1VYHA

Paf-ah holoenzyme: lis1/alfa2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
218
Chain Sequence
SNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling Paf Signaling to Dynein Regulation: Structure of Lis1 in Complex with Paf-Acetylhydrolase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB BETA SUBUNIT
total genus 72
structure length 218
sequence length 218
chains with identical sequence B, E, F, I, J, M, N, Q, R
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1vyhA00
1U8UA 2O14A 2Q0SA 5BN1A 1K7CA 1DEOA 1FXWF 1ES9A 1ESCA 3W7VA 2WABA 4Q9AA 4HYQA 1BWQA 3P94A 1PP4A 3BZWA 3DT9A 4K7JA 1WABA 5HOEA 4S1PA 5JD3A 4PPYA 1VYHA 1VJGA 4H08A 4IYJA 3HP4A 4JHLA 4JJ6A 1ZMBA 3RJTA 3DCIA 1ESDA 1V2GA 4JKOA 2VPTA 3DC7A 1BWRA 4K3UA 4NRDA 1ESEA 1YZFA 2HSJA 2WAOA 1J00A 4OAPA 4RW0A 2WAAA 1JRLA 2Q0QA 5A4AA 3PT5A 4LHSA 3DT8A 3C1UA 4Q7QA 3SLRA 3MILA 4M8KA 4TX1A 5B5SA 4DEVA 4I8IA 1IVNA 3DT6A 1Z8HA 3SKVA 1DEXA 1FXWA 4OAOA 4JGGA 5CD9A 3KVNA 4K40A 4K9SA 3U37A 4HF7A 2APJA 4XVHA 4JJ4A 2W9XA 4RSHA 1BWPA
chains in the Genus database with same CATH superfamily
3RUDA 1BMFA 4YPOA 1MOQA 3M6XA 4RTMA 3WKEA 1FP4A 4HZUB 3UB2A 4W9RA 5ALKA 2H8GA 3UUFA 4NIMA 6PFKA 4DUZB 2HTFA 2YCLA 2G88A 3FWKA 1NM5C 3PHIA 5B1DA 1JAHA 1O97D 3MXTA 4FZJA 2CJWA 3T06B 3K1YA 4Q4AA 2VDRB 5JS6A 2P9YA 3I92A 3JYOA 1BWSA 3VZCA 4YRJA 1SB9A 1F60A 3D8BA 3EZFA 4DDHA 1RZVA 2B7CA 4LSMA 3VTZA 3ETCA 3AFMA 4YR9A 5JO0A 4DF3A 3ZGVA 4FLEA 4KVGA 1WIWA 4G07A 1B43A 1TTQB 1BE1A 2VSYA 2EL9A 2W6MA 4TVKA 4KE6A 4EYSA 2YIJA 3X2SA 2N3ZA 4DXAA 3MTJA 2PQ6A 1XMSA 3IBTA 3IAHA 1EFPA 5JE8A 4Y6GB 2YV2A 4CMIA 2B98A 4X90A 4XW2A 3TIVA 1QG0A 3LDGA 1N3YA 4TWAA 1EDDA 4Z7OB 5A6SA 4R31A 2JFPA 2VT7A 5KOHB 4CIVA 3IERA 3GPLA 4ND6A 2W48A 2F90A 1OH7A 2P6UA 2GNAA 2NXJA 4UM8B 5DNAA 1YA8A 3HYNA 3GT3A 4PN3A 1RWQA 2VDNB 5EQDA 3TIXB 4DJFC 3R23A 3PU6A 4HMQA 1NTOA 1L4BA 2Z8ZA 3UJHA 4WX2B 2FPKA 2SCUB 2VDVE 3DO5A 3AYZB 3B1YA 1R7RA 3MTQA 3B6EA 2QKYA 3VPCA 1VKNA 3NH6A 1Z83A 1ZRNA 2G8LA 5DXJA 3UQYS 4N0MA 4NK4A 2P4EA 4MS4A 1CRLA 2J41A 2WLTA 4RH1A 3RS2A 1ZLXA 3KKQA 4E22A 3THWB 1PSWA 2AMVA 2IYOA 1G3MA 1EUCA 5JWRA 4UNRA 2WAAA 1E2IA 3FCOA 3DBOB 4LZLA 2FGKA 4OGKA 1F0YA 3AI1A 1HDCA 2IYYA 3TJRA 3TRHA 1YKFA 3UIEA 3PC6A 3VFDA 2GZMA 2H4WA 3FTNA 3CKLA 4MS1B 4GAEA 4BO0A 1D1PA 1XCBA 5EZYF 4U9IS 1FTWA 3ICCA 4JOCA 3WKDA 4EMBA 4HNQA 4CLOB 3WNZA 5J2UB 3U3RA 1UOEA 2KWIA 4F72A 2GAIA 4MGIR 2FPIB 4RFVA 3CNHA 3KLOA 4C14A 1KH3A 1E7YA 2UUAB 4EBBA 2HCJB 4UASA 5T4HA 4L9WA 2Q29A 4O02B 3FD8A 1RKBA 1LI5A 2REOA 4MRMA 2R65A 3KKLA 3KOYA 2R8PA 1BEEA 4O4LF 3UYLA 2ORYA 4QU0A 4DLNA 1DQYA 2CNBA 5A5VA 1UR5A 1M5UA 1VMKA 1M10A 2D8AA 1XG5A 2GO1A 1Z2DA 2WIGA 5DHTA 5LJIA 2HN9A 3WK8A 1IAVA 3OZBA 4J76A 4YP1A 3KJQA 2G5CA 3D6AA 5H5JA 4NY1A 1Q0TA 2H1SA 5DMHA 1U4SA 3KBOA 3GCXA 3KFVA 5DLQC 3E22B 2QLTA 3OETA 4PHCA 4ZHSA 1KO5A 3ZD7A 1NSFA 2QORA 2V0CA 1HQYE 4AWBA 4BNWA 1QHYA 5GV7A 1NXPA 3PGA1 4M49A 2CVZA 1QOQB 1CE8B 1JU9A 2XYPA 5CA1F 1P8AA 1A8QA 5LQKA 3BFJA 1QHHA 4NYJQ 3L92A 5IJAA 1NJGA 3K9LA 1SHZA 3G7UA 4G0ZA 4XX1A 3MTGA 3HJTA 1WA5A 1NUUA 1JH8A 2D5AA 2VUUA 4UEWA 5FNVF 2HJRA 1OE0A 2WJPA 3IEPA 2VOEA 2YWJA 4GI5A 4JBIA 5H16A 4CM9D 4J43A 5I4BA 1DARA 5F1KA 1FW8A 1WLYA 3GZNA 2HCFA 5GM2A 1WDKA 1XVUA 5BURA 1PLLA 3D0OA 3C8MA 3K4QA 1FRQA 1GG8A 3BFVA 3O73A 5DBFA 4ZVSA 4M0KA 1D0IA 3ZHYA 2IBSA 2B4YA 3QA9A 4BS9A 4I55F 3KQNA 3KUCA 4WVFA 3C3PA 3DMTC 3DHNA 3B1VA 3N6XA 3PI6A 3KKOA 3DVSX 1JILA 1VIMA 4M76B 2FMXA 5HYVA 2GPYA 5IFLA 2PLRA 2Q3FA 1W34A 3PL5A 4XLLA 1K4MA 4MVYA 5EJFA 3TNJA 5LQRA 4FGKA 1YNOA 3A2LA 4ZQEA 1C0PA 1Z62A 4H7FA 2P5TB 1C0KA 1KQOA 2D7CA 3AF4A 1OMOA 1T8UA 2BKAA 3I58A 4IEFB 2ZWIA 1PL8A 1K0FA 3FZQA 4GOMD 4NC9A 1Y48E 2VYVD 2WM9B 3IUEA 2H6EA 2WZCA 4P5DA 3DW1X 3E15A 1XP8A 4JHLA 1E1NA 2REBA 3LKVA 1CY8A 4OQFA 1NYTA 3TRDA 1P8JA 2JGMA 4P3XA 3EUFA 4HH1A 2J6CA 4YP7A 3RJTA 3TZCA 2WTUA 3SS8A 3VYRB 2B2NA 3SFVA 1KI4A 3IDOA 2ID7A 4KDFA 3LQRA 3C7DB 3QKIA 5IDQA 4BEBA 1IOLA 1NSTA 4FOSA 1I7DA 1K9SA 3PP8A 5DRTA 3H5VA 2GKSA 4CKBA 3R3JA 4EI7A 1L4UA 2C82A 2W2VA 1K89A 1X39A 2NN3C 3B82A 3P2YA 1SXJA 3Q12A 1NBMA 3RVRA 5ETJA 3WYDA 3VSDA 2OBMA 3D3EA 1T6NA 1TM2A 1NI5A 2HK7A 3OHSX 1HOTA 1QHEA 1J09A 3UBMA 3PUIA 5A4FS 4RHXA 4FR5A 1W44A 5EKDA 2EGUA 3WSVA 2P2SA 1P2DA 2G5TA 5LQNA 3RC9A 2GK4A 1ESMA 4LDZA 4ZVLA 1ZUIA 1WRBA 4CIAA 2QUZA 4MW7A 3QEAZ 3U6KA 4L73A 3MW8A 1HRDA 3HWSA 2RG7A 2J0EA 2JGAA 1K3UB 3AF3A 3L8YA 4JL6A 2RSLA 3FPKA 5BNTA 1FUIA 2XQFA 4CDNA 4D96A 1JDJA 1EEHA 1UZUA 1PR0A 3KV3O 3L7IA 3DLHA 1OFUX 1ZIDA 5EN4A 2QTZA 5JVDB 2X5OA 4F2DA 3D6TB 2DHQA 5TGTA 1SG6A 4OMUA 2ZREA 1YOBA 1YUBA 2BFNA 1GG5A 1P7WA 5KAMA 5HHTA 2J32A 1Q2XA 1TUGA 2YJ6A 2X5JO 3KQPA 2FWMX 2VXBA 4GYYA 3U6BA 1G9TA 4HNUA 4QOEA 1SA0A 1X9IA 2JLBA 1OQAA 3ETGA 3MTDA 5BOSA 5ICGA 5IVHA 3PICA 3ZU3A 4Q05A 2V4UA 2YINC 4H3KB 4OBWA 1EUZA 1E2EA 4RBNA 3BBPA 2X8JA 4QNNA 2PE5A 4R1UA 1NZFA 7ABPA 1L5ZA 2BE9A 2Y2VA 3OF5A 4UVIA 4F5YA 3A7DA 4KPEC 1KAHA 1FJHA 1QV6A 5BV7A 5JHHB 4J7UA 4DGSA 2AWOA 3AJDA 4V0QA 3WNDA 4CE6A 1UJ4A 3W1WA 4U0JA 3L6BA 3Q11A 5ALPA 1P9RA 4WHMA 4WRRA 