1VYHA

Paf-ah holoenzyme: lis1/alfa2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
218
Chain Sequence
SNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB BETA SUBUNIT
publication title Coupling Paf Signaling to Dynein Regulation: Structure of Lis1 in Complex with Paf-Acetylhydrolase.
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 218
sequence length 218
chains with identical sequence B, E, F, I, J, M, N, Q, R
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1vyhA00
4IYJA 1U8UA 4K7JA 1V2GA 4PPYA 1BWQA 4K9SA 3MILA 2WAOA 4M8KA 3BZWA 4JJ6A 1BWPA 2VPTA 1K7CA 1ES9A 4Q9AA 4JHLA 4TX1A 4H08A 4K40A 1JRLA 1VYHA 3KVNA 3DC7A 2WABA 1DEXA 3PT5A 4K3UA 3W7VA 4JGGA 5A4AA 1FXWF 1BWRA 4JKOA 4JJ4A 1Z8HA 4LHSA 4RW0A 3HP4A 1VJGA 4XVHA 1ESCA 3P94A 1WABA 5HOEA 1ESEA 1IVNA 3RJTA 2O14A 4RSHA 2Q0QA 4HF7A 4OAPA 5JD3A 1FXWA 1ESDA 3DT8A 4S1PA 2Q0SA 2WAAA 5BN1A 2HSJA 4Q7QA 1J00A 3SKVA 4I8IA 5CD9A 3C1UA 3U37A 4DEVA 1YZFA 5B5SA 3DCIA 1ZMBA 4OAOA 3SLRA 1DEOA 3DT9A 1PP4A 4NRDA 4HYQA 3DT6A 2W9XA 2APJA
chains in the Genus database with same CATH superfamily
4EA8A 4QO8A 5DNCA 5JNWA 5DI9A 3IIKA 3G6WA 5K3SA 9LDBA 4IDAA 5FKJA 1XEXA 4BVFA 2ZVQX 4HL6A 1XDWA 2H11A 2OD7A 2XMZA 1GHTA 1VLJA 5LZ9A 1F48A 1JDSA 2OXFA 4RTPA 2XF8A 2PGIA 2RBKA 5LBUA 4OP1A 3RC3A 3WLMA 4B6OA 4EFKA 5LXTF 4URVR 3CVXA 3N6RA 1Q2XA 3IVXA 3RG8A 5MN4A 3U1TA 3WK8A 4DLAA 3WAKA 1AQNA 1U6JA 3K73O 4MPJA 1HE4A 5HIIA 2AOTA 4AY5A 1CR0A 3LOUA 1CP3A 1DIHA 2ZSAA 3QKRB 3EISA 3OIWA 3RBVA 3A4MA 3C0KA 3E7XA 3Q41A 1TVCA 3S55A 1A3CA 2VP5A 3O3CA 4OQDA 5C8YB 4AMZA 5KTKA 3IHKA 3MERA 1L4UA 5IN4A 3KXIA 4R8RA 3QBDA 4DSNA 3GB9A 3RADC 1POWA 5TE9A 2J46A 3C1OA 4IQ8A 2BN4A 2QT9A 4V0MA 5TJ9A 4GMDA 1LZLA 2VYCA 5EHGA 3DB1A 2AZXA 3DBRB 2CCJA 2PT9A 4XFDA 1JZSA 2I3AA 3CZ4A 5A4FS 3OQNA 5MHTA 4R9VA 3VTFA 1VSBA 2CLKB 3JD2A 1EAMA 1UT6A 3L1JA 4EA6A 1F17A 3M4JA 2M6RA 1R66A 4MZXA 2BVNA 3FNFA 1RACA 3N7TA 4R8LA 4H3VA 4E15A 5IJ9B 4BNVA 2WKPA 4HDNB 1OX6A 2C58A 1OZAA 2RAUA 4HJRA 1UJ2A 2OCIA 3LVFO 4CBVA 2F1OA 4JJ4A 1M6YA 4RVDA 5K01A 3I58A 2HK7A 3KG2A 1PTJC 2WBLC 4U9IS 1I10A 1NLUA 3NAMA 4WBXC 1NZDA 4BIIA 2FV8A 2XB2A 1TCBA 1VCIA 1C9YA 3VNRA 3QU2A 1YF3A 1CD5A 3IVAA 3NBKA 3GD7A 4OMUA 4JU8A 2FQ1A 1QBKC 1ESEA 1IAVA 4XD7D 5LDHA 2QW0X 4CV2A 4OMFG 5K8IA 4PIPA 1ONOA 2A1IA 2Q0QA 4HXYA 4TT8A 3GLIB 4DLUA 1QH8B 4IFEA 1LV8A 5CX4A 5A9TA 4Q03A 1PQWA 2BELA 1GG8A 1SHLA 3H5AA 4QAJA 3ZDYB 4HNTA 3AQ4A 3NATA 2LGJA 4HNHA 2PYDA 5AVVA 2OBXA 3F7TA 3DFFA 2WICA 2FPMA 3DL7A 3FZNA 4TS4A 4OLAA 2CL7X 1OV4A 2VH5R 1JBEA 1SC3A 2A7XA 1TM3E 2GN6A 2WSBA 2XVMA 2ZBPA 4OO3A 5M3BA 4B7UA 1ODIA 1DG9A 3HU2A 2GD6A 1U2GA 5AMXA 2BFCA 3VBCA 1T4GA 1U2ZA 3L40A 4LRSB 4LDPA 4TN5A 3TQIA 1PVVA 4UBOA 1LVUA 4MW2A 4P8RA 2NPIA 2CXUA 2P1DA 3HZZA 4YR7A 3GJXC 4HVLA 5HKAA 4RZUA 4RV9A 1P3JA 2DQYA 2FNAA 4P82A 4LMAA 1WULS 4CCWA 5IXJA 1XAGA 3MMZA 2Y0DA 3BXXA 1XTVA 3OFNA 3SSOA 1TYEB 1U2TA 3CNLA 3KKMA 4MP6A 2G04A 4YH1A 1WDKA 2PA3A 1ST3A 1BMQA 2ZUUA 4FBMA 4EMUA 4QRDA 1HC7A 1PFVA 5KPJA 4RHEA 2VP4A 5ALYA 2NUBA 3AZPA 1RLMA 4M6WA 4MB2A 4QXPA 5FAXA 3VC3A 4KN6A 1ZVQA 3R3VA 3E05A 3GK3A 3OJWA 4E6EA 4F9GA 4OX9B 5K4GA 2DPLA 2R96A 3AHDA 2COEA 2OBMA 3OH8A 4Y1FA 4ZK6A 2WM3A 4ZO4A 1X7XA 4MVXA 3VR3D 3D4NA 4C2UA 3MJCA 4R9SA 1YAJA 3AVUA 4Y2VA 2LV8A 5EJMA 4CKBB 4WWHA 3SEFA 1N8TA 2NO0A 2P4SA 1M2JA 3IB3A 2XCOA 3LHDA 1XKLA 4DWWA 4MDFA 1J25A 1XCBA 5JAMA 3Q8MA 4E3ZA 4MW7A 2VSYA 1KR2A 4AD8A 1J5EB 1FJ2A 2XUJA 3SZMA 3SC4A 3D9QX 4JBHA 3ML1A 4R54A 1DRKA 3F5FA 1XAJA 2N9UA 4OX9Y 1ESNA 1LQTA 3MTDA 4CM8A 1M8KA 1FLNA 1PUJA 3EFOB 3KFLA 1CR2A 3T9FA 2I6FA 2Q6OA 2E5FA 2A3RA 3WGKA 1N6OA 1ONBA 3RDPA 3LL7A 4I1UA 4WLFA 1X2BA 5BPFA 5CB4B 2XQFA 1WO8A 4QOIA 1A9TA 2UZ0A 3T5CA 2OBBA 5CJ2A 4OHZA 3LQ2A 4I14A 4PC7A 2RK4A 3PEUA 3V6LA 4L4SA 1YUNA 4DV3B 4RHUA 1ULUA 4UXJA 4IF4A 1S7CA 1V11B 4KEAA 4OL0A 4XLLA 1QSGA 4NH0A 2DC1A 4HLDA 4JI5B 3T8YA 4B3IA 5EIWA 1DJPA 3ZC3A 3TL2A 4BXOB 2ONCA 2GK6A 3VZPA 2YC2C 3HGQA 4KO4S 2MSLA 5PNTA 4D0LB 1X77A 4IHAA 1A5AB 1JQDA 3FMPB 3GZJA 4EFDA 5J2TA 2ST1A 4F3YA 4DBZA 1TMOA 4ALKA 2J6IA 3OIUA 2JVIA 2IE0A 2V7GA 1VECA 1A9OA 1QHEA 5JT1A 3QELA 4IJWA 1BXRB 1B3BA 2FPOA 4WDRA 3RC7A 5BWMA 5IABA 2O2CA 3A7DA 1Q3TA 3QY0A 4ER5A 1F2UB 2XTNA 2X4IA 3B9QA 2G5GX 4LF9B 3GH1A 4C1NA 3C8UA 1AQJA 3LMKA 5E0KB 3MCZA 3QOFA 4OSEA 1T1IA 3PQ4A 1JL3A 4HGNA 4LJ8A 4MB0A 3C41J 4GR4A 1C7JA 1W4AA 1P75A 5CMLA 4KHZA 4JI7B 3AW9A 1M6NA 5JVDB 1NJFA 1O9GA 2GNOA 2H18A 3KHTA 2AOUA 3LYUA 5C34B 1C3OB 3VHLB 3ZV4A 5I6DA 4LGYA 1NW8A 4PZPA 4TKVA 1UPUA 4I7EA 4KWCA 4LBWA 3UIEA 3QE2A 3ZGVA 5A4JA 1NI3A 1PNTA 1PTJA 1V7ZA 2AV6A 1C2TA 4U5QA 3T3IA 2O8DA 1R27A 2K5UA 1F2UA 2WILA 2YWHA 3M6MD 4UFNA 5EQJB 3SJ7A 4EW6A 1XTPA 4G0NA 4K1XA 1THGA 5JS2A 4YPVA 1PWHA 4OK3A 2V7XA 4MKFA 4YB8A 5D86A 1E66A 3QKUA 3THWA 3COSA 3QHQA 5F3WB 1VSTA 4HX9A 1GUYA 5AKIA 5BOVA 3K6JA 2XUKA 1GLNA 5AW1A 1ST2A 2WWHA 1YIAA 4KLAA 2NPFA 3L7DA 4IY1A 1I7LA 2HQSA 3L07A 4YAWA 5K51A 5LDGA 3SSAA 5HQ3A 1OOEA 1QIFA 3UMCA 3PUJA 4FFDA 4YRJA 3RRJA 1JAYA 2C4KA 4BO6A 3INTA 1E6KA 2AWNA 2QLBA 3ADKA 2ZDHA 4BLUA 4MQMA 3H87A 