5M34A

Structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
245
structure length
228
Chain Sequence
AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTYQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Change of a Tryptophan Residue in BtuF Facilitates Binding and Transport of Cobinamide by the Vitamin B12 Transporter BtuCD-F.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Vitamin B12-binding protein
total genus 80
structure length 228
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m34A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m34A02
4HN9A 3AESA 5KHLB 4ND8B 5KOHB 2PS9A 4FI3F 4WESA 5B58T 5KOHA 4LJSA 4B8YA 2R79A 3K1AA 2XH8A 2AFIB 4M7OA 4WZAA 4FNAA 3BE5A 3AERB 1H1LB 4G07A 4MLZA 4WZAB 4XPIB 5BVHB 3HH8A 1EFDN 3AERA 4LS3A 3TNYA 2Q8QA 3MWFA 4K3VA 4TKUB 1TOAA 3BE6A 4OXQA 2XY4A 1KAHA 1N4DA 4PAGA 3EIXA 3AEUB 2WI8A 3AEUA 2QI9F 2OV3A 2AFIA 3R5TA 5M29A 3AEKA 1KARA 5BVGA 1M1NA 1G21A 3AETA 4MDYA 3ZK9A 1N4AA 1K75A 1L5HB 1MIOA 5KOJA 3LHSA 4GICA 3MWGA 3AEKB 3NU1A 5BVGB 5JOQA 4HMQA 2PHZA 2AFHB 2YNMC 5GGYA 1PSZA 3TLKA 4H59A 1ESZA 4WZBB 4WNAB 5CX1B 4NNPA 4TKVB 1FP4B 1K7SN 2XDQB 3G9QA 3ZK7A 5JG7A 1K2VN 3ZK8A 4TKUA 3PSHA 3U7QA 1G21B 2O1EA 3PSAA 5CR9A 3GI1A 1QGUB 5FLYA 4G09A 5JPDA 2AFHA 1XVLA 5M34A 1G20A 4CL2A 3MFQA 4OXRA 2PRSA 4UDNA 4WNAA 1FP4A 2XDQA 1M34A 3CX3A 5I4KA 1H1LA 5BVHA 5CX1A 3U7QB 5JJ5A 2OSVA 3PDIB 4INPA 4ND8A 2XV1A 2MINA 3UJPA 4WESB 4FKMA 4HMOA 3HJTA 2M6KA 1N2CB 2PS0A 1M1NB 1M34B 3AETB 1KAEA 1MIOB 1L5HA 1N2CA 1QH8A 2M6LA 5KOJB 2ETVA 1M1YB 1G20B 1QH8B 2Q8PA 2OV1A 4WZBA 3HXPA 3AEQB 4IRMA 5HX7A 3R5SA 3PDIA 4DBLE 1N2ZA 4UTPA 4INOA 2X4LA 3AESB 2R7AA 5M3BA 3EIWA 2RG7A 4NNOA 4FILA 2MINB 1QGUA 3ZTTA 2WHYA 1QH1B 4PM4A 1M1YA 3ZKAA 3TEFA 3MINA 1QH1A 4UTOA 4N01A 5AFSA 1PQ4A 3K1AB 2OGWA 3MINB 4H0FA 5GGXA 4MX8A 3LI2A 4BBPA 3MD9A 4UDOA 2PS3A 5M2QA 4WN9A 5HDQA 1K0FA 2XUZA 4TKVA 4MO9A 3AEQA 4WN9B 4HMPA 2XQVA 2YNMD 4XPIA 4OVKA
chains in the Genus database with same CATH superfamily
4IV8A 2OYCA 1KO1A 2FFQA 2JH9A 3CLSC 3P2KA 5HYVA 5LP6F 1U2QA 4CL3A 1B8NA 4FGJA 1TD1A 3L0SA 1OH5A 1WTCA 1B6GA 4KPYA 1R5NA 3GUHA 3T1NA 1O96A 2PNFA 4XVCA 2JAOA 4IMJB 4OBBA 5JVDF 1IAVA 4GVPA 1DQRA 2O3QA 3LK7A 2YWRA 4IDGA 1EX9A 2BGUA 9ABPA 3A1VA 1Z0UA 3VR0A 1POXA 3QVTA 4PVDA 4G5QA 1VCNA 1EFDN 4WCFC 5DVZA 3FM9A 1PZGA 4H0CA 5JXJA 3FYTA 5JARA 4YMWA 4RFSA 3OSZA 4TOIA 2OD7A 3VHRA 1S2NA 5EYPA 3IQDB 3HYCA 5EHNA 4C1NA 4QIHA 4D9NA 4L5CA 4LMRA 3DAGA 3VO1A 5J4YA 3EISA 2D74A 2JK0A 4DR1B 2J0QA 2BPOA 2J5XA 3HTXA 1X7YB 2FPOA 1AG9A 2O2YA 5B7QA 4YMIA 1EA5A 4NMWA 4GOKA 4GLOA 1KTVA 4UTZA 4O3MA 3QTBA 4ZT4A 4YR9A 4A2CA 5JVDB 1GAJA 5J2TA 3QNWA 3A6GA 3HWSA 2JHAA 4MW0A 3EQ2A 1JB9A 4MQBA 4RY2A 3O9VA 3ZD9A 2CVFA 3KKPA 1UDWA 2DBQA 2O3TA 1B8PA 2P6OA 3AJDA 1K5DA 3EXIB 4KQFA 3KAKA 2R2GA 2CCJA 1MNAA 2HJWA 4F97A 2FOIA 3H9CA 5C53B 4QPDA 5JH7A 1UIMA 4QTYA 1W76A 1NP6A 4TLLB 3A9SA 1R4MA 2P4QA 1RR6A 4UDNA 3NYQA 4YAIA 1QYCA 2AXPA 3O4IA 3CNHA 5ALGA 1JXMA 2BTOA 1Q0RA 3IMGA 4QNNA 4B6JA 4J1TA 4BB0A 1QHXA 3PYLA 4HWKA 4C78A 4KIWA 4Y2QA 2IPOA 1A5AB 4YREA 1NF9A 1FBTA 4HDMB 4YBZA 1OMOA 4CTOA 2W2XA 5TVKA 1SO8A 5FORA 4J1NA 3ND8A 1N2XA 4GWKA 3A1CA 4KXMA 2HY7A 1EFVA 2PA3A 3H11B 4OQXA 4YR7A 3TTUA 4QJ4A 2A5FA 2QSZA 4REMA 4Q93A 1T2NA 4EUNA 3WLEA 3LX6A 4H0NA 1TAHA 4NDNE 3GLRA 5FNZA 3ZDEA 4FLEA 1QIEA 5BYKA 1IZ7A 4MS3A 2HCFA 5FBHA 1IOLA 4R1SA 2OV1A 3TM5A 3WYGA 5BSFA 5LB2A 5F9MA 1L7MA 4A91A 3N86A 3RUPA 3C70A 3QU7A 1AM4D 1Z7YA 4R31A 1PEAA 4H3VA 4R51A 2P9HA 3STYA 4KC0A 1S3GA 5GVSA 1QOPB 2BDUA 4NNOA 5DKFA 3ITKA 1FP2A 4DV5B 3P4YA 4JC8A 2WHYA 2X7XA 3A4IA 3MOGA 5EOVA 1D2CA 1L7QA 1WQ4A 3WNDA 3VJRA 1EUYA 1XDGA 2CXUA 1Y1PA 4TZKA 1QZ3A 3H5VA 5GGXA 4O4HB 2ZIUB 2PX4A 5IAJA 1US8B 2FDXA 1EFAA 1MR3F 1FLNA 2RJ3A 1G55A 3HB4X 3OQVA 4HI0E 4PO3X 3RVLA 3WYNA 4EG8A 4JC5A 2IJGX 1SHTX 3JD2A 1T0JB 2J32A 2GK6A 1OLSB 1TECE 2XE8A 1DC5A 2JFNA 3AB3A 3WICA 1WE2A 1IXYA 3LW8A 3C6XA 4BP3A 2XB8A 1HM5A 3EXFA 2AX4A 4TWAA 4RM2A 4ETMA 1Z3CA 2Y1XA 4WZAA 1TM3E 3T0IA 1HXHA 1ZPDA 3N6RA 4E7OA 2DHRA 2GARA 1FRFS 5HKKA 1V1JA 2DY0A 4HT3B 5JRZA 4S04A 1L3BA 1RJ9B 3PX7A 4TZ6A 2AL7A 4Y2HA 1RWVA 2AHOA 3V6LA 1NY6A 3K2EA 3ZI0A 3SQLA 3ESXA 3T4UA 5J2TB 1VSQA 2GDJA 4Q3DA 3UUGA 3PXUA 4RK5A 5DHUA 4ZC8A 2FSPA 2QPLA 2FUG1 2W2OA 2YHBA 2OV3A 3LY7A 3MEQA 4QU9A 1O6ZA 2B1GA 4KYUA 5L7TA 3FWYA 4W5OA 5EUQB 5K4AA 4B35A 1SHZA 4GXTA 4LZJA 1Z34A 3DJFA 2PHZA 3MJVA 2DVMA 3ELYA 1UL1X 1L5ZA 4IDCA 4TKVB 2PR7A 2YL2A 4H1UA 1Q7RA 4RMNA 4L78A 2N9UA 3AM5A 2AVDA 4P08A 2PL9A 3TJZA 2Q7XA 3NNDA 4NS1A 1FFHA 4MR9B 3HPRA 1UPAA 1UPCA 3O1HB 2I80A 5JD3A 4B33A 4O4HF 1UEIA 3KYIB 1TCCA 1V2GA 3D2CA 3C45A 1O54A 4FIDA 5EQFA 3MFQA 1Z39A 1HK7A 2X2EA 4WZZA 3BBPA 3RIGA 2N47A 3EIOA 3L8CA 3X1DA 5CA1B 3LYAA 4S35A 4CTJA 3BMQA 4BV9A 1IHDA 4MVWA 3T7CA 4PXAA 2ES4A 4X3OA 1H2XA 1N6PA 3GDHA 4HKTA 4F9FA 1PJTA 1ZGHA 3OUZA 1XTKA 3TDKA 1NL3A 1JQAA 2GHTA 2QMEA 1J23A 4YX9A 4D3SA 4I8XA 4GECA 1BE8A 1C0PA 4WT7A 3W3AD 1IDOA 3H2HA 1EP2B 1R4AA 3T35A 1JG3A 2HJHA 5CB4A 5IJ0B 4TWIA 3OOEA 4DRZA 1XD9A 4QGGA 4GFDA 1EIZA 4DLXA 3QMWA 5F78A 