5M34A

Structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
245
structure length
228
Chain Sequence
AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTYQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin B12-binding protein
publication title Conformational Change of a Tryptophan Residue in BtuF Facilitates Binding and Transport of Cobinamide by the Vitamin B12 Transporter BtuCD-F.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 80
structure length 228
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m34A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m34A02
1QGUB 2YNMD 3AETB 4G07A 2Q8PA 1QGUA 3AETA 4BBPA 3R5TA 1KARA 4NNOA 5HDQA 2YNMC 3NU1A 4G09A 3MWFA 5M29A 4H0FA 4PM4A 5CX1B 2AFIB 2PS3A 4UTOA 3ZK7A 5M34A 3CX3A 5CX1A 2AFIA 3MINB 3PSAA 4OXRA 3ZTTA 3MINA 4MO9A 1G20B 3HJTA 4PAGA 4H59A 3ZK8A 5M3BA 1G20A 4GICA 3AEKB 3AERB 2OGWA 4WZBB 5KOJB 1N4AA 3AEKA 1N4DA 3AERA 3HXPA 4LS3A 4WZBA 5KOJA 4INOA 4WN9B 3LI2A 1MIOB 2R79A 3AESB 2XUZA 4N01A 4WN9A 5JG7A 1MIOA 4WESB 3U7QB 3AESA 2X4LA 1KAHA 3U7QA 2AFHB 2XV1A 4IRMA 4WESA 4LJSA 4CL2A 1H1LB 3MD9A 2AFHA 3BE5A 4M7OA 1L5HB 3ZKAA 1QH1B 1H1LA 5KOHB 1K75A 1L5HA 1QH1A 5KHLB 1FP4B 4OVKA 3TNYA 5KOHA 2XH8A 1FP4A 3EIWA 5I4KA 2M6LA 4UDOA 2R7AA 2WHYA 2O1EA 2Q8QA 3LHSA 1PQ4A 4FI3F 5AFSA 1PSZA 4HMQA 4INPA 5JPDA 1EFDN 2PS0A 2PS9A 3MWGA 5FLYA 1N2CB 1QH8B 3G9QA 4HMOA 2ETVA 5BVHB 2PHZA 1N2CA 1K7SN 1QH8A 4MLZA 2PRSA 4WZAB 3MFQA 5BVHA 4WNAB 4FKMA 4WZAA 4FILA 3EIXA 1K0FA 1KAEA 3TLKA 4MX8A 1M34B 1N2ZA 2OV3A 2OV1A 4WNAA 5JJ5A 1M34A 1XVLA 3HH8A 3BE6A 5CR9A 1M1YB 4HN9A 3AEUB 5GGYA 4B8YA 2XDQB 1M1YA 3AEUA 3TEFA 5HX7A 1G21B 2XDQA 3UJPA 4UDNA 4FNAA 2XY4A 2MINB 1G21A 3K1AB 1M1NB 1K2VN 3R5SA 4ND8B 4TKVB 3GI1A 4NNPA 2MINA 3K1AA 4ND8A 1M1NA 5B58T 3PSHA 4TKVA 1ESZA 4TKUB 4MDYA 2M6KA 3ZK9A 4TKUA 5BVGB 2OSVA 4XPIB 2QI9F 5GGXA 5BVGA 2WI8A 4XPIA 4K3VA 4UTPA 4OXQA 3AEQB 1TOAA 3PDIB 5JOQA 5M2QA 4HMPA 3AEQA 3PDIA 2RG7A 2XQVA 4DBLE
chains in the Genus database with same CATH superfamily
2C59A 1E6CA 1GPLA 1PGNA 2XVYA 1SD2A 3ROQA 2I1LA 2VRCD 1T9HA 2NW6A 3LY7A 4MEJA 4M9CA 5BN5B 5C2JB 3U16A 1U0FA 3MGGA 1E79D 2FEPA 1T5TA 4X94A 1U2SA 1XKQA 1OT3A 3OAAA 3TL2A 3WGIA 3VR0A 2LE0A 4CKEB 5K7SA 4PFQA 3G89A 2QAIA 3H1FA 1QV9A 4PPQA 1Z0DA 2A14A 3O73A 1X6VA 4UUOA 5LIPA 3EBOA 2D59A 3QFSA 2HIAA 1IAQA 4GUDA 4AKHA 4JT9A 1G5HA 4TQUS 4BCCA 1NP6A 4JROA 2GZHA 5F52A 5FLKA 3ZK8A 3ZNNA 2PWBA 1IJEA 3HACA 4IIVA 1RPNA 1UXKA 4M99A 1REQB 2PRZA 4N7RA 2LWIA 3O4RA 4FEAA 1M75A 3QFFA 2C4VA 3LQKA 3C3JA 4E6EA 4F1JA 1TYEB 5BMVF 4JVLA 1XHEA 2VQ6A 3QMVA 1O96A 4ENPA 1Q0RA 2FG5A 2H8GA 5LNK6 4IHJA 1WD7A 2E5LB 2JGEA 3FGNA 2DFLA 2J6CA 2I67A 5DZSA 3S55A 1C7EA 2WUVA 3E0QA 1QO0A 3WV5A 5KNCD 4MYDA 5TIIA 4H6PA 5KTNA 3IUYA 4EEKA 4CF6A 4OVKA 4RQAA 3FUTA 5JWRA 3VNAA 3PT9A 1RC8A 2RD2A 1JWBB 2XWBF 1SNYA 1YQDA 1ABBA 4WL0A 2G5GX 4O08A 2JHAA 4NMLA 3HVRA 3VPAA 2EBHX 2WHYA 2A3RA 4KPGA 4PFJA 5AKZA 5LC1A 4D74A 2NV6A 5CLHA 3ETLA 5DYGA 2VPQA 4F4JA 5KVVA 4B17A 1OAKA 1V37A 2BEWA 2VG8A 2YHBA 5H83A 2C2YA 2CLOB 4DLUA 3I9LA 3RSOA 4IZ6A 4TYMA 3TZKA 4MWBA 3DXZA 3HU5A 1JRLA 4Y2PA 5C8YB 1ZH4A 4HGZA 3N2IA 3IPAA 2BR4A 4JJ4A 3SZUA 4DL9A 4ZQCB 3AB3A 3JQFA 3T41A 1EB8A 2JGFA 5J3JA 1QR6A 2PT6A 2JGRA 3PFWO 2N75A 3X1MA 1R0SA 4F56A 1JJIA 4DKXA 2VF4X 3PUIA 4UQPA 5BWBA 5LQNA 2PLAA 2C4HA 4ER6A 1MH9A 3DCYA 4K9DA 4LMBA 4TMXA 1IXZA 5IKPA 2FPKA 4BJHB 1ID1A 2IA5A 3OZTA 2E37A 2RKWA 5F7ZA 1DTEA 1P2DA 4DJDC 5L6MB 1E2GA 3VNQA 5LXTB 4TQGA 3FDIA 3OT5A 4ZVLA 3FSGD 1XC7A 3P2YA 2HRDA 2L17A 2VJMB 5CGZA 4EKGA 1ML4A 1XF1A 3ROFA 2C2HA 1SCDA 3E5HA 1NFFA 3CJQA 3DEJA 3W8FA 5FA8A 3ZDCA 2X6QA 1HWYA 3KZ1E 4JMLA 2ZUBA 2D5CA 3IJPA 1V48A 2FQXA 2H5EA 3I72A 5EGSA 4ZVMA 3CX6A 3LOQA 5KJFA 5G1PA 4RU1A 1JHVA 2XWSA 3B5EA 3VFDA 1ZWKA 4TRNA 2X8AA 1I36A 2XQGA 3VAYA 4NZOA 1R0LA 1NYTA 2Z30A 1COWA 1L5MA 3QHAA 4QGFA 4C7JA 1R50A 2FNAA 1JE0A 1CUCA 4GRAA 5D1NA 5GVSA 4RMGA 5FCDA 1JR3D 1R74A 4B4OA 1NJ6A 1Q1EA 4M9RA 5JS6A 2JFXA 3OWOA 1QQTA 1DQPA 1LW7A 2HZBA 1VYHA 4TQAA 2FSHA 5DULA 5GOTA 3R7BA 1VSQA 4UU8A 2G9NA 3BWCA 1EX6A 1M2VB 1EWKA 3HDTA 3X2EA 2RE8A 3SYLA 1CQXA 3N0VA 3ZLUA 4TV9F 3NIFB 2XXJA 3M5WA 5EPEA 2QTHA 1EYZA 4YALA 4E08A 3GUCA 5T8KA 4YRGA 3U26A 2UXBB 4FQ8A 3TSAA 5KOIA 3BH6A 3QPVA 2PRJA 2MU1A 1JSLA 3ROKA 2DCUA 3V2HA 4DJEC 2YWJA 3HRIA 4Y2HA 4K9OA 1M34E 1HE8B 5AIBA 4I50F 2Z95A 3BAZA 1T8SA 2YWDA 2HW8A 2RI1A 4TTAA 1E20A 3BZUA 3G2KA 4G1MB 4J6FA 1DT5A 4TTTS 4F92B 5JD6A 3GCWA 4QEDA 2BPOA 2Z4RA 3L7KA 1FB5A 3PENA 3RJTA 4UEQA 1SIBE 3I0ZA 1EPUA 1C1DA 1H8HD 3D2CA 4FCTA 3WMRA 3NVKI 2GH1A 3QXCA 1U8AA 2ODBA 3EDMA 1UANA 1RNLA 2P6PA 1ILEA 5FNZA 4E22A 4IICA 2J5XA 2O57A 5CVJA 3S7TA 1LNQA 4LHSA 3TUIC 2ODPA 3LNCA 1G5RA 3K0KA 1FP4B 4ZVQA 3UICA 2RHCA 3V1YA 3IHTA 3A9WA 2NUPB 2XAUA 2FSSA 1GV0A 3C74A 3O2SB 2EW8A 3QKIA 4G1EB 5IUJC 1Q83A 2IYFA 4D4LA 1RPTA 4N48A 3BQ9A 1VE6A 1IONA 1J8QA 4PYOA 3L1VA 5EIEA 1GQ2A 5IC4A 1WB9A 1QXSA 3EXAA 3F49S 4FNMA 4MITA 3D81A 4MV4A 4JV5B 1DBSA 1BU8A 1NSFA 4PNZA 4Z2YA 3P19A 4PSVA 1WW8A 1C8LA 2AA3A 2HXYA 2I87A 2P91A 3MBOA 3RU3A 1VCNA 4YTEA 