3F9IA 4D98A 1AKEA 1HTTA 1I24A 1SU8A 2KM1A 2IZZA 3BK1A 3CF2A 3M89A 4HAOA 3W8NA 3NGXA 2L18A 4ARUA 1SVUA 2IIQA 1GFZA 3BXPA 2D0DA 3ROFA 4Z4IA 5JXJA 1C3XA 3R7DA 1C3JA 4FXOA 2AE1A 3BIWA 4PO9A 4QUJA 3BN3A 3ESRA 1L5GB 2H9AA 3DT9A 4ENSA 4D80A 3SJBA 4P34A 2Z3VA 2XCSB 1YB7A 3HEBA 1MVLA 4BLUA 4Y7DA 5NULA 3BA6A 1NX9A 2IIBA 3VSCA 4IYRA 3OOSA 5DHUA 2ID4A 1HDZA 1OFVA 2O2EA 4RVSA 3KHTA 3IBFA 4WKBA 1OFGA 4HWTA 4BNXA 1TPZA 1WMDA 2EAUA 3EF1A 2XDWA 5CVDA 5JD3A 5TB5A 5LZ9A 1DXOA 3H2ZA 1FUYB 4FM9A 2IZ5A 4CRWB 4OJYA 4JI6B 4DUGD 2YXLA 1W96A 5FUYA 1KZ9A 2IYRA 2NZ2A 3LLSA 5I7SA 2Q1UA 3IJ5A 3INGA 3EVDA 1N8KA 1ESDA 4WSOA 1X74A 3HDHA 3PFHA 3LJKA 3L77A 4LQLA 3NP7A 3C7KA 2NP6A 1SIWA 2CXQA 4YAJA 4C78A 5L9AA 3U9LA 1R27A 2WMOB 2YNMA 1MO5A 3SZLA 2C9OA 3MZ0A 3PYXA 4QT0A 3KYBA 3V4RA 1G5PA 5HJ7A 1WTCA 1A4IA 1M7HA 1W49A 3EIWA 1I5EA 4JLNA 1PNOA 1A2BA 2H9IA 4KLZA 3QWAA 2XA2A 1XZNA 3X3HA 1MDFA 4WVLA 2Y1OA 3OT5A 3UCEA 4ND7A 4DIMA 4DLBA 3P2KA 3SHVA 4ICIA 1O6BA 1T34A 5LXTF 1WW2A 3KEQA 1A96A 3IUNA 1OI7A 2X2FA 3NVDA 2FUKA 3ONEA 4XGIA 4EVRA 2WQ7A 4FOPA 4LZNA 2NUTA 2H1IA 3TRFA 2Q6OA 2OK7A 1UJ5A 2GBLA 4JOSA 5KTNA 1L1EA 1AKMA 1KWKA 3N74A 5K09A 2HRZA 3M34A 4ZGGA 2J6HA 5AW4A 4CM5A 4MV6A 1Z5VA 3KZVA 4WJLA 4L0CA 1EYZA 1TX4B 3I1YA 1XU9A 3PITA 5CA0B 1K4KA 4CKCB 4IWXA 1MTOA 1PUJA 1BNCA 2ZS7A 1LUAA 3KTAA 5T8KC 2DOKA 4ZVMA 3UJCA 1G0NA 1M8KA 1KERA 5D84A 1DBQA 1FX1A 3L1UA 3KOWA 3EK2A 1DBPA 1Z8HA 1CY1A 4KX3A 2UYYA 3K0AA 4ECAA 3W6OA 1E6UA 2W6ID 3MUFA 4CCWA 2J9XB 2PT7A 1WSBA 5CURA 4Q6WA 4N7JA 4WBNF 4L7VA 4DTIA 3KVNA 1I13A 1L7QA 3RU3A 4Z9BA 4C08A 4XUGB 3AJ9A 5F3RA 3V8QA 4D7AA 4Q1EA 3GT7A 3NTXA 5FI0B 1M34E 4X1IA 1ECJA 1IIBA 3P0HA 2AXEA 4RWEA 4UCFA 1TCUA 4RHTA 1MV5A 3JY6A 5AJUA 1C3VA 5ALDA 3VYTB 2VVTA 2QM7A 4J4TA 1WUKS 3DF7A 3G79A 4OY3A 1GQOA 4IEIA 5JS7A 2B25A 4L0QA 1Q15A 2Y3IA 5IVDA 1L0BA 1QKJA 1XQ9A 3G2JA 1QQBA 3AUJB 3AEXA 5C4IA 1Y8RB 2HUPA 2QY6A 5L4NA 2OGSA 5BNWA 1WBJB 1DCMA 3OZWA 4M98A 3Q7TA 1LK5A 3LC0A 2IP2A 2OAGA 3WLKX 4M46A 3QEMB 1XTUA 3N9IA 3U4HA 3SICE 3X2FA 2H7YA 4RK5A 5JVDA 2QRVB 4U6QA 4IHKA 4CFYA 5AJHA 1K6XA 5A1TA 5CEJA 3II6X 4O4LA 4QPNA 5DZSA 3D6FA 1FYEA 4FP9A 5EZ5A 2AQIA 1L5QA 3H8JA 4GLOA 3PKJA 4AFNA 4ZIRB 3CX3A 3Q40A 2OO5A 1X8JA 3B7PA 3NCHA 3IP5A 3WMRA 1ZBQA 1JI0A 2YOHA 4N9QA 3VC7A 3WIEA 2IYTA 3MS4A 1TOAA 1IDOA 3VH1A 1O94D 1G59A 5KYUB 1ZHOA 2DMRA 4P5EA 1JWBB 2P7HA 4PLPA 3C0KA 3UCFA 1N8TA 4E6PA 1E9CA 1XYYA 2I1QA 4QZVA 2MMCA 1MT0A 1YQTA 4N7RA 3RUFA 3SX2A 2NVWA 2XNSA 1P33A 4B0OA 5FWYB 3AW8A 5E6RA 4OQYA 4KQCA 1SXGA 2VTEA 3WICA 1D1SA 2I2FA 3GJRA 1QOZA 2R2GA 2G04A 3TTWA 4DE5A 3QELA 2FN7A 2IHVA 1JQLB 1O95C 4XB2A 3R8XA 3K72B 1XZDA 4H0NA 5FBKA 2BDUA 1DMRA 3D2CA 4RMHA 1JKJA 2KE5A 3MUNA 5ERGB 4HT3B 3C16C 2D1RA 2PH5A 2QTVB 3A3OA 2NIPA 1UEJA 4JSRA 3WHPA 1J1IA 2B7BA 4QDZA 3CBGA 3CX4A 3T1VA 5CIYA 2BHLA 3LA8A 3CVWA 3EOBI 4N8DA 5KOHA 3L7AA 2I6GA 3MTBA 3QUTA 3CINA 4MVJP 1NWHA 3BHJA 1R5OA 2AOVA 3L04A 4HUTA 3T7DA 1GCAA 4QVGA 2QAIA 1SB8A 1HEUA 1KP2A 3H1PA 3R9KA 3VX3A 4EW2A 1MX1A 2NSYA 1IHUA 4HN2A 1X38A 4TYQA 4IJ5A 4EHHA 4L0MA 2PD3A 2IX9A 4DSUA 1NLZA 5CYPA 1YQUA 4L0DA 5KDLA 4JENA 1U7ZA 5MHTA 3ZGOA 4PTZA 3JXEA 5IFKA 1Z4PX 2AKAB 2C9CA 2C7QA 1VZ3A 1KDTA 2IU0A 3T99A 4TV8F 4D99A 2CUNA 4M1EA 4QM6A 2X1VA 1R0RE 9ABPA 5B6JA 3QGMA 1FDSA 4AMYA 3BWYA 1R4NB 4BQSA 5LKRA 2JLUA 1JHUA 2JIMA 3STHA 3STVA 3ZY3A 1ZUWA 4F8EA 2XTNA 4BFXA 3I61A 1NTRA 1YB2A 1OH6A 1SXJD 2IHKA 2G9QA 2XIQA 4HZIA 3K6SA 4IMRA 1JZTA 1JEOA 1UFVA 2DKFA 4DIKA 4M9SA 3MCUA 5GJBA 1E2UA 3PL1A 3PJRA 2QPOA 3T61A 2P4QA 2NTVA 3SSAA 1FJ2A 3AIKA 2HF2A 3MA0A 4PCLA 2AFHE 3LWNA 4RELA 1GTL1 3SLGA 4OBXA 5B6IA 2Y05A 2B78A 2BBWA 4IFIA 3B3GA 4L9RA 5G0WA 4DCOA 1FMFA 4RKFA 1WLSA 2WFMA 3VO9A 3AL2A 1OUMA 1K7CA 1UPUA 3DPUA 5CB4B 4KXNA 4ITVA 5DU2A 5FPHA 1Z0KA 1D6JA 1D2CA 3C3KA 1JBEA 5JISA 3UPUA 3KQQA 5HG0A 4BJ3A 2WG0A 5B57C 1GKUB 2BGWA 2QMYA 4RV5A 3N2ZB 4FOLA 4OP2A 3LK6A 1ZVVA 4MW0A 2R6JA 1I10A 2WF6A 5DX0A 3BL8A 3MT7A 2O8FA 4URYR 1DNPA 3DKRA 1AGYA 1A0OA 1NMZA 5A4JA 5AQ1A 1JH9A 4QHTA 5DCWA 2N9UA 5DN6A 2GHRA 5JS1A 2PVCA 3DWGA 2OG1A 3EGCA 2IU4A 4JEUA 1XNRB 1M6VB 4MKFA 4LRYA 4B43A 3G5AA 3K2QA 1UKYA 3Q1KA 3GLTA 4EGJA 4YRFA 2OCPA 4H7PA 3UC9A 3B8EA 4IRXA 2FZVA 3O26A 2J33A 1V3TA 2XBUA 1FJGB 2BBTA 3DXXA 1Z07A 3LXXA 1A8HA 3WL3A 1V9LA 5CA0A 1C1XB 5KYVA 4QBHA 2UYHA 2RBGA 4BOYA 5JNTA 1KK2A 4QTYA 4EENA 5KHAA 4WH0A 1RCFA 3DG9A 4R2MA 2E48A 4LYFA 4XB6B 5JH7B 4DIUA 4WAUA 5F2EA 5HRCA 2AMLA 1J90A 3H8WA 5DOZA 5SV2A 1HORA 1YJXA 4LN1A 2PKCA 4RPHA 4Z49A 3U13A 1Q16A 1YAJA 1U3FA 5IANA 2CJWB 1MO2A 1U6KA 3KUUA 4QJ4A 1DQNA 5G02A 4EJ0A 2Z8YA 3P0RA 2Q4OA 1R9JA 4OQDA 2ZAIA 2HA3A 4N5HX 1VG1A 3QWFA 4XKJA 3T7JA 1MIOB 2I2BA 1S8FA 1RKVA 3CWCA 3ENNA 2OO7A 3Q0TA 4TT3D 1K08A 4K2HA 4TTTS 1USGA 1NKVA 4CT4B 5DGIA 5A4AA 1VBMA 2XY4A 4OKNA 3OQ1A 4FR2A 4P58A 2REQA 3PUWA 4AT1A 2XOXA 2F3TA 1NQAO 1FXUA 1MOPA 2QAGC 5KJ6A 5BOSB 4KXVA 4BNKA 3BWVA 1QGOA 3OZCA 5AW2A 4LDPA 3W9UA 2A9VA 1MJNA 1E9VA 1WSDA 1W1IA 2C4UA 3ZHTA 5KKNB 4DLKA 4KE8A 1FB5A 3OQBA 4C04A 2PX5A 3N5CA 1ILWA 4TZ0A 1N77A 1IVYA 4CHTA 4UE6A 3AP1A 2CFTA 3HZOA 1IEWA 