4QGHA 5JXHA 1T2AA 2M9MA 2YZ2A 3FSEA 3ODGA 4JP1A 5A7HA 2R7AA 3EIWA 3B5IA 5K3AA 2VHYA 3REQB 5I9IA 1ZN9A 3AF6A 4C7OA 3IVCA 4WW0A 5A9RA 2H1LA 4URHA 4KCGA 4IS2A 4JJFA 3NH9A 5EUCA 4F04A 4HFJA 4OH1A 2FA9A 3A4IA 4K9OA 4GX1A 2VBIA 3JD0A 1L5HB 3ZYCA 5JSZA 5HJ7A 4KQFA 5CXXA 4Y3UA 1LCIA 3E15A 5DNWA 3EDRA 4HO1X 2HDHA 2B35A 1JEJA 1CZKA 3X1ZA 1LDYA 4HLUC 4QZVA 2H54A 2MIIA 4JR0A 1TDJA 2WT9A 4ZO7A 2I3ZA 5FHRA 2WNIA 2FWAA 2Z4RA 4WPGA 5FWYA 1FTWA 4BFLA 1E7QA 1BQ3A 2JI4A 3S2UA 5J2TF 3RS0A 4GE0A 4RC9A 3UKDA 5K99A 2VF2A 3CO5A 1M2OB 4CM9A 2TMKA 4I1IA 4F9EA 5IT0A 4JLJA 4A23A 2WNHA 1AMOA 1M10A 1E9CA 4TSKA 1TM7E 1VBFA 1FY2A 1WE2A 2OBNA 4HMQA 2IHYA 4IJVA 4S3MA 4H6VA 3I9JA 3THSA 5EJEA 4IINA 3VYTB 1W47A 2DRIA 2I22A 4FFRA 5J2UB 4BYGA 3WA6A 1C4XA 1NU8A 1T9DA 2GCNA 2B69A 3S68A 4AKEA 7AT1A 1DXQA 3BIOA 4JVSB 4AC9A 5BQFA 3GJZA 4G5SA 3EXEA 4HR7A 3D6TB 5JAHA 4AZTA 2GARA 1H0KA 3TTVA 1WUHS 1OVMA 2HREA 4OU4A 4KDRA 1FFDA 4N3AA 4PNPA 5AK4A 1MW8X 1SUFA 2Q29A 4Q7EA 2I6GA 2YX1A 1GTL1 2QTWB 2DWCA 3BGVA 3QFSA 5TPWB 3W9BA 3MB8A 2G9VA 3SX0A 1L1FA 1TI7A 3KOXA 4BVKA 3S99A 1P6XA 1BE8A 3LXUX 3GL9A 3KT8A 4W7SA 3B1VA 1H9BA 1LI5A 1Q1QA 4R1SA 3EQ7A 4MS4A 3REOA 5JQGB 5KTMA 4DNOA 4DDTA 1QOZA 3F8TA 4CQNA 2V7EA 1C8BA 2HCFA 2VG8A 4G9EA 3JZMA 1GU0A 1JNXX 1I3KA 1XLTC 3QVJA 2C5GA 4UEJA 5I7RA 2I80A 1JSZA 1SXJE 1TKRA 1R5NA 3P2MA 1FFBA 3ILXA 3MWEA 2OY0A 3QVGB 4JZYA 4LXIA 4M21A 3CTPA 5C53B 2BFEA 1G8AA 1RQ7A 3ZU4A 1CNMA 1JAIA 3IUPA 3PEFA 2R2AA 2XW6A 4YEDA 4RORA 5LOVF 5TNXA 4N7JA 3ZDEA 4OBBA 1D2NA 3IPCA 4X1KA 1IEQA 4M37A 4BDSA 3FGOA 3DOIA 4NZ9A 3IO3A 1JILA 2W42A 4U7PB 1Y5LA 3KQTA 3OZWA 5IVHA 3NHYA 1MORA 5I47A 2VPQA 3I05A 4OAOA 1EDEA 1GFIA 1JKJA 1CJMA 1H2FA 1MQSA 4NSNA 4PHHA 4BNKA 4Y9TA 1KK3A 2Q1XA 4ROTA 3FTCA 2QMHA 1UUFA 3GJ6A 4AJ9A 2F8MA 3MBKA 2P2GA 2ZWOA 4KK3A 4UTXA 2O8CB 4BNDA 1HUQA 3O8QA 4OY3A 2XZOA 1IN7A 1PCXA 2FSVA 3R5XA 1NI5A 1S8NA 1S2DA 4M88A 2NU8A 2P6NA 3RVNA 3SI7A 2R48A 4AJHA 3PF8A 1OYYA 2BJHA 2JDIA 2AQIA 1UKCA 3OTHA 2CL5A 2CCKA 2HK9A 4Q15A 4KWHA 1ZK4A 4QOHA 3UJ7A 4ND8B 2FYTA 1RM3A 1UBUS 1UDCA 4JY7A 2GA9A 4HP8A 3U17A 4ER7A 4G1BA 1ESMA 4H17A 3CPSA 4NF2A 1YFLA 5G3YA 1XXHE 4OL9A 1MGPA 2X7XA 3GLHE 3TLEA 4M98A 1XMVA 3H1GA 3JVUA 5DBHX 1A4RA 1FDIA 3ZR4B 5HS6A 4Y6PA 2ZROA 2NXWA 3RRNA 2YJ5A 1J8FA 4HSEA 3ZZUA 1F8UA 1V3TA 4GHWA 1E2HA 1NYRA 1Q11A 4ND7A 3VPBA 3WLNA 2F4NA 2HPAA 2Z3ZA 4LY0A 3K1AA 3K30A 3AR4A 5JSYA 3INNA 1O6CA 3ZE0B 2QXUA 1B8OA 3CEMA 3K4HA 3ZQUA 3KUUA 4ND8A 4CTNA 2F55A 3WFIA 3ZGXA 4H6WA 5BRJA 4DCUA 1QAQA 1LJLA 3P45A 4P3NA 3UM9A 4DR1B 1LRJA 3NQ41 4YCSA 2VTVA 2O4CA 1ZR4A 1CUIA 1DQNA 4LNHA 2ZG6A 3FYUC 2J48A 3U9TA 1U3CA 4Q9HA 1RPAA 1Z2CA 2IXAA 4HB0A 3KIPA 1G20A 5HZKA 1GQRA 4HDAA 3TQQA 1HYHA 3BXHA 1ONNA 4IEFB 1L5NA 2NYRA 4JLNA 2CNDA 3Q3IA 3QEOA 1ZK0A 1WB5A 2QHXA 5L3SA 1XRJA 1YD7A 2JFWA 1CJKC 4BX9A 1HLFA 1JLKA 1EWRA 1ZUWA 1UBGA 4D0NA 3NJ4A 5IDXA 4O4IB 2AW5A 4K6GA 3AHGA 4LX8A 1XKTA 2H0RA 3K0KA 2QAJA 1EH5A 1NVBA 2FW9A 2VHVA 4JQZA 4AJLA 2JD1A 4O8CA 5CXQA 3PDWA 3MUOA 4XX0A 4B44A 2QP4A 4R5HA 3WK4A 1TKAA 1JH8A 1J8VA 1N1GA 2WMOB 2Q6VA 2WF8A 4KYTA 4ZI5A 3IR6A 4JDUA 4AP9A 4EJMA 4GIBA 4HLUA 1C7RA 3G3EA 3VNUA 2OCYC 1ZIDA 3KEMA 2QYHA 5JY1A 3ZNQA 3CCBA 1JHDA 2CE7A 2JFNA 2P41A 2G9QA 1OLSB 3TFWA 4EA9A 2QU7A 5HTOA 1JFTA 3EG9A 2PA0A 3M1IA 1WM1A 1PKEA 3B1KA 3GC6A 3TXAA 5H4GA 3OOWA 3X1WA 4RCZA 3WBKA 4PFSA 2BHLA 4II3A 4Q7QA 3EZYA 1SUWA 1IY9A 1CEXA 4PSAA 5BORA 1QFZA 4TZ0A 1KI6B 3FZEA 4KV7A 5LA6B 4U6QA 1LPMA 2OB2A 2UZ4A 1E4VA 3DOFA 5KC8A 1E0DA 4N9WA 2G77B 3KD3A 3M2TA 3O93A 3EOBI 3WB9A 1V9CA 3QXCA 3T1HB 4LYJA 1R6TA 1NN5A 4XZ3A 4CLDA 3GLTA 2VWHA 4RM3A 4L3OA 3CKKA 5B58T 3ETEA 1OLSA 3SLGA 4G2TA 2PM8A 5EAIA 4K86A 2IUUA 3UCEA 2ZSJA 5ENDA 2EXXA 3DFUA 2IEZA 2V58A 1ZBDA 3UG7A 4AMUA 2ZTHA 1BGWA 5FUYA 1NW9B 3KC2A 3O82A 2JK0A 5GGYA 3AI7A 3HYRA 3NHLA 2NO4A 2ZB8A 4L4XA 5LA6A 3BH0A 1OIWA 1P9OA 1KO1A 3ZZ1A 4FNMA 1CTQA 1UH5A 4KVGA 1NSYA 3WXMA 3DEYX 2P68A 1NDHA 1ZRNA 1XLTA 5CDSA 2XWPA 3EGOA 4UM8B 3U7EB 1WKCA 3BMQA 3K70D 1Q12A 3MBIA 1HF3A 1Q20A 1U3VA 3DDSA 4EB0A 5JXGA 1CS4C 2ZYAA 2IVZA 5HF5A 3ZBTA 4KGXA 1XLVA 5EJ5A 3GGCA 2PUTA 2OYRA 4NE2A 3FIUA 1PJ3A 4H6XA 1WIWA 4Q9KA 3ZY6A 5DEOA 3FUWA 5L3RA 2JLYA 3OFJA 1TECE 2OQIA 3MWJA 1UBLS 4QBHA 2CJFA 2PS3A 3E9EA 3OCYA 4XWYA 2CFSA 1GADO 3WK6A 1RAGA 1HZJA 3PC7A 2ZYVX 2AFIE 3NTQA 2O3JA 1G2QA 2WF6A 3HKBA 4DHWA 2GPBA 5CG1A 2F6RA 3WGMA 1CYDA 4NNJA 1NJ8A 3KUCA 4D57A 5E7JA 2JJ1A 3PYMA 3KQWA 3FR8A 3O1JC 3UUWA 1Z0KA 1X7YA 2ZT5A 3KQMA 4KR0A 2X8AA 3RUEA 4ZOBA 4YONB 4ZI2A 2CNBA 3C5WP 4AZ3B 4FGUA 3RAPR 2IEYA 2IHNA 5HGXA 3QPBA 3U6BA 3BSFA 2D2XA 3FDJA 2YOFA 4FC7A 1NQ5A 2MINA 3N6XA 4LHYA 1VE6A 2FFHA 2IDKA 4TVKA 2ZZMA 3AUFA 2FCAA 1D9XA 1UFQA 3EEIA 4LXGA 4UAGA 1PNQA 4YRCA 4DLXA 4JBIA 4PQGA 4DJDC 4BY9E 1U0EA 2YV4A 4IV5A 1VIDA 4DCSA 2QMEA 3FM9A 3VKGA 3QWHA 2PPLA 3ROZA 4BMPB 4ZAVA 1F60A 1TO1E 2F59A 3B1FA 2OFOA 4NYIQ 3P94A 4TKMA 5FLEX 1R37A 5TQVA 3W4KA 3C4VA 4DQXA 2VAVA 2VYVD 1EEHA 1EUYA 1O77A 2YXDA 1Z2NX 2ZR8A 4PX5A 3AUUA 1YMUA 4N7MA 4RFSB 3STYA 4DDMA 4LF4B 4TYNA 4LCEA 4CT5A 4HN9A 5K3BA 1ENZA 1Y7HA 1NT2A 2J08A 