1A8QA 2O8VA 1HK7A 2FRVA 3T5MA 1JBEA 4JXXA 4JIMA 1M34B 1GPDG 5EQJB 2QJOA 4QT0A 3BIXA 5FOSA 4FMCB 2R86A 5C7IO 5KWSA 1V7CA 2O2CA 4MAMA 3UANA 2B78A 2HDWA 1LPMA 2Z9DA 3IUPA 4QYIA 4C29A 4JSYA 4MRRA 1RXEA 1KOLA 1TLLA 2FMIA 2VLBA 1K4YA 3EARA 1V8BA 4KMMA 4K9MA 5T8KC 3SFZA 3DPSA 3VDNB 1LW6E 3AVXA 3U40A 3I30X 1P1FA 1O0SA 3EAGA 1Z4JA 3GI1A 3ROZA 2V6FA 4XM1A 3TD2A 2ZKIA 1GTMA 1XFDA 4HGRA 3GLFE 4N3GA 3MCVA 2DQZA 2G9UA 3FYTA 2PGIA 5IUKC 1ZL0A 3CC8A 3W9BA 4DTIA 2F8SA 2IE0A 4QKQA 3SBDA 3ZJTA 4CGYA 1DAIA 3G8DA 1BWSA 3INRA 4IMIB 4TL7A 5JH7B 1OWLA 1CW2B 4HPJB 3CWQA 3L93A 1EUCB 4OQFA 1FU7A 4ZP1A 4E51A 1TK2A 2VH1A 1RAEA 1F06A 2XUJA 2BUAA 1YZLA 4NAVA 4RJTA 4DV5B 3WWDA 3LKDA 4BQIA 3KLOA 1F60A 2X5KO 5CLJA 4R3WA 3CN9A 2F00A 1ESCA 2IDKA 2VWGA 4K86A 1LLFA 1V41E 2WE7A 3P9SA 5COAA 2FPIA 1Z7BA 3V4FA 2XQFA 1W7AA 2C20A 5JS7A 2PL3A 1S9DA 5A9RA 2JGMA 3MJVA 4Q9AA 1KQPA 2EG9A 3LGAA 2BFCA 3UEOA 4WLEA 1WCXA 1LRLA 5A6SB 1P8JA 3RYHA 2W8BA 3EF3A 1HX7A 4GOOD 2IZ1A 4NU5A 5TY0A 2RH4A 5ELXA 4H1WA 4HRYA 3TXAA 1WUIS 4OHRA 2H4ZA 3CGGA 4EHAA 4UFPA 2VXOA 3ANSA 4MS1B 4CDRA 3GJ4A 3N6RA 2Y68A 2C3YA 4P31A 3GLFB 1O89A 1L5OA 4DR6B 3H11B 3L0OA 4FGZA 4QUIA 1Z6ZA 1NA5A 2H2WA 1USWA 1RRGA 2Y1WA 3DKRA 2PE5A 4MR9A 4MR8A 2WJWA 4DY6A 1EWQA 3VKWA 4YDRA 1Y9EA 2DQKA 4DDWA 1JAYA 1VMDA 2Y8EA 4INAA 5EFZA 4JI5B 2AEEA 1K6IA 1QHHA 4I5FA 2WAMA 4QBTA 4DQVA 4UTRA 2F3TA 4JI2B 4ITVA 4ETNA 2D7DA 5AW0A 1L4EA 2PU7A 3NB0A 3FCUB 4ZVSA 2WHEA 2Y1XA 3HUDA 4RIEA 3AKDA 4RPGA 3BAFA 1VPDA 5F21A 1C9JA 1MP0A 1U2RA 3L8YA 1WB5A 2FZWA 4Y98A 1JBKA 1C4WA 1ENPA 1DFGA 1II0A 1IXKA 2AZXA 5K5EA 2C07A 3H9QA 2P3OA 3RFTA 4J3JA 3H2IA 2Q07A 4FMBB 2C5GA 1A9QA 4O5AA 4ETMA 4B31A 3LYHA 4C7OB 4B1FA 4X95A 2C9ZA 2OQRA 3M33A 2UZAA 2I91A 4TQ9A 2PXHA 1E2KA 5CNIA 5KKNB 5H4GA 1JHAA 4OHOA 1E6WA 5BW6B 1RBYA 4CQMB 4EW6A 3HL4A 4QBIA 3UKDA 2ZZMA 4M89A 4GDMA 5BSWA 1CK4A 4ETWA 2R7LA 1XQWA 3BM5A 2AWNA 4WY5A 4JB2A 2F3QA 4KLAA 5CCBA 1OLSB 4LK3A 3LYLA 4DSOA 1XMOB 3I3SR 4FEYA 3RVOA 1AJEA 3CB4A 4QT4A 3AEUA 4F2DA 1FX0B 1MDBA 3E4DA 1GVNB 3NJ4A 1OMOA 3C43A 3QPDA 1KVSA 3UJDA 4BMZA 2JA1A 4BTLA 3F1KA 4U3JB 5KJCA 4OK3A 4NBKA 5A5VA 1FFYA 3D64A 4A2PA 4PO3X 2JHFA 4BNUA 2V4UA 3ACBA 1NW5A 1MCZA 4HDKA 4IYJA 1EHCA 3BBPA 2B20A 2KJQA 3EA0A 3OM9A 3OPQA 4IOJA 4NENB 4YFVA 1WPQA 5E0OA 5EE3A 3K70B 3D6FA 1ZCZA 3TZBA 5AW7A 2FCRA 2EQ5A 1KIFA 1GILA 3CUKA 4HI0E 1DO2A 1BEZA 1WXDA 5BNZA 3JWGA 7REQB 1ACLA 4H7HA 3DTNA 4AY6A 1K9VF 1MC4A 1LBQA 4INJA 3T7DA 4ZREA 3ORHA 4LSWA 3N2KA 2X1MA 4WJKB 2FW6A 4OI4A 5JD5A 2CBZA 1NJ8A 5LJIA 4YAWA 5REQB 5JCJD 4F6LA 2BEKA 1GUFA 2H65A 2WU0A 1W2WB 5BN5A 16PKA 3DH0A 5TVKA 1XNRB 5DTEA 1P9RA 1WB6A 1ZJZA 2Z58A 2FWIA 3A1WA 2AMVA 2P79A 3WGHA 5IDXA 1U9CA 2N3ZA 3ZY6A 4X8HA 4XCQA 5M34A 3F4LA 4EG0A 3WYGA 3LX5A 3WVNA 5G0SA 4ZMRA 4YMHA 4YGYA 2FAXA 2YXNA 1CS4C 5TT1A 5IAAA 2OAEA 3LC2O 3NWPA 1VCMA 3WBJA 4X64B 2VNKA 3ZHZA 5EJFA 3RABA 2ZFUA 3AEKB 1EBUA 4F86A 1NKTA 4QBGB 4IDBA 2HTEA 1P8AA 5ELMA 5HE9A 3MHPA 3WMWA 4QJ5A 4S12A 4W7HA 5K03A 3HWWA 1LV7A 1VBNA 4L74A 1REQA 4UCFA 1NW3A 3M6VA 1AQJA 3IJ5A 1YJ8A 2HO5A 1GGVA 2J5QA 4F45A 1C41A 5JJKA 2CEAA 3ML1A 2Q6VA 2RK6A 4PZ0A 4EKEA 2H1OA 2JBAB 1NV9A 4GLOA 3M9WA 4BTVA 1Z6GA 1SVSA 5C5EA 2YYZA 1G8FA 2HO4A 2OD2A 4V0SA 1XG5A 4C2BA 2OY0A 3PNPA 3ZWAA 4A7PA 5BT8A 1OLXB 4RFSB 2IU4A 3TJMA 1HDIA 1T2CA 4KLNA 4RIFA 4H3SA 4WJZA 2O3JA 2VP4A 2Y1LA 3OLCX 5FI1B 1B0AA 1BJRE 2MR5A 3OTQA 4OGGA 2YRXA 4JLAA 1PYOA 1STOA 4XQ9A 3BRWA 3IELA 1Y8AA 4TRRA 1G7CA 2XYPA 1CTQA 3DE5X 1TKRA 3EXG1 3LCCA 3VX3A 4HXFB 3ZOZA 3IXMA 4KHPB 3GEEA 1V7QA 2AD1A 5DSZA 2VT3A 2YV1A 1NWCA 4GMXA 4DXHA 5KUTA 1E9AA 5A0TA 1PW7A 3BDIA 4NE9A 2V5AA 1TZMA 1Q50A 3N2ZB 5D3KA 2JFBA 1V8ZA 4BLPA 4Q93A 4C30A 2R6HA 2ZUWA 2E48A 4J8PA 1Z68A 3PXCX 3S81A 5A05A 1KY2A 4F3YA 2NXNA 2YINC 3FETA 1NUSA 4I6EA 2C83A 3PTLA 4S2EA 2YHAA 4WACA 5LUBA 1ABFA 4WDQA 5DM4A 1CIVA 2QLMA 1OYWA 2XE6A 3BB1A 4E3ZA 4JLMA 5IN5A 4YJ2F 1LF5A 1ZVVA 5EJIA 1Z4LA 4ZVVA 1FFEA 1XCJA 2Y9MB 1QDUA 1Y98A 3GRCA 4TTSA 1IHDA 3K73O 4ZU3A 3TBFA 4LYEA 3NASA 2QZJA 1ICIA 1N3YA 4OAPA 1PJQA 5CYPA 5HM8A 3KM0A 1U65A 3BF7A 5LXTA 3J80A 4H0NA 1QE5A 4C1NA 1GIAA 2VJMA 2AKYA 5ESDA 1TL7C 2WYIA 3WADA 5D5PA 4FPXA 4YT8A 5CFMA 3I6YA 4NXNB 4TMWA 4DLBA 1RZVA 1DC8A 5EY5B 1GKUB 4JB0A 3TCKA 3OURA 3HCEA 4I3FA 5GINE 2JK0A 2PJRA 1QKKA 2CXHA 2B94A 2PGJA 3SM9A 2CNKA 1FVFA 1NR7A 4MQ5A 5ILOA 1C0EA 2VYVA 5KPDA 1P60A 3IR6A 4DJJA 2GYYA 1UEXC 2ZJ6A 3HMQA 3NHAA 3VR6A 1DU4A 2JRLA 2GILA 3WHPA 4ZA2A 3VC1A 3GVIA 2C04A 2G25A 2XUFA 4NULA 2IWRA 4XDYA 3NT4A 4GU5A 3DXFA 1RLJA 3DL0A 3FUUA 3ZOKA 3FVWA 1E2IA 5L7WA 3B1KA 5A3RA 4CQNA 1DNPA 1G5TA 1M2VA 1N2CE 1PJCA 2ZRGA 1N0HA 1QB8A 3MINB 4IS2A 4OXRA 5CFRA 4YIKA 1ESNA 1HZJA 3CWCA 3PRKE 3GAAA 1LEHA 1TIKA 4DSTA 2VI5A 2OC4A 1M83A 3E9EA 3AWIA 1H5UA 3DOOA 4QBKA 4AZTA 3UB3A 4PGFA 1T1JA 1XJCA 1LF0A 2PSFA 5ILQA 2IV7A 1BZYA 1LDNA 1Z4OA 2CB9A 3N39C 2QY9A 3A4YA 4F4FA 3H0KA 5CT6A 3HI6A 1NAIA 3OOSA 2O6LA 3BL6A 5EJ9A 2G09A 3U9TA 3D3KA 1FPQA 3DC2A 3QEBZ 4U2DA 4CMJA 2PX6A 1Z6QA 3M0EA 4Q24A 1KFJB 1UWLA 3IEVA 3GFFA 1L5WA 4BMSA 3QX9A 5BQFA 1XIVA 2I55A 3DE2X 1FXUA 1F0KA 1IUOA 