4DNQA 5J4VA 3LMKA 4ADSG 4OB7A 1NVFA 5FAXA 2G08A 1C9EA 3LECA 3M2PA 2HSDA 4O2AF 4E7OA 4Y0VA 2R00A 3WYBA 3V8PA 2RBKA 3M1LA 1OU0A 3MOGA 1E5XA 1GZ3A 1FTSA 3FPJA 1B2LA 1CUJA 4PPFA 3OWOA 4JGGA 1P61B 4M1ZA 2IWRA 2IBTA 1E62A 2FG5A 2AUNA 4RAQA 1CG6A 2XB8A 3PB3A 5E8JA 1TU3A 1YKSA 2PG3A 3A1EA 3PXAA 4K6OA 1D9ZA 1W4ZA 2WKWA 4TVBA 4WOCA 3VZSA 4RA6B 1Z4JA 4XVHA 1PX0A 3BZUA 1F4LA 1SBHA 3TQHA 1PZFA 4Z0TA 3NRJA 2QL7A 1BJRE 3K0HA 2QL6A 4KXMA 1OILA 4LXIA 2YUIA 3JZAA 4C0HA 1TTTA 3DAPA 4W9MC 5EHGA 1VL0A 1CU1A 3HLKA 1HUQA 1I9CA 5EWJB 3RSZA 2OQIA 3U4IA 4HYQA 1GVHA 4JYPA 4G65A 3DEAA 4I5FA 2PMDA 3RRNA 3V32A 3BIOA 1NBAA 1KZ7B 3PIIA 2ZTMA 4J0CA 3D1LA 1AKVA 4Y9DA 1RE0A 1KK3A 2EZ8A 1SULA 2HWUA 1I30A 1CETA 3A70A 2FN8A 4XYMA 4EI9A 3TM5A 4R3NA 3Q6NA 4MUYA 1FY2A 1CZHA 3TQRA 4DMLA 3QZUA 1VYVA 4K3VA 5CT9A 2QDKA 2QYHA 3ETHA 3KSDO 4JQYA 4DT1B 4FFSA 1Z6ZA 4FOTA 2ZSBA 2DVMA 3GRCA 3VR4H 5BRAA 4IDGA 2QRLA 2CNKA 2FPRA 2ZIAA 1A3CA 3QQPA 4PZUA 5EIBC 5JAMA 4J29A 1QYVA 1CFZA 4UUAA 5JZMA 1XQVA 2E4ZA 3DBHA 3HP4A 5IAEA 4S1WA 5B7PA 4LBVA 1CE8A 1AQNA 3TQFA 1UK6A 1KDOA 3HDGA 3B1WA 1U5AA 3BXHA 4Z7JA 2ZI7A 3U7EB 3EZ6A 2IUTA 4M7OA 5T4EA 1YIOA 2P30A 1OZ0A 1SWVA 3MB8A 3LG2A 4GM4A 4S24A 2XWJI 1CWUA 2OFFA 2GI4A 3H2YA 5DLEA 4BB9A 2YIVX 5E1OA 4OJKA 4F9TA 2O7VA 4DW8A 5FBLB 1U1FA 3IQZA 4EZEA 1ZHHA 4B3XA 2Q8QA 1XHLA 4MCIA 4D5GA 1X7XA 5GP1A 1ADBA 3RVDA 1E9DA 3DXYA 4LHZA 4AU1A 3G02A 1DWPA 4PPQA 4NJMA 3CZ4A 1WKVA 4QBIA 1BVUA 1E9SA 3D3NA 3NYQA 4OHWA 3UAVA 5K8TA 2JBAB 4KMRA 5C52B 2D3WA 4GHWA 5M5BA 2ZRNA 3IPXA 3L0DA 3L40A 3NFYA 2VQFB 1G5HA 4YB8A 2ZS8A 3DC2A 4I81A 4CM1A 1SCAA 1SWWA 5CDFA 5JYEA 3DOUA 1VE5A 2VRCA 4HDSB 5AJZA 1GLNA 4JLOA 3VTAA 3E9MA 3VBEA 1Z12A 2M6RA 3V8MA 4XJXA 4XDGA 1U2SA 3LP8A 1YGPA 3NHJA 2O57A 3R0IA 4GLLA 3C3BA 3BKWA 2ENUA 1NXXA 3EODA 1OPXA 2F55A 2ECOA 2K87A 2P1RA 4ZT4A 4ZV7A 4D4MA 1D2HA 2ONKA 3GGPA 4HDCA 5A6VA 5CX1B 5FOQA 4HWRA 4AD8A 3SSNA 4BQQA 3RC8A 4NJEB 3QF4B 1C9DB 4YMIA 2IY7A 5EE0A 4QJ5A 1VCIA 4CF5A 1XYVA 3LQYA 3MCZA 1I1NA 1JTVA 3KV1A 5DVZA 1H1LB 3F2IA 1AUVA 4C0SA 2QX7A 4QXPA 1TECE 4GP9A 3CNQS 3H65A 4QC2A 3UFXA 3ADCA 3E23A 2GF2A 4ZAZA 3R3XA 1M5TA 4UM9B 5J2TB 1DOZA 3IKMB 1USVA 5LZ8A 4RJ2A 1L8XA 4L6IA 5J43A 1USWA 4IFTA 4C7VA 3M33A 1KMQA 5KJ1A 2PT9A 2AFVA 4YUWA 4LXQA 2QZ4A 1QRDA 3VDNB 3HM9A 2Y4OA 3GJXC 3KCQA 1OWLA 4TLBA 4EO7A 4F60A 5IJXA 2B99A 2XF2A 1U9YA 4KAAA 3SYTA 3ZDAA 1OTYA 1SVOA 1E3TA 1BKYA 4D4JA 3UJ3X 5DM2A 4ASUA 2X40A 5F5XA 3JZIA 1L9KA 1MB9A 2KSQA 2FQYA 1E89A 3MWDB 2V96A 4ZC8A 3R7WB 3ITEA 2DYKA 1BYUA 3SDSA 2ZB4A 1ECLA 2ZRJA 4NEQA 3PX2A 3QWBA 1KXZA 3OZXA 4UHBA 6REQB 3FSRA 3T5CA 1J97A 1W85A 5ES4B 1X15A 2I78A 1LNSA 3A9WA 2NPIA 5DIZA 3G59A 4IHAA 1L5NA 1VI2A 1VJGA 4C2BA 2PH1A 1CDDA 2NO1A 1GTG1 4TLEA 4C4SA 1Z8DA 1ZMBA 3V4VB 1BN6A 1YAHA 3WYEA 5HF9A 4C4OA 1JQBA 1TZ2A 1NF2A 3HB9A 3O95A 1OXXK 3QH4A 4IGIA 3DNPA 4URWR 2WA1A 3KB2A 4YMLA 2VSXA 2O6LA 1DFGA 2DPXA 4OLAA 3ZX5A 5SZKB 1DEHA 1M7BA 1OI3A 3KT0A 1QLHA 2H5LA 2J5QA 3OC0A 3P19A 2ZT8A 3Q4GA 4KX5A 1R6VA 2I2WA 1OXKB 1VLMA 4JQZA 1DCKA 4OFBA 5JD4A 2RGRA 2XEDA 3QSYA 1W5FA 2ISCA 2PKRA 3QVGB 5IXSA 5KINB 1TU0A 4KSYA 2JGIA 2MSEB 2IHYA 2WK1A 1VLZA 1HF3A 2A14A 1KOLA 2K7ZA 3V5NA 1DQSA 4IIEA 3I64A 2CLHB 4OSOA 3WTCA 1L2TA 2IP4A 3IVRA 5SYNA 3VISA 3AR4A 3GDGA 1E6KA 4GICA 2P9HA 2GWHA 4FYPA 4AYXA 1P0IA 1G3IA 1QHFA 3N2YA 3NYWA 1P45A 2PMCA 3QELB 3CNEA 4MS4B 2I4RA 1CUXA 1KY3A 2BJVA 4QOHA 3EBOA 1GD1O 2P5UA 4LKOA 4MARA 1N6KA 4RVHA 5F12A 1MX5A 5EEGA 4FEGA 2RHBA 4YJ2F 5DP2A 1CPYA 4FYIA 2FUCA 3QE3A 4RE6A 1EUCB 1NLUA 2BI4A 2EFHB 4LHXA 2LIVA 3T3PB 1JKIA 4BNNA 1KMNA 3MJSA 5K3OA 4J1TC 1U65A 5DHPA 3S2UA 1QTNA 3B36A 5AK6A 3IS3A 1KU0A 1VL2A 3OE5A 4R8SA 3F7NA 4XB1A 5DNDA 5F7ZA 3DE3X 2RIPA 1JHXA 3KELA 1ORDA 4RQUA 4W1RA 5FJIA 5GVSA 3G0BA 1AV6A 1SOUA 2GWRA 1VJRA 2OORC 1NV9A 2XGGA 1YJCA 3CCBA 3K31A 3UN1A 3HY3A 3U17A 4ZVNA 3OT1B 1AHIA 1WSAA 1HETA 2BMVA 3A3YA 3IQFA 4YV2A 1D0VA 5CD9A 1DKRA 3U5TA 2IJGX 3JARB 1F38A 1GTJ1 1FQJA 5E3HA 2YRFA 1KYZA 2FVYA 1D5CA 1Z4OA 2VT3A 1S2LA 3UOWA 2CDCA 2XRFA 5FWXA 3SZRA 4HF7A 1MW9X 2FFRA 3IOMA 3AKDA 3K8OE 4DM7A 3LIIA 3ITKA 4WK2B 1VDMA 4OSPA 3NBUA 3A6PC 3PNBA 1HY3A 1FLVA 3A6ZA 2BGIA 5CM9C 5ALSA 1WUHS 5C8YA 3UA4A 2OHGA 3ZDCA 2IWHA 5JNVA 3G7SA 1TUIA 3WQHA 1ONOA 5D1HA 1FQKA 2I55A 5DHFA 5TT1A 3STTA 3R0XA 3ECAA 4OHPA 1XF1A 3V3KA 1MVNA 3EZ7A 1J24A 2GDZA 3DZKA 4DB4A 1TKBA 4RD6A 2X8WA 2ZJ5A 3O4GA 2X6RA 4M0CA 4HN4B 2GPNA 3LX6A 4FIDA 5AXDA 1PP4A 2OBBA 3D59A 1CUCA 1Z4IA 2WD9A 1LVHA 4PYRA 1WHTA 3PUXA 4JLWA 4M0MA 3W2HA 3O9ZA 4EHJA 3RADC 5C53B 2GCIA 3N2GA 4KE7A 5KX5F 2NMVA 4G89A 3MGBA 4IUYA 1VI6A 4RC9A 4DR4B 2GEDA 2GD0A 3AV3A 3UXHA 1BCRB 3OX4A 4LS3A 3U26A 3TEMA 3R7LA 5CX1A 3KYDB 2PAFA 5JC8A 3TLJA 1WABA 2QUJA 4QJ3A 2BCGY 4L02A 1PWZA 4JT2A 1HT2E 2ZVJA 3RYFA 1B1CA 4CR6A 1P2BA 1XDBA 1NP6A 1XTPA 3CUVA 4BX8A 2HCRA 2QRQA 3K09C 1V7PC 1V16B 4YRNA 1T2DA 2W8BB 4NDNE 3BXXA 1G7TA 1EQAA 3LP5A 3TAXA 3QKWA 1BRMA 1DADA 1HT3A 1XDUA 1K88A 5AM1A 1JJ7A 3KAPA 3LCCA 4IL5A 3VVLA 4QL3A 2OMKA 3IIJA 2ZW9A 5IJ9A 5C8YF 1US8A 1MA3A 4CGYA 4LYGA 4RXMA 5BMVA 2RHLA 5M7EA 3KPWA 4GVLA 