5M34A

Structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
245
structure length
228
Chain Sequence
AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTYQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Change of a Tryptophan Residue in BtuF Facilitates Binding and Transport of Cobinamide by the Vitamin B12 Transporter BtuCD-F.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Vitamin B12-binding protein
total genus 80
structure length 228
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m34A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m34A02
1H1LB 1M1NA 2XDQA 3UJPA 1QGUA 4BBPA 1EFDN 5JPDA 2PS9A 4B8YA 3AETA 5AFSA 2PHZA 1M1YB 3ZK9A 1FP4B 5BVGB 3TNYA 2PS3A 3AEUB 3AESA 2AFIA 1G20B 3BE6A 4WESB 5M2QA 4WN9A 4NNPA 5BVGA 1M34A 5I4KA 4FILA 3ZK8A 5JOQA 3K1AA 3AEQB 5GGYA 1N4AA 5BVHB 3MWFA 2PS0A 3EIXA 4UTOA 1M34B 1PQ4A 5FLYA 2RG7A 4OVKA 3U7QB 2XQVA 2AFHB 3LHSA 5CX1B 2XH8A 4H59A 5HDQA 4PM4A 1N4DA 3BE5A 4DBLE 1N2ZA 1M1YA 2Q8QA 5JG7A 2M6LA 4M7OA 4UDNA 2O1EA 3AEUA 2OV3A 1G20A 2X4LA 3R5SA 4MO9A 4NNOA 2OSVA 1QGUB 4WNAA 4G07A 5BVHA 2XUZA 4H0FA 4HMOA 3AEKB 5M34A 2OV1A 4UDOA 3HXPA 3U7QA 1K7SN 3NU1A 1FP4A 3AEKA 3MFQA 4MLZA 5GGXA 5KOJA 3ZTTA 1QH1A 3HJTA 4UTPA 4HN9A 5JJ5A 4WN9B 4MDYA 1L5HA 3AETB 4ND8B 2MINB 4WZBA 5KHLB 3TEFA 4FKMA 3MWGA 4TKUB 3HH8A 3AERA 5CX1A 1K0FA 2YNMD 3ZK7A 1M1NB 2QI9F 3MINA 2PRSA 4GICA 4LS3A 3TLKA 4INPA 4IRMA 1KARA 4LJSA 3PDIB 4OXRA 1XVLA 2OGWA 4WZAB 3PSAA 5M3BA 3K1AB 3AEQA 1KAHA 1N2CB 3R5TA 1K2VN 2YNMC 3PDIA 2WHYA 3MD9A 2MINA 4WZBB 2AFIB 2XDQB 4K3VA 4WESA 1KAEA 1N2CA 3EIWA 4TKUA 5B58T 4XPIB 2R79A 3MINB 1G21B 5KOHA 4INOA 2M6KA 4MX8A 1MIOB 3CX3A 2AFHA 2ETVA 4HMPA 4WZAA 3ZKAA 3LI2A 4FNAA 4WNAB 4TKVA 4N01A 1H1LA 5HX7A 2Q8PA 1K75A 4G09A 2XY4A 4PAGA 4TKVB 1TOAA 3PSHA 1PSZA 5KOJB 3G9QA 4XPIA 1ESZA 2R7AA 5M29A 4HMQA 1G21A 1QH8A 1L5HB 2WI8A 5KOHB 4ND8A 1MIOA 3AESB 2XV1A 4CL2A 4OXQA 5CR9A 3AERB 1QH8B 4FI3F 3GI1A 1QH1B
chains in the Genus database with same CATH superfamily
3UWDA 4J9VA 1YAJA 4HJXA 3RTBA 4NATA 4NMXB 1A9TA 2OHOA 1TW2A 4TZ0A 4BCCA 3D1JA 2YMMA 4HRAA 2IXTA 1NRIA 1U3TA 3IIKA 1F2TA 1VE7A 4CM9A 1FP4B 2FW6A 4KPUA 2BZGA 4AXBA 4Z9YA 2EVWX 2I4RA 2FFBA 4K88A 2DPMA 4H1TA 3V4LA 1H1TA 4PTYA 4HLNA 2QP9X 1Y1RA 4AY2A 2ORED 3S2EA 1CT9A 5KYNA 5HK8A 3T5CA 7ADHA 2HBQA 4COOA 1KJ9A 4UUQA 1JQEA 5LJLA 4L5AA 3U7QB 2HA3A 1OZGA 3A7EA 5IJWA 1E2DA 2LDXA 4B33A 1K0UA 4GPAA 3QEBZ 1LPNA 5DYYA 1ZDMA 3S44A 2C5HA 1NQUA 1N2ZA 3WLNA 2REXB 3N75A 1GRCA 3HYRA 4MQMA 4PZDA 3GOHA 3WK6A 3HRHA 1FBTA 4ML3A 5I9IA 5K0CA 3FHTA 2XOEA 2B4AA 4NEQA 4J76A 2EZ8A 3WE7A 3WGQA 5KC9A 3SVLA 1YQUA 1QGDA 2W9XA 3EGXA 2NX2A 3WWEA 3H9QA 5AVWA 3ZY3A 5LXTF 4UU0A 3B2EA 4RHYA 3VPAA 4M37A 1SB9A 4TTSA 4WXYB 4Q7JB 3RKUA 3T5TA 3ZOZA 4KITB 1YZKA 1ZJ6A 2HTFA 3C85A 3PVCA 4XX0B 5G0SA 4TVBA 3B12A 3P9XA 5CT4A 4K9KA 4F3NA 3EPJA 1TJPB 2VUHB 3P9RA 4CMIA 1U8ZA 3A3YA 2XYPA 2CHFA 3BJRA 3OQIA 3A27A 4DVJA 1JBKA 1GM5A 4I3HA 2WM8A 5J2TA 3I5MA 4EJSB 4E21A 1CJUC 2WFZA 3P0FA 4ZI7F 3KETA 5EQFA 3RVJA 3TL6A 3NGLA 4BCBA 4Q9NA 3C3MA 3E1GA 2J5BA 1IHXA 3M1AA 1JSZA 1HQKA 5EXPA 4RTLA 1VE9A 2C4MA 2GR9A 5AYVA 4U6SA 4BL5A 1B43A 1I01A 2ATXA 1XDUA 4BO3A 5ISMA 2XIQA 4NMMA 4KE8A 3ZWVA 3OHMA 4KAXA 3TAUA 4MKFA 4PLTA 5AI6A 3FR7A 1ULUA 3TIFA 1GQYA 3ZDRA 4E0BA 1DAGA 1MO5A 4M9SA 4IDBA 1IB0A 4DT1A 5CXSA 3VH4A 3FPSA 1HE1C 3AQIA 2XZLA 1I3NA 2HA6A 1X7WB 3X1KA 1YQEA 3IP6A 3MGAA 4RZUA 3DYBA 2ZSHA 4PGGA 5T7BA 1HT0A 3ED1A 1QGED 4FNOA 4OI2A 3RGWS 1WE2A 5I7FA 5DOZA 1DJPA 1S2OA 2KI5A 4LMAA 4WZBE 4REQB 4CTNA 1P9LA 1KI6B 3WQQA 2QX9A 3ESZA 5IPFA 2QW8A 3PBKA 1O89A 3HCOA 1TK2A 3KKNA 3PITA 3VR5H 3ZV5A 4AICA 4G0WA 1XZDA 1YT5A 2PSEA 3GB9A 2GEVA 5KQGA 1XTTA 1D2NA 2PMEA 5EMHA 1WU8A 2OXIA 9LDBA 4G2NA 1V71A 4L8LA 4IMRA 2ZS8A 5AMXA 4AZ3B 2I3DA 3DDCA 3LA6A 4EFKA 5JMWA 1IN4A 3CZRA 4DS3A 1TYZA 4RD4A 4ZP1A 4JB8A 3QU2A 3R7DA 1WPGA 3NIGB 1FFGA 1SG6A 2EBUA 4GW3A 4I4NA 4YAJA 3S29A 4CHGA 3JASA 1XA0A 2GKSA 3MFYA 2ZRQA 2X4GA 4J3FA 4MW7A 4QFMA 1XKLA 5FD8A 1YOVB 1DWQA 1CYDA 1EBUA 1E58A 3I8OA 2W22A 2IP1A 5C4MA 3GPCA 1B8VA 1H2EA 4G8JA 4K1LA 1JAZA 4MR9A 1NUHA 1AUQA 1UOOA 3GLRA 3IAM1 1C2TA 2JASA 3IH5A 2H2HA 3RARA 5I7RA 5G53C 3HV0A 3Q7SA 4P0QB 1P5ZB 2VH1A 5E7MA 1G59A 4E1AA 5A0TA 1MB2A 3O8BA 4J7XA 1VE3A 1G7SA 1C0EA 8ATCA 3LMKA 4GQAA 1WF6A 1QZZA 1E2QA 4UM8B 5D3QA 5FQNA 1DX4A 1EXNA 2EHDA 3D6JA 2YVUA 3KYCB 1BU8A 1PEAA 1WEHA 2AG5A 4MMZB 4YCLA 1FXUA 2YZKA 4PM4A 1P2SA 3TQFA 5CB0A 3PYLA 2P0YA 4GKBA 1KMCA 4L73A 3ZU2A 4BTLA 1OXBB 1RXSA 4M7OA 4EY3A 1CUGA 3MMSA 2OXTA 2OKCA 1F2UB 3FVVA 4JN6B 4DM7A 1XD2B 4LWZA 4URWR 2EEPA 4NYJR 1G7CA 4MW9A 1PJ2A 3PRYA 3QNUA 4FFNA 4LE2A 4F4FA 1CPYA 2AZDA 4WDQA 3PIRA 4GZLA 4XCQA 4Z9BA 5G40A 4BUCA 4P86A 2RK3A 3NBYC 3F6RA 4F3KA 1LC3A 1X74A 4K3UA 5JJLA 4ZHSA 1MX3A 2QAGC 2OGUA 2IX9A 3O84A 5JQWA 3HCCA 3STUA 2G67A 3IA2A 4II3A 3RJ9A 5AP9A 2BBOA 3K3PA 4J0KA 5AJYA 4OLBA 3ZZUA 4CMBA 2HCFA 3IJPA 3G6WA 1K8ZB 4JROA 3SR0A 2CT8A 4CEHB 4DIFA 3W34A 2L0XA 3BREA 3THYA 1QZ3A 3DFUA 3H18A 1WY5A 2JHAA 3DAGA 3MGKA 4KRYA 3SQNA 3JQAA 2IH4A 4ER6A 5GONF 5ALXA 4OLAA 