1LF0A

Crystal structure of rasa59g in the gtp-bound form
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTGGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein P21/H-RAS-1
publication title The Structural Basis for the Transition from Ras-GTP to Ras-GDP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 66
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1lf0A00
2VSFA 2YWEA 4MGIR 721PA 4TMTA 5GJBA 1G20E 1VTKA 2FJUA 4A2QA 1G5TA 5KHOC 2VHTA 3VX3A 2GVDC 2GCOA 1Z63A 5JBQA 3JVUA 3I5YA 4UXIA 3LBHA 4C0AC 4BECA 5HZKA 2WJVA 4EKDA 1KI4A 1OB5A 2FU5C 4O25A 3I73A 4PO1A 3FMIA 2VA8A 5FPYA 1U0LA 1G3MA 4P33A 1AN0A 1U2RA 1E79D 1YR7A 2N42A 2VEDA 4MRSA 2YKGA 2QP3A 4PO8A 4LJ5A 1AS2A 4FMCF 3SFZA 3EPHA 4G5QA 5CM9C 4EPXA 1S8FA 4HLCA 2VYFA 3EASA 5HKKA 1S3GA 3GJ7A 4W9MC 1Q20A 2RGNC 2REXB 4RY2A 5TVKA 3HDTA 4Q1BA 1W36C 2ZANA 3TE6A 2PX3A 1DAMA 1OKKD 3H0KA 4A15A 5BQ5A 1HEIA 4I4LA 4D4JA 2FA9A 4KO8A 1PV4A 3C41J 1W0JA 2OSBA 4C30A 3GLHB 1Q3HA 1UKZA 5LDDC 3FHOA 3TH5A 5FUXA 2Q21A 3KUDA 3QENA 3GLGB 1W4CA 1HY3A 1XEWY 5IDVA 4EFLA 1LF0A 3W3ZB 2X2FA 4CVNA 2QTFA 3PVSA 1E2GA 4ARZA 2P6UA 5KU1A 2RGBA 3SS8A 4M1WA 2F7SA 2GCOB 1B0UA 3LLMA 4N3NA 3VR6A 2DWOA 2BEKA 3CRVA 2HCJB 3B1ZA 1LS6A 2GZHA 1T5IA 2GBLC 4PR0A 3ZDQA 4I99A 1HT1E 4DDWA 4RFSA 2CCGA 4QXAA 4Q18A 4URYR 2QAGC 3I32A 3P4XA 1NLYA 4PHFA 5AJWA 2RHMA 1F3OA 1YZUA 3LVRE 4WZ6A 4I1VA 4WA7A 1ZRHA 3C14C 3TK1A 1F2TB 1VYUA 1FFHA 4NYJQ 4UJ3A 1I4LD 2N46A 4B32A 3GLIA 1X1RA 1G1MA 3BOSA 4G5OA 1XTQA 4JLVA 4TL6A 1P2TA 3SYLA 3AVUA 4A4DA 3GFOA 3SNHA 1OW3B 3OIWA 3ZS8A 2QI9C 4E07A 1KI9A 4Q7JB 4XVQA 2ANBA 3UK6A 1E9DA 3F8TA 3MWJA 3U4QB 4AYXA 2R8RA 4F93B 3DKPA 2WJYA 5SZIA 4XD7D 2OG2A 1Q0UA 2ZI9A 3CM0A 1EX6A 4ARZB 3HU1A 3WP1B 1M2OB 4CT4B 4ERNA 1LB1B 5FOUA 4EIWA 2IUUA 3PUWA 2J9RA 2AK3A 5AUPB 2BBSA 1GILA 4NPHA 2NO1A 1XTIA 5DI3A 4D82A 3LW8A 4A82A 4WAUA 4JVLA 1T9HA 3LW7A 4CDGA 1XZPA 2C03A 2FPMA 4RFSB 4P4SA 3U3RA 1NN1A 2G0NA 3I8XA 2CMKA 1KZ7B 4CW7A 1F60A 1TF2A 4TT3D 1I4TD 2FSFA 3FHTA 3K0CA 1VCMA 1Q12A 4BFWA 4WXRA 4JLMA 1OIVA 1G7RA 1CTQA 3GLIB 2YVUA 2BBTA 1W7AA 4QBIA 3LBNA 4C0JA 3QJYA 2IYRA 4BLSA 1O87A 1YVDA 4WXPA 1GITA 4LUCA 4M1KA 2ZRDA 5FTKA 3WP0A 4I1OA 3U7GA 2J0SA 3G0HA 2R9VA 4TMWA 4Y0AA 4DXAA 1PLKA 2VRWA 4G3XA 1SGWA 2E9SA 1RRGA 3I72A 3A1VA 2BBWA 2IX3A 3K9NA 3QPVA 4OI0A 3B9QA 2XOKA 3PEVA 2XZLA 1CJTC 3G5UA 1YKSA 3F5FA 4PC6A 2J46A 3B60A 2JJ8A 3EARA 5DI3B 3FOZA 3DEFA 1KYIA 1TTTA 5CJPA 4B75A 1XCPA 2YYZA 4QGGA 5FUWA 4NTZA 3U3OA 4HDQB 1G21E 4P4SB 4Q1CA 3TGPA 1I2DA 5K8IA 5F9HA 1XXHE 4MKIA 5DHFA 2IS6A 5C4GB 4HAVA 4QHTA 4FMCB 4EFNA 2UZIR 1KTVA 1MABA 3J81k 4MUBA 3VTKA 1LVGA 1XCMA 3PR1A 4G1UC 3PJRA 1R0ZA 4IOLA 2ATVA 2Y8EA 1N0UA 4KYUA 4X8OA 2CVHA 4IDPA 1CIPA 4W7SA 1PLJA 4Q03A 4C9BA 4BE7B 4E22A 3ASZA 1IQPA 2VF8A 4BPBA 4Q9JA 2ZR9A 2VP0A 2UZ3A 2HCBA 2OV2A 4XVRA 1KJWA 1XD2A 4RZ2A 3QXCA 2ZXUA 2C5LA 3TQCA 3TUIC 3GJ0A 4LPSA 2NPIA 1X86B 2XSZD 4BFXA 3A1TA 2Q0HA 1KI7A 5BN4A 2MSEB 5L3SA 3W5JA 4TWZA 2QRNA 1SKYB 4Q7MB 2VP4A 3JZMA 2IXGA 4UXHA 4I81A 4LBWA 4PQFA 5FR1A 4LHWA 2OFOA 2ZAOA 3T35A 2BM0A 4GNKA 3A4MA 4MKHA 1KIMA 3BC1A 1CS4C 3I92A 5GJWC 4TLEA 3IBYA 5CLLA 4C0QC 4NBSA 1MABB 1X6VA 1Z8FA 2GK7A 2F3RA 3OF5A 1D9XA 3OEHD 2Z43A 4IFBA 2PBRA 3FKSD 1KY2A 1ZUNB 4B3CA 4AC9A 2WV9A 2IS1A 5G3YA 1A2BA 1XBTA 2GXUA 3B5JA 2AFIE 1IN8A 1T3LA 1MT0A 1ZW6A 3F3YA 4Q02A 4TLCA 4D0NA 4KAXA 2WVJA 4OHXA 3QXSA 2XTZA 1TQDA 3RC3A 3T5DA 1XD2B 1DG1G 2ZE7A 1WBDA 1ZCAA 4LV5B 2ZU0C 1XEFA 4B33A 1BS1A 1M6NA 4HB2A 1CXZA 2C2HA 2ZITA 3JVVA 