1UT6A 1EH5A 2G5PA 3QYFA 5I7WA 4ZI7F 3T5AA 4PRLA 2N75A 5TSDA 4G26A 1RRCA 5BR4A 1VJ0A 2QT1A 2XITA 4MQ4A 2FEKA 1P44A 4IX1A 4WJZA 1B8NA 2OBYA 3RV3A 3SYMA 2WG1A 3KB6A 3VH3A 1HNWB 2XCUA 3KU4A 3ICOA 3UJNA 1WZIA 2GDJA 1DC4A 3IQDB 3NUGA 4US1R 4EFNA 4PCUA 3RC2A 4MW4A 3CRVA 3R4VA 2AG5A 4Q03A 4L7QA 4LEIA 3V7NA 4IH9A 2OYCA 1JFFB 1Z2AA 2W7TA 3ANTA 4ANFA 2VA8A 2WF7A 2WUWE 1IATA 4IOJA 5C8ZA 3OIGA 1GUAA 3SM9A 4BB0A 5IT5A 1G5RA 3R9WA 4PHGA 3WGOA 1AS0A 1SUIA 1VRCA 1XTVA 2C07A 3E5NA 4P83A 1FC0A 4D82A 1DP4A 3MC1A 3SR0A 4WFQA 1LGYA 1TAHA 3FCXA 4TS4A 2AMJA 4RJKA 1P29A 3VBCA 3AU8A 1UPBA 2AHOA 4R0NA 1J0AA 2JFFA 2RGCA 1IIRA 3AGPA 3LUPA 3BJZA 4P33A 3W3AH 4GDFA 2F00A 1JEQB 1DEXA 2XSZD 1DXQA 2YWXA 3EXEA 5LQUA 1EK6A 2VWPA 1VP9A 4RLHA 1I33A 2WV9A 3UJ7A 3F5QA 1SU7A 2XUFA 2NVBA 3E3AA 2FHSA 2GZRA 3NYIA 1G6HA 3N87A 1M6EX 4BIIA 8ATCA 4REOA 4H4EA 4MR7B 4ETNA 4L75A 5LP6B 4A1FA 1B8PA 1G98A 4QLAA 4P92A 4PY2A 2CCGA 4GM0A 4LX8A 1KTVA 4OYLA 5AVKA 3ND9A 2R5WA 3JD1A 1HDRA 3L8ZA 5KJCA 4KDRA 2XJ4A 3SC2B 3KKPA 5JCOC 4JJZA 1EHYA 2QTAA 4DT1A 2QVXX 1YC5A 5HRUA 1L1RA 4ZEVA 3NWBA 2DLDA 4P53A 3AKZA 4DQLA 2JIOA 5B2EA 2WABA 4QDKA 4LJ9A 2OCKA 3RK1A 3TOSA 5ENVA 4GKJB 1EDOA 2ASEA 1D1TA 1OR8A 1C9KA 2I7XA 5EJAA 3UGTA 4NU0A 2GZ1A 4F3NA 3R7BA 5LNK1 1JDVA 1TQ6A 1U3WA 2OLJA 4MRVA 4P7KA 2P11A 3WDKA 2JIZD 4JXXA 3DKKA 4EG0A 2Q49A 1O5IA 4GRIA 2R44A 2QL9A 5L53A 1JDBB 2J9YB 4RZ3A 4YRPA 4F04A 3KRTA 3H5RA 4GD3Q 4OGGA 5JFGA 5FYQA 5COAA 4NCKA 4O1IA 4NBSA 4ZQBA 4KXUA 4MW6A 1L5LA 3Q8LA 1G9XA 3EH2A 4AIIA 3Q5GA 2FWNA 2O3QA 1DRJA 2VP9A 3CVXA 1N6NA 1LV8A 2O5RA 1QAOA 1PO7A 3LVFO 5I8ZA 5CFOA 3FR8A 2IHUA 3WBFA 3WWEA 5HZKA 2DC1A 4O2AA 1X9GA 5EC8A 5HQTA 1GGHA 3A3KA 1FZQA 2QTHA 3L0ZA 1QGUB 4I2VA 3PKIA 3TNFA 3NORA 1GPDG 2GYUA 3MJ4A 4FKZA 4HWSA 3TL2A 3SWWA 4PLVA 1N5MA 1GSAA 3TR5A 5I4CA 5FTLA 4MQ5A 1BU5A 2GYVA 1OIWA 3E35A 1PZNA 4RZSA 1NMXA 4PAQA 4GPIB 2I7DA 4EJFA 1EDBA 4FYXA 1MH1A 4OAPA 1E7QA 2GK6A 5JIBA 3ZN2A 2OSBA 5EWLA 4I50B 2XUAA 4U5QA 4J7XA 1MC5A 3WQBA 3DEJA 3WXMA 3IE1A 1TJ3A 1N7IA 3FROA 4CF7A 4UD2A 2WJZB 5C8YB 1NSYA 4HAXA 3TZLA 2RGNC 3RTEA 1Q3KA 5F2OA 2FW8A 3GFVA 5HKOA 1JJFA 3BXGA 3L0IB 1H6AA 3SLRA 4FD3A 1G42A 1MCZA 1KZ4A 1N5IA 1Q7EA 5ITZB 4B4WA 3QBJA 1F4VA 3SE0A 5IJ0B 1GNRA 1NT2A 4LYEA 3AZOA 1PL6A 1Y7HA 1MQAA 3G2NA 4KO2S 2PXXA 3DNFA 1FP1D 1TYBE 3P9RA 4OTZA 2Z6AA 1ECGA 5KTRA 3DGFC 3NRCA 1Z82A 1RI1A 2IHTA 3FPBA 2XUQA 4GPD1 4O25A 3S44A 2YDYA 3KWFA 4HUJA 3ZH9B 4RSMA 1R88A 1I4EB 1YR9A 4B3TB 1CNFA 1T91A 4TYYA 2BT4A 4PPGA 3C85A 4Q66C 4EG1A 1GSHA 1NV8A 4DNPA 2G9UA 3MFQA 3K16A 2NVOA 4ZU3A 4IKPA 5KO2A 5ALVA 1QTRA 2DHDA 1WMAA 1GGJA 3UMYA 3E7WA 2BEKA 2H9YA 3X2EA 1NOKA 1UIRA 1W9HA 2R2AA 2QE6A 1W88B 2JDID 3R3VA 3H3FA 4FNMA 4JBNA 1EVZA 4JYCA 4KWTA 4JUFA 4WXHA 1KQNA 4AYTA 2HFKA 2DFDA 4XUDA 3SXUB 3M6AA 3BQNB 3H1AA 5JAUA 3QOWA 1ZGJA 1MB4A 3ZTWA 1DG1G 1XNQB 3ZHVA 4D6YA 5SZJA 4YMTA 2ZIZA 4HNGA 4YAIA 3PXGA 4BCCA 3FSGA 4Q47A 1MO4A 4IXWA 2AFHB 1DTWB 5HEKA 4X0EA 3RVLA 3U9SA 3PHLA 4PZLA 3HNOA 4RDHA 2CDAA 3ML1A 1HSZA 1YQQA 3OY7A 3RYHB 2E1RA 2NUAB 4L3OA 1FFDA 1RDFA 2P91A 3E84A 1O87A 2QD3A 3W2IA 1V8ZA 2HJHA 2JANA 2B1JA 2BFFA 2ODWA 1BFUA 1Q57A 4NMMA 5CIWA 4BCBA 3MLBA 4EPTA 2BKEA 5IASA 1VL5A 3HGQA 1UDAA 2R8XA 1N5DA 1XEWX 2VUIB 2D2EA 3EXIA 2QE7D 2HA6A 1V39A 3EF3A 1E2JA 1IQRA 4GR5A 2BFPA 2HNKA 3UWSA 3S28A 1FF9A 1GNPA 5EIBD 2AH5A 2X4DA 2YCBA 3DDCA 1KJWA 2HLHA 3JS5A 2NYAA 3K0KA 1UOOA 5KIAA 2ZYHA 4YAEA 3HB4X 4BN5A 2YBEA 4J0GA 2GILA 1NI4A 4J0EA 2YASA 4O4LB 1H4VB 1NUHA 3IDAA 3O84A 3N5KA 5KOYA 2VF8A 5IH7A 1L3CA 3EF0A 4JV5B 1QC5A 4ZV9A 4BEVA 2TYSB 3TBKA 4QDUA 3ZWOA 1PYOA 2GN8A 3K0BA 4P98A 4UHFA 4DR6B 3TS1A 3SP1A 4U2FA 5JALA 1T13A 3GN2A 4IQGA 4DSOA 2JBHA 1ZGHA 4CG2A 3F4LA 1Z73A 4M8SA 1HLGA 5F4BA 5DM60 3OEED 4HNAA 4NPHA 5D00A 4P31A 5CFPA 4UQOA 3UW1A 5L3RA 4RIHA 1MC8A 1RRKA 4MPDA 2DUNA 1EHCA 1VBNA 4FDMA 2NZUG 2Q0QA 1ZQ9A 3ZCPA 1AUXA 1NT4A 4WOJA 3JAKB 2VRBA 3MT8A 3Q10A 4OHXA 4AY2A 1AS3A 5E9AA 2Q27A 1L4YA 1CIVA 1DPFA 1QE0A 2IS2A 1JLMA 2JRLA 1YDEA 1EFHA 2XMCA 2YNMD 1XQ1A 3ZD8A 5K3EA 4AG6A 5DCYA 1G2IA 2EERA 2JI8A 3CCFA 4DWOA 3MB5A 2IYVA 4HXFB 2PKWA 3NNSA 2C83A 4Z99A 2IOHA 1ZK1A 2PRKA 3JR7A 5IC4A 1SKUA 5K0LA 4D6PA 1ZU4A 3FUTA 1PZEA 5G41A 3CEPB 4EFMA 2RK6A 1MNAA 2WV7A 1HFJA 3E61A 4J3NA 1U6JA 3GC6A 1R0CA 1HTBA 1DRUA 3TW0A 3CURA 4G0QA 3OZRA 3WRVA 2XMQA 1ZBDA 4EELA 1X80A 3PQ3A 5A0VA 2X7HA 4RPIA 4UUOA 5TV2A 5AVSA 4XD7D 2FPMA 2WWFA 4JSTA 1EE9A 1FMJA 3SBOA 4RCYA 4IH4A 1YSCA 4UXJA 3VNVA 3LYAA 4CYMA 4B6EA 2GA9A 2XNCA 3DTVD 1DT5A 3F47A 3MFYA 4WBXC 4WUVA 4FHCA 3TL3A 3TX6A 3IHKA 4NPAA 1E92A 1AO0A 4PXSA 1TLLA 2P3QA 2IS4A 5IKPA 1Y4ZA 4AY4A 2A86A 3OPXA 1U94A 2I2DA 2PSEA 4RPKA 3LI2A 5ALWA 2JI6A 5ECGC 3SG0A 3ERCA 2F43B 3CH5A 3T9DA 1HQKA 2HLPA 3DLPX 1NVBA 3EVEA 1U0SY 3N0XA 1GEGA 1XDZA 3EWIA 3OOHA 1E18A 3ICWA 4O33A 4IMJB 4M0LA 1OD6A 4G2NA 4K8OA 1EBBA 4DY6A 2V1UA 4LE0A 1A5SB 1IZ8A 1FUEA 1NYLA 4ENRA 5EIEA 1ZKMA 4NMHA 3SLKA 5G0VA 5HBRA 5M29A 3EVBA 4D3XA 1IPEA 5HKKD 3PE4A 3ZEAA 4RK6A 1TO6A 2FN4A 3A06A 4IOKA 1C8LA 2JL1A 3RC7A 2ZBVA 3K0AB 3ZUGA 4EPXA 4JEIA 4GPBA 4LKRA 5AUNB 