1K8QA 1YS9A 2C4NA 1KTVA 2G77B 1U0EA 2D8AA 4WKBA 1R5OA 3SLKA 4CM8B 3WV4A 3ZXYA 1WZ2A 3ILSA 2PGAA 2Y66A 4M54A 3CU5A 5HEKA 3JYNA 3MTEA 3R41A 3Q7QA 3ZBUA 1AZTA 2MR5A 3O1JC 3NKVA 4Z4EA 3PPIA 2PCJA 1KJQA 4KQKA 4PW0A 1J9GA 5IYZA 3VDXA 1RR6A 4MIEA 3Q3JB 1IVNA 2Z4RA 4Y2UA 2V7PA 3WGJA 2MT9A 5TGDA 2C4UA 2OHJA 2IZ1A 2SCUB 1LPOA 2XRMA 4C3VA 3O38A 3OTWA 2DFVA 1THTA 2HLNA 4R8KA 5IXSA 1ODSA 2FPPB 1ZJWA 2XMGA 4R2WA 4ZCMA 1NI3A 3THSA 1GVNB 2HXYA 3SX2A 1T4GA 4OMDA 5JZVA 1CSEE 3UH0A 1ZI9A 5KBYA 1RKUA 1OGYA 1C14A 5CTAA 3RW9A 3D43A 1BDJA 2IPLA 5IAJA 3U4GA 2J9YB 1WM1A 5L51A 1KF0A 2GK3A 1BXKA 2WB2A 2YWGA 1RBYA 3BDAA 1TC1A 2QD1A 3C6YA 3C6KA 3ZX5A 1TYBE 1KI2A 3FNBA 4NMHA 4KK3A 4TLMB 3ZXXA 5C8YF 4WAUA 3T3OA 3RUFA 3EZLA 3TJMA 3HCEA 2A5JA 1XROA 2ROQA 3CH5A 4ZVUA 4YJHB 3ZW7A 3WGLA 4PXYA 4ZQIA 1KE1A 5FRDA 3FRHA 5HJEA 2QZJA 4AJHA 1SU6A 3EF0A 3W05A 4CG3A 2G3YA 2ZE6A 2GJSA 3L4EA 1ADBA 1BWRA 1DPGA 1QR6A 4PN7A 2P40A 3BGSA 4C0XA 3IT0A 4Z99A 3H5OA 2DY1A 3RNLA 4D57A 4BO2A 3OFKA 2FN4A 2N42A 3MJFA 1NUAA 1U1CA 1M6YA 1F48A 2CVQA 2PKRA 2A5DA 3BE6A 3LCRA 1D2AA 2E4YA 2J3EA 2NZYA 4IZIA 4JLMA 1QHNA 1TF5A 1A9XA 1KPHA 4BHTA 1JR6A 3TW0A 2MR6A 3ORHA 1MVOA 2V7UA 5T6BA 3H13A 3TGLA 5BSVA 3CVWA 3FBGA 4EW6A 3DFFA 2PUHA 3QJ5A 3EMBA 4Z0NA 1FS4A 4BNNA 5DNEA 3MRTA 3EIHA 4JEIA 1GFIA 3B6MA 4HNAB 4YUWA 2BCGY 5KMGB 3PCXA 2AQHA 3GIWA 3HUEA 3MLAA 4N9WA 4ZRDA 4ETIA 1U7XA 4HQKA 3KUXA 5EJ7A 2HWXA 3IVMA 4LYFA 4GXRA 4IIBA 4IF6A 2BE9A 2FWIA 4UNSA 5KYWA 1JIVA 5KZMB 3TZEA 4ACAA 3CEMA 2IYXA 2ZYGA 3OOWA 4UCWA 4P9NA 4XM0A 1H0HA 1XDDA 1MP0A 1RLIA 3GYBA 1DV2A 3R09A 1NLYA 2GJ9A 2CNOA 5FPHA 3VR4D 1RQ7A 2AQIA 2FPXA 5LB2A 3OTHA 3UG7A 2JJYA 4FFDA 3WNVA 2GB4A 3L4JA 3LIPA 4OP2A 5LZ2A 3M4YA 1SFRA 3L8DA 3UXHA 3EH2A 4DY4A 1R37A 1AE1A 3ER6A 4I1IA 2DPHA 4OD0A 2R00A 2YDXA 4ZHQB 2HCBA 5DH9A 1Z4KA 2UV8A 3PPWA 2ZSFA 2F90A 3K8ZA 3WYEA 4HH1A 1RXUA 3H0EA 5K2OA 1BD3A 3M4NA 1KEVA 3HN2A 4DJFC 5KVAA 2A9QA 2RHCA 3KV3O 1SZJG 1TC2A 3U3DA 3VYSB 4QG7A 4D4GA 1C7FA 4M99A 1E0KA 2X0JA 1MH9A 2QUIA 1C8VB 3DLTA 3IAEA 5LQUA 2GF2A 1QO7A 1Q3KA 4WUTA 5ERYA 3EIWA 1GTSA 4Q19A 2I91A 3ZI7A 2O8CB 2AD1A 1UEIA 1KBOA 3KUDA 4ERXA 2P1RA 4M4SA 2ZUBA 1UFVA 3SNKA 4C04A 2LGJA 4HX5A 2OVBA 3A6LA 2FE1A 3FVQA 4GOMD 4Q1EA 5F5NA 5L40A 4A8JA 3NCHA 5AK4A 1L4FA 1UZUA 2R1ZA 1EX7A 3IAM6 4N01A 4EATA 5KU1A 1SQ6A 4FT4A 1SC6A 4FGWA 5D7BA 4C2UA 4J2TA 3KR2A 4FWBA 5JXJA 3AEXA 4EKNB 2Y4OA 5ALNA 4KN6A 4MV3A 3VZDA 4UUMA 1BS1A 3WGMA 1W5EA 3D6FA 4I55F 1CUIA 1WD5A 4QLOA 4RLFA 3EY4A 3ZIAA 3CH4B 5HDBB 4KE6A 4DAEA 2H54A 4KVZA 4PG5A 2XKBA 4A2PA 3GGOA 4JLPA 2IITA 1CY6A 2JFPA 3D6AA 1ZL2A 1ZXXA 1J24A 3G82C 4EQ6B 5AO9A 2I8CA 3KSAC 5T3YA 3SWWA 3AETA 3GGJA 3P26A 5CFQA 1DIHA 1OFUX 1I6MA 1VA5A 1SVMA 1TIPA 2AN9A 3HA7A 1ZGCA 2G1AA 2FW0A 1I94B 1PYOA 2AN5A 3KJQA 1YBHA 4PRLA 4N5IX 1DT3A 1RIFA 3VR6H 1Z0UA 1YUMA 1OZ0A 3JQAD 4LJ4A 3UANA 5ED4A 3RYIA 1B3RA 1IRXA 2WEKA 1GZ3A 4TQGA 4EKIA 5HIKA 3RRYA 1EEXB 1ZRMA 3I76A 5IKMA 1RWOA 2DKFA 1OI2A 2L17A 3PT9A 2AR7A 3TNLA 5A4IS 1U3WA 1E1RD 3WWCA 1FC0A 5LIRA 1J70A 1Q1QA 4FUQA 4KXWA 1BKDR 3BPSA 2QGFA 3NFYA 3SC2B 2VWGA 2JGEA 2VLIA 3GRFA 4LSMA 4XOIA 3E35A 2C7VA 3H9JA 2HZ7A 2AJBA 2W98A 3NAGA 4Q4JB 5F98A 3AHHA 1DKOA 1U3UA 3HBFA 1E3EA 1E9BA 1JJAA 5BVHA 5JSYA 4QVGA 5KTPA 3NR2A 3V3KA 2ZJZA 2YFYA 4YRMA 4D9BA 1VJTA 2E5WA 2ZWVA 4EVRA 2OUIA 1GGHA 1VIAA 3EC1A 5K3CA 4NFHA 1M7BA 1SBCA 2O5RA 2M9MA 4O2AB 5BP7A 1YU6A 3TLYA 3BVPA 1S2NA 1RP1A 1U6KA 3BULA 3E58A 3INRA 5CRIA 1M74A 2WV7A 3T7KA 3QUCA 3ET5A 2QPTA 1X6VA 3GLKA 1H2WA 4EKEA 1GFSA 4OYYA 3MG9A 2XE4A 3L6BA 4RK5A 5LOVB 1C9MA 1LRJA 3USZA 4E94A 1SIOA 2K6GA 4KXQA 5IC4A 3SQMA 3AV0B 2A7XA 1DADA 4HUQA 4D0SA 2CC2A 1EFRA 4UHCA 2PL1A 2QDXA 4CQMB 1Y6GA 3Q2IA 2XDQB 1S2DA 3EHEA 3W9BA 4PSVA 2D2XA 3B13B 4OGFA 4TKUA 3TZHA 4C4ZA 4EUFA 4OLJA 3LYHA 2O3RA 4NARA 3UXYA 4BGEA 4HLDA 1RKBA 2XD4A 2P2CA 1ZD1A 3AG5A 1HNZB 1Z18A 4KBYA 4KWIA 3GFSA 5JXIA 4RM2A 3E6AA 3BWEA 5FNVB 1ST2A 2WAAA 2P9TA 3BIOA 1DG3A 4KZPA 2XVMA 3WGUA 2FN8A 4EECA 5C5EA 4BJ5A 1C9NA 1XV5A 3EWNA 4NS1A 4E70A 2EFJA 1K5PA 3BWVA 3L82B 5DNDA 1NMYA 3NG1A 1JEDA 1TCVA 4IWNA 2I3GA 2PT7A 4Q4AA 3CZ4A 1J33A 4DGSA 5D84A 4YNBA 3WAKA 2ZI4A 4MI1A 1O6CA 2NV0A 4M9UA 4XGIA 2PSSA 3SF8A 3TRFA 4CFYA 3HB9A 1V7PC 2FR8C 4D4JA 5AHOA 4HO1X 1IL0A 1IG3A 2MSWA 3DTVA 4FN5A 4JQOA 3OZAA 2YZMA 4MW6A 2ILVA 5C8YB 2F55A 4EDHA 1SVSA 3NTLA 4YRRA 5PGMA 5JPDA 4BFTA 3U1BA 5IABA 1RQLA 1FW8A 2AG1A 2G28A 3L0ZA 2ADOA 5ICGA 3OJEA 2FPGA 3DMGA 5CLJA 4I81A 4KQ2A 2W2KA 3BGVA 2Q7OE 3BXGA 4L50A 3PQ6A 3RRMA 2VJYA 2V6FA 4EENA 2WA2A 4KDFA 5ESWA 1OU0A 3A6HA 5LYJA 5JNRA 2ZATA 4IXWA 1M8JA 1RBZA 1PZFA 3ELYA 5AJTA 2JAQA 4Z1MD 2HDWA 4ETWA 4CETA 1CZRA 4JYAB 5FO1A 3ZV6A 3PUZA 4FEYA 3H7IA 5DYIA 1T8RA 5CJPA 4C4OA 2Y9PB 4V39A 4HS4A 1E0JA 3ND5A 3OESA 2WF7A 1YZNA 4DLUA 3RYFB 3GZ4A 4AJKA 3HVJA 4PYNA 2ZIVB 1EUDA 1YQTA 1RTKA 2I3AA 2Z4SA 5H80A 3HB4X 3CUSA 1S3SA 3QV1A 4GPIB 1IXKA 1Z68A 4ZT7A 3GROA 1R4MA 4DKJA 5FTMA 1LPAB 2JLCA 1O6ZA 3CO0S 2QQ5A 5GONB 4XD7D 2OLEA 1B3BA 2ZQZA 1P81A 5J47A 2XXBA 2J3KA 3U16A 1ZCZA 3ONFA 2XT9A 2XXJA 3ZV4A 1IHYA 1XNGA 1DLIA 1TAHA 3G9XA 