4AY2A 2WMOB 4A8JA 1NSFA 5L3SB 4GDFA 3W6PA 2IS2A 3TVDA 1E2MA 3U6BA 1FZQA 2IYYA 4IOMA 1Z08A 2PCJA 2I1VB 1ZU5A 2GCNA 3EC1A 1D2MA 4EDHA 1DBSA 2D7CA 2OO7A 4ZKEA 2QGNA 1GP2A 2OE2A 2XNDD 2QQ0A 2QP9X 4JIMA 2ANCA 3BS4A 1Y63A 4LBYA 4PPFA 2RB4A 2NOAA 3WBJA 2Q9CA 2ZE5A 3WYFA 4BLRA 1KHTA 2GBLA 4PAOA 3BXZA 5EP3A 1T6NA 1MO3A 2BEJA 1B23P 2FNAA 5H68A 1G5PA 3LV8A 3OAAD 3VQTA 2IYSA 4C2TA 1HT2E 2W2VA 4KSBA 2GETA 1NVVQ 1MR3F 1ZM2A 1P62B 2FSIA 2JLQA 3QPUA 3W3AA 1W36B 3DMDA 3L8YA 1YHNA 4TQAA 1E2DA 2X77A 2YV5A 5DGXA 2A2ZA 2FOLA 1EWQA 2IYLD 1CBUA 5EXTA 3AVVA 3DOEA 1JJVA 2W6JD 3DDCA 2ASEA 5CIQA 3LXXA 1W4RA 4D0LB 4F38A 3OIYA 5KNCA 2C77A 4FMBB 5G40A 2VLIA 4A8JB 4DSOA 4UNRA 2RKOA 1KNXA 1KSJA 1X8KA 3PUXA 2GNOA 5A5GA 4DLXA 1XTKA 4MRPA 2B92A 1DS6A 5D3QA 3CF2A 3FTQA 1E9FA 3CONA 3DKVA 4XOIA 4DC9A 2H92A 5C46F 1G3IA 4MDFA 4D2IA 4JBYA 1TMKA 2QN6A 2REBA 1S4QA 3GPLA 3KQHA 1FNNA 1S2MA 1Z0JA 4HLUA 3FKQA 3ZIAD 4BZQA 1JR6A 4LC1A 3K70C 3VKHA 1AK2A 2AHOA 4DB2A 1Y3AA 4DSNA 2REOA 2QT1A 3IILA 3IPYA 3VU9A 2QMHA 3RC8A 1BKDR 1QG4A 4IDQA 2ZSAA 2BMJA 2JLWA 1ZJ6A 2YOHA 4B35A 1NVUQ 2ZRGA 2GF9A 4QBHA 2ZR0A 3AKYA 1TUIA 2BKEA 2W6IA 4PHHA 2J0UA 4MKFA 4O2LA 5EE9A 2WSMA 3VHXA 2B6HA 2VP5A 1YZQA 4KU4A 3QG1A 1RZ3A 1E4VA 4KLZA 2FZ4A 5IK2D 1L7VC 3TW8B 2BKUA 5AUNB 2EWVA 4K8OA 2Z4RA 4JL6A 1JECA 1XX6A 2JEOA 2G9NA 4DJTA 4NCKA 5B64A 2R6FA 1VIAA 1S9HA 1Z0KA 1XPOA 2DY1A 5CIWA 1VIYA 2GESA 5JHHB 4QHSA 3ZZ0A 4B3BA 4HAUA 3D8BA 3Q8XB 4JYBA 2RHDA 4C0BA 3CNNA 2PT7A 4MGZR 4AURA 2ZJ5A 1K6MA 1L4YA 4RVCA 3CR7A 3NC0C 3QKSA 3KXIA 1TU3A 1Z28A 2VF7A 3GMTA 5LBIA 2ZRPA 1TEXA 2AWNA 2HT6A 2IWHA 1KO7A 1XJ0A 4A2PA 3DM5A 1DAHA 3W6OA 4G0NA 4Z8XA 1W2HA 2X19A 3ETLA 4EPYA 5FL7D 2J0UB 4Q7LA 3EZ2A 2YOGA 3A4LA 1ZAKA 4MYTA 3AF2A 3SR0A 2ZI5A 3ZD6A 2EYUA 3Q7PA 1FL9A 2R62A 1N6PA 5AJYA 2FPKA 4QRHA 4L5BA 1Q1EA 3K9LA 3RANA 4YMVA 1N6NA 1G8YA 3IKJA 4LDJA 1QF9A 4D4LA 3OEEA 1VCIA 4R2IA 3UXMA 3UWKA 4LV6A 2JJ1D 3BFKA 4H1VA 2QL6A 1UBCA 5BWMA 5FTJA 2ZVPX 5GJCA 4GMDA 5FH9A 2XX3A 1R8SA 5JFGA 2CDNA 1Q57A 2H17A 2B8WA 3W8RA 3LBIA 2CCJA 4O0MA 4OHWA 4FWTA 2PLFA 2GZAA 1VMAA 5KOYA 3U6KA 1XMJA 1II8A 3AVYA 3RVBA 2JASA 5E7IA 4ITRC 4PHTA 1GZSA 1GM5A 5AUOB 5KSPA 2PEYA 1J7KA 1M7GA 3HU2A 4YXWD 1BO6A 1E4YA 4CEJA 2EYQA 2KI5A 4KJZA 1KJYA 3PCRB 1W44A 2P65A 2W0SA 1XJQA 5DE3A 4NCHA 4XWOA 4IOJA 4DWJA 3AP2A 2ONJA 3T06B 2EFDB 4A0HA 4KITB 1NBMA 4TQUS 4RJLA 5JJIA 2HYIC 4ZKDA 3SOPA 1AIPA 1ODFA 4KYIB 2WJIA 3BFXA 2OCBA 5FUVA 2QROA 2QTVB 2FG5A 4JS0A 2BMEA 4TQ9A 2F43A 4LCBA 4Z8YA 4KLNA 1NN0A 3QY0A 3BWDD 2QP4A 3U3MA 2DPXA 3U7FB 3CWQA 2J7PA 5DIFA 1ZD9A 1KI3A 3MD0A 1S96A 1JPNA 1NVXQ 1VECA 4OJQA 3W8NA 1I2MA 1PUJA 521PA 1KK2A 2QEQA 3H1TA 4JLPA 2P2LA 1H8ED 2RAPA 4II7A 1WDTA 3KKOA 1EX7A 3Q72A 4DLRA 2IUTA 2R2AA 3UMSA 3ICEA 1II8B 1KDOA 2DHRA 3B78A 4FCWA 3U61B 3D3QA 3MSXA 3THWA 4B34A 5L3QA 1IN5A 4CEJB 1R5BA 1SKQA 1CR1A 1SXJA 1XMVA 2EW1A 2HXYA 1KDRA 2V6JA 2FMXA 3NC1C 2ZS7A 4CRWB 2I1QA 1E0KA 1R4AA 4MRVA 1OH5A 4Q47A 3SZRA 1ZYUA 1GNRA 1AQYA 1ZVQA 1CR4A 3EC2A 1E2KA 1AQUA 3M0EA 4UJ5A 3RWOA 4ESHA 5B2ZA 4ASUD 1E1RA 2F43B 1W46A 2FH5B 1TQ2A 4TYNA 1DAKA 1Q21A 1BMFD 1RJ9A 3C16C 2DYKA 1Q3TA 1Z07A 5CK4A 5FPSA 1LY1A 4DIDA 1J90A 121PA 3KB2A 3CNLA 2W2TA 3ND9A 4DRZA 3WBKA 3X1XA 5BXQC 5F3WB 1R2QA 1OFTA 3EWSA 4TN1A 1ZC3A 4DDVA 1HE8B 2GJ9A 5ANRB 1Q1BA 3DHWC 3OE7A 3CWZA 2QMEA 5FOSA 2FDCA 2QMUA 3OFND 3TBKA 3GJ8A 2CBZA 2D3WA 1R8QA 2RH5A 3E2IA 4YLGA 1RIFA 5CDFE 3THWB 2ZI4A 2HF9A 3CRMA 4XIGS 5L3QB 1DE0A 4QJ5A 1ZCBA 4HEJA 4ZO4A 1BH2A 3DM9B 2J41A 1SXJB 