4J6FA 4G25A 3IAS6 2Z09A 1DEHA 3ONWA 3LC0A 4HRXA 1PFUA 4JT8A 1YZLA 1DFHA 1Z08A 3BMNA 3CLUD 5K3EA 1V8OA 2Y0BA 4BB0A 1MEJA 2WUVA 2WHYA 1Z17A 3I37X 2Q5CA 4LE2A 2IYLD 3NAQA 4G24A 3DJFA 4F6CA 1FK8A 2B4RO 2BGJA 3RF7A 3CB4A 2X14A 3WMWA 2YC4C 3C3AA 4IIJF 5F5XA 2X1LA 3ZEAA 1NOKA 4LGCA 4MVJE 2OO7A 3NHWA 5EKSA 4KKXB 3ZJ4A 4LV5B 2J07A 4H31A 5K05A 2PS1A 1U0FA 2J9FA 2Y67A 1BDJA 5HIAA 2YHIB 2Q4EA 3GFRA 2CHGA 1YR9A 3ETNA 1YE8A 1E3EA 3IBTA 3ITNA 1C9NA 3LW8A 2J0UB 5I7HA 1OD6A 3IUQA 5G02A 3TQFA 1RPZA 4M1WA 2ZRGA 4MIYA 4Q6WA 3JYOA 4YRRA 4X3CA 1O97C 3VJLA 4NI5A 4OKSA 4C6TB 2O8EB 1FS4A 1Z22A 2IYSA 2OO3A 1KVTA 4MRNA 4YBRA 1GU1A 4IVRA 2VAWA 1W30A 5UKDA 1SWVA 5FPYA 3IUNA 2E7ZA 2VLBA 5SYAA 3TSZA 1VG9B 2I7TA 2XNHA 4ZEVA 2BGWA 1V2GA 4NICA 4AJPA 3L8EA 3H65A 1O58A 2XYHA 1Z4KA 5AKLA 3VVCA 5K3CA 3EJWA 3ITEA 4EPWA 1M7GA 1P9NA 3R3HA 1AJEA 1AXEA 1M33A 4NVRA 5IP5A 5KYXA 4KE6A 4KPGA 3NOXA 1INLA 1ZBQA 2NSDA 1X9IA 2HF8A 2NNWB 3BCUA 3MGCA 4JASB 5LLSA 1Q83A 2H2FA 2XITA 3EAFA 1JEDA 3K0AB 4TROA 4CLRB 4DMCA 5C0OE 4WGGA 1VKOA 2Z5GA 3UK1A 1B41A 3H5RA 3IMGA 3KB6A 3VUFA 5KNBH 2H1RA 3OQPA 4JX8A 1D2MA 4LUCA 4Q9JA 4K3VA 5A5EA 4NCAA 2H1CA 2PRJA 4AYTA 3BFJA 2ZSIA 1PT8A 2PX5A 3L01A 3CEPB 2HGSA 1UBNA 2MT9A 4GM1A 1JHRA 4BWYA 3KT6A 5K8CA 1ORWA 5DNDA 1VPTA 1WXQA 2P2ZA 1WUIS 5FTNA 5G41A 3VV2A 2HT1A 1QWOA 3OOHA 2XF2A 4D3DA 5K0JA 5D8DA 10MHA 3M82A 1AT1A 4IYRA 4QPJC 4X24A 1JRLA 2A9FA 2O0MA 3TF5A 3M6LA 5JMOA 1VYHA 2CMGA 2DHDA 5BSVA 2ZJ1A 2ZDQA 2QLJA 3IEXA 1IPFA 1JYSA 4OKNA 4UJ3A 2GS9A 5EINA 1DAGA 3JRXA 2IC5A 4HDSA 1GARA 2VIIA 4TXHA 4X95A 5BVGB 1PWZA 3NVAA 4WY5A 1NNEA 4PCVA 1G21E 2Q4TA 2R3SA 2ZRDA 2C2GA 2PUFA 5CYFA 4ZKEA 2QZ9A 3GLSA 3D02A 1KZ7B 1NULA 2RC5A 4I19A 4IDNA 1R16A 1XQYA 1XZMA 1H6CA 3AJEA 3IBGA 3MAGA 3SS9X 3BSWA 5A06A 4EUFA 3HP4A 3HS3A 4PG5A 4P7FA 5ILGA 3R1IA 1N25A 2YNMC 1NDUA 2EZ8A 3F1LA 2IDJA 2KS6A 2C3UA 3KPJA 1WWKA 4K9LA 5TQ0B 3D59A 1X0XA 2C99A 1OAOC 3FUVA 3IFSA 1JKIA 3L84A 4I9GA 4NG5A 2WA1A 4DGSA 5HPYB 4ZEMA 4GKBA 3IERA 3KJFA 2JLXA 1I6LA 3L8MA 4IGAA 3O2JA 5FOXA 3AEXA 3TVTA 3W5VA 1W25A 4B8ZA 2REBA 1UAGA 3GFOA 3K9GA 1TF5A 4RDIA 4RDXA 1QVVA 3NG1A 3W05A 2P0YA 9MHTA 5BNIA 4LF8B 1MHTA 1RCUA 5FOUA 4DQUA 1N2CA 5L7YA 4CEHB 4CMJA 1M67A 4OP3A 2XT9A 1I4OA 4FINA 4F97A 4G37A 4IM7A 1H8HA 3MT8A 4UEWA 1YKFA 2PWAA 3PX2A 5ECWA 3IMFA 4KX3A 2PAAA 2G9RA 3JCZA 2PLAA 2GTHA 1X1TA 3O7WA 1H4QA 3JQRA 3AB7A 2O2GA 3K35A 1K08A 2Q9BA 3CBQA 4XYEA 3CEAA 2HU7A 1HH4A 3DDOA 1VE1A 2OHXA 2CUNA 1MPXA 4ME6A 4N76A 1TXGA 1XCGB 3HXLA 5AVRA 1I7PA 3DYBA 3TQRA 4ZCTA 4R0NA 2RCYA 3KRTA 4QEZA 2EWWA 3A1CA 4MMZB 2A0FA 4LVUA 2FQQA 5BYBA 2VPYA 1FJGB 4IJ6A 1R0ZA 5DYTA 1VFPA 2R1TB 3HG7A 4FPXA 5LBIA 2Z1MA 3U4QB 1UT8A 3A2MA 2E4VA 2WIBA 5EXTA 3RBXA 2AXEA 2DY0A 3I6ZA 4OJYA 4QECA 4UM7A 4ZJZA 5JJ5A 2BMDA 5PGMA 3DCNA 3HYLA 4RMNA 5H3CA 4F0JA 3Q3JB 1APBA 1UBMS 4L6CA 4A3SA 4DXAA 2AN4A 1NPTO 1KAEA 3HXQA 2WMNB 3AUYA 2GAAA 2GETA 2IGBA 2ID4A 2AF3C 3D2CA 5GWXA 1V6CA 5E6RB 4PSVA 1SO8A 1YMVA 1GTSA 1MFPA 2GTIA 4TS1A 3HB4X 1QE5A 4JJ6A 5EN4A 1E2DA 3UJ9A 5I5GA 2GVNA 1R8XA 3C5VA 2OEPA 3I4CA 1VHQA 2R1TA 4MGEA 4G8BA 1KPGA 4NG4A 2VEOA 2CLCX 4Y18A 3BB3A 3RAJA 3KTOA 3SJUA 4E22A 1W76A 3G1TA 4QYTA 3LCUA 2P2YA 3WGNA 2OILA 3LXXA 4G1UC 4OXKA 1OIVA 1RQGA 3VX3A 1KJNA 4I8XA 1M34A 3AOEC 3LD9A 2C9OA 3HABA 2WABA 4MLPA 2IOYA 3I2HA 5G1PA 1U1DA 2FPXA 2X0JA 1CZLA 2Z2YA 3I1IA 4KK4A 3VJKA 1TRHA 1X86B 1UKBA 3GRPA 2Q21A 2VXYA 2GBCA 4G0XA 4NNPA 4P92A 4EZEA 3T7TA 3VDRA 1TU0A 3EXFB 5L51A 2FI1A 4G84A 3ICPA 3TGLA 3SJBA 2C59A 1BWRA 3AF0A 3E4CA 1QS0B 1LRLA 1XFAA 2D5CA 3M2PA 2YW2A 1FZQA 3EZ7A 1K86A 1KYVA 1S4MA 1U80A 4FDTA 1AK2A 3EH2A 1K75A 4B82A 3QVVA 1S8FA 3MGGA 2Q7OE 2FRVA 3L1HA 1EHCA 1GO2A 4G4GA 5IEJA 3IEMA 3ANSA 3INRA 3R8FA 1L7EA 2WKQA 2X4LA 3E48A 4FGSA 3VA7A 3CU5A 3LPAA 3MM4A 2QNIA 1H23A 2DPGA 3C6QA 2V7TA 4DW8A 3BUSA 2QD5A 1OX4B 2JAPA 2V0NA 2B6HA 1ADCA 4GLJA 4HX5A 1B14A 2PT6A 5EXSA 1Z5WA 3ZXUB 2XDQA 5U4XA 3JPYA 3Q40A 2A9RA 4Y2GA 4DV1B 3HPQA 2RGNC 3ILYA 4J2TA 4F92B 1ZNXA 3DR5A 1WAMA 1L7NA 3UOAB 4DVGA 521PA 3W34A 3NYWA 5CW1A 1YIDA 2IOHA 2XUHA 1L8LA 4BBPA 5BMOA 4ZTUB 2FJ0A 1XQ6A 2EBHX 3AF1A 4LV6A 4O0LA 1KXJA 1LPNA 3T3PB 4RA6A 3S1LA 3WDSA 2CYAA 2YNMA 4MQFA 1XD2A 2GK3A 2I66A 4UARA 3GHYA 1EGHA 4B7XA 2FX2A 4YCCA 1XMSA 1OAOA 4M60A 1U7ZA 2XMCA 2YIMA 2PFGA 1XZGA 4E07A 4MEJA 5EUQB 2WU8A 3I2JA 1X19A 4HTAA 4TQAA 1KY4A 1CUJA 3ZW7A 1I2MA 3DE6X 5LYJB 1IG3A 4ZOCA 2O8BA 4WHMA 4BLPA 2VR1A 3FI0A 2ZAGA 4HYEA 5DWVA 5AKKA 5JMTA 5JDIC 4FCWA 2JGJA 4V0LA 1J8DA 1JEQB 1YZHA 1Z26A 4HTFB 4Q6BA 5DTMA 1VL8A 3ZV5A 1H1DA 1E5XA 3RIEA 4MW0A 3U60B 3DMTC 3S2SA 1URPA 2P9QA 2Z6VA 1KI8A 1O2DA 4GI1A 1NF2A 3MS7A 2ZS8A 4G1FA 1P4RA 1B4DA 1XZFA 3CC8A 3OA2A 1YDEA 1HDXA 3MB5A 2XXAB 1EKXA 1VFNA 3ORHA 4R8KA 5EQFA 3VOSA 3W2EA 4Q05A 3AVOA 4DMGA 1L4KA 5EJ6A 3VOBA 4EQZA 3G0IA 4L57A 2A8YA 3B3GA 2B98A 2VPTA 5A6SA 1ECJA 1HORA 1OAKA 4LY3A 3DV9A 1BYUA 2PHZA 1MO4A 1W35A 3NHMA 4IIVA 4RU1A 4U7DA 4JCCA 3VQTA 4DCVA 1B23P 4B46A 2RJ3A 3NVDA 1A5BB 4FIDA 1QYVA 1Y81A 4DM7A 2C5LA 1TCVA 3DE4X 1WQ3A 2JI8A 3P0RA 4ZARA 1XT6A 1VKJA 4C22A 4CUJA 