5M34A

Structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
245
structure length
228
Chain Sequence
b'AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTYQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin B12-binding protein
publication title Conformational Change of a Tryptophan Residue in BtuF Facilitates Binding and Transport of Cobinamide by the Vitamin B12 Transporter BtuCD-F.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 80
structure length 228
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m34A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m34A02
5BVHA 5KHLB 1QH8A 2AFIB 4WZBB 3AEQB 3LHSA 2PS3A 3MWFA 2XV1A 1G21B 1QH1A 1N2ZA 2OV1A 3AETA 4MO9A 2OV3A 2Q8PA 2XH8A 1G20A 4FNAA 1QGUB 1M1NA 1K0FA 4TKVA 3AERB 3BE5A 2PS0A 1TOAA 1K2VN 3AEKB 4M7OA 5BVGB 3AESB 2X4LA 1M1YB 5KOJA 4HMPA 4FILA 1M34A 1PQ4A 4WN9B 2O1EA 1L5HB 5I4KA 4H0FA 4UDNA 1FP4A 5JPDA 3NU1A 4NNOA 4UTOA 2XUZA 4WNAA 1MIOA 2OGWA 4NNPA 4WESA 3TEFA 3GI1A 3PDIB 1K7SN 1N2CB 4K3VA 2M6LA 2AFHB 2PRSA 3MINA 4HMQA 4ND8B 2XQVA 3ZK8A 4LS3A 3AEUA 1EFDN 5BVHB 4XPIA 1QH8B 2MINA 4N01A 3CX3A 3R5SA 1H1LA 3AETB 1QH1B 2XY4A 1G20B 5M3BA 1M1NB 4TKVB 2XDQA 4MLZA 3G9QA 4UDOA 5GGYA 3TLKA 4INPA 2QI9F 4OXRA 2Q8QA 5CX1A 2R7AA 3ZK9A 5KOJB 1M34B 5KOHA 1K75A 4DBLE 4LJSA 1FP4B 4MDYA 4B8YA 5M34A 3BE6A 2PHZA 4WNAB 2RG7A 3R5TA 1MIOB 4WESB 4WZAA 1N4AA 2ETVA 3TNYA 4PAGA 4TKUB 3U7QA 3HJTA 5JJ5A 2PS9A 5HDQA 5HX7A 4MX8A 3AEUB 2WI8A 4WN9A 3MWGA 3PSHA 1ESZA 2MINB 1H1LB 3MFQA 4CL2A 2M6KA 4INOA 3K1AA 2XDQB 2AFIA 4FKMA 4WZBA 4OVKA 3AEQA 4HMOA 5CR9A 4G07A 1G21A 5M29A 2WHYA 5CX1B 3UJPA 1QGUA 4FI3F 4UTPA 5KOHB 5B58T 5JG7A 3AERA 2R79A 4GICA 3EIWA 1N4DA 4BBPA 2OSVA 5GGXA 4H59A 4WZAB 3AEKA 3MINB 5FLYA 1KAHA 5BVGA 3AESA 3ZKAA 5AFSA 1M1YA 3U7QB 2YNMC 5JOQA 2YNMD 5M2QA 3HXPA 1KAEA 1L5HA 4XPIB 4IRMA 3LI2A 3PSAA 3ZTTA 4OXQA 3EIXA 4PM4A 3PDIA 1N2CA 3HH8A 4HN9A 4G09A 2AFHA 3ZK7A 4ND8A 3MD9A 1KARA 4TKUA 1PSZA 3K1AB 1XVLA
chains in the Genus database with same CATH superfamily
4C0KA 3PZRA 2HNBA 5GM2A 1K5PA 3EXG1 5DEOA 3TX2A 4EA8A 4PTLA 4JYCA 1Y9ZA 1NQTA 2GJ8A 4PQRA 5IG2A 2OV3A 1AF7A 4JYZA 4GLFA 1N8NA 1P75A 2ZATA 3TUIC 1MTZA 2E18A 3Q3HA 4RTQA 2HGZA 3DEFA 4I1RA 3QYAA 3CUVA 1N6KA 4J9VA 5ARBA 4GH5A 4WGFA 1AGNA 3QV2A 2YHIB 4JEUA 2EKZA 3IHLA 3D2BA 1FDRA 5AVUA 1Z2NX 3F3YA 3FROA 3RBVA 3BTSA 4QGFA 2XRYA 4RK1A 3W0LB 1DEXA 3SHVA 3HBFA 4AYXA 3KQNA 1KJ9A 5JDCC 1WDTA 3AKEA 1Y9AA 1EX7A 2BGUA 2JGKA 4C4PA 3M83A 3NBUA 3QP9A 3VDQA 1GGMA 3LGAA 3IUBA 4M9XA 7GPBA 3ESZA 5GV7A 1GNQA 4ZCQA 4NMWA 3FNEA 3L05A 4KAAA 1QHYA 2WF8A 3QVXA 3K0FB 3KZOA 4I6EA 4K05A 4V0RA 4HV4A 3R44A 4MQBA 1DXHA 5LKAA 2RHDA 1VB3A 1UZUA 1T5SA 1WSDA 3SBDA 4F3TA 1JX6A 1TJYA 4QICA 4CXMA 2ABWA 1MXHA 3FMFA 1UWLA 1H0KA 1GTMA 1UAYA 5AI4A 3EDOA 5GJWC 3D31A 2Q41A 4DMMA 1XPUA 1R8QA 4FLMA 2Q3LA 3IX7A 4P54A 2PKCA 1JU4A 4G86A 2FKAA 4KMOA 3WGIA 5B4VA 2ZI3A 4A0SA 2YZ7A 4LY3A 4JBWA 4B9EA 1T2VA 1Y7IA 1C1XB 5CG2A 4DIMA 4EHFA 2PKXA 3PC2A 3AY0A 3PLRA 2RKWA 5DH9A 3USZA 4MW6A 4JU9A 1RAIA 2QMOA 4KZPA 4NS4A 2RJ3A 3IDSA 3PFCA 2FEMA 3ELUA 3PNSA 3RGWS 4BUCA 1QRTA 1BFDA 3VNUA 1PYDA 1UIMA 2ECPA 4FEAA 4PNHA 1XZLA 1S4MA 3A0UA 3AL2A 3ITKA 3IV6A 5CVUA 1CRPA 5JBNA 1EESA 1IJBA 4YJ3F 4DYHA 1SOVA 5JSZB 2E4ZA 3U6BA 4LV8B 2VRCA 2HDHA 3QMVA 4TL6A 4X95A 5T6BA 4FN4A 3WDSA 4F04A 4MJXA 4KX3A 1F60A 2PBFA 5CU7A 4JHXA 1JDBB 4MRMA 1ZK1A 1D2RA 2B4TO 3C6XA 3HKCA 4NECA 2J3QA 3WI7A 3L01A 1DV2A 3AFMA 5G0UA 3VDNB 3V3KA 3GT3A 3N2GA 3T7RA 4Z4GA 5AJHA 4GVLA 1XNGA 3U4CA 4AZSA 2M6RA 2PS1A 2NZJA 2R60A 2WMYA 1PJ3A 3BORA 3FPGA 2R84A 4RMGA 5E7MA 1EA5A 3ZYCA 4TLCA 3DDSA 1HDCA 1PUIA 5ELMA 1PJSA 4QUBA 5KVVA 1XTVA 1GN9A 4CI0B 3LWDA 3OOJA 1RHUA 1V1RB 2WKQA 2J6HA 3Q85A 4UEOA 4Q39A 5AW9A 1WF6A 4DCCA 3ER9A 3SR3A 1EUQA 1XEXA 1KOGA 4ZO4A 2C96A 1BQ3A 2WF7A 4QPZA 3WLLA 1A88A 3RUCA 1GKUB 3PUWA 4GMHA 3SX2A 2BBSA 3W3ZB 5DLPA 3WMFA 5AKXA 3MUEA 1DFHA 2HTEA 3PXBA 4JMLA 1J2YA 1KHTA 1Q3TA 1RLOA 4OBBA 4YRJA 5HM8A 1VYUA 2X8JB 4M0PA 5F51A 5I7WA 1FTWA 1I5EA 1M2OA 1DEHA 1FLVA 2I33A 3IT0A 1XLUA 4IWYA 3E7DA 1VP9A 3U7GA 1E0SA 1T1SA 5D5HA 2C1EA 3QKUA 2IHNA 1F0KA 5JROA 3GJ7A 3HADA 1USKA 1VC2A 2C1XA 1XALA 1G19A 1THZA 2IBTA 5EJ5A 2AR9A 4LOLA 5TB5A 3ZE0B 5CD9A 3G2NA 3CCFA 5FWYB 4YV1A 1SELA 1X0XA 2C4HA 3FNIA 4BNXA 3TZBA 4K26A 3I32A 3DEJA 3VVCA 5BOSA 1NJSA 3O92A 7YASA 4TWIA 3TRJA 5A3SA 4J94A 1NVDA 2GPJA 4DIOA 4TGLA 2CFRA 5AW3A 4YCCA 3QWIA 1O0BA 3ONDA 2HF9A 4OMDA 1LBTA 5EJAA 5IJZA 1A7JA 1TZCA 4HTFA 4CM7A 2CF5A 4DLLA 5IZ4A 2WJ4A 3GPBA 1GNSA 4ZT4A 3BBLA 5ERYA 4RJLA 4XM1A 5JS7A 3FLEA 3Q12A 2O54A 4Q4JB 3EGVA 1JJAA 3EF3A 5EIBC 4OB8A 4I55A 5DHSA 4ZARA 2F62A 2J9XB 4EX7A 5TV2A 3ZJ5A 3T34A 2NO1A 3IUNA 1V5EA 3VBEA 2FETA 3VKHA 1K89A 3HO1A 1T24A 1ZGJA 5H68A 3SVTA 4J7UA 4A2CA 2LCFA 4HDSB 4JBIA 3OEWA 4WESB 1XO1A 1EFRA 2FE1A 4EL0A 1XJ0A 3L07A 4LJKA 3TW8B 2FZKA 2OXCA 1DKOA 4HLNA 4S0ZA 2QQFA 3ENWA 3K70B 1HTTA 5DN6A 1XTJA 5HK9A 3GT4A 3VTAA 2O7SA 1C9MA 3QK7A 1AUVA 3KYIB 1H9CA 4LTDA 4B3XA 5HF9A 1DHRA 3OEEA 2PZ8A 4RH0A 1UQTA 1V7CA 3VAAA 4LSZA 5D3ZA 2KMLA 4HNQA 3SAJA 5DOVA 