3NWJA 3VFDA 4ESVA 4TLDA 1F48A 1UM8A 1X3SA 3BB3A 2DFKB 3MLEA 3N2EA 1G41A 3LAWA 3LX8A 1KMHA 1OXTA 2Z0MA 3DZDA 3TLXA 3L0OA 1COWD 3FWYA 1LW7A 1Z6TA 1DVRA 2GJSA 4IDOA 4AKHA 2EFEB 1MOZA 4GZMA 4RD1A 4ZDKA 1JEEA 4TLBA 1ZM3A 3QUSA 3PG5A 4PXAA 4TSFD 2V8OA 1S1CA 5H70A 1OH7A 3B85A 1E0JA 4MYCA 4DLWA 4M9SA 4Q1EA 1LTQA 1TX4B 3P1JA 4Q4HA 3MWYW 1RJ9B 5LB2A 4O3MA 2IF2A 1P72A 5DSZA 2ZJ8A 3KKPA 4PPQA 3BRWD 2ZRJA 4Q01A 4M2LA 5FBQB 3L8ZA 3TSOA 2ZR7A 2WOOA 5KNDA 4TYPA 1RE0A 4R7ZA 1S0UA 3N5CA 4PZLA 2IEYA 4M9ZA 2BIFA 4TYQA 4BFYA 4JL5A 3GLHA 3I62A 2ZRCA 1GKYA 1OHHA 1Z6AA 3WMEA 1JNYA 3NG1A 4EFMA 4XWAA 2P67A 4KV9A 5DN6A 4JVNA 4LHVA 3TW4A 3THYA 2OBLA 1Z2CA 1K5GA 2PH1A 4LOAA 1NMZA 3EXAA 1XPUA 1XP8A 2GTPA 1DADA 3PUVA 4BWYA 2CLSA 3GEHA 3MWKA 4DEXA 3TUJC 4AYWA 2DFTA 3TMKA 1ZIPA 2FF7A 1WBBA 1RVDA 1KMHB 3CR8A 5H1YA 4WZBE 4B3FX 5GJVC 2QRZA 3QNUA 2NO7A 2VHJA 4Q4JA 2KE5A 2PCLA 5FOWA 1BYUA 4LY6A 4HUTA 1YZGA 1ETUA 2ZE8A 2O0JA 4TMVA 1U90A 1W0JD 2OILA 3DOFA 4EUNA 5JEDA 4PQYA 2BCJQ 3KQNA 2IW3A 2JA1A 1DEKA 1IJEA 1EFRA 3B1XA 4Q4HB 1WB9A 1IBRA 4LV8B 2C04A 2K5UA 2ZRLA 4EJSA 1T8UA 2YWFA 4QJ3A 1F2TA 4DDUA 5B30A 5EP1A 1KI6A 1ZD1A 3B1WA 1HA3A 2P6RA 4TZ0A 3VHLB 4JLKA 5DLQC 3LX5A 1V43A 4V03A 4IEEA 5HCNA 1UEIA 2AXPA 2BC9A 4C7OA 2WBLC 2ZTSA 3RHFA 4C4PA 3CBQA 4LZZA 1Z0IA 3KJHA 4AI6A 1XPRA 1ZU4A 2HUPA 1SQ5A 3K0EA 3U4QA 3THYB 1XFAA 1QHNA 4UKDA 2PT5A 3ZVLA 1TPZA 4HLDA 4WBSA 2FN4A 5IRCD 4D6PA 3IO3A 1E9EA 2ORIA 5L8VA 1YU9A 2Q6TA 3MJRA 5HR5A 2ODEA 3Q85A 3QPWA 1NN3A 3M1IA 2XEXA 3RS0A 2DR3A 5CYPA 2VHQA 5AJZA 4Q4JB 1JPJA 2FX3A 3IDQA 4BQSA 4PPNA 4A1FA 5FOTA 1P9WA 4L16A 1UBFA 2IYTA 1P3JA 2BMFA 3V9PA 3KQKA 3M6AA 5DYGA 4ZDJA 3EAQA 2GAOA 5AR1A 2JLYA 1N6HA 2PZEA 4FW9A 3X2SA 4DCSA 3VX4A 3GLGE 3B6EA 5KDDA 3I61A 3KB1A 5FR2A 3VR5A 3TR5A 4EJSB 1KSFX 1VPLA 1CEEA 3LY5A 1KI6B 4Q9HA 5HPYB 1E99A 2VP9A 2GHIA 3A4NA 3BJIC 3B8HA 1H8HA 2F9MA 4PPGA 1D6JA 4C7OB 3T1TA 2EFGA 2J5XA 3P4YA 3ADDA 5JJLA 3K9HA 4QGHA 1QHXA 4IVRA 4LBZA 4LI0A 2WICA 4FIDA 3EZ7A 2IT1A 1JAHA 5AJXA 2XZOA 1E3MA 2PLRA 3AGQA 3WY9A 4Q7KA 1W2GA 4D81A 4A6XA 1TF5A 1MO5A 3MJHA 3EG5A 5F2EA 1QZXA 5CITA 1RRCA 4AWXA 1WCV1 2GEUA 3IHWA 2NGRA 1PLLA 4LBVA 3REGA 3A8TA 2V55B 4B47A 1G7CA 3W9YA 5F9FA 3VKWA 4XWKA 1L8QA 5C1BA 5GVRA 4G5GA 3BGWA 2O5VA 4N0EA 1P4SA 3T1QA 2D06A 2QMOA 4AKEA 4BLTA 3QE0A 4MGYR 2W83A 1KZGB 3GJXC 2VP6A 5TARA 4QOSA 1ZIOA 5JCPA 2GK6A 4GOXA 5HE8A 1YR6A 1D2NA 1W0KD 1E6CA 1QVAA 1UAAA 4V0OA 1FPMA 1U81A 1NY6A 2V6IA 2XJ4A 3IIJA 1NJGA 4DLZA 1U9IA 2O52A 2H16A 2ZYWX 4BZXA 2O8DA 1WP9A 2R6GA 2GXAA 2V1UA 1AZSC 1S3SA 1HE1C 2XOKD 2FSGA 5KNBA 3VKGA 2OCYC 2OXCA 2BCGY 2QGZA 1M7BA 4XD7A 2AXNA 3TAHA 4G5RA 2IK8A 3NH6A 1E2PA 3R20A 4QKQA 1DOAA 2JIZA 5J4LA 1PJRA 5JRJA 1D5CA 3IEVA 4OK5A 5EQTA 1E96A 3KFXA 2GJ8A 2GJKA 2J45A 5EUMA 3EZ9A 2OHFA 4HAYA 4FCTA 4HDOB 4P31A 5J4KA 3BH6A 3RS3A 3PUYA 2X8AA 3T61A 3GLIE 3N2IA 3EPLA 3FMOB 1JXMA 5J4HA 4TT3A 5JSZA 1GG2A 1R5OA 2A5FA 1ZUIA 4QG7A 1KK1A 1NL3A 4Q9KA 1WE2A 4FMDF 5BN5A 2ZM5A 2AL7A 4LYFA 5FBRB 4U5XA 1YZNA 5BYJA 4A0RA 1IY0A 4ACAA 1T91A 1SVOA 2QM7A 2ODWA 1YR8A 3FFAA 8OHMA 1T8TA 4W5JA 4HAWA 1NLZA 3FPAA 2O8DB 4OHVA 3RWMB 4KODA 5JI3E 1OH8A 3L82B 2O0HA 5EZ6B 1BIFA 4M21A 2WWIA 2ZRMA 4MDEA 1SZPA 3HYRA 4HLQB 2GDJA 4NONA 2C9OA 3Q5EA 4UNSA 2NZ8A 3RYTC 3GP8A 3LVQE 1YR9A 2ZI7A 3B9PA 1DAFA 3IHLA 1OE0A 2EQBA 4KVGA 3BK7A 3PQCA 1CKEA 3AVTA 1UPTA 4JVSB 1JEDA 5LD2C 3MUFA 1OYYA 1CP2A 1SHZA 4FI3C 1VYVA 4EPTA 3O8CA 1XZQA 2WZQA 3Q9LA 5JSZB 1MV5A 3GJ3A 2R65A 3RSOA 3QQ5A 1G8PA 6Q21A 2HLDD 1E1QA 