3EVFA 4FSHA 1PS8A 2EW1A 2QTMA 3RSQA 3ZKAA 1O9HA 4F60A 2V5VA 2I6UA 4IIBA 1B4DA 1U8YA 4R9NA 5IYZF 4LZNA 2HWXA 5MGBA 4ZTZB 3ESYA 3K6KA 1MRNA 3NOQA 3OPNA 1FP4A 4FR5A 4R0NA 3KUXA 3MUOA 4LY6A 2FSPA 2NUPA 3VR6H 1JT9A 2HCFA 2Q4TA 3AC0A 2XB4A 4ZOCA 3O92A 3ROPA 1OYVA 3I3OA 5LU9A 4BMOB 1W5FA 2QXYA 2G17A 4P7JA 2Z5VA 4PO8A 2WNIA 5JATA 1NDQA 4LY3A 1XZHA 4C3OB 2H3HA 1N2CB 4YUYA 4Y6SA 3WGQA 2VHWA 4R84A 4Z9YA 2FY8A 4QGSA 2Y2VA 3RHTA 2DOKA 4V0ME 1C4KA 1TO6A 3GT0A 3D02A 3C85A 1Q22A 4LZPA 2QLLA 3WZ2A 3HJNA 1TCAA 3OKCA 1JL3A 2YBEA 3QU4A 3NBKA 1VKNA 3U4IA 4E4RA 4I8DA 1M34A 1ZC3A 4L28A 1MF7A 4X5OA 3UMCA 1M54A 1TLTA 1GCGA 3ILHA 4A91A 1W0KD 1KDTA 4GG1A 5AOAA 2O2YA 2YC4C 4US0R 1TI7A 1TM4E 2YOFA 3UW3A 5FORA 3A36A 3AR4A 1QCZA 3N76A 3S29A 2VPYA 3PD0A 3W4KA 4EEZA 5M7EA 1ZN9A 1YNOA 2KM1A 3FF1A 3I04A 4PAOA 4TXMA 4TVOA 5AI0A 4C6RA 3FPSA 1VYUA 1AHPA 5A0VA 2UUOA 1T1EA 3OVMA 3F9CA 2J9XB 2HJ9A 2Q4RA 1NVAA 4MGYR 1U31A 3WWYA 3U13A 1XTPA 2VVTA 3JVIA 3NANA 4JYPA 4OKNA 2DHEA 5EQTA 4IOMA 1MHTA 1CUHA 3M6AA 1ZNQO 1T0JB 3IT3A 5ER9A 1ST3A 1YGYA 3HO6A 4MYTA 3Q3EA 3GROA 4CDNA 5FWYB 3U1BA 3NTQA 4GKKB 3N6VA 4P58A 4QU8A 4BLQA 5JH7A 5AM1A 1WA5A 8GPBA 5AM5A 4BLOA 1EUCA 3H3XA 2ISQA 2C88A 3EG5A 2I1WA 2JGNA 4MJ7A 4YRZA 1I6MA 3IC5A 1UJ5A 1Y0BA 4TL9A 3B38A 4AJ2A 3CW9A 2CNWA 5HTKA 2Q3EA 4LY0A 1Z08A 4MV6A 5AI6A 1LTQA 3R09A 3LDUA 4F3KA 3ADBA 3QE2A 5E7IA 4UHHA 2OVBA 3SHFA 3WYFA 4ZYTA 3GFRA 1UMCB 2DY0A 3Q5EA 4WLFA 2B36A 3K2EA 1E2NA 4M0EA 3FNBA 1WXGA 3PDJA 5KQPA 1AG9A 3R20A 4MP3A 3LK6A 5A6SA 2Y0BA 4J90A 5IXJA 4MWCA 2FV8A 4ZJPA 2RONA 3WWCA 1WUJS 2QW1A 3UHPA 1XUOA 2HRRA 3KJFA 2FPXA 1E1QA 2VQDA 4DB4A 4MS1A 1VC2A 3O0DA 3HUUA 3PF8A 2QQFA 3QPUA 3GLFA 5DWVA 1XTUA 3P0FA 5E38A 4XCVA 3H11A 1RQXA 4M8LA 3IULA 3TQQA 4AF6A 5KU1A 5LP1A 1G0OA 3MIZA 1HDYA 3GLRA 3QZUA 1Z5ZA 5C35A 3TOZA 3RI3A 1GTSA 4KL8S 2ZCVA 5TS3A 4TLAA 1UQRA 4E4YA 4IHQA 4BVKA 2V3WA 3FNGA 1U7UA 2QRPA 4QDTA 1PX2A 3DHWC 5J63A 4CL0A 3VSBA 1L7EA 1T3LA 2WVHA 4LHYA 4TLLB 2PNJA 1BMDA 2A92A 2QM8A 4MW4A 2OCAA 1WY5A 4WEQA 1E4VA 3PQFA 3RQIA 4EPRA 1E9VA 1P91A 2FMTA 2HQBA 1VL8A 3TIXB 4TZ6A 2NIPA 1B8OA 1ZESA 1HF3A 4FFMA 4HDAA 4YECA 1SHKA 3IDOA 5IARA 3G1TA 1JNXX 1XCMA 3R5HA 3EH1A 5I9TA 3X1XA 1MJFA 3NIBA 1NVFA 1WF3A 1E89A 3TTUA 1UJ2A 1NRXA 4CCSA 3DMNA 1EVKA 3MFQA 3VR5A 5IJWA 1E0AA 3DJFA 2J3IA 1VHWA 3X1JA 4C7OA 2IP4A 5GIPE 3KAPA 5T3YA 4Q4AB 1NXTA 4YRRA 4JY7A 4CCAA 1R8SA 1KIAA 1ZGHA 2F3RA 2VDWB 4CQMA 2QYTA 1C29B 3U4HA 1VG8A 3M3HA 5KCMA 3ZNOA 2OXIA 2D3WA 3UJHA 3VZPA 2DXIA 3B8EA 1OLSA 4PLWA 3U56A 1XVTA 6LDHA 4ZAFA 3CNLA 4L16A 4ZT3A 1DKPA 2TECE 4TMYA 1ECLA 1Y3IA 2JJ1D 1FX0A 2AJLI 1IRIA 3W05A 4GUAA 1H66A 1Q1AA 3IP5A 4MVJE 4U3JA 3FIJA 5DGXA 1ESZA 2EKDA 1O0CA 3EOZA 4LVUA 3IESA 4XWTA 2RJOA 3I6IA 3EIQA 3VZCA 3I62A 3KOOA 1UBRS 2VPIA 2BBWA 5B5SA 3TRFA 3WNDA 3H05A 2YXDA 3IV7A 1CJBA 1LI5A 1ZN2A 3LE8A 4NENA 2AN9A 1FFAA 4ZALA 3TL6A 2GFQA 3H19A 3ZTYA 4C14A 3LLUA 3HSSA 2BMEA 4EIWA 3PDIB 1LVHA 5TVGA 2F62A 1MORA 3DEIA 4CV2A 1ZNZA 2FN9A 5BWMA 7REQA 1SVMA 3HCFA 2W93A 3WK6A 3JVVA 4TZ0A 5AI5A 1JHDA 5CTAA 1QZTA 3F3MA 1T26A 5JBNA 3E7PA 5K0LA 4YXFA 3WYCA 3SVZA 5EKDA 1MENA 1BYUA 5REQA 1VLLA 2AV6A 3FBWA 3P2OA 3WYDA 3IT0A 4PYJA 5LMCA 1TCUA 2FPWA 3N5KA 2QD5A 1U0NA 3DLAA 2M2IA 4V0KA 3OLZA 1H2AS 2YRFA 4M1EA 3MAGA 1Z3IX 4L4RA 5EZSA 1TEZA 5K3DA 4FR2A 3EWIA 3V48A 1EZ1A 2FN3A 2D6FA 2ZWPA 5BR7A 4ZCMA 5JPCA 2DF8A 1XZPA 4G01B 1D03A 3BICA 2ZIVB 4P08A 2EFGA 4CW7A 1G98A 4JI3B 3K9FC 3EIOA 2H0RA 1KKUA 2P1DA 2C2GA 2H2DA 3L82B 1PZNA 3JQBA 3QJYA 4DC0A 3FSRA 2H7YA 1UEIA 1D1QA 1R8YA 2IXGA 3AEKA 3H7IA 3GMTA 3JALB 4OQYA 2ANCA 2W2TA 2QX7A 1VSTA 3OPMA 4JCOA 5FADA 5LCXA 1CYEA 2G77B 4A0QA 1X7DA 1MR3F 5MGNA 3U7JA 1TQ8A 1CUAA 1T5OA 1QVWA 2A58A 4GZMA 2ET6A 4P4NA 2BHSA 2H7XA 4W9NA 3VJRA 4DM3A 1Z6XA 5EIOA 2JBAA 2R7NA 1HL7A 1VLJA 4YROA 3TQOA 3LFUA 4JI8B 2YY6A 3A6EA 5HG0A 5H82A 1ML3A 1RI3A 3TSWA 3JYNA 4IP0A 1WLYA 2GJSA 2OPBA 2MSCB 1QQ6A 1UWVA 1K6XA 3MUNA 2G04A 1OLXA 1B0PA 3P2EA 4RFSA 5FNVF 5LBUA 4CF4A 4WV3A 3EIFA 1SQSA 5LVAA 1HBJA 5K0NA 2QRKA 4GO1A 4IDPA 3CLTC 4GYYA 1MKYA 3TLAA 4DIMA 3E9RA 1IQUA 1C8VB 2G06A 3K70C 1VDMA 5KI6A 1TM5E 3IODA 1N9GB 2H1HA 4IUYA 3P8ZA 3GVHA 1SB9A 1XEXB 4EYOA 1GO2A 2PXCA 2VJNA 3N53A 2VSNA 3SJUA 3WGJA 1S89A 4P3XA 5ECWA 2H5LA 3AF4A 4L7QA 3F3KA 2OO3A 3EIUA 4TMZA 4UU0A 1GTVA 4C43A 5CFNA 4ZXPA 3LW7A 4L02A 2IBTA 1CR1A 1BGWA 1E2HA 4P38A 4YUWA 2YS7A 5BMVB 3I61A 2IOFA 2NSJA 3TIGA 3ND9A 5HZMA 4TTJA 3N8KA 1YDMA 2UYCA 2XA2A 1W4AA 3GUVA 4DMFA 2BN4A 4EHHA 4EUFA 4B7CA 2C4UA 5LU8A 2SHKA 4DNQA 3UCXA 2BSAA 2Z8ZA 4D6YA 2J31A 1YS4A 4UBKA 5CT4A 4G86A 3RANA 4C6SA 1W581 1Z0ZA 1RS0A 5ALRA 1XRQA 1EFRA 4E5DA 4FFDA 5EJ7A 3F6RA 3N2YA 4BMXA 1V3QE 1QYRA 2PVPA 5KYWA 4UVGA 1MV8A 3MC1A 2BISA 3AOEA 1TZJA 4DLVA 2WICA 3JQBC 4M1MA 4OHMA 4URXR 4FR0A 4ZI7F 4YRPA 4JNKA 1BRTA 3PFIA 3AVYA 2X9LA 3SIPA 3B6MA 3FCYA 4ACBA 4CCWA 5T6BA 2VDPB 5JD4A 3LUGA 2Q9BA 3CINA 3GLVA 2WG2A 5HCIA 1OBCA 5SZHB 3V4LA 1CRPA 4RH1A 3COJA 1BJKA 4K0KB 1N0UA 1F0NA 2GDJA 2W11A 2ZS9A 1KZ4A 5WRFA 2V4MA 1EA5A 1WDTA 1J24A 2KBFA 2QGNA 1L4HA 2Y0EA 3DVSX 3MK31 3O4FA 4LPKA 