3MFQA 5AIAA 2I1LA 5AOAA 4CKCB 2X58A 4JS0A 5TX7A 1SU8A 1GJRA 4PICA 3SMVA 3B6EA 3GAFA 2DJ5A 3X3HA 4UTPA 3LKDA 1RM3A 1PE0A 4W1QA 3KAJA 4R1OA 3D4IA 5JANA 2W48A 3T15A 3TEFA 1XHFA 3UWKA 3O9VA 1XKQA 2WU4A 3I6ZA 5CVUA 3R5JA 1REQA 2GNOA 4RF2A 1ZZGA 3VVMA 1M0WA 4EOGA 4HVLA 2NUTA 3L7AA 1ZMXA 4URXR 4C07A 4M1EA 2FY8A 5F2KA 3IQIX 1VGQA 1ZIXA 3HU1A 4OJQA 1KARA 1Z5OA 4NBKA 4OTZA 4E12A 2QSYA 3HO1A 1B6SA 4FFBB 4PC3A 4BB6A 2H92A 4B4VA 1HETA 2ATIA 3ET4A 4GR9A 1ZUWA 4YJ2B 1SOVA 3K09A 2P6RA 1LUAA 2ZSIA 3EH1A 3DL0A 4MW5A 4PO1A 4TRMA 1KETA 1R00A 1FMTA 1TGVA 2HWUA 1OXMA 5H59A 1YJAA 1XWWA 2ZE8A 2ZRCA 2JLQA 4WN3A 1EUZA 4DNPA 2VDUE 3DVSX 3JZIA 4BNHA 4BLTA 3VFDA 1Y8RA 4I6GA 5E1BA 3OQJA 1YR7A 3LF1A 2FP4B 4PC6A 4JI8B 2HJVA 5GQSA 4N03A 3RAJA 5LNK6 2G5GX 1QV9A 5JYCA 3ZBTA 2YMQA 3N74A 1I7SB 3O94A 2AHOA 2J6HA 4OYLA 5EHXA 1SK9A 2J9XB 3BD6A 1XQWA 2AQ8A 4FZVA 4JBNA 4II2A 1H65A 1TQDA 3UGJA 4DR1B 3X1WA 3OEYA 3FGOA 4F06A 5IFLA 1KU0A 3KFXA 4EPVA 1GEGA 3MCTA 1MO2A 4TTIA 1NLUA 3LXRA 4MVYA 5DM1A 4BNJA 2AJ8A 2DT8A 3IALA 2YV5A 4JVOA 2HV9A 1XKXA 3AH8A 5E7JA 4DBLC 2NWQA 3RC2A 3PCTA 1IJFA 1H9AA 2HQ1A 3CM0A 4O4HF 2HTEA 1IZ0A 4DNOA 2NPIA 1F8XA 3UK7A 4WCFC 1AKNA 3GT4A 2A9RA 2IU4A 2P0AA 3AVTA 3AC0A 4YR9A 4HGOA 3WQSB 1U9JA 4AO6A 2YZ2A 2UXCB 4MRMA 5K4GA 4NEHB 1ONBA 3IRUA 2C7PA 1FJGB 3MJ4A 3LYUA 2D4HA 2Z9CA 3MTAA 3A7DA 4D3ZA 1AU9A 3QVUA 5A5DA 4XGNA 1XZHA 1Q0TA 4BGIA 2PXAA 2YOGA 2GAFA 2HSJA 3D59A 1I2ZA 4HYYA 4ZVMA 2FZ5A 4C9BA 1JMKC 4DLWA 3D7LA 5A02A 5CA1A 3PWTA 4OFXA 4HDSB 3JYHA 1XXLA 1OXXK 4IGFA 2VK1A 3I6YA 1TJNA 2C9YA 2P3OA 2ZITA 2O8FA 4AM8A 4BEJA 5BUQA 1CKEA 3NX4A 3S1LA 1GARA 2Q9BA 1N9KA 2IYUA 2W4IA 3C1UA 4YPVA 4IDCA 1YTUA 4FIZA 4X1IB 2YCLA 4LF9B 1G5RA 1SUPA 3THXA 3RVQA 2X6QA 4NBWA 4ZAYA 3L1JA 1O6FA 4JLUA 4CKBB 4X91A 5HW0A 3VR5A 2EF0A 3E5RA 4E5NA 5M34A 3TRKA 3QLTA 1V8OA 2X2EA 1CUJA 3U3KA 5H3HA 1GU1A 2WT8A 3M0EA 2H5LA 1MXFA 3CX8A 3UZUA 3VH3A 4ND4A 3JAWA 1NU6A 4IVNA 4OBBA 4G36A 3EXAA 2NO9A 3W4IA 1FPQA 1Y7HA 3BFPA 2NVUA 1B8UA 3V9PA 4CXMA 4BNLA 5DZSA 3R44A 4K6MA 5DP2A 3SDBA 1UJCA 1Q0RA 4DUYB 4M36A 1LTQA 2P9QA 3DLHA 3CISA 1UADA 2D0PB 2QYOA 4RL4A 2Y1DA 2QU8A 3L4KA 3VNUA 3VJRA 3ZQUA 4GPBA 1JA9A 1TECE 1YS4A 4PYKA 3UMYA 3OX4A 1FQOA 2BJVA 1KZGB 3H5NA 1Q20A 1V3QE 1DTEA 2IE0A 1A1SA 1OC2A 2NADA 3CT4A 2F3TA 3OOSA 5LUBA 4AC9A 2PT6A 5A6VA 2BEVB 2VP6A 3DF9A 3I2KA 3TB4A 3HDYA 4RFSB 1H05A 4XDGA 2W7TA 3IQWA 4JBWA 5DLYA 3B2NA 2JI8A 1JT2A 2AE1A 3VKWA 3WY9A 3GQBA 1NX9A 1Q0LA 3A4NA 3GFPA 3L0YA 3EIEA 4HQRA 1VSVA 4JLVA 3VNAA 5EWJA 4W1PA 2RAVA 5IT9A 2GD2A 1QFXA 2BFDA 5E7QA 3BS4A 1JSRA 2DFKB 3VX3A 1NM5A 5DTMA 3Q0IA 3HDQA 4EY4A 1YR9A 4GUDA 3AUYA 1QX3A 3N2KB 1IUOA 3W3AA 3TB6A 4PG6A 3EBPA 1YE8A 3HCBA 2ZRAA 1W96A 2VYFA 5ILQA 4HRYA 3CB2A 3ABSB 3MHTA 4I5FA 4MUGA 4B3MB 5BSEA 3JQ6A 4PV7A 2O5VA 3A6FA 4P5EA 1PR5A 4ZCLA 3FPKA 3W2IA 2VP4A 3I2FA 1TM2A 3WLLA 3FR8A 1ZRNA 1TM5E 4B7XA 1LVGA 4DMRA 4LJ5A 2GJ4A 2B92A 2FWBA 3FROA 3EZ2A 5D3MA 4ZOCA 4KWCA 3TCXB 2AK3A 3HLYA 3K32A 5G0VA 1UT5A 4GQBA 4AX4A 1BYIA 3QZUA 2HIHA 5I7EA 3D4PA 4I4TA 3RV3A 3AR2A 1JVBA 3TSCA 1QQBA 1JXMA 1WHSA 2F9MA 5KSZA 3PGXA 4IAOA 2YHIB 1YDHA 4JUDX 3V2HA 2GPWA 3OQMA 5B3JC 1GPMA 1D8TA 1GPH1 4X3OA 2EKQA 3SKVA 1PFQA 2OECA 1DNPA 4F38A 5A2QA 1A1VA 1CEYA 1LWNA 2NO6A 4WBNA 4FU0A 3AUJB 4ZOLF 4AZ0A 4YYZA 1UXKA 4CM6A 4N8SA 1KYYA 1WVGA 4CQMD 3FFWA 1NQWA 2KSQA 2PK3A 3D7NA 2O2HA 3EXEB 4LC9A 4MVJF 4FMPA 3BE4A 4LJAA 3AEUA 5GADl 1N92A 1H6CA 2OV3A 1D8AA 2GCIA 2QNBA 1X1TA 3CN7A 3ZU4A 1RLMA 4BMXA 4DRYA 4YRAA 4QOJA 4B0PA 1GGNA 2G6TA 5JU6A 1Z56C 1JMYA 2VDWA 5KKAA 3V8VA 3VKHA 3LWBA 1NZFA 3IOCA 2P62A 3CEPB 3PXDA 3VYUB 2XHEA 3N8NA 1KXZA 4RORA 3U49A 4B6GA 3PUYA 1Y9AA 5AHXA 1L5FA 3ZNNA 1WZUA 4LHVA 2Q0XA 4JODA 5D86A 3JXEA 4ZXPA 3LSTA 3SI7A 3ZWWA 1WU7A 5IH7A 1DAOA 1ECBA 2ZPAA 3L2OB 4KI7A 4FN4A 3PC4A 2I9KA 3ZK7A 3G59A 1NVKA 1EWKA 4DR3B 1LD3A 2QLBA 2ONYA 3DPUA 2NUAB 2B1RA 4GQIA 4HZGA 3VKUA 3LDFA 1JVNA 4OAPA 3M4ZA 5F1KA 1OX4B 2CF6A 3TKAA 5CDFE 1JEYA 1QG0A 2YMLA 3EODA 3PYXA 4RD2A 2WTXA 4RWEA 1DRVA 3UK6A 2G0NA 3VNSA 5SY4A 1KVQA 4PYQA 5JAHA 1H2HA 1PD0A 4D9IA 2JATA 3T4UA 5B58T 2V1UA 3KFVA 1VXRA 5K0NA 5F9HA 4AJEA 4QPJC 1GG2A 5KDOA 3OECA 3A6EA 1Y6QA 1JHVA 2H48A 1L4LA 4O3FA 2CKDA 5C8DA 3FB4A 3S1AB 8AT1A 1NXOA 1C1DB 3H5TA 4HFRA 1H8HD 3PFKA 3A1FA 1TEHA 3G88A 2NYRA 5COBA 4F9GA 5G1NA 3U44A 5F1YA 4RVDA 1Z7WA 2I6GA 1N3LA 1I4EB 1XQYA 3VOBA 2R6FA 1RVV1 1RIIA 3QXXA 2L69A 2V7VA 2QD3A 3FAZA 2E5FA 4R5MA 3LQFA 1JQAA 4KACA 3V1UA 4FGUA 2BFBA 5JS8A 3WB2A 1C4WA 5TLSA 1AZSC 3CLTC 3A28A 2IY7A 1GKKA 2PKXA 4I50A 4MYRA 4NE7A 3NM5A 4M22A 2Q4BA 3OHPA 2Y1XA 3DXZA 1WPRA 4QYMA 3KPVA 4O8ZA 1VPWA 1DEKA 3DTYA 4JBYA 2V59A 4LPKA 1CF2O 5C4IA 4J7CA 3W4KA 1XL1A 3OPQA 1PJTA 1YZTA 1LF5A 3KWFA 3EAQA 4H3HB 3AWDA 1L6IA 2ZI7A 3JCZA 4AU1A 5KNBA 2ZZNA 4NC9A 3W2FA 2X4DA 2GN9A 1P73A 4G4JA 4ID3A 5B30A 3L8FA 2YJ3A 4EG6A 4RGYA 3U7JA 1GKYA 4IDQA 1H3NA 2BI7A 3EVAA 1KSFX 3EMVA 1KRHA 4KYUA 4JLBA 1XU7A 4M0CA 1EI9A 4ES6A 3EUFA 2HBRA 2R2AA 4QC2A 4UBLA 4EX7A 5IJ9B 3HEAA 2ZULA 1OSNA 2YXPX 5J23A 1G98A 3A6ZA 3NMUF 4WUVA 3TOXA 1H5UA 4FS3A 3QELA 3LL4A 1NVAA 