 4ME6A 4QG7A 4LI0A 3KPJA 1E94E 1DDGA 4MTCA 3QKIA 4OM7A 4RCVA 4B8YA 3FCAA 4JU8A 1C3XA 1XZNA 4F4IA 1PD0A 1FRNA 3U09A 3HJUA 4F3KA 1MIHA 3ELDA 4GF5A 2CHQA 5AVZA 3RANA 3T7RA 4NC9A 1M73E 4NP6A 5E6RB 3ZI7A 3GCZA 3VYVA 3BN3A 3EG9B 3UJHA 1N8SA 4P4LA 4IW3B 2X0FA 4FWBA 5EYPA 3DAYA 3IT2A 3VR2A 1PAUA 2PQ0A 5COQA 1E9FA 2IQ5A 3ZWXA 4MWBA 1G66A 2QG4A 3H0KA 3U80A 3ZHVA 2PX6A 1YMUA 2O4UX 3KYCB 2BT4A 3R3WA 3VGJA 4EY7A 2LWIA 2V0GA 2GJ9A 2Z04A 3DQPA 1Z7YA 3NBAA 4K3UA 1P8JA 3Q3HA 3W90A 2GLTA 1I30A 2CD7A 3K31A 1T6ZA 5CVUA 2VYND 3U62A 1ORHA 5ICSA 1GGKA 1NP6A 1UPCA 1SIWA 2HFJA 3NS7A 5AH0A 4YRKA 5AW1A 2B4QA 2DJ5A 1RRVA 5HF5A 4HLNA 1YULA 4QFMA 5KCZA 2W70A 5D51S 1SQFA 3ZQUA 3KXLA 4G26A 3WK6A 4B87A 2BD0A 1P39A 1SU4A 1N0WA 4XTCS 5BMOA 1E60A 3D3EA 3MT0A 2AD5A 2LIPA 2YYAA 1T4MA 1KYZA 2LRHA 3RYFA 4JBWA 4EB8A 3MZ0A 4IFEA 5CX4A 1YS2X 4NCXA 4Q1AA 2W93A 4JBXA 5GOTA 2ISQA 5CIQA 4UCQA 4YJDA 2ZJAA 3HVJA 1G5HA 1TJYA 1C1DA 1JZQA 4OI4A 3NFRA 4FFLA 5L95A 5LJIA 2XQGA 3N2NA 3ZKWA 1KYQA 1ZO8A 3CLUC 4KUHA 4D26A 1VL0A 4AUNA 4C4PA 3AETB 3I5UA 2FUG1 2QVYX 5DULA 4ZVUA 4MRSA 4YEDA 2E4UA 2YN4A 3GAMA 4QUKA 3A10A 2EF0A 4HLDA 2BH9A 4Q37A 3DE0X 1N2SA 5DVZA 1JIUA 3C8ZA 1CY4A 2F6RA 1QVWA 1TC1A 1Y7HA 5JXWA 5K2MA 5U9CA 2C2ZA 2P1DA 2RGGA 3AG5A 3PGMA 3UJ9A 1V4BA 3C5CA 4M49A 1L7XA 1NMSA 5JYDA 3PD1A 4NRDA 1DS6A 3P8ZA 4RFSB 8ABPA 1UPXA 5A4JA 2CXPA 3B3AA 1Z8FA 3LO5A 5EHQA 4XFDA 1Y6ZA 3LP6A 4IM7A 3ZZUA 1SUSA 1FMLA 3NIFB 3ITNA 3C85A 1JQ5A 4HB3A 5TB5A 1U7PA 1Y9DA 3OOSA 3W2FA 5BUQA 2I2DA 2DFNA 1NUPA 4J76A 2ENWA 5GY7A 4MW4A 1UKCA 4I9NA 3M2TA 4E4RA 3PTZA 4HRVA 4IHJF 4DOMA 5P21A 4B7UA 1NVVR 1NDHA 1VIYA 1F60A 2CE7A 2PKQP 3GRZA 3SIRA 2XTZA 4F85A 4LQDA 1BRMA 5AOCA 