2ZRNA 5L9AA 1FNSA 1CZLA 3AETB 1UBSB 4HNQA 3O3OB 2R1UA 2VH5R 4OKSA 2HREA 4M88A 3UV3A 1GJRA 1R6TA 1TEXA 3CRMA 3CT4A 3H13A 3HY6A 4Q3BA 5BNIA 5JDIA 2BFNA 3KKEA 4HZUB 3EGIA 3H86A 3M6WA 3PBKA 4I9UA 4QREA 2XHZA 2DM6A 3KPWA 1P33A 4UOQA 5E3HA 5KQGA 5CDHA 4KQJA 2KLBA 2G9ZA 1OD6A 1X7YB 5ITSA 4Z86A 4YRKA 5HVNA 3IAM1 4P3PA 4ZAGA 3T0GA 1PNQA 1NX6A 3MINA 1E3TA 2DGDA 2Y4NA 1V95A 2X42A 4D3YA 1E2UA 4Q9KA 3T5DA 1O1YA 4JU8A 3UPTA 3P1JA 1RYMA 4LXHA 4JHXA 1FS4A 1ZVQA 4AS3A 1FFBA 5EAIA 3H5WA 3UIEA 2ZEJA 4YXWA 4FJ1A 2ISSD 2EARA 2HN9A 4L8VA 3ICPA 1G42A 2Y0CA 3CEPB 3JR7A 3DM9B 1NBHA 3PFNA 1VRWA 3D6JA 5FB3A 4XUCA 3UB4A 1SQGA 2ZGVA 2JIBA 5E3IA 2XCIA 3MJRA 1E5LA 2WKRA 2VDMB 3PHLA 2DERA 2X4LA 3HEMA 1DAOA 1EBFA 1V9LA 5HBGA 1K88A 2X4GA 5THKA 1OIXA 2IHBA 1QJ4A 3ENKA 3EZLA 4L76A 2PMEA 3RS0A 3H65A 1JQ5A 1HE5A 3O03A 5JYDA 1LJLA 2C9OA 2H59A 3H6HA 1BS9A 1ZX1A 2A86A 3OF5A 4K05A 1KDZA 2JZNA 4NBLA 3U3DA 2DB3A 3FYDA 1XHLA 2JAPA 3R8FA 1ORDA 2CXSA 3AOEC 3OOEA 3UOWA 1EZ4A 2OGZA 2NZ2A 3KD3A 1FFSA 3NUGA 4KU4A 4RD0A 3U5TA 1YK1A 4E5SA 2J6HA 4JLWA 4PW0A 5EIAA 1QONA 4TV9B 3DAYA 5ECYA 1ND6A 1S8AA 3QVKA 4Q9IA 4A2WA 4F04A 3OUZA 1WCIB 4FFOA 3CRW1 3OQ6A 1E5VA 3DD1A 3PE6A 5B2ZA 1J9GA 3QXXA 2O3UA 3P45A 3E3OA 4GYKA 5JARA 2ETVA 3AP3A 5DIFA 1N2CA 2W22A 4UHFA 2G71A 5B36A 4I50B 1EEXB 1OYOA 3WGNA 4M22A 1LGYA 3P4YA 1ISHA 4HNVA 4CL8A 3IDZA 3LXUX 4GGMX 4M2LA 5IDYA 5KWEA 3CXUA 2CLHB 2RC5A 3CTPA 2BKVA 3A8TA 5JDIC 2Z3VA 1QDEA 2ZUSA 4FE3A 1KEKA 3GWGA 2VDLB 3U7GA 2OKGA 5AOBA 4C4TA 1NG9A 1U9JA 3STXA 5JANA 3U19A 1M0SA 3C15C 3CKLA 4DA8A 3WXBA 3NV7A 3HK2A 2B5OA 2I3GA 3MRVA 5LBTA 3WAKA 1Z47A 4FZVA 4G8JA 4FYHA 1FFCA 2IVFA 3Q3GE 1BQ4A 3DF9A 3DXXA 4IR7A 4GLLA 1PBNA 4I9HA 5T4EA 4OA5A 3EF0A 2AB0A 1GLGA 2GWHA 4P3YA 3RRYA 3IBYA 1A7AA 3MOIA 1IBKB 2TSYB 3K9GA 5L3ZA 4CF5A 4LBZA 3VOAA 2SKDA 2Y67A 5AMXA 3RFCA 1I6KA 1RHRA 4P3KA 5FWYA 5DM1A 4ZCTA 4J2HA 4BJ6A 1VJ1A 1MJGM 1UPUA 4D45A 4JJAA 3FJOA 4MINA 4RF2A 3MMPA 2QM7A 3T4PA 3GEIA 4MVJP 4BMDA 3MIIA 1DDIA 1NMQA 1DCFA 4IMRA 3DZJA 1JKXA 4C06A 4GOLD 1OX4B 1F5NA 4V0MA 3C7AA 2FSGA 4Y18A 3T6KA 3D8UA 4O2RA 3RRNA 5E4JA 1WF6A 4I9FA 3HUEA 4RADA 3QBDA 3I05A 1LLDA 1Q3HA 1HT0A 2YUTA 4O1MA 5JWHA 5IG2A 3PC6A 2CNLA 1EH5A 4HO1X 2DHCA 4XRRA 3ZGOA 1O8BA 4B3DA 1UMCA 5BW5A 1ZDMA 3L4JA 1X1CA 2CVQA 1EMDA 1R4NB 4FYXA 1XZMA 4K40A 5FHRA 1YI0A 1PGJA 4MV3A 1MNAA 3DFUA 3HKEB 1MV5A 2RGXA 4RCVA 3JV7A 4O2BF 1PBTA 1WXHA 2FCAA 4E5NA 4GSLA 1JMYA 1ZD1A 3C3DA 2XSZA 3MMZA 4KI7A 2PJUA 4TLMB 3SIRA 2VJKA 5ILGA 4F5ZA 5J59A 3PUZA 4N3AA 4LHVA 1QLHA 1KI2A 2V9PA 3DA8A 4HATA 4LDJA 4CN8A 5JTUA 4EYQA 2X7XA 3IAEA 4N6OA 1IZYA 5ISMA 4MUFA 1BKSB 2O7RA 1YT5A 1RFLA 2H4XA 9MHTA 4GGPA 4XLTA 1QH1B 3IQHX 4CQJA 3CH7A 3DUWA 1B8VA 1I7LA 4GKBA 1WUTA 1P2VA 2XXBA 3X2SA 4CT0A 4LRXA 2WTEA 1K3TA 4EA9A 5I48A 1RLUA 4PYKA 4B85A 1NQ5A 3I6ZA 3AB8A 3A9RA 3PQ4A 2V7WA 3EW9A 4L50A 1OZHA 3RUHA 2ZBQA 5B7NA 3WICA 1QV6A 1ORIA 3OX4A 3SX2A 1T13A 3DV0B 5LP6F 4U9UA 3FSJX 2OYRA 3BGOS 5SZJA 4HC4A 2GPYA 5HS4A 1X1DA 4M9SA 3O8RA 1FZTA 2DFNA 3ND7A 3UUFA 2DX7A 3OH8A 2QHXA 4MIEA 2GTPA 3FNHA 1NJFA 2JEOA 2JGDB 4P2BA 4L8LA 4PBRA 4X44A 1NW6A 1QK4A 3TPCA 4A1FA 1QAOA 3FPJA 4H7PA 2F90A 1K1EA 2P27A 4RZUA 4Y2XA 1J0BA 4YV7A 4NCNA 2RGAA 4DBZA 2CXUA 3FKSA 4K9NA 1IRXA 3RC3A 2JD2A 4Q4AA 1E2DA 1XI2A 4NMXB 5AKLA 1KEWA 3KOUA 4MZDA 5F3RA 1GSAA 2ZAOA 1UIRA 4EFDA 4BFCA 3BG5A 4YUZA 2VDWA 5BR1A 6PFKA 4DMCA 3L06A 3M1LA 3LHDA 4N03A 5EWLB 4EK9A 5EJ6A 2AOXA 2QL7A 4E11A 2WWFA 1KJYA 4HVAA 4KV7A 3AHGA 4E5UA 1W4RA 3WK4A 5C7LO 1PZXA 4AP6A 3PK0A 3ZGXA 1BHJA 4CRWB 1T34A 5JY1A 3ZHRA 3WP0A 2I9PA 2Z5LA 4LZLA 5FTMA 1O03A 1BN7A 3CLRD 4R9VA 3LLVA 2I8AA 5CNKA 5SV2A 5HUJA 3HL0A 3W34A 2WMYA 4XLLA 1PIWA 3BDAA 4J16A 5EIWA 1LCIA 3A4NA 3QQ5A 3VTZA 1V3VA 4KIWA 1SBCA 2R66A 3AY7A 2O7QA 4MR7B 4HNTA 3PDIA 1Z5OA 1WIWA 1TU0A 3W6NA 2FVYA 3U3OA 5HIAA 1QNLA 3DPIA 3C24A 2EZ4A 4KB5A 3F96A 4M1WA 3DMPA 3PRYA 4UUMA 3JZDA 5GVRA 2P2YA 4XWGA 1RQ2A 2Z8YA 2AJ8A 1KI6B 2BTQB 4CIAA 1JFVA 1KH3A 3OQHA 4RLFA 4WIAA 4D3DA 5L4SA 4J29A 1N2IA 4B6GA 3TGLA 1VHDA 3WYNA 1J20A 1E1RA 2PWZA 3FUWA 5ALUA 4O29A 4UCQA 3OFNA 1KL7A 3NRBA 3P9YA 2QUBA 1OFGA 4GI3A 1ZIPA 3A26A 4Z0TA 1YBVA 4HR7A 2Q2NA 4MVYA 2EYQA 1P6UA 4QHYA 1P72A 5CVEA 4EZBA 2EJTA 1RZUA 4HV4A 1Y3CE 3DDUA 1D2AA 4L5AA 2ZTSA 4YWHA 1A4UA 4HN4B 3SG0A 1WNTA 1RRVA 1X74A 2PS1A 3JALA 1NV8A 4GP9A 3AR5A 1U81A 3ESZA 2I76A 4MVJA 2GCEA 3PL1A 5ICGA 3V4OA 2WT4A 2P2LA 4YRLA 5IBPA 3IEIA 4K2AA 4C7MA 4EWLA 1QKIA 1HL3A 3K6JA 3WKEA 3OECA 4LVCA 1TF2A 4P81A 2FKNA 3IP9A 4N7BA 4V03A 5SY4A 2Q3CA 3EEQA 4DAEA 3NH6A 3MJFA 1TMYA 1FYEA 3STYA 1ZGCA 2DPYA 3U2QA 2DJIA 3VI3B 3QE4A 3WLQA 5T4FA 3IQWA 2O05A 3LHSA 3SLGA 1UKVY 1CB0A 3SQDA 1V2GA 4QYMA 2YOGA 3OKFA 1JDNA 4NPHA 4A82A 1FYFA 2GX6A 2KB0A 1Y8ZA 4XH9B 5DLPA 3KU1A 4E1AA 2A4KA 4J16C 4Y8VA 3RYIB 2IUSA 1J06A 1Z2EA 2HJRA 1N5KA 3EVEA 1N9GA 3IBFA 2ODAA 4O59O 4G6ZA 3D1JA 1QR2A 4GDFA 3SXJA 1Q3TA 4JXKA 5HKBA 1XEXA 4HK4A 3I83A 4D4GA 2ZRJA 3H42B 4S1WA 4BLTA 2R65A 1ZGBA 4WXHA 1G0NA 1ZGJA 5IHPA 1KQFA 3EVCA 3OTOB 3KKPA 1ZI6A 4I08A 3ZJVA 4EHLA 1R27A 1GAJA 2G9QA 3WKBA 5JR3A 2FUG1 2A7QA 5HQJA 