1TPZA 3RO7A 3DBRB 1T34A 2FG5A 3I2HA 3VHXA 5LXTA 1JIUA 4X60A 1FK8A 5CLGA 3BHMA 4ZEWA 1X7GA 4ZZ3A 2C5EA 3CZAA 5HKLA 3DM5A 3H3JA 4MJ3A 1EWVA 1FYVA 1RWMA 4J43A 2JANA 3E8SA 4EELA 2GZAA 5ECWA 3UC9A 3E3AA 4OY3A 1T15A 4OHMA 4TM8A 5TT0A 5BWOA 5M5BA 4Z9AA 1I2AA 2P68A 1FU7A 5GV8A 2FQXA 4AZSA 4DLZA 1QDLB 3K70C 3U40A 4G07A 1ZJJA 4DV3B 1JJ7A 3CVXA 1OREA 5AOCA 2O0LA 4N3NA 1PZMA 4RZXA 3TD2A 1JWAB 2PU5A 2Z43A 1OMOA 2PUWA 4E5UA 4EJ0A 2CJXA 4QLBA 1TM7E 3M70A 1TCUA 3HN6A 1L7OA 2W6PA 1TEXA 3AI2A 3IEIA 5H7XA 2OHIA 2JFYA 1KC3A 2IW1A 1AQNA 3PR1A 2Y1GA 1OKKA 1W5TA 2QLLA 4NVRA 4D98A 4B5KA 1ZGBA 2FDXA 2YS7A 4Q48A 4TUYB 3ZHZA 4R68A 4M98A 4BLVA 1D6SA 1Y3AA 4ATNA 3MIIA 4LF8B 4YDRA 4F3CA 1ZGZA 1VM6A 3PL5A 1XQ1A 4ERNA 1OI7A 1PG5A 1H22A 2EFDB 2DGDA 2WYIA 3IQDB 2JIZA 4ME6A 3BRWA 5A03A 3DBIA 3EQ7A 4PYJA 4A15A 5F9FA 3FTEA 1I1OA 1U2DA 3G0OA 5CGQB 1VTKA 2X2PA 2C5LA 3SYRA 4CCSA 2GAIA 1DWOA 1QS0B 4MGYR 3Q8XB 4AP6A 1V11A 2AZ4A 2ZU0C 2Q1UA 2XNSA 2XYRA 3KSZO 4L0DA 5DK6A 3V4FA 1GQ2A 2VNJA 5CT5A 3W2TA 1R8XA 5C80A 1O95D 2POCA 1JG4A 4KIUA 3L8CA 5LB4A 4M0PA 1EXWA 2KM1A 1CUFA 2Y0DA 5JASA 4CR7A 4H2DA 2SBTA 4M86A 1H1LA 4EI2A 3HWRA 4DNQA 1ZA1A 5JATA 1JEAA 3IPCA 4XWWA 2BM8A 1BNCA 4EY6A 4N9QA 1ISIA 2VSYA 5B1SA 3A0RB 3RREA 3Q7EA 6GPBA 1VMIA 1YWGO 3WXBA 4BLWA 4PG7A 1GA6A 2GM4A 5ITZA 5ED0A 1XR3A 5KYTA 3F9RA 1L4KA 2AW3A 1QKKA 4B6QA 1TYAE 7MDHA 5FWNA 4ZYUA 3JTEA 4EYQA 2YASA 2YIJA 4UREA 4J91A 1O03A 1DC4A 4DCCA 3PHJA 1GGEA 5I5EA 2RC6A 3DL2A 3N0RA 3EZNA 3NHFA 4CTOA 1Z6ZA 4DTCA 4DCMA 3OF2A 4HBZA 3AFMA 3CG4A 3I1JA 3R8CA 3RSSA 1UBHS 2DTDA 1LRKA 3L06A 3GNTA 3O5AA 3OX3A 4X5OA 4NBRA 4NPAA 4PZEA 1G6Q1 1WX1A 2OFOA 2E87A 4X1KB 5LFAA 3VO9A 3PEWA 2Q5LA 3INYA 1D0IA 5EJMA 4PSCA 3QXSA 1YKSA 3L7DA 2TRSB 4G5YA 4HLUC 2EKLA 3LUKA 1H0KA 4M1QA 2O9JA 2ZWAA 4EB8A 3DNFA 2BCEA 4D44A 5IJXA 1C1XB 3F6YA 1K4MA 3TIIA 1LI5A 4LXUA 3QQPA 2F8TA 4O2AF 1XMOB 2P78A 5CHEA 5BQOA 1QHXA 1ONSA 1VE5A 4C6TA 5A5VA 3AKYA 4JD5A 1UF9A 1XRRA 1ECCA 2ZBVA 2Z5GA 1VP9A 2CNKA 3H6GA 1E2JA 2GETA 1I4OA 4I66A 3FCCA 5JCZA 1L5LA 4RENA 5EKXA 1T91A 5CT6A 1EK2A 1ETHA 4WNAA 2B5WA 1WW2A 1G2QA 5EQTA 4D9JA 2XE6A 1NR7A 5HPYB 4LTNA 3CRRA 2RCNA 2Q4OA 4I4CA 4O4IA 4Q7EA 5HQTA 1UK8A 4HP8A 3SR4A 3ZYZA 4GR5A 2RKWA 2WAOA 5HFAA 4QJ4A 1DLJA 2ZJAA 3OAAA 2PN1A 2B83A 4BX9A 1WEKA 1D1PA 3WKEA 3ITEA 3ESXA 3WA7A 2ONJA 4AJLA 4YAGA 1JFFB 1I36A 1TZBA 3DDOA 4H9GA 2UUPA 3WHKA 1IRIA 1WMBA 4D74A 1OFUA 3FNIA 1H8EA 1PG2A 1R5NA 4MR7A 5BNTA 1LW7A 2Q2VA 3JRWA 2BUCA 3AERA 4BIIA 3EFOB 1QRDA 2JGIA 2VSOA 2FG6C 5F7JA 1AN0A 2YJTD 3RASA 3P2EA 3Q9LA 4P2BA 4QPZA 4B9EA 2A5GA 3T7IA 4ENSA 3OUUA 4WKCA 4PLCA 1T3LA 4C0JA 1IOZA 3O73A 1DC7A 4J6FA 2OAP1 3EISA 1MOZA 1GSOA 3LNTA 4OP1A 4D3SA 5HXAA 1Z6PA 1N33B 1VC2A 4QNMA 2OC4A 3HKBA 4NJMB 4YCDA 3O7WA 1U4NA 3QA9A 2VP0A 3L05A 5U1PA 2A3RA 3F4KA 5JSZA 2VSXA 4FHCA 2OSBA 2EARA 1CQJB 4M60A 1Y8AA 2QSZA 3MINB 4G25A 4YT5A 1D6JA 1ZK4A 1HPLA 2ID9A 4I0WB 5DBEX 1KDYA 3DKKA 2AFHA 2GA8A 2X9LA 4HGRA 1YONA 4LSGA 4B32A 2BF7A 1T6BY 4QBIA 3GJTA 1SQFA 1OU4A 4ZT3A 2MTBA 2XWBF 4A7PA 1KO5A 1E3WA 1W5AA 5FBRB 3TW6A 1VJGA 4DLRA 4N3GA 5FQOA 2CXSA 4A10A 2MYNA 2P0EA 4L7VA 4EGJA 3AKDA 1KE2A 2GBCA 3HU3A 1N0WA 3DZDA 1EG7A 3KJZA 4MQ6A 4X54A 5REQB 2ZXUA 2CNNA 4D4HA 3O4VA 2BGNA 3DF7A 4BFZA 1YMVA 5T67A 3A6GA 2HXGA 3VUFA 4KDRA 2FJ0A 4DCUA 2C0QA 2Q9AA 5JNWA 2M6SA 1M5UA 4TXHA 5CX1B 2NQ2C 3I42A 3ULKA 4L51A 4QE3A 5IAOA 1UDXA 3FNQA 1QZXA 3D6TB 1ZCFA 2V9ZA 3K0BA 3KJHA 3Q7TA 4IHJA 1U04A 4PPYA 3RRZA 4RKRA 3WLSA 3ZWAA 4S04A 4XYLA 3BGDA 3I9KA 4NBSA 2XMSA 4QDKA 4QHTA 4URHA 4WOPA 3JQEA 5KINB 4MS3B 4J49A 2GOYA 1RXWA 4MUXA 3H42B 4M0EA 4RQAA 3GJQA 2XVAA 3I8SA 3LHDA 1KFBB 1RJFA 4QUEA 4HDAA 1KRWA 3GVCA 4V1CI 4GVPA 4ZFNA 5DSZA 3N5CA 1T2EA 4NZOA 3WA6A 2YWRA 2RD2A 4LX0A 1PJQA 1ZM9A 5FPKA 3BRWD 4QASA 1GPYA 1VJ5A 4ZC1A 4GRAA 2XQJA 2PGDA 4OJYA 4XFJA 4F4CA 1R6DA 2HF2A 1OR8A 2BEKA 2MIIA 2WU8A 3CC8A 4M7PA 4FYJA 4LKRA 2GESA 2QTNA 1OXTA 1T5LA 4A2CA 5JNUA 4KOAA 1XHEA 2JBWA 1A9RA 4NQZA 2HU7A 3VRHA 1G21E 3GDGA 4R71A 3B1XA 4DR2B 1RQPA 1RD4A 1RT9A 3JR3A 2ZB7A 3RUDA 2GO1A 3RT1A 4PSAA 4CGYA 3H9CA 4HLCA 3AKZA 2HXSA 5KHAA 1T25A 1C3OB 2O4UX 2GEKA 2BLNA 4BNMA 1YQXA 1X7ZA 2JLRA 4EA6A 1SU7A 4MS1B 4BFSA 1ZUNA 2EYUA 3FYCA 4GM0A 1QF6A 2WNSA 4INJA 1ZUIA 2CUKA 1NNLA 3ANLA 4IDGA 1KQOA 4OMFG 3D8UA 3A1TA 2Q1TA 3ICOA 3HDVA 3ZVNA 2XDYA 2DHEA 3EIQA 1XMPA 621PA 1EVIA 2RHHA 3FUTA 3L6UA 3OFND 4GRIA 4GICA 4LGCA 2ODNA 4LWPA 2WU3A 1O8BA 3HUFA 4OB8A 5ADWA 2ZEJA 1QZUA 4IMPA 1LGYA 2JAXA 4MKHA 4EB3A 1S89A 2ECOA 2ODQA 1ZITA 3FMPB 4YGXB 3ZWPA 4C01A 1C3EA 3KLOA 4IIUA 4I1VA 3BN3A 4HFNA 1DXYA 1QIMA 4JB3A 4L8WB 1WQ4A 2Z8ZA 4QARA 1F17A 3FJYA 3M33A 3RU3A 1G66A 1TEZA 4X3PA 1JA1A 3HHEA 2V9PA 3KB2A 3R23A 4IKPA 2C9BA 3EGDB 5K3SA 3ZE9A 5IDQA 1LQTA 1JF8A 4A0FA 2I2CA 4KNVA 2CV2A 2ABWA 5ICEA 2O57A 1N2IA 4NOJA 3MTBA 1V5FA 4P3XA 4M38A 4TX1A 3VR1A 5BWNA 1JEOA 1YS1X 3K0KA 3LZCA 3V34A 5BN4A 3OQPA 4RVGA 4NFLA 3ENQA 5H1YA 4QYIA 1T9GS 2JLBA 5AW2A 1T3ZA 1QO0A 2H07A 1M83A 1MAAA 2XY4A 2RMKA 4L7QA 4LRTB 3AR6A 2X0DA 3MT9A 2X2FA 3L01A 3NRCA 5EHNA 1J56A 5T41A 4CM5A 1RYDA 1FP7A 1UMDB 