5F98A 1HLDA 2QX4A 3KYCA 1XNJA 1SCNE 4H7DA 5AJTA 2HNAA 2AQ8A 2I67A 3Q6MA 4C4XA 4V1CB 1QF6A 1EWTA 4TZTA 1MFPA 2PNJA 3HB5X 1XDUA 1E0KA 3HB4X 3O93A 3DBLA 4QGGA 3AW8A 3TZLA 3KPVA 5K0FA 1HT1E 2XHEA 2ZVJA 4CN8A 1X19A 1CUEA 2H4ZA 3KWMA 4CIYA 1DAIA 1JIKA 1R6TA 4Q9DA 4MYTA 3DBIA 3HBMA 1BCRB 2W8ZA 4YCAA 4ZVPA 4D8YA 1Y6FA 3PXGA 1SQ5A 1XMSA 3V33A 1COWD 2OQVA 3GJTA 3OPMA 4YRRA 1WDMA 3C3CA 5DGXA 1S8FA 2XVZA 4NX2A 2RGDA 3B1FA 4P84A 1GUFA 3PSAA 4G41A 4B7CA 3AF4A 4GOLD 2FHSA 3WK5A 1RVDA 1UBCA 1GEEA 2ZWMA 3OSZA 1RQXA 1GRVA 1KI6A 2XCLA 4RHYA 1KWGA 2BR3A 3THXA 2LBPA 2FV8A 4IGIA 5EJ4A 3L8EA 1AGXA 1G55A 2W22A 3X1KA 2OHHA 2ZSKA 3A2NA 3CPHA 3GEHA 4E09A 2AUTA 2XNHA 2OQRA 5FJIA 3CN9A 4XB6B 1RXEA 2F9LA 1WD7A 4K9SA 2RHTA 3K16A 1DL5A 3K9QO 3MOIA 4PGAA 3STUA 1X1CA 2AN4A 4H3SA 2Q2NA 1CUIA 1M75A 1CQZA 2I0FA 2QP4A 3ANLA 2VFAA 3CIOA 3QEJA 3VR5H 3VUFA 1H4QA 4TYPA 3MVEA 2DEUA 4TKVA 2ID4A 2ZAOA 5HCIA 5C8YA 2PS0A 5IT9A 2JZOA 1WPXA 1YJ8A 2C2GA 4CL0A 3HCNA 1PFKA 4HFMA 1JFVA 4LDPA 1C4KA 4XD7D 5KKAA 1PGQA 2QXUA 4J49A 5EL0A 4ZEWA 1X74A 3UHAA 4E1BA 2UYHA 1ADBA 1CQIB 5KYYA 5L6LB 1HY3A 1Z16A 3REGA 1WLYA 3MWEA 3PDIB 2FQXA 4MWBA 2OHIA 5FJJA 2X8BA 1GAJA 4GOJA 1PL0A 4X8LA 3PTLA 1BEUB 1UFVA 2IZ5A 3FYTA 3MOGA 4PZYA 1LLQA 1IATA 1ODFA 2G0NA 2OGSA 1O2DA 2RBGA 4GUAA 4L5YA 4TXJA 3TLGA 4BYMA 1ZSNA 3M3PA 4JWKA 4LGMA 4Y6QA 3PEUA 3IOBA 4FR2A 1A5SB 2JA2A 2GZRA 3M9XA 3L1IA 3IEMA 3O21A 3HJGA 3B1KA 2YXPX 1PRYA 3NVAA 4KQ9A 1GR0A 1NATA 4YAJA 4AJPA 5IM4F 1P2BA 2G83A 1IWPB 4FDUA 3EJWA 3HM9A 4UU7A 2PQ2A 4YC7A 1SUAA 2NPFA 1LQTA 4R81A 2W2MA 2ZUUA 3CC8A 3QHQA 1QCDA 3UANA 4X20A 5F5XA 3GCXA 3ZBTA 3P26A 1VB5A 1SCQA 3EC7A 4JB2A 4YI5A 2JFZA 1GQRA 2R7AA 2WAAA 4URFA 1SCDA 2GGSA 4GLOA 5JAZA 2ZBUA 3SS7X 5BUCA 4UDXX 1S7CA 4GOND 1GU1A 1T8YA 3DZHA 1TU0A 4TQGA 4N0EA 2CUZA 4FXOA 4QL3A 1CR0A 3ADOA 1KPHA 1EPUA 1CHNA 4E22A 4N47A 4DY6A 3GRRA 3OQHA 4RZ3A 2QTWB 2GI4A 1XHLA 4R0MA 2GILA 2V0NA 4WFQA 2O8DA 1DRUA 4X9XA 1MXFA 3DM5A 1WHTB 1XCLA 4RKRA 4XJSA 3RAPR 5K9ZA 2J32A 3W5UA 4R51A 4J0EA 4AY2A 4LOKA 3RTCA 3TLEA 2WM3A 4PXYA 2C7PA 4R40A 4EUSA 3D8TA 1RKUA 3UWKA 3BHNA 3QYJA 1MH9A 3FOCA 4XEHA 3KPYA 3LTEA 2QSZA 1TYBE 2NQTA 1BW9A 1Z6AA 4TZ6A 3I92A 4TUYA 4MV8A 5J47A 1M72A 3OIDA 3WS7A 1RMTA 3QKRB 1Y34E 5G3ZA 3CF6R 3WWCA 3TMAA 2WDZA 2Y4NA 2P5UA 1Q44A 5K3DA 1RJWA 4U7WA 3HLYA 3HXLA 1U2GC 1LX7A 1RRFA 2Q21A 1GRNA 2BKAA 4KLRA 3QSGA 1YF3A 1AKEA 3E9MA 4G63A 2R8PA 4WW0A 3TTUA 4INJA 4M1OA 2AJ8A 5I48A 2P78A 3SQNA 5IPFA 5EWLB 3FNQA 4MYUA 4D1YA 1X1QA 3UXHA 3DYIA 3BBPA 4ZVOA 2Q3DA 1E63A 4LRSB 3RSZA 5HFAA 3UFXB 4GPIB 3U1TA 2E9SA 4IDBA 2PJRA 1N0HA 4I1UA 4HB0A 5HS6A 1TJ5A 2JGIA 4P3PA 4U6SA 5KMGB 3C3BA 3D1JA 4RJIA 2QJWA 5FPYA 1XPJA 1I1QB 2O0HA 3BEOA 3PPWA 2GASA 3CEAA 2AEMA 1WXIA 3ASUA 4D99A 2NZXA 4MCIA 2Z2ZA 5IDVA 1Z17A 4PHTA 4BGEA 4F9TA 1QB7A 1P4GA 1ZL2A 2D74A 3PQ5A 3SEQA 4E94A 3GEBA 5JCZA 2A1UB 3MLBA 1E5XA 4OYYA 4PAOA 1ZI6A 2RKBA 2ZCUA 1U0BB 2PT7A 4G0MA 4BFSA 4PC3A 3W7AA 1XMOB 3EMBA 5EHGA 3TL3A 4DDMA 4RM3A 4KPYA 5I4KA 1VKOA 4WN9B 2O1EA 3CSUA 3UYKA 5DMXA 1P33A 1IJEA 5H16A 1HZJA 2F3RA 3A1DA 3T3MB 1KEUA 1MIOA 4JX9A 4BB6A 3GCWA 3IIMA 4KMRA 3FYUB 3EWNA 4G9BA 3FOEC 1URPA 4PINA 3EGXA 4Q3CA 1TMYA 4MAMA 1SVNA 5IJ9A 7ABPA 1TNDA 2P9JA 1KVUA 1BWQA 2VUHB 3IQIX 2XUQA 3INGA 2IX3A 3I3OA 5LXTB 4IOMA 2BM0A 1HFEL 3BXGA 3OURA 3QENA 4M54A 3THWB 4I1PA 5DT9A 4KREA 4F85A 2CNKA 2JI8A 4LHVA 2J7KA 2IUUA 3ZX5A 1SBTA 3K5IA 1ZGBA 1DX6A 4KGDA 3KQQA 1SGWA 4ES6A 1ECPA 3SR0A 4NDAA 2G63A 2W6PA 4JROA 5EGNA 3L0PA 2AKEA 2PU7A 1FDVA 2RHLA 4LMRA 5KTMA 1JR6A 3C3YA 1ZM9A 2FW9A 2GN2A 2PZEA 3HVJA 2I2FA 3EF1A 3OE1A 2DT8A 5A9TA 1JXMA 1RCFA 4LCBA 3WRVA 3PC6A 5TT1A 3OZBA 4P31A 1FS6A 2DBVO 3LKDA 1L1FA 3RJ9A 4K87A 5JZVA 4C7OB 1SOWA 1SQGA 1ZGAA 1N6NA 1Q0ZA 2NN3C 4P4SA 4XFKA 5ES3A 1OXTA 5SYMA 5IANA 5JQWA 5IT0A 1YDFA 1L4YA 2R6HA 3FVTA 2BFAA 3LLMA 4Y9TA 5FOXA 1V7ZA 4BTEA 3QX7A 3G1WA 4MA4A 4TXHA 2HZ7A 1II8A 4FT2A 5EHZA 3P2MA 1EWYA 4ABYA 3L4JA 1ZSVA 3CF4A 1UMCB 2H1HA 3EOZA 3MS4A 3NIDB 2X76A 4HWTA 1EYZA 3RVDA 3MTGA 3U3OA 3P7MA 1PTJA 2H07A 1U8UA 3AHHA 4NBLA 4P35A 2GZ2A 5KI6A 2CLLB 5L3ZA 5FNVA 1JE0A 3B3JA 1AKMA 5IVDA 5D01A 1Q74A 1Q95A 4A92A 1M67A 1DMRA 2XPCA 3QXCA 3V46A 1CY1A 1RMYA 3BREA 1PNOA 2A94A 2VPQA 5G3YA 4C0LA 4RK4A 1MOPA 4DTIA 2AG8A 1FX1A 3TW0A 1DTWA 3WQSB 4QVIA 3B60A 3KXDA 1L5ZA 3I1JA 4H0NA 1M2VB 2G4LA 2JD2A 3FRIA 1XK6A 1Q22A 2IZ7A 2Y1LA 3VVBA 4RL6A 3BIJA 1AZTA 3LUJA 5TSDA 2GBGA 1HXHA 2QAGA 1HYEA 4ZU3A 1F2UB 3HGQA 4Q9KA 4J2HA 1Y5LA 3R24A 3E35A 4ZHQF 1SEPA 2WYWA 3RC1A 4LDRA 1M8GA 3L41A 4KE9A 4LXQA 3EXG2 4BLRA 5EKTA 2Q5FA 1GPBA 3S6JA 5ARDA 1JXQA 1M2NA 4QC2A 1G5RA 4QARA 3MELA 2ATVA 1F1BA 3QBVA 1JHQA 5BSGA 5LDDC 7MHTA 4IUBS 3DKKA 3IAS6 2H18A 3QWFA 4FC6A 1RYZA 4RF4A 4BWVA 3SQXA 3H8SA 3I04A 3SIRA 3B1WA 2O4UX 5EE1A 1Z5NA 1XD8A 4NTZA 1WULS 1JR3A 3VU0A 3F90A 1W5TA 2UZ0A 4L3OA 2Z1NA 2FPPA 5IEBA 3WKEA 2YHBA 3JSXA 5CT5A 1GFZA 5D87A 2YJ5A 2VPXA 4MUBA 5E6RA 2AKYA 4AJ1A 2GARA 3VPHA 2GJAA 1PT8A 3HKBB 2V6IA 5HXAA 3MG9A 5JMTA 1G4UR 3QVJA 4FYMA 4JLAA 2QL5A 1NUTA 2P2GA 1K4KA 2ZE7A 1KFBB 2V7XA 1GA6A 1JFTA 2JJ1D 4RDIA 