5BMVA 4MLDA 2XTJA 4FQ7A 4EFLA 4Q3DA 3RIMA 2GQ0A 1J6UA 2Q50A 2ZRCA 2P9CA 3QUBA 4NFSA 3AF3A 4NH0A 3E23A 1G8PA 5J1TB 4CTNA 4MVJH 3WXMA 3C7TA 3TGPA 4Y9SA 1Q0PA 3V2UA 1M7GA 3CKYA 3IOEA 4J0EA 4KR7A 1HRDA 1ZAYA 3W5BA 4BAGA 3R3JA 2AOVA 2D1YA 3N8DA 3P32A 3A1DA 1T25A 2QTVB 4M38A 3KBBA 2MR6A 4AMBA 2PFSA 3WQBA 2PBZA 4ASUA 5IRCD 3EWAA 1SVWA 1V8DA 1VM6A 4FOSA 3PD7A 4YPVA 1I01A 1HY3A 1NIJA 1Q1GA 3HGMA 4XPIB 1KK1A 1T5HX 4AAYA 4PN7A 2OC9A 3MT7A 4QBHA 2OA0A 3DBRB 3TVDA 3H1AA 3W1VA 4GPD1 1U0OC 2JFOA 3E9YA 1QGZA 4PY2A 4DDKA 1G4UR 4R6XA 3LCUA 1CQJB 1J1IA 1YH3A 4MKIA 2V1XA 3N59A 4IXMA 3THSA 4CUZA 3OM1A 3GJ3A 3TZEA 3A6FA 3I01M 3EHEA 4NF2A 5DVZA 2PUBA 3FGZA 3AETA 1JEDA 1YZVA 3JZFA 4XQ0A 5AW4A 1I3KA 2H2FA 4B80A 3W04A 1LDGA 2NZJA 2ZWIA 4P3NA 2AD5A 4QFDA 5FFFA 3L41A 4MCAA 4HZUA 3RYFB 4BNIA 2W42A 4NBSA 4YJ2B 1LPNA 1O6BA 3QPWA 3TFWA 3L6RA 5KB3A 2JJ2D 4O1HA 2VDKB 1X7YA 2D5BA 4ESEA 3E1GA 3TTYA 1PZMA 4C0WA 4PAGA 1BHSA 2W6ID 2KYRA 2OM2A 5KTPA 1W29A 2A5DA 2XD9A 1XKXA 2AYZA 3BCSA 3GZJA 4R71A 1H23A 1Z0SA 2ZRPA 3FTCA 1D3AA 3JATB 3Q6MA 4R2HA 2VHTA 4WN9B 4YRQA 4C20A 1IBMB 4YV0A 3S1AB 1H85A 2ZZNA 1A7JA 1QJCA 3GD5A 2OB1A 5C8YA 3N8IA 2ACVA 4FUTA 1GZHB 3SNHA 1V4NA 3VPDA 2QRQA 2Y1FA 4D0NA 4XX0B 1RI5A 1HFKA 3BIJA 5B3JA 4QOGA 5I4CA 1DOZA 4CEIB 4YIHA 2CJWB 3O8CA 1GNRA 4HL6A 4U2KA 2IYLD 2VA8A 1SHTX 3KPJA 1R0RE 3FPGA 4ZRNA 4HNAB 1SG9A 1Z5GA 3KUDA 4GXRA 4L4ZA 3W8EA 1GPUA 2AW5A 1LD3A 1HLFA 2AZDA 4HN2A 1BQEA 4WA8A 5EUBA 2C96A 4IEIA 4ZCPA 5E9AA 3IH5A 3LIIA 4FE7A 4R9UC 5FBRB 5L3RA 3DOCA 4XTRA 4TV9A 1OV6A 2BI4A 1P2UA 4WLVA 2IP1A 1WCIA 1XZKA 1WMSA 4JSTA 2GKSA 4RHCA 3QUTA 1OPXA 1LK7A 4UD6A 2QSJA 2ZE8A 4GR9A 4K5QA 1G6HA 2DU8A 4OYLA 2H1SA 2VT7A 2P4QA 4I50A 1DBQA 2IY9A 4BNYA 4PC1A 3AR2A 4FYJA 1H0RA 1I8TA 4QODA 3TFQA 5I7HA 4FSXA 2QS9A 4R1LA 3OWXA 3KOYA 3RT7A 1DKUA 1VZ3A 5ALSA 5EXPA 3QVOA 2P4EA 5AICA 3ZHSA 4IJUA 4GW3A 3GU3A 3H18A 5CVUA 3OZUA 1N5JA 2BIFA 4DCCA 1Q6YA 3C8MA 3DL2A 3JASB 1CHDA 2GM3A 4ZFNA 1PEYA 2K87A 3WI7A 5CDSA 1L5SA 5IYZB 3D6AA 1VYTA 3A4VA 1Q0SA 4XIFA 4YEDA 2CHEA 3VPHA 4EL5A 2WAAA 3D7SA 1KZGB 4QUHA 3T8YA 1DHRA 5DKFA 3TZ6A 1GR1A 2VXYA 3GVCA 2VQFB 4FYPA 4BNDA 3RVKA 4N5DA 2QRNA 4FKZA 4R1UA 4EP1A 1I7PA 2LUOA 4PLCA 4X1OA 1N2HA 4JOQA 4X54A 1CYDA 2GM5A 4X93A 1BE6A 5AUQA 4E70A 5DNUA 1XZQA 5ITZB 3EGVA 1HLPA 2ZSJA 1D9ZA 2CVFA 2B6HA 5F78A 5B3JC 2P6MA 1Z88A 1KRWA 5E3JA 2IYRA 2EKZA 3R2JA 3ZCVA 1AXGA 2CVZA 3K0SA 2CCJA 3E3NA 4FGJA 4AURA 3NW9A 1ZVKA 2IF2A 2XOEA 3FKJA 1JQAA 2AXQA 2Q3JA 3KHKA 4G67A 3IAS6 4PLGA 1OX4A 3TE7A 5BWLA 3PGA1 5C8ZA 2J5RA 2REQB 2R6FA 5FOXA 3UNXA 1RM0A 2GASA 3ORQA 4ND6A 4TTPA 4YJKA 4BWFB 3AJ9A 1WQ4A 4DSNA 3MT0A 2PN1A 4FFRA 2O4UX 4JQYA 3W9YA 4D9CA 4E5PA 4GSKA 2GN6A 4UAVA 2BM0A 4MKGA 1XWFA 2VRCA 3MGAA 2WUFA 4KQEA 4BNWA 4BZPA 1JFTA 3GB9A 1G3UA 1CJSA 5GQSA 2JW5A 5D00A 1R4NA 2HHAA 1GNQA 1QVVA 1XDZA 2NSDA 5E95A 5I7AA 4DM4A 1L4YA 3ZS9A 3HKEA 2FR1A 3QX8A 2XB9A 2FG6C 1Z18A 2JLBA 4I2VA 3V34A 3HFRA 2XUZA 3OX2A 3B7PA 5HZKA 3KHSA 1MAVA 2YL2A 3VU1A 1XD2B 1K63A 2BFAA 3R3YA 5K0CA 3K9QO 5TPZD 1Z73A 4RVFA 2PMWB 4AN0A 1N92A 2F8TA 3BD9A 5K0BA 4N49A 4ND7A 3ELYA 1A3CA 3ABIA 1QH1A 1XJWA 3TF5A 2H2GA 3TNYA 2XH8A 3GIWA 4AC9A 3IAHA 2QE6A 4FIDA 1V3TA 3R3SA 1W1WA 5EZYB 4Z6KA 2VUHB 4LJ7A 2P3LA 2JFWA 3EIWA 1S2LA 5AP9A 2XUIA 1JKMA 3IQGX 1UL1X 4GOMD 2IUUA 2C9YA 4HZGA 3R5FA 1IUPA 3UKOA 2GM4A 3DV0A 5AW1A 1EGAA 2P9GA 4KHZA 3K7EA 4YAKA 5IJZA 4LYJA 4QFMA 3B3FA 3CJTA 4M1OA 2VWPA 2XE7A 1GG8A 5KNCA 2XT0A 1KHHA 3FTDA 4RULA 3C98A 1XAHA 2NXJA 3KXKA 1K7SN 4MLZA 3UMVA 2JGDA 4LCBA 2ATXA 4DLWA 1VE5A 3CISA 1HV8A 3LS2A 1K0FA 3GQVA 3D7KA 3ONEA 4HYQA 5LB4A 3U9LA 3K6RA 5JS2A 5GZ1A 4MGEA 5H02A 1BJTA 1N2OA 1Q84A 2ZR8A 5BW4A 1Z15A 1G19A 2R8EA 3NC0C 3KEMA 4LRSB 2BR3A 2EKLA 3AOGA 3L43A 2VJDA 4HDQB 3H84A 3JARB 4AQ7A 4PSCA 5JT1A 1LRJA 5EWLA 5JADA 3IURA 2G1JA 3NBFA 3ITNA 3B1VA 3LP8A 1L3IA 3LPLA 5IM4F 1DJNA 1MFPA 2R96A 1GRQA 3GCXA 5EZ6B 4ZT2A 3UGJA 2JD1A 4KE8A 4EO9A 4K6CA 3DLHA 5L8VA 1UUFA 4QU0A 4GM1A 2PRKA 2WKQA 1QRSA 4MKXA 1C30B 3JWPA 4IIXA 4QSHA 2YXPX 3AKEA 1MUUA 2XE4A 5F73A 2Z2ZA 3U4QB 4OLBA 1W75A 2PZAA 2IUTA 2YMQA 1S96A 5THQA 1T43A 2CK3D 2GD0A 2XNHA 3ER6A 1NQVA 3QVMA 4YQFA 3FSGA 2J3EA 5AI4A 4N47A 4YN3A 4MQLA 3IB3A 2QT0A 3IOBA 3BKWA 4MR7A 3OMLA 1N1GA 3R3HA 4N65A 3IDAA 3OIFA 1TM7E 3IQDB 4EX7A 4KCGA 4R5MA 3WGOA 5KNCH 1IBLB 1RYFA 4ZQBA 4YP0A 4GVXA 5T3UA 1UFKA 2MSKA 3FCOA 1E32A 1I9GA 2YMMA 3LPDA 3JQAD 1N2JA 2R6GA 3QYJA 4XD7D 5CLIA 4PSAA 4H0FA 5ALPA 2PS3A 3NDBB 1KI6A 2BTQA 1PFKA 1UWKA 2Q1TA 3NIWA 3KPVA 2Z8XA 3TVTA 3CRQA 4QWWA 4IWYA 2WKSA 5F5NA 1EAYA 4B3MB 1ESMA 5BPHA 1PNOA 2C7BA 3KAJA 3PUXA 2F9LA 3EWNA 4N18A 4OFXA 3DEYX 4O4HF 3FRJA 4JUAA 4HTAA 2GN4A 3P0EA 3BSFA 3MBIA 5EJGA 3HLYA 1MH1A 4ALLA 1UZAA 2ETXA 1MX5A 4TTQA 3ZUGA 3N87A 3O91A 4RKEA 4ALIA 4JD5A 2JBWA 4Q9DA 4F8JA 4MCHA 4UEKA 2ZUTA 4OQNA 3I9JA 3LBAA 4J0JA 1E1LA 4EMSA 3HR7A 3G85A 3QX3A 4F91B 5KHOC 2R8OA 2NADA 4RKFA 1M0EA 1EK1A 1U2EA 1Z62A 4MMXB 3D6UA 1T3SA 1WVIA 1MB4A 3HN2A 1NT2A 2P5TB 3FPBA 4BKPA 2EAUA 1WU8A 5BWOA 1RWKA 2H48A 2ZUDA 3L7JA 4ZN6A 4ZHQF 2Q45A 4DNXA 5I7OA 3EOAI 4G0UA 