3PE6A 1M75A 4TXLA 2QTBA 1G8KA 4DA0A 5EEGA 2ODEA 2ET6A 2ZS9A 3R76A 2NU6B 3T5AA 2FQWA 2WIFA 3ON5A 1T1IA 1ZN8A 1E79D 3GT7A 1GTJ1 4MI6A 3FOWA 4CMGA 1BC5A 3EX7C 2WU1A 3DEIA 5D5QA 3UMGA 2BF4A 2P6NA 3FUUA 1FRVA 1EZ1A 5HJ2A 5LDGA 4OK3A 5T64A 4BAGA 1NG9A 1EDZA 1NNI1 1UP4A 1IDOA 2ZBFA 2AOUB 5EWMA 1ZNQO 1R12A 3QE3A 3CE6A 5DHTA 3DDZX 5JAMA 3RSOA 4YBZA 3O2QB 1BYUA 1WUYA 1EFLA 3F3YA 2PV0A 1NLZA 3DR5A 4UATA 1I3CA 1UM8A 1ZM2A 4IUYA 2JNWA 4NFSA 4UTOA 4Q00A 1BXGA 4YMSA 4ZVRA 4GOXA 3R3YA 1XE3A 1YR8A 4N7MA 3GZNB 6ADHA 2I6XA 3UHJA 3SFVA 3PRJA 1CERA 4LCJA 4BIMA 3OM8A 1BCRB 5EJIA 3WL7A 5IBRA 4AULA 3TMAA 3HVRA 1CY0A 3HABA 2ZRMA 4PXSA 3ND9A 4FDTA 3L8EA 1QH0A 2RHBA 4JUIA 4KO2S 4POOA 1YKGA 2EG5A 1MC5A 2FLWA 3C8HA 4CJXA 2BSXA 3PWKA 4FOLA 1LA2A 1LFDB 1F9EA 4JJEA 3X44A 3ADDA 3D4NA 5EZYB 4JLAA 1MC4A 1TVKB 4C5BA 1B0PA 3ZCTA 1PWXA 4HLQB 4D0LB 5LWHA 1Z3IX 2QN7A 2WD7B 3FPEA 3INNA 3KELA 4PG8A 4P54A 1XTBA 2FUCA 2V4ZA 1DAHA 1W0JD 2JGDA 1FP4A 2H65A 3CRVA 3EVNA 1E2GA 1O5IA 4OJTA 3TAHA 1KR5A 1L4MA 5F35A 1MTOA 4BFCA 4HXGA 4DIBA 1NMSA 4WGFA 3FNHA 3NM6B 1AN9A 4LDQA 3ZY2A 2BONA 3H1EA 5AW8A 3WGHA 5JAPA 1E96A 3J7AC 1OWPA 3F46A 4LZLA 1F4VA 4TYPA 3O2NA 2FN3A 4LV6A 2PVPA 3ZW8A 5KTTA 1RXVA 2FNAA 1M0EA 1PYDA 1S7GA 4F6RB 1JU4A 4WLOA 1ZN9A 1K6EA 3E81A 3F3MA 1EVEA 4DMUB 1C7JA 3ZVKA 4DREA 3DGFC 1I2DA 1ECFA 2C42A 4JITA 3DH0A 1BCSB 3BMCA 4NZ9A 3V8PA 2P2GA 2D5BA 3ZC3A 1N6LA 4YUVA 4RE5A 4TMKA 1M2VB 3FZEA 3QVKA 4H7PA 3W9SA 4MQ4A 5CFRA 3SSNA 3IR6A 2NN3C 1X1AA 3B60A 4H15A 3OPXA 4UD6A 2UZAA 3UW3A 3VXKA 3V33A 3UV6A 2ECQA 2JL1A 1QK3A 2XCOA 2IYEA 1ZVKA 1SN7A 4I3GA 4LBYA 2V7XA 4UTXA 3JVVA 4MPRA 4H7IA 4RKEA 2CFCA 5TNXA 3UENA 3ZDCA 4FC7A 1JX6A 4ZMSA 3RAPR 1XUOA 1YJXA 3KXPA 3AX6A 4L4RA 1KDPA 3VR0A 5L45A 1F7VA 4FUTA 1PFKA 1X15A 3MBIA 4L2IA 4TS1A 1QGYA 3DT9A 2RAPA 2VPPA 1HBJA 1V3UA 3B9BA 2CYBA 1R9JA 2J7KA 1M2FA 1R64A 2O2ZA 2WI8A 2X8LA 4OM7A 1K8YB 2GTPA 2X2OA 2PUFA 3IR7A 4XQCA 3LP8A 1UDCA 2C8JA 4LFCB 2K7ZA 4P4SA 4V03A 2AN1A 3IHTA 2XVYA 4TRJA 4B4UA 4NXMB 3JTMA 4J0CA 4EH1A 1XVAA 3N6XA 3O8OB 3HADA 1RHQA 3NGMA 3PQDA 2BCJQ 1YV9A 2R6ZA 3QBVA 3GFFA 1W8IA 1KDTA 5ESDA 3RABA 4PN3A 4R5HA 1U2ZA 2DKOA 4WE3A 1XG5A 1ZI8A 4H6WA 4HH3C 5EIEA 1P1RA 2E3JA 1G5QA 4MVJA 3EQZA 3SEQA 4Q3EA 2WVHA 3K8OE 3SHWA 3M2TA 3UH1A 1DC6A 1SEVA 2JHGA 2V6BA 2Y05A 2DBYA 4CKXA 2RHDA 3KYIB 3MWFA 9LDTA 2AMYA 2QRUA 4G1EB 2I7XA 5H3CA 4DIMA 1MX9A 1V9CA 4KLCA 2CXUA 2FE4A 2JHPA 4X95A 5H5JA 3KALA 1UPFA 4TV9B 4F0JA 5HKBA 4GHWA 4RSGA 2VWPA 3GAAA 5MGBA 5IJ0A 3AHIA 3EEYA 3R3SA 4JBGA 3T0IA 1C50A 2GHQA 1TU3A 2J85A 1CR1A 1NUSA 4H3KB 4DWWA 3MQ4A 4R7TA 5ABPA 3DXYA 3CKMA 4WXPA 1L6RA 1NKVA 4RMJA 1M0SA 2VDPB 4MQEA 1N3BA 4EI8A 1T8PA 1V3VA 1UMCB 4LOJA 4UEKA 2H06A 3LAWA 2XKJE 1WPQA 5DMHA 1GQQA 4MV5A 4TYWA 1Z45A 3KHSA 1PGPA 4DDUA 3E22A 3IGFA 3PXAA 1IIRA 4FMCB 3UMSA 3HXQA 4O1MA 1QV7A 2IBTA 3H4IA 5KAPA 4YRGA 1VL2A 5C3MA 1AX9A 2QX7A 2E4WA 3ZZ0A 2FJPA 5DNAA 4YN3A 3NWEA 3TX2A 1M1YE 1U8FO 4LZOA 4NDAA 4L9WA 3H75A 4TMFA 5EKSA 2FW1A 4C7MA 4C1BA 4PLGA 4NV1A 3RM3A 4R81A 1UQTA 1YR3A 2LW7A 3PS9A 2GM9A 1NVDA 1Y80A 3ASUA 1OCEA 3H6KA 5E9WA 2K4MA 4K3VA 4GKJB 3IE0A 3NBQA 4NSNA 4B3HA 3HXOA 3EW7A 3B78A 3RC8A 3Q3GE 1YB6A 3LT5A 2B4RO 1K7XB 1XLTC 1I6KA 1HZJA 3K4QA 1SCQA 4PGHA 4EAQA 4TN1A 2P6PA 2AJLI 4RNCA 4Y67A 2FSGA 2HCRA 2JFNA 3QF4B 1Y7TA 5DSTA 5MN4A 1KYIA 2GZMA 4AZVA 2XOKD 2Z2YA 2CBGA 3L6EA 3F1KA 3DL4A 2ZWMA 3S1SA 2W6ZA 3I2YX 3EGOA 3M1IA 4YASA 4F60A 4R83A 5EMMA 4O4LA 3I4FA 1X1EA 1RQRA 3WO0A 2MSNA 3G8YA 1ONPA 5G4KB 1FDIA 2J3MA 2WF6A 2XUFA 4AKSA 1MIOA 5JMPA 4C4XA 1DAKA 1T5OA 2FSVA 2NZVG 2TMDA 3DFIA 3EQ8A 4NYMQ 1G9TA 1E2EA 4TT3D 5CJJA 3MAGA 1D5WA 4WCDA 1JHQA 4ZOAA 1RWBA 3VAAA 1VJRA 1M2JA 2QW1A 3QLUA 3IR5A 2R7KA 3GF4A 1MAWA 3C97A 2QTGA 1HC7A 1S8OA 1XZKA 1PR6A 1KTIA 1GO2A 2VSFA 3LW7A 4UMFA 3ROZA 2DWUA 3QU7A 4JL8A 5IXYA 4GD3Q 4WZZA 3DKRA 1U4SA 5EHIA 3KUKA 4KJZA 4D9MA 3LO5A 1AZWA 4EWLA 4XI9A 1C30A 1IY0A 1OYVA 3GMDA 4U39A 2AD5A 3CYFA 2FFHA 5IEJA 3WLPA 3QPAA 2VAWA 1CUUA 2VHTA 1OA1A 5CYPA 4TROA 4UBJA 4MEAA 3EZ9A 1DOHA 5KI6A 2GILA 5AJWA 2B3DA 4MOWA 4XQ9A 4Y9SA 4D99A 3AR4A 3PE3A 5FWXA 3JQDA 3ZU3A 3E8MA 4OI0A 2QQFA 4B87A 1YMUA 4F56A 5EVCA 1C1HA 4P22A 2PLWA 5LD2C 1BE1A 5A5FA 5IASA 3EXG2 3LC7O 3ZTWA 3GCDA 1TF2A 4KRGA 2ZUUA 2QVYX 3EQ6A 5EMJA 3WYNA 4Q34A 2BV3A 3THRA 5JNLA 3T3HA 2PO5A 1ID8A 2PZLA 1CR4A 2D5IA 3MWJA 4RA9A 2VAXA 2ZYIA 2F17A 3SC4A 3L0SA 2Q7DA 3KHTA 4IH4A 4AX8A 5JHGB 2H4JA 3DMNA 1SXJB 2AS0A 2ZJ4A 2D5LA 5EG5A 1DAMA 1CVLA 4MROA 2HLDA 4RPLA 5BN3A 1JE0A 1W2WB 2BUBA 2ZYUX 2DBQA 6LDHA 1Q1BA 3OIDA 4DW8A 1JPNA 1AJEA 4AWXA 3CLUC 4BBZA 2I4NA 2ISSD 4R16A 1ZGGA 2OGTA 4FK8A 3T95A 1NPYA 4D9KA 3NHWA 3V7UA 5BYAA 4Q3KA 5KYVA 3R7LA 1K88A 1T35A 2CD9A 5DLEA 4OIFA 2FMHA 2X76A 4ZYZA 3I9OA 3FVRA 4Y2VA 4EO7A 1BA2A 1V1JA 5AESA 3HXMA 1FYFA 3CNOA 3IURA 3CUUA 3L0BA 1CNEA 1E9DA 2J0VA 1B1CA 1QHFA 1LDGA 2R7LA 1DKRA 2HRBA 4ZVNA 5GZ6A 3C6QA 4BAZA 2QUKA 1FRZA 2PMWB 4BKUA 4EGCB 1BWQA 3HVKA 1ARZA 2CN1A 1AS0A 2QRVA 1W4CA 4GNRA 3VAZA 4DQDA 1NYTA 2VA8A 1NZJA 4KTTE 4X24A 5MDHA 1RI2A 5IAEA 1IMOA 3FWNA 4H1WA 3H1PA 3QHQA 1QYIA 2D3TA 