4WJKB 3RRXA 4B5LA 1JG7A 1ESMA 1VBMA 1XZCA 1Y4ZA 1QZXA 5CNKA 5HE9A 2G5GX 2VJMA 1BD4A 3DBVO 3EG9B 3IGFA 4FC7A 2O8VA 4FHEA 3DE7X 4OUDB 5EJMA 2D1FA 1F06A 4R7GA 4BKRA 1E6EA 5HQ3A 1NJ6A 1ZK2A 3ZI4A 4DZTA 3U19A 4ALKA 1CRWG 1JDTA 2YZKA 4HGYA 4HWSA 4V39A 4YCJA 4HFNA 2BF7A 1WZCA 3Q5DA 1KJNA 2BI8A 2GJSA 4JX8A 2FWJA 5LZ9A 2OBBA 1TQ4A 3ZDAA 3FY4A 3SYRA 2C1ZA 4PS0A 2UUCB 3DD5A 1ONSA 2MIIA 2VR1A 2IXBA 4B3DA 3AF5A 5C9ZA 4TX1A 3OLVA 3L7KA 4DVGA 1B8OA 4O59O 4AG3A 2YV4A 1VA4A 4XIGS 5KINB 4RX1A 4RF3A 4E4RA 3C3KA 2G76A 2YTZA 3RHSA 3MIZA 4I4TF 3TD2A 1BGXT 3W7BA 1ZOOA 2P40A 2GM9A 3DONA 3VNAA 1W5BA 2PXHA 1E5DA 4XCQA 1XK7A 1QAMA 1ZP6A 2YICA 4P38A 4CJXA 2O7QA 1DBIA 5HKLA 1XUOA 2P2DA 3F97A 1KOLA 2ZUBA 5NLLA 4MPDA 1P6UA 4NMHA 2VHTA 1YB4A 3DE2X 3GXBA 3OE7D 3FOAA 5GOTA 4MKIA 4WHMA 3GVHA 1V9CA 1ADJA 1XAHA 3JQBC 3LECA 3QXGA 2WA1A 4AJHA 4DXDA 2OENG 4M7RA 3N39C 3IDFA 5JE8A 3GZ4A 2RGYA 4HAVA 4D9IA 3LDUA 3CLSC 4U2BA 4W5JA 4KR9A 4CT4B 2HGSA 1K3TA 4O63O 4R8LA 3P9NA 1Y81A 4G1EB 4ACAA 2CLHB 1I1OA 3OJLA 4Z54A 3IXQA 4BVKA 1QTIA 4RGBA 3TE6A 4R84A 3EIWA 1TUBB 3ENNA 5FUBA 3D2LA 2ZJBA 1PR0A 4L6IA 4D9BA 4EITA 4FSXA 3PV0A 4TZKA 4JI4B 3VTKA 5HIKA 3WADA 3UIEA 4QYIA 1QQ5A 1N7JA 2NUBA 4HOYA 5CYOA 3WSVA 1I4EB 1SULA 1L5HA 1RI4A 4KI7A 2C58A 2R8XA 4D9NA 4RTRA 3IUQA 2ORIA 2WSIA 4M8SA 3EZYA 3Q7PA 2SHKA 1P2UA 3D54D 1YE5A 4DIDA 2OAGA 4F6LA 1M6VB 1HX7A 4RZHA 1SXQA 1SKYB 2AFHA 4YAGA 1V2GA 3QUTA 4B7XA 3LBNA 2JI7A 1S5PA 2BF4A 5A06A 2FSPA 2H1RA 3RSFA 3TSWA 1UDAA 2JKYA 1JN0A 1JHPA 2B7CA 4PLZA 2C3PA 3MFYA 4BHTA 2WVHA 3HXKA 1CG6A 3R7FA 3NC0C 3AR3A 3C5WP 5HA5A 3VTFA 1JYSA 3TXXA 4AZ0B 4QM6A 4R31A 3OC0A 2WM9B 5DULA 3I5YA 5EUQB 5KDLA 1YA6A 2BGWA 1TK3A 1IYZA 1VLHA 1B42A 1VE6A 4RV4A 3BT7A 1L5VA 4MAAA 5COQA 5K20A 2AF4C 1TIBA 2X9NA 2QX6A 4QRIA 4ZVLA 4B9AA 2BLNA 3DV0B 1X8LA 5EQFA 1M6NA 1O6FA 1UJBA 4B46A 2QPLA 1UT5A 4O2BB 4B2YA 3M2TA 1E2IA 1LBEA 3QVKA 4G1CA 4BRSA 1GZVA 2G1UA 3ID6C 4RVUA 1TUEA 2P9CA 3ZX4A 1RR6A 2IOFK 1OFUX 2RB5A 1OA1A 2A1TS 4K3VA 1BTOA 4UPVA 3TW6A 2ZTUA 2JK1A 2HJHA 4HAYA 2WTXA 2WV9A 5B1EA 2BY4A 1LLUA 2UYOA 4OHZA 1E3QA 4U3JB 5BV2P 2OL4A 1X80B 3OF3A 1Z15A 3SDBA 1IULA 5AVXA 2EFYA 3N8KA 5FPPA 4UM8B 4IWXA 2ACKA 2JAOA 4AO6A 4A23A 1TO6A 2C77A 5LMZA 4DRZA 4AL4A 1CUXA 1IQ0A 2QVXX 4BMVA 3HVRA 4WKOA 3VO9A 5AVYA 2A35A 3RU7A 5J63A 4AT1A 1MTOA 2PBLA 2ZYRA 4WOJA 1JA1A 2YIVX 4WUTA 3GCZA 5B4UA 2Y3IA 2FCAA 2D4HA 9LDBA 1WNFA 3TD6A 4FD3A 4OQLA 3NJ4A 5KNCD 1D4ZA 1M34B 5KOHA 3E2PA 4PFJA 5CP8A 5DYTA 4C7BA 3L8HA 3ANSA 1IBMB 2GFHA 1C3VA 3T4PA 2ZKIA 2GM3A 3DP7A 3MNFA 4IQ4A 1J8MF 4RD0A 1Z22A 3EC2A 3JWHA 1R50A 3V2IA 1UKYA 1V5WA 4HNRA 4OHRA 2F17A 1UK6A 4R5MA 3A6PC 4II2A 3VPAA 3UAGA 4ZCMA 1LVHA 3M81A 3WGGA 1HL3A 3R9XB 3AVWA 4F38A 4JB8A 1ZHFA 4OY3A 1CDDA 3AINA 1FUEA 1U8XX 3B3FA 3NATA 4H7JA 2YY6A 3GZNB 3ZWYA 5G4KA 5F12A 1OFIA 4CV3A 1OWPA 3KT0A 4M1ZA 5A5DA 2JFNA 1SXJC 3AEQA 3UMBA 2EGUA 2WIKA 1B0ZA 4E2WA 3TLCA 2YVKA 4NFYA 1I3LA 3EDQA 2ZI5A 3R3ZA 4HS4A 3DMNA 1A71A 4Y0AA 1Z0SA 1XWFA 1GITA 2P4UA 4FWTA 2R44A 5IJAA 3I1FA 3QELB 5CFQA 2FG7C 2Y0PA 4BFZA 3THYA 1NJGA 3RVBA 4R8SA 3TO5A 2W2KA 2JGJA 2O8FA 2WUGA 5E95A 1DAKA 2D1RA 4Z3KA 4IHJB 2Q62A 5J5VA 4DMCA 1RADA 1Z5WA 1U02A 4K8OA 4EJSC 1RT9A 5FOQA 5L3QA 3OTGA 1Z5GA 1OYOA 3OLZA 2ETXA 3K20A 1J0XO 3FHOA 4C14A 5AUNB 4YJ2A 4EVRA 2Q0XA 2CV2A 1F3OA 3HDTA 1F4VA 1ULAA 2JFWA 2PS3A 1M8PA 3KKOA 1IB0A 1RNLA 3FDZA 3LA6A 4HB2A 3T3NA 4M86A 2OP0A 1I14A 2QRLA 2AJTA 2RH8A 3KPJA 4MPRA 4DUGD 3TRIA 2FA9A 4KWIA 5CVJA 1W8DA 1LW7A 5E4YA 3D02A 4U4AA 2J67A 4TLBA 4ZV9A 4D0RA 1ISHA 1ZNYA 3N2NA 3MRSA 3SZGA 3GD7A 3H9GA 2C20A 1ACMA 3PDWA 1H9AA 1OI7A 4FTWA 3ZY3A 1DTEA 2A1IA 5HIMA 5DJ5A 3GT7A 5HIAA 4KNYA 1VKZA 4DCMA 1I94B 1MNQA 1KMIY 3S3TA 4HDKB 1G2PA 1JILA 3RTGA 3O9VA 2OGWA 1AKNA 1O4WA 4LBYA 4U7GA 3K2BA 4PG8A 5K8UA 5LQAA 1Y3HA 4M99A 4RTKA 1NXTA 4Q1FA 3F96A 2GPNA 3KKLA 5ICSA 4MEJA 4R3UC 1Z3CA 4FYPA 4ND8B 1GNRA 2W4IA 4WFKA 1RHJA 4ONEA 5LB2A 2X0JA 1II9A 4ASUD 1OIXA 1LDYA 1SRRA 4U0JA 3GG2A 1MIHA 1WMBA 1SCKA 1Z2DA 4A6EA 3DOIA 5A1TA 5MHTA 1QNFA 2XKJE 1REQB 5CLJA 1G8KA 1RAHA 2OLEA 1CFJA 2E4WA 3OJOA 1A9YA 1NOKA 1YASA 3MJHA 5DN9A 1IOWA 3P9CA 4X5OA 1K8YB 1QMPA 3PGKA 1F6DA 3Q0IA 4WSOA 3H2SA 2IP2A 3D3JA 4WXMA 1Q1EA 5JHHB 1GGKA 1I4WA 2X1VA 2NO7A 2F1IA 2OA0A 4QYWA 4IDNA 4CMAA 5L53A 2VVTA 2Y1XA 5DM70 4Z4QA 4G8JA 3DFIA 3TNLA 4HRYA 2JJ1A 2ZIXA 2VATA 1XZNA 4HF7A 1VPEA 2XUGA 3VYWA 4JC4A 2VWGA 4WKNA 1FYVA 2BHNA 1UQUA 4PAGA 4BNHA 5F2NA 4V24A 3SZ3A 4GE0A 1KEEA 1QHSA 1VLVA 2PCJA 3PDHA 4MS1A 4QOHA 3V9PA 5DM60 3RYFB 2PSJA 3DUFB 3ND8A 1QE3A 1WUYA 3E82A 2QXYA 3UCEA 3DQZA 5EHXA 2WDPA 3N7TA 3B20A 5CAEB 3P9PA 3AV3A 4WT7A 5JSFA 5HSGA 2VK8A 1XU7A 1FMCA 2WEKA 2Z57A 4Q7LA 2C2ZA 5IBQA 4L5IA 3IVXA 1F1JA 1NJ8A 3MUFA 1FF9A 4MKXA 4E5SA 3DJFA 3ZD7A 1T1EA 5EUCA 5JVDB 5JS2A 2ZDQA 5DW0A 5FI0B 4EHJA 2I91A 2P79A 1G9XA 2PUHA 1KQPA 1V3UA 4IKPA 3W4KA 3D6MA 4GXQA 1QFMA 1Y9JA 1O95C 2LIPA 1WZEA 3LZ6A 5JSUA 4DUYB 4X7RA 3GLRA 1VLQA 4G1VA 4JEHA 1P7ZA 2ZZMA 3F2VA 1U5BA 1DAMA 3QPCA 2O14A 1J0EA 3I8XA 4E2YA 4QBTA 4KQXA 3TSZA 1HZZC 3EW9A 3DDUA 3FDJA 3OIGA 1ZHHA 4XCVA 1QRRA 3I2YX 