5E1DA 1P39A 1VSUA 4I4IA 3HY4A 1B3RA 1W4ZA 1OGIA 1XN4A 2JFZA 1RTTA 5H4HA 2HK7A 5AVOA 2ZULA 5H5JA 4QQRA 3WOVA 2JLUA 3RFVA 1QHFA 2FPMA 4J0QA 4MA4A 1Y1PA 3L7MA 4G4SP 4R2XA 2AG1A 3KT0A 1RJDA 4NJMB 5I4KA 5I8WA 2AUTA 1M8GA 1KGSA 3PXBA 1P0IA 4K9KA 3UAZA 3GFPA 5AKIA 2VP5A 1KVUA 1FUEA 1QFSA 1QPBA 3GUHA 4BATA 1Y1TA 4R3NA 1NE2A 1ZK3A 4KQIA 4QO8A 4JEMA 1PO7A 3F5DA 4BNJA 1T9BA 3RYIA 3TOXA 1JT2A 1CRWG 1OTXA 2OCYC 3A1UA 3EMDA 5DSTA 4RDXA 3W3ZB 2CXRA 2C7RA 1JU3A 3EQ2A 4MARA 3MJDA 3SEAA 1BFDA 2G67A 4EVQA 1E4YA 4A6DA 4HDRB 1UZNA 1ZIDA 2B0CA 1LBSA 3A37A 1BW9B 1VKHA 2IK8A 2R751 4YRDA 1Z22A 2Z6UA 1SKQA 4EUEA 3GUYA 1ZAKA 5TSDA 5FH9A 4P3OA 3D5TA 4HGQA 1NLYA 2B37A 1P7PA 3DCIA 3HTXA 1BOOA 1GL3A 1KDPA 1RRKA 1J5EB 3OWHA 2CV2A 1BWQA 4V0RA 4MRSA 1W36B 1L4BA 2O20A 1X86B 4UDNA 3RVNA 3BULA 1PQWA 3AM4A 3V6MA 1VMKA 1JTFA 2QTLA 4JJFA 2A9KA 4KRXA 3A28A 1ADFA 3OQMA 4BN5A 1D09A 4H17A 2AJDA 4LTNA 5FHQA 3S28A 1IBCA 5F4ZA 2QTVA 2HUPA 1SU6A 1Q0HA 4G1CA 3Q7QA 1KWKA 3OLWA 3S8MA 3KKOA 1RMYA 4NCBA 1QAMA 2DLNA 5I7VA 3WA6A 4BDSA 3USZA 5L4NA 2K5UA 5DP2A 4O4LB 4XPIA 3K9HA 1BA3A 4K8OA 2IJGX 3L6BA 3LUKA 4OXQA 2BTOA 3DBRA 5COQA 5E6SB 5TB5A 2PKQO 3ZVLA 1INLA 1K98A 1T0HB 1XGKA 4PZ9A 5EE0A 1CQJA 1JAIA 1RIIA 3G6KA 2HU7A 5AXCA 1P2GA 1W8IA 1E8MA 5BV8A 1PR5A 2JAOA 3OQOA 1FNNA 1RWWA 4QG3A 1JPVA 1LI7A 1RR6A 1RFGE 2OL4A 3IE0A 2ARKA 1NVXQ 3C3WA 3HJUA 4GMKA 2DWQA 4OBBA 5E1BA 5LQKA 4DOMA 1TTQB 3AY0A 3QOFA 4I5IA 3RYFA 2IEYA 2A0UA 1YTLA 2IV2X 3PCTA 1C9NA 4YJ2A 1YU9A 1XTKA 1W48A 1B26A 3JRNA 2Y1OA 1Q15A 1U4OA 2CFSA 3QY9A 4JP2A 4UDYX 4MPJA 3TSOA 3U37A 1M2GA 3HWX1 5BV0A 2QTRA 4PTYA 3A0UA 1A96A 2FFQA 4D42A 4LOIA 1HNZB 1IOVA 2PQMA 3OTIA 5DGHA 1DE0A 3QWIA 1M72A 2E4VA 3HADA 3GX1A 4EHKA 3GELA 4F38A 5EIHA 3T0IA 4PTZA 5IVIA 1LPSA 5DOZA 4A8HA 3U0BA 2BJWA 3NORA 3AZQA 3EUAA 4C9BA 3JATA 4WN9A 2IPAB 3LQFA 3DYBA 3F7MA 3KO8A 1T9GS 1V2HE 4NZZA 4RK4A 3S1LA 4LISA 3L1JA 2GEFA 3IPYA 4TM8A 3LXXA 4ZYWA 4KVZA 1M66A 3FPKA 3QOWA 4OAQA 4CTMA 3SQXA 3MD9A 1R1DA 2YWFA 1EJ0A 4RVNA 1MN6A 4XX0A 3WFJA 2YHIB 5CPFA 4KQWA 1OVMA 3O1LA 5K0JA 3P2JA 4CEIA 2CJWA 4KIUA 1VL6A 5GPBA 5E2BA 3L84A 5FPQA 1JAXA 1M67A 4BQRA 3E5RA 3NYIA 3N2EA 3VRHA 1PP4A 3ED1A 4HNAA 4BAZA 4IYRA 3VAZA 4DIUA 4NZPA 4BDTA 2O1SA 1HYGA 3BFKA 4FI3F 3DHNA 1PSZA 4BLVA 3KS9A 4IJ6A 4YMWA 4RVGA 4KR6A 4B6PA 3KKLA 3K94A 2XRYA 1GN9A 1TAHA 1Y7PA 2XZDA 3HBMA 3NHSA 2RCYA 2X8LA 3BE8A 1Z5PA 1HR0B 1EKXA 3TQRA 2IH4A 4Q3CA 1X2EA 2VT6A 2OBBA 3N58A 1T2AA 1EP1B 2VJYA 3RSSA 1Q2XA 3IAM6 5COBA 2P41A 5DLDA 2GAIA 1OFUA 2GN8A 3G5UA 4Z99A 3CVOA 1GKKA 2JZOA 2PCJA 2M1ZA 3ORYA 5FQNA 3S2GA 4RDHA 5CDYA 1GU0A 4QL3A 1IQPA 2GSWA 2PL5A 2IPNA 1RQGA 2QWXA 3F9IA 1IWBB 5FULA 1HQKA 2H6EA 5CUQA 5AKXA 1R6VA 2VHZA 1R3DA 3GRPA 2FJ0A 3UV6A 2I78A 3DMGA 4TRJA 3SDBA 2J9RA 3OZBA 4MUIA 2C5AA 1QIHA 2FDCA 4IIYA 4X6LA 3V1KA 3EX7C 2BF4A 2C61A 1DKRA 4W9RA 4LZAA 3JASA 4Q6BA 3D4OA 1CU1A 3PUHA 5SYMA 1PT7A 3B3GA 5IYZA 1AQIA 2X5NA 2ZKLA 2QRUA 3ADPA 4JEHA 5K6RA 1EUYA 2WM3A 1CUGA 3FX2A 2AE2A 3R3VA 1BX0A 1JVBA 3UPDA 2CSUA 1E94E 4JKYA 4HWRA 3MQ2A 4ISCA 2ZIXB 1FTNA 3PD1A 1S01A 5IT0A 1IXRC 2PBFA 2IS4A 5KO2A 1CQIB 4LJSA 1UPCA 5ITZA 2QD1A 4E5YA 3FPHA 4OGKA 4HT3B 5DN6D 5LMNB 2JIDA 1BKYA 1E4EB 2H17A 5JCOA 3AJEA 3GZTB 2HU2A 2VFAA 2J3LA 2FB9A 3BWBA 3GN1A 4U2CA 3U3XA 1AKMA 4MUXA 3EGXB 2JJQA 3LT5A 4K9LA 3THOA 4MYCA 4YCBA 5INTA 3A1SA 1ID8A 2OSBA 1YR7A 2CYAA 2FW8A 5ARDA 4IIUA 4L6AA 2GEJA 1CUWA 2REQA 5J2TF 3PLAE 1Y3AA 1Q7BA 4OGFA 5CFOA 4FMDF 4RJLA 1M6YA 1ZD3A 4QOHA 3W2IA 3ZDEA 5JCJA 3ZWPA 2OORA 2VYND 5DM60 4BECA 2RKOA 2RBGA 4GXTA 4QXQA 2RI0A 5EJ4A 3STUA 4RQUA 1V5FA 3UYKA 4AUNA 4CHTA 4IX9A 4UOZA 1WX1A 4MUKA 1CXZA 1M1ZA 1ZR4A 3KVOA 2R1ZA 2ZYGA 5IH7A 5K0EA 4CYMA 3PEFA 1C3XA 1G8GA 2H11A 3L8MA 2RAPA 4PSUA 4G4GA 3ETDA 2OVFA 4F9FA 4H7JA 3KJEA 1U2PA 1XD2A 2ZJ4A 4W63A 2N42A 4EPYA 1VP9A 2WQ7A 1GU7A 1KI1A 3G2OA 1G6Q1 3JXEA 4I4NA 4C7BA 1H4QA 5EUCA 1T10A 2WB2A 1D7AA 1E3JA 4ANFA 5LP6B 2Z2KA 3QUCA 3QV2A 1ZGAA 1U7OA 1VJRA 3KJHA 4FOLA 2XGMA 5CB6A 3ZV6A 4P83A 5EZYA 4HEA1 4D3SA 3K1TA 2EF1A 2VEOA 4S1NA 2QW0X 3QSGA 1G38A 1SC3A 2JCGA 2FR0A 3AHIA 3N07A 1J23A 2BM9A 2QYOA 2HBQA 4NDZA 5FJIA 2WWGA 4KITB 3E9CA 1W1UA 1RC0A 5FFNA 3V5NA 2XWJI 2ZB3A 4JR0A 4U2FA 5BVHB 1WUKS 4AWBA 3LTEA 5SZIA 1I3OA 3A9CA 2BHTA 4POAA 1CUYA 2VDUE 4YMVA 3OBBA 5CHYA 4MGIR 3TTVA 3ZWVA 3H7AA 1UQUA 2B4AA 5MN4A 4MUNA 4W6ZA 4M49A 5ESXA 4ZDJA 2B4TO 3RUCA 3Q6IA 2PX2A 3CS3A 4L3OA 4UM9D 5CM9C 4X41A 2OENG 3SMVA 4B87A 1PGQA 1YRAA 5F2NA 2W2XA 1SXJC 4KX3A 5B2FA 5KSOA 1VGRA 3JARA 5EP4A 1F3LA 1TZBA 4CI0B 3V4SA 3MRSA 3FM9A 4GR5A 1P19A 4YRFA 4FFSA 2QLJA 2X1VA 2OORC 3HVHA 4FXPA 4LG1A 1KYWA 4JVNA 4LYYA 3Q7RA 4TKMA 3BJMA 3M3DA 3FMGA 4TKUB 1JIKA 3G88A 4Y2TA 5D7NA 3U4AA 4YCNA 1AS3A 2RHDA 3CZAA 2OBXA 2OSVA 1AO3A 5AVYA 2WC1A 1C30A 2EJUA 1NVBA 3KNZA 1NYLA 1FEZA 1UBUS 1Y48E 3LRTA 2D8AA 5TQVA 3R7DA 3ZWBA 1AB6A 3U4QA 2VPZA 1EDZA 1EGMB 1QTIA 2AMFA 2P75A 3RYTC 4AUEA 4CKYA 1GGKA 3DBHB 3MERA 5M2QA 4XARA 4OD0A 1CETA 2VHXA 3WZMA 4UJ5A 3E4CA 5K3SA 3INNA 3QW2A 1H2ZA 2JVJA 5HHTA 3RS5A 2GBPA 3HYTA 2QMOA 2HIHA 1G5IA 4BKRA 3CUUA 5L95A 4YMIA 1XHFA 