1IVSA 2O54A 1JB9A 1RHRA 2R1ZA 4WNIA 2HF9A 3ED5A 1ZGJA 3A2LA 4JLOA 3EULA 5EWMB 3CPEA 3M3HA 2PJUA 1V95A 2NN3C 2Q29A 4EYQA 3LTNC 4RGVA 3SC2B 4YT4A 3F6SA 2FPIA 1OR8A 2JGNA 2QYTA 2XGGA 3KQWA 3O90A 1NQOA 1E2GA 2AOXA 4NYJQ 2V6GA 4LG1A 1JDNA 1ZN8A 3A1DA 2R62A 3VNAA 4DA9A 2AX4A 5IG2A 4GKBA 4L1KA 1KH1A 3NTOA 1W36D 4XIFA 1C4KA 1DQYA 4HWKA 1O3YA 2JRLA 4MUKA 4LV8B 4PC3A 4EY6A 3QM1A 3EMKA 4ZMBA 2WG1A 3TB4A 2BN4A 1TVCA 2HDHA 3I01M 3AESA 3CH6A 4XD2A 2R87A 3AJ8A 2YWCA 1IM5A 2NG1A 4KGVA 4WEOA 3HCRA 2BR3A 2Q3JA 1L7AA 3GUVA 3TLBA 4CM7A 1CK4A 1RXIA 2GK3A 5KVAA 4QVIA 4ZQEA 4F9FA 5G1NA 1F8UA 3OQJA 1YRHA 4R5MA 4S2EA 5G1PA 4F71A 3GEPA 4DUYB 1QK4A 3G82C 3QEKA 4RVGA 4L0DA 2Z3WA 4TX1A 4MGHA 4BLWA 2B1IA 3RTAA 2JBWA 3SI7A 6Q21A 2F3UA 2RAFA 3CNNA 3KFLA 1U7UA 3F7MA 3JPWA 4HNSA 3U61B 5JJ5A 3X2SA 5K3SA 2A5DA 4C5BA 3H17A 4MKGA 5FA8A 3T7KA 4RPIA 3DVRX 2BUAA 1SNYA 1FVXA 4D9NA 2YW9A 1I24A 5JSZA 1OA0A 5K0JA 3F5SA 3GVCA 1NJGA 1IJBA 3O4RA 5GGXA 1CS0B 5C53B 3KELA 1XSEA 1R5OA 3N2ZB 3PQFA 4Q7EA 3U7JA 3HTXA 2JJ1A 4JR1A 5F5XA 2OGSA 3WFZA 1XPRA 5KNBH 2EG5A 2AA3A 3K09A 1DIAA 2RH8A 4OQDA 3VYRB 1KO4A 1MLDA 4RZIA 4DUGD 1DRUA 4I0WB 3IV7A 5DNYB 3AI2A 2JK1A 1A77A 2D0PB 4KAFA 2RG1A 2B7CA 3G1WA 4M1QA 4X45A 4B6EA 4MR8B 1F7UA 3UO8B 4D8YA 3ES9A 4IDPA 3UHOA 4G0VA 2V3VA 2FEOA 2FLWA 3ITKA 3SJAA 4A6XA 5KSPA 3M6WA 3WGOA 3UJ7A 4O4LA 1US8A 2J9RA 1PFGA 4M0KA 3ZNOA 4BVFA 4DVJA 3ODGA 2HXSA 2WIKA 2JLUA 4LJSA 3U1VA 1I1QB 3PUVA 5FUYA 4PLTA 1O97C 1ZOLA 2HKIA 2LCFA 3DT9A 3OCJA 3P9NA 3PUZA 3T7SA 3BORA 2WQZA 3B82A 3I9OA 1EP1B 3TOVA 1QHSA 4DV7B 5G40A 1ZD2P 2NAPA 3RREA 4Q9IA 2CNWA 4Y18A 4JITA 4KW7A 2HAEA 3W4IA 2H1HA 3F6EX 1U28C 4M9CA 4A82A 3NR2A 5B7GA 1H2YA 4M7PA 1MBZA 