3K8QA 2YHBA 3IQXA 3DFKA 2QTVA 1VG1A 1PG0A 1JIIA 1ILWA 1URPA 5H8WA 3OM0A 3VHLB 1P0MA 2GTIA 1IG0A 2WUWE 1VDMA 2VHXA 3PC3A 5DVZA 2JFUA 3P4UA 4CM4A 5DNYB 1C41A 1YB7A 2WM2A 3T7SA 5JR3A 1G291 2LBPA 2YDYA 3A9CA 3GU3A 4QLAA 1K5GA 2NTJA 2R7AA 1QXSA 4RY2A 1WTAA 3NNNA 2GNPA 3IX7A 2PUVA 3T9AA 3ILVA 4F3YA 2XCSB 2QL5A 1WNFA 1D5CA 1MJGM 1P8AA 1YD7A 4XB2A 3TLEA 1U63A 1J07A 2B4TO 1LVUA 1P0CA 2Q07A 1NNSA 3K6KA 4FOOA 3W5HA 3ETLA 1QH1B 3H2IA 3C39A 4RETA 2HW8A 3KAQA 3ODPA 3L6DA 1WULS 4QEDA 3MD0A 4FFPA 4HQFA 3E9RA 3TTTA 1QWSA 3FHLA 4IQ4A 1R5BA 2C94A 2PRJA 5CP8A 5A4KA 5HZKA 3ZK9A 4AO7A 3G23A 1FXSA 3F4LA 4ZEVA 5DNCA 5I5GA 4V0OA 4QPDA 3E0XA 2FLVA 4D7AA 1DBWA 4BVLA 3A1NA 1L4HA 4XZ3A 1WXQA 1S1CA 2A0XA 2GBLA 2RGWA 3T3PB 3ZLVA 4B75A 1PK8A 3S40A 4W5WA 3O3NB 3GDOA 3N05A 3I39X 2QV0A 4NRDA 3LZDA 4TL7A 4R1MA 4JDPA 2IH2A 4FFWA 1E7MA 2CEAA 1GTZA 2VF7A 1MQ8B 4GLOA 4DNXA 5LIPA 4IIYA 4UKDA 2Q62A 4F21A 1II8A 1LJ8A 1JNYA 4S12A 4DKXA 4YQFA 1DEHA 4RV5A 2AVNA 3LUCA 3UWMA 721PA 4WXMA 4A1FA 1DMRA 4C78A 4N7RA 5KNDA 4IXNA 3IEKA 2NO4A 3PFNA 5K8LA 5EKTA 1RQ2A 4V3BA 3RDPA 4DMHA 1CZNA 4OL0A 5E2BA 3TQQA 5BSHA 4EG3A 5HK9A 3V1YA 5LMNB 3QEOA 1UWLA 1K7SN 1K9SA 4X61A 1S3FA 2QG4A 3S2IA 1BO6A 1T9ZA 1O5OA 4EHAA 2OCIA 2KYRA 3NWPA 3V1TC 2JAUA 2GH1A 1NASA 5DDIP 2TECE 3B8HA 3HJUA 1UL1X 4Q24A 2PX5A 2FA9A 3UA4A 1NOJA 4CF3A 4C7KA 1CZKA 3R0ZA 5ITWA 1NIJA 1QCCA 3B1YA 1YVPA 1U6JA 3K0FA 5DISB 1T4CB 2X0FA 3RUEA 3BZWA 5A62A 1OXUA 2RHGB 2WJZB 1NBOA 2ZSKA 3GP8A 4FCWA 1N78A 2WABA 4FDUA 1NRJB 4CUKA 2EWWA 1YOBA 4IJ5A 1QRAA 2R1UA 3MCWA 3AEYA 3N70A 3SC2A 4ZCPA 5KSYA 4QUJA 4NS4A 2CHEA 1RYYA 2H1WA 1H69A 1PTJC 2J5XA 2OZEA 1FFSA 1FTNA 1M7GA 2G25A 3PHLA 1BQ4A 4IG4A 4OP3A 4JASB 4ZO7A 5KAMA 1MO3A 1K63A 2VTEA 3CCFA 4JI3B 1HWYA 1FB5A 1KPIA 2E48A 2VJCA 4Z3DA 4MVCA 3MOSA 3OOJA 2YXDA 2PX0A 1JDNA 2XJ4A 1DT5A 1NN1A 3JYOA 4DEYA 5FV4A 3N2ZB 3QOYA 2VYVA 3GJ5A 4QSMA 4DC1A 1ORTA 2ETVA 3O83A 4N49A 3GHHA 2XCUA 3G9UA 2XPCA 3WWDA 3MWKA 3G2NA 5EXSA 2VTKA 2HSGA 3QP9A 4YP7A 2QPOA 5EZ6B 4BMSA 1P1CA 2P5TB 3UKJA 4Q7QA 3O95A 4J0IA 4N8EA 3M5DA 2XXAB 2DBRA 3ICWA 4FI3C 1ZFNA 3QEKA 1DTWB 1PK9A 5LOVA 3ZHOA 1DINA 3N39C 2KQUA 4S1NA 4F5DA 5JQGF 2QVLA 3N2YA 1P19A 3KKPA 3X2SA 4XQEA 4G3XA 4ZRMA 1EIZA 4BKRA 1IZYA 4HUQB 1KBZA 5EIAA 4BFLA 2JLAA 3AT1A 4R1TA 4UXJA 4I2VA 2J3LA 2XDQA 3AM1A 3IHWA 3U17A 3KSBC 1V1RA 2NNLD 2HJGA 3RJ5A 4WJZA 5AWFC 3MTJA 2QX4A 5H9VA 4FMCF 3DKPA 1N34B 2O5EA 1KFKB 3VDRA 4I3FA 3ZDBA 2CFIA 1OPXA 4EHJA 3PUIA 3FTNA 2NAPA 2PMDA 2YIMA 4O4LF 4BMZA 3QVXA 1P4GA 4EF5A 4IHAA 4BP3A 4OQ4A 5K01A 1RU3A 1X7DA 4E2YA 4W63A 3Q15C 3MJDA 1RTTA 1X1CA 2QRGA 3SF8B 4TQAA 4TZ6A 3WK4A 3K5IA 5F5XA 2HQBA 3G7NA 2GLXA 1MHTA 1N2EA 2VJDA 3KVNA 1QZTA 4K6KA 3PXXA 1Y6JA 3H3FA 5L4SA 2A59A 2X4LA 2Q5IA 3T52A 5HF9A 1RYBA 2CXTA 2Z58A 4JMLA 1D2RA 3JV7A 5NLLA 4P34A 3LT4A 5LZ5A 1SIUA 2X1LA 3ZX4A 1QHGA 2DEUA 3GLIA 4Y6QA 3U4AA 4FXOA 3ZJTA 3PXUA 4KQ9A 2JRCA 2JFFA 5IWAB 1XPJA 1N1DA 1RFLA 2IXAA 4LDAA 1TQ4A 2A88A 4Z51A 3IPLA 4H1UA 4I8IA 4F5ZA 1IQRA 5I9NA 4ZVTA 4XJVA 1CY1A 2DP4E 3FSGD 1L5HA 2X19A 4WGGA 3V2IA 5JARA 4PCAA 1V6CA 2H59A 3QUTA 4Y2PA 2O2SA 1GN8A 5EFOA 4UMDA 3M9WA 1YA6A 3DZ8A 1SHKA 5J2UB 3C8MA 3MF4A 5B1IA 2WWWA 3MS4A 1Y3CE 2GBGA 1JQLB 2WJ4A 4BB9A 3A6PC 3COVA 2VJMA 4L6AA 1DL5A 1GOTA 2OCXA 4ZOBA 2F3SA 2BTQA 1G2PA 1FTYA 1QR2A 1UBUS 1MZPA 3IB3A 3KTFA 1EUDB 1WW3A 4KREA 1ZK0A 2F8SA 2W6ID 1QGAA 2A4MA 3R5TA 1K9VF 2UU9B 1R5JA 1VB3A 2DPXA 5DBOA 4DABA 1KQ3A 4D42A 3VTAA 3TCKA 3VR4A 4X00A 2O2GA 1BW9A 4N6NA 1XEAA 3ZCRA 4QICA 2O8EB 2C0CA 2ZDQA 2HA5A 5BSKA 4ZK6A 3ZH2A 1DMSA 3FWKA 3RROA 1FY2A 3AZQA 1LEHA 2G7MC 2QZ9A 1RRVA 3OIYA 3T0GA 3RLFA 2UZ0A 3DONA 2E1RA 1PTKA 1O87A 2QB5A 4UCXA 1RM5A 3ZI0A 1XNJA 3EFBA 3ZI4A 1REQB 3IXLA 4HJRA 4JWTA 3R0XA 3TS1A 2C2KA 2O06A 1EMDA 1U8AA 2YXLA 3TZ6A 4CBVA 3MLBA 1C7IA 1SBTA 4Z3OA 4DQXA 4YGYA 2JCYA 2DQSA 3PJFA 4HADA 3VNRA 3TN7A 3E48A 2DCUA 3PWZA 2VTBA 1U31A 1QH8B 4G65A 4TT3A 4L07A 3K9CA 2P9EA 4GDMA 4EPXA 4MCAA 3FOFC 1OLXB 4FDVA 3ND7A 1NQAO 4G1UC 1OZAA 1OC4A 3AWIA 1R0BA 4FQ8A 4EJ2A 4RYDA 2JFOA 3D6HA 3KOMA 1S8NA 2YL2A 4B3RB 2Z1NA 3A2LA 2DSTA 1NDQA 1CP2A 3MTGA 4QTUB 4JLKA 5BVGB 2LKCA 4BPRA 1Y8RB 1RJWA 1V16B 2HMTA 2IYLD 2AFIA 1J8MF 1UT8A 2RI6A 2XX3A 2ZR9A 3CV3A 4RU1A 1HLPA 1I24A 5DLQC 6ABPA 3COYA 3N2IA 3PJGA 1CJSA 4FILA 1GYPA 4TXJA 1EUCA 3AP1A 1Z7EA 5IAGA 4A4DA 1AV6A 4ZIRB 2H1SA 1LC0A 4Q93A 5IK2A 5LN1A 4C20A 4YAWA 1QB7A 3FOEC 1LDMA 2DHQA 2VPTA 2X0EA 2DPLA 2F43A 2QRJA 1E1RA 1X7YA 2FFJA 2Z04A 2ZANA 1G7TA 2X0NA 4DV2B 2BKAA 1RI4A 2AOTB 2JK1A 4RTNA 2CLOB 1RZUA 2PZAA 2PGOA 2ZBRA 4HWSA 4MS4A 2J08A 4QRHA 1Y98A 4TXMA 1ILEA 1T3SA 2VF8A 3I6IA 5BV1A 4G9BA 3B6ZA 4TT8A 3PUJA 5KC8A 1U2DC 3GFOA 1IMJA 1SC1A 2I6TA 2I76A 4XVHA 3UCEA 2BEUB 4H0FA 4TSFA 2JGMA 4ED9A 4F1JA 2IS6A 2G9VA 3BG5A 3GJ8A 5FTKA 4E7OA 3W5IA 1KZYC 4V0KA 1NMZA 2FZLA 2XA1A 3H19A 3MM4A 4PHHA 4WRRA 2UVQA 1I7PA 3L46A 1EG2A 2FPUA 3V48A 4CCAA 5ALQA 1SOMA 2Q2OA 3ZHTA 2RHTA 3ISTA 3T3MB 4P53A 3PNSA 2YYAA 4TS9A 3CH6A 5K05A 4NZNA 1EVZA 2FF7A 3N6RA 4WACA 1ONOA 4S1TA 3P2KA 2GM5A 3E2MA 2PA0A 1BEZA 3V4VB 3GFTA 1QX4A 1PI3A 4L9AA 