3AL2A 4MUEA 1PT6A 4A92A 1S2GA 3U7IA 4TSFD 3PLRA 3E3AA 4BX3A 5DE3A 1UINA 5FT9A 4ZOLB 3UTCA 3I4FA 2FUNB 3NS7A 3PNBA 2PUAA 2P5YA 3D7MA 4GLFA 4C7KA 3GPDG 3I9KA 3LBHA 3NHKA 1ODFA 2WAYA 1CZOA 3LVBA 2GHRA 1YIAA 3O4IA 4N40A 2ZSUA 5KSPA 3U3RA 3E8SA 1XMJA 3D2LA 3NC4A 4Y9RA 1NLFA 3ELUA 5E7JA 2IW1A 2Z04A 2GHTA 4GICA 4P36A 1BWRA 1M2KA 3QJGA 2JEYA 2OGWA 3IP3A 3CFYA 2IEBA 1EUZA 1FYXA 4QOEA 2VUTA 4C7VA 4ZV4A 1LUAA 2ZIZA 4UOEA 1BNCA 1W8DA 1MC8A 1X0XA 4B5LA 3D1VA 4W1RA 2VHQA 5IT5A 4LMRA 4MUMA 1O95D 3E0XA 3MAAC 3I5AA 3KJZA 1G21E 3Q1LA 3SC2B 4J4BA 1HRKA 2BMDA 1A7UA 4ZICA 1UAGA 1P18A 4J0IA 3LVQE 3GC6A 3S44A 3WTBA 4ZYLA 2JI9A 2CXOA 2DWPA 3CLUD 4OUDB 1ZP6A 4EHIA 3K0BA 4L07A 4UNPA 3RS3A 1OU4A 4NZMA 1CQZA 2V65A 3B1XA 1HGXA 4FYIA 5DLEA 4BFWA 5LLDA 5M5BA 2O8BB 3EDYA 3IKVA 2H1RA 3MQ4A 4MWSA 3ZDRA 1ORTA 1PLLA 4DREA 5FTKA 5ALVA 2R8BA 3NV9A 4NJMA 4ONEA 1I4LD 1U0JA 3LHIA 1ZNYA 2IEGA 4DDMA 5JPDA 2GK6A 4B73A 4TWIA 1TZCA 2NQ2C 5G40A 5C4GB 4J1SA 1L2TA 4EY8A 5JC1A 3CQ9A 3IBCA 3H2ZA 5AQEA 1XTBA 2AW3A 4I1VA 3PWKA 3RC9A 3KAKA 4PRZA 4S05A 1ZUD1 2ECPA 4QDUA 4MVJG 5DHPA 1VKZA 2HRZA 4EITA 1V25A 4JS0A 4OHVA 2C5BA 4ZK6A 1TPZA 2X7JA 4FILA 4QWMA 3TLKA 3UFBA 4XUEA 1JJFA 1JLLB 1HE3A 4KMRA 2R62A 1DINA 2RHBA 2V98A 4G23A 3OC0A 4GWLA 2WJVA 4HDRA 4OK6A 2MDTA 1CZUA 1BW9A 1SCNE 1ZEMA 2ZWAA 5FL7D 3VUFA 1IY8A 2IYAA 3NVAA 2P68A 3GGSA 2HA5A 1JMKC 2HY7A 4FFBB 2AN1A 4D4JA 2Z9BA 1TT7A 1G21B 1AUQA 3A05A 1P31A 4G63A 5I9SA 4ZEXA 4LFCB 2DUWA 2OWEA 2QL6A 4CL3A 1AMOA 1T2NA 2GO7A 3EWSA 4RHEA 2V0GA 2A5JA 2XQJA 3CZ5A 4NBUA 1XTQA 1H6BA 2H4JA 3EVAA 3H5NA 3UJ7A 1NNLA 3ASUA 1QQ7A 3CW2A 5I7WA 1W34A 1W0KA 2QNRA 3B48A 1C7ZA 1AE1A 4IO0A 2PPLA 3LHKA 4QAJA 4BEWA 3KSBC 5HGXA 2I2FA 3GP3A 1K8QA 3ETCA 4F21A 4XM2A 3GBPA 1GTG1 2ACKA 4K1XA 4B47A 4BQSA 1EVIA 5ADUS 1P80A 4O4LA 4DADA 4N82A 4QTXA 3DLIA 4FZJA 3DDZX 3SICE 4QD3A 5E6SA 2JJ8A 1RXWA 2WYUA 1AC5A 3I1FA 1B73A 4HQOA 5LKRA 3PEYA 3UJ9A 3FKQA 4IJVA 4HB3A 1Z37A 1PYDA 3GGOA 3HB0A 3Q85A 1FE8A 3WOHA 2QORA 3R5TA 1KARA 2C0CA 3LCJA 3DBLB 5CT8A 1RDFA 2IHZA 5ER6A 1R18A 2WIGA 4IQ8A 3HVKA 5TLSA 4G37A 3VDMA 1QYDA 5JSHA 4X60A 1Z0FA 4GMHA 4X62B 421PA 1NATA 1RJWA 2KE5A 1L6IA 3COZA 3R23A 4B9EA 2D0PB 2E5FA 1L7OA 3KKMA 4M0LA 5F4BA 5IKXA 2B8WA 4Y0NA 4Q4LA 4FW8A 1LC3A 3VNVA 4DJTA 1Z5VA 3E7FA 2PO7A 2A1TR 2BJHA 1J9ZA 4OM8A 1JEQB 1WY7A 3WNZA 1KBOA 1XK6A 2FOLA 3FTQA 4HXEB 4JJKA 5SZKB 3TDMA 2H5JA 2NO5A 3IQFA 1T4GA 5KOJB 4BJ3A 1C9YA 2XVAA 4ZVPA 4ZO7A 4KAAA 1Q11A 1Q77A 1M6VB 4RY9A 2J3JA 2FYTA 3ZVMA 2AUNA 4URWR 1DEKA 3ZE0B 2DUNA 2XF8A 1Y8RB 2PEZA 1NQWA 3DAOA 2JPDA 3CUYA 2W70A 3NZEA 1A0OA 1PNVA 1WDMA 1YAHA 2CF5A 3NJRA 4Q1EA 5GWXA 2XNDD 1BO6A 1FMFA 3FHCB 4LNAA 3FLAA 1OILA 4M7OA 3NUZA 2E7ZA 1E18A 2VK2A 4EUSA 4YV1A 4LQDA 3I04M 5K0GA 3QV1A 3F5MA 2YHIA 1W36C 1WAMA 1W5EA 2WTXA 1TYBE 2XB6A 2YFYA 1JXQA 3BGWA 3DDSA 3MGCA 4L73A 5L51A 3SJZA 5BRAA 5BQPA 1QUEA 2BBSA 3AP1A 1NBOA 4KJXA 5IFKA 3CPJB 3KWJA 1H8ED 1PQ4A 3MGBA 1USUA 4DV0B 3AFOA 2WWIA 5DO9A 2NN3C 3SHWA 1J2RA 2PH5A 1YFZA 4D96A 2BGTA 1N25A 2HBYA 5J4KA 2L69A 4D4IA 3SPXA 2XMGA 5G41A 1ZRMA 4QVGA 4DEXA 4NYJR 4RLHA 1E3IA 1E9CA 5C5IA 4GNKA 1NUTA 4MV0A 2L19A 5C7OO 2RGUA 5JHHB 2W0SA 3GZNB 3ZW8A 4ZT7A 4TTRA 2E4WA 1RHJA 5JJ5A 1CZRA 4CM5A 1IEXA 4COKA 2KS6A 2ZU0C 2VDOB 1EFUA 2FWJA 4DS3A 4A03A 3ND5A 2G1PA 3RAJA 4S1PA 2H5IA 3UAGA 2ZAMA 3BL5A 7MHTA 3PR2B 2V6IA 1RHUA 3LPMA 5FOWA 5FTJA 4BNTA 2ZUEA 2DFVA 4GMGA 1P3DA 2YQZA 3PC4A 3QPBA 2GYVA 2ZB4A 4DR3B 2AF4C 2Z6AA 2XQKA 1BGXT 4RMIA 4WKGA 4LW8A 3MNFA 1WQ1R 1CJTC 3OU7A 1V6AA 3ZS8A 4LWPA 2H63A 3FNEA 1M8KA 3BTUA 4GPEA 1E7SA 1PHRA 5HS6A 1YB1A 1R6DA 4KGDA 5B58T 4K9RA 1NSYA 2NZWA 3BXEA 1C1YA 3BXGA 2QTNA 4BVEA 5DGDA 2JA2A 5DNDA 4EATA 4QXPA 2G5TA 2C1ZA 1ORHA 3B6EA 1R3UA 3SQNA 1OI3A 1RI2A 3EA4A 1J99A 3H1TA 1PUJA 2W0MA 1E9BA 5FPPA 3PZBA 3SC6A 3A6KA 5DHQA 5IM5A 2NVUB 3U81A 4Z4QA 4CIVA 4QM6A 2JJ1A 3KQTA 1FSPA 2Q4EA 1SIUA 1EGQA 1C7JA 2GJ8A 2X9GA 4LC0A 3GJ5A 1ZIXA 2ZIXA 3LV8A 4TWZA 4KR3A 4BQQA 1JKFA 2EBUA 5IWAB 2OLKA 1CQIA 2WUEA 1TEVA 1TA9A 2GAJA 3MM4A 3BE4A 4X6UA 3R74A 2JCSA 2QZZA 3KXPA 2Q4BA 1G64A 2FE4A 3HDGA 5LZ7A 3S2ZA 4YAGA 4Z51A 5EHXA 1OXVA 2AVDA 1GZ4A 2GVDC 4ZMBA 9GPBA 1E4EA 5JSYA 4FHGA 4DNOA 2HK9A 2OAQ1 2JH9A 3LVRE 4UBMA 3VZQA 4EHDA 1GFSA 7GPBA 3EGXA 3DZBA 3ZK7A 1PJ3A 2AQKA 3R7WB 3BGVA 2D7CA 1OZGA 2ZXEA 4Y2SA 3ZLVA 3DDNA 3JYHA 2WHQA 4MCJA 4QXRA 3LWBA 3ULKA 4BU0A 3CVWA 1PR6A 1CS0B 4MW5A 3HG7A 5HTOA 2HU5A 2G7ZA 1EX7A 2R6ZA 5E9JA 4AUMA 1ZZEA 1F8GA 1TO2E 3Q8LA 5IAOA 3ZCTA 2XBLA 1GAEO 3JWEA 1UDXA 1BIFA 2W6MA 2XJ9A 1I2CA 3A58B 1ODCA 4RK0A 2RDMA 1ZO8A 1GA6A 1SKAA 2ZAGA 2ZROA 1YA8A 3E5NA 3GEDA 3OOJA 5FPTA 5IT9A 2X0EA 3D8RA 4B2IA 2I3DA 3N3AC 1CUBA 2PSHA 3D7NA 4QECA 3QEJA 4HGPA 3PE4A 5LDHA 2YHSA 1S2MA 3KKZA 1QS0B 2V8OA 3AUTA 4P35A 5ALXA 5AJZA 3BGDA 4BKOA 3PQCA 4DYHA 3ZGYA 2V03A 2WJYA 2GM9A 2YWHA 2VPPA 1KO7A 4TTVA 2DQSA 3ZZ1A 4KNYA 3EW7A 3W1EA 1T4BA 2DTDA 5FPYA 3VZSA 1NXPA 5LP6A 2AK3A 4Q39A 5F9FA 3FI9A 3HBLA 5F5LA 2IDJA 1TKAA 4XR9A 3RBXA 2X8BA 3NDJA 1UBOS 1Y3BE 5F12A 5LD2B 5F23A 3DMRA 3MTGA 3EVNA 3S5UA 2FQYA 4NYIR 4LJ8A 4P5DA 1I7DA 1PQUA 