1P2VA 4HYYA 5FPTA 2YWGA 3B7GA 3UANA 1P7CA 2AKYA 1ZNZA 1MO4A 4L15A 3EPKA 2AD5A 1NI3A 4JYCA 2FZLA 3BB4A 4GOJA 4KFUA 3D7MA 4GRAA 2HEIA 4JVMA 2BVNA 4J0QA 2RGNA 3NKVA 4G5SA 1FQKA 2HV8A 5CYOA 3SU8A 2CHGA 2XNSA 2G6BA 2ZJOA 3ECCA 1NY5A 3QEJA 2QM8A 4QFMA 3K53A 3LDAA 3ZZTA 2R6CA 3RS7A 4MRRA 2NPFA 3GJ6A 4GL2A 2AD1A 3TSWA 1JBKA 5KUTA 2CE7A 4I1UA 1OH6A 2F3TA 1F5NA 4NCJA 2ECKA 4ZI3A 4M9XA 2ZSEA 2ODBA 1ZP6A 2A78A 1RW4A 2E1RA 3TRFA 4AG5A 5DI9A 3ADCA 1ZM7A 3S1AA 3NDBB 3P26A 4FN5A 4IXNA 4E5UA 1ESMA 1X8LA 2FEOA 4TL8A 3I1FA 1IN6A 2A5YB 4IRUB 4QNMA 2DB3A 1G7SA 2QSZA 3I8SA 3QF7A 1XD9A 3LLUA 3OEHA 4GI7A 2XB4A 3WRYC 1GFIA 2QE7A 3FKSA 3I4LA 1MKYA 1F6BA 1TU4A 5JJKA 1XD8A 4YDSA 3K09C 2UKDA 1NVWQ 4RKFA 4A6PA 3KX2A 3R9IA 5L3RA 4TYYA 5EXSA 1Q1QA 2QAGA 1A1VA 4B2IA 1E94E 4Q4LA 4F4CA 2VL7A 2XTNA 4V0ME 4QHYA 4B6EA 3SQWA 2OUKA 4OKSA 2D4HA 1E9AA 3QSYA 4UNQA 3P20A 3ASYA 3SI7A 2Q9BA 2IS4A 4WW0A 5FPKA 2WWXA 4BGDA 1T3SA 3VAAA 4LJ7A 1L2TA 1NG9A 1NMXA 4HATA 4MKGA 4D25A 4JL8A 3SEAA 1SVSA 2JDIA 1PVOA 3CW2A 4HZIA 4US0R 1SVIA 3WHLA 1J8MF 3WYAA 4LPKA 4DB4A 5DISB 1EFTA 3PITA 2H1LA 2GF0A 5HE9A 1P75A 4C0LA 3SE0A 4CZ2A 4AKIA 1FX0A 2RCNA 2XNDA 3S1AB 4HB0A 3TQFA 2F6RA 5KPDA 3TAUA 5J47A 2OAQ1 1KMQA 1VG8A 3BH0A 2QENA 3A36A 3DMNA 1CRPA 3B82A 3NEYA 1KK3A 4LJ8A 2CL6X 1GOTA 1E2NA 2G3YA 5BW8A 3U5ZB 4NE2A 4NKRA 4S2EA 3V00A 3OAAA 1NKSA 4X8MA 2F1JA 1W4BA 3KQUA 3CLVA 2B7CA 3QXXA 2QAGB 2WWWA 4FMDB 1OXSC 2QPAA 1Z83A 4DIEA 4LYAA 1E9CA 1MRSA 3RDPA 1KK0A 2WJJA 4GPTA 1E2LA 1UKEA 1N6KA 2W6JA 2WPDD 1OIWA 4LYJA 3TUZC 3RS5A 5K8LA 2QY9A 3ZGXA 3U7EB 4TZ6A 4QBGB 1H65A 1NN5A 4M8NE 1G19A 1UF9A 4TL7A 4U00A 3LXRA 4MGKR 4U02A 3MG9A 1N0WA 1OXUA 3SQXA 4JLDA 3O8BA 4NYMQ 2AKAB 3IO5A 3DL0A 1FX0B 5J40A 2JLSA 3MCAA 1JQJC 3NBFA 1R5NA 2BMDA 3K1JA 1FP6A 4DCTA 2JGNA 2AR7A 2PMDA 5FBLB 5JLJA 3THXA 1N5IA 1NF3A 3L43A 4QL3A 1C4OA 2B8TA 1K8RA 2KJQA 3OIUA 1E9BA 2NG1A 3Q3JB 5F98A 2ZJ2A 3IBGA 4PANA 1G8GA 1Q44A 2RGXA 1GL7A 4URXR 5EXPA 3GJ5A 4Q00A 4QC2A 2GZDA 2P0EA 1RC8A 1N25A 4PQRA 1J99A 2NTYC 3THOA 3OIVA 2OEPA 1VHTA 2ZIAA 4BASA 1KJZA 1YZKA 3KTAA 3OEED 4CEHA 4L8GA 1CF4A 2W2XA 5IK2A 1AGRA 3HPRA 2JJ2D 1G8FA 1G18A 3QVUA 2CNWA 4D0GA 1RRPA 4ON9A 1ZNXA 4KBFA 2FWRA 5CB6A 3LFUA 3MWLA 4MRNA 4YQFA 5IHPA 1JB1A 1G8HA 1W1WA 2C99A 4HI0E 4LJ9A 1TAGA 1R6BX 3AVQA 3ADBA 4BFSA 1OXVA 3H84A 1JALA 4L9SA 3THXB 2GVZC 2N1BA 5TV2A 4XSHA 3O8RA 2CL0X 3B2EA 4Z1MD 3QKUA 3AKCA 5SZKB 4UNPA 1R7RA 4LK2A 4ZV4A 4BFZA 3EW9A 3QXHA 4NYMR 2P5TB 2YWHA 3B1VA 3ZLJA 3WNDA 3SBEA 1BOFA 4ZI2A 1JR3A 2JCSA 4JLJA 5FL7A 1NBMD 4M1TA 2B7BA 3QKRA 2ZRBA 3EPJA 3P27A 3F0TA 4TMKA 3ZQJA 2NMVA 4AKGA 2VP2A 3CH4B 4JLAA 2ZVQX 3KTAB 4CEHB 1FQJA 4EPRA 3UMRA 2CK3A 2V7QD 1U0HC 3HR7A 2A5JA 3UPUA 3A1SA 3DO6A 1TF7A 3TKLA 3NDPA 3UG6A 2G0TA 3E70C 3U7HB 3A1WA 5FFMA 1CU1A 4TL9A 2C78A 4HB4A 2WKRA 2JJ1A 3W5IA 1JJ7A 1DO0A 2Z83A 3DZ8A 1LV7A 5EP4A 3KQLA 3REFA 2JLVA 4RD4A 5LD2B 3CF0A 1T0JB 5B57C 2ONKA 4BFVA 2QPOA 1RPZA 2RMKA 3NXSA 1KNQA 1SVLA 1JAIA 2CCKA 4B76A 2QT0A 2GILA 3L0PA 4KBGA 1WA5A 3HJNA 5CDFA 2GAAA 2ZETA 2AFHE 4C0HA 4GP7A 1QHYA 2FSHA 2IYZA 3QKRB 4YXWA 1E2HA 1T4GA 3O47A 1ZNYA 1NLFA 1E2QA 2RGEA 2Q9AA 3LRPA 1J2JA 2YC2C 5A0FA 1KDPA 2MMCA 4AK9A 3AB3A 2OESA 4IVPA 3OESA 4Q1AA 4TLAA 1VCOA 1FP7A 1KO5A 3AKEA 5E7MA 4EPVA 1EFHA 1JXOA 5EE1A 5E3HA 1UDXA 1UJ2A 4IVQA 3QEOA 1AS3A 3GLFE 2PZGA 1UEJA 3PENA 1IY1A 1G3UA 2H7VA 5CLQA 1EWRA 4OQMA 2WMNB 5KSOA 2IWRA 1QBKC 2WM9B 1OV4A 3A58B 1I4DD 4V0LA 3KJIA 3WNCA 1U0JA 3OE7D 3W90A 5FTNA 4KSCA 4IOKA 3CX8A 5KSYA 1YJ5A 