1SN7A 1U8TA 2H51A 2JGAA 4BGIA 2ZJBA 3PJDA 2NZ8A 1QV7A 1VBFA 3E48A 4ZKDA 1RZUA 2P6OA 4L3VA 2Q1UA 3TUZC 4BLVA 4OB6A 1R6BX 2IP1A 3JALA 3CUEF 3ZKAA 3L7LA 3TJMA 1DC6A 1UCFA 2I1QA 1XU4A 4N5DA 2G67A 5HRCA 2X1VA 1E99A 2COKA 1NQAO 2Y1GA 2B36A 1Y9ZA 1KVSA 2GA8A 1NUHA 1XDBA 2UZ1A 3ZY2A 4YXWA 5FOXA 4EYGA 1X0VA 1IWOA 1ORIA 4YQZA 1COWA 4U6NA 3UAWA 3QE9Y 3LL4A 1J33A 3IEXA 1JZTA 2HN9A 2I7VA 3T34A 3ZCUA 1EB8A 2E3JA 5C5DA 4IOJA 5JQGA 2Z2XA 3WO0A 3RSHA 2GJKA 1T34A 4CM8B 1TCUA 1GGMA 3CNLA 3O2QB 4IJKA 3OQNA 3KKMA 1RD4A 2ZYTX 4Z3DA 3TOCA 1XDSA 1C7QA 1LLCA 2V5VA 3AV0B 3BYZA 4I08A 4G0QA 4PX2A 4ZQCB 1Q6YA 1B15A 2CMDA 4HD8A 1QPGA 1VC2A 3LDAA 1T8YA 1DQRA 4WW0A 3R8CA 2ZRDA 1NOIA 5KOIA 1G8SA 3REQA 3K20A 2XWJI 3FKJA 3KHSA 4GLFA 5BPFA 4OQPA 1ZS9A 4Z51A 3GGJA 3NYQA 2ZWMA 2RAUA 3OZFA 1KEWA 2C5AA 1BD4A 3FSJX 3L0BA 2DY1A 3KWLA 1HL3A 1RAFA 1TECE 4YAFA 2IXTA 1EXMA 2NU8B 4C4YA 2GA9A 1S4QA 2BVNA 1JFFB 1RCTE 1M34A 4TV9F 1C8LA 1U9IC 2ZRKA 3DEHA 4S1PA 2G40A 2MWMA 1GGVA 4Q82A 2ZBVA 2X3UA 2HA2A 2XB8A 4CKWB 5CFOA 3NEJA 2C9BA 4YCBA 4KAJA 3T3IA 1CQWA 3H3FA 4DM4A 4R01A 3PVSA 1P5RA 1H2ZA 1F3LA 3M0EA 4G23A 1MVOA 2JLZA 5FEUA 2B2CA 2C94A 4GOOD 4CM9D 5LLSA 6ABPA 1VI6A 4WX2B 4R0MA 3FCYA 3UENA 1QLJA 3ANSA 1XROA 3OZUA 1OPRA 1JHAA 1EG7A 1M0TA 5AJYA 1MORA 4OI1A 4NV3A 1P73A 2QZSA 2SKEA 3NIBA 4FFSA 4LBVA 4TXNA 2H2DA 5EWLB 5JWHA 4BNWA 5I4IA 4HN4B 4M0DA 4I55B 3DHYA 1JJBA 2B94A 4JJ8A 4R41A 1JA0A 3NHZA 3QOYA 1ITZA 1TUGA 3ISVA 4INOA 3DHWC 4Z7QB 4TZ6A 3GEEA 1S9DA 2O23A 5JNVA 4K1LA 4QHSA 5DBHX 4E30A 2HZBA 1X7WA 3NXKA 2FWRA 2X8LA 1XOIA 4N76A 1PKEA 2P27A 1UC5B 4QRHA 3WAKA 3A6ZA 4BNDB 1PDOA 4NLLA 3REOA 3IEMA 2IITA 1I13A 4WE3A 2AD1A 2P9EA 4Y2UA 2I71A 1WHTB 