3AF2A 4N5LA 4QIHA 2LNDA 3P0IA 4HXFB 2EFHB 4Y6PA 4AYTA 1Q19A 3CT4A 4WECA 4QX6A 2PWPA 5KVCA 2IDZA 3HU2A 3RLFA 3C6BA 2FMIA 2J3JA 3AI7A 3HFSA 4UQOA 2D5CA 1SHKA 3QVGB 3NHMA 1GTVA 3UC9A 4DLPA 2OVBA 3D0KA 3UA3A 4QZVA 4P32A 2QTRA 4BB9A 121PA 1VLLA 2CKDA 2UZAA 4YUYA 2WY2D 4JENA 2WAYA 4BXOA 1RXCA 3OBBA 4Y30A 4C20A 1M7HA 3K8QA 4J0CA 5LQKA 1HYGA 3VC1A 2JAUA 3QLUA 3FNBA 4GL4A 5JY6A 5K0EA 4D43A 3F6EX 2PD3A 3IBCA 2VI5A 1PWHA 5JDIA 1IQPA 4DV5B 5IUJC 3JY6A 1ZPDA 1VMIA 5K0JA 1KS2A 2QTGA 1YHNA 1BE1A 1YRBA 3FBWA 2WJ3A 1GR1A 2IY9A 3TI9A 4UFPA 5D3MB 1E59A 3W2EA 2PWAA 1R4MB 2PRIA 1WF3A 2QUIA 3JQAB 3PQ2A 4XVHA 3VYSB 2Q49A 2DH5A 3KUDA 1EP3B 4D4GA 4FPXA 1GDDA 1GYPA 5BORA 3GYBA 1BFUA 3I9FA 4JUFA 5CGQB 1PL7A 1GNPA 4YQEA 1SY7A 1FDOA 3HDVA 4WOBA 1PG2A 3D4IA 3S2IA 4PHCA 4YVFA 3LQ1A 1V45E 5FT9A 4IUDS 3WGMA 3RG8A 2VH5R 3C6YA 4ARZB 1AUQA 4A5OA 5DIFA 3CZPA 5EIBD 2H9YA 1RYEA 4LYEA 1L5GB 5C8YF 4MUGA 3B1XA 4JT9A 3K9LA 3D6HA 2ALJA 4HYEA 1E1QA 2D7DA 2WJVA 1E4OA 3I1YA 4NV1A 2A9JA 3DXXA 1J7KA 3C43A 3GJ6A 1JFLA 1DZIA 1WLSA 2R4UA 2VHZA 3H99A 3NWBA 5CGZA 3LL7A 1D8AA 3K09A 3QFFA 3AF6A 3I34X 3QX8A 2R1UA 1O0CA 1XD2B 3OE5A 1WKVA 4HAZA 5ESRA 5TPWB 4AJJA 5C0OE 1H2HA 2FQWA 3H13A 1BRTA 3O6VA 1RYNA 1L8QA 2JFGA 2UV8A 4LV5B 3W2TA 1QZUA 2CLCX 4DOMA 1QGZA 5FIUA 1SNYA 4N8SA 4ZGBA 1H0HA 1XLWA 3D5EA 2YZGA 3OQJA 4DT1B 1PDOA 1OC4A 4A0GA 4DIUA 3KJIA 3BFJA 4JLMA 4DTCA 1FJGB 3HYCA 1CF4A 1X1BA 2XQFA 3G2JA 4J4TA 1H65A 1EAYA 3HP4A 4NU6A 1M2KA 4W9RA 2QJRA 3ZI7A 1JZSA 1L7MA 2DY1A 4FE4A 4ALNA 2YFHA 3H9CA 2SCUB 1KVQA 2ZYWX 1XNRB 4QGSA 3HEBA 3CTMA 2I87A 3ULKA 2PQ0A 2R79A 4N76A 4I5IA 3TRDA 4E33A 1C4XA 1B74A 1CJMA 3BMXA 5T41A 3KS9A 4BX0A 2C3YA 4PQFA 3GH3A 3JYQA 2B4QA 4CCAA 1HDGO 3FWPA 1L7RA 3N3BC 4MS4B 5CNIA 2IS4A 3K2EA 2FVXA 3UK1A 2PX5A 5BN5A 1YQDA 4OGFA 1EEXB 1IC6A 1PKEA 4PG4A 4CM9D 5I7AA 2AQIA 5EHIA 4V03A 4O6VA 3ZV7A 4W7HA 1CT9A 4YBRA 1OZFA 1I10A 1Z5OA 4F2GA 1K86A 4CZ2A 2ZRDA 5FRDA 1H8ED 2AN9A 3EVBA 1I3CA 3QE2A 1JB9A 1EWKA 1G21B 1N2ZA 1QH1A 1ZD9A 2PH5A 3HKDA 5D6NA 2JAQA 1T4MA 4TUYF 4LOJA 3W5AA 4JJIA 1UFRA 1YJXA 2YWHA 4PBTA 4LEIA 1PLJA 1QYVA 3NT2A 4HH4A 5EXXA 4X1IB 3MILA 1SBZA 1DE0A 4B7AA 2G72A 4FCWA 5JH7B 1J5EB 3TIFA 1G8YA 2QLFA 3TGLA 1EXMA 1BXRB 4IQ8A 3OD1A 3AG6A 2LCQA 1ORRA 1CUYA 5ALNA 1STOA 1GNLA 2BCGY 2WHPA 3TTVA 2J85A 5FYQA 5JO0A 1XZFA 2ZKLA 1U0SY 2H2WA 5JU6A 2X2EA 2Y1GA 4WBNF 1VPVA 3LFUA 4K03A 3U1VA 1YDHA 3UFBA 4EJMA 1GTL1 2F1JA 3AHIA 5F9FA 3CISA 1EK2A 2R48A 3PLAE 2R8BA 4YB8A 2P5SA 4NCIA 4TYYA 3G3EA 2WWFA 1QYXA 2P7HA 3RROA 2WB2A 1WMEA 4KFUA 1T13A 1KC1A 4DUGA 1FFSA 3C3DA 2CXQA 3OBIA 3TF5A 2B4AA 1YKGA 1KZ6A 1DAOA 5JARA 3ZDDA 4CMEA 1XDWA 4UJ3A 5FBZA 3VRHA 2O2XA 3OPNA 4G4SO 4JJAA 3S1AA 4ZQEA 3VOBA 1QQ7A 5EPEA 4ESHA 1SKYE 4OXNA 5C1IA 3NX4A 1JALA 1KH3A 1KYXA 3KTOA 4HC4A 4ZXFA 5CNJA 1UK7A 2C2KA 4FHDA 3TZKA 1HYBA 4E5PA 1JJFA 1SUIA 4Z53A 1MJHA 4M76B 1EUDB 5CHYA 4MNTA 4TKUB 4XASA 3ZCVA 2P75A 5G2OA 1J39A 1CCWA 3BXFA 3LH5A 3HP1A 3MJEA 3DKVA 5DF1A 2MSEB 3IURA 5AKJA 4AYWA 3JQ8B 3BWCA 1E7YA 1E5TA 4FZRA 4WMLA 2WC1A 2JF0A 3SJBA 1QV6A 4PZLA 2H00A 4B1FA 4DBLC 4NFHA 2VJAA 5IZCA 4PSKA 2FOXA 3EH2A 4RV9A 2D2XA 1NF3A 4JIMA 2Q0QA 2NSDA 4JXXA 3M7IA 3CVOA 3E18A 5DLQC 1GD1O 4BO8A 4QTZA 2P27A 2PH7A 1QQAA 4DC1A 3R4CA 3NKVA 1V7PC 4I8XA 4B8WA 1TCAA 3OCYA 4L2IA 4L4RA 3KETA 1M5UA 2C59A 3OHMA 4M9CA 1HQKA 1FXUA 4DCSA 5L95A 1BDHA 3OESA 3RUHA 4OK6A 3CX7A 4MQFA 4JI5B 2RB4A 4OHUA 4N4AA 2BZGA 4LUCA 1X2EA 3KP1A 4EY7A 5BR8B 2W37A 4DIKA 1VYHA 4D0SA 1B2RA 3G2KA 3T3PB 3AR4A 3G8BA 2WRZA 3X1MA 2PE5A 3AI1A 4K9RA 3SOZA 4EI7A 5LLSA 3HEMA 2ZUFA 2AG1A 4P0TA 2HLPA 5JNTA 5EWJB 3ZDBA 4B83A 3EXAA 2BZSA 1L1RA 2Q6VA 3IAM1 2RBEA 4LF8B 1M34E 1RC1A 2IHKA 3AF3A 3HFGA 4Z0HO 5PGMA 3GLTA 4LJ9A 4C06A 5DNUA 1NXVA 1PWXA 1GXSA 2UVQA 1TRHA 1LNZA 3DDOA 4PG6A 4IXWA 3TINA 2RCNA 1D7OA 4E46A 2C92A 2IPMA 1SCBA 1XWWA 1YU6A 4W1SA 3LP5A 4UNIA 4XM0A 5DNEA 1MAHA 2HSGA 3WJ2A 3V8EA 3ZU5A 2O8EA 2QJOA 3UOAB 1HF3A 1OI3A 3B48A 2GX6A 5JMOA 1L7NA 3OIWA 5EJEA 2IV3A 5GJBA 2QTAA 4JR0A 1MV8A 1O0SA 3PJDA 5SZJA 2GZ3A 3ELBA 4HAXA 4QDZA 2YN2A 1FP2A 1Q7TA 2B36A 3AU9A 4RHXA 1X7GA 2B1JA 5HJ2A 3ADDA 1DFIA 3BMCB 4J2OA 3WYCA 3LPAA 2X3YA 3GGCA 4UVEA 4DVJA 4ZZ0A 3RYTC 1JFFB 3E6AA 1XTKA 3FLAA 1PNTA 3RT1A 3RS0A 4JOQA 4KAJA 3N7UA 4PW0A 2PUEA 2RHBA 2NLOA 2CB9A 4NBNA 3PDCA 5GM1A 5LBUA 2VTVA 4ZVKA 4YJHB 3CMCO 4AUMA 1E2BA 3GCGA 3GFTA 3IPYA 4NQZA 4D6XA 2UZ3A 2JAPA 2WTUA 2WU1A 4N01A 4OH7A 4V02A 4IS2A 4CMJA 3UGQA 1UWCA 4OATA 4DV3B 4P3OA 1P4HA 5LA6A 1CEQA 1ODTC 1CVIA 2H31A 3V7NA 4TZ0A 1JDNA 2D06A 2NUPB 2BFBB 2I1LA 4NFLA 5HGJA 1MB2A 1B41A 1THTA 2B4RO 4HCJA 3C1OA 4BBJA 1XMQB 4KQJA 1R15A 4FWBA 4HEA6 4PXSA 2RHWA 2PGIA 2ZFUA 5CPBA 2AX4A 1JP7A 3IJRA 1M3SA 4HSEA 3AJDA 2B2NA 3DA8A 3ZWDA 4LY6A 4Z9YA 4CQNA 4UFOA 3WWZA 1U5AA 4HVAA 2CMKA 2MCFA 5I3CA 3H8VA 1BVRA 2OZLB 4MB2A 4PRLA 4C0AC 2QN7A 2VDPB 3D7SA 2OZVA 2CNNA 1N6LA 1Q3HA 2QL6A 4ZTUB 2WYOA 1K7CA 3CGGA 3JYLA 3D8HA 4MP6A 3W8NA 4BQIA 4IGEA 1NW8A 4KN5A 4ND6A 5CG1A 2AGVA 2FHPA 1OILA 1VKNA 1YB2A 1VE9A 3RFFA 5L4SA 1F7UA 3U4QB 1CQJA 1WHSB 2N75A 3WK8A 3P2EA 3UV6A 1NXQA 2PU5A 4PSAA 