1P6XA 5C4MA 4GBMA 2IUSA 1H8EA 1X8JA 1HQYE 4F92B 1F2UA 4RCZA 3N70A 4NZYA 3A37A 1G3RA 821PA 4NCNA 3C15C 3K0CC 2Z4SA 2OZEA 5G3ZA 1NBME 4DUGA 3CX7A 5DHAA 4AIIA 4BEBA 1FTSA 5TMPA 1AJEA 1CR0A 2NO9A 2VTKA 2ORWA 1VYTA 3T1VA 1OT3A 4US1R 2O8CA 1ZNWA 4BFTA 1ESNA 3MAAC 4L9WA 4QNRA 2XXAA 3WRXC 2QORA 1TUEA 4DLUA 3EIEA 3U60B 4KFRA 4WIAA 4CEIA 3AV0B 1HH4A 1HYQA 3L0SA 2WSSA 3V4RA 3PEWA 1D2EA 1CJVC 1RYFA 3HYTA 3QXJA 1JQLB 4ASUA 4DSUA 4RSGA 4HB3A 3A1UA 3PIRA 4B48A 5JCZA 1BMFA 1P2SA 3EIQA 5KO2A 3C8UA 3R8FA 1OHHD 4DCVA 4ZDWA 3AQ4A 3R7WA 4C0SA 3RRYA 3KJGA 4DBLC 4DZZA 4KXFB 3ZZUA 5FOVA 4WVFA 1UKVY 1OXXK 2H8KA 1CJKC 2YOFA 4KVAA 2BOVA 2GKSA 1F2UB 2YZ2A 4BRUA 4PX9A 3T5GA 1UBEA 1EG7A 4P3YA 1TL7C 4QJ4A 1MRNA 3BB1A 3WNBA 1R0XA 4LJ6A 1HTWA 3OFNA 2QPTA 5KDLA 2JATA 1UADA 4MA4A 4DCNA 5HCIA 2WWHA 1GSIA 1GIAA 2ZS8A 3K70B 5TDHA 2H57A 1TQ6A 3SFVA 3O8DA 2ZU6A 4D4KA 2O8CB 4NYIR 1N3BA 2XXAB 1L4UA 2BJVA 5AUQA 2LWIA 1N5LA 2QG6A 3AF1A 1EFRD 4BLPA 5HKKD 1G17A 2OXRA 1CRQA 4JJKA 5EE0A 1Q1ZA 4CEIB 3UG7A 4G01B 5G53C 4A92A 3K0SA 1XEWX 4LJ4A 2H5EA 4OHZA 3UWOA 2ZI3A 4TSFA 4GP6A 5FUYA 2ZEJA 3TSZA 4Z54A 2R44A 4MQBA 4KFTA 1CJUC 1W5TA 4KFSA 4JSYA 1YQTA 2X1VA 2GJAA 4V0KA 4L4UA 2VQSA 3CF6R 2ZJZA 1DELA 2D74A 4R9UC 2DWPA 2J87A 3R7WB 4TTRA 1NKTA 1AM4D 1GKIA 2ZRNA 4OK6A 3CO5A 4YMSA 5TXGA 4KI0A 3MRSA 3T34A 2BM1A 1NRJB 1Z47A 4AD8A 2FGKA 2OFWA 4OQXA 5SZHB 4AG6A 2J0QA 3QVVA 4M4SA 1WF3A 3AVPA 1E9RA 4FWIB 1DTSA 1LS1A 3KKNA 4NU0A 4MYUA 2G88A 2F55A 1YZTA 3NEJA 3OZXA 3IQXA 2PZFA 4N0DA 3RAPR 4MITA 4PTLA 4V0NA 2ZS9A 1Z6GA 2C95A 1U8YA 1E2JA 3AUYA 1DAIA 2R6DA 1KSHA 2GEVA 1EFCA 4K81B 4RFVA 3AH8A 1XTSA 3NHBA 5JI2E 1UBGA 2ZYTX 1OB2A 4MUAA 1EESA 1ZM9A 3VR1A 4HZUA 1E79A 2P6NA 5C2JB 1GKUB 3RLFA 2FPLA 2W58A 3BAFA 4X8HA 4GZLA 2YNMA 1DG3A 5A4JA 4OK3A 4PSAA 1H8HD 4B6FA 3EZFA 4A8JC 3GLHE 4NHOA 3KUCA 4Q9IA 2VIIA 4ILEA 4OHYA 4IDHA 5KDOA 3IPXA 2ODNA 1T5LA 1XU4A 2E87A 4GT1A 2WWYA 1OKKA 2Z5FA 2VSOA 4IDNA 1II0A 4Q9LA 1FW6A 1KKMA 3UKDA 1IONA 1OFHA 3FYHA 5JEEA 5JHGB 4RD0A 3NTUA 4PO9A 3TVTA 2C9YA 3HR8A 4V02A 3HWSA 4DLVA 2VH5R 1Z06A 3T1OA 1OJLA 4BRWA 5GVSA 5JWRA 1TQ4A 3CNOA 1XNJA 1U94A 5J4VA 3NBZC 3R9WA 1HUQA 4JZKA 4C2UA 3QG5A 2B21A 1G4AE 2HXSA 3PV0A 3CRQA 1CJMA 3DVLA 3SDZA 2X2EA 4D4MA 4A0FA 2O8BA 3BIFA 2ZI6A 4PAQA 3IIMA 4B3XA 1N5JA 2QSYA 2SHKA 3QOFA 2NO6A 3BH7A 4HZUB 4F7WA 3LA6A 5JS7A 4NDZA 2Q3HA 2QA5A 1A82A 4M1OA 4PC1A 2PEZA 3L2OB 1US8A 4PZZA 2F9LA 4M22A 3VNVA 2OBNA 1P73A 1Z2AA 1XXHA 1W49A 3SJAA 3FHCB 2LKDA 1IXRC 2ZUBA 1SHKA 4JJZA 1HURA 2ZSFA 4LX0A 1IAQA 3TR0A 1N6LA 1M34E 3SJZA 1C1YA 1WQ1R 1W48A 1Z0DA 2IYVA 3GFTA 4YMWA 5JRZA 4LGMA 2JIZD 4DDTA 4HLUC 2DBYA 4ZCMA 4JBWA 4BLQA 4A36A 1QHSA 1FUUA 1EXMA 2I3BA 3DPUA 3RRNA 2AK2A 2GXQA 4H1UA 1QHGA 1JI0A 3PUZA 3I5XA 2C9CA 4Q21A 4JKYA 3IIKA 2ZRFA 4Q1FA 1G7TA 3SN6A 2PMKA 2ZJAA 3LWNA 4A2WA 5FBVB 1AZTA 3RNLA 3FGNA 2O8BB 3HP1A 4YONB 2IYWA 3K9GA 5JWHA 4BZPA 4FINA 5FBWB 4OQNA 4C3ZA 3AM1A 2AX4A 2QTHA 2ORVA 2XJ9A 2LCFA 2MSCB 2ZROA 3E1SA 1G6OA 2G77B 4Q1DA 2ERXA 4P0TA 3PXGA 3SHFA 1US8B 5EE3A 2ZE6A 1M1YE 1XXHB 4RD2A 1P9RA 5AJVB 5DYIA 1W0KA 1DAEA 1KO1A 1U98A 1ZBDA 4NYJR 3NBYC 3WHKA 2TMKA 5DNYB 1N5KA 4HUQA 5EZ5A 5G41A 1M74A 4OL0A 2VBCA 3GD7A 4A0GA 1KKLA 5H8WA 4R71A 1RYHA 3ZJYA 3SJCA 1E2EA 4W5WA 5JS8A 1FUKA 3WXMA 3G82C 4R2HA 2JLZA 2FFQA 5E95A 4B2PA 3QF4A 2ZYUX 1E98A 4PC7A 2J3EA 5KSZA 4JSTA 1XJCA 2V1XA 4K46A 1AKYA 1XF9A 2WIBA 4M0LA 1ZMXA 1ZD8A 1E69A 2J7KA 1KO8A 1BYIA 1R0WA 2R6AA 4IW3B 1G4UR 3CIOA 1K5DA 1KY3A 1E1QD 1GNQA 1U99A 4EQ6A 4HAXA 2WAYA 