3K4QA 4G37A 1IM5A 4QL3A 1TLTA 1WU7A 4FBMA 3TLBA 1TO2E 3QWFA 4UVGA 2E48A 5KINB 1KGDA 3HKBB 3PGLA 4QDUA 2IYVA 2RG7A 2CXSA 4J0GA 4R8RA 1IQRA 1E59A 5KC8A 3WIVA 1XMOB 1XCMA 3C5VA 3QKRA 4ADSG 4F7WA 1R18A 3E23A 2Y1GA 2TSYB 4QATA 4MARA 4EPYA 5IZ4A 3B3FA 3F5FA 1Q95A 3UJNA 3KLBA 1R16A 4FGUA 1XGKA 1HQCA 3NBAA 3W06A 2Q6VA 2Q5CA 2YV1A 5LMCA 1ISFA 3G2OA 3KAQA 5C4MA 4JQZA 4MS1A 1A2QA 3PRHA 4MYTA 1MFPA 1Y9JA 2QY6A 2Y4OA 3ROTA 3VR2A 1JSZA 1O97D 2AMJA 5E4FA 5HJ5A 3ZGYA 2PZEA 1SCJA 4I3GA 1DBQA 2RI1A 1UADA 4NYIQ 5AUOB 2GO1A 1Q44A 1SCUA 5DTRA 1RM0A 5DW0A 3ZCTA 5TQVA 1K4YA 2XE6A 3ZWWA 1WMSA 4AO6A 3ENKA 4A6DA 3ENWA 4YWHA 5BUCA 5U4XA 1OHHA 5CDSA 2YXBA 4EVSA 1ZR4A 4UREA 5CA0F 4KX5A 5BVHB 2VNAA 5C5IA 4IP0A 4FGKA 1L5WA 3T9CA 1IN1A 2COEA 4HGOA 1QMPA 2QT9A 3CW2A 4YCBA 3KTDA 1TCUA 4UFNA 1VYUA 3S44A 1L4HA 1ZVKA 4H6VA 1AA9A 3BDAA 4G8BA 1QAMA 4ITRC 4OHZA 5CFZA 4HLUC 3CVYA 1VJTA 2C4TA 1CIPA 1OWOA 4FS3A 1OPRA 1QUEA 1QUFA 4R4JA 3PFIA 5A1TA 1X7DA 3H87A 3OETA 1PJQA 6PFKA 4B80A 3WAJA 3SVLA 4HH1A 3RFXA 3NPMA 5E0KB 3MJCA 2F7SA 1ESZA 1U02A 2FPXA 3MQFA 4J03A 1NVTA 4MCIA 4MWCA 1CY2A 4WBSA 4E12A 2D8AA 3DM5A 1VCMA 1O95D 3GUYA 4JSYA 2C7OA 4HQOA 4PZDA 2B7CA 4CG3A 3L0ZA 2J1LA 5DNEA 3VNVA 1GPJA 1PFGA 1UXHA 2FPLA 1LC3A 4MDHA 4XIJA 4EHBA 3E15A 2VNIA 3A3NA 2I87A 3AUYA 3DE4X 1Z74A 4GHWA 4IKPA 4LJ4A 3L2OB 2IVFA 3U7EB 4X20B 4TZTA 2W4IA 5EE3A 3VPBA 4F04A 1UJ4A 3GQVA 2WWHA 5KO2A 2YXDA 3PRKE 4OQYA 3PRYA 5HTOA 4RW0A 4NULA 1AJEA 3RUEA 3UICA 3S99A 1XRSB 3SYRA 4BLVA 5AOCA 2A1UA 3CE6A 3GJSA 3B9BA 1KBZA 3KQWA 1UMDA 1ZU4A 2EX4A 2OBNA 3DVAB 1KI6B 1QLJA 3LNTA 4LYAA 4PFJA 2H51A 5D85A 3E7DA 3CRW1 3LVRE 1QZXA 1W85B 2FEPA 1TW3A 2BMDA 2QRUA 2ZI6A 1HDCA 3AI3A 3ND9A 2NGRA 4QDKA 2FMUA 2FRDA 1ZIDA 1BXRB 1XFAA 4JMLA 3WHIA 3KYCA 4HR7A 3P0JA 1ENOA 3Q88A 3ZWMA 4CQLB 5JBIA 1ORVA 1F0YA 1U0EA 2QTCA 4L2IB 2F4NA 3I01M 1BN6A 4E11A 3JASA 4BNGA 2C4KA 1Z73A 4B44A 4MI6A 4TM8A 3UAYA 3CUKA 1BCRB 3LVQE 3U13A 2WSMA 1COZA 3I1IA 5FAKA 1GGMA 3PCRB 2QW0X 4HGQA 1WXXA 1M0SA 3O03A 4MJLA 3FOBA 3K6RA 1H0KA 4ACBA 2G17A 1XVAA 2NADA 2QPTA 1P4RA 1RHJA 3L18A 3NHLA 1VGQA 1ZK0A 1JT9A 2VCHA 1L9XA 5JMPA 3GBVA 5A5VA 5CT5A 2GEDA 3OCZA 1IN8A 1EBBA 1EGQA 3ETHA 2XGGA 3O8QA 1RCTE 4R7TA 4DF3A 1FS4A 3MA0A 3NOOA 4PAQA 3SK0A 5LPNA 1UP6A 2G4VA 1BS2A 2HMUA 2XAUA 3EVTA 4XDZA 3RBXA 2XB9A 2NSJA 3KTAB 3CZCA 5EFOA 1SWVA 3NHWA 5BQFA 1QE5A 2VH5R 3O4VA 5H59A 2FY8A 4NX2A 2NW6A 4RSGA 2BV3A 5ILGA 3QXXA 3CR7A 2QTFA 4KUHA 3LFTA 4MZXA 2R00C 1T3LA 4Q16A 3GLQA 4QXAA 2NU7B 2QVLA 2RBGA 1PVOA 3C3DA 3A6DA 1P29A 1U3DA 3GLTA 2F8LA 3F4BA 3QOFA 3OQJA 1DAOA 3TQQA 2GHQA 2BFPA 2FXIA 2P3OA 3EVZA 1RPAA 4P3KA 1WAMA 1DJOA 3PEEA 4EBFA 3A3OA 3O8NA 3SC4A 4L08A 4MQFB 1QC5B 4OHVA 2HB6A 1J4AA 2QUBA 3QELB 1L1RA 2O2XA 2VJKA 1E5XA 4UNQA 3EZ2A 1G6OA 2LPMA 4N39A 3RSFA 4JQYA 1FYEA 1J8DA 1M3SA 3MF4A 1YK0A 10MHA 1IHUA 4P4GA 4QNRA 1KZGB 2C4UA 4ZRMA 3A36A 7MDHA 1MN6A 3CCBA 4UUQA 1JQLB 4H1WA 1OX5A 4QLAA 3RS2A 2PVSA 3HR7A 1GPKA 3SMQA 2HDNB 1P44A 3RH0A 3E3NA 3LBAA 3G9QA 4P36A 3WISA 4C08A 1DBRA 1GZVA 4ZYUA 3ZCRA 1WXWA 3L05A 1OIWA 5AKXA 1K63A 3LQKA 2UVQA 1Y5NA 1CU1A 3D1JA 5KTTA 5GOTA 4PIPA 3QKWA 5ESWA 1O97C 4IBOA 2JGMA 3IMKA 4JR1A 2EYQA 2Q1SA 4RA9A 4TN1A 3UVEA 3Q9NA 4X0EA 3FZQA 1FMFA 2R8ZA 4KXNA 2OFFA 5DOVA 5HM6A 3IHKA 5LD2C 2UXDB 3SLGA 4D97A 4AJIA 4FTWA 1VCOA 2LKDA 2Q3MA 3EGXA 3U4HA 1C3EA 2ISSD 2WR8A 2WZDA 1ZICA 2JJ2D 2ONCA 4QAQA 4C07A 4L5BA 1KU0A 2NUTB 5A3SA 3FCOA 3R8XA 1ZD8A 3RVOA 1W48A 5LP6B 1LPOA 1KK1A 1XIVA 2YRWA 3BDVA 4R98A 1ZL2A 1I01A 4IRUB 4UU7A 4IDBA 1UBUS 3HYLA 3G5UA 4J0HA 3F3SA 2O1WA 4L6IA 1YAJA 4CEIA 4PYMA 2QBYA 1BDMA 5GM2A 2XGMA 1D5CA 1U0FA 1SUEA 1NMEA 3IUEA 5JCZA 4PG4A 3OLYA 3UUWA 4ZOCA 1R0SA 2PGIA 3Q3HA 4P3YA 3AM4A 3RW9A 4CNQA 3KWJA 1K6MA 1Q92A 1ENYA 2Y0DA 2G6TA 5FO0A 3AVQA 1PGJA 3KQVA 4FKZA 3IPXA 4QOSA 5DWQA 5CIWA 2OBBA 3PRJA 4G24A 4W5WA 5I4CA 1X8LA 3SBEA 3VNRA 1XMSA 4NAVA 1C3XA 1EUCA 1WXFA 1AQYA 2A1TR 2IGBA 3GVHA 3NHFA 2WG0A 1GR1A 3CH4B 4KVGA 3U56A 4PLGA 1SB8A 3NAMA 3ONFA 2ROQA 3GEDA 2PO5A 1KIMA 2ZJ7A 4M1EA 1FW8A 3IEKA 2GEKA 4EGJA 4IGAA 1ID1A 1S3SA 2AI3A 4HWGA 4IIDA 3GVPA 1I5RA 2H8GA 4RO0A 4AYXA 4D4IA 4LFCB 5AKJA 5B4VA 5LMNB 4FZ3A 4AUMA 2PUTA 2ZQZA 3EUEA 3PEVA 4IIYA 1UEJA 4F84A 3DL4A 4JOSA 1Z7WA 2PT7A 5DXJA 1JEJA 3D8NA 4KR3A 1BTOA 1YU6A 2WUFA 2J7KA 1CUIA 1YOBA 3PGKA 1ZM3A 2WVGA 2CNWD 5EYPB 2IYFA 4B5LA 3AV0B 5T3UA 2PZMA 2GD6A 2ZJ3A 1DBVO 4LE0A 4M21A 3B3JA 4R6WA 3TGWA 4RC9A 4BAZA 1SOWA 2LCFA 2BCJQ 1M75A 2FQWA 2IKSA 2W9XA 4BNKA 4J76A 1ODTC 5C4IA 1JYFA 5IDWA 1P6QA 5BOSA 3PHCA 1VMIA 3WZLA 4RTKA 4YRZA 5CHEA 1J8FA 3VHXB 2JFFA 1EBFA 3ET5A 5FD8A 4B7AA 2RSLA 3T3NA 4PC1A 5FNVA 1SUIA 1ZCAA 3NTUA 3D2LA 2WT8A 1CJMA 5CXQA 2VDKB 3U9LA 3CX8A 3GFOA 2R65A 1GWNA 1BS1A 3F1KA 1L7NA 2W6IA 5C7LO 4LGCA 4HMQA 1SQ0A 5C3UA 1KJNA 3KZKA 3E5RA 3TWOA 4W7SA 3WDKA 1LVUA 4UQPA 2CV2A 4MIEA 3VNBA 3PNYA 2O0MA 4GKVA 1KQ3A 4BGEA 2M6RA 3W6NA 5BW6B 4DFDA 4TKUA 3ILXA 3SZOA 5KNDA 2I2AA 4E94A 2R1TB 4GZ5A 2EWMA 4Y2YA 1UM9A 1LF5A 2DXIA 1N0WA 3G8BA 1YR6A 2ZPUA 1C7RA 5AJUA 1LU9A 3ZEIA 1SIOA 4D3DA 2WFAA 5C7OO 2IDKA 2QBYB 2HJ9A 4CGYA 