2BGUA 2NU8B 4EF6A 3BWEA 4DBVO 3BMQB 2AFVA 2C57A 4Z5XA 3JQ9C 1R0ZA 1IVNA 2G63A 3EVZA 3IO3A 5BVHA 3BA6A 4FKMA 4OQEA 2QVYX 1CRZA 1AGYA 1JVSA 2YWBA 2AMYA 2ZT8A 3OEWA 4X1IA 4CKBB 1N2ZA 1RKUA 3PICA 2VNAA 2ORED 2CMKA 4K03A 1WEKA 5F7OA 1AT1A 4YC7A 4E03A 5DBFA 1FSZA 2IIBA 1LKZA 3H2GA 2RK3A 1KEPA 4G0YA 4L9SA 3H8SA 4LAFA 2Z9CA 4RNCA 4UC0A 3VU3A 2FN7A 4BUZA 5JI3E 5KOYA 1G4HA 3NTXA 3CRRA 4KQCA 2JKZA 1FFGA 3DGFC 1G20E 4JOCA 1V96A 4BGUA 1Q7RA 2W58A 5K1ZA 2XYRA 1C7RA 3JW8A 1DRUA 1ZICA 1VRCA 4XSVA 1U98A 4EW3A 4FK8A 3SJBA 5LQJA 3HRKA 4MW2A 4L2IA 4XI9A 3PC2A 1Z4PX 4DCOA 3RAFC 3QVXA 1NVVR 4CR7A 1QV7A 1JGTA 2ID4A 3K9CA 4ENTA 4A36A 3DE0X 4CM8B 1ZOIA 3PIDA 3BWDD 4Q9LA 1I5EA 4BEVA 2ECFA 1U9YA 2BM1A 4TKUA 3ZGVA 2E1PA 8ATCA 1I1OA 1E98A 3LCMA 3HJBA 4II7A 4QUDA 3QGMA 3R5KA 4FZRA 3FDZB 4I8IA 3ED5A 4CHGA 3SMQA 4DQKA 2IHVA 3BFJA 1YKGA 4NYMR 1A9RA 3L7AA 1V6CA 5KWIA 5EJ5A 3DBHA 2IW3A 3G3EA 2AN4A 3OZXA 3VNRA 4C0QC 5CA0B 1RKVA 1EGVB 3PS9A 2ZT7A 4JK3A 1ZOOA 4WNIA 2V0CA 3AG5A 4OYRA 5MN5A 2P3QA 5A03A 4YQEA 1VJCA 3HP7A 3S7ZA 2VJLA 5HYVA 2WJHA 3HJGA 4URVR 1K08A 5LP6C 3AXTA 4U6SA 1KDVA 1P1RA 3T7KA 4AW9A 1QO9A 1SC1A 4N0PA 4ZOLA 3LBIA 3GMIA 1DDGA 3KP1A 3Q3CA 2ZCJA 1DIRA 3E27A 4KUHA 4PHCA 1XQ1A 4HGNA 4TS9A 2QTGA 5IAGA 3W5SA 2X2PA 5JC8A 5A62A 1G20B 4HXYA 1K9SA 4EJMA 2NO7A 4B46A 1EFAA 1U1FA 4H3HB 4JJ6A 4LIPD 1DWUA 1ULUA 1RAHA 3AERB 1A50B 3R3WA 4NBWA 4HDNB 4OH1A 4YUAA 1XBTA 2YH2A 5FL3A 5B4TA 1P61B 4YAJA 3I6MA 4KWIA 1RWPA 1Y82A 4M36A 3FLBA 4DCJA 5BN1A 2NAFA 2OYCA 4KYIB 4W8GA 4YMGA 2P6OA 2Q5LA 3KQMA 4GL4A 3WB0A 1NUAA 1F4PA 4JGBA 3X1YA 1QZ3A 3GVPA 2AQ8A 4HX9A 3AI1A 2ZJ3A 3OZAA 1YMVA 3SC2A 4HP8A 3G2HA 5HIIA 5EERA 1FXWF 4O8ZA 1WZNA 3FZYA 3IIKA 1X19A 3D7RA 3PYXA 2WNHA 3GDFA 4QBFA 2OP1A 3C8UA 4OUDA 1UBKS 3H9BA 2NM0A 4X7MA 4LF9B 2O8BA 4TLBA 3RUPA 1PJ4A 4XWYA 2M6LA 4JQSA 4D9IA 1Y81A 1Z83A 3EQ8A 1R5JA 5TGDA 1QP7A 1CC1S 2ZCUA 3SYRA 5LFAA 1LQTA 2O8FB 1E2BA 3HYNA 3NNNA 2J59A 4J1TA 2AJTA 2XITA 4O4HB 5GJCA 2GAFA 2XAAA 4LZWA 1NGSA 1ISJA 3TINA 4Y2VA 1WNFA 2WJAA 2R7KA 3EB9A 1YD7A 5D5QA 2Z43A 3CJRA 3RJZA 3D3JA 4FKBA 2J5BA 4P2GA 5BYJA 1KYVA 1HT1E 1P0QA 4QYSA 5B3LA 3VNUA 2XOXA 5J43A 3S8EA 1WVMA 2JHCA 4RPJA 1JLLA 4OXNA 4YRMA 1DMRA 1JTVA 3PA6A 1Y8CA 2DTEA 3FHLA 4Z7JA 4X8MA 1ZSNA 3SXUB 3I9V1 1DXQA 2K7FA 3LF1A 4FN4A 4ZHQB 1TTPB 4YK7A 1A9SA 2WZBA 2CDCA 4KQKA 4LXUA 2D74A 4FFBA 4LHXA 4F3TA 4KDFA 1G21A 3A2NA 1RCUA 1B43A 5EHGA 4B4KA 4KUGA 2G0NA 3LGSA 4IF4A 5FUBA 1Q0UA 4PO1A 4D4KA 3ZWOA 2EWWA 4HYTA 1ZK2A 5CIYA 5CNMA 1PR1A 1RYNA 1XYYA 4U7HA 1GUYA 1UT5A 2ZB2A 1CY6A 3PGLA 4YJ3F 3OA0A 3PWZA 4X6XA 2YWGA 1YRWA 3F5FA 3UHAA 3ZD6A 3G59A 1Z9BA 4DR2B 4OI0A 1R66A 2D0IA 1G60A 1I13A 4YRAA 2XUDA 3B7WA 1D4FA 2EEZA 3EC1A 4EENA 1GAXA 3P0IA 3OCJA 3QUAA 4CCYB 2XUAA 4RX1A 4P8RA 1U5BB 1D6SA 2GJAA 2X0JA 5HIJA 2VA9A 2PMKA 3GFTA 1F6BA 1PUXA 1Z7WA 4UXJA 3SEZA 1CUJA 4S04A 4X92A 4HQNA 1YA6A 1DTWB 3OZRA 5EUQB 3NRJA 3DBLA 5I8PA 4UASA 4H16A 5ALIA 2FWRA 3CUTA 3I37X 1XDWA 1QGDA 4LDPA 3T1HB 3GNSA 2ZQZA 1VJTA 5AVTA 2WSYB 3FTFA 3N0XA 3C2QA 3H9JA 3TPZA 4AO8A 3ANYB 1RBMA 2NUBA 3UWKA 4U02A 1V47A 2JJMA 4BRZA 3TNFA 3DNMA 4PRKA 2AZTA 1YAJA 1XP5A 1JEQA 1VE9A 2BV3A 2C8JA 3BL8A 3JAKB 3O21A 3HXMA 1QUFA 4M9UA 3CIFA 3DO8A 4MPRA 3NT2A 2W2LD 5KOJA 2AKEA 2VCYA 3ABSB 5FA6A 1IATA 2QF7A 2AOTB 1TU4A 4PVCA 3RS8A 3W0LB 4BN0A 4HVTA 1M6VA 4B6JA 4R8KA 1PR4A 4DZRA 3IJRA 1BS2A 2KPOA 3GYGA 1Y8RA 3HYLA 1SJ9A 3LA8A 4HWSA 4K26A 3T3IA 3TNJA 4EI7A 2FKAA 2YN4A 4OL9A 3PPVA 4KXQA 2J09A 3DAGA 4LE1A 5G53C 1M9NA 1X70A 4KPUB 5HJ7A 1KO4A 2LNDA 3M49A 3MCAA 4XQCA 4YCDA 4EG8A 4POOA 3RAEC 3NEPX 1GRCA 4HDOB 4GXQA 1HMPA 2AHOA 2DKFA 2ZE5A 4NFLA 4E6PA 5DNYB 1MB2A 1L6RA 2RHLA 4A0SA 4F2HA 1GZSA 4J7AA 5JZOA 4ZEWA 5K8UA 1JVNA 4HWTA 2YIDA 5ALMA 2RAVA 1ZD9A 5CEFA 4LGCA 2W5UA 3R3XA 3BMNB 4N9WA 1S8OA 3TG8A 4QUAA 1PZHA 3ZXXA 5GJBA 2J4FA 2X7HA 5A0FA 1KSGA 2HD4A 4ITRC 2QRVB 3KSUA 4IDFA 1P4RA 2WSMA 4K9QA 2BFFB 4QUJA 4OQPA 1R6UA 2N46A 1OUMA 4UCXA 3GZNA 1SUWA 2B7CA 3QQPA 1SCAA 2R85A 1THGA 1EVYA 1NN3A 1XLUA 3NNSA 1OX6A 2ID9A 2FK8A 1M76A 2YZ7A 4Q3NA 4G0NA 1EWVA 3S4YA 3SDSA 3EDRA 2INGX 4PF1A 1Y9ZA 2D4HA 3TLJA 1P5HA 1EXWA 3CONA 3KYCB 4RGYA 3X1WA 2WIFA 2P11A 1KMHB 5IZ4A 1IM5A 2CF6A 2M6SA 1KC1A 2I8LA 4KVAA 4BL5A 1CBUA 3DDOA 5JAMA 3GGPA 3GLSA 4RVHA 4Z9FA 1R6AA 3OQNA 3UVEA 3ZU3A 2O3SA 2J87A 4XD2A 2Q4DA 2LCFA 3K72B 1AZSC 1RXCA 4XTCS 4EJSB 2X5OA 4A9AA 3DTVD 4X0EA 3RTCA 2WFMA 4QVKA 3E3LA 2FDRA 2NVUA 3FJYA 4A16A 4FDVA 2UUAB 3QHQA 4D9NA 2QL9A 4PC7A 1Y6FA 1R0CA 2VDQB 3ETEA 4KO2S 1GZ3A 5BOVA 3QUQA 5FBWB 1VQ1A 2V7UA 4HQFA 5D3MB 3ZGZA 4UCWA 5HNKA 2PTGA 4ZO8A 3QF7A 1VYVA 1OOEA 1CDDA 3TAXA 2LZ0A 4XX1A 1VB3A 1XMPA 3AINA 5DHRA 2CZQA 1PL0A 1KZ6A 4H7IA 2C1EA 3VPFA 1UKYA 4UNNA 4JQZA 3KDSE 3DZDA 2XMDA 2J0VA 3C3KA 3THWB 1PR9A 3R7WA 1D1SA 1T3GA 3GLIE 3G5AA 4FEGA 1L7XA 1CS0A 3JQAB 4YY3B 1U4SA 1U7ZA 4IVNA 3G2QA 3OOWA 3TZLA 2WV9A 5TF4A 3ZV5A 5FJJA 3FOAA 2FWMX 1QBKC 2JKVA 4YASA 1E2LA 4ZQEA 4CKCB 4OO3A 2GBGA 2VDNB 2EKQA 1GTL1 4FGKA 1UH5A 5K0FA 2NT4A 3ZH2A 5BNFA 1D0SA 4ZGBA 3RVQA 3FY4A 5JRDS 1K7XB 1PDOA 2NO4A 2IHUA 3TBHA 1FBTA 4OUKX 2GHQA