4FCVA 3EX7C 3KZ1E 2DFNA 2IEZA 3FB4A 4POAA 2A5GA 4FXPA 1C9KA 5CB8A 4US2R 1DARA 4DLTA 3LNCA 3IEUA 5JMTA 2H18A 2A30A 4Q5IA 2V3CC 2GCPA 3C5HA 3GJ4A 3W34A 1W36D 1Z22A 2FV8A 1EGAA 4HUQB 3AVWA 1T0HB 2IYQA 4DCUA 1AA9A 1GAJA 2WAXA 4ZIRA 3CKLA 3GCGA 4LSGA 4LYHA 2EFHB 4URZR 5TB5A 3SHWA 3U2QA 4B74A 4QM7A 3KL4A 4XSGA 4V0MA 4HSEA 5GADl 5FTMA 2O8FA 5K8TA 1GL6A 4CGZA 3AVXA 3FMFA 3QF4B 1XMIA 1GTVA 2XGJA 4JKIA 1SKYE 2JLRA 1UKYA 2MMGA 1P9NA 4LHYA 5E4FA 1KAGA 1N0VC 3CH5A 2QBYA 2XSZA 5M04A 4E03A 1GNPA 3AF4A 3ZQ6A 3BE4A 2HDNB 4JLNA 4X8LA 1U8ZA 2NO0A 1T3HA 3CUEF 4W5HA 4CYMA 4BLOA 5BYKA 4QGAA 4RD3A 2G1KA 4TYWA 1OPXA 4EQ6B 1KI8A 2QE7D 2PX0A 4HAZA 1A4RA 4B43A 2IC5A 1SVMA 1QVRA 4Q4AA 4TMXA 1QG2A 1SVKA 5EJEA 1MO6A 1AKEA 2V54A 3KJEA 2ZUCA 2EVWX 2HLDA 5EP2A 4TMZA 4XVUA 2IA5A 4B3DA 1IHUA 4I1SA 1Z0FA 2ERYA 2ZREA 1QHIA 2A9KA 3IQWA 3K0AA 5HZHA 221PA 1GRRA 1KO4A 4DVGA 1G6HA 1QRAA 4S35A 2WIAA 3B1YA 4ZIRB 4RD6A 2WKPA 1S1MA 2BBOA 2YJTD 1Z6YA 4ZPXA 2O8FB 2JDID 3C4JA 5K8UA 2KWIA 1E2IA 3LQQA 2ZSBA 3B13B 3CPEA 4B3GA 2ZUDA 3ZS9A 3PEYA 4KCGA 4JMPA 1XEXA 3VR4A 3E5HA 4B2LA 1NSTA 1VG0B 2JLXA 2QBYB 3EZ6A 1EK0A 1G64A 2BJWA 1WRBA 3AGPA 2MSDB 3KDSE 5D3MA 4OI2A 3K0FA 3HU3A 3ZVRA 2ZJYA 4WOPA 1ANKA 1KDTA 4QBFA 3U3JA 3I3SR 3KKQA 1SXJC 2O8EA 1DPFA 2FFAA 4Q4AB 4XH9B 4YC7A 1Z6XA 2IHBA 3FFBA 1XTJA 1KAOA 4PFSA 2HJGA 3LH5A 2VHUA 5P21A 2FEMA 1G291 2F1IA 2W6ID 3AVOA 5AK0A 4DHEA 4F91B 3K0AB 5C18A 2KBEA 5KYKA 1HV8A 4JBXA 3LO5A 2CVFA 4JT2A 3UMFA 4DEYA 1XDBA 5AWFC 1NG1A 1VKJA 2RGAA 4NL4H 2I4IA 3OHMA 4PZYA 1E32A 3CB4A 5J4YA 1VG1A 4LWZA 1XEXB 4OBEA 2J0VA 2KBFA 3EA0A 4IJMA 4MYHA 3RS4A 2DCUA 2GA8A 2JAQA 2VHCA 2IHYA 1FOEB 1WMSA 1R10A 2OLJA 2BHRA 1N6IA 5D3MB 1OFIA 3VR3A 1Z5ZA 3K0FB 1M8PA 1RKBA 1NNEA 4URWR 4EAQA 3SC3A 5IF9A 2QU8A 4IKEA 2GEDA 2QQEA 4U7DA 3KKMA 5KTYA 5LPNA 2O8EB 1NP6A 4PSVA 4KHZA 1CR2A 1IXSB 4N1AA 3NVAA 3PFIA 4PSKA 1OF1A 4M1MA 2PJZA 5J5CA 1FMJA 2IF0A 4P4TA 2CLDX 3ZIAA 4DLYA 1GVNB 2O0KA 4RZXA 3H2YA 5HTKA 5UKDA 2HJVA 2KSQA 2ZRIA 1YRAA 2ZSDA 1S9DA 4IHQA 2L0XA 1LNZA 3AUXA 4M1YA 3X1DA 5ELXA 1KSGA 3VR2A 3RS2A 1OSNA 3A6PC 2D2FA 2D7DA 3GFPA 1NVVR 1NJFA 3ZYCA 1YE8A 2CNWD 2YINC 3CPJB 3D6TB 1E2FA 2HYDA 2WPDA 4OJKA 2HT1A 3V4FA 2LKCA 3D31A 2FFBA 2YHSA 2ZRHA 3RABA 1TEVA 4ABYA 1ONBA 2ZPTX 4M53A 3WMFA 1DO2A 3BFVA 4NP6A 5DH9A 3Q5DA 2XB2A 1IOZA 2NIPA 4XJXA 1ZINA 1N6RA 1VHLA 1EFUA 1HQCA 4TTQA 4BUJA 4E09A 2ZAMA 3VU9B 2XITA 5SZJA 2V4ZA 3MFYA 3NHAA 3PEUA 1KOFA 4MH0R 1O3YA 4UQOA 1RRFA 4BFUA 4LHZA 4AYTA 4ZCIA 2JLUA 4LJYA 1JR3D 4NH0A 2ATXA 2C8VA 1XTRA 2RGDA 5FI1B 1XMSA 2QAJA 2VSXA 2W0MA 2Q3FA 2WWFA 1DAGA 3TIFA 3T12A 2ZQ5A 1KI2A 4HDCA 3M4YA 5E7JA 4QM6A 4LHXA 5FI0B 3ADKA 1D9ZA 2F1RA 1AS0A 4JLOA 1LF5A 1W5SA 2GXSA 3UIEA 1E9SA 4UXJA 4OYHA 4YDHB 2CK3D 1XWIA 2QUZA 3W6NA 2NZJA 2WJGA 2CL7X 4IXMA 4DKXA 1SVWA 2GWHA 3GEEA 3NIBA 4EJSC 2YC4C 2FGJA 3VNUA 3RSLA 1SULA 2WHXA 1FTNA 4DSTA 3ZVMA 1ELOA 5TY0A 4RKEA 1E0SA 3ZH9B 3TJZA 5BN3A 3NBXX 5FPHA 2JJ2A 3AF0A 2J1LA 3CZQA 1YZLA 2IYUA 2CXXA 4B73A 2QNRA 3BBPA 3SYKA 1IY2A 3QKSB 5EUQB 2A5DA 4B71A 3GLFA 2IYXA 3AKDA 1UFQA 1Q22A 4M9QA 4IFEA 4XTCS 2J7PD 421PA 4CF7A 4IEIA 3SYNA 2VPPA 1V5WA 2KB0A 2OFXA 3CRW1 1RFLA 4YMUA 3H86A 5FL3A 2BV3A 4GFDA 1GUAA 3FDIA 3IGFA 3X1WA 5EXXA 3CRRA 5JZVA 4Z51A 1VDZA 3FVQA 4Z1MA 3P32A 1KGDA 4URUR 1AGPA 1X1SA 3R8CA 4OI1A 4WZAE 4F4JA 2ZJBA 2CHVA 2OM2A 2DWQA 3ONWA 2PJRA 1ZUHA 3IUYA 3VMFA 1SXJD 3MGCA 3X1YA 1GRNA 3L0IB 1PZNA 2CJWA 1GDDA 4Q66C 1TNDA 2G83A 1KI1A 1YRBA 3GEIA 4JLBA 2OAP1 1QHHA 1A5TA 2ZYVX 5IT5A 