4FDVA 2NX2A 4WRRA 5J58A 2OAGA 1JPNA 2FG7C 1F17A 5L6LB 4BWYA 2ZIGA 2AQ8A 1T91A 3PT9A 4XEUA 3GZ4A 1EWRA 2LWIA 5LDHA 5MN6A 4CQNA 3WRWA 5JJ5A 1MAVA 2XYHA 3IX7A 4QSMA 5ERXA 3KB8A 1BQ3A 3F6SA 1H2YA 4HH0A 2I7DA 1IQ0A 2ZRNA 3JYHA 4IX9A 1V35A 4LYDA 1KKUA 3EN0A 4OREX 1BD4A 3ZJVA 2IYSA 4P32A 4LGMA 1UWVA 3H5IA 4OV6B 4RACA 3G49A 1NP7A 3NEJA 2HOQA 3HUEA 4KYTA 4QLBA 4TT8A 1B2LA 2F59A 1ECLA 1RJDA 2HX1A 2CYCA 4X45A 3PEFA 1HQDA 1XD2A 2DPLA 4OGLA 1A9ZA 1D09A 1T9ZA 1ZOIA 3LIPA 4GRDA 1HDZA 2HCRA 4NBVA 3WE7A 5FP0A 3E5NA 3UGJA 4JV5B 1KH1A 2BZ1A 1ZSVA 3AR6A 3BN3A 5B1HA 4CETA 2RIPA 3BE8A 4JJ7A 3F73A 3G0HA 3VYVA 1U0TA 1TYEB 2V5AA 5L40A 5KYGA 1P4SA 3GROA 3BIFA 1ZMTA 3K35A 4KLRA 1X7XB 4Q3LA 5AHKA 4E4TA 1BC5A 4QQNA 1NDUA 3FBGA 4O2AF 3LHKA 4PW0A 4UMFA 1X1EA 4MUFA 2OBMA 2R00A 3L7BA 1EUZA 3IJRA 1XMVA 3MWJA 3V4OA 4ZI7F 3KETA 3I9FA 3JWHA 4YHBA 2PQMA 2OQRA 4IUYA 1IOVA 2GCPA 5CA1A 3B13B 3MIIA 4MO9A 3KP1A 5JLAA 1NFRA 5JRDS 2PKYX 2VBFA 2X9NA 2L19A 3NAZA 1MMFB 4FMPA 1S5PA 3AXSA 3FPJA 4FFWA 2UUOA 3MBIA 1VJRA 4FW9A 1N57A 4LRSB 4P31A 4ETWA 5IDYA 3WLHA 2H9YA 1L8XA 5CFMA 4Q4LA 1TJPB 3I83A 2CMHA 4C05A 3V4PB 1BW9A 3D3WA 3DZDA 1FNMA 3O4FA 2QTAA 5CVJA 5F5LA 4B83A 3PQ7A 2BEVA 4BN5A 3ZV7A 1J2YA 5ESXA 3HR4A 2UXCB 5K99A 1N8NA 3RROA 1U94A 1P31A 2DFKB 1BA2A 1P7YA 1UMBA 3KXKA 3UV3A 3Q2KA 1WZ2A 4NESA 3BGVA 3H2BA 3LGXA 1EXVA 3TG8A 2QJOA 1RKQA 4W5HA 5CCDA 1KAHA 3U3DA 5DISB 2R97A 1RADA 1CR2A 1JMVA 1ONBA 3D4LA 3MXTA 4I6JA 5D8DA 2MR6A 4HDCA 4C0WA 4D81A 4EUEA 4QELA 4YJ3A 4HB2A 3ZXIA 1GKLA 3KEOA 3ZJUA 4MDFA 1YUBA 3ADPA 3GBSA 3PX3A 2H18A 3WOVA 2P9JA 3ROFA 3GPBA 4AP5A 1RZRA 1JTVA 1E4YA 2ZE6A 3CX6A 3PQCA 4MWZA 4LSWA 1M6YA 4JOQA 1DWOA 1G3UA 2WVAA 5IAKA 1SOAA 2QT0A 2HLNA 3IPYA 4HEJA 3RS0A 3N2ZB 2IDJA 1E9FA 1N6HA 2FFHA 3VTAA 1MD9A 5KB3A 2HADA 3BMQB 4KH0A 3SHVA 1OLOA 3HL0A 5E8JA 5A5FA 3E53A 2YQZA 4C4ZA 2VTVA 1PR5A 3HFRA 3GPIA 4EG6A 1E8DA 4HF7A 4QYMA 4RV5A 3ZOZA 5KOYA 5AICA 3KQYA 4C5BA 3FF4A 1BYUA 1X6VA 4MRMA 4BFZA 1J2JA 5B2EA 5HKKD 4BGIA 2Q2VA 1HGXA 4W7IA 5A3QA 2VHQA 4OK3A 1JGTA 1GHTA 2C5GA 2HYDA 3CFYA 3NKLA 4Y6LA 3IQEA 2PPLA 2Q5HA 2J5RA 4COKA 3ML1A 1UWLA 1LS1A 1NOIA 1VB5A 1P5RA 2Q28A 4XLLA 5F64A 4GYWA 5HJ2A 3W7AA 1LI5A 2ZRQA 1W30A 3H8SA 1E2UA 4LOJA 4TLEA 1WU8A 3U37A 4NV3A 1KETA 4NFSA 2A0UA 4KTTE 4I55B 4YPOA 2P3LA 1SUDA 1TQ4A 1NVXQ 3K9WA 4D4MA 4NJMA 3AVTA 1SM4A 3V4LA 5L7WA 5K3OA 2GM9A 2H2WA 4KQXA 2MU1A 3HQ4O 5DHTA 2CBGA 1PFWA 2HUPA 4DARA 4II7A 2XMDA 4DJEC 1NI4A 3V8QA 3ZV5A 3GVXA 2OGSA 1KYVA 2OBLA 5K8CA 5KQLA 4LF4B 4PCVA 1T36A 4XIIA 3WQSB 3B6ZA 4Q3NA 3FUCA 4X93A 2JLZA 1YJCA 4L50A 3EFOA 1TGYA 3BJIC 1TZJA 2Y1WA 1KZ6A 3GFPA 1JFFB 1ZD4A 4XSVA 4XJXA 3WIEA 4WNYA 3H1EA 3AFHA 1OYYA 3FVTA 3I61A 1B6TA 2KBEA 1KYQA 1E2NA 2VQ6A 1WSAA 4OJNA 4IVRA 3TFQA 5A1JA 1SEPA 3D4OA 4CUKA 4CT0A 1K7EB 2IITA 3G5MA 2XXJA 4F5YA 2I22A 2QROA 5U1PA 1SVMA 1UPBA 4REOA 3H0CA 4K9MA 4PN3A 1EE2A 3HPQA 1M6WA 4QDXA 1CPYA 5EGNA 4Y9UA 5DGHA 2FZ4A 4X63A 4BX8A 3OM8A 4EHHA 3UBTA 1LSSA 4MA5A 2J0EA 1RBZA 3LV8A 4O8ZA 4UM7A 1CQJA 1GTG1 4U0JA 3CLSD 3BWDD 1V6CA 1RNLA 1J90A 3A1TA 3AG5A 3AKDA 3I28A 3IHTA 3LC2O 3K9GA 3LL7A 3KHKA 2WSIA 1K7XB 2QTLA 4FZVA 1GRNA 2EJVA 4LY3A 3EGDA 3K94A 1ULZA 3WKCA 1BH2A 5AD1A 1XPRA 1K2WA 1UKBA 2JA2A 4U2DA 4WBNF 2QVYX 3ZJTA 4K3VA 1YVEI 1EAMA 2JFUA 3BSFA 4HAVA 4V3CA 4EGCB 3LP8A 2PMCA 2QJWA 4GF5A 4PAGA 2Z2IA 2GBIA 3QRWA 4LVUA 3MTIA 2AFIA 4CU2A 3K8ZA 1AS2A 2GZAA 2QTZA 3LUDA 3AHCA 1SOMA 4F3RA 5LBTA 3BKWA 2RHHA 5ALZA 3ODPA 3RVDA 1R10A 4EITA 2XLCA 4WZBB 4EPTA 4LPSA 1CQPA 2BFEA 2O7RA 3KHUA 3OCXA 3NFRA 2ZRPA 4JLJA 1HR0B 3W2EA 2ZSIA 4J91A 2A5GA 4C87A 2QZPA 2H85A 4F71A 1QIFA 1M2OB 3KL2A 1JJ7A 2P8SA 3CPSA 1JIUA 5REQA 1JDZA 3D7KA 1VLMA 3I30X 1G5RA 4GRIA 2PMEA 1GVHA 5FLYA 5TGZA 1S8NA 4ZHQF 2FFBA 3W1VA 3SF8B 4AL4A 5CVTA 2D2XA 1E3LA 1MB2A 4CF3A 3PQEA 3IHWA 1BMFA 1LJLA 4R3NA 4DTCA 4ZMRA 2CGEA 2XVAA 3ZJYA 4YP7A 1IATA 4BMYA 2VPPA 1TB4A 3LA8A 4KMOA 5EWMB 3GD7A 3E1KA 5I9LA 2AOWA 3BK7A 5T5QA 4FFMA 2GN4A 4F8JA 4CLEA 3FHTA 2AJCA 1MQ9A 3E9QA 3CVXA 4O63O 1YDWA 1B42A 3GLHA 1N2CB 2QVGA 3Q3JB 3MT7A 1XC7A 5DNWA 1RLOA 3UH1A 3IVCA 4MS3B 2FJPA 4R8KA 1QP7A 3CUYA 5BSUA 4AO8A 3FYUA 2A88A 2GTPA 4U6SA 1M1ZA 4YH1A 5KX5A 1OWLA 1JE0A 4UVIA 2QTBA 1JJAA 1RXVA 4K6FA 5BYJA 1KY4A 3EB9A 3TS1A 1L5GB 3M1AA 3GHYA 4EHAA 4NE9A 1A7KA 3V4ZA 4A0HA 1CUJA 1PR1A 3BS4A 3LLVA 1X19A 1FTSA 3AC0A 2I8CA 3GFVA 4LOIA 2WKSA 2L2QA 3NDRA 1A5BB 1BWQA 1E9DA 1Y8RB 2PV0A 4MH0R 4U7JA 1T15A 3OY7A 1V6SA 1SXPA 1D2EA 4S0ZA 2PZJA 3ABIA 2Z9CA 3OE5A 1Z2DA 3R1IA 5E8RA 3RM3A 1Y6GA 4BTVA 2EGUA 5AKHA 1CR0A 2XUJA 1XVIA 3HLKA 3PGXA 2P4HX 1NXSA 1PR6A 4NU8X 4DVJA 1WW8A 2J87A 3TR5A 3IQFA 1OLSA 3ED5A 5H4GA 2QUJA 4MJ7A 4QGSA 3THRA 4JJ4A 3ANMA 3OFKA 4ROSA 4GR5A 2B5WA 1U1GA 1CF9A 3IERA 4HVTA 5A9TA 4XARA 3QXSA 2PRJA 4HZIA 1KSGA 3TQIA 4C0HA 3DBVO 5K4GA 3GJ6A 4YWJA 2Q3LA 3N39C 4DCNA 3U4CA 4OH1A 4DS3A 3VJMA 2ZAMA 3D6MA 1HTBA 2BMWA 1HORA 4MULA 3UHJA 5H8WA 5BPHA 4WK0B 2Z0MA 4GKBA 3EEYA 2A9KA 4S1WA 5T41A 3D9QX 3GEMA 4I2NA 4IOKA 1VYVA 4ZODA 3WNVA 3BK1A 4DLAA 3P5BA 1FLDA 3UA4A 5FX2A 3I3SR 4O0MA 2JH3A 2QF7A 1JR6A 1SXGA 1ZD3A 