2W4QA 1U3TA 2UKDA 3N8DA 4TS9A 4WW0A 2V9ZA 5BMVB 1QBGA 4PHTA 1XZQA 4ZT3A 1EKXA 2YS6A 3E18A 3HPQA 3NJ8A 1KH2A 3GY0A 3LQKA 3TGLA 1L5YA 1GUBA 2A30A 1OC2A 1PQUA 2FR8C 1TEVA 1UBHS 1Y5IA 2IYQA 1ULSA 3NHFA 4N3AA 1P6XA 5JXIA 3OJOA 2OHVA 4NV1A 1EVKA 2RCYA 2ZP1A 2QP9X 2QRKA 3GX1A 1ZISA 5FBQB 3X1WA 2P6NA 1KQGA 5DP1A 1XRQA 4HDNB 2IE8A 4QQRA 5A62A 1QIHA 4WFIA 3IP3A 4ZMBA 5DTQA 2AG1A 3K70C 4MRSA 3OTWA 4RXTA 3C3WA 2QWXA 4H6XA 3TXYA 4EG6A 3HL0A 5H80A 1C8VB 1ADJA 1WPRA 1YMVA 3SQWA 1M72A 3WIDA 5AOCA 3V9PA 2QJFA 3GYBA 4C6RA 1LBSA 2R1VA 5JI2E 1P4HA 5ANRB 2ZSDA 3CSSA 1YB5A 1RWPA 4FMCF 4K6MA 3RBAA 3BCRA 3UICA 2F59A 3JQ9A 2LBPA 4P2BA 1AZSC 3FB4A 2ZQYA 4HEJA 5BOVA 2Q5CA 1K68A 1NBME 2VHUA 2VK1A 3PIRA 4G97A 1LQUA 2WPNA 1GGKA 3GJSA 4LHSA 4AJ2A 2WF5A 2YIDA 2JFOA 1KRHA 1FFXA 1Z5PA 2CNWD 2RJNA 3BMQB 4NG5A 5HUHA 1KRXA 2Z6QA 5C18A 2Y67A 2XOKD 4U0KA 2ZIUB 4HVCA 3ZWVA 1P1IA 1IXRC 1B26A 1VXOA 2ERXA 2DWQA 1H8HA 2BZ0A 1CV2A 4CG1A 1J2YA 4OHFA 3K96A 4JFAA 4K9RA 5UKDA 5HQ3B 4ZOBA 2BI7A 1TA4A 5K3SA 4GM1A 2UVDA 2HMSA 4MW2A 4XWGA 4TM7A 3OU6A 4LZPA 2IUUA 1QANA 3AEUA 4DR2B 1DIOB 4IINA 4IF4A 1ISIA 4FE3A 3SYRA 3B13B 4FYMA 3GPBA 1O03A 4A26A 2HR1A 1FDTA 1HNNA 3FDIA 1E1RA 4IVPA 4PU0A 3MD9A 1KR2A 4Q18A 3REFA 5EGSA 4MYRA 2HMYB 3F4BA 5JPIA 3I5UA 1GL7A 3N2NA 1VBFA 3FRJA 4J0KA 3BMOA 4TLAA 4Y98A 5B1SA 4N0DA 4NESA 3AVYA 3NIBA 3BD7A 1CQXA 4S35A 3L79A 3ESDA 3GGCA 3RTAA 5AVRA 2R48A 3KQLA 1I6LA 1QIJA 4LBWA 4NYMR 4YWJA 3ZS9A 3E9CA 3MMPA 4ZXPA 2YJ3A 3HDJA 3VH2A 1Y7PA 3E3OA 1KI9A 3GBSA 1GG2A 2B3TA 2R3SA 4IDDA 2ZDHA 4HFJA 5F21A 2FPLA 5IYZF 3GA5A 1JSRA 2DPLA 2NO9A 2XA1A 3JQBA 4AF8A 3CR8A 1M8PA 4QWMA 3GZJA 3OPVA 3K8YA 1PGNA 3GP3A 4LSZA 2HSGA 1HYGA 3FHLA 5JI3E 1D4FA 3ASZA 4JP3A 1MAAA 4C22A 2M6SA 3PNLA 1K5PA 2HD4A 2GM9A 3C43A 1G8KA 3VPDA 2XI4A 2O5EA 2AZ4A 3HR8A 5IVIA 3V7WA 3RYCB 4NBVA 4ILKA 5C0OE 3FHCB 1V8PA 3OICA 1QGUA 1O0BA 5NLLA 2BGUA 2XUGA 3A6FA 3MQFA 5AM5A 5SZHB 4F93B 5JZOA 3EPLA 5DHAA 1AU9A 1V45E 1LSUA 2KB0A 2XLCA 5IUKC 3ZNNA 1GYPA 5AVJA 2IEBA 4U7GA 1MPTA 5ECYA 3N6VA 2NU6B 4M1MA 1JLLA 1Q1ZA 4MOWA 2PZLA 2J5RA 1P6QA 2I03A 4A91A 2AW3A 4M0PA 1E77A 3MHTA 4MMZB 4KRFA 4ZDKA 4YBRA 2C2YA 5B1EA 4U4AA 2C3PA 2AQKA 4A8HA 3IPAA 4OHZA 3H6KA 2A7QA 2GNPA 2JVJA 2PBRA 2Q4EA 3EFHA 2JAOA 2Q9UA 2W2MA 3OU2A 4JLSA 4CUZA 4TKUA 3OQMA 3KBBA 1CT9A 1QCYA 3GZ4A 4HTFB 1ULAA 4XQEA 4J0IA 5DJ5A 2IY8A 3TDKA 3EGXB 4LDNA 2DLCX 3GPCA 1RJ9B 2H4YA 3B52X 3OCYA 4YCAA 2JIBA 2WT9A 1W8IA 1N5JA 3E0QA 4WLNA 5DX1A 5TT0A 4PRYA 2J9ZB 2QBYA 4NFSA 4QUHA 3RTBA 1U31A 3LLVA 1NVTA 1THGA 5DNUA 4XFDA 4ND8A 3DFKA 1UC9A 3RQSA 2CYBA 3DEYX 4E51A 5JNWA 1C30B 2W6OA 4BVFA 4E15A 2PX8A 5CDTA 3UW3A 2QTGA 5LYJB 4P3YA 3IOCA 1N2CE 1PNVA 1YR3A 3OEWA 3P0FA 3ABIA 1L5HA 3ZZTA 3NVMB 4ZCSA 2WU4A 4RF4A 1XCMA 1NZJA 3DWEX 1EFVB 4UD6A 3HPRA 1OWNA 3CW9A 1W46A 2BGRA 1T26A 1ZEJA 2D1QA 3PSAA 3T52A 2XRYA 4PONA 4CEHB 4GECA 4NI5A 5FTWA 3NVKI 2VJNA 2G06A 5AW3A 4Q7JB 4I5GA 2PGIA 4PSUA 1V16A 1XEAA 1XL0A 2X9QA 2J5XA 5AIAA 2RAPA 1R9MA 1NVAA 1IRIA 2VJQA 2VC2B 4CCYA 5KQRA 1T1EA 3ZZ1A 2OV1A 5SYMA 4MUIA 3H9GA 1YOVA 2UZ0A 4YJHB 4DA6A 4EZIA 3LUCA 4JQCA 1JQAA 2GEBA 4OI4A 3M5CA 2FKNA 2I8CA 521PA 1VM6A 2P9GA 3M4NA 4IS2A 5FPSA 2QTLA 2TMGA 3HA7A 1EEXB 3FUWA 4CEHA 2GZSA 1J2UA 4MUMA 5C81A 2F1OA 4KO8A 1NM5A 2A4KA 1EESA 2QM0A 1GNVA 2Z2KA 1N9GA 3ND5A 3NNDA 4JJ4A 1O6FA 2Q5LA 4KXFB 4OU5A 4UARA 3SOPA 4F2WA 3V7YA 4V0ME 4IIHA 4C0QC 1QQ6A 2OFWA 4GZ3A 4RTLA 1WTAA 3E1GA 3NDPA 2CDRA 3SEQA 3V1LA 4Y18A 2O20A 4D4GA 4BNUA 2CZCA 1MENA 5LMZA 3DBLB 4EEKA 2GX6A 1WF6A 2R4QA 4MS3A 4ZPJA 5E2BA 1RI5A 4L51A 821PA 4MA5A 2AHRA 4LWZA 5L40A 3H6GA 4FI3C 4JA0A 4BQNA 4CMKA 3DHEA 3N2KA 1BAPA 4JJ7A 2XOKA 3A2MA 3OZDA 3UY4A 4D57A 4GLFA 3K5IA 3P1JA 2GEUA 5AHXA 3NIFB 1JFRA 5FR1A 3W8RA 3A4YA 4WY8A 4HNRA 2H07A 2A0UA 2IW3A 2JGDA 3ZHZA 5K2OA 1ISHA 3RASA 1X6VA 2P9EA 3DTYA 1BDJA 4TMTA 3BJEA 2IUSA 4GRDA 3CIFA 3BTOA 1KXJA 5TRTA 5LUBA 3LLCA 1V0JA 1U81A 3H5WA 2VZ0A 2RE8A 2D6FA 5AVOA 3WGKA 1GPUA 1NMEA 1X1DA 4RNDB 1Q83A 4JASB 3K9CA 3V4FA 1D09A 3HJGA 2HWYA 1P2UA 1RD4A 5TDHA 3RUHA 4IRMA 1ZOPA 3TL6A 3T38A 2NX2A 2ZPUA 3ADPA 4QU9A 3ZZUA 4DDVA 1T4GA 3V1MA 1YB1A 3SJUA 3NWPA 5IU6A 3WLFA 3WAJA 3IIIA 1BDMA 5HQJA 4FN4A 2I6XA 3SVZA 2IX3A 4JI7B 3L2OB 2IXFA 4ACBA 1RSZA 2DCMA 4N7MA 3VZRA 1UBNA 5E95A 2EBUA 2JGKA 2ROQA 3AOEC 4IJMA 2AQ8A 3L7LA 4V39A 1ISGA 4W6ZA 3I45A 2EQBA 4ITRC 4CUJA 4HP8A 1UK8A 4ZQCB 2YN0A 3EE6A 4BX9A 1E2NA 3BB3A 4DQVA 4EB6A 1P1CA 2EFDB 3GFQA 4YEDA 3GJYA 4BNTA 4FX2A 1M2WA 1E7SA 5J23A 4KKXB 4IM7A 1NE2A 2INGX 1IN1A 3IT2A 3MLAA 1ZR4A 3C1UA 2ERCA 4YALA 5G4LA 4MPRA 3SIRA 4D3ZA 5E2IA 4YP9A 1TEZA 4F5DA 2FPUA 1P7PA 3C7CB 3AFGA 2C59A 4JL8A 4DLSA 1JEYA 5EJ8A 3EVGA 4FQ8A 4I1SA 4PZZA 3V80A 4C4XA 4U7HA 3ZGXA 1GTRA 2IE0A 3R9XB 5DGDA 5B58C 2C7OA 4ARIA 2QENA 2W2OA 3D8RA 4CF3A 1E5QA 1W5EA 3C5CA 4ZD6A 4RTSA 4JGIA 3AHFA 3S68A 1Y6GA 1FP6A 1TXGA 2QAGA 1R50A 1XDWA 3NAQA 2QRPA 4QE3A 3ROEA 5JZ9A 1LJLA 1CLEA 4WLFA 1YCHA 5DSTA 3QPAA 1GZUA 3FWPA 2DF8A 1EPUA 3T34A 1OBHA 1IOWA 4R7ZA 1XZGA 2B20A 2VDQB 3W5AA 2ORVA 4GO1A 1H1DA 4HQRA 4KBGA 4RD0A 1LLQA 3WLLA 3VDQA 