1ANKA 1MMFB 3F6BX 3JPWA 4I4IA 1EX6A 1S5PA 4MUFA 3A36A 3HSKA 4HUQB 3H1EA 3C4JA 4KGZA 1IN1A 2QRPA 3G1WA 1JLSA 1U94A 2I3DA 3W5JA 2PWPA 2WSSD 4F56A 4NBTA 4IMIB 4OATA 2NWQA 4YN3A 2O07A 4TWAA 2G1UA 1P2DA 1TM1E 1M2VB 3ZQ4A 1J8YF 3V7UA 1JA0A 1VZ2A 3GN1A 1FVHA 1XVUA 3FTQA 4NPHA 1CQIB 4CQLB 2EKDA 1W36C 4K28A 5E8JA 3VPHA 3QG5A 3HA2A 5AHRA 3SBXA 3HM9A 2X41A 1KZGB 1R3UA 3L6RA 1A9XA 5CYOA 1QNFA 4JROA 3B52X 1SXHA 1OPXA 3IQXA 3L6DA 2GBLC 2DPMA 3BB1A 1MXHA 3CJQA 4BQEA 1ZAKA 1XVTA 2AMFA 3DMFA 3GDFA 2IYUA 1Q21A 4CQMA 5BNZA 1PR6A 2UU9B 5JRJA 4QUDA 2GEKA 4POOA 2PJZA 5L3QB 2E18A 1R8JA 3JALA 3PXBA 1QM5A 2FETA 4CM1A 1LSUA 5BVHA 2PD3A 2QSUA 4K46A 3JD1A 3BX1A 3PXUA 4FMDB 3RT7A 5FOQA 1EVYA 3B2NA 4O4JB 1AF4A 1E2NA 2VSOA 3AOEA 2IIVA 4RM2A 4DB4A 2Q8NA 3BSSA 1ZUIA 1MRZA 1GPUA 2HSJA 1KYQA 3CX8A 3H2KA 2NXJA 1KF0A 3JYQA 1E8NA 1MVNA 1R1DA 2IXEA 3EC7A 3JYPA 5ALIA 4NC9A 3UWMA 1QAOA 2YL2A 1Q3HA 4OHMA 3A58B 2PH1A 1WZIA 2J3JA 5MGBA 1KO8A 1JI0A 4E2XA 1MLDA 2D2IA 3LUCA 4M89A 2DKOA 4PO8A 2AJLI 1J8QA 1YJ8A 4NMLA 1VMIA 4ZVQA 2G40A 3WTCA 5CLFA 2FKAA 3UMSA 4WXHA 4R98A 5FWAA 3EXIA 5EVJA 4NJOA 3H7IA 1U9YA 2JBAA 4C5AA 4YJ3A 3EDMA 4M1OA 3ZOKA 2V7VA 3HMQA 4DV4B 2C7BA 4TKUA 4Q4CA 1TAUA 2JAQA 3FNRA 4QYSA 4G41A 3VPCA 5EZ6B 3QKIA 3QUTA 4IPTA 3MC1A 1KA9H 3LGAA 3PGXA 4OFWA 2UVPB 4AQDA 1VXRA 5DYNA 3WSVA 1NVDA 2YMQA 4MROA 2NACA 3ZBQA 1PF7E 1R6XA 3EQ6A 3Q6IA 5GIPE 4E88A 3QPUA 3EYWA 1LC3A 2INGX 2RGNA 2SNIE 3AIOA 3A4NA 3U61B 3DS8A 5J1SB 1RPJA 1EQAA 3HO6A 1E1RD 1N3LA 3Q0TA 4HLCA 4C0BA 1NVMB 4ZIRA 3DKRA 4M8KA 2WQ6A 3QYFA 3TOSA 3BZWA 4KI7A 3I5YA 1YBFA 4OQ4A 4GSLA 4TUYB 1X1BA 2ZRFA 3RS3A 3W9UA 4E08A 3ZE2B 2DX7A 3ZHQA 4ZJUA 2CNKA 2XTMA 2I7XA 2DR2A 1IAQA 4GO1A 5COAA 4B79A 4BKRA 4F96A 2Q7XA 2PZKA 3N8GA 3GR6A 2ANCA 2Z9BA 4D0SA 1ZOPA 5FI1B 2OESA 1QO0D 1J39A 2HO5A 2VK2A 5DO9A 5JO0A 2QW8A 4S05A 3D3QA 2P9EA 5D00A 1L5ZA 4W5WA 4JQCA 5K3FB 4REQB 3KBOA 1JNYA 1QIMA 4JODA 4U63A 1LDGA 1JH9A 3F47A 2BTQB 4JEHA 4R31A 1VG8A 1FYEA 1P5HA 5JDIA 5KNDD 3IBFA 2VTKA 2YXBA 4NENA 5JNVA 5CPBA 4YX9A 2A33A 1QGUB 1BZYA 2PZBA 5LMCA 1A2OA 1FDWA 1N5KA 1QYDA 3A6HA 4LHVA 3DMTA 4FOOA 4BAZA 1YQEA 4CG0A 5BOSB 1UFRA 4YJ2B 2M6KA 5HNKA 1I33A 4AU1A 5FBVB 4RPGA 1NATA 4WFKA 4CF3A 3GLUA 4EB6B 1GN9A 2EFYA 4RPHA 3WRWA 5KYTA 4MR8B 1OJLA 2YN4A 4DUZB 2QENA 3PGLA 4BGUA 5KREA 1NV8A 1QC5A 1MRNA 2A9VA 4FEAA 2A2ZA 3TLGA 3OE7D 3OY7A 1Y8ZA 1O1YA 4CIDA 4DDVA 3MJEA 4X6YA 5AHXA 3CLSD 1WPRA 5BW6B 2RGEA 2RHGB 1A8HA 3JVIA 3O9MA 3VNBA 1GDTA 1D6MA 1V1MA 1XI2A 2ECPA 1PGOA 1PR4A 2HA7A 5EWLB 4PZ0A 1Z68A 2H4JA 5EXEA 4LPKA 4W1SA 2W43A 2CHQA 2G67A 3Q10A 4R5MA 2NSLA 4E2YA 3MT9A 3IJRA 5L7WA 4YJ3F 3SZ3A 4C0LA 5JBQA 2QBYB 3OIDA 2QUIA 1SU8A 1A1SA 1PT9A 1MB9A 2ONYA 2ABWA 4B85A 3BF8A 3ACDA 3ZJTA 1DAPA 3TL6A 2CDNA 1WKBA 5H3HA 4I3FA 5FWDA 4BB6A 2JIZA 1M1ZA 3H42B 3MWDB 2VRNA 3NTOA 3LUPA 4X3OA 5D1NA 3ZGZA 5C1DA 1ZH0A 2QTMA 3Q2KA 4HBZA 2V9CA 4EI2A 1QUEA 1AG9A 3FNQA 4WD3A 4NEGA 5HSGA 3PI6A 1QGED 2CZGA 3T1VA 4PQRA 3VVLA 2GLUA 2W6ID 1XO1A 3MG9A 2HOQA 4F2WA 2WZQA 5CFZA 3G9XA 4URUR 5K2MA 2WYIA 2ATIA 2QBYA 4WLNA 1AKWA 1K8XB 4RXUA 2BGTA 3MD9A 4HEJA 1AXGA 4EJ0A 4DIKA 1N4DA 1PL7A 1U1GA 2RDMA 1RXSA 1ULZA 1DQSA 3B8EA 1I80A 3BRSA 4L9RA 1VCHA 3KLPX 4NJMB 4PS1A 4Y2JA 5BQPA 1TFRA 4C3UA 1KE1A 3FKSD 3P20A 3ZV3A 1SQ6A 2OBFA 1RJ9A 4PRYA 1V7PC 3ESQA 2Y1LA 1TIKA 1NAIA 3KQOA 4NBRA 1BWQA 1QO7A 2H8GA 3LY8A 3X2SA 3O4GA 1Z63A 3GLGB 1Y6ZA 1MJGM 2XE4A 3TBKA 3V8MA 2RIRA 4QLOA 1KKUA 1DKOA 3KR9A 3KQVA 1HTWA 1SHUX 4BMSA 3OIVA 4DILA 1OFUA 1DV2A 4FC6A 2TMDA 1PR5A 3RTAA 2Y0EA 4W9NC 3H9UA 3KZNA 4U39A 3PKIA 3HXKA 3R3JA 1FVXA 1X1DA 1Z88A 1E18A 3NBXX 4UM5A 1PJBA 5EIAA 5HKBA 3TJRA 1NMZA 4JGIA 1N3YA 2P62A 3R7DA 4CG3A 3GNSA 3FJ1A 5DT9A 1IATA 4EPVA 3O3NB 1GLGA 2H16A 3I2FA 5A05A 4EYGA 2Q2OA 1P2UA 4DXHA 3WNBA 3U4HA 4TN1A 2CVHA 4HLNA 4UD6A 3OLQA 5ALGA 2PWBA 2MR5A 4Q19A 2QE7D 4KXVA 1QMPA 3RLFA 2PUGA 3NGMA 1YKGA 3HBMA 3P4UA 3FLBA 3S70A 2BFMA 2VK8A 4HBGA 3Q3CA 3ZYZA 4X1OA 1W94A 5ERYA 3MPOA 3NHJA 3GRZA 5EIFA 3TCXB 3UT6A 4C01A 4Z2AA 1L5YA 2Y71A 5F76A 5REQA 4IUCS 4J0KA 3I52A 1H65A 3PRHA 1UXKA 3UC5A 1YRBA 4N0EA 4QRHA 3UFXA 4AYXA 4C04A 2PMDA 4MYSA 4LDNA 2AI1A 3LWBA 4IO0A 5FBWB 4ZI7B 1BHJA 3IRUA 1JFFA 4XLZA 2V6BA 2HA6A 1LDMA 1M8FA 1VIVA 2PQMA 3DPSA 4E5MA 3CMCO 4P0PB 2ODEA 2YIVX 3KO8A 2C1EA 4C2BA 1XCPA 1U3WA 3DBHA 4X7MA 2V5VA 1DDOA 3AEQB 5JRDS 2C5SA 1WMEA 3QWIA 5FUBA 1Q50A 1WXFA 4CEJB 3FNEA 1K6IA 4BQOA 3ZZMA 2PVPA 3O8NA 2YRXA 3LX4A 4RSHA 2DG2A 2FFJA 2B92A 4ML3A 1WHSA 1AHNA 3SS8A 3W04A 1ZKMA 2XCIA 3A70A 5LB4A 4LJ9A 5ARDA 1XR3A 4QU8A 4FWBA 2LPMA 3DFZA 5EIHA 4RA9A 1E5DA 3ANYB 4F21A 1OI2A 1CQZA 4HXEB 5FLKA 2O3SA 1B76A 3OHPA 3ONEA 1ZKDA 4FFMA 1MJHA 2GRAA 1XOIA 2IY7A 2BL4A 3AEQA 3HCBA 4U3JA 4ZEWA 4LVCA 1RLIA 3IOEA 1EA5A 1GRNA 1RI5A 4CEJA 3TR6A 3I8OA 3IAFA 2AX4A 3DMNA 3HKCB 1RXCA 4BKPA 1Z3CA 3FGNA 3QLEA 4X44A 2QRLA 4WCFB 3OZBA 4XYGA 3MWYW 3WRXA 5K6AC 1NMEA 3MINA 1F5SA 4Y6LA 3W7AA 3NGXA 4P7KA 4JZKA 4YMSA 2HHHB 4Q7JB 3L4BC 4Q1FA 1Z37A 2OPHA 4O63O 1XRLA 3QNWA 1EMDA 4J4TA 5B1HA 1XZNA 1RFGE 4OSPA 3SR4A 4DR3B 4YUVA 3WP1B 3PL5A 3THYA 4DFDA 