2QDXA 4WZAE 1XA0A 1FDWA 3K8YA 4B2LA 4B48A 3OBBA 1SD1A 4RQTA 3FVQA 4R2JA 1PNTA 3ECAA 3F4LA 4QA9A 5TJHA 2H3EA 1HO3A 2BUAA 2Y0PA 3L0YA 1W4AA 4Z3DA 5CGZA 4ARSA 4CT4B 5BP7A 2ODTX 2AFHE 4PYIA 1Z15A 2BM9A 4LHSA 5EQTA 1TXGA 2OTCA 4DRXB 5JS7A 1II0A 5BNTA 4B84A 4MR9A 2PGXA 3A4YA 5EFZA 4ZDWA 1N2SA 4EB3A 4QARA 1G63A 2FCRA 4QNMA 3E48A 3OJXA 2ORVA 2VYQA 4Y9DA 3C1UA 3PE4A 3EZLA 4A10A 5J4VA 4IUBS 1GRCA 1SB9A 1XZBA 1PLJA 3BA1A 4L6AA 4UAGA 3LK6A 4HQ6A 2O4UX 3PFNA 2HK9A 4HXYA 4IQGA 4FN5A 5I3ZA 5HRUA 1UANA 1E7WA 4M89A 3TTTA 4CKCB 2HT6A 4I08A 2O50A 2ZG6A 4O4LB 4PLTA 3I52A 4DA4A 3T52A 1JXQA 1H2RS 3I0ZA 1J25A 5CX1A 4GRAA 1H9BA 2VP4A 3VPDA 4LXTA 1JFLA 3EYWA 3GLIA 3TZBA 4FFRA 2BSQA 3IEVA 4ND8A 1RFGE 1P4HA 1T8YA 1YCFA 3TL2A 3SXUA 3SVTA 4WADA 3HXQA 3LO5A 4C4YA 4B3CA 2J9FB 2W90A 3TX2A 4TSFD 3C4JA 4DPKA 4P4SB 4XCQA 2CF5A 1QKJA 1JU4A 1KI3A 1CY4A 3H2KA 4DJJA 1NBIA 5KYXB 3HP4A 1I3CA 3WL5A 3RHFA 2B1IA 4N12A 1C1HA 1WETA 2O8FB 4HAUA 5FOVA 3K8OE 1N3LA 1SGWA 1U0HC 2V59A 2ZT8A 3IKVA 3EDMA 5B3KA 2FSGA 3HG7A 4ZK6A 3L0OA 5B36A 3UMGA 4AMBA 3GUVA 3UJ7A 5I51A 2Q1WA 3JQFC 5E6UA 4ZT6A 3AVXA 4H16A 2YMQA 2Z9DA 2FFAA 2W6QA 1HSZA 1WUJS 3BVPA 3NATA 3U4QB 1X2EA 2VUHB 5EE9A 4HYYA 2X40A 3E9DA 1M54A 5JS6A 1ANKA 3GR6A 1R4NB 1UT8A 4O1IA 4JMPA 5JY1A 4KL8S 3AVOA 3VDNB 1JEQB 4EFKA 4W1SA 1RXWA 4AS1A 1YI8A 1II8A 2ACEA 1IE3A 3IVRA 4K8RB 1U4NA 4DL9A 2Q9BA 4JP2A 3C74A 3MRVA 1Z4PX 2NN3C 4E07A 1K3FA 1YWGO 1NQ5A 2FR8C 1UDXA 3JYOA 3NBZC 2P27A 2GPNA 2QGFA 4A0RA 1XD8A 3EIQA 4KQ9A 4JQSA 1HDGO 4RMIA 2ZTVA 1PG0A 4QPZA 4BNXA 1Y9EA 3K9HA 2UDPA 1NC1A 2CNOA 1X1TA 1IU9A 2L82A 2R79A 4Y9TA 3WLTA 4F11A 4BYGA 3AUUA 2PJZA 4ZQEA 3QU4A 4KWIA 3T3IA 5C81A 4NIMA 1Z8NA 3R0QA 1UWCA 3L4SO 1RCUA 2ZYVX 3G85A 3ELBA 1FIUA 3LJKA 3IUSA 1U80A 1UJ6A 2OESA 3PQ6A 4N6OA 3Q7QA 4NZMA 1DIBA 2JJ1A 4O4JA 4LYYA 5CNIA 3ROQA 1TAQA 3CB4A 4FD2A 1DI0A 4A1OA 4CTKA 3GPLA 2XY4A 3T9DA 4A0FA 5A2GA 1EB8A 1GT6A 3VHLB 3LLUA 3DEKA 4D9MA 2PH5A 2FK7A 1OXUA 3MCWA 2HREA 2GB4A 1G7CA 1GDDA 5KDDA 1Q0PA 2QV0A 4DDMA 3UWOA 4DE5A 5BVGB 4R41A 3RUDA 2SKCA 2PD6A 3QG5A 2C4VA 3E9EA 1ZD5A 3O8OA 3TJRA 5C1PA 1YS7A 7ADHA 2YASA 4HEA6 4LTDA 1CQZA 1OXVA 4ZQBA 1P62B 4CKCA 3A9TA 1U3CA 3F90A 1VCIA 4D4LA 3I6QA 2QTVB 1BKDR 3NRBA 4F3CA 3HJGA 2CDNA 4YCLA 1TYBE 1NA5A 1QQ6A 2QLBA 3T8YA 1KRHA 1TVCA 1ZGBA 1I13A 4D9JA 4GBMA 1UAYA 1RI3A 1WXIA 3INTA 2MSLA 5E3IA 3BJZA 4RK4A 2V65A 4E08A 2G4LA 5LBUA 1U6JA 3LYUA 5E3HA 1RFLA 2NSLA 2HAEA 2XYGA 4MUXA 1ILEA 3HJFA 4N48A 2QSUA 2PRSA 4R7ZA 4GKKB 1AHIA 3E3LA 4ILKA 5B53A 2HMVA 3CS3A 5ARDA 4MEBA 4W99A 4M9RA 1X92A 1OYWA 3FYUC 4NBSA 3W1WA 1UKCA 4R2XA 5AXBA 4BMDA 1EYZA 4Z7JA 5HPYB 1BEZA 4WW0A 1DWPA 1G5TA 2NYVA 1A8UA 4DWWA 3NP9A 3UHFA 1SD5A 4D6XA 5G0SA 4NFYA 5JSHA 1Y8QB 4GAEA 1J0CA 2OXRA 4MPPA 5ERYA 2AJTA 2D0PB 3HU3A 3RVRA 2XNSA 4EJSC 5CEEA 2WSSA 3AKCA 3KE8A 4EW1A 4ENSA 1B3BA 4U8HA 2PSJA 3L7JA 4MLDA 3E27A 3RBZA 3SJAA 4DXAA 1OPXA 4LCEA 3AYZB 4UHBA 5GJCA 4EVQA 4Z4CA 1EFCA 2R6CA 2VNSA 3IH5A 1JR3A 3R5SA 5LMUB 5EHQA 4IOJA 3UCXA 1T3ZA 2AE1A 2KYRA 3QLJA 3NYRA 3O3CA 5FF9A 1X87A 3M6XA 5CVEA 3SIRA 1E9AA 1SHLA 2POCA 1QCCA 2AG1A 3V2HA 1TTTA 2EKPA 5DYIA 1KWKA 2I0FA 4KQWA 1FRVA 421PA 4ZI7A 3TNLA 5EXPA 521PA 2ZUWA 1J70A 1SA0B 5EIBD 4FEEA 4MRMB 1N2OA 2CLOB 1I1HA 5EI5A 1BU8A 2R6HA 3GRFA 1XTSA 4BFLA 1EUDA 1YFZA 4X1KB 1IXRC 2P6UA 1QRRA 4WUTA 4INJA 2OHGA 3JQ7B 4D80A 2ZIEA 5KNCA 2CE7A 4KMSA 1I30A 3Q9LA 3FUXA 5EIHA 3I2FA 3QYPA 2DEUA 3H5RA 2OECA 4XIGS 1XZEA 2VQ3A 4XPZA 5LYYA 4C0BA 1Y1TA 1K8ZB 2O48X 3CLRD 5EXXA 3UJBA 2AZMA 2GN0A 4W8GA 2VK8A 3WIUA 1FJGB 3CCCA 3PNQA 1P0IA 5E7QA 1YKFA 5HE9A 3N28A 5BSWA 1KORA 5AH0A 3W2FA 3F9CA 4MRPA 4Q7EA 4M86A 3CVOA 4JKIA 3VVMA 1MG0A 3GY0A 4P98A 1G98A 2C7PA 1Y5MA 1U0SY 4UBNA 4RTOA 1HZZA 3QE9Y 1SH7A 1UKZA 2QN8A 4IJ5A 1UQRA 1NZFA 3I04A 3OPXA 3OKCA 3LRXA 1NAHA 1U2ZA 3D6JA 3VR4D 3X1YA 1I1NA 4A2WA 4F46A 2VQFB 3D0OA 2CHQA 1DMRA 3H05A 3LC1O 2ZKIA 3USZA 1V1RA 2OB2A 1OAKA 1VL1A 4OMFG 3CZMA 3L4EA 3KLMX 3GEEA 3GP3A 5SY4A 5KOIA 3H65A 1TQ8A 2BFDA 1ZGJA 5CJ2A 3B1YA 1XEFA 1QF9A 2IP2A 5ILQA 1QCDA 1SBIA 5I9SA 3WMRA 3WSVA 5JZ9A 3C6BA 3GGCA 2PVCA 1XWIA 3FUVA 1JG2A 4IJQA 3ZYZA 3WLFA 2B0CA 4BVKA 4LZAA 2HXYA 4O2RA 3O84A 2JAXA 4FUQA 2VJNA 4MYRA 1GPNA 4FEGA 4FNMA 5ABPA 1SC4A 1Y7LA 3V97A 4BNJA 4IGIA 1DT5A 1OH8A 1YZ3A 1BFUA 2PWYA 4ZO8A 3E7XA 2QR5A 2B30A 5CCXA 3ZDDA 1M8GA 2BE7A 2YY6A 1AZTA 2ZANA 2IUUA 1WHTB 3E1SA 2YMMA 3RBVA 3U3MA 5LLDA 3ZVNA 3H1AA 4G1MB 4JLAA 3LWDA 1TAGA 2M1ZA 2BYTA 2ZI3A 2CLFB 1CLUA 2HHCA 3HEBA 4AI6A 3PGVA 2X4IA 1NU6A 3NFYA 2WJIA 3TRDA 2GFIA 3IALA 4G5SA 4D8YA 4YUZA 2XCTB 1PR9A 2OZVA 2VLBA 1E8NA 2AC2A 3OZAA 1FE8A 1YI0A 5J23A 1E3IA 2C9OA 1L4EA 4UBMA 2ECKA 4KBGA 4JR2A 1BO6A 5LSAA 2H4WA 3CJRA 1E3SA 4R2HA 5C32A 1QRAA 2EP5A 1G0OA 2BJHA 5GM1A 4Q6WA 2QRLA 1HE4A 2BF4A 1G2OA 2IU6A 2WDPA 1QH8B 3N0TA 3SQWA 2AMYA 3ABOB 5JYBA 2G9UA 4YTEA 3DBOB 1OTYA 2C5EA 3B5EA 2K2QB 4L27A 1E2IA 1OKKA 4P7BA 4XM1A 5DM4A 5FT9A 3T1QA 4RXTA 1GA1A 2Y1DA 3IB6A 1K7YA 3OOJA 1S8FA 2ZBVA 2ZSBA 3OE7A 4H7EA 4MQEB 1W36D 1XNQB 5H3CA 5LLTA 2DRIA 1SKYB 3K0AA 1JBKA 2Q1YA 4FILA 4KJXA 4R83A 3RUIA 3T41A 