1CEYA 1H1TA 4HH3C 1XAIA 2GAFA 3U9TA 5BR7A 4IXNA 3L82B 5AOAA 4C1NA 4ZGWA 5EEHA 1EWTA 1IE3A 2P4UA 1VB5A 3AEYA 1RAIA 1GPNA 3ZWKA 2ATXA 2W6PA 2WPDA 5CU7A 5JHGB 5KYNA 1BXKA 1F12A 3S3TA 1YZYA 2C57A 4H16A 1P5RA 1H93A 4L4YA 4R69A 2HU7A 3MUOA 4GOXA 5TLSA 2JS7A 2KJQA 2YQ5A 4Z4QA 1ECBA 1LQTA 2Q6IA 3JARA 4RAOA 1I2AA 3DP9A 3KD3A 1QYWA 1V7CA 1XZCA 4KXQA 4BU1A 4C4ZA 4GOKA 1KNQA 1KZGB 4I4LA 3AI2A 1DMSA 2H2DA 2QYSA 1PTKA 4KUHA 5EP4A 5IXJA 2C9MA 2REXB 3EY4A 3LXMA 3WO1A 1RYMA 4FCWA 4B4OA 2IZOA 2PL9A 2ZSJA 1K75A 3EEBA 4UW9A 2OXCA 3HYRA 4DMMA 1DGQA 4HAZA 4XWAA 3U62A 4YC7A 2Y8EA 1DLIA 3FB1A 1F7VA 5HS4A 2FWRA 4RHEA 4UUQA 2QLMA 4AN0A 2XCLA 3LC1O 2Y9PB 1GARA 1VPWA 2DWCA 1IWBB 3NDJA 1DTSA 4EITA 2IYZA 2SECE 2BSAA 1F8FA 2H1HA 4LJKA 1TVCA 1COZA 1VLQA 3UNXA 4A15A 1RM3A 2H3HA 3WK6A 2BKVA 3O8OA 3DLAA 3IEMA 2C9ZA 3B1JA 5CFMA 3GXOA 3IUMA 1K6MA 1IBLB 4MXDA 4E5SA 3ITDA 3RK0A 4ZYVA 2Q3EA 2ZRKA 2QPLA 1DJNA 3FTDA 3HDYA 3TK1A 3HBNA 2O5CA 2IOFK 4XFJA 4WESA 1UC8A 4KGDA 1D2GA 4Q34A 4LI0A 1X7HA 2DCUA 2EVWX 3V00A 1T1SA 4MWGA 3UUWA 4Q19A 2OQVA 3FVRA 3S2IA 1SBTA 4BLRA 5BN3B 5FWNA 1JIUA 4RW0A 1M2OB 2BTQB 1CW2B 1K8RA 2PPLA 3G9ZA 3R0QA 4JUCA 4AJJA 4HC4A 3D1VA 1IU9A 1SKYB 1AZLA 1ITZA 1XMVA 2W6CX 3SZMA 4ALNA 3ZWNA 5JSZA 4KHPB 3F3MA 5KVSA 2BJHA 3QJ5A 3KZOA 3F1KA 1DAKA 1FNNA 1IMJA 2JGDB 1JIIA 4BVBA 1J21A 1JHMA 1Y9AA 2B7LA 3L6OO 4H3HB 4XJVA 1KMMA 3SZGA 2I9PA 4U02A 1JIXA 2HBRA 4C07A 1A8IA 5CNJA 3WRYC 2GCOB 2NZYA 4M8KA 2I6SA 4EWLA 5LD2C 2H51A 1JL3A 1E2MA 3Q3IA 1FFCA 1QFJA 4C43A 4AROA 2A0WA 2LNDA 4FSDA 3RRZA 4Y0NA 4OCZA 3GLUA 3JAWA 1IVNA 4DAEA 2A59A 1Z45A 2ZXUA 1VCHA 1H9AA 3GLHA 2BYTA 2D7DA 4B3RB 5BMOA 1KE2A 3UK2A 3L7CA 1UODA 3QWHA 2BTEA 4V1CA 2JLVA 2E2WA 1VMDA 2ZCUA 2VQDA 5CHYA 1WL8A 2V58A 1Q0SA 3A1SA 3WLIA 4MGKR 5LOVF 4RULA 3K1TA 5FV4A 2Q2NA 2XNDD 4RK0A 2AN1A 2G71A 3IT0A 1JFLA 1O96A 1J0DA 3F8SA 3UG6A 4KNYA 4FD2A 1K7FB 4NK5A 4N8EA 2G6TA 3HUTA 5D5QA 1AKWA 1YJ5A 4CQMD 1RVV1 3CLTC 1M1YE 3MWKA 3WA7A 1YZUA 1V3QE 5BSHA 1J0BA 3IAUA 4IDBA 5JAZA 4CDMA 4YMUA 2PA0A 1XSEA 4FBMA 4HKTA 2ACEA 1HA3A 1NA5A 4UNIA 2J67A 5AVTA 3AIMA 3PENA 1Q0HA 2FPOA 2BEWA 4FFWA 3VUEA 3W5BA 1Y98A 4C3ZA 4TLMB 2DJ5A 5DULA 2IQIA 4OL0A 2X3YA 1RC0A 1P7CA 1ZH6A 3EQ7A 1CRQA 4EQZA 5CAEA 4DUGA 5E8RA 3NHZA 2CC2A 3KJZA 5AT1A 1EK2A 3L5OA 3QVKA 2Q1TA 4DEYA 4BNLA 1OJ7A 3UHJA 3W2EA 3HKDA 4BJ5A 5ABPA 3FRIA 1QUFA 3NTOA 4OK3A 4DSNA 5KOJA 2X14A 3OUTA 4KVFA 5C5EA 1NNLA 4TMZA 1KIAA 1BA2A 2ZXFA 3OO1A 1Z0IA 3VOBA 3MGCA 4NF2A 3MJDA 4OI1A 1UP7A 1SNYA 1U0LA 4HQKA 3T5TA 1QZXA 1WXFA 4IQFA 1I6WA 2QRNA 2ZJOA 5EE5B 3PLNA 3GMDA 2NV2B 3R6DA 3DZHA 3TXXA 2B1QA 4WDQA 4CF6A 2OBNA 2YHIB 4UNSA 1BZYA 2V6GA 2X9NA 1A7UA 2ZWPA 1V7ZA 1A2QA 2JGJA 1P0MA 5EWMB 4PTLA 1T9HA 4QDTA 5GGYA 2JIRA 1J5PA 1NUQA 2QX4A 4K88A 3WOHA 1KPGA 2D1FA 2WD7A 5FPQA 4YFYA 3U3DA 1RZUA 1KDPA 3A9UA 5CYGA 2WVHA 2XB6A 1LRLA 2J0UB 3I30X 2PTGA 1K63A 2B4KA 4D56A 5K03A 1BIFA 2PKQP 1YBMA 2QT0A 3HCBA 2HHJA 1B7GO 1DFHA 1FS6A 4QTUB 3VZBA 2DULA 3YASA 3T7TA 5A06A 4IP0A 4HRAA 1SKQA 2G83A 4CVNA 1ULHA 4C9BA 1UBSB 2BZGA 1OWMA 2HDHA 2VUTA 4HH4A 2YJZA 2DFLA 2VHCA 3GK3A 4JDUA 3ZVKA 2C4HA 4WCVA 3A9TA 5FBZA 3HB0A 2DKNA 3C3AA 3RTDA 1CKEA 2DECA 2PR2A 3EDMA 3P96A 5EQFA 4WA8A 1TI7A 3HLYA 2YH2A 3SIXA 4X61A 5JEEA 3G6KA 4MKIA 3PR1A 1I2BA 4YECA 3OJLA 4I2NA 4OHOA 4PRKA 4EEXA 5B37A 3A32A 1TT5B 1JEJA 2H92A 4O63O 3S7ZA 5DX8A 3UMFA 3VPSA 4DIOA 1JR3A 4YQFA 2V1XA 3W5UA 5K0GA 1US8B 1KJJA 1YV9A 3DONA 1QFYA 3EXFA 3KOOA 4K6GA 4AICA 4F4HA 3D1JA 4RDCA 1NAIA 1HMYA 4B2IA 2G76A 4L9AA 1KYXA 2AN5A 3FOAA 1ORTA 3I2IA 1LTKA 1M1ZA 1ZM2A 2YWCA 4WKCA 2FI1A 3F5SA 1PJAA 1KR5A 2HF7A 3QPBA 1V4VA 2X9LA 1Y34E 2XUOA 4KGZA 3GFTA 4R2KA 4US2R 3C5VA 1FA9A 1KYIA 1RMQA 2EIXA 4IV0A 1BXGA 3AY0A 5HUJA 3H9BA 1A8UA 2I80A 2P67A 3ANXA 2H1FA 1KYWA 1P60A 1VCOA 5DSXA 5FOUA 5BN5B 4DSAA 1ZC3A 1BS9A 3ND8A 1OA1A 3OIDA 1JNXX 3ACBA 4HX5A 1S7CA 2P5YA 1Y7TA 5CA1B 2D2FA 3ESXA 1D7OA 3O75A 4QAJA 1XZEA 1E61A 1S0UA 1TIPA 2H4JA 2JC3A 1PR1A 4A8PA 4DFDA 4F7DA 3WJ7A 3DQQA 3CNNA 3HFRA 1X1CA 2QG4A 1TMGE 4MH0R 4PLCA 3GZTB 3GVIA 4DN6A 2LVBA 5JH7A 5KQSA 4IDHA 4CQMA 3I5YA 1HRKA 2V3WA 4J1NA 4X64B 3PRJA 3OZEA 4L3WA 1WP4A 3W7AA 1R6BX 1PI3A 1X3LA 2O3TA 3IAFA 4PG4A 2O59A 4AUEA 4PTYA 3AL0C 1X8XA 5ICSA 5BQPA 1UBCA 1C7JA 2ZJ1A 1EUDA 4AKEA 4OEHA 1KJYA 4EYKA 1Q14A 1EWQA 4G1UC 1DO2A 3T3HA 1GGFA 1F8YA 3RAFC 2PRZA 4HYTA 1QPZA 4LFAB 5FFNA 4LFBB 1LDEA 4F97A 1IH8A 2CXTA 4O0MA 3E81A 3GRAA 3OPYI 4HB3A 3FOBA 3W90A 1KE1A 5EMLA 3C6XA 3SFZA 4CKXA 2QX6A 4ZVPA 1V2GA 2F8MA 2IODA 2LR0A 1WCYA 3HNPA 2NTYC 5HBGA 1RJGA 2CLCX 1VKOA 4TOIA 2QTCA 1EUQA 3SAJA 2VJYA 1KJQA 1L7PA 2CMDA 4B3SB 4JUIA 4MVJH 4H18A 1Y9DA 2B9VA 3IVGA 3AERB 4YQEA 3PJFA 3DHVA 4EATA 3AP2A 3SS9X 1RXUA 2B30A 3FUVA 2BH2A 1SXHA 1ZCZA 4HB2A 5LD2B 2R47A 2GH1A 4ESHA 3UAGA 1ORRA 1BQ4A 3CRW1 4PXYA 1W6RA 4MMXB 4M2LA 4LWQA 1AN9A 1TYAE 1XZAA 4J1QA 4JFRA 2BM8A 3FPSA 3S8MA 1T5OA 5THQA 2GS9A 1AXGA 3K0FB 1TTPB 2C3MA 3R4CA 4ROSA 2SICE 3ZCXA 1DQZA 2E55A 2QMHA 3CSDA 2B2CA 4RJJA 1NMSA 3QU7A 5BV2P 4RJIA 1T5LA 1NGSA 3HJBA 3LY8A 3NW9A 4OYYA 5B5SA 1XXLA 3ISVA 1NPYA 3PJDA 