4X8MA 4YJFA 4F72A 1YRYE 3GFPA 1F12A 3DC2A 1RE0A 1V6SA 3HY3A 4KX5A 3UXYA 5BQPA 3PK0A 4UBKA 4B81A 5LZ4A 1KDPA 2BFEA 2G1AA 4S1NA 5FNZA 1E2NA 2GDJA 2F1OA 2QTTA 4RGVA 4XIFA 5KVAA 3RR2A 3VMMA 2DGDA 1VMAA 4MVJH 4R4JA 1C0KA 2JLSA 1TF5A 4QVKA 3ZBUA 1QYRA 4F4UA 3R6LA 1N0VC 1V6CA 4JVSB 3VVMA 5AKIA 1KZYC 3I2IA 3OOSA 3F9RA 4HLDA 5EJ7A 1P0IA 2R751 2OLJA 2VA8A 2QM7A 5ALLA 4CMGA 2M32A 1QHHA 3BRWD 1CUFA 1O9GA 1PEDA 4KXXA 2Y9PB 1ISFA 1EQUA 1P6QA 1J1UA 3QU5A 2C54A 4QJBA 5K6AA 5TS2A 5K5EA 3T41A 1VG8A 1W4AA 4QXOA 3T0FA 3EULA 1CJCA 5I7UA 3ZDEA 4BP1A 5LKRA 3H3JA 2X13A 4LWOA 2XNDD 2UZ4A 2B98A 2WG1A 2W6OA 2Z04A 2V6MA 2XMCA 3N5KA 3RRFA 3TZ6A 4B31A 4XX0B 3GBPA 2AZTA 4W1PA 3T9AA 2QUZA 5AM2A 4NK5A 3T0GA 3LYUA 3S68A 4JLVA 2ZSHA 3BFVA 4PAMA 1U2RA 2PZFA 1CFZA 3CF0A 2OHGA 3CE9A 3CB4A 3LKBA 4N6OA 2IJGX 1FNDA 1E9VA 2H0RA 3LUPA 4I5DA 3DBHB 4YCBA 3HBNA 4UMFA 3EK2A 3FAKA 4XSHA 1GZ3A 3EVZA 1G9SA 1YACA 2EZUA 2FPXA 3B2EA 1ZUIA 1DEAA 3I05A 4L9WA 4J75A 4RFLA 5G41A 1W4ZA 2WYVA 4HDRA 4N5HX 4H1WA 4YRZA 3DHWC 1BQ4A 4XI9A 3EEIA 4XQCA 2V5UA 1ZKMA 5KTRA 3W8FA 2J6CA 2Z2IA 3G9UA 3G7UA 5REQB 3QM1A 3A6HA 1Q0RA 4H16A 3EIHA 2C7RA 5HF6A 3KZXA 4B45A 5THQA 1VSUA 2AZXA 1KJZA 2H4FA 1U2TA 4KQCA 1H8EA 2CHFA 4IS3A 4FINA 4ZK6A 1N6HA 5B12A 4C6HA 2A7QA 1Z73A 2NX2A 1F0NA 4IV8A 3WNBA 5U9CA 1H05A 1TK2A 4JJEA 1U7UA 3NHWA 4II7A 5M3BA 1P60A 4JJGA 4M89A 2EF1A 2FZLA 2GD6A 3DAPA 4RQTA 1N1DA 5F5NA 3E8MA 5EMHA 4TRNA 3JAKA 3OETA 5JASA 4EMUA 5IULC 2YFKA 2COEA 2J9ZB 4OF4A 2Z3WA 2Z9CA 1SC3A 3GVCA 5B2ZA 3A9WA 1VKHA 3FTFA 4QLOA 2JZNA 4LWQA 4URUR 1JMKC 4PNEA 3CRNA 4QT4A 4IDEA 4O4IF 2HA6A 3V1KA 4DCGA 2PX8A 3ACCA 1P2GA 1EGMB 1X7DA 2JCBA 5IF9A 1I7NA 4ENTA 2ZRQA 1X7XA 1XKLA 2HQRA 1WUKS 3A31A 4XFJA 2YQ5A 4O08A 4C4OA 1OI4A 1EDEA 4X00A 1OROA 4XGIA 3SXUA 5J2TA 1AB6A 4HDOB 2A9KA 1CUHA 1DT3A 4MYRA 3IB3A 3P71T 2IBSA 1C7QA 1M2JA 2BI4A 3JQ9C 3PNQA 2GHQA 5E6SB 4WBSA 3A6FA 4UAGA 2JGLA 1UBKS 2VBCA 4LSGA 2IUTA 2AVDA 2I78A 2DBRA 1CUJA 2IU3A 2OHJA 3ESYA 4JP1A 4X24A 2YXEA 4BMPB 3CLSD 1IIRA 5TEWA 3OJFA 2OBNA 1XKQA 3Q2KA 4RZQA 5CB8A 3DLAA 5L3VA 5E4FA 4W5TA 1UXHA 1QK3A 2VCYA 3M5WA 3NP7A 4GKJB 3RIXA 3FZGA 1VJGA 2OBLA 4FMCF 4AURA 1H5NA 4CLRA 1Y6GA 4CEHB 1AURA 2HV9A 1OU0A 5FL3A 4XWGA 2OSVA 1C0EA 4Z9FA 1QQ6A 4ZAZA 3BJEA 4HNUA 3AI2A 1B15A 3RRYA 4LZLA 2WLTA 5AM5A 5F7JA 2YHAA 2GDZA 3UEOA 2JFYA 2XCRB 4L0MA 4G0YA 3U6KA 1A9XA 3E2MA 2H1WA 2RGBA 3AHDA 3TJZA 4RTOA 3T4XA 2JCXA 4HYTA 1DELA 1RJEA 1GPJA 4RA9B 3A7EA 2V1XA 3I04M 3J7TA 1X9IA 2GK6A 4FLFA 1CZOA 1L6IA 4Y2RA 3S99A 1NVGA 5E38A 3RJ5A 4ZZ2A 4CQMB 3QNUA 1GOTA 1GPLA 1X70A 2MWMA 1W85A 3A3NA 5DCUA 4GIBA 1I01A 3PJFA 1OFTA 4TS1A 3K70D 2OBMA 2WYUA 4LHSA 3UT0A 3IQWA 2Y1FA 2HQBA 4M36A 4J3NA 2AD5A 3WMEA 4CLHA 2JL1A 2Q5HA 2XD4A 1M1NA 5LYJA 2G9VA 3EBPA 3AFNA 4YONB 2OC4A 3L0YA 4HADA 3R2JA 4ZT3A 4BU0A 2RJNA 3B6KA 3U5ZB 1W48A 4I8DA 3LV8A 5GV8A 3SF8A 3C74A 2CHGA 2V54A 3BF7A 1PSDA 2E87A 1NURA 2X4LA 4NABA 5H4GA 1GQOA 4UHEA 5LUAA 1OLXB 5MF6A 3JVIA 1XV5A 2HSEA 3GGSA 2VF2A 3D0RA 3RODA 4YWJA 4MMYB 3GN1A 2JHFA 4YRSA 3GLIB 5EJ6A 1DO2A 1H8HD 2G36A 2G7MC 4G0ZA 5L9AA 3ZVKA 4URWR 3DBOB 2DKOA 4G8BA 1B26A 2WOOA 1V16A 1OH5A 1YVPA 1EMDA 1OY1A 4FK8A 3PX2A 1M5RA 3STWA 2P3OA 2OY0A 4WRRA 5DBHX 1FS4A 4QECA 3VI3B 2R96A 2DFLA 1ZK3A 2RHMA 4IMJB 3VPXA 1GZ7A 2WHEA 4BO7A 4UAUA 1EBUA 4FW9A 4YJ2F 1G1MA 5J4YA 1JEYB 4BB0A 5JJLA 4Z1MA 3PE6A 4M98A 4E2ZA 2X1HA 3GNLA 4YGXB 4YTEA 2QUHA 2C8JA 3OFKA 3GELA 4MJLA 5J2UA 2YS7A 1T9KA 1Z8FA 2YUTA 2IPNA 2ZW9A 3O1HB 5AI0A 4PO9A 1WVIA 5EFOA 5HFJA 2RGXA 3KB1A 4E11A 4I99A 4N82A 4Z4EA 3OJCA 1JJIA 3PNLA 4B8ZA 3STYA 3UUFA 1PVVA 4XR4A 4KPUB 5KAMA 3IUEA 2H6EA 4CKYA 2Y0BA 3GMDA 4K81B 3AY3A 1SBCA 1PZGA 1MBZA 1U9IA 4LNUA 1FDWA 1POXA 1FP4B 1ZA2A 2Q3JA 4C22A 4ETMA 1G59A 4URYR 4JEMA 1JIVA 3IO3A 4GQBA 5KVSA 4LXXA 4I9UA 4Z9BA 4GI7A 4AKGA 4TXMA 3NRBA 2D00A 4PYIA 1G21E 1WP9A 3FZQA 2Z8XA 1KI1A 4UC0A 2IYPA 3GJXC 4HX2A 4KFSA 3T7IA 2P1ZA 3HNOA 3UUEA 4MIYA 1WW8A 2G5CA 4B6FA 5SV2A 5KHOC 1YB7A 1TIPA 3DZ8A 2HDOA 5EE5B 1UKBA 3KOYA 3L6DA 1LC0A 3BVPA 3DQQA 2YQ4A 3NYIA 1LBQA 2AF3C 1XMVA 2D1YA 2FZGA 2O2SA 2PX2A 3MT9A 3JASA 3K1AA 1RYYA 5KNDH 1JR2A 3T38A 4MUEA 3X44A 3FYHA 3QNMA 5CT4A 4M83A 2FZCA 4OPMA 1MHPA 3ML1A 5FV7A 1H4VB 3ZY6A 2JLXA 3ZEIA 1I2CA 4NNJA 3GLSA 5LQDA 5LMNB 1NNEA 1P3DA 2AK3A 1KTIA 4MITA 1JJ7A 2HHCA 4KWCA 3FWHA 5BR4A 4DCVA 1G42A 3UWOA 2XUAA 2VJKA 4FQ7A 2X0EA 5D2CA 3PA8A 5K3FB 4I50B 1W0KD 2W6NA 4BNWA 2YHIA 2H7XA 1XQ6A 3Q2OA 1VJCA 3NT5A 1SHTX 3ICOA 2OFPA 4L4SA 4MWSA 3SSNA 5JAPA 5KPDA 2XDYA 4XIIA 3I4CA 1E96A 1L5WA 3TTWA 1XA4A 4MW7A 3DYVA 3HDGA 3WTBA 4C7XA 5BMOA 5AK6A 2ODWA 1R64A 2BBTA 3PEVA 4YJGB 5DX1A 5I9MA 2UUAB 2C29D 3CNNA 2KX7A 1QGAA 4OMFG 4U2FA 1DX4A 4KHZA 3UV7A 1BVYF 3T1OA 5LP6B 4IPTA 2HYIC 1UT8A 3UMJA 5EN4A 3R6DA 1FDTA 2PX0A 3HA2A 1NBME 5M04A 3K0FA 4GS5A 3F7OA 1Q6YA 1U0RA 1NR7A 1P7CA 2CLOB 3A9CA 3M6AA 3OZIA 4MMXB 2B8WA 2PUAA 1NIPA 2NTJA 3CLVA 4GRAA 4Z99A 2W2OA 1NYRA 4ZO8A 3VOSA 5C5CA 4X0EA 4WADA 3GRFA 4AS2A 4DLRA 5CA0F 3U56A 1X94A 2Z8YA 3NEAA 3O3OB 5IASA 3G5UA 5JUWA 3HLTA 4HRAA 3ZUGA 1MKYA 1ZH0A 2OKCA 2QLBA 3WK9A 3V5NA 