4MGIR 1KO4A 1UFOA 2C04A 2WJHA 3F6SA 2ZU6A 1NUQA 2PZFA 2EX4A 1IK6A 3JZFA 2YWBA 2DFLA 2GNAA 4FCVA 2VKQA 3SKXA 1Z4LA 2C84A 2H08A 4MUMA 4DY6A 5EJ6A 1XMJA 5L6MB 1QOQB 1RJ9A 3E70C 2C58A 3STTA 3V6LA 3L7KA 4X63A 1G6OA 3R77A 4ZJPA 4RTSA 1L1FA 3WKBA 3A4MA 4UNPA 1SBNE 3FDFA 4R7ZA 3J81A 1WZNA 3TG2A 4O4JA 3D3KA 3CLTD 3S81A 1N0VC 2RBEA 4MRPA 3KBOA 2VHWA 2PSHA 2Q3FA 2I6QA 2X7XA 1VZ2A 2BT4A 3ML1A 4JKOA 1H23A 1NHWA 3DD1A 5DOVA 5K0BA 4YHHB 5IYZF 5F73A 1P2TA 1VIMA 2ATCA 2WJPA 5CLHA 1ZM3A 3G0HA 2HYIC 1WXXA 4YCJA 5K8VA 1Z7GA 3ZQ4A 1Y9DA 1XL0A 2ZZMA 4B79A 4PCUA 3K2QA 3BT7A 5JUWA 3SEZA 1T5HX 4IV8A 1O4WA 1M9NA 2RH9B 2X9QA 2Z5VA 2W2MA 2A0FA 2CUTA 1AKRA 2FRDC 2QA5A 1OFVA 1QSGA 2I67A 2Z30A 3DVAB 3I12A 5SZIA 3HKEB 2QTHA 2ZB2A 4WNIA 1L5KA 4YMLA 3GLGE 3Q1LA 4O4HB 1LI7A 1B2LA 2VBCA 3U4DA 1MPTA 2AC2A 1T2AA 3AL3A 4MPDA 5TSDA 2IC5A 4L0CA 4RAOA 4AQDA 4J94A 1SVLA 1UC4B 3ZHSA 1JDJA 3AUFA 2NVWA 1Z4PX 3RUAA 2IYQA 3KJIA 5BQPA 1SWVA 2O2XA 4BQIA 1NR1A 3C4QA 4R1QA 3ZS8A 5K8CA 3N28A 5FPPA 4KC0A 4Y1RA 4WXRA 1ISPA 1R10A 5AK3A 2TSYB 3DMPA 3O92A 4RD6A 1QV6A 2WB4A 2N9UA 2QL6A 1YO6A 3MWYW 2WY2D 1NF3A 1P1IA 3VKVA 4PE5B 4Q3DA 4RZ3A 1ORIA 4OK5A 1HDGO 2R1VA 4I9NA 5G2OA 1Z0JA 1JHZA 4HATA 4HWGA 1PZGA 2QMQA 3KRTA 2BI8A 2ZQYA 1D4OA 4WH0A 3EZGA 2AK2A 4K7JA 4FX2A 1A76A 3ZEAA 2QN3A 4U9IS 1BXRA 4PFSA 5D51S 3WYGA 4CU2A 4G4IA 2PA3A 1TJYA 4DA6A 2NU8A 1NXWA 4RVCA 1QF9A 2B8TA 1IBMB 5CVCA 3I2JA 3KXLA 4RK7A 1XXHA 1PEKE 2B82A 2VH2A 4YAOA 3LCJA 2E37A 2DLDA 1LX6A 3GUHA 3LUBA 4G86A 3B8EA 4X1OA 4LSZA 4ALIA 4PNZA 4V3CA 2WTUA 1JU3A 3ZE0B 3RS4A 2ATEA 2ZJOA 2ODAA 4KQIA 5TVKA 1XJ5A 6REQA 5TF0A 1EEHA 3SR3A 4XJXA 5ADHA 1GTVA 1H93A 4UHDA 1WHSB 3RH0A 5BO5A 1KZ9A 3KLPX 5KNDH 3WLIA 5JZMA 4EM6A 3KT3A 4N0QA 1XP5A 2V03A 3ELBA 1WXFA 3UMFA 5TIIA 3GLIE 2OR3A 4ETNA 3NYWA 5DASA 4IIVA 2O3JA 1W1UA 3HA3A 1Y37A 1QC5B 2HSDA 4IWYA 5FUXA 3TR6A 5CDSA 1GIAA 4UBOA 1A50B 5L3RA 1QGZA 4DV5B 2DWPA 4GS5A 3WP0A 1JR3E 4O29A 3TLCA 4ZDJA 5ALFA 2DECA 1W35A 3N0VA 3UV3A 2A9OA 3CF2A 3FKQA 3FM9A 1WAMA 3EW9A 2GN8A 4PFKA 2DQZA 2ERYA 3ROPA 4QXRA 5EWLB 1MJ5A 3DO5A 1X9IA 3OMWA 4UNNA 4FYKA 4M8NE 1OWNA 3RC9A 8ADHA 2HFJA 3OPVA 4NU5A 4YRCA 2WJAA 2F67A 4ZVOA 3GLGB 1HSZA 2BR5A 3TLXA 4JJ4A 2CZCA 2O3UA 2VDWB 3OZCA 1B0ZA 3UHOA 1JU9A 5CVDA 2Q41A 1JR3A 5I3CA 2H85A 5AKKA 1CIVA 1G60A 4XARA 1MO6A 3DAHA 4YT2A 2IOHA 4RD1A 3T5GA 3OTIA 1U81A 1VBKA 4FBLA 4BMVA 6CHYA 4ZQGA 4CMAA 4N5MA 5JVDB 3T9FA 3PXBA 4RH3A 3KSDO 3LUPA 5E9JA 4MQBA 3SMQA 4C0QC 2R1TB 3H4MA 3K6SA 4PCVA 1PW7A 4U2KA 3HKDA 1QIDA 4ZI7A 2NUAA 4KIWA 1JDBB 1NP7A 2ZAIA 3RVLA 3F7MA 4B43A 1CE8A 5KOHB 1DVRA 3BWCA 1VYHA 3AONB 5IVIA 3NXSA 1JEYB 4FR5A 1PZNA 3WJ7A 1PNOA 3OPYI 2XUAA 3QTTA 4XVUA 2QENA 3DLCA 3AHJA 3LJKA 3O9MA 5CK5A 4YS6A 3V32A 1QMPA 2OO7A 2PTGA 3EIFA 3G0BA 3KXKA 1QGUA 2QLNA 1OVGA 2VCYA 1V7ZA 2CJWA 4GGPA 1QIHA 5JSUA 1G18A 1Q0SA 2ENWA 4OB7A 4WOCA 1A8SA 5JRDS 4J0JA 2HOQA 3E05A 1KXJA 2VRCD 2Q3MA 3KKLA 4YACA 4ZAZA 5IULC 1UJ6A 5JAZA 4IYRA 3BH0A 1K6JA 4TXNA 4F1KA 2OILA 3GGDA 2V4UA 4Z6KA 2ZI3A 4MP3A 1ORWA 4EHBA 3U44B 2GYVA 1U0RA 3P9QA 5L4NA 3VYVA 4I1YA 3AVVA 2YV4A 5DM0A 1IQPA 1FXWF 2H18A 5KYXB 3A3PA 4PC2A 4BQQA 3QWIA 3EN0A 4GZ6A 3LCCA 3D1VA 2UUAB 4GP9A 4XDZA 3R4CA 3BH7A 3CLSC 2OAEA 1ZLYA 3M6LA 5ES4B 1QTRA 1TF7A 1OAOC 4XFDA 2B6NA 3OT1B 1FMCA 1XTZA 1QG6A 3EZYA 4R9UC 1H2YA 5I8PA 4FZJA 1J2EA 1NQ5A 1ZW6A 2CL5A 3DWGA 4URUR 4ND3A 3UAGA 3VPXA 3N53A 4PAWA 2G40A 5JLAA 1R9GA 4MYCA 4Y2JA 4GKVA 1QTNA 3UHAA 1PWYE 5LMZA 3QRWA 3WMGA 2O07A 4GOOD 2PUBA 1SJ9A 2R48A 3R20A 1HDRA 1YRAA 1E2LA 3L3BA 3TFWA 4RHFA 2MYUA 4JP1A 1V2HE 1K7YA 1KP2A 1J9EA 4MLPA 4ZPJA 5IMBA 4QBTA 3GDHA 3K9WA 4XM2A 1NWCA 1HFEL 2NU7A 1O5TA 2ON6A 2Z09A 3AJRA 4RQUA 1AGRA 5BV0A 1G38A 2I54A 1R74A 1YBMA 1YQ9A 2VQ6A 1A8PA 4MUAA 1LCIA 3HJHA 1YJQA 3CVVA 2YC4C 3LLSA 3QK7A 1O9HA 4XOUA 3K73O 1IY2A 4H7HA 4QQNA 1ECLA 3V4OA 3ZE6A 2EERA 1VOTA 4PQYA 3S4YA 5A7HA 4MVWA 4D9CA 3RU9A 3VC2A 1JR4A 1Z17A 1O9BA 4FXPA 1NP3A 1GCAA 1W5FA 3GA7A 4UBKA 4WNYA 1NSTA 1PR2A 2Z1MA 4ALKA 3EVCA 1OIWA 4MW1A 4RY9A 1PBNA 2VBIA 4G0UA 2NT4A 2FPKA 1YR1A 1JPUA 1X2BA 1R6BX 2RHMA 3A3OA 5EJAA 2M6KA 1V6AA 4KP7A 3K0CA 4S24A 1RKVA 3NTVA 3WS7A 4F1WA 2BAGA 4UHFA 3A70A 4BVBA 4R9NA 2HV8A 3QXHA 1MLDA 4C0BA 3GWGA 4GXTA 3OQ6A 2RH4A 3LUHA 4J1NA 2R68A 5CGZA 4WERA 5IC6A 4KRFA 2RJ3A 3OZSA 3KQLA 2BGMA 4TM7A 3VYWA 5CB8A 3OWHA 2R8RA 4RK6A 3NT2A 4Z0PA 4EFMA 2V54A 5AKEA 3FVWA 4R3WA 2FZCA 4ZTUB 5EP4A 3C98A 1I1HA 1E6LA 4FYHA 2XB9A 2C3UA 3E0QA 4NXNB 1RFGE 4PX3A 3LZ6A 4BQFA 4A0RA 1AQLA 4H1HA 3RC3A 1ZR2A 3DEZA 3K0AA 4U7JA 2AMVA 5HRCA 1QGOA 1SD1A 2NSDA 3P52A 3T3EA 3OKPA 3MRVA 2QM0A 4YQEA 2G6BA 5D2CA 3QITA 3ZD9A 3X1YA 2Q4RA 2WPDD 5IEBA 3L8GA 3DWEX 4B74A 1ELOA 4QGAA 5BW4A 2XZPA 4UU1A 4QXQA 2G71A 3F6CA 2PJDA 1F1JA 2QRZA 1RYEA 3TSZA 2OYCA 5KUTA 5CM2Z 4GM1A 5CA0B 1IAVA 2B34A 4UZFA 3EBOA 4L8YA 3IBCA 1NE2A 1E9SA 4GL4A 2Q27A 1UBFA 4ZAFA 5BOVA 3WNBA 1N4AA 1CS0A 3TFOA 2GFHA 3SN6A 3BZBA 1U9ZA 1M34B 4HRXA 3KB8A 3PEUA 1PQUA 4OHOA 4PG4A 1U8TA 5HF8A 2X8WA 2H9IA 1DIRA 3VO2A 2BJWA 3ABZA 5ITZB 2QTAA 3F7TA 3IMFA 4JX9A 1E9RA 1AKUA 2ZXEA 4KQ1A 5K20A 1UDRA 1M1YA 