1M7HA 4ZCLA 2IL1A 3CX6A 2ZRKA 3BD9A 1P61B 4D80A 1J70A 1P60A 3QBTA 3ND8A 2V7QA 621PA 4Q48A 3UATA 3K09A 5L3VA 1G16A 4DT1A 3QKTA 1GRQA 1E1RD 1OLOA 1FMLA 2NQ2C 4NMMA 2GRJA 4RCYA 1QDEA 2AWOA 1Z0AA 1NMYA 2CE2X 3GLFB 1Z3IX 2CHQA 2FE4A 4PAMA 1P5ZB 4RZUA 3AP3A 1E0AA 1IN4A 2G1JA 2F1HA 2P3SA 1VCNA 3CZPA 5DO9A 3LD9A 1JR3E 2J59A 5EE5B 2QZ4A 3AP1A 2RGCA 3ZVNA 3C7KA 2WKQA 1XCGB 4ZDIA 2WJHA 4DUGD 4Q19A 4LC0A 3SJBA 5CM8B 4ACBA 3K70D 2BDTA 4OQFA 2RGGA 2EWWA 2EFCB 4NYIQ 1CULC 4R98A 3EIHA 3ZD7A 3BORA 3K8YA 5CK5A 4B44A 1LFDB 2CJWB 1P2UA 3U44A 1GL9B 4FD2A 2EU8A 3AF3A 1QHHB 1XB2A 3H4MA 3WMGA 5B58C 3X1ZA 3WYGA 4C0KA 3FE2A 2WSSD 1Z29A 4EPWA 1A7JA 2W00A 1U8AA 1U9IC 2IXFA 2ZRAA 3JZAA 4GOKA 1J8YF 3RRZA 2D2EA 4CT5A 4F4IA 1FNMA 3BERA 4OI4A 4Y0VA 3CPHA 2IXEA 2P5SA 2WOJA 4H9GA 5FOXA 1MH1A 4A9AA 4DT1B 4P32A 2HF8A 3QI2A 1CLUA 4GSYA 2D62A 4LJAA 2DFLA 1OFUX 3SBDA 2VO1A 3EA5A 3EWAA 4D26A 1A2KC 3C5CA 3Q7QA 1II9A 4PC3A 3MMPA 1N6OA 3TNFA 2CEAA 3LQRA 1IJFA 1IM2A 1IN7A 4LRWA 1WXQA 3HPQA 4M1SA 4CIDA 4YMTA 1G9XA 5JECA 2CLCX 5DN6D 2IBMA 2XAUA 4RZ3A 1SXJE 3ICQB 1UDWA 2OBMA 4BEJA 1OYWA 3KFVA 3U44B 1XRJA 1R0YA 3GQBA 1IXZA 3RRMA 4PHGA 4QGFA 2WTUA 2OLKA 4PC2A 1ZM4A 3QIAA 4URVR 1ZC4A 2AN9A 2UVQA 3QBVA 1GWNA 1TADA 5JWOA 1W4AA 3T15A 1OIXA 4DLSA 4TTPA 4UNNA 3NH9A 4OQLA 2OT3B 4GMXA 1G5RA 2OCAA 2XZPA 1PUIA 4O2RA 5KPJA 2V9PA 2Z6VA 1COWA 1N2CE 2FFHA 2A3RA 2WWGA 5LB4A 3U3KA 1W47A 4P4UA 1NIPA 5CJ2A 3AEZA 2Q3MA 5FTLA 1NIJA 3R9XA 1G3QA 1VG9B 1D8TA 2C98A 2C96A 4JT4A 4XTRA 3FMPB 3KXLA 2BWJA 2OCPA 2PL3A 2A7QA 2XTMA 4NCIA 3GLGA 3KXKA
chains in the Genus database with same CATH superfamily
1CUCA 3OCYA 2F9FA 1X1DA 5DM4A 3H18A 3ZUPA 4C0XA 4KN6A 4ZGGA 2B1GA 1HKHA 4X3OA 2QX8A 4LXIA 1SRQA 3OD1A 2FN3A 3GG9A 3D64A 3PX7A 2FHSA 5CLFA 1Y1QA 3HZRA 3O75A 2WKWA 4UXIA 4C0AC 5AVWA 2Q27A 4EELA 1N33B 2UYQA 3ZWWA 1YI8A 2FU5C 3PIIA 1SXHA 4O25A 2HPVA 4P33A 3T9FA 3GU3A 3IESA 4NU8X 4MRSA 5JFTA 5AKEA 1IIBA 2AJTA 2YKGA 2WZDA 4PO8A 2BEVA 3FHLA 5FYDA 2PLWA 1ZR2A 1CEYA 4ZRMA 2VNKA 1MD9A 2VYFA 4GPEA 5HKKA 3NPMA 4ZHQB 2FZVA 1DGQA 1V9SA 2BP7A 5A05A 4UM9B 1JKFA 1YJAA 3QEBZ 1QJ4A 1C1XB 4Q1BA 4RY2A 4CF5A 2ZJ3A 4MAAA 3A4VA 1P33A 2OB2A 1I4WA 2WT9A 4MLDA 5HCUA 1HEIA 2WT8A 5TQVA 4A15A 5FQNA 1FFXB 2FA9A 4MO2A 3ZQ4A 4KO8A 1UJ5A 2Z6UA 3C41J 1R8XA 4N7RA 4BB6A 4C30A 4ZCQA 3DDWA 4NU6A 4D44A 3ST7A 1KGSA 4XJSA 5FPQA 2ZDGA 5H4HA 4LXYA 2G09A 1GUZA 4G8CA 5ELLA 3WLOA 3FUXA 3UWOA 4IO1A 4MUIA 3K16A 1HY3A 4YXFA 3T3OA 2X2FA 3IPLA 3VDQA 2QTFA 2FDRA 1U4NA 3PVSA 4ARZA 2P6UA 4COKA 3MUOA 4HFRA 3GV0A 2IV2X 2RGRA 1K89A 3IJEB 1BFUA 2F7SA 3MS2A 5AVUA 4OMFG 4Y3UA 3CRVA 4JUDX 2G72A 5ECYA 4A8HA 3PDHA 4AJ1A 4B6OA 4Z4HA 4IIUA 1UP4A 1Z37A 3G2IA 4GXTA 4MYRA 2KYRA 5GMOA 3KUXA 2VT3A 2ZJ0A 4BRZA 4I99A 1HT1E 1YA8A 3RVOA 5E8JA 1W6UA 1VXOA 4Q18A 3EJWA 3SQDA 3C3AA 3JXEA 1YBHA 2QAGC 4FFPA 3P4XA 1UFVA 2QTLA 4PHFA 4G67A 3RODA 4OB7A 2WQ7A 2OO3A 4PLPA 4RTOA 3FPJA 1YZUA 2BP7B 4WZ6A 5AXCA 1ODKA 2JIQA 1R9GA 2NZYA 1S2GA 1A9ZA 1CCWA 4JAVC 4YAFA 3SZOA 5A4MS 3G5AA 3R3WA 4NYJQ 4DG5A 4YHBA 2Y66A 5HILA 4TL6A 2GCGA 3LVBA 3FBTA 3AVUA 3IMEA 3GFOA 3EPPA 4CHGA 1U9ZA 2Z2JA 4P4LA 2J9XB 4C4OA 3RAFC 3DVRX 2HWXA 4XARA 1XMPA 2PGAA 4R7GA 3TKYA 4EZEA 2AMYA 5HUHA 5T8KC 3G02A 1E9DA 1LVUA 5JCXA 1T2CA 3U4QB 2YVKA 1QCYA 5KNBD 4N3AA 2R8RA 3EZNA 3OHPA 5FEUA 4XD7D 5IUJC 5EPUA 1VCHA 1I7PA 3CM0A 3EBOA 1FDIA 4FONA 4ARZB 1IK6A 2IPOA 1O1YA 4CT0A 3GDFA 4CT4B 5ALYA 1MAHA 2JCVA 2IUUA 3CMCO 4PBTA 1MMFB 2Q1XA 4NPHA 4GMFA 4U7PB 2Q62A 4X6UA 1ZFNA 3DDOA 1V7ZA 