4DCJA 1XCJA 4RF5A 3I45A 4BBZA 2H63A 3QA3E 3BRWA 1E18A 1IUKA 2QK4A 3RTAA 1DU4A 1R6VA 5FLXA 1C1XA 2BJHA 5CLQA 3F3MA 4QBHA 1ZIXA 4J9UE 2F43B 4Y3UA 3H19A 3B8EA 3I4LA 3IKMB 3RARA 3HUTA 3W9BA 1ATIA 2B25A 3BXEA 2OO5C 1ZESA 2CL6X 4BJ1A 1SQFA 2XNDA 4JVMA 4YDRA 2WAXA 3JALB 4UXJA 5ENDA 4FGSA 2DQYA 3VR2D 2DKNA 1MO6A 3QJYA 4XLZA 5FXMA 1XQWA 1GRQA 2DWOA 2V98A 4MWZA 2QP9X 4GM4A 2RFLA 2QMZA 4WN3A 5EJ2A 2O2HA 2ZUWA 3L5OA 1RYHA 2VN8A 1C7FA 3Q3VA 3ND6A 5SYNA 5JSZA 4I1IA 1E0JA 2VDMB 1UBHS 1ZN8A 3EF0A 1ZUWA 4I1OA 5LLDA 1RXWA 4E5NA 4L4UA 4OAQA 3WJ1A 1VRCA 4PCUA 1E9AA 1EEHA 4Q7JB 5FYDA 3GOHA 2V9CA 3UJHA 1XEAA 3LGSA 3V7FA 4E2XA 1TM1E 4BGUA 4EHAA 4A3SA 3RRMA 1E0AA 4TQUS 4D81A 1YBMA 5KOJB 5SZHB 2C3MA 5BW8A 3VH4A 3PI6A 2QRVB 1VXRA 4PX5A 3GMIA 4BVAA 3NETA 1U2EA 5AO9A 3NOOA 4B6EA 5FEUA 1IN4A 5DW3A 4NOJA 8ABPA 4RVSA 1J24A 3VZPA 3IKVA 4R68A 1FQOA 1VZ2A 3FGNA 3PEYA 3D7LA 5AI8A 4MYCA 3RREA 4NZYA 4UW9A 4ZD6A 3TKLA 4LZPA 5T8KC 1V1RA 2C8VA 3NUQA 3LP8A 3PDUA 1PSWA 3OG9A 4O33A 1YZFA 3GIWA 1ORHA 1VGRA 3MFQA 4L02A 5I9LA 4MPPA 3WMRA 1T5BA 2NUTB 1SG9A 2AXPA 2Q8NA 3UW1A 4MQ4A 5CA1A 2V55B 2X8JA 4B4UA 3G2QA 5CBPB 5LLTA 3O2SB 1SAYA 3CU5A 3F7NA 5H82A 1LPPA 4D8VA 1NYQA 4WLOA 1WPRA 3TQSA 3TUJC 4EFLA 1GV1A 1O95D 4UTPA 3H1FA 5JALA 1JH9A 2WTMA 2XYVA 4ZVSA 5A6SB 3T54A 4TMYA 3TIGA 1PJLA 1QWSA 4AMUA 1KFEB 3TFQA 3LSTA 3W8EA 2XUKA 3O84A 1W5EA 5AKLA 2BKVA 5MN6A 2QORA 4LHXA 4G84A 5FWYA 2O2JA 1NVWQ 2HD4A 4NG5A 1HSZA 2Q1WA 1JB1A 2ZRGA 4IYRA 2DWCA 1BS1A 3OX3A 1NBAA 4PPNA 4YRCA 1RS0A 3E9DA 3L7DA 1E2EA 2O3SA 1T5HX 4J16A 1TVCA 4IP0A 1K5GA 2O7NA 5TVGA 4FE3A 3H2HA 4G01B 1TTPB 4BIIA 2IUEA 2WNSA 2XYPA 3JQCA 3JTEA 3VHRA 3DLBA 3I2FA 5FBHA 3RKSA 3K0SA 3HV0A 4LHZA 4Z0PA 3AEYA 1T10A 1G4AE 1L4HA 1WTAA 2AXNA 2V97A 4IRXA 1NNSA 4W63A 4TRMA 3RIYA 1JQ5A 3SN6A 4L5CA 3ZCTA 4DCNA 4GYJA 4L4ZA 2XADA 2HHHB 4Q4JA 4DZRA 4GI2A 5TF0A 5A4IS 4HNAB 2OGTA 3LYLA 3ASZA 4UBJA 3AKZA 3QYPA 2BR4A 1B93A 4KE8A 2Q9CA 1XPOA 2J5KA 1K3FA 3FCXA 5TJ9A 3I2KA 2E85A 1K27A 3N28A 3R6GA 1CUAA 1NMSA 2ACEA 3N58A 4HDSA 4WESA 4JL8A 4J0QA 5IC5A 3AL3A 5TQ2B 2VHQA 2XVXA 4G5SA 3L0SA 5AQEA 3NAGA 3L82B 3TW8A 3OQVA 4XB2A 3SK0A 5BWBA 2YIJA 2IGTA 3ZHXA 1ZJZA 2NV0A 2A2ZA 1YZ3A 3CY6A 3CZ4A 3SHQA 1RZ3A 2JLUA 3RC3A 3OTIA 2X5JO 1Z0KA 1XN1A 3O4HA 4XQ0A 2HXSA 2IYTA 2BP7B 1JGTA 3IYLW 3KUKA 3AUXA 4N0PA 4FYWA 4DMUB 1BCSB 3OPYB 4M0KA 4PQEA 1DDOA 4U7FA 4B40A 3P5SA 4V1CA 1R0WA 4UKDA 2QYSA 5F4ZA 3PXXA 3C6ZA 4HGPA 5LIPA 1WPGA 3ZLUA 3G7NA 4OXRA 2ZSIA 3DFUA 3E9ZA 3NMUF 3ZIAD 5KUTA 4NH4A 2NSJA 2WU4A 4UXIA 2W9XA 3E22B 1PR6A 1VHQA 2H7YA 1F2TB 2YZ2A 1BCRA 2AR7A 2ZPUA 3EZXA 3GR6A 2XGGA 5FFNA 3GMSA 2X23A 4H6VA 4U2EA 3UA4A 2CC2A 3G8YA 4MVJD 1P72A 3FUVA 3A0RB 4U63A 3WLOA 5DTJA 5F1OA 5KREA 1G3QA 3AONB 3TRKA 3NH9A 4H18A 4IX9A 4TV9B 1D1PA 1GNTA 5C5IA 1O96B 1ZU5A 1LLFA 1QR2A 1B8NA 1E3WB 2R5NA 3D3KA 1MAVA 4OYHA 2R5WA 4LMBA 4ZOLB 4DY4A 2Q6OA 2QPOA 3L43A 4LOIA 5ICCA 4AX8A 1WM1A 3QLVA 3L79A 3O31A 5B1HA 2GBLC 3K30A 3H5TA 3ZHOA 4ZYLA 4LC9A 2UZIR 5ELLA 5C4MA 3AFHA 1OTXA 2PG3A 4NOKA 4PAQA 4E4YA 2QRQA 3K9HA 2B34A 2BWJA 4Y9DA 5G0SA 1MZVA 4YJDA 3OSUA 3PYXA 4EF5A 1XZ8A 1RQGA 4ZOEA 3PX3A 4UUBA 2QROA 4E3WA 2D8MA 2UAGA 3OZTA 4OHFA 1XLTA 4FGLA 3TQCA 3ZVMA 5F7ZA 2HSWA 4MA5A 1NKVA 4UOQA 4G0VA 1Z36A 4KOEC 2XAUA 1QK4A 1RLMA 2JHAA 4OGGA 4ZEMA 3FMIA 2OPBA 1CQIA 1JEOA 4H2DA 4E7PA 1XROA 2RI1A 3TSOA 2PA0A 1U7TA 2WILA 4I36A 3JWIA 3S7ZA 3PYMA 3PDIA 4TKMA 4X8OA 5TGTA 1EXWA 3MTIA 4A6DA 2Q0SA 3BMOB 3MWKA 4DG9A 2JG3A 1L4BA 4QOJA 2O0KA 4XOIA 4F6RB 1YZNA 4EARA 1SKMA 1KF0A 1WB5A 3CRRA 2KBEA 3PD0A 2CE7A 3DTVD 2GA8A 2YIMA 2A84A 5J58A 1T4CB 3GX1A 3SE0A 2D4AA 2XBLA 5C51B 1GUDA 2QR2A 3ECCA 3LFHA 5CT9A 2DTXA 3M6FA 4KQGA 4IH4A 2IYLD 3ZNQA 4QGHA 2QL7A 5CYFA 5KYTA 4U7DA 1COZA 2ONYA 2QRPA 2TECE 1IY0A 3F6RA 4OHWA 3NC1C 4N1AA 2GHTA 2XMSA 4BLOA 4C3ZA 1WCIB 2QG4A 3PWTA 2WSSA 5G40A 3AK4A 3L7NA 3LHDA 3IODA 5IKMA 2CE2X 2JAWA 3JD4A 2WF5A 5FTNA 5JNRA 2XUZA 5F5LA 5LD2C 5HE8A 1KZHA 4QG7A 4KXFB 1CUCA 1Q0LA 1Q0UA 2CYAA 3DGEC 1XU4A 5AHXA 5LQUA 4ZVUA 1E6WA 1TZKA 1E9CA 3HQ4O 4PVCA 1B6TA 3LW8A 4H77A 2ZCJA 1PZEA 3L8MA 4B6QA 3QUQA 4YDHB 1MH1A 4RKQA 1GPMA 2GXUA 1IPEA 1EFTA 3RKUA 3W9SA 4JLPA 5CVTA 1WHTA 1RC8A 1P2FA 5D3KA 1U0LA 2RGUA 3EMDA 2VP6A 2BM1A 1Y1RA 2J09A 3CWCA 3TGWA 2GN1A 2QD3A 2EOAA 1HE3A 3D2CA 2VKTA 1Y37A 1ZI9A 1DIHA 3T1VA 4TLLB 3NHUA 2QU8A 3DNFA 5C4IA 3O2JA 5DI3B 1I6LA 3ED5A 3QKRA 2IPXA 4PPFA 3BA6A 1S2OA 1U8ZA 2PUFA 4NSNA 5B1SA 1LZLA 4ZCRA 5B30A 5AKHA 4PYMA 4UCQA 3E9RA 2G70A 5J4HA 2GTPA 4XX1A 5FF9A 4CKZA 1ONBA 4YT8A 2PH1A 1P80A 2EYUA 1G60A 1OYWA 4ON9A 3TD9A 4X44A 1VE3A 1BH2A 3NQ41 4IIJB 5IT4A 1VXOA 1S2MA 3PB3A 4U7HA 5DK6A 5EWLA 1PFVA 2QY9A 3SD7A 2YKGA 4P3KA 4UTNA 5AVTA 1Y98A 2ZRHA 1H1LB 4RNCA 5ALKA 5ALMA 3OF5A 3M4ZA 3UFXA 4EKDA 1ZNQO 4M87A 1II0A 2H54A 2HO5A 4AXXA 4NCAA 1IHPA 1QHFA 3EW7A 5I8PA 5KMGA 2RSLA 4NLLA 3RV4A 2K7FA 3A26A 1CJUC 1FBNA 2VPIA 1Z68A 4AKEA 4AJOA 5LP1A 3QMPA 2O3JA 4LYDA 5B3KA 3OI7A 4D5GA 1G6Q1 1EUYA 3J7AC 3OA2A 3WRXC 3DCIA 4L0DA 5JG7A 3CNBA 1T36B 2A1UA 4O2LA 1OWNA 2VXYA 3GP3A 4F1WA 5AW7A 3EFEA 5M5BA 1IY8A 4DJAA 5AFSA 2AQHA 