2H17A 5CJPA 4F85A 3LA8A 3EA5A 1T9AA 2GJSA 1IU9A 1G6Q1 1ENYA 1QRUA 2MSKA 3WIDA 3I61A 2XR1A 4JYBA 5J4HA 2JIOA 3HY4A 3A1TA 2VWGA 4L5YA 3ZZ0A 2XNKA 1NZFA 2R47A 3UUFA 3DV0A 1FPMA 2NT3A 1UWKA 1BCRA 2EZ4A 3GFPA 3FVTA 3RSQA 2JLSA 2HL6A 2XMGA 4AS2A 3DNPA 5K2OA 2GJKA 2W2MA 3I8XA 4FLFA 4AJ4A 1W0CA 3GEBA 4JB8A 1M8JA 1I1HA 4OQLA 4ALIA 3BIXA 4EPRA 1Y4ZA 5CLGA 1BCSA 1NJSA 2WD9A 3GRAA 4DUGA 3PDJA 4QTZA 3MRXA 5CDFE 3EPHA 2YS6A 3RB8A 2CE2X 3GDWA 2GJ4A 3UTDA 1ZH2A 2ON6A 1YNOA 2ZS9A 2OC9A 4D9HA 4C6SA 5JNUA 2JH3A 4Q4LA 3O3OB 1G6OA 5ALXA 4JYMA 4H18A 3WLLA 3B89A 4ND3A 1MBZA 4XLTA 5GGXA 3S8YA 1CY1A 4OLHA 2CD7A 1I14A 5GADl 2AEFA 2HV9A 2WYVA 4BJ6A 4DG9A 2QAGB 4M9UA 5DX1A 2DXIA 4FU0A 4JXJA 4DLYA 4LY6A 1RLUA 2Y8EA 2O05A 3ABZA 3CX4A 3EMKA 1M76A 2C2XA 1Z9BA 4WN9A 2O5EA 4IZHA 2EAUA 2FUKA 1Z2OX 3JQGB 3RYIA 4E09A 2F3UA 2IZ5A 3DDCA 4Q24A 1JHZA 3S7ZA 1RCFA 2Q7DA 3FYCA 4IOMA 4UE3S 5HEKA 4YRGA 1DRUA 2J6CA 2IWRA 2Q3CA 3WYGA 1OBOA 3LQKA 3AGQA 2D62A 2NNLD 1CJBA 1EP2B 3QVKA 1YR2A 4W9NA 3WLFA 2N0SA 1C80A 1TJ3A 4AZSA 1JU9A 1Q77A 3M9XA 1RYDA 1GFZA 1E6MA 3HB1A 3PD1A 3G2PA 5HIJA 1NG9A 2ZXEA 3PC2A 4WLOA 1EP9A 5K0GA 4EHHA 5K8VA 1N5IA 1UOOA 5SY6A 4J6EA 1S3GA 5CYPA 4ARIA 1U90A 1T4MA 3FPLA 4C29A 4QNNA 3OZGA 4TTJA 2XCQA 1J4AA 1TM2A 1E98A 1SBHA 2QL6A 2YQZA 3B3FA 2B1RA 2ID9A 3IP8A 4U4AA 1OV6A 2PXAA 4HY3A 4ASUA 2BP7B 1IVYA 3IAM1 1B74A 1JR3A 2DKFA 1AO3A 3DLAA 3L0ZA 3LS2A 3NKVA 3TTYA 1DJMA 3U13A 5AJVB 2W4QA 3HFGA 2PBZA 3Q85A 4FMPA 2BKEA 4JC4A 3UAYA 5TT1A 2OCKA 4PHCA 2MSEB 4H7FA 3WZMA 2WM2A 3I64A 1NE2A 2BLLA 3HDTA 1LI4A 1ZD5A 2ZJ5A 3KL2A 3E7WA 4N0DA 1BXGA 2HA5A 3CH4B 3GPDG 5BSHA 3K70C 1N36B 3BJEA 1DJNA 3MWKA 1IN4A 1X7ZB 5FORA 4WXPA 4BJ3A 3ICOA 3UTCA 2XTZA 4UQPA 1ADBA 1WSAA 3O73A 5CLHA 3O8OA 5EZYB 3P9QA 3KYJB 3BXEA 3WL6A 1TF7A 3OX2A 5G4KB 3I9MA 5SYNA 3LPLA 2GESA 4AXBA 1PN3A 7ADHA 2BP7A 3FNGA 1TUBB 3K0BA 2RKOA 3A4TA 1Z35A 1TK9A 1FFXA 1QH9A 3ECCA 3UCFA 4PBTA 3F9IA 1IEVA 4YR9A 2H5EA 3F4KA 2XYVA 1CWUA 4HNGA 5L3VA 3A0UA 3OF5A 2O48X 2MHCA 1VL5A 4YQZA 1SXIA 4K9MA 2EJUA 4YMVA 3KR2A 1E0JA 2FLKA 4KKVA 1BMFA 5KTRA 2IJGX 5DF1A 4O3MA 5E1BA 2VJOA 3HR8A 4OQQA 4D02A 5EZSA 3PCXA 1MHPA 4HDMB 4P5DA 3OJ0A 4YACA 5F5LA 4G07A 3CRW1 4GOOD 5CDGA 3MIIA 3V97A 1BS1A 3IELA 3L7OA 4I6EA 2WHQA 4S24A 4WXMA 3SSNA 5F98A 4YV2A 3A2KA 2O8FA 4KQKA 4JLMA 5E8RA 5EPEA 3ASVA 1WETA 2QVCA 3SEZA 4OYLA 1KI2A 3ZDFA 5D3MA 3MHPA 4WBNB 2AJCA 3BYZA 1I8TA 3BGWA 1N9ZA 3VVMA 4XIJA 2ZRLA 4PW0A 2O5VA 4LJYA 1K6EA 1YO6A 2C0QA 3VKWA 2GSDA 4KAXA 1PL8A 3O2NA 3WGUA 3Q7IA 3QOWA 5F2OA 5DM60 1Y1RA 2VVTA 4NPAA 1UPTA 4JHLA 2C00A 3RC1A 1V3QE 3PHLA 1Q7TA 1AGPA 3CKLA 5E1OA 1B1AA 1YVUA 3B9BA 5DTJA 3VNAA 9GPBA 1HDCA 4YRAA 2DH6A 2ZANA 5I4CA 4HWGA 4OGKA 2FW1A 3CR7A 4CHGA 1U0LA 1ZAYA 421PA 1Z0IA 2H4XA 2ZUTA 2EWMA 3BDIA 1JG3A 3TAHA 2I7DA 3HDGA 2WT8A 1P3Y1 3FCAA 2WWXA 4WBNA 4S1OA 4F1KA 4ZVPA 2ZAYA 3EVNA 4MKIA 5A02A 1T25A 1L7DA 3AETB 4GBGA 1NW6A 3SIXA 4ANFA 2HWYA 2OZVA 2X77A 2ZU6A 4AZ0B 4BRZA 3NBAA 4TLEA 5HYVA 5CVDA 2WPDA 4QAQA 4UAUA 3SNKA 1O9BA 1Y9EA 1L8QA 3HY3A 4OREX 1Y1KE 4MRMA 1XZEA 2AG1A 2GPYA 2A1TS 2HT6A 2C77A 1NVGA 2Q1WA 3G13A 3HI6A 4NYJR 3R7SA 1YCGA 3RK0A 1FIUA 3RVOA 1KAGA 2O9JA 1A9SA 3EZXA 4IOJA 2Q3EA 3FA2A 4RD2A 4RVCA 2XVYA 4PLVA 3WISA 3ZWCA 4B3TB 5JJLA 3S2YA 2NP6A 2R1ZA 3KEQA 2GPAA 5EYPB 4G4SP 4HRYA 1I2AA 4ISBA 4C1BA 3VNVA 4YC7A 3HBNA 4CL3A 3DO8A 4QOGA 4LRYA 3UB3A 3EA0A 1JXQA 2OCXA 3RHTA 4AWBA 4JBXA 4L0CA 2GN2A 1JFVA 3T34A 4AZ0A 2O7QA 1TKCA 1YA8A 1E1KA 2QGNA 2B4AA 3LBIA 4CLOB 3ADDA 4XDGA 2FQWA 3EASA 2WFLB 4H0NA 5B2EA 1TKBA 2VI5A 2OHJA 3SICE 4AKSA 5B3AA 3H6GA 4PAQA 1ESDA 4RKWA 2X9NA 5HRCA 4W5NA 3V80A 1SB8A 2R66A 4YASA 3TFQA 1A1VA 1DC3A 1ZEMA 1UJ5A 3L8FA 3MWGA 5TQ2B 5I3CA 5EL0A 1PZHA 1JB9A 4FGLA 1Z5PA 1DG3A 1VE9A 4EDHA 3EIXA 4PYLA 5JEEA 1PWEA 3DDZX 2IU0A 1R6UA 1IK6A 3IA7A 5E6SA 3WWYA 4HFRA 3E84A 4XCXA 3LLSA 3R6DA 1PNVA 3UXEA 1MX9A 3THXB 2B82A 4IOKA 4KQMA 4DUGD 1TEZA 3FTFA 4KIGA 4YUWA 1HNXB 1KJ9A 2B8WA 3V4ZA 4PZEA 1E1MA 2WJ4A 3C98A 3DMGA 1NKTA 4D4LA 1I0LA 4E1AA 5F9HA 3X3HA 3QFFA 2HV8A 1JEEA 2XSZA 5HKLA 2LP4Y 4ZOLA 2NU9B 2C57A 1VHDA 2H4YA 2NZJA 2QN2A 3C4QA 4MRAA 4U7FA 4WV3A 1X9GA 5H16A 4AX4A 4ZYWA 3Q8XB 1U81A 3VSCA 4MOWA 4NYMR 4AKGA 1FNCA 3HJNA 1N34B 3HVJA 1KSFX 2HRDA 3JQEA 2KPOA 1KR5A 4NMWA 4U7WA 4YAFA 5KAPA 1OWOA 4GOLD 5FOSA 3BE8A 2I2CA 4KMOA 1CDOA 4CKYA 2EJTA 3VYVA 4WUTA 2FE1A 1LQUA 4L7QA 4FR2A 1MDBA 4E4TA 5B36A 1A4XA 4BNWA 3CUWA 1OB2A 2GN0A 3TRDA 3EUFA 4OHVA 3IIMA 1QIGA 2VZ9A 4X1IA 2HUNA 2OXIA 1OT3A 2P67A 3WHPA 1ISPA 2XECA 5DOZA 2ASEA 3PWZA 4EUKA 1OBCA 3AZOA 3B1ZA 3NM6B 3IDQA 3WYEA 4DRXA 4CFYA 2JNWA 4DWJA 1W5FA 2FSFA 3GEPA 4RPKA 4HQRA 1X70A 4DPMA 1NN3A 2QN7A 5AK6A 5I8ZA 4HZUA 1V3VA 1QMGA 4M3NA 3HDHA 1OZ0A 4NAVA 1KK1A 2W2PA 4KJZA 4W6ZA 4C0SA 3E3OA 2F9MA 4ARVA 3DC7A 1V4NA 3DWGA 2C2BA 3OT4A 5AVSA 3OICA 1GNSA 2NZYA 2CLFB 5LMZA 1EDBA 2O0LA 3ORQA 3EYAA 1IBMB 4A1OA 3KOYA 3ZVKA 1IHXA 3FPHA 1Y9ZA 1Z25A 3OPYI 4B1FA 2ZYTX 4UHHA 4IIUA 5C51B 1WVIA 3F7MA 4JKOA 3P71T 2BGNA 3GOQA 3PHJA 5LDDC 3IB6A 5EXDA 3FCUB 5KVSA 1DUIA 5I48A 1RVDA 2FMTA 2HKIA 1ISFA 4F3KA 3IE1A 