3AERA 2UUBB 2PANA 5AI4A 4QRIA 3IO5A 1YZNA 4FCCA 4ZYYA 4NFLA 5A1JA 3CT4A 3GGGA 4IAOA 2AX3A 3EIQA 3GFOA 1X8KA 5AICA 3VAAA 3CRRA 4O2BA 4RZUA 1XTIA 2X1HA 2XTAA 2ZUDA 4UTVA 3CZ9A 5FRDA 4RVNA 2ST1A 2VHJA 3NIDB 3P9QA 4XR9A 3K1AB 5IBRA 4K1LA 4B4VA 3A14A 1T8RA 1R0ZA 3BUSA 2YYAA 3LYHA 4TWJA 5IN5A 4BP1A 1PWXA 3T5DA 3TLYA 1G8MA 4OB8A 4RACA 5EVCA 1PF7E 3NBMA 2VJCA 3SC6A 1XRSB 1JP7A 1CTQA 2JFXA 4YJ3A 1SPXA 4D3SA 1C30A 1R18A 4ZJYA 2LV8A 3NDIA 3A6JA 1ZXXA 2VZ8A 3IBYA 1QH1B 5ADHA 2Z6VA 1TM5E 1QIFA 2GFQA 2IT1A 3OFND 5TQJA 5EFZA 5JCXA 4UULA 2NUPB 3L6CA 3EA5A 3BE8A 3O92A 4WKOA 3HBLA 1FDOA 1T1RA 1H5QA 3W7VA 4DM4A 4DC1A 2R97A 2RHMA 3UWDA 1RYDA 6AT1A 4DSTA 4G1MB 2M98A 3FJ1A 1AQIA 2DT8A 1X1QA 3P7MA 4Q3LA 4WL0A 5C2JB 5IMSA 4ZZ1A 4AQDA 4F84A 3CEJA 5KVQA 2ZKIA 3A0UA 1HE2A 5P8WA 1G2PA 3L7DA 4M0UA 1TGYA 4WNAA 4A8JC 1G2OA 2FRDA 4M4SA 2WPDD 1Z5OA 4MV9A 4MV7A 2NZXA 4BHTA 1OLUA 2RHOA 3ESYA 1EX1A 3L1KA 1HBJA 1CD5A 2GBFA 3U4DA 3DOHA 2Y2UA 3MRXA 4CMEA 1V8FA 2FVXA 2QZZA 2WT8A 3MS2A 5HCIA 5JFOA 5AVUA 1O94A 1NL3A 4KSCA 1BXRA 3ESBA 1W7AA 1GNLA 3CONA 2YZGA 3JSAA 3L8FA 3H4VA 5F33A 3VR1A 5H59A 3DAFA 3PFIA 1PR6A 3QXXA 1C3OA 5EZYA 1F3OA 1HL7A 3OCUA 4EPRA 3DNMA 2C7VA 2AJCA 1S2OA 1RKQA 1W0KA 4K8RB 2KS6A 3WNCA 3BRCA 3QLVA 3RG2A 4PQFA 2ZBGA 1JAXA 2X6TA 4E94A 3FTCA 3PQ4A 2ZJZA 1OLUB 5JR3A 4NVRA 3PDWA 1KOGA 1DOAA 1KSFX 1Z0DA 2ZUBA 2Z2JA 2ZYAA 3RJZA 3RRMA 1VE6A 4BWVA 3ER9A 2J4FA 2Q3MA 4RDXA 1E1MA 5T4BA 1VSTA 1LCIA 3EMKA 3MD0A 1PFVA 1YZFA 1A04A 2JFZA 1E58A 3PQCA 4MIOA 3CO5A 4YQZA 3N2KB 3ZHCA 2JNWA 3ENZA 4DRZA 5JXHA 5L4SA 1Q0PA 2PS0A 4MDHA 4MO2A 1K97A 2OCLA 3DWFA 3DJFA 3O4VA 2KPOA 4MVJI 4H31A 4C4TA 2ZB2A 1C3OB 3MSCA 4E21A 5IP5A 3MOIA 4UOZA 3KSBC 4CCYB 1YVUA 2AG0A 5JMPA 3S2EA 1II8A 3C6ZA 3FCUB 3UH1A 1ZNZA 3IA2A 1Q1NA 4GOOD 2PWPA 2CHQA 2DGDA 3OSUA 4HEA1 4EEZA 1PS8A 3HA3A 3HUEA 1WU8A 1TQDA 1LQ2A 2VP4A 3BE5A 1C2TA 4MQFB 4AS3A 1TLTA 4BX2A 3SK0A 2VHZA 4WI1A 4PIPA 5FOTA 4DEVA 4M8NE 2AMYA 3UKJA 2O0HA 5BN5A 2J4CA 3QPVA 4U3JA 2XQJA 4PHHA 3PNVA 3ZWAA 4COOA 1W36C 1OX6A 4RSRA 3ZVRA 4BU0A 4C7OA 1YUNA 3CKKA 2EJBA 3NT2A 2POQX 5IZCC 3KQKA 1LDNA 3GLIA 3JYNA 1RW4A 3GIWA 5G3YA 1PWEA 1KA9H 1Z6PA 3JQPA 5LQJA 3R3UA 5IT4A 1T8YA 5BWBA 2Q5EA 4DILA 4E14A 1S2DA 1Y1TA 3H0CA 3NAMA 4RM2A 3COVA 5ALQA 1JLRA 1Y80A 3BD9A 3BG5A 3HWWA 5CAEB 3LUBA 3S55A 221PA 2D2VA 1F51E 1L4KA 1RKXA 3K0EA 4TXMA 1CUYA 5BQ3A 2D5CA 3AY6A 4B7UA 1DKLA 4AMGA 4KZPA 3M6UA 5FPTA 3RE1A 4WBNB 1G3QA 2FB9A 2P2DA 2PIAA 4ECEA 1N9KA 3F2VA 4F12A 5MN6A 4TTJA 1FLAA 1WB5A 1QR2A 1UC4B 2AEMA 3I42A 1EAMA 2ZJ6A 4V3BA 1OOEA 2W5UA 3OF2A 4CEIB 4X3CA 1W73A 1T3TA 3I0ZA 5DGCA 5DW0A 3FPCA 2ORWA 2QXYA 2C95A 4MVJF 1FDRA 4YRCA 4DWJA 4IIJB 2GZAA 1N7GA 5HXAA 5IWAB 1GSIA 2CVHA 1TIKA 3SDBA 5A3SA 4FFVA 2CMHA 4HVLA 1LC0A 1O96B 1R9GA 1TJ5A 1JB9A 1A76A 4N3CA 3DYBA 3I8XA 2F62A 4WKNA 1BFDA 5GQSA 5ITWA 2FDRA 3QOYA 4TT3A 4LRQA 2K2WA 5IG2A 2AUMA 1R9NA 2N42A 4MEAA 3TN7A 1J23A 3B5JA 1X1TA 4HEA6 3CX7A 2V6BA 2GR9A 3HCWA 4MWCA 4RABA 1AKQA 4P5PA 5FQOA 4F5EA 4OHRA 3PR3A 4MMYB 1E1QA 3GP5A 5BW8A 5BSFA 4DR7B 4EABA 4KRYA 4TVSA 1XWIA 2C2ZA 2ZUVA 3T7AA 4DB2A 3RUAA 1PT9A 3AFIA 4YCBA 1JPJA 1U4NA 3PGKA 4PWYA 5EZ6B 5KYXB 2V55B 4IR7A 5ITSA 3QU4A 4X1KB 2QZPA 1U7TA 3VKFA 7AT1A 1FYFA 3W6NA 4AP6A 4QNRA 4R9VA 4KFRA 4O2BB 2VZLA 3IQEA 5HKLA 4D8XA 3GF4A 2EWVA 5D3KA 1Q7RA 3KYCA 5CLFA 3Q7IA 5HF8A 3SEAA 3L4JA 3GMIA 3I62A 3WBKA 2IFTA 4J2HA 4GC9A 4OV6B 5KSPA 1Y1QA 1COWA 1N1GA 3QY0A 1F2TB 1JHYA 3EY9A 3PK0A 4QOJA 5LZ7A 2DAPA 2PQ0A 2OAEA 3D4NA 4BX0A 1SC6A 3GCGA 5TEVA 3ZUPA 4CKWA 1SZJG 2BF7A 2OILA 3ZW9A 4DBVO 1MQ8B 3GLSA 1XRJA 3HL4A 1CDZA 1PFGA 3IVAA 4CMEC 3UANA 2C8KA 3K7EA 3AT1A 2IL1A 1NJSA 3A6KA 2QXUA 4U9HS 2JGNA 2WTAA 3W3AA 4A0GA 1ZRSA 4JY7A 5TE9A 3DVAA 4AJLA 4WN3A 1XE3A 1CZUA 5EZYB 4IJQA 4RCZA 4JI5B 4A2CA 1GTSA 3BH0A 1R6UA 4TYMA 1JQ3A 2RHDA 1DJPA 4FVTA 3QPDA 3O21A 1S9DA 5ICCA 4GL2A 1X13A 1KEWA 1QHHB 2AMFA 3CLSD 4HWGA 1RTKA 4DMKA 3CPHA 3A6HA 1BFKA 4MW9A 5A71A 1PG2A 2FF5A 9LDBA 4JI0B 1H0SA 5TXGA 2RAUA 2MSNA 1C7ZA 2NGRA 4RF5A 3RFFA 3WB2A 4DA0A 3B3FA 5JUWA 3KETA 1JA9A 3D7RA 4GZLA 3QVWA 4CM9A 2OWEA 3ZOZA 3AG6A 1MABB 2NU7B 4OIFA 1EJ6A 1WHTB 4D9IA 5CDSA 3KQWA 2PRJA 1X2BA 3L0PA 1IBCA 5AKHA 4BAGA 3EH1A 2FN9A 2YXBA 1L7EA 2BFEA 4AY3A 1GTZA 1I51A 3JQ7A 3P2MA 4QPZA 4QYIA 4GBJA 4H7KA 1R37A 3H13A 5FOVA 3U1TA 4A1OA 4R1OA 2XWPA 1XNGA 2FZLA 4LZJA 3W79A 4AG5A 2NNLD 1KO4A 1Z22A 3R5HA 4R8KA 1EE1A 5I51A 5BQOA 3ZK9A 1SKMA 5CXQA 4GYWA 3L0SA 2WSIA 2Q0XA 5G4KA 4DLZA 1H5NA 5B2FA 2YDXA 3AY7A 3DB1A 4RORA 5F2NA 3JAMA 3ZGLA 3ZHSA 1PEAA 3TZHA 1T0JB 2EP5A 4JB8A 1QPGA 4Y2RA 4YT4A 5E2AA 2D2IA 4X8HA 5JNUA 4QOGA 1SIBE 2FMIA 2C5HA 1I8TA 3D3WB 3QEKA 1H42A 1HR0B 1SOVA 3NPMA 4BYGA 1M2JA 1OHHA 4K7JA 2ZUCA 1W19A 2RHRA 2GERA 3WFJA 3C14C 2O2GA 1XJCA 1YNSA 3PXEA 5JV5A 4M9RA 1BOOA 3H6HA 3UPTA 3D31A 2PD4A 2AT1A 4FWBA 1Z4LA 4GSKA 4PPYA 4KUGA 1MB2A 4YT8A 1HK7A 2AXPA 1E9RA 4M8LA 4UBOA 4E03A 5AESA 3DZBA 3M6WA 1CNMA 3MWJA 3WMEA 4FEYA 3ZTTA 3JVIA 3K73O 2QRHA 2OL4A 4BAZA 1XZIA 4JL5A 4F5ZA 1B0AA 2E0IA 1ISMA 4QLOA 3PNPA 2AEEA 5CCDA 1AB6A 4XWYA 4P7GA 1LX7A 4E08A 