2Q8QA 1P5FA 1TQDA 4MPDA 4BBAA 4BVLA 4XR4A 3R5JA 4EZIA 2W90A 3AKZA 2IXAA 2JFVA 2OM6A 1DLIA 1NR1A 1A7KA 3CGGA 4A3SA 4D43A 1MCZA 4EUSA 1X6VA 2JI6A 4ACAA 1VKOA 4TLMB 1WJGA 3QXHA 4XIJA 2BFWA 3AVUA 3VMFA 5GPBA 4MRAA 1OLSA 2QR2A 4MNTA 4ZYVA 3D59A 3PQEA 2ZIVB 1JJVA 2LR0A 1H0RA 2O48X 1IBSA 2X1MA 5JH7B 4BVAA 4DCNA 2UDPA 2X9LA 4AY5A 4O4IA 1UOOA 1LUAA 1YR1A 2O1EA 5TVKA 5CBPA 5LQRA 2KQUA 3W5JA 2Q21A 3SU8A 3NX4A 4JKYA 3N8KA 5E6UA 5EIBD 1ZOSA 1NN3A 1EWVA 4CEJB 3KZVA 3EGDA 2EBWA 1JU4A 2ZUUA 1QQ6A 4TKZA 4W5WA 4KPFC 3EQ7A 2C4NA 1RM4A 3OT1A 4O2AA 5LQCA 1PR9A 1XU7A 2HC9A 1QBGA 1J0XO 2Z8XA 2GM5A 4KVAA 4JVSB 4S1NA 1X1AA 1HOTA 4UKDA 4G1FA 5ALWA 2EKLA 3ME5A 4FKZA 5HCIA 1OVMA 5JO0A 5SV2A 3TXAA 3ER8A 1E1MA 2PJZA 3QXXA 3JR7A 4GMGA 4OLHA 2QMUA 3ZLVA 3DMTC 2FG6C 3HA3A 3OI7A 1DOHA 4ZU1X 3TIGA 2WD7B 3Q7PA 1VM6A 1GPAA 1DOAA 1GP2A 1W4CA 3HMQA 3O4VA 4F2WA 5B58C 1OYVA 3EN0A 4TSRA 5AKHA 4BIMA 3LK7A 2X4LA 3AUTA 4MUNA 4CEIA 3INYA 4M55A 1F2TA 1V8OA 2Q4RA 3I9V1 1MC4A 4LZNA 4PANA 2RG7A 4HT3B 4U8GA 4LJ6A 3B38A 3WYEA 4NBNA 4PYJA 5C8XA 4JZKA 2HRRA 2QAGC 2VLIA 4CXMA 4ENPA 4KFUA 3KAQA 2VHVA 2QMHA 4LOAA 3JQBA 2CSUA 3K0FB 1YDHA 3FAZA 4KSYA 4UFOA 4UTXA 1U7HA 5EKDA 4WOPA 3W3ZB 3KSZO 4CIVA 3KQPA 3KKOA 4FE4A 2QEQA 3M6MD 2PTGA 5DHSA 3EGXB 2ILVA 1UBGA 3ABZA 1XDUA 2BMEA 1SUEA 2BELA 3I52A 3PC8C 2V6IA 4I55F 4RKQA 5E9QA 3DXXA 5H16A 2NSYA 1FP7A 2NU9B 1HM5A 3AM5A 1JEQA 3CLSD 1WUTA 5A2GA 1LF5A 1XX6A 2GD2A 3SY8A 3TGPA 2AEJA 2O8EB 1P0QA 4PTZA 3HKCA 4K3VA 2RBKA 1A82A 3HYTA 5DIZA 4KRFA 3BK1A 1X19A 1ABBA 3K9CA 1KSFX 3O0DA 3M4XA 3GCXA 4HQRA 4OSOA 4P4TA 3NTLA 2HXGA 3R75A 1CUYA 4BWYA 2VCEA 1LBHA 4JEHA 2LBPA 3PV0A 1BCSB 1E3WA 3AO0B 3KEOA 4N65A 5D3QA 3ESDA 