3QV2A 4ZYLA 3MBKA 1I7QB 1XXLA 2PV7A 1G8FA 2XCLA 5A4DA 2H7XA 5KYTA 5JNSA 3FETA 4QUJA 4HRAA 4EFDA 4NZOA 4BAGA 2D5AA 5AOBA 2EQ5A 4I1RA 2MSWA 4RTRA 3OTQA 3OQNA 1XTUA 5HEKA 5H7XA 3IEPA 1E1RD 4LXHA 5F5NA 1A8HA 1R0KA 4ENTA 4DV4B 5J2UF 3I62A 1RAIA 3TLYA 5AW0A 2P9EA 3VDQA 3L4BC 4P6VF 4F6LA 1FDUA 4OLJA 2DUUA 1XQ9A 1ESMA 1H8ED 2QHXA 3GJQA 4OGKA 4B75A 4E5DA 1R5OA 2JG3A 4Q7JB 1GNTA 2O5RA 5K51A 4RK0A 2PH3A 1BMDA 1YS2X 5ANRB 2VT3A 4K1XA 2ZJ8A 4BZXA 1CUBA 2B9VA 4OP2A 5D5PA 4TQAA 4EENA 5KYYB 4XRRA 1OXMA 1J0AA 2JIQA 1UBCA 3QFHA 4M38A 1RI5A 4KH1A 5SY9A 1JIXA 4B6EA 1LLUA 5FNVB 4BNWA 4DANA 1HDRA 3DF7A 1IOZA 3Q8KA 2CNLA 1B7GO 1SULA 5CYGA 3F47A 5DX1A 2BHSA 2PJUA 4B87A 5H9VA 5E2BA 3WMWA 2OZLB 1O5TA 2FP4A 3R9WA 1U8TA 2OFOA 3MJ4A 4HYQA 3GG9A 5A4MS 2EGHA 1CY7A 4WK4B 1FX0B 1JG4A 1PSZA 4HDNB 4E0BA 3HKCB 4ALKA 1GJRA 1I9CA 1RRGA 4DIDA 4PV7A 2ZVPX 1VI5A 3H83A 4QHYA 4EYQA 5IF3A 3EIHA 5JRJA 4HGPA 3ECCA 4TTSA 3GDFA 2ODWA 3CWZA 3QOYA 5EQDA 3NBUA 2BBOA 5L45A 3KXIA 3MMXA 3BEOA 4N4AA 3TNJA 5JNVA 1ZP6A 2IEAA 4OHBA 4KIJA 2YINC 3DOCA 2VJDA 2YIVX 5AVOA 2JJMA 1W4LA 4OSOA 2QJFA 5CIYA 2HJSA 4CKEB 5FQOA 1GDHA 1P3JA 4OXRA 4YDSA 1FYFA 3OE1A 3DOOA 2DY1A 5FV7A 3RQSA 1SXJE 1U0NA 1VPDA 2FRXA 4V0ME 3TSWA 2Z30A 3ZKWA 3BG5A 3GCDA 3SZLA 2COUA 3UGTA 5F98A 3IMCA 1CRZA 4G5XA 2BW0A 3IDFA 3U1TA 2DQYA 4YDRA 1MA0A 4Y9RA 5EJ2A 1C1YA 3BUSA 3DMTC 3R75A 2JFOA 3E9YA 3EX7C 2QYSA 3DW1X 1OZAA 1WKVA 4M0EA 3J81A 1GLVA 1FMJA 4MQEA 4B9EA 3VFDA 2E2WA 2PWAA 5TR9A 4C2TA 2IZ1A 1TL7C 2VR1A 2CJYA 2JJ8A 1JAYA 1VPTA 1KOJA 3AM3A 5IKEA 2ACWA 2XBUA 1L7VC 5CK4A 3FJYA 4D4JA 3C6MA 3LUBA 5C80A 1QIMA 1NR5A 1C5KA 1GILA 2EF0A 2IZ7A 1QTQA 5ALEA 2B8JA 2RAVA 3SQNA 3MERA 2Z4SA 4IV0A 3RLIA 3UJDA 4ARUA 2C0QA 3BSSA 3CZ4A 5KQRA 4CEJA 1Y3DE 3NP7A 3CZPA 3STXA 2R1TA 1ZIOA 4M88A 4QPJC 1D5WA 1H69A 4CMJA 1G60A 3AL2A 3GXBA 4JI3B 3T9AA 5HR5A 1MV8A 4F2PA 5B2FA 2R5WA 2ECPA 3CCFA 5CBKA 1GTL1 5IS2A 4F38A 1R8QA 2QN2A 1OBHA 3DYIA 4O4LA 5HDQA 3WP1B 2BDEA 1G9XA 1LUAA 1RWBA 1R0WA 2I9PA 4GC5A 4LN1A 2PU7A 3W5UA 5IC5A 4DR7B 1AXGA 2IZOA 3RGWS 3V48A 2CE2X 3X1XA 5AW7A 1CFJA 4P3OA 1G0NA 3G68A 2VRCA 3BD6A 3NORA 2PS9A 2C5HA 4QBTA 2H29A 3DTVA 1UZAA 4M37A 1PGPA 3UT5A 1KO7A 5A5GA 2I9KA 2VPXA 1L7OA 2PZAA 4JKYA 1EVJA 1OB5A 1V4VA 5CPFA 2VF7A 4RA6B 3TIGA 2P3QA 4EAAA 2ZDGA 1MZVA 2B83A 2NVUA 4I4CA 1TQHA 1ZJ6A 3PPVA 2ODQA 3R6TA 3EFHA 1AOXA 4PRLA 3GRRA 4XFDA 4HB4A 2QI9C 1BGWA 3QVLA 4QG3A 1UMKA 4ZVTA 1KO8A 3P9QA 3KOZA 4KB5A 1W0KD 2VDLB 4MJXA 1PL7A 3MCVA 4FFPA 4OXQA 1ID8A 4RJKA 5K0ZA 4WFKA 3HA3A 2B1JA 1G5IA 2WLTA 4YJ3B 1NZDA 3R77A 4GM4A 1M0WA 4IIJB 2QAJA 5AW4A 3U4AA 1W36C 1YQUA 2O07A 3KS9A 4B0PA 1N4AA 1QVAA 5AW6A 2P67A 1BOOA 3UM9A 3UEOA 1AV7A 3CVUA 3TE7A 4Z4GA 2GCIA 2VYFA 4OKSA 4PBTA 4PYNA 4ZMBA 3CY6A 2UYOA 1M33A 4MMXB 2JANA 2RGUA 2XIJA 3FZGA 3YASA 1FP7A 2XWPA 4RDCA 3K0EA 4Q9KA 5F1KA 5TGDA 1E2EA 1E2FA 3LYHA 4K3UA 2W2VA 5TARA 1BD3A 1XBTA 5D7BA 4JLDA 4F45A 3AI7A 2PFGA 2QYHA 1TKRA 4IWNA 5AW9A 3BK2A 4D6PA 5C8YB 2ATIA 2CF6A 3C6YA 2QN6A 1P1RA 4ETIA 4F6RB 2W0MA 3KX2A 3TR0A 3R3SA 1P9WA 2H7YA 4F9TA 4K88A 1UK7A 1WB5A 3PTZA 5AVJA 5JI3E 2GWHA 1AUVA 4N5IX 2D2FA 2LCIA 3WB0A 3SWWA 3GXOA 1TEZA 4UBIA 3VKGA 5E3JA 1MFZA 3M89A 4MKRA 4KFTA 2A0XA 3V4SA 1KI4A 1KI6A 3E7FA 2RGDA 7ABPA 1V1MB 4LBVA 3M33A 1Z37A 1KR2A 1Y5RA 4L8LA 1CUAA 3EQ9A 1PTKA 4RJIA 2FF7A 1GZDA 3NTXA 4XUGB 3JARA 4RKYA 2GZ1A 2H7VA 3QU5A 1JAZA 4RIEA 1DG3A 4QHTA 3TRHA 3QEAZ 4MCJA 1I51A 3HJTA 4YEDA 4AJ2A 4AFNA 4CQLA 2B5OA 4Y2JA 5FDFA 1QB7A 2J0UB 4L74A 4XSHA 2V1XA 3IE1A 3E84A 3LKDA 4RPIA 2FZ5A 4ZZ3A 4FHFA 2WAMA 4IZ6A 4U2BA 2YC2C 4XYLA 3ROXA 4KQMA 3CYFA 5B58C 4CRWB 1WM1A 4FC6A 3TIVA 3ORHA 3R6GA 2P30A 1E2PA 1O6GA 3E8XA 5D6NA 1LTQA 2X9LA 3DT8A 1OY1A 4AN0A 1YCGA 1ZU5A 4MQLA 1JFFA 3A11A 1RZUA 3E03A 3CH6A 1RM3A 2ETXA 2QL5A 3BTVA 3EUFA 4Q02A 2O3JA 2A3RA 3A1NA 1DE0A 1XVUA 3DTVB 4GLFA 2P4UA 4MR7B 5ALJA 4ZANA 4YY3B 4ND7A 3ER8A 1RAEA 2GD2A 4EPWA 1FC0A 4D3ZA 1ZVVA 4V0LA 3QX7A 1W93A 3K0FB 2PT9A 3U61B 4RD1A 4DMKA 1FFYA 4TMYA 5LJIA 1XFDA 2RGNA 3DP9A 1Y3IA 2RH9B 2HSJA 1PDWA 3HCFA 3F8SA 4MYCA 2JFVA 1T0UA 2ANBA 2X22A 3JQGB 1DC4A 4RULA 1HMYA 1PJSA 2A8YA 3EG5A 3LMKA 4MWOA 3RDPA 3Q2IA 2MWMA 5JTTA 3ZDAA 3U19A 2GJ9A 3UQZA 1T9CA 3AW9A 1ABEA 1JIKA 4G0YA 4P83A 4ZO9A 3UFXA 4C5CA 1OGJA 3OUUA 1UJNA 4RTLA 3CUUA 2FG5A 1MO6A 1EE9A 5I8ZA 3U48A 4DSZA 1XNRB 4FMBB 2QVXX 1F20A 3V8VA 3GPCA 2SKDA 1A82A 2VJOA 2B4AA 3FUWA 1FS5A 3O8OB 2QE6A 3C1TA 3CG4A 3QLTA 3M9WA 4M9SA 5B7GA 5IULC 5AUQA 1HSOA 1N5LA 2ORIA 3CLRC 4AW9A 3F67A 2I4IA 5AJWA 3TD6A 2A9OA 1PD1A 1XDZA 1MNQA 2Z98A 3C3EA 3EOZA 1GA6A 4CW7A 1Y34E 2AEMA 2DOKA 5B12A 4IHJA 4DDHA 2H1LA 4M0MA 3C98A 3QIAA 2FUG6 1FFEA 3JQ8B 4GVLA 4XYEA 4BXOB 1NJ2A 1UINA 2GKSA 2FEWB 2YW2A 3DO8A 4IDQA 3V1UA 1YZFA 2CV1A 1EINA 3AF1A 4GIBA 1KEPA 4NQZA 5T3YA 1LDBA 1CV2A 1V25A 4XWYA 3QKIA 1KEKA 2X8AA 1BMQA 1K7SN 1P2GA 4M9XA 5K3EA 2J3KA 3VSAA 4RPLA 2YZNA 2R8BA 4GMXA 4YT8A 4M46A 1TVKB 1ZG3A 2ERYA 4CV3A 1E9SA 1SVUA 1U5BB 4EARA 1C29B 4RA9B 2CYBA 4PYQA 3S1AA 1CY0A 1V5IA 1Z07A 3KOMA 2JFXA 5F73A 1FPQA 2WMOB 1AKUA 2VT6A 3VDXA 1R4ZA 1BROA 1V11A 2AZTA 3UJ3X 