3O7WA 5K3AA 1TEHA 2C03A 2LUOA 4HDAA 2WVGA 4UBNA 4UUPA 4ARVA 5IK2D 3HCPA 2FPMA 2IIVA 4HGRA 2IHJA 5HMLA 3TR0A 3WQHA 4F46A 5I7OA 5BQXA 2GAAA 1TT5B 5KYXB 4QYSA 4IXDA 2V7PA 1IN7A 3FYUA 4WVLA 4PN7A 4ZDJA 3RUDA 4DDWA 4H0CA 5SY4A 5B2EA 8AT1A 1W0JA 1ZITA 1YRAA 4LXHA 1H2BA 2ZSUA 3FPHA 1ND6A 1PF7E 3THWA 5LXTA 5HZKA 2Y68A 1HDOA 4TSFA 3MT8A 3RQSA 3HO8A 3CVWA 3LM8A 1L7OA 2IZ0A 1OGYA 5HUQA 5B6JA 3VQTA 1AT1A 1JLHA 1G8HA 3E7FA 3BRSA 2J0UB 4GD3Q 2NXNA 3V6MA 4D42A 4MCHA 4CIDA 4EKNB 5CCBA 3F78A 3OKAA 4H3HB 2GB4A 4Y67A 4E21A 4QGBA 3QBTA 5CM9C 4BQFA 1IONA 4K46A 3ENZA 4Q1VA 1Z6GA 1I51A 3DE0X 1EWVA 1PJTA 1Z6YA 3H9EO 1T43A 4KBYA 2BGGA 4C7OA 1W1IA 1DIAA 1QYIA 2W2LD 1GYQA 3G88A 4U5XA 1JI0A 4WOKA 5F77A 3OZCA 1P0PA 2FRVA 1YQQA 3NTVA 1IZYA 1FA9A 1PWEA 1WUJS 4N3NA 1FDSA 1Z2PX 4C6SA 2WK1A 1ODSA 3OFJA 4H4DA 2QY6A 1C7RA 1ZVQA 1PE0A 1UMCA 4QU8A 1FFXB 2DUNA 4PVDA 1VL8A 5E3IA 1DQYA 5IM5A 1GEGA 1EIWA 4B3JA 4F7DA 4EELA 4UHHA 4MUYA 3KNZA 5DRYA 4J6FA 5KWVA 4LQ4A 1FTQA 2ZIVB 1S2IA 1EINA 4ZRDA 4BNVA 4F5WA 3AETB 1E2JA 3LVFO 3AIOA 2PCLA 1ZMBA 2HEGA 2Y1CA 3DL4A 3DVAB 3GXOA 1R0SA 1YOBA 5LBIA 1JSXA 3DR3A 4HZIA 3UMRA 5BV0A 3QU4A 3RVRA 2BHTA 2VNJA 2PDAA 3K5PA 4LISA 4X84A 4TS3A 4Z86A 5TRTA 3VO2A 4D25A 2O59A 1ML3A 4L16A 2WUFA 5TEVA 4Z7QB 4WFIA 5B3LA 4Q3EA 4ZCSA 4GMGA 1TM5E 1NL3A 2D1TA 2P6MA 3HR4A 1J0AA 3NBKA 4G5HA 2VF5X 4R8VA 5GOZA 5BRNA 4L7VA 5KNDD 3ANYB 2ZYIA 3B3QA 3NOVA 2I8AA 3PTZA 4QUAA 3USCS 4B35A 4BX3A 4ESOA 5K4HA 4NBKA 3G17A 4NE9A 3R5TA 3HXQA 1EVQA 2I03A 1WE2A 2F64A 4H35A 4C6RA 1V8OA 1F2UA 1FEZA 2FX2A 2VP5A 5E2BA 1X87A 2HT6A 4LY9A 1RQRA 4UDYX 6ABPA 1G1AA 1A69A 1M0TA 1YO6A 2BEUB 5HDQA 3ZQUA 1JHVA 2JJ2D 1O57A 2FN9A 4JT4A 2AC4A 1RYMA 4TVOA 4G36A 1QUEA 3N0WA 4UHJA 3QGMA 4LVCA 4AW9A 4RFSB 4Q47A 3NKLA 4H1VA 4IHKA 3K1JA 5I5GA 2BCJQ 3K71B 1QDUA 1XAIA 4OHCA 1JU3A 4EAAA 2PAFA 2X9VA 2IYAA 1YZVA 2E37A 2XDQB 3NHKA 3QVSA 5LWHA 2JHGA 3BJRA 3R5FA 2NU6B 4BX2A 3NIGB 2I6TA 3FWKA 4HMOA 1NR1A 1RPAA 3ZIAA 4QPPA 2WHYA 3JD1A 1KFKB 1G5QA 2VWPA 4BKPA 4LX8A 4R2KA 3L4KA 3WHPA 2A5JA 2XMBA 1Y33E 4Q19A 3BTUA 3L7JA 3SM3A 2PUCA 1WUTA 4C87A 1JYFA 2EBHX 1Z0JA 1G6OA 2UVPB 1KAHA 4D26A 2Q9AA 2ZXUA 3HKBA 4Q9LA 2WQZA 3B38A 3GRAA 3C2QA 3KT8A 4K9KA 1IRIA 2AUMA 3GUUA 3WTCA 3D8SA 1S3IA 3S1SA 1NJ5A 3CE6A 1OFHA 3X1WA 3T9BA 4Q48A 3BWDD 1Z0DA 1NPYA 2HIMA 3BYZA 4UUNA 5J2TF 3V1LA 4DSNA 5LFAA 3CV3A 3HH8A 3G8DA 3IOMA 2D0OB 1UEXC 1T2CA 2QN3A 3HB0A 4FNGA 3TZHA 3WKBA 1MORA 5FO0A 1GAXA 1TLTA 4OUDA 4MGYR 1ZNZA 1UPTA 2FPUA 4P81A 1KVSA 1W1UA 3ENVA 5E9JA 1QMGA 3I9LA 4RD3A 3KJQA 4R1PA 1EK6A 2PX4A 4N5NA 1YRLA 3BTVA 4Q02A 3BIXA 1JG1A 1IUNA 1SU6A 2OD9A 3A36A 2FPKA 5KOYA 1OH8A 2GJKA 3BZWA 4PYNA 4WASA 1UANA 1YA4A 2F1HA 3NWJA 3U3ZA 3X3HA 1VMEA 5HGXA 2VT7A 1T5OA 1YZKA 4XGNA 4DWWA 3SC6A 4GUDA 2GFQA 4GVPA 3QUCA 2H59A 5DGDA 3N74A 3CO5A 2OB1A 4JC5A 5D7BA 2J3LA 1KJIA 3PU6A 4CF4A 3PVCA 2WNHA 4DEXA 2IODA 1FNCA 1WMSA 3OQBA 5LB4A 3T5TA 1O1YA 3A1VA 1PYOA 2HA7A 2O5EA 4PZZA 2LIVA 4YRPA 2CSXA 5FORA 1GGNA 3C97A 2A14A 1EK1A 5DBEX 1SA0B 1TGYA 1XC7A 2GK7A 3JVDA 1OX5A 5JXJA 2CKMA 4NBVA 1ZH2A 2J3KA 2ZLBA 4RGYA 1V5GA 3S2YA 3DP9A 3RUIA 3HYLA 3RUAA 1ZJWA 5AJYA 1Z12A 1ODKA 4XE5A 3MAGA 2FK7A 2GCEA 3N8DA 5FO1A 2DJIA 2GLTA 4FOPA 2Q3FA 2PMDA 3MD0A 1ZVMA 2DPXA 3UJ3X 3EEOA 1KJYA 3DVLA 1Z38A 3SQWA 3TLKA 3MA0A 3FCOA 3VKUA 3QE9Y 5FQNA 1H2WA 1VL2A 3L7MA 3ADBA 4Y6OA 1TUBA 3PF9A 2TMKA 1U3TA 1OBHA 2HC9A 1RP7A 3MCTA 1ANKA 1U7XA 2Q6KA 1AS3A 3ILXA 3LXXA 5CLFA 2CHQA 2VQ6A 1ICIA 4ZAYA 3CW8X 1BS9A 2YN4A 3MMPA 4OQDA 1CUWA 3SU8A 3L02A 1J1IA 1V71A 3LHIA 3V34A 4B4DA 2DTDA 4AN1A 5MGBA 1LTKA 2WTBA 3A9VA 3M6UA 1RM4A 2C2HA 1M6VA 2NVOA 2PZAA 3FYCA 3RK4A 1C0IA 5IXSA 1FOEB 3ELYA 1PWYE 2ZVQX 4AULA 3OMWA 4XKJA 3DCYA 2YW2A 3QKIA 3JQAD 4INOA 5KWEA 5J2UF 2GYUA 2Y27A 1UPCA 4L73A 3SYLA 4QJ4A 5AVZA 3L9WA 2J30A 2V7GA 4LZNA 2X2PA 4JFRA 4NPHA 4R05A 4OO3A 3SBOA 3ZY2A 5CIYA 3FFAA 4G1FA 2X1MA 4JYAB 2EZ8A 3PHCA 4UFNA 4AZ0A 1IOZA 4GGPA 1ID1A 1VMDA 2QJTA 2C7GA 2W2QA 1NQWA 1G8MA 3NORA 1K4YA 1DRKA 1Z75A 2G67A 3PQ4A 4S0XA 5IUNC 3NJRA 3DV0A 4M9SA 2BRUA 4O2BA 4N0DA 2PYZA 3FAZA 4C4YA 4GAEA 3CPSA 3AHJA 2PFGA 4QDUA 3RS2A 2Q4OA 3ZTTA 3RVKA 2GESA 1XRJA 1XIVA 3EPLA 1U8FO 1JV2B 2EX1A 3AF0A 5FUVA 5GP1A 5IDYA 3IOEA 3Q3EA 1N2GA 3QA9A 5GJVC 1QNLA 3NWEA 4QDOA 2QNIA 2Z6UA 2O8CB 1PEAA 3ZV5A 4U3JA 3ZNPA 4FHGA 1X80A 2WHRA 3H9JA 1PR9A 4OBXA 2I76A 4H27A 1T0HB 3OLYA 4H3VA 3LF1A 4QXPA 2QSYA 5C18A 2IQIA 1UPAA 2ZANA 5TQ0A 5EMNA 2J9RA 4NY1A 4CKWB 2REXB 4DGSA 1NVAA 4A6XA 1U6IA 4ID3A 1AQUA 3GRUA 4U2DA 5ED0A 2WSMA 4EGCB 1L3BA 4OXIA 3S2UA 2XT6A 3NBQA 4HH1A 2QD5A 1DKPA 3ZHTA 3GPIA 1M34A 2HUNA 4X1KB 1XWIA 5AW0A 5HOEA 5HILA 4IIGA 1ZL0A 5JPDA 2ZZNA 2AFVA 2HK6A 5FPTA 4GPBA 5J43A 1YGYA 4B82A 3PD1A 3I01A 1OLSB 4Y2VA 4DA9A 5ETJA 2QUBA 1B8VA 2RH4A 4DJ5X 1YWGO 3RDPA 1TA0A 3BMQB 3DOJA 4OM8A 1XL1A 3F98A 2V9PA 3L93A 3O1LA 4FGJA 4DCTA 3R9XA 4IVPA 2V5VA 3ZNOA 4HNTA 1G8SA 4EH1A 1BHO1 3BXZA 4P98A 1TU3A 2V7QD 3IUSA 4Y2QA 4IFEA 4CMKA 3O8NA 4AMVA 4Y6LA 3GZNA 5TR9A 1ZOIA 1YDEA 5KVQA 1NNUA 5JZMA 3PHLA 1XDDA 2FRDA 4EI8A 2RK4A 2NAPA 3H2BA 4FMPA 2JVJA 4Q7QA 4MV5A 