1D3AA 1J70A 2H5IA 2HGZA 4XEHA 2SBTA 2NGRA 3OT1B 4Z0TA 4HNUA 1A9ZA 3ZW9A 4D3FA 2LCQA 1GYPA 3DP7A 3K6RA 3NM4A 3HUUA 4E14A 5A1TA 5BN4A 4J0HA 3C3BA 3CONA 2OXTA 2W48A 1VB5A 2XCLA 5KX5B 1CRZA 2WP8J 1JHVA 4MWGA 2VYVA 3LYHA 1NZJA 3EVFA 1T0UA 1JYFA 2VJQA 3G82C 2BISA 1UBSB 3IUBA 5B4UA 5JI2E 4DT1B 4KU4A 3I5XA 5TT0A 4J07A 2ZI4A 4LRXA 1TLLA 2WAAA 1I4DD 4NNOA 2BR3A 4WJZA 4JUAA 5TF0A 3HXOA 3U5ZB 1JG7A 4ZOLF 5H9WA 4L5JA 1CUDA 2IE8A 2YWDA 1GEGA 5GV7A 4IXMA 4M55A 1U04A 3QQPA 1KZ1A 3A11A 4BEBA 4DHEA 2YY6A 3LDHA 2WTEA 3SVTA 1SQ0A 5B7QA 1UMCA 1BDBA 1STOA 1SVMA 3BMCB 3PFGA 3C97A 3DQPA 3TLYA 2FMHA 5DX0A 1HT1E 1JKFA 2YJ6A 3B7PA 2TYSB 2XOKD 3STTA 3X1MA 4BE9A 4JJIA 1SURA 4FZ3A 4N4AA 2IYPA 4UEKA 3ZHSA 2JGLA 1J1IA 4EDFA 1ZHFA 4WK0B 4JLBA 4WZBA 1ML4A 5LUAA 2ZSKA 4B3CA 1A7JA 1QHYA 2JJQA 3ZHCA 2IHVA 2Z3VA 5TXGA 1SM4A 4O5OA 5HCNA 1Y1LA 1SD2A 3IAM6 4X20A 4XIIA 2IZOA 1L4YA 1C3EA 3RH0A 1TVMA 3LBFA 3RAGA 1MR3F 3MCVA 3M0EA 1RHMA 5FCDA 1TZJA 1RZRA 1M7HA 3HWX1 1RAFA 2VQ6A 4C87A 2ZYDA 4QLBA 2WU0A 1RRKA 2E4ZA 4YCDA 3BA6A 3CO0S 4C3VA 3LJKA 3FF1A 4FHGA 4O4LB 1JF8A 4F8EA 1HYEA 2Y4OA 4FFVA 3NV9A 3AGPA 2QF7A 3NBMA 3AV3A 3F6PA 3I72A 3VU1A 4LCJA 1THZA 4E5DA 3HU3A 2CJWB 1FVOA 1YRAA 2G6BA 3CMMA 4PC1A 4UHCA 1LBIA 2ZB2A 4EPYA 3CLKA 1EXMA 4MV3A 4UMVA 2R84A 1J09A 4XWGA 3N2KA 1O89A 1SCUB 4HEQA 4OM7A 5HKOA 5FA8A 5KMGA 4GICA 1H3FA 3QY9A 1UMDA 3QUBA 1U8AA 3ZLVA 1QP7A 4CMAA 1SC4A 5DVZA 1HURA 4H1TA 2FG6C 2V9PA 4O4LA 3SSMA 4JH0A 1O87A 4YDHB 1Z7YA 4KBFA 1CW2B 3H5VA 1PJQA 4DLSA 3ESZA 1TYDE 1A4UA 2NVOA 3N2ZB 2VQDA 2WIKA 3T0IA 1BFKA 3DUWA 4EG8A 5CG2A 3O7MA 2CJXA 2DTXA 4AJJA 2VYFA 2H9AA 4OXXA 1RM0A 3LPCA 1QANA 2MCFA 1JHYA 1P0PA 1GPKA 4JEIA 4XAQA 2BHRA 3L7LA 3LM8A 2GZHA 2QN8A 1P72A 4WXRA 5CHEA 2BFDB 1XNRB 5FJJA 1Z8HA 2R4QA 4E2ZA 4PGAA 1FYFA 2C31A 1MPTA 1H8ED 5TLSA 1CNFA 4BIMA 1RI4A 4WOKA 2PGXA 1D4AA 4DMRA 4P3YA 1XA4A 4RNCA 1KFBB 2HXYA 2QL5A 2M2IA 3WQBA 1QV6A 4DB2A 2QJWA 1VE3A 4C0XA 1D4ZA 3CH7A 4M0CA 4R2MA 2LIPA 4X63A 5JI3E 2OFXA 4LJLA 3CZCA 3FHJA 5A5VA 3JYLA 4RTQA 4QE3A 3IHLA 1GT6A 3TB6A 2GEFA 3WMEA 3ZJYA 621PA 2AX3A 3H84A 3ODPA 4I50A 4RF3A 1ZEJA 3SFZA 4HF7A 3FMGA 5ERGB 3ROFA 1C3XA 3ZLUA 4EP1A 1DAMA 3CRNA 5TMEA 3LPNA 4EGQA 1TNDA 3ED1A 4MYTA 4RAOA 3C6ZA 2MTBA 2PK3A 3DXZA 4TTRA 2OM6A 5T41A 3KETA 1E2BA 2W11A 3PNLA 5DBGA 4F91B 3BERA 4DNQA 2BMFA 2FGJA 4TKZA 1EA7A 4MMYB 4RD6A 1UOEA 4RGQA 4AT1A 3BIWA 4N01A 4PAGA 1TEVA 2QDKA 4Z5XA 16PKA 2DCMA 1CIJA 3UMMA 1G8SA 1ZK3A 2REXB 3AONB 4BFVA 2DLDA 3ERCA 3NBUA 1T8SA 2ZB3A 3WNZA 5KYWA 2XEDA 3W8NA 3PNOA 3IE2A 1MZPA 5JJBA 2VL7A 1XQVA 2PR7A 3QLTA 4RO0A 1E6CA 4NHOA 1QF9A 4BC1A 1JG2A 3G7NA 3OJFA 4PG6A 3KPUA 3OBIA 1A0OA 1F0NA 2J9GA 2AFVA 2RAFA 5EESA 3WR5A 2X22A 2JLWA 3ONNA 4FTWA 1C81A 1ADJA 1ULBA 1UM9A 3T54A 1T3SA 4EF4A 1ZGZA 2AGVA 2V8BA 1X7GA 1TVEA 1IMOA 4AKHA 3HZHA 1W88B 1CV2A 2B34A 2EX1A 2GPSA 3KHKA 3LY7A 4UBMA 3EPLA 2WEKA 5MGNA 5GM2A 5H5JA 4MAFA 1DBQA 1JJ7A 5B6JA 1B8VA 1SD5A 1Y3DE 3LZ6A 3AL0C 3JQAA 2GBIA 1Y5MA 2W2TA 1O94C 3FOEC 2HMWA 5CLIA 1FNMA 4BX8A 3RFXA 3NHRA 2PVCA 4MR7A 1JDZA 3TSCA 2YXNA 1JG6A 3Q7PA 4ALJA 3E2PA 4C7XA 1KDRA 1QCYA 4UZFA 2GJ9A 1U1CA 2LKDA 1UOPA 3DL2A 1GILA 2KLBA 4F3TA 4F86A 1O57A 4G1VA 3P2EA 1HDZA 2XAUA 1GR0A 5G0WA 3KWLA 5DT2A 1SA0B 3GY0A 4I99A 2W2OA 2PSFA 2RMKA 2X1MA 3EXHB 2BUAA 2ODTX 4K0KB 3HA5A 4NFYA 1OGJA 4J43A 4MVCA 1W0KD 3AM3A 2BZ1A 4KLZA 4LVNA 1RWNA 4RZ3A 2V3VA 3E5HA 3UC9A 3E9NA 1Q44A 3MN1A 721PA 2C7RA 4AICA 3PNPA 3IULA 4HDRB 2EX4A 2C9CA 2VSFA 1FQKA 1CJTC 2PRKA 2IIQA 3BFPA 1DIRA 1KAOA 2UZ1A 3KU4A 4I50F 1OE0A 1Z5GA 3TYXA 5LU8A 3OMXA 4IWNA 4RANA 4CHTA 3KYBA 3ELBA 4Z9AA 3RQIA 1RMTA 2ECOA 1F4PA 3H6KA 4TRNA 1ZVJA 4KPEC 1JA9A 1O08A 4BYMA 1GCGA 2DFPA 1K7FB 3P5SA 3O4HA 1VRVA 8ATCA 3MQFA 1SXJD 5TIIA 4XVHA 3FDZB 5EHZA 1SMKA 5FL7D 5LLDA 3PWKA 4MDEA 4XTCS 5KTNA 4F7DA 1ID1A 3UUEA 1IY0A 2PZLA 3KB8A 4GLOA 1O5TA 5IX8A 1CY6A 1K4MA 1DADA 1MX5A 2P91A 3MFYA 4G67A 4PIVA 1AY0A 2KYRA 2XGMA 4N5HX 4N9QA 2CFOA 1RYYA 3ZVRA 5GAJA 3IEPA 1NR7A 5FUWA 5JD5A 3WLKX 3UATA 3ESXA 1DCTA 4R16A 2G1KA 4G0UA 3T99A 4REMA 2ICAA 2D0DA 2HRBA 3GJQA 5E7QA 4A8HA 3D3WB 4R0MA 1CHNA 3NTVA 3M4NA 2XA1A 3WC4A 4CRWB 1OXSC 5U9CA 5JAZA 2IS4A 5JSUA 1GPLA 6NULA 4LOHA 1ADGA 1W85B 2JH8A 3CNNA 3AIKA 3G2KA 5C8XA 4A4DA 4WE3A 4CCYA 4YHHB 2C2YA 3NPAA 1MVOA 3E18A 1U65A 3EGEA 3F3MA 3GLFB 3ICVA 2PX2A 1CT9A 1YASA 2BAGA 2RGCA 2W00A 1T1RA 3B6IA 3G9TA 5LZ8A 1CUWA 4JWKA 3SYLA 3DF7A 5JS6A 1CEEA 5JWRA 2V6GA 3CVOA 4KQGA 3VR2A 2ORYA 4RXTA 1SBYA 4DIBA 2QV7A 5K0TA 2XDWA 3OQ1A 2KW5A 5EC8A 1PJ4A 4A36A 3AL3A 5CB8A 2AE2A 4MJXA 3EE6A 3HADA 5K1ZA 2JLVA 4RPIA 4UVIA 1E6LA 5AK5A 3AY6A 1DTWA 5DASA 3VHQA 1W85A 5F7JA 3H5IA 3RKUA 2HZ7A 3T38A 4JIMA 1YCFA 4Y1RB 3UMFA 5CUQA 1CUCA 4KP7A 3AVPA 2VAPA 1P2GA 4G8JA 1KOLA 1E7MA 4H1VA 4KE7A 5MN5A 5FWXB 3VKUA 3WO0A 2H5JA 3HLYA 5CH8A 5E1DA 2C7OA 2I65A 3ZHYA 4XJXA 2GRJA 1IHPA 1X1AA 1SBIA 1DBPA 3EBLA 3DZ8A 4IWYA 3WIEA 4WDQA 3ZIAA 2ZE7A 2JI7A 1OUMA 3HCOA 3ZCSA 1SKQA 3ANLA 4A0RA 2DF8A 1JVSA 3D0KA 4EJ6A 4EW3A 2R6DA 1ZD8A 4OLJA 1ES9A 2Q4RA 3SQDA 1PSDA 1UR5A 2DHRA 2QSYA 3GDOA 2NN3C 1OLOA 