1DTWA 4RF2A 1QO0D 2F90A 5JEEA 2HEGA 3IV6A 1GYQA 1QHHB 1B0PA 2FSVC 1F2TA 2OG1A 3SDBA 3CEMA 2E5LB 1HQYE 1TM2A 1HC7A 2YVAA 2GKGA 4WKNA 5EIOA 1UODA 1XA3A 4BGUA 3NNSA 5EP3A 3UK6A 3ESCA 4RELA 3M4JA 4UHFA 4AC9A 1FZQA 4E33A 2B4YA 3WLNA 5DT9A 4KI7A 2G5PA 2FTKE 3D4NA 3P2MA 1P9LA 1NQOA 1NUPA 2FSFA 2I2CA 4QPPA 1MPTA 1TADA 4I5FA 1DG9A 4RZIA 4DA8A 1H2HA 1U9IA 3I09A 3OO1A 1XL1A 3WWYA 3ANLA 2UYGA 3LQFA 1N5RA 2QUKA 3JRXA 1PQPA 2KPOA 5B64A 2TECE 1KJ9A 4NOJA 1G16A 4WZBA 4FD3A 3DJYA 4GGMX 3ETGA 5CYOA 5BSHA 2GCGA 3P9RA 2K7FA 3U26A 1X70A 3T7JA 1UAAA 2VSOA 4R1QA 3BMNA 2ZJBA 4KIGA 4DLNA 4GD3Q 1E2MA 1V37A 1RKXA 2DPGA 4WCVA 1TJYA 1T0BA 1XMIA 1HFJA 3IBFA 1VZ3A 1RJFA 3ORRA 5DP2A 2Q5IA 1O57A 2Y0BA 3H8VA 1KDYA 1Y6FA 3NOVA 4B4WA 1P9RA 1T5IA 2PKCA 3O83A 3TQTA 3KQUA 1XDBA 2R8OA 1KQOA 1VJDA 2DMRA 4JELA 4C88A 3HBMA 1GQOA 4C2AA 2AUNA 2XTNA 4G67A 4E22A 4X66B 4KQ6A 2QLFA 3Q3GE 1AY0A 3QBVA 5HOQA 2CSXA 1NN3A 2FDRA 1CT9A 1S6YA 4IILA 4LHYA 3FNRA 3ETLA 2Z4TA 4F7DA 4Y1GA 3KUKA 2BFFA 1HE2A 2G5GX 2CDRA 4GPIB 2OV4A 4S1VA 4TRJA 5DF1A 3S81A 1RLMA 5KOHA 1NNI1 4HD8A 1F8FA 4F5WA 2N3ZA 4O5AA 5GPBA 1I5OA 2UUAB 5JZMA 4HADA 4CM1A 5CG2A 2OQ2A 4EF4A 1MABB 3VZSA 2EX0A 1A8SA 1QORA 2WJYA 5CH8A 3THSA 5DLQC 1CRPA 3PUWA 2IXBA 3WLQA 1JU3A 2X13A 1GCUA 4C4SA 4IMIB 1J00A 4YQFA 1ZZGA 3P20A 1DV2A 4TSRA 4KQHA 3N3AC 4CIDA 5LUAA 5AXCA 2KJQA 4UM9B 2ECFA 3M83A 3O31A 2UYYA 1YO6A 3DYBA 3D5EA 2I7TA 3UYLA 2A33A 3DXZA 4ZP1A 4NEQA 4Q39A 1A9QA 3EASA 3I2GA 1KIAA 1KRWA 2F1JA 5FPKA 2R7NA 4N82A 3N2EA 3KLPX 1RVDA 4JN6B 4YRQA 1A3CA 2CJFA 3ETJA 3PFWO 4OJMX 3LXUX 1OE0A 2WF7A 4LE1A 3LF1A 3H16A 4J29A 1WW3A 4D92A 4HNTA 3DZJA 3PIIA 3VVBA 4CIYA 5DHAA 2R96A 2DSNA 1VSUA 3DWGA 3DDHA 3UKJA 3ZZ0A 4L72A 4M6WA 2QTTA 5CR9A 1KJWA 1WPQA 3DKRA 3NGXA 2QRHA 3FVVA 5HUQA 2GF9A 3RKRA 3VH1A 3ACDA 2F9LA 3JATA 4TTQA 2AMLA 2BFOA 2HWKA 3KVYA 2VFAA 3GZTB 4K6KA 4J6FA 2W6CX 4ZQCB 5CXXA 1MO4A 4NEHB 2GPTA 3T9EA 4Q1CA 1MUUA 1GLNA 1Y1LA 3GN2A 4J6EA 2AJBA 2YJNA 2WSSD 4OHUA 1W34A 4LSMA 4YLYA 1MORA 3ANYB 5L4SA 4X97A 1H8HA 1DJPA 4H4EA 4NG4A 4FWTA 3DE5X 4PRZA 3IVMA 3IEXA 2EBWA 1P0PA 3N0XA 1GFZA 2Q9UA 2ZSDA 3BIJA 3DPSA 1L5HA 5LOVB 4EMBA 3E58A 3QE4A 2I1QA 3ASYA 1VLZA 2FQXA 3PF9A 1JR3E 4MUNA 2XCSB 1CERA 4ALLA 3AOEC 2JGDA 3HYNA 4H08A 1EU1A 3G0DA 2ZUEA 2ODPA 2E5FA 4DQUA 1SEVA 1JTEA 4WINA 3IYLW 3KSMA 3NT2A 4O08A 2UUPA 4Z4IA 1E4EB 1QKKA 4RZXA 3CVWA 1VPVA 1IMJA 3JZDA 2X8JB 4FYKA 4QUKA 1X1SA 2C29D 3OCWA 2QRJA 1JQKA 4C0SA 3GA5A 3U4QA 1ZKDA 4LUCA 2ZCJA 4NBKA 3EIFA 2BEUB 1YFKA 3NQ41 2BMJA 3QVWA 4QJ5A 5HGXA 3V1YA 2C4NA 1KVQA 4OFXA 4NCHA 1E9RA 5HIJA 5LDDC 3PNOA 5CXUA 5FIUA 2WWIA 2B8WA 3ZWOA 3KFVA 3JYNA 5KSPA 5TB5A 3OM9A 1FS6A 5IHXA 1FYVA 3VPCA 3HJAA 5HM8A 1T6BY 4KXWA 1Z83A 4YRNA 4C0AC 1EH5A 2IPLA 1TEXA 1L7AA 1PR4A 4UE2A 2GDZA 1GPWB 2X5KO 2BEJA 1QU2A 3OWXA 2E18A 3TYXA 4MW7A 4PAWA 4YI3A 2IY8A 2W48A 2VJYA 2G7ZA 4HS4A 1VPLA 2P91A 3VMMA 5EKTA 4NBLA 2G1JA 4KRXA 1JJBA 2J3HA 2PZBA 3CPEA 3DHEA 4ILEA 4V0OA 3ZE9A 3UENA 4TL7A 4MLZA 4PPFA 4ND6A 1T6XA 2XUKA 2YTZA 3GRAA 3OPYA 3PUIA 1X14A 3WGOA 1RAAA 2ZBRA 2O2CA 2OHIA 4Z2AA 2JFQA 4Q6BA 2QRVB 4W5JA 4ZYVA 2YZ2A 4JP5A 4EH1A 1G8GA 3RUAA 5I7AA 3USES 2EF1A 2OO7A 3C7TA 4QUIA 4CR6A 3AM1A 1NI5A 5BV1A 3K6KA 4JR0A 4M9CA 3I05A 4URHA 5ICMA 5A9SA 1P18A 3EMKA 5FTNA 3L7DA 4KLAA 4BCBA 2DJ5A 2WOOA 4EJ6A 1TRKA 2BZ0A 4ZT2A 3W78A 5JXGA 2J3DA 3CLVA 3SHFA 2UZ1A 1QYRA 3RIMA 1PU2A 1D4FA 3MGCA 5AUPB 2XUPA 5LR6A 5CTAA 2QLTA 4FYWA 5D3MA 1GG8A 3T99A 5TQJA 2X58A 4U2KA 5A62A 1CNEA 3ZKWB 3VZBA 4X1OA 3FWNA 4Q4HA 2P9FA 2ZRLA 1E7RA 1NVVQ 1P4GA 2QLJA 3AU8A 4CDMA 3NCTA 1DJLA 4ZAYA 1AUOA 2H1RA 3BD9A 4FZ5A 4Q34A 3OP4A 2ATXA 4EWLA 4UAJA 1PQYA 1GNLA 1JDBB 1T6YA 2OUIA 3UB4A 2YWHA 1R9NA 4UM5A 1QB8A 5ILOA 1NHWA 3CX3A 1ABFA 3EDOA 3I2IA 3OA0A 1U7PA 3DWEX 1GR0A 1YS6A 3DZ8A 1Z7GA 4U6QA 4WN3A 1XELA 1Q7TA 5SYMA 1M5UA 1A9YA 2QQ5A 3DMYA 3IR5A 2JGDB 1MW9X 4YO7A 5HNKA 1DVRA 1F12A 4TL8A 4OX9B 3ZWKA 2F1IA 4X54A 1L7PA 2WJHA 3P0IA 1NMZA 2J6CA 1XZLA 3JXEA 2C7RA 3DFFA 1FSFA 2M6KA 1N33B 1R9MA 2ID4A 2WM8A 5DFAA 2CXRA 2R44A 5KZMB 4RXUA 4QEDA 5HF9A 4RQBA 1PSWA 1HEUA 3D3NA 1T36B 1Z2NX 1EM8A 3EF3A 3Q7EA 3BOSA 4LDZA 1CS0A 3WLJA 4CFSA 1T3GA 4D9IA 1EDDA 4OY3A 5I45A 1RQNA 3E8SA 3GL9A 3ZCUA 1DWQA 2ONKA 4ZCRA 2ILVA 3EQZA 2YW9A 2V4MA 4JZYA 1W5BA 5TQ2B 1CUXA 2O7VA 3C14C 4N49A 1JAXA 2A0KA 5H82A 2GH1A 3AUKA 3WKAA 4JHXA 1S2MA 4ZTBA 3GLFA 1ENZA 2GWRA 5EUCA 4R9RA 3Q15C 3S8MA 1QH1A 1N8TA 3IVXA 5H83A 5JAQA 5I3CA 2I3DA 3NONA 3DULA 5EVJA 2NXJA 5EIBC 2XOKD 5CB4B 3NM5A 4UBLA 4P86A 1NSYA 1SC3A 3L07A 1ISSA 1ETUA 5G1NA 4RH0A 3O2SB 3VXKA 3O9MA 4MYHA 2E4VA 4Y98A 5CNMA 2WAAA 1AMOA 2PUCA 2N1BA 2R6FA 4KP7A 3VGPA 5LQMA 5CD1A 2HYIC 3IRVA 2F3QA 2DWCA 4R69A 1RTTA 4IQ8A 5ITZB 2ST1A 4R7GA 1Y4ZA 2G1AA 3ZU5A 5KVVA 4J07A 3KPYA 2FZVA 2VDNB 1Q0LA 2Y76A 2F9MA 4B3JA 1K8YB 2L69A 4RFLA 2YN2A 3CNLA 4BLSA 5K8JB 1JKMA 2HRZA 1Z5ZA 5A9SB 1K06A 2YWBA 2J9XB 2W6OA 4OM8A 2YN0A 4YFYA 4KMRA 5DU2A 3EH2A 2YJGA 4KQKA 4TV8F 1UBHS 4LS3A 3ROKA 4DLKA 5JSZB 1GO2A 2WM9B 2I4LA 1NF8A 3ILSA 3O5AA 4R2KA 1FRZA 2ZPTX 5D3MB 3ICCA 2BH9A 4GX1A 2EEZA 3IQWA 4D46A 1QFXA 