3X0DA 5F7OA 2IBSA 2I71A 4HTFA 5CM9C 1U11A 2R9VA 1GGJA 4UVHA 3QJGA 3ZNPA 5GVSA 5JFGA 3W7AA 1MTZA 2DY0A 3KT0A 2J6BA 1SCDA 3D3JA 3PDJA 2W90A 3R5SA 4G9GA 4RXUA 1XMXA 3MS2A 3RTDA 3L1VA 3OJOA 3DG9A 3LWZA 3ITNA 3THWA 5CPBA 4HMOA 2D1QA 5HCUA 3K9LA 1FMLA 2BHLA 2B6HA 4XUGB 1SCIA 2BFOA 1Z22A 3SSAA 3B1FA 1NW9B 4FMDB 4EEXA 5JI3E 3CPJB 1E6WA 1WJGA 3DDWA 4DIDA 5AKIA 2BZSA 5SYNA 3AM4A 2FHPA 2NMVA 1SA0A 4ESHA 4ZAXA 3FMVA 4RSMA 1YIAA 2O48X 5AD1A 5B2ZA 1ADGA 1CQIA 1OLUA 1P80A 2ZYVX 3I2IA 5TQ0B 3TLBA 1RS0A 1WLSA 5D3ZA 4EO9A 1C1XA 1UC8A 3CNNA 2CHUA 4OPMA 3T5MA 2AOVA 2HQOA 5CURA 3RAGA 4RIIA 4JSYA 4KVFA 1QYVA 1RC1A 1ZGHA 4FMDF 4OIMA 5HTKA 1EFAA 4MWGA 5IBQA 5AVOA 4YP5A 1XEXA 4JU9A 5KNCH 3IVXA 1E5DA 3OCYA 2PL5A 1BJKA 1U02A 1YDWA 2IZ0A 3HXLA 4I4IA 3TRHA 3WIVA 3L84A 5DO9A 4BN0A 4ZYVA 1IEWA 4I1RA 1Z12A 4TLDA 3KWJA 5LWQA 3REQA 1K7EB 4JH0A 5FPSA 3WZ2A 3WB9A 5F9MA 1L5VA 1YJBA 3DZJA 3EIUA 3HFRA 4OSEA 4H27A 4RNDB 3HL4A 3K9QO 4QODA 1X8JA 2H29A 4NESA 4G23A 2PH3A 5TVGA 4L5JA 4RIEA 3ZHUA 3HUUA 1FVXA 3UB4A 3C24A 1KFCB 5HWSA 3NKFA 1FNMA 2IQIA 3EA4A 1KZ7B 3MTIA 5GM2A 5KQRA 1GPBA 3ZD6A 4MR7B 1EDDA 2CCKA 2CF5A 5LDHA 3EFOA 1QU2A 1E9FA 4YXWA 2G5CA 4YXWD 3WISA 3NBAA 1EFHA 4KBGA 3HRKA 1NBWB 1KI3A 2CNBA 3FSJX 4E22A 4JOBA 3ICEA 2EF1A 5ALTA 2H7VA 1QE5A 1GQFA 1QAQA 2WYWA 2YUIA 1VLMA 3RFFA 2QN8A 1QFSA 3E2IA 4XYEA 3ER9A 3HWSA 2XTJA 3FZNA 1EINA 5GM1A 4B3DA 1IWBB 4NOLA 3MHPA 3I04M 4CV1A 1W4RA 4LHEA 1GCGA 2XJ9A 3AXSA 3CW2A 2GPYA 3F5FA 4D6YA 4IDPA 3HEMA 2GXQA 1XCMA 3JD0A 4TV8B 2ZRJA 2FZKA 3HA5A 3N59A 1JQDA 1FLVA 4GOND 2OENG 1E99A 1W2GA 2NYUA 4JL6A 4F84A 4N3CA 4UHKA 1BMFA 2C29D 1KJIA 3G2QA 1L5MA 4J0FA 2V97A 1PD1A 4I55A 4KN8A 3W90A 4YRIA 3M5PA 5IT5A 1NYQA 2HO5A 3CUTA 4L16A 1HEIA 1TJ5A 3KEMA 4JNCA 1UDBA 5REQA 2QUHA 3RYHA 3HJBA 3FW1A 3COZA 3HSYA 3C1TA 4YK7A 1XRPA 5BWCA 3IIMA 1EX6A 1NSFA 4UUBA 5TEVA 5B6JA 5ALHA 2QYSA 3TEMA 2HPAA 3HVIA 3PIIA 2C99A 4MUHA 1B41A 1DPFA 4US2R 4YRNA 2V5AA 4F71A 4P0TA 5FKJA 2B9EA 3BX1A 3FWPA 4URZR 4ZYTA 2IZZA 1V26A 4XRGA 1PKEA 2BKVA 1LK7A 2DFNA 2P3SA 2V4MA 4JJZA 2QAGA 1CFJA 1KK3A 3PPXA 3MT0A 5I47A 5B1DA 1G5IA 1FU4A 3O4FA 4R9RA 2V6JA 3SBEA 3DXFA 3QYPA 1NDHA 3H5AA 3OLWA 2A1TS 5H0IA 1VHLA 2BKUA 4MITA 3WDKA 1X1BA 1JP7A 2IYFA 2P2ZA 3WTCA 4PZYA 3RSHA 3QVLA 2CVHA 1EP9A 3E9DA 3NQ41 4FHZA 5EPOA 5HRUA 3OO1A 3PT5A 1NW7A 2ZW9A 3TLGB 1SHTX 2IHNA 1FUYB 1NXVA 1U5AA 3CCCA 4LA4A 2DR2A 4JBIA 3TPCA 4XX1A 1H5QA 2IUUA 3ZDQA 1DCFA 3EULA 4CG2A 1RLJA 4DSAA 1OD6A 2OL4A 4PC7A 3HJFA 1U9IC 3WADA 2QM3A 1GT6A 2G36A 3IEMA 1S6YA 2P11A 1T8SA 3RF6A 3K1AB 1UJ4A 4K86A 3KG2A 4KBFA 1QVWA 1TQHA 3FF4A 3KJGA 4CWAA 2JVJA 1ZX1A 3B2QA 3V7WA 1NVVR 2VNAA 4ZT6A 3IAAA 4MEBA 4AIRA 4JUFA 1X8KA 4TL8A 1O96A 4ZREA 5H9WA 4CLOA 1C3XA 5TJHA 4KO1S 2D1TA 2CVZA 2IK8A 1KPGA 3L8YA 1XRJA 1G8JA 2G0TA 2NNWB 3LT2A 1XYGA 1W2HA 3JY6A 3TTYA 3OCZA 2VJKA 2PGIA 2AA3A 1VE6A 2XA2A 3D7RA 4LSWA 1YZFA 4OGKA 4ZZ2A 3RSCA 2LPMA 1J2TA 4W5JA 2VNHA 4BJ3A 1J8VA 5BN5A 5LZ9A 4TKVA 3OE7A 1JTEA 1SMKA 3QBEA 3U4QA 5B2EA 4Z7JA 1OT5A 1H4TA 3UAOA 2PIDA 1MVNA 4EGQA 1P1KA 2JW5A 4BVKA 3EDCA 1LNZA 4F9FA 3NHSA 1P2BA 4YRBA 4V0SA 3IMCA 1C3VA 1KH3A 3OM9A 4OGLA 5FI3A 4DE5A 2YV3A 4Q7LA 4BEWA 2AMJA 3I1YA 4O5OA 4M2LA 3BC1A 5DI9A 1UM9A 1E6UA 1K6IA 3FYSA 2HLPA 3EOZA 4I4TF 1Z4MA 1E5QA 2MSKA 4IMIB 3RFUA 1TFRA 3QU4A 4QQ8A 3KKZA 4LZZA 4BMPB 2BGUA 4BNVA 5CCEA 4IQ0A 2F1JA 3TEJA 4MV8A 1LPBB 2ICAA 2G07A 4Z4FA 2BEWA 1E9EA 3U0VA 4PSUA 2JGLA 4TYNA 4JT4A 4I5GA 2VHEA 3BHNA 4JKIA 5C34B 4DIUA 4ZO6A 1VL8A 4H7JA 5DTRA 2WK1A 4Y2HA 5CFLA 2PZ8A 2ZKIA 3I30X 4JT8A 5BN4B 3EMKA 5TMDA 4N82A 3P4YA 3GVIA 5I4CA 4WOBA 4DWVA 3I9V6 4AY4A 1J00A 3DXXA 3RTEA 3Q85A 2RE8A 1Y63A 3VOTA 5KREA 3AHDA 4CHTA 5DEIA 1UMDA 4JJAA 2QN1A 3OX2A 2XRFA 3QFHA 4PHGA 1X7WA 4XVRA 1XRQA 3RC7A 4U7HA 3LX5A 5B53A 3WL4A 4YP9A 3QKSA 4A1OA 2Z5LA 2IYNA 4CQJA 3V3TA 1HYEA 5JS7A 1PJ8A 4FQ7A 4I50F 4HQLA 5EQDA 1XQ9A 8OHMA 1V8ZA 4REQA 2WKWA 4KO3S 1NW4A 1MO4A 3DEJA 2ZJ2A 2A9FA 1N9GB 3TR5A 3PC7A 4OAQA 4Q6BA 5JBIA 3KEGA 2SHKA 2VI5A 1QRSA 3H8VA 1DQSA 4CKWB 1SXHA 3H9UA 3JQ8A 2B0JA 2QQEA 4Q3AA 1RLOA 1TA9A 1K6XA 1RYFA 3DOIA 4FOPA 4GC5A 2BFMA 3EXIA 5FP0A 3BMNA 2OLKA 2XUQA 5EMNA 3U13A 2XYVA 2JLSA 4FYPA 4ZODA 5YASA 3P9IA 5WRFA 4DZRA 4KIJA 2JZOA 3LHKA 4V2UA 3X1DA 1F3LA 1Z4OA 2P9FA 2PPVA 2QD2A 4WCFB 1MNQA 3ZE1B 3O8CA 3DE2X 2V8BA 2GM3A 3HBLA 4PAQA 3U7RA 3ZVLA 2IGTA 2GCGA 5EL0A 4YRJA 4LS3A 2LCQA 4IRMA 3SXPA 1VKRA 5IZ4A 1JDVA 2WAMA 1MT3A 2OOSA 4MRSA 4CKEA 1O0BA 4IXTA 3AEQA 3A1EA 1FUUA 2YWXA 1JXOA 4EG1A 5K03A 5LP6B 5EJ4A 1DCMA 5JAQA 4NIMA 3ZGXA 2JFZA 1W46A 1HE5A 1PFUA 3HNPA 2EQAA 1ESEA 3AQ4A 3GEPA 3LUDA 4Z7OB 3DC2A 3KKMA 5JXHA 4AMYA 5CIYA 1BMFD 1O95C 1V35A 2WZCA 1G21B 3ABOB 1YB2A 2BLLA 3G17A 3QVGB 1N6OA 2ZBUA 2Y92A 2RB4A 3JX9A 3KYCA 4REMA 1C8BA 1N1GA 1SBIA 4AMGA 4ZT4A 3RIYA 4F12A 2WSLA 4XUEA 1NV8A 2VF2A 1DRUA 1XALA 2KS6A 3JVUA 4MRVA 4I5EA 4QDXA 4UEQA 5JEEA 3Q5EA 5JYEA 1KEEA 4F6RA 3FKJA 3JAMA 2DM6A 2NXNA 4FEAA 3K9GA 4GRDA 2X8JB 2IYTA 2EZTA 1Z5VA 1X13A 3ANMA 3AI3A 3GN2A 1NA5A 1AF4A 4Q47A 5GJWC 1VI6A 5KX5B 5TR9A 5IVKA 4BXOA 1ESDA 4LDRA 3C3EA 2J5RA 4XYBA