3JQFA 3LW8A 4WACA 2GUGA 4DUYB 4LGVA 5FNZA 1T9HA 3LW7A 5J3JA 5IKXA 4QU8A 1NUUA 3JVIA 2YASA 3HM9A 5ALUA 3U3RA 1QTRA 3WA7A 4DUZB 3RVQA 2R0QC 4H31A 1HLGA 4HZGA 2G0NA 2Q3DA 1IULA 1KZ7B 2GUWA 3K73O 4TT3D 3HLKA 1YNOA 2WUDA 2FSFA 3FHTA 1PFUA 1VCMA 4FILA 1DBWA 2JRCA 1OAOA 4G8DA 4BFWA 4JLMA 3H99A 1G7RA 3ZHYA 2DQSA 3ETHA 2FMTA 1CQIA 1VL2A 1L4LA 2HK6A 2QYTA 2ZSIA 4MYDA 4QBIA 3UJ7A 4C08A 4AU1A 3NRJA 1G6KA 1O87A 4WXPA 3ADOA 1LV8A 2ZULA 3BCSA 2RAUA 3UW1A 4NOJA 2ZJFA 3FNHA 4D43A 4PGAA 4TM8A 3OZIA 3KKLA 5ECDA 2Y77A 3JQDA 5IAEA 2ZRDA 4D5GA 5BWOA 3WP0A 1I3NA 3D3WA 3Q0TA 1DBRA 2AZTA 4TMWA 3EXHA 4Y0AA 2VRWA 4QIHA 4YRMA 3P2MA 1WDKA 3JALA 3SEFA 3LGAA 1C9YA 1FNBA 3CN9A 2XB8A 3EUFA 1L8LA 3DL7A 3KUKA 3I0MA 4YJGA 4EX6A 6GPBA 4CETA 3SIPA 4KWHA 1EHCA 3PEVA 2HO5A 3DULA 1CK4A 3LT0A 3C1TA 2XZLA 5IHXA 1R6XA 2I3ZA 2J46A 4CCSA 2JJ8A 1ZVJA 3FOZA 2HWYA 3TNYA 1BVHA 5CJPA 5AXAA 1ENYA 4NTZA 2EBFX 1Y8CA 5E6RA 4LF7B 3V48A 4GOLD 3P4UA 1OA0A 1TJ5A 2YQ5A 1I2DA 3DV0A 4KR7A 1JT2A 4XEHA 1E3TA 3PGVA 1KWKA 1XNQB 1XXHE 4MKIA 2IDJA 4PTZA 4IBOA 1M76A 1P1JA 4HAVA 2I6GA 1H4TA 1P1BA 3J81k 1L5HB 2D0IA 3IVGA 2X9QA 3BXFA 5DJ5A 3VTKA 1XCMA 1TM5E 1RQGA 3PR1A 4G1UC 5BSTA 1CQIB 3PJRA 1HYGA 2RK3A 2QRGA 4FZ5A 1ZUNA 1PNRA 3I9OA 4R8SA 1T8WA 2A9JA 4IDPA 3NVKI 2PA0A 2XB6A 3D3WB 3N3AC 4LXTA 4PVDA 3RSHA 2QI9F 3EXHB 4MIOA 5HJEA 4EVQA 2C5GA 4MLCA 2FCRA 5L4NA 3TCXB 3JALB 4RKRA 1JF8A 1XD2A 1YF3A 3M1AA 4E6PA 3HXQA 1DHRA 3UWMA 4K2HA 4EYQA 1GNVA 1P7ZA 2NPIA 3BWYA 4L0DA 4YJGB 4YASA 3S2UA 2I9KA 4IMIB 3H17A 3ONFA 3R44A 3PK0A 3RS8A 5CFRA 3FH0A 5L3SA 3HE3A 3EBPA 1K8QA 4CQNA 4MCIA 1MAVA 3H5NA 1ULUA 2H3HA 2HFKA 3GYBA 4FHZA 4GOOD 4HGOA 4NAHA 2QQ5A 4QO7A 5CBPA 3CF4A 2FW0A 1GPDG 1OTXA 1Q15A 5E6RB 5ALSA 1TTHA 3UUWA 3INTA 1IXKA 4LHWA 2OFOA 1LX7A 4PYOA 1EZ1A 3DV0B 2BM0A 3A4MA 3ETDA 3NTOA 4EI8A 5F12A 5ALTA 3EG9A 4O2AA 4TLEA 1HPLA 2CMFA 4C0QC 3JCZA 4OU4A 4ZQEA 3RTDA 3FJOA 2WD9A 2PV7A 1U7OA 2Z43A 2P1ZA 2EGUA 3OCZA 4CI0B 3PQ6A 3FKSD 4E12A 1KY2A 1NC1A 1ZUNB 1D6MA 1Y7HA 1OBOA 4AC9A 2FMKA 5G3YA 5B7QA 4R2KA 1P91A 3IIEA 3AUAA 3IUMA 4UUOA 3ZCPA 4BO1A 2J9GA 3ZU6A 1IN8A 1MT0A 1ZW6A 4Q02A 4CNQA 4FM9A 1OC2A 1TO1E 4RPGA 3QE4A 1KBOA 1EK5A 1PWYE 2G9VA 4D3FA 3T5DA 1U8CB 1XD2B 2O1WA 1DG1G 4A5SA 3PQEA 1PT6A 1N2OA 2ZE7A 2FR0A 4LV5B 3AI3A 5KKAA 1N2JA 3VNSA 5KSWB 1YGPA 1M6NA 5EHNA 1JLRA 2Z2ZA 3FLEA 2H1IA 2A0KA 1PBTA 5ECWA 4AY2A 1JQEA 3LC2O 1FRQA 5L3SB 1GQFA 4Z4IA 3GY0A 5TSDA 3U6BA 1E2MA 4C6SA 1QQ5A 4NBKA 2IYYA 1GN8A 3Q9SA 2PQMA 1IK4A 4KN5A 4N7BA 2PCJA 2I1VB 3IHKA 4ZGWA 5CBPB 1PDOA 2D7CA 3CEPB 2QGNA 3H0CA 4QSHA 4OQ4A 3JD2A 2VJNA 2WSYB 3W8EA 1KU0A 5DLEA 1A3CA 2JEZA 1BEEA 2YVAA 4MQ4A 3TLGA 4NBUA 5JDIC 1YSCA 5A9RA 4AJNA 3QTTA 4B4DA 5JJBA 4PAOA 3BXZA 3UH1A 3AG5A 5FX2A 1B23P 1ONSA 4NDNE 5JZMA 1NV9A 1GDHA 1JR4A 5H68A 1G5PA 1PR2A 3TOVA 1BDHA 5TGTA 4IUBS 4BFLA 4F2DA 1LNQA 1HT2E 1EWTA 3QVWA 2GPYA 1SG0A 2P62A 3DZJA 3T54A 3WFIA 5C5DA 4WWHA 4LY9A 4C4YA 3QPUA 3JYOA 1LVHA 4X7RA 1H2XA 5DGTA 3IDOA 5AQEA 3L8YA 1YHNA 2X77A 4KXMA 5BNIA 3FNGA 4MVJA 1XKTA 2W6JD 3H87A 2ASEA 4UUBA 1U7TA 4PLWA 4UTPA 3VVBA 5T8KA 5C32A 4JK3A 4FMBB 4UNRA 4DSOA 1KNXA 1X8KA 4HT3B 2WYIA 3IP6A 4IDBA 5A5GA 4MRPA 1L7XA 2B92A 3F1LA 3L5KA 4G09A 4LDPA 5T7BA 3FTQA 1RMQA 4G5XA 3DKVA 4NQZA 2TMGA 1KBQA 2XWQA 1G3IA 2BSQA 1JA1A 3EXEB 3WWDA 1U7PA 4WNAA 1RJEA 4K05A 3ZIAD 1Z0JA 3A6DA 3FKQA 3TLGB 3VDNB 4D56A 2BL4A 4LC1A 4MUHA 1Q0RA 3V34A 3X43A 4ZV9A 5EG5A 2AHOA 4DB2A 3AR7A 4ND1A 2LRHA 4AZ0A 3IPYA 4Y18A 4I6GA 3RC8A 4YQYA 1ZXXA 3KQOA 5E0OA 3PNPA 