1M8FA 2IOHA 2QKYA 3RT9A 4ZYZA 5I48A 1H94A 4R1LA 1MIOA 3HR8A 5FH9A 4REQB 1ZM2A 3T7KA 4H27A 3O91A 1SVNA 3K0FA 1CW2B 5G1PA 1N34B 1DGQA 2YXPX 3TUZC 1Y5LA 1BJKA 2B9EA 2I4NA 4OQFA 3V1MA 2C07A 1AVTA 3U40A 4H3KB 3SM3A 1AGYA 1KYXA 1JT2A 5JDCC 1DAHA 3DA8A 3N7TA 5EA2A 4IDHA 5IAEA 3WY9A 4ARCA 4J7AA 2CNNA 2JGFA 1JLMA 1BZYA 3RANA 1QFSA 4AJOA 5JMWA 5EE5B 1N0IA 2C2GA 2VK4A 1B41A 2RH8A 4G4GA 3I6IA 3CQ9A 3OESA 3IAS1 4KK4A 4PC7A 5KNDD 1ECCA 4OXNA 1VKZA 1IHPA 3HGQA 1Q7BA 5F7JA 3SC3A 3CSSA 3F6CA 2JVKA 3WWEA 1VA4A 3K15A 4GQBA 3TBHA 2G9ZA 3WGKA 3NT5A 2DC1A 4W7HA 1EM8B 3MWYW 3OX3A 1H6BA 1QDUA 4GVXA 1HH4A 1U2EA 1I4LD 2BCEA 5JCOC 2Q0QA 3RF7A 3O8RA 1NW6A 2H1FA 3IP9A 4UZEA 3RS4A 5GONA 4XJSA 4Q21A 4IHAA 3A9RA 2A30A 5HRAA 1I6KA 3DTNA 2RC6A 3S3TA 2OMKA 2HRCA 3K4HA 2WWXA 3BFVA 5KX5F 3S40A 1R0ZA 3EVFA 3KQTA 3P9CA 2WU4A 3LPNA 1QH8A 5H3HA 2UVPB 3E3OA 3PL5A 4GPZA 5CDGA 1NXWA 5KX5B 2ISCA 3UPUA 4G4SP 1LFDB 3RV3A 1NPDA 1LBIA 5G1OA 2J4DA 5A0FA 1E7YA 1GTJ1 4EY6A 4YXWD 4ZALA 1Q12A 3U44A 3UV6A 1O94C 1K9VF 3K96A 4MAFA 4R8MA 3VDMA 5K0JA 3G0OA 4Q1VA 1ZK1A 3FSGA 4R9VA 1DKRA 1TMKA 3GLGA 2CCGA 1V9LA 4IWXA 3QMMA 3TNFA 1BA3A 4ZMSA 1IPHA 3QWIA 1I4WA 1QHHA 1U28A 2OHXA 2IUYA 2X0RA 4RMHA 3N59A 3DZIA 3EPPA 4UDOA 1MVNA 4A5OA 1TJ5A 4BNFA 4LOHA 1XMJA 2EW1A 2HIAA 3KG2A 5HZMA 2Q6KA 3CT6A 1MENA 1SUFA 2QQ0A 2IEIA 3TB4A 2R6JA 4BBAA 3DW3X 4OVKA 4P53A 2O8BA 4CLOA 1DT3A 4DILA 4Z51A 5EERA 5JSZA 4CQMB 1KE1A 1C9EA 1BEUB 1TA0A 2EHDA 3AINA 2Y77A 2GPJA 3SQMA 5KMGA 3ZHRA 5DEIA 4J0CA 2NQ2C 1QGYA 2R1UA 2DJIA 4S2UA 3HBLA 4HX9A 3BH0A 1GGVA 2WW8A 4OJYA 4REQA 3K9BA 3N53A 5DCUA 3JYPA 4FB5A 4KAFA 3VZQA 1ZW1A 3B82A 3SIPA 3QHQA 1FP6A 2B78A 2LUOA 1Y4DE 2Q8QA 4V1CA 5ADHA 3I45A 1PP4A 4H15A 3V5NA 4FEAA 4F92B 3KTAA 4UBOA 2SCUA 1C30A 1E2HA 5ALRA 1PDOA 2X5NA 3N05A 1FX1A 1YJQA 4KODA 1WD7A 3GEIA 4RZ3A 3IA7A 1IM8A 5C18A 2AT1A 5BMOA 2AZXA 3KZOA 2PBRA 1MH9A 4DIFA 4U5XA 4MI9A 2NU7A 3IOMA 5AT1A 1V48A 1RPNA 1S4QA 3UMMA 2WYIA 5HVNA 1VBNA 2W6MA 3A14A 1T1GA 4Z3OA 3AMVA 2G70A 4NBNA 1GRRA 4KUGA 3TZEA 4IJUA 1TM1E 3PLRA 4UC0A 3WRVA 3GFFA 3ZE6A 2APJA 4NV0A 4G1BA 1HF3A 1QWSA 4OO3A 1G21B 1JWLA 5I7WA 3FPFA 4G0MA 3B5JA 5ALWA 4QC2A 1G20E 1M0EA 2PUVA 4K86A 5IKPA 1VLJA 3FKSA 1E5TA 1IULA 3MS2A 3NVDA 3OLWA 1OV6A 2WSYB 3VU9A 4EI8A 2P90A 4UVDA 3KWLA 2FLWA 4DADA 5JSQA 1YU9A 1D2RA 2J9YB 3C1AA 1C0KA 2CV0A 2P5SA 1XNJA 2WIAA 3T5AA 2Z95A 3RNLA 2IYTA 3OAAA 2NO9A 2ATCA 2G76A 2WB4A 2G67A 3PVZA 1GOTA 1Q1AA 4G5OA 2P4EA 3K3PA 4E30A 1P19A 4MV7A 1Z6AA 3JSXA 3M1LA 3UXMA 4EKIA 1FRQA 3KD3A 4POAA 1EG2A 4MWGA 4TM7A 3ZZNA 4BLUA 4F4UA 4HMOA 1XCPA 2CJWA 4D8VA 2QD5A 3HACA 1JEEA 4IFEA 4Q4AA 1GPUA 5J5CA 1C8BA 1Y82A 5U9CA 3RB8A 1JHRA 1C8LA 2GEBA 2HRQA 3P2JA 4NCJA 4QOHA 4HHEA 1F0NA 4OGWA 4NENB 2ICAA 4HDNA 3K70D 4B3DA 4X91A 4U0KA 1QHGA 1RLIA 2RHTA 2VKTA 4GWGA 2EBUA 2PKRA 1C8KA 4L0CA 4QEKA 3WLIA 2VHCA 3UFBA 1PBTA 2P69A 1JECA 2XZPA 3IXLA 1N6KA 4H35A 2RD2A 2I67A 1GSAA 1MDBA 3ZV3A 3A4NA 3L8YA 4P93A 4EW3A 1ORDA 2QD3A 1I2BA 3NUQA 4G1VA 5A7GA 4BLWA 4POOA 1GLGA 2VTKA 3MINA 1Y9AA 3P71T 4KITB 3L0DA 2A9VA 1NJ8A 1PQ4A 2R68A 2OGWA 2P2DA 3P9NA 4XR4A 4YECA 1JDTA 1ODKA 3Q1LA 2PS3A 3R76A 5BXQC 4NZZA 2XB6A 3UKDA 2Q5OA 5ICGA 1DKNA 1X1DA 1ZOSA 2NM0A 4WJLA 4ALJA 1Y5IA 3O4RA 4XWWA 4XPIA 3ENNA 1YJAA 4EW6A 2C61A 3C87A 2AR0A 5SY6A 3IGFA 4YCCA 3NVAA 4Y2TA 2IUTA 5L8VA 4JT8A 4BMSA 1ZEJA 2YJ3A 2QNBA 2HM7A 1CHNA 4WXHA 5HK8A 3L43A 3RS5A 4CNBA 3O82A 2UU9B 1ZXLA 3MTEA 4HLNA 4L16A 2HA2A 3JVVA 4BY9E 3ZHXA 1SU4A 4LOLA 4MQUA 4YGYA 1G3IA 4BJ1A 2R1VA 3RYCB 4KVAA 2OBYA 5IU6A 5CCBA 3R7WB 1SRRA 1Z6TA 3ZY5A 1FJXA 1MKYA 3STWA 4DSOA 1DRUA 4IXDA 2FUNB 1NV8A 4DEVA 2J67A 1M6EX 4P7KA 4YJ3F 1IPEA 5JECA 2X1LA 1JPVA 3TKLA 4ZVRA 3DAFA 5FTMA 3C8DA 1QV7A 1FLAA 4HGRA 1G18A 1SBYA 3GQBA 3EPKA 3O7MA 5LCXA 3ZQKA 4FDLA 5BVGA 2ZYGA 3GAFA 1LBTA 2OQIA 3H9EO 4JJ6A 4TTPA 2P41A 3SFTA 1NVMB 3BIOA 4FBLA 3SSMA 2Q8NA 2IY9A 2HIHA 4H7IA 3RYIB 3M6LA 3UMRA 1G21E 1J2TA 4MUKA 4ER3A 1MP0A 1QIHA 1NVUQ 3LT1A 5LQCA 1I3KA 1UBFA 1XDSA 3ZLJA 3G0BA 4PHHA 3WNCA 4BVFA 3KR9A 4B47A 4AG5A 1XN4A 2VDJA 4Y2XA 4ENWA 2C1XA 2Q5JA 3DUFB 3N2NA 4KMMA 3QG1A 4LXQA 4WKGA 1EP3B 3INYA 3IIKA 3ZK8A 2O1EA 1KFEB 5E0OA 1RQ2A 4NBTA 1W96A 2GNPA 4KPGA 1T34A 4CKYA 1XVLA 4KKXB 4Z9FA 4MVYA 2NV6A 2WD7B 5IJ0A 4ZQIA 1OBFO 1OQAA 2WWFA 4X7BA 1XU7A 3SS7X 3RFVA 4CLOB 1AQJA 3VGJA 3GDGA 5KWVA 4R68A 1R9JA 1O6CA 1V1MA 3K09A 2FPRA 2VUTA 4TLBA 5HF8A 4D99A 4F96A 2XKAA 4E31A 5BUSA 3RAFC 1UXJA 2JF0A 3FNEA 4YJFB 5I7RA 1WXDA 1GTZA 2DM6A 4NENA 2EKQA 2JL1A 2SICE 3ZY6A 5KTNA 5J2UA 2VWGA 3A2KA 3MAGA 4JOBA 3AK4A 1X42A 4JITA 3WV4A 2EP7A 5CEJA 1O94A 1XEXB 2GRUA 2GBGA 2W6ZA 1CLEA 3DFMA 4KV7A 5LZ2A 1YR8A 1I6WA 3LPAA 1ISIA 1E6LA 4ZAFA 4B6SA 3R2JA 3BMOA 4ACAA 1V8DA 5FAXA 3AKYA 3B8HA 5JJLA 3FSGD 1FFBA 4U9HS 4M0CA 3G1UA 4U7GA 1V39A 4UMVA 3W8DA 5BQOA 2XVZA 1Z4MA 1GNSA 4PXYA 1RIIA 1JLLA 3EVGA 3GVCA 1YDGA 1NONA 5GY7A 1VL2A 2HFKA 5EZ5A 3TVDA 2WIGA 3PD1A 1E98A 2V8OA 3OZXA 3QKUA 2H3HA 4C06A 4NK5A 1CRWG 3KHSA 2LR0A 3LTEA 1ZVMA 4XGRA 3L49A 1GKUB 3NEYA 3OJEA 5L4LA 2Q41A 4MNTA 3I2JA 2B7BA 2HSDA 2ARKA 3P45A 4KO4S 4PYOA 4FHCA 5H4HA 