4H1VA 4IJWA 1OC2A 1A1VA 5EAIA 1GPUA 1DIOB 4EY4A 4ZPXA 4H7JA 3WGJA 5A3QA 3E9RA 3IEVA 1FUIA 3V1TC 3IJRA 2ADFA 2WMYA 4JUIA 5EC8A 5DWQA 1RIFA 4F7DA 5ALVA 1YCFA 3WIUA 5EIEA 2FQ1A 3BQ9A 3N75A 4TKUB 2ZQ5A 3FNGA 4H4EA 4Y6QA 3PC4A 2G70A 4J16C 4DJ5X 1FXWA 1OIWA 2RMKA 3VZCA 1SVMA 3KEGA 1SHLA 4IG9A 5A03A 5AM2A 5JVDF 4KPEC 4V1CA 1D9XA 2V03A 5J5AA 1N9KA 1XIVA 3D8UA 5T5QA 3WBBA 1YCHA 1TU4A 1TYZA 2FF7A 4BMZA 2BHSA 3TI7A 1OFIA 1U0TA 1XYYA 3LC1O 4C4RA 1XQ9A 5LR6A 3UB4A 1PZFA 2F3RA 2ZJZA 3MLBA 2DULA 4E2FA 1K9VF 3DNPA 4Q9NA 5AUNB 1RI3A 2X5JO 4TS9A 1MJGM 1VG1A 3W8FA 2Y9PB 1Y8AA 3AIMA 4FDVA 4I5IA 4ND1A 1L5FA 2BY4A 3AM4A 3HYRA 4GOND 1E1RA 4IXNA 4JGGA 3O8DA 5EJ6A 5AW6A 2VYVD 5I4KA 1MF7A 1Z5UA 1JEYB 3NOXA 3X43A 3D8TA 1PW7A 3BB4A 4NCAA 3N8NA 4QM6A 4RXTA 2AXNA 2GBGA 3MMXA 3Q3IA 4C4OA 3MMZA 4F4FA 1VHJA 3KUXA 2WA1A 1C81A 1WZIA 1Z7GA 4H3KB 1NSFA 5EQJB 3RARA 4NAHA 4YJKA 4EHIA 3ZIAD 5IKMA 1EVJA 4I8DA 3D7MA 2I3DA 4KGXA 1ST2A 2WAMA 3J80A 3VKGA 3R3SA 1G41A 2RBEA 2INGX 2OPHA 1QYVA 2AK2A 1YH3A 5B58T 4WT7A 1WUIS 2PKQO 3ZC3A 6LDHA 1Q2UA 1VL8A 2QMZA 5BMVB 3NEPX 4G5HA 3CQ9A 4PU0A 4ZYTA 3ZBTA 4H15A 3B2QA 2FN3A 3E1KA 2C04A 4HJRA 5BSGA 2JFYA 3MTIA 3IP9A 4R7GA 1R0KA 2OYCA 5JY1A 1S2LA 3WJ2A 2Q8NA 1AUOA 2XB2A 3EZNA 4TMZA 1H5QA 3P4UA 1X77A 3B6IA 1NN5A 3PSAA 4X7BA 1N6KA 2HA0A 4A5OA 1JYEA 2PSSA 4IZIA 5BV0A 5G4LA 4MV5A 4JXXA 3B9QA 4B31A 2FGJA 2Q6OA 4BP3A 1F8YA 1GZSA 1NI4A 2CDAA 3DDCA 3PTAA 3CCCA 3ZQKA 4B8ZA 1ZC4A 3OJOA 2QE6A 4G65A 4LC0A 4DBVO 4YJ3B 4ASUA 3UTCA 3K05A 4UCXA 4MO2A 2EZUA 1H3FA 1ZJZA 4IIJB 1Y37A 4DIKA 1JT2A 3T7CA 4MVJD 1ECPA 2IS6A 2PZFA 4EBBA 1BTOA 2PX0A 2GPBA 4WBSA 2D5IA 5MHTA 5BQ5A 4GW3A 4KE9A 4R2LA 1MNQA 4BP1A 4QNMA 2E6KA 1MMFB