2V1XA 2HFJA 4YDQA 1NA5A 2NUAB 4E7PA 5IT5A 3U09A 5CT6A 2A78A 1E9DA 1IB0A 1PS9A 4M0EA 4L72A 1HLPA 4DIEA 1THTA 1U0HC 1ZHOA 1DLIA 2J6BA 3QSYA 1ELOA 4M0PA 3CRMA 1HL7A 3D6MA 1T2UA 2WHPA 1GAJA 1Z5UA 3OF2A 4EEZA 3NM5A 5HXAA 1IBKB 2DQZA 3CZ9A 3L8ZA 3CLSC 3LY5A 2O3UA 3V1TC 4A8PA 2B8EA 1DIGA 7MDHA 2G5PA 2WM8A 2ZJFA 4NU8X 2YFHA 3X1YA 4C6HA 2YWEA 5HDQA 1IY2A 1N7IA 1YJBA 4MLDA 3HACA 3C3KA 3PDIB 3G2OA 4DWOA 3V2HA 1J56A 2HO4A 2P27A 2WSSA 4TTQA 2GYYA 3TG8A 2WTUA 1QUFA 1YRLA 2H57A 2I9PA 1ZL2A 1P0IA 3GT7A 1PJZA 3MK31 3MWFA 3AM5A 2Y9PB 3ANXA 3JWEA 3O21A 1CUGA 4FN4A 3EHEA 4RH1A 3VM6A 1L5QA 2XNSA 4KN9S 1BG6A 4ER6A 4LXYA 4Z3DA 1E2UA 4JJZA 4JJAA 4HGRA 3NRJA 3PUKA 4OUKX 1QDEA 2WP0A 3BAFA 3HP1A 5EP3A 2A9PA 1IEWA 1CUVA 2GKOA 2O2HA 1GPBA 5IFLA 4ICIA 4BFXA 1ZH4A 1XK6A 5DK4A 1BKYA 2IHJA 4DABA 3AHIA 1L3CA 2K87A 1UM8A 2PZMA 2WIDA 1ISGA 3P9YA 3PDIA 4J7XA 3VHXB 1UINA 3HEAA 1QZTA 1WW8A 5KSYA 3NTUA 5J40A 5BY2A 1A9QA 4GOXA 3R6TA 4W4TA 4FHFA 4TKLA 1Z4PX 1NP6A 1E1QD 1NI4A 3JD3A 2LNDA 3TH5A 2BGKA 4PFQA 1AQYA 1U6KA 3RSFA 3IKVA 2A5YB 1PNRA 1CY8A 3H05A 1RI3A 2GAIA 4JV5B 3BWDD 3AQIA 4DA7A 4D3XA 2TMYA 1JDNA 1OX5A 1C1DA 3HVIA 3MCWA 5A03A 4CKWB 1OYOA 4ZVOA 1NUQA 3WK9A 3KYIB 1TZMA 1L7OA 3FROA 1OA0A 3RE1A 3ADCA 4HVCA 3VHXA 2HSZA 1EZ4A 1BD4A 2QR2A 2WKRA 3KXPA 2EDCA 2JCXA 4PZZA 3V1MA 2PE5A 1EFLA 1P1BA 3JQCA 3I5UA 5U4QA 4MQUA 3RODA 3FY4A 2WF7A 3JTMA 3T12A 4B4VA 1DAOA 1UOQA 4BMNA 3A6LA 4DKXA 1USKA 2GF0A 4EG1A 2CXSA 3CA8A 4F46A 4QXOA 5ICCA 4BE4A 4X60A 5EFOA 2C88A 1YS6A 1NDQA 2MWMA 1EG7A 2ZQZA 4QUEA 3EC2A 1JJBA 1NF9A 3KSUA 3PJEA 5FBHA 5J59A 4AFNA 4BV8A 5BRAA 4C03A 1KI7A 2QTGA 2HIGA 5AOVA 2OE2A 4JP5A 4MKGA 3K4PA 3MUNA 1ISMA 5NLLA 3KJNA 4ZU6X 3FPBA 3OFSA 4IDOA 1KJQA 4UPVA 4YRDA 3JAKA 3OX4A 2MSDB 2PL3A 3AF5A 1W8DA 1QTQA 4LS3A 4OP2A 2XYRA 3SP1A 5E7IA 2VA8A 3C48A 1E1RA 3VO9A 1QYXA 4PNZA 1RLJA 2E49A 1IN6A 2NU6A 1X39A 2QPLA 2ZJ8A 4LKOA 4RKEA 4RE5A 2H65A 1GGJA 3GAAA 1A9RA 3IKMB 4JP3A 1F0KA 4R1NA 4RH0A 3OOJA 4HXFB 4B6GA 1T8TA 1CEQA 4BJHB 1C9KA 5IYZA 4HNAB 4K40A 4RZSA 1YL6A 5TJHA 4D5EA 4DCMA 2QGFA 4U6SA 2LBPA 4MJ3A 1H1LB 1G9SA 5C5CA 4AQYB 1CXZA 3LUJA 1XTBA 3L7KA 1DTEA 1EM8B 2V5UA 1QO0A 2ZR7A 1JPJA 4JFRA 3PHIA 4OXIA 1N2BA 2D1RA 1WUJS 4H7IA 3X1JA 1RM5A 3I62A 1DWOA 4I5FA 4UCXA 1Y3IA 2WV7A 1EUDA 1L2TA 4PC2A 3TVYA 5IRCD 1NJ1A 3JZAA 4JHXA 5KNDA 2ZUEA 3G23A 1QHHB 1XTZA 5E9WA 5KS2A 1BVYF 3FHCB 4EH1A 4HNAA 1D09A 3EXG1 1DG1G 2NZ2A 4N39A 1S0UA 2H63A 4D9MA 5I9NA 2IX9A 4X85A 3U3OA 1HEYA 4QTTB 6ADHA 3ABIA 4QBIA 2X0EA 2YMMA 4B3DA 4IG4A 4WA7A 3D6AA 3UFBA 4OOFA 2FG7C 4IIYA 1JR2A 1SZDA 4Z4FA 2QVXX 1L5LA 4ARZA 4Q4JA 4BWGA 1C1XA 1ECLA 2G25A 2CWDA 3OZEA 3HA3A 5G4LA 4MI9A 2JLBA 3KSAC 1XRMA 5T8KC 1MV8A 2ZIFA 1NQTA 3C6MA 1DRJA 4N0PA 4CKEB 3LSYA 4JA2A 4CJXA 1HQKA 1SUDA 2LWIA 4FYPA 4FHEA 1BW9B 4H3HB 2ACKA 3SF8B 4H7HA 3SQXA 3LOQA 4HOYA 2PZAA 4YTEA 2ZWIA 1ZIOA 4OF4A 2B4KA 2FSHA 3HBAA 4RUKA 3GAMA 3SZOA 2UYCA 2RGBA 2O1WA 3L8CA 2Z3WA 5K6TA 1E5VA 1QU3A 2AKEA 3K31A 1PDOA 3DVQX 3QHPA 1DO0A 1DMRA 1FL9A 1XTRA 4HWSA 4MW6A 1XK7A 3VPDA 1DQYA 1FFYA 4ZHQA 3RVDA 1ONSA 1ZRSA 1X7HA 3ER9A 4Y0VA 2WAXA 1JEYB 4GZLA 3NP9A 1D6SA 3QUQA 5F9FA 1NXOA 4UNNA 1YE5A 3EIEA 1OYVA 1TEXA 1ZCZA 4PTYA 4C4OA 3LUFA 3NEPX 4D98A 4UNRA 5FBLB 2AMYA 5L95A 1LNSA 1WKVA 2ZBQA 1FSFA 4MYDA 3RFUA 4DV5B 3ZI4A 2IXGA 2C1XA 1ACMA 2DLCX 5CK5A 3ZCRA 2EBWA 4DY4A 3SAJA 3QA9A 3LHSA 5IYZF 4GWKA 4YWJA 2BUCA 2WE7A 3LFHA 4QC2A 4B35A 1B1CA 1X92A 2DECA 4F72A 2AN3A 4ZQHA 2JFHA 4FE4A 1E3LA 1R4AA 2C5FA 3P9PA 4GPAA 5IVKA 3LUAA 2H7XA 1A8UA 3PUXA 4AW9A 4RY0A 4Y9RA 1Q6YA 2WJ6A 1VMDA 3UPTA 5CBPB 4BO7A 4ABTA 2CDCA 4L08A 2O7RA 2FUEA 5JG7A 3OZSA 1VJDA 2DBZA 1Y3HA 1C14A 1EQUA 3QE0A 2GO1A 4GX5A 5FIUA 2XB4A 4BECA 2K7FA 1K98A 1A5SB 1MZVA 2VJNA 1B6SA 2ZIUB 4X65B 1D2CA 2EKQA 2QROA 2XVZA 3NHFA 2ZVPX 3MLEA 1YVRA 1JSCA 4AS3A 4DTCA 1I13A 3FTNA 1OH6A 1GL3A 1P5RA 2ZYWX 3AF4A 4DLWA 2OUKA 4FCCA 4JIGA 4IH9A 4AJNA 3LC2O 3NWEA 1XCOA 3DXFA 5KWIA 3KSRA 4GQAA 3W8DA 2AG8A 2XUDA 4HB4A 4Z3OA 3B20A 1WOMA 1RLTA 4O8ZA 5KTTA 2O2IA 4O29A 1UP4A 1UPCA 1YJXA 4HQ0A 5LFAA 3QE9Y 1ODTC 2JAHA 2JD2A 1RDFA 1AKMA 3E22B 4CDRA 2D5AA 4D81A 4OLBA 2XQJA 1YOBA 2CJYA 3DLCA 1G18A 4QFMA 3HNRA 5K0BA 3IUMA 1K88A 1W4ZA 3L7IA 1JA1A 5LQSA 2YY7A 4FQ7A 1U7WA 3L7CA 2FPPA 2PSJA 1VB3A 3C6BA 3ZGNA 4LHXA 4YWHA 3K9HA 2JFQA 3AERB 4XWAA 4HWRA 3ZE9A 2Q99A 3A8TA 5HBGA 2D13A 2VTBB 4XJSA 2PMEA 4TV9B 3CZPA 1XZDA 1Z45A 1FW6A 2BFPA 5C4IA 3TMKA 3AHJA 2A35A 4M0KA 1QKJA 4AG6A 3HNOA 1F2TA 1UMKA 4ZHQF 2PTGA 1B7GO 2ZPTX 4GGOA 4N40A 1M2NA 5JDCA 3KM0A 4EKGA 1I6MA 3LF1A 4PPFA 5CM2Z 5BMVA 1CJSA 4PLTA 3AJRA 1BN6A 5HRAA 1I0ZA 1JV2B 2BFOA 4Y9SA 4N3NA 4G5HA 1MO3A 3A26A 4V0OA 5BP7A 1JLLA 4QG7A 1AU9A 3CUVA 1ZGJA 2ZBDA 1I4WA 1YDHA 4F4DA 5I3ZA 3ZDZB 5CDYA 4ZMRA 5KOHB 4MS1B 1YDFA 4HMOA 5LZ2A 4YV1A 4LNUA 1JDPA 3ETJA 3PLNA 2IHZA 5E2AA 3BIJA 1XN1A 4DSOA 2Q5EA 1SHJA 3GPIA 1N8NA 5FTKA 4C4SA 3BRWA 2ZJAA 3JARA 2VK1A 4I6GA 2G72A 5KKCA 1MABA 2NX2A 2DQKA 3QW4B 4OG2A 2C1ZA 2Y1XA 3R44A 1IJEA 3MUFA 4RKQA 3SX4A 3CJRA 4CLEA 3AEUA 3KQNA 1K66A 2X9QA 4IJUA 4YECA 4H27A 1QF6A 2FN3A 3EVTA 2EQ5A 