2X0DA 3JPWA 4ARAA 3THWA 3KZMA 3ZGZA 2GPWA 5EWLB 4Q3BA 1WLYA 1BE0A 3OPVA 1JWAB 3KLOA 4J43A 4MO2A 4Q19A 5DCLA 1IBMB 4EYEA 4A36A 4PYLA 1YMUA 1ZI9A 3CPHA 1Y48E 3IP3A 4LHXA 2QRPA 4KRFA 1JZQA 4RD2A 4HN9A 5I9NA 1GYRA 3EGIA 4DWOA 1E1KA 5AW5A 3WBFA 5A04A 4TYNA 1RCFA 5AK0A 4Z53A 2XDWA 1PFYA 3PPWA 1JKJB 1U3FA 1HOTA 5SZKB 3DLAA 1Z0ZA 3E9CA 1UBNA 1VIDA 3O26A 1GV0A 3VZPA 5FI0B 1Q21A 2PQ2A 4G6ZA 1CEEA 5TF0A 1BXZA 1C2TA 5DW3A 2B94A 2HDHA 4Y2PA 5IRCD 2Y05A 4AXBA 2R0QC 4EEZA 2QZJA 5FNVF 3FROA 4K40A 4PGMA 3WB1A 1U5CA 2X7HA 2E1RA 3AJRA 1G4HA 4BRWA 2UYHA 3AEUB 3ZKAA 4OJTA 4W5TA 1F9AA 4O33A 4M8KA 4D82A 1I3LA 4KN5A 1MX3A 3SX4A 5L3SA 4EUKA 2JHCA 2VPYA 5EIAA 5EMHA 3GPDG 2F3TA 2OE2A 4OCZA 5JI2E 1BW9B 4GGPA 1JHZA 3KKZA 2WAXA 1LPMA 3E1GA 1Q57A 4KGXA 1W47A 1XV5A 1YB4A 4IUDS 4PX2A 4YRDA 3HJRA 3SEAA 5GAJA 5IVIA 2CXNA 2FEAA 1Q0SA 3GJ0A 3RWBA 5JJKA 1UMDB 1TVKA 2XPCA 3FVRA 2HQRA 3VC1A 1GQSA 1YZNA 4G0OA 1JMKC 2VNJA 3WDSA 1OVGA 1E79D 3WWCA 4AT1A 4CFYA 4YJGA 4OU5A 2OK8A 2P3SA 1JVSA 1K08A 3Q5DA 5EMNA 3PC2A 1C50A 3OQBA 3TL3A 1LW7A 3WGYA 1Y6QA 3TTYA 3OAAD 2VXCA 2EW8A 1LSJA 1UP4A 2HFJA 3AVPA 1DDOA 2OLKA 3RAJA 3L0PA 1IZ9A 1KKMA 2X2OA 4F56A 3RRXA 2ECQA 3FI0A 1N2JA 5C34B 1XDDA 2VP2A 4GC9A 1VG8A 4MQ5A 5DX0A 4LX0A 4BKPA 1OFUX 3E22B 4ZEXA 4HQFA 1HEIA 1X7GA 5TJ9A 3V4FA 2EQBA 3NTVA 3JQEA 3ZU2A 3RIHA 3DKIA 2IZ6A 1A9XB 3GCGA 2F3RA 2VEOA 3OLZA 4GI7A 4JENA 3NHJA 1E0DA 1L5QA 4MEAA 4MW4A 5B3LA 1FZTA 3W8FA 4EZEA 4EEKA 3G89A 2Y67A 2GI4A 4FHZA 5JCJA 3UNXA 1WG8A 1N0HA 2V03A 1AHHA 3AUAA 3BJEA 5K2MA 2NWQA 2VPZA 3OKPA 4RORA 4DUZB 2ZR9A 4QVGA 2H5EA 5KJ1A 1E7SA 2OHJA 3A3PA 4L73A 3I4CA 1CDOA 1F3OA 2CMKA 2HMSA 5EJ8A 1DFHA 2A84A 3GJ3A 5JW6A 2LGJA 1FJ2A 4LHWA 5EAIA 4C76A 4EO9A 5C51B 4NI5A 3IOCA 3S4YA 3RRNA 1IZZA 3QV1A 4FGLA 4JGIA 2J07A 5DV9A 2B5VA 5EKDA 5T4FA 1T13A 3LT4A 2RMKA 4PNEA 4I9NA 1EXNA 2D0DA 2W8ZA 2NUAB 4ZGGA 1IY8A 4XW2A 1ZK4A 4E09A 2XVXA 5DTMA 1ZUHA 1G7SA 1L5LA 3CKKA 3A9WA 5COQA 1MQ8B 4BE7B 4YALA 4ZV4A 2QL9A 2HGSA 1F2UA 1RBQA 2GYUA 3FOFC 3ZD8A 3TUIC 4Y18A 4WJKB 2BWJA 1KI8A 3S7ZA 1WW2A 3S2YA 2R25B 2Q3HA 1ECBA 4FYHA 3UTDA 3FSJX 5T7BA 4WXPA 4OHYA 4MWBA 2JVJA 2ZJYA 2B2XA 1GSIA 3MYRA 3QVKA 3DS8A 5KQGA 3G0GA 2Y1EA 4B4OA 4RTSA 1J8MF 5DNCA 1MGPA 4BRZA 1IONA 3DT9A 3MWEA 5K6AA 1TI7A 4Q3CA 3AERA 1K9SA 4JVNA 2YHSA 4AKHA 2D2EA 2CN1A 2WYOA 4H1TA 3ZWNA 3LAWA 1KK3A 3CF2A 1N32B 1IUPA 2FG6C 2RHCA 3CINA 1LQ2A 1Y6RA 3IAAA 4BAUA 3JWEA 3PD7A 2ILTA 1CBUA 1KEZA 2CMDA 2J45A 1KYTA 3FIUA 2FZCA 1GN8A 3TR6A 1KARA 4LXYA 4GQIA 5GZ1A 3O7WA 5LDGA 5AM2A 3WBKA 2P1RA 4GICA 3U7HB 3UOWA 1OASA 4M1OA 3DVLA 1A72A 1I0ZA 2FN3A 3HB5X 4OG2A 1Z8HA 5KI6A 2XWQA 1DMSA 1GTVA 1YE8A 2H8KA 2G9QA 4N0MA 2XRZA 1GPLA 1E8MA 3QOWA 1JKXA 4NZPA 3LCRA 4OGFA 3WGGA 3ZK7A 3UK7A 5D1NA 2GJ8A 1D3AA 3OCUA 2PRKA 4M83A 1BFKA 1WDWB 5IAAA 4FLMA 1OYOA 1ESCA 2WU8A 2QSJA 2RAFA 3JATB 3C3XA 3AR5A 3OZWA 4LWPA 3OWHA 3A10A 4Y9SA 2AFHA 5A6SB 1I7PA 2UAGA 5PNTA 1VHDA 1GM5A 3Q12A 2GLUA 2VKQA 1WXQA 1VKJA 3PA6A 4DR5B 4P82A 4O2BB 3LFHA 3FE2A 4UNIA 2ZLBA 1G38A 3HE3A 1YDEA 3IEIA 2DE0X 4ED9A 2JHPA 2WMDA 3C3WA 1ISMA 2A0FA 2Z04A 4C04A 4JBLA 4AQDA 5H9WA 2WILA 4DA7A 1SZCA 1DX4A 5LZ5A 1P61B 1RXEA 4RD0A 3RVBA 4LF9B 2DHQA 1D6SA 1SXJD 1XLVA 2Y9MB 3WWZA 1MA3A 2WNIA 1EX1A 2R7KA 4UZFA 1VZ2A 3F78A 2JBWA 4ZCMA 1ZRMA 1AK9A 3LPDA 1C41A 1PLLA 4NTZA 3WLOA 3ZHYA 4BLTA 2PR2A 4CT5A 3NAQA 1BH6A 3ASUA 4PGGA 2DKNA 1J0EA 1OR8A 2NAFA 3ZVMA 1R8SA 3OEED 2ZJAA 4NOMA 4NYJQ 3K92A 1OA0A 4IIJF 3THYA 3FRHA 2BC9A 3LX5A 1H65A 3JR3A 1ATIA 3AFMA 2RJNA 1JUDA 1SG6A 3CLTD 2LW7A 3N87A 4BVGA 2V55B 4QWWA 1UAGA 3UO8B 3REOA 3PDWA 1T2VA 1HNWB 3UC9A 2VCEA 2A7XA 3OQPA 3VX3A 2AB0A 3FPHA 3R3YA 1KC1A 3S6JA 4UE3S 2ZJ5A 5KJFA 1W52X 4J2TA 5BN5B 4NZYA 2RHMA 4JUFA 4O29A 4Z54A 4ZN6A 1L5KA 1B0AA 3LX4A 4XI9A 4DSUA 3GNTA 1JFRA 4PYRA 1KFJB 5TSDA 1W4ZA 1XWFA 2ZRJA 3BWVA 2CUTA 3IT1A 4DQXA 3S27A 4RWZA 1EUCB 4DCJA 1E2JA 2AW3A 4X1IA 2Y0CA 4U2CA 4UATA 5DHRA 3EA0A 1YFLA 2IEDA 3ZV6A 2JFZA 4D0LB 5L3QA 4KYIB 1YASA 3V1LA 4L5AA 2BEKA 5ARBA 4DM3A 1E3MA 2C1EA 1XO1A 3PC6A 5HSGA 4U7WA 3BKXA 3WRXA 3TTVA 1L3IA 3V46A 2CVOA 4J0DA 2FSSA 3TD9A 4AZSA 1U5AA 4EMTA 3AKZA 5H1YA 1YC2A 5JQWA 1T2DA 1TKAA 3COJA 2VUSA 3KIPA 4BL5A 1EVIA 1J7JA 1E7MA 1ZK2A 1E62A 3LOUA 3W2TA 4YV7A 3B6KA 4MDYA 1ZMOA 1MB3A 1N0VC 4HPJB 4IDNA 1KZHA 1N9KA 4AKGA 1K6JA 1NIPA 3SNHA 2Z8XA 4Q3KA 1WSDA 1PEDA 4PFQA 4EA6A 1V7ZA 2X77A 4DLLA 4OLBA 1UK6A 4N8SA 3LT0A 4ZXPA 1CRLA 1Z4JA 3PP8A 5T4HA 4X6UA 3ZDXB 1T35A 4JCCA 2B8TA 3KUUA 2D2IA 1N78A 3QXCA 4ZV7A 2FR1A 2IBMA 1GGJA 4MHTA 5IAGA 1Z82A 1GEGA 2BF7A 2JK1A 3ACBA 3H2YA 5TGTA 5C35A 1YL6A 2RH4A 3FMPB 3CISA 1OUMA 3VZCA 1OLUA 3WNBA 4TT3D 2Q49A 1G4UR 2E4AA 2G7MC 2GPYA 4MV8A 2A9RA 3CW9A 4OKIA 1LDMA 5AKKA 4EQ6B 1QGOA 3C41J 3BQMB 4LNAA 2B36A 4B3RB 1GPH1 3FWPA 4PGAA 2B4KA 3NAGA 4D02A 5BNZA 721PA 4BN0A 3OQIB 3H1GA 3SCZA 5KNCD 4MV3A 2JLXA 5FBRB 1OC4A 4PHTA 4ZCPA 1JRLA 3VYWA 2C54A 4YXWA 1MB9A 1FVXA 1EXMA 1L4KA 1N8SA 1T9BA 1PEKE 1UM9B 1K97A 5BMVA 4FBGA 1T4CA 4MKIA 1B73A 3K31A 1UXGA 3E4CA 3CPJB 3AYXB 3REQB 1UDCA 4N8EA 4RLHA 1YVPA 4FX5A 3DKKA 4K9QA 3ZI4A 3RI3A 3B1KA