2GFIA 8MHTA 3EGDB 2W2LA 5LBTA 2IEGA 1TA9A 1JDPA 4HLCA 4TT8A 1NI3A 3D6NB 1PUXA 1SCUB 2BGMA 3HYRA 3QPAA 4J0HA 1AZWA 3FZYA 3NT4A 4W5HA 4MDHA 3BN3A 3RT9A 1KZ1A 4S04A 4QTXA 4RULA 3JAWA 2VQEB 2TMYA 1ADYA 1VJ5A 1AKVA 2YY7A 3QELA 2XRZA 2JDID 2BFNA 2RAPA 4JLSA 5AHKA 1TIKA 3OX4A 3VOTA 2IW3A 2ONZA 5JQGB 5LOVF 2NT4A 3M1IA 5I4CA 3OZSA 5AXCA 3H8WA 1MEJA 2Q7OE 1P9NA 5CBKA 1JG2A 4PX9A 2OHOA 3IELA 4MW5A 1M8KA 4IHJA 4PPQA 1MGPA 1E79D 1TCVA 2RGAA 3IMKA 4DE5A 1N25A 2HY7A 4GC5A 3CLKA 4UEKA 2J1LA 3VPCA 4NK4A 2IGBA 1X0VA 2AEJA 4X85A 2FXIA 1Y0BA 1KOFA 5YASA 3TTYA 2QW8A 5HOQA 2HJ9A 3BSSA 2FUNB 1GG5A 2YV1A 2YUIA 5A4AA 3HRKA 1HSOA 3SYKA 3TUZC 3U61B 3IUJA 4DSUA 3USES 5AW4A 4C2BA 1XP8A 4CM3A 1YB6A 4KUHA 2R6GA 2L0XA 1CC1S 2GO1A 3L7IA 3F67A 4YT2A 3ODPA 5H1YA 4M1YA 5GAJA 2F3UA 2ZR9A 3GV0A 2VYNA 1QCCA 2EL7A 2OORC 1FNSA 3EZNA 3EGWA 4MVYA 2HCTA 2DFPA 3Q3JB 4AMGA 3KR9A 1ADCA 2J9FB 3RLIA 1I1HA 2QZSA 2JJ2A 1B2LA 1W93A 4JLUA 3ZQ6A 4W5OA 3AJAA 1L7EA 3EDYA 4HDKA 1ZM2A 2B5WA 1HORA 1NONA 3AMVA 5EIEA 1EM8B 3PPVA 2NADA 3KJGA 3RNOA 4FFOA 1ISSA 1R6UA 1W4BA 2JI6A 3IFSA 2F9FA 4OEHA 5GONB 3VNSA 3WGVA 4NYJR 4G0UA 2B92A 1BVUA 2I8CA 4ND8A 4GEGA 1NQAO 1ODJA 1WR8A 3T7EA 3G5TA 3LKVA 1LTQA 2NAFA 2SKEA 4HFRA 2MTBA 1NF8A 1CUSA 1FC0A 2EJWA 3HB7A 4L85A 3TLXA 5CA1F 5FA6A 1U8AA 4FGKA 1A8SA 1REQA 4DR1B 3GJQA 3P0FA 1CY8A 1AQJA 1NUQA 1W34A 2FUCA 4RENA 2ZJ2A 3MC1A 3AVTA 1QHEA 1JT2A 1JZTA 1Y6ZA 2YC4C 3O9ZA 4TMWA 2RAVA 1D2HA 3HFRA 5K8CA 1XFDA 5E0OA 3VZCA 4JJ8A 3R1IA 2FFJA 4N7JA 4KN6A 4PHHA 1PNQA 4KSCA 5ALTA 4ARBA 1TXGA 1L7BA 4LRXA 4MUNA 1CVLA 4EGJA 2EW1A 3H1BA 4ZAWA 4FFBB 2WHQA 3N2EA 1WNTA 2O6LA 4MW1A 5CDSA 2FEWB 5JC8A 4NICA 4MIKA 4ND1A 2NVBA 3KK0A 1V11B 2OYSA 4YDSA 4BQOA 3BD8A 3MCZA 5BW6B 2R2GA 2QZ4A 3FNHA 4ZO6A 3W8DA 3AILA 2ZT8A 3DUFA 3RYFA 3PQDA 5I4BA 5EVCA 4M1WA 3FCSB 3T5GA 4ZT7A 4JV5B 1QS0A 5CAEA 1L8AA 1JG6A 3CHYA 3RYCB 5DRTA 2VJYA 2WTNA 4RTSA 1NP3A 2D2IA 2PGLA 2PLNA 4J1TA 5KAPA 3MHPA 2ZUCA 4GSYA 4KH1A 3LT4A 4DHEA 3K2IA 3NXSA 3K9NA 3PQ7A 4QUGA 3CUUA 4MW9A 5C52B 2P1DA 5JVDA 1OF1A 3OY7A 2GKOA 4FYKA 3B6ZA 4BMNA 1XF1A 4C2AA 2JGNA 2VQ3A 3E3NA 1R0KA 4LECA 4OD0A 2QWXA 5EE9A 5JO9A 1PO7A 4J1NA 3ETEA 3HMQA 3IVGA 2JAXA 1S1CA 2YMQA 5K51A 4Q3KA 4Z4HA 2Y71A 7REQB 4AQYB 1F2DA 3PFWO 4QASA 3RSLA 3A9RA 3EUEA 5EZYB 1ZD4A 4UU0A 3DNPA 1KI4A 2QQGA 3GWGA 2C8LA 3WG9A 4CDNA 3GJ3A 1RZRD 1SHUX 3E70C 4H17A 4OYLA 4R2XA 1ATZA 1EQAA 5CCXA 4PWZA 3PIDA 4TL8A 3URKA 3IE1A 4YACA 4BRZA 2AG0A 2HZBA 3OFSA 4OA5A 4DDKA 1UZMA 3EQ2A 1XCBA 3N8NA 2FUKA 3FFXA 5EWMB 2UUBB 3A6EA 4JQZA 3WKCA 4AZ3B 4AN0A 3QVGA 2ZJ6A 1XG5A 1FFHA 3TZQA 1YBHA 3IP6A 4EDHA 1CTQA 2J7PD 3QTLA 2M9MA 1OXBB 2A6PA 3H05A 5DV9A 4BQQA 1XVIA 5F1YA 1ZGZA 4D4HA 4CF7A 3KOOA 3M4JA 2DETA 1TW2A 1RHRA 1Z7BA 2VP0A 2BFPA 2CXUA 1JWBB 2YWCA 2I34A 3O1IC 4MKGA 3RVQA 4KW7A 4C5AA 4EPTA 3B51X 4POAA 4HLUC 5GGXA 3SQMA 3E4CA 2OZPA 2ZYHA 1H23A 1KQOA 4QJ5A 2R6FA 4E07A 2GYVA 2O0LA 1PN3A 3CVYA 2YNMC 4EY8A 2A0YA 2PAAA 2XF8A 3GAAA 4GFDA 3NDJA 3SZOA 3SYNA 3Q72A 4C07A 2V3VA 1AIPA 1LW6E 1L7AA 1MX9A 1XTSA 2FSVC 5D3MA 1R4MA 1EFVB 3OCWA 3JQAA 4M0EA 2IC5A 1GDHA 2VRWA 3T0IA 3N07A 3S29A 2JI9A 3EEFA 1NXXA 1F17A 3QBJA 3RUFA 3VGPA 4F45A 2ZRFA 4U9UA 3HUFA 2HIAA 2XV1A 1NV9A 4K2HA 4BBPA 4P0PB 2EJUA 3H5RA 1X7WB 1RIFA 3VHXB 1B76A 2O3UA 3ZR4B 1KFJB 2VIIA 4WKGA 4HK4A 4LYJA 4I4NA 4ZC8A 3SIXA 4ARZA 5BW5A 1K8XB 1SVMA 1N8SA 3F2IA 3LVBA 1J49A 1VSBA 2FEXA 1FYXA 2IOQA 4A26A 1UKAA 1BMTA 1H6DA 1GZDA 3FSGD 4LJ5A 1QIJA 4OHKA 3ZN2A 3VC2A 3I4FA 4OL9A 5FAKA 2QMQA 2ZAYA 3OHSX 2GNOA 1XD2A 4KC0A 5TPWA 2CJPA 1TM2A 2ZTMA 1X3SA 4JZYA 4U8HA 4MKRA 3KR1A 2ATXA 5IFKA 4LBWA 2PUBA 3BSYA 1UMKA 3VZQA 4I0WB 3TLAA 4BN4A 3WIDA 4GYYA 3OLQA 3FPJA 3BWMA 3EMKA 2L69A 2K2WA 4YALA 4JB3A 2ZROA 4DT1A 1UFOA 3NLLA 4YAFA 5LDGA 2XWPA 4JUAA 1BXGB 2G4VA 4P3NA 4L1KA 1MO4A 2EHDA 2ISQA 4AFNA 5A0VA 2EKLA 1KAOA 2CVZA 5CYPA 3KD2A 4XJVA 1U0NA 4Z8XA 2ANCA 2QI9F 2SCUA 1Z33A 3FUWA 1ONNA 3KD3A 3CKLA 4S24A 5DXJA 1FYEA 1SB8A 3CUSA 2VYQA 4WNAB 1MQ8B 4I1VA 3ZXSA 3WL4A 1XRQA 4LBVA 3N7AA 1MB0A 4R69A 3NNDA 4WA7A 3WLEA 3G13A 4HRVA 2IHBA 1OYYA 2BFCB 4FSDA 4Y0NA 5TMBA 1TT7A 4IDAA 1X9GA 3A1UA 4HG2A 2HBYA 3I8OA 4GI1A 3WGHA 3DL7A 3LT2A 3DB1A 4NV0A 3ERCA 1N5OX 1IXSB 3NHYA 3QNWA 1D4FA 4IV0A 3CKYA 4X64B 3DM9B 3ADCA 5D1NA 1KU0A 4R83A 2QQ0A 2I9PA 5F3DA 1WMFA 3LLUA 4V1CI 2J59A 2K87A 1K66A 2C5BA 3T12A 5GVSA 4B09A 3U4IA 3DL0A 4KSYA 4LBZA 2OXFA 2OAEA 4IFTA 2ZM5A 2BT4A 4FYJA 3C39A 1G21A 3FA2A 3TQRA 5F2OA 4MV9A 6AT1A 5K0TA 3RC9A 2DPMA 4R9VA 4TROA 1Y5NA 1AKYA 2QNBA 3I9V6 4MA0A 2F1RA 4X1IA 1XA3A 1H0SA 2B1QA 5JH7A 5H9VA 1RLJA 2AVNA 2FPWA 2P9BA 1D4OA 3ZXYA 1BXRA 1C1YA 3WLIA 2XUIA 3Q8XB 4N8EA 6LDHA 1E79A 2WJHA 4AQ7A 1U99A 5T4FA 4PQYA 1KS9A 3FD8A 5FKJA 1VIYA 1QM5A 4J03A 4D3SA 1U4OA 2DMRA 1TM7E 1YL6A 3TG2A 4JJKA 2A88A 4NMLA 3TB4A 3VC7A 4CGYA 3MTAA 1XVLA 4R1SA 3GGDA 3R3HA 2VXOA 5CD1A 3KLBA 4KR6A 4JZKA 3NDRA 3EC1A 2XUJA 3DTYA 1OREA 1V2HE 4L5JA 3K0CA 1WL8A 4GZ5A 4GGOA 1KP3A 1U28C 3TRHA 3N86A 1K5DA 2D8AA 1NDHA 3SXPA 2GNPA 1M5TA 3OZGA 3UB3A 1QB8A 1UFQA 2H1SA 3EHEA 2G8LA 1B8UA 4HWPA 2V4ZA 5EIOA 3DHVA 4IJ5A 2GRJA