4LJAA 3K8ZA 2A58A 3I92A 1F6BA 2COKA 5BQ3A 3H3XA 1E58A 1R64A 4L5AA 5E2IA 3SC2A 4DRZA 3PFWO 3VV3A 5K8UA 2X13A 1ISSA 4CETA 3EQZA 2JCGA 4J0DA 2JJYA 3M49A 1VCOA 4LV8B 5GMOA 3H2ZA 3QWAA 2HEIA 1CE8B 2WU3A 3KVVA 3P52A 5CVEA 3W5IA 3CIOA 1U0OC 2GM4A 5K3DA 3EW7A 3MAAC 1JXAA 3C8MA 2P9ZA 5IAOA 4JVMA 5C3UA 4DC0A 2UKDA 4AG5A 1W34A 3DHYA 2WIJA 3JQ8B 3K0CC 2YZGA 4YMWA 2HMYB 4OLFA 1NBOA 2NSJA 3UENA 3GLIE 1G7SA 2OV3A 4KJXA 2NLOA 4KDFA 2VT2A 4LDJA 4QT4A 3QKWA 1K9SA 1XQWA 3L4EA 4ZODA 4JL6A 5HFNA 1DOHA 1ZO8A 4TTPA 4DQ0A 4GRIA 3W6NA 4EY3A 3VH4A 5DNYB 3L9WA 5C81A 3J7TA 2GXAA 4QFBA 1W1WA 5ADWA 2UYQA 1XEWY 4H15A 1ILWA 3TW8B 1LBEA 1RYBA 2AN9A 3FW1A 4GI3A 1ZLXA 3DDWA 4P7JA 1ZGCA 1ZK2A 4XFJA 4B40A 3GJ8A 3EZGA 2LDXA 2FFAA 4YMLA 1XWFA 5JBIA 2FZCA 1SQGA 2ZSBA 2HPZA 3LT4A 3UF0A 5KB3A 1Z18A 3WGOA 3LT1A 2FTKE 1MAWA 3E1GA 3DAHA 3WZ2A 3RSSA 1Z13A 3BRCA 2VP0A 4FX2A 1FLAA 3DTYA 4E12A 4QG3A 3B6KA 1ORVA 2Q07A 2GVZC 1QORA 4P4SA 3DO6A 3UJPA 2C7PA 3QKTA 2XHZA 5BMVF 4F45A 4LA4A 4W8OA 4LCBA 1JTFA 3OFKA 1UKYA 4MTCA 2OZLA 1O0BA 3DPUA 3E3MA 1HWYA 3F4BA 5AUNB 3S1AB 4RY8A 4CTOA 1GAWA 4DLVA 1CR6A 1R0YA 1W87A 4MV7A 4Y67A 4B6EA 2C0CA 5A4IS 1UDWA 2PGDA 3OIGA 4MYCA 2FU5C 2IPAB 4C2AA 2NZVG 4JXXA 4LZZA 4URZR 2RH5A 3R7WB 4U2GA 3OEEA 2ASVA 3Q0IA 2P3SA 1T0HB 1DINA 1ZMXA 1PW5A 2BSAA 3OLZA 5CFRA 3NHUA 2CC2A 3KJIA 4M7PA 2IP2A 2O14A 4G0WA 3C87A 3I6QA 3FB4A 4DMUB 1O95C 1IXSB 3LY9A 4F5WA 4KDEA 5JD3A 3LDGA 4G0VA 1GNRA 3V46A 1E7WA 4XQ0A 2WQZA 5KI6A 1N5RA 4IEIA 4J0GA 3U7JA 3DQZA 3MBOA 3S2ZA 1LFDB 2ZUDA 3Q72A 4CF6A 3GVPA 1KMNA 2GEVA 4Q39A 3SJZA 3T35A 4F6LA 3UAOA 1XNHA 3CPEA 4O4HA 1ZM2A 4QGSA 2OGWA 3WMRA 1E8MA 4Z9BA 1NN1A 2AQKA 4OPMA 5JH7B 3WKCA 3LLCA 1E8DA 4D6PA 3I9OA 2AS0A 2RGWA 2SCUA 4IV0A 3RS7A 4JL5A 5EPOA 4C4XA 1LX6A 5EE3A 4KH1A 4FYHA 3QUSA 3EZ2A 1LXCA 3K9BA 3AR6A 2ORED 2ALJA 3PFNA 4WACA 1LDEA 3GFVA 5DLEA 4AIRA 4UCFA 4EMBA 5BYJA 4WK6A 1NBWB 5HJ5A 3NHPA 2ZTVA 1DXHA 4JN6B 5CXSA 1RMQA 1P45A 3SF8A 3T0GA 3TLXA 4AP5A 1MC1A 2CLEB 5ICGA 4H4CA 4WA8A 1YA6A 3O8CA 2VJMA 3R6LA 5H1YA 3U4DA 3ANNA 1P81A 2HHJA 2QSJA 3K8QA 2BEVB 2YV1A 3OPMA 1AIPA 4CEIB 1QQ6A 5IF3A 4QVIA 3BK2A 5DSZA 1J9GA 1KBQA 1JYEA 1OA1A 4BEJA 5K0SA 2VTBA 1HE8B 1N1DA 1QQ5A 2JA1A 4RLFA 4C7JA 2H4FA 1IVSA 4J4BA 3WX0A 1X8JA 2R5FA 5IKPA 2Q41A 4J03A 1LW7A 1IHOA 1CUYA 3SZRA 2L69A 4LDAA 1T5TA 2OWDA 2FFQA 3SXPA 4AP6A 2QRJA 3R9KA 1KQ3A 2A1TR 4ZCRA 5JZMA 4L74A 3E9QA 4D56A 2YHUA 2A0YA 1B2LA 3IGFA 3R77A 4TPKA 5AKZA 1T1EA 2QU8A 4X3PA 2EBUA 5H70A 2W8BB 3FTDA 4LZPA 2JH9A 3BH7A 3LNTA 3RUCA 1GVNB 3DWIA 2GUWA 4DXDA 3KVRA 5F7OA 4JVNA 3II6X 3HUTA 4BNHA 1PR2A 4R1MA 4G5YA 2QVBA 2C2HA 1G7TA 5TGZA 4OI4A 3C1TA 4XCVA 2EWVA 3QUCA 5FBRB 5JCPA 4QTYA 2QNRA 1EFVB 1Y7PA 3OZTA 4L5IA 5EE0A 2YIDA 1EBUA 2Q3HA 3H11A 5FBKA 2AFHB 3GRVA 1ISRA 3OQHA 1IQRA 4ABYA 3OX3A 5AKJA 3TK1A 5TGDA 2CXHA 3F2VA 1WLYA 3K8YA 1W8IA 1ZGHA 4L76A 3SHTA 3B2QA 4A27A 4AO7A 1GA4A 4LOLA 1FYVA 4LOKA 3TI7A 1KSGA 1H66A 1KRHA 3TZHA 1WEHA 1CF9A 3PNQA 3BF7A 1JIVA 3K0CA 5DX8A 1CUAA 2VNIA 4O4HF 4DF3A 4NJEA 2WAYA 4RTJA 3LQQA 1JIKA 4JCOA 2VQ3A 3JQ9C 3KPYA 3OFND 1EFVA 5A0FA 3RUFA 5JZVA 2UUAB 4G9GA 1TB4A 1NVVR 3GW8A 2GGSA 1XDGA 5CTJA 3R7LA 1L1QA 1H4SA 1XA3A 5DNEA 4PPQA 2BT4A 1WZCA 5HUQA 2OCGA 1FFCA 3DKIA 5GTDA 4YCAA 1HETA 4EHLA 4B3XA 1JUDA 1PYGA 4M8NE 2Z6UA 2BEUB 1NFQA 1VYUA 4O2BA 3C3DA 3IUSA 2HZBA 5J23A 4G65A 2F1JA 1ZOLA 3QJGA 4OQFA 4S2UA 4PWYA 4PSKA 1AVTA 1YHNA 2IT1A 2OD9A 3QF7A 1H3NA 2VHEA 4QDJA 4F4IA 1I94B 1U98A 1Z0UA 3V2GA 1KEZA 4WL0A 2C9DA 4G5FA 2JD0A 5EJFA 3ZLTA 3IBYA 3CLVA 1QH1B 4D41A 1BRMA 3PE4A 5F3DA 5A5FA 1WHTA 4Q3AA 4ZOAA 3TXXA 2HR1A 3DKKA 2OCLA 3IPLA 1JXOA 1T8UA 3DT9A 1V5EA 3JSXA 4M9QA 1LBHA 4R1QA 2BM1A 1QHSA 4OYRA 5F2EA 4EG3A 4ZDKA 2AC4A 2IU6A 3RYHA 4K6MA 5JSHA 3KQYA 4GU5A 2BM8A 4LZNA 3W06A 4TL8A 3QGMA 4BLRA 4QM7A 1ECPA 2IYOA 4JT4A 5AQEA 3SJAA 3UV3A 1ODSA 1O95A 2I1QA 4H1UA 4NIMA 1M0WA 4PO3X 4U7GA 5HILA 4FQ5A 4PPNA 3TLZA 5HF9A 4DMLA 4Z54A 2HI0A 1F6DA 1XQXA 3FWKA 2C04A 4GP7A 1KFJB 4UC0A 3DE5X 5U1PA 1US8A 1JWAB 2P5UA 3IRVA 3L1KA 2CNLA 4YCBA 5AQ1A 3Q3HA 1IH8A 3VMMA 2YW9A 4F11A 4CIAA 3ROTA 1Y6QA 3UB2A 4AM8A 4M4SA 4I4TA 1IZ8A 1Z6ZA 4OJQA 4BLQA 3HO8A 4YT2A 1SKMA 1Q0LA 1K27A 1JECA 4LZAA 4OH7A 1BWPA 4OHFA 4RW0A 3SKXA 3GU3A 2GBFA 3QBEA 1XJQA 3LQYA 1P1FA 4R3NA 4FGZA 4TOIA 4WSOA 3OESA 5EPUA 5AK3A 4ZT4A 2IEIA 3M9LA 2JRLA 3OIFA 5D85A 2B7LA 4D25A 3S8EA 3FWNA 4G63A 4NFLA 1GG5A 2JKVA 2X0KA 1SBZA 1ZZGA 4XSHA 2A1UB 1BE1A 2RH9B 4B81A 3TQSA 2X40A 2RD2A 3MJRA 2ADOA 1YQQA 4JT2A 1TU3A 2ZJ7A 2WZBA 4F5EA 3I6IA 2FRXA 3OPYB 3RK1A 2FEXA 2PKWA 1C30B 1WCWA 1D2AA 4TLBA 3N28A 5CA0B 1WU7A 2VF7A 4JXKA 5JRZA 3M5DA 1YVEI 5E3JA 1P3DA 3F6YA 3LBHA 3KLOA 3ESRA 3H0CA 4Z4QA 1WZNA 1F9EA 4BEVA 1BVHA 4DG5A 2Y0CA 1X0VA 4O2BF 4CDMA 4F1WA 2ZSEA 2W2XA 1XTIA 3RVPA 5CFMA 2ANBA 1ABFA 2OV8A 3COPA 3L1VA 1KOGA 2X15A 3V9AA 3X43A 2MMCA 3TW6A 4NWIA 1GITA 1KDPA 1SPXA 4LWPA 2FPKA 2PO5A 3AMVA 1XIVA 1YFKA 3N2GA 2FUG6 3OU2A 4J9VA 1M0SA 3OPYA 4NXMB 1V37A 2QP9X 3PR1A 2VAMA 3V8VA 1PT5A 3TMYA 3IJPA 3CWQA 1T91A 3IUEA 3FETA 4DJJA 4JAVC 1X8KA 1Y7IA 1Y1QA 2VNAA 3CE6A 4JVOA