5E9JA 1BRTA 3OFSA 4QPDA 2C0CA 4QVIA 4I1PA 4OI2A 1L9XA 1LK7A 1ZH8A 5CH3A 1YS1X 5L4LA 1LBTA 4IIJA 2HU2A 1E2PA 4GX1A 2Y1GA 2CXRA 4G5XA 4J03A 3OCJA 4JVOA 4QOIA 1R8YA 4F4FA 1EGVB 1EK1A 1IHYA 1U2RA 3MN1A 2QEQA 3TQSA 5JQGA 3OLYA 2YHBA 1EQUA 2WWTA 3DL7A 3NBFA 4IDPA 4L8FA 4BPBA 1TJNA 2XHEA 5FTMA 1CCWA 1AY0A 4YI3A 3O47A 3QOXA 4MITA 2XMSA 2IZ1A 2WTMA 4NCJA 3CZRA 4TWRA 2GESA 5JCOA 5EPUA 4TMYA 4WINA 4Y9TA 1THTA 2V0NA 5FHQA 5KI6A 5BMVF 1XI2A 4J94A 4XYBA 3H5TA 2ZWOA 5DM70 3D8NA 2HWXA 2QTVA 3NEJA 4GMXA 3N53A 1N0UA 3O03A 4I8IA 1RZ3A 1CZOA 3MM4A 3HFJA 3O38A 4FZ3A 3KDPA 2RJOA 1JX6A 1LH0A 2MYNA 2OO5C 2Z8XA 3OLZA 4KH0A 5E9WA 3O7MA 2PNJA 3TAHA 3C70A 5FKJA 5KNCD 1O95A 2BBSA 2QTTA 2W2XA 4HMPA 3AF6A 4HFMA 1YFLA 3AVWA 2VPWA 2D7JA 2VFAA 4F1KA 2JH8A 3B60A 3FJOA 2A5YB 3BDIA 4OAOA 4WLVA 2Z08A 2AXNA 2EQAA 3A7EA 4I9GA 3UOAB 4I9NA 2FPIA 2UV8A 3IP6A 1A4RA 3ONDA 1BD3A 4LDAA 5CFZA 2DUWA 2R87A 3LT1A 2C3OA 16PKA 3IKLA 3Q15C 4QD3A 1CVRA 3ORSA 4R16A 2WAMA 4BO7A 4H17A 3MJFA 4D44A 3OQJA 4K9MA 3L6UA 4LA4A 1QVZA 5HVNA 1B41A 3MTIA 2XZLA 1UINA 2RK3A 5LIPA 5MN4A 4DXDA 1BSVA 1EINA 1E6EA 3DMTA 3WWCA 1NW5A 1E0SA 1E4YA 2FN3A 3NEYA 3NOOA 2QI9F 3CO0S 4KP7A 3RODA 1I4OA 2OAQ1 3BHMA 2YXPX 1ESCA 3NASA 4YRDA 1FP2A 3OOJA 4EUNA 1ATIA 4CL2A 5I9NA 2C5BA 3KDAA 1QCDA 1XAHA 2NYRA 4AM8A 1C29B 2YWFA 2X3UA 4MDYA 4TTAA 3IKTA 3FBTA 5FI1B 2GN6A 1ZIYA 4FZVA 3HVIA 4RE5A 2UU9B 1GUYA 3GRPA 3KE8A 3WLPA 2HJSA 3QVOA 5CNKA 4B6GA 5MGNA 2VT2A 2G0NA 4MUJA 1GN8A 2OHFA 1Z0SA 2Z30A 3E4CA 3FNIA 2JAXA 2JCBA 3H1BA 4I6EA 4RSGA 3ZU5A 2MDTA 4C6HA 3U4GA 3DEHA 3BL5A 1MBZA 4TWZA 1HT1E 1YDFA 3L8MA 2P4HX 4H0CA 3RLIA 2P40A 2QRUA 2NU8B 2DB3A 4W5NA 1RAEA 1J39A 5DM4A 2C5EA 1U8TA 2WJYA 1YQ9A 2B37A 5B1IA 1RBQA 2L0XA 2YXDA 3RHFA 3C8UA 4JMLA 4TZKA 4B3GA 3ZE6A 4DDMA 3GRZA 3AVVA 5F76A 3ZLVA 2OB1A 3BIFA 3H9JA 1V1MA 2SNIE 1XA3A 3ORHA 4KLCA 2ID8A 3O4HA 2BCJQ 2OOKA 1HGXA 1YRAA 2F4NA 2P0EA 4I4CA 3T3IA 5B1YA 5CG1A 1RWNA 5JZSA 3ZJ5A 1GSOA 1PR3A 2CLOB 4KHZA 5CB4F 1H0HA 2WJJA 4GYJA 4F2PA 1DS6A 3EASA 2QVBA 2JW5A 3B7GA 1DIRA 1NQXA 3I2FA 4BKUA 3DMRA 1YR2A 2PSHA 4ZJUA 3AETA 2B9EA 1ZCBA 2MT9A 3QKRB 3V9AA 4BFSA 4CTJA 1G1MA 3EZNA 1L4HA 2YWRA 3RNLA 2PGDA 1E3MA 2H1CA 2QSJA 3C1TA 2X13A 1NQUA 3BF8A 4R9UC 1JNYA 1ACJA 3ZDBA 3K6RA 2PHZA 5D87A 1R4MB 1NY5A 2JAHA 2C2GA 3AHHA 3FZGA 4KAXA 3H05A 1R6AA 2P78A 4OATA 3JD2A 4H1WA 4IGFA 2NTEA 1OYYA 1Y42X 2O1XA 2EEPA 1T9CA 4LV6A 2GPWA 1NJ5A 2XYHA 1KRWA 1Z13A 1A1VA 1H9BA 4MTLA 1K5HA 1F1BA 1EVIA 1PEDA 3RSFA 3KP1A 3SEFA 3QUQA 4TXNA 3TRKA 2PSDA 3MK31 4WKGA 1ZAKA 5AI9A 1DV1A 1G8GA 1PDOA 2P35A 2IPXA 1EVEA 2ZTVA 3C8HA 3D7NA 4HDMA 4UNPA 5IC6A 1LNZA 3BL6A 2QVGA 3ZWBA 1CLUA 3UFXB 2MYTA 2XCOA 3IEKA 4UHCA 4CMGA 2RGAA 1YRWA 3JWEA 4RH3A 3P0IA 3B1FA 3MQ2A 2L69A 2W2QA 2FH5B 4DCGA 5K0JA 4P54A 2A5JA 4TXLA 1V95A 3RV4A 2O19A 1V47A 2AF4C 2ZZKA 4X62B 2P65A 1JFFA 3WYNA 4PYMA 1NN3A 3LNCA 3H2GA 3TCKA 1DBSA 1N0VC 1PJ8A 1RKUA 1SEVA 1XEXA 1RQLA 1QK5A 2BUBA 4O3MA 3NV9A 1JIQA 2B94A 1UXGA 3AP3A 2TECE 3L4BA 4EUKA 2JIZA 4CTMA 5BSVA 2X0NA 3DOFA 1EG2A 4G0YA 1TCBA 2H52A 4HNHA 4V1CB 3AUSA 2M32A 5LQMA 3VYSB 2W71A 4CQJA 1Y7IA 2A5FA 3KKNA 4NNJA 1RLUA 3VHXA 5IVPA 5TEWA 1NQOA 4LOLA 1QGZA 1T5HX 1QRAA 2JVKA 4LRWA 4RQBA 3AY3A 2QIOA 3OIWA 2YV4A 1R64A 3VH4A 5CLLA 1BQ3A 3EVAA 4MYTA 1G21B 3EAFA 3HYSA 1L5WA 3QKTA 3KNZA 4Y6QA 5B2ZA 2Q7DA 4CPDA 2E4UA 2Z43A 3GNSA 3VR5A 3NRBA 2QTMA 3LVQE 4U39A 4ZOLF 3I28A 2ARKA 2BEWB 3FVTA 3HG7A 4JWKA 3UXEA 4HCJA 2O2YA 1H0RA 1OBOA 3EPRA 3KVRA 4WZZA 5DYNA 3KKZA 2CBGA 1KPIA 2B34A 4D4KA 4BB5A 1ZM7A 4QT4A 2JA1A 3RFCA 2YBDA 2YWEA 3THWA 5I7VA 2PZ8A 3IVMA 1COWD 3WGMA 3JYLA 2QJOA 4MVJG 3FG9A 4TTRA 1YCFA 3NOXA 3GAMA 4LBZA 4UAGA 1I32A 1Z68A 2ZQZA 1AA9A 4HSGA 1HE8B 3IOEA 3GA7A 4LVCA 3RWMB 1NULA 3SHFA 3OLWA 2YWDA 2PEYA 3T3GA 3CNBA 1ABFA 1CUSA 2GAJA 3ONVA 3RK4A 2NQ8A 4C5CA 1PR9A 4UC0A 3IEVA 2X77A 2X0JA 2FMUA 2WAOA 2VNSA 3CM0A 1NE7A 4X92A 2A0KA 5F1YA 5C1BA 1NRXA 1P7VA 4JVMA 1HDGO 2OWDA 5IULC 1E7RA 2JIPA 4L4SA 4UXHA 4Y1RA 4ZMSA 4MGYR 5BNZA 3OKPA 1IY9A 1WZ2A 2B0CA 4RKWA 1AB5A 3TZBA 3IR6A 1JEDA 2E4AA 3G68A 4ZRNA 3AZPA 1NJFA 3Q3GE 4WOBA 5BN4B 3VU1A 3ZBTA 3RIEA 4AXXA 4I14A 3TD9A 4BMSA 5MGBA 1EE2A 2PT5A 3UH0A 1BX1A 4U9UA 2QLNA 1SRRA 3CMMA 1J7KA 1FUKA 4UHJA 2H7VA 1JDTA 3A6DA 1NJ6A 1C1YA 1GP2A 2IEZA 1JUDA 5JLAA 3R75A 3GVCA 5BWMA 3UJ9A 4FCVA 1I1QB 2LRHA 3R3ZA 4X1YB 5CNMA 1YB4A 2A9PA 4QUGA 4D46A 4FMDF 2VK2A 3DBRB 4AX4A 2Y1LA 3L7NA 2HM7A 4QDOA 3ZI7A 1K86A 4QEZA 4QQNA 4AZ0A 4EDHA 4GYKA 1IUKA 2HF8A 1GGEA 2IV3A 5B12A 1Z7BA 1XAJA 4M37A 1EWKA 2HHLA 3NEPX 1I4DD 2I7CA 2R1TB 4BE7B 2AF3C 3JWGA 4N3NA 3COJA 3IAM1 4XSVA 3JR3A 3A1TA 1LFAA 2AZXA 4P93A 4G01B 1BU8A 2HC9A 3H5NA 3B8HA 5DFAA 2GFHA 1WKBA 1MPXA 3DAYA 2JKVA 4GWGA 4NZ9A 4CNQA 2O2DA 1NVEA 4WECA 5A3VA 2HOQA 4CM8B 4YA6A 4LF5B 2OQ2A 2R6DA 2WNIA 3EOAI 1PK7A 4D74A 1JHQA 4KEAA 3OJFA 1IFXA 1ID8A 3WWZA 4CLEA 1QDUA 2HZ7A 3O2QB 1U8UA 1PEYA 3R5JA 4E31A 5IPFA 5JCJD 4MHSA 4PZAA 1YACA 2O2HA 2PUHA 2I1LA 5AXCA 3UT0A 4BMVA 8AT1A 2ZRHA 2A1IA 2OO3A 1R2QA 1T29A 4IHJB 4JJAA 1BE0A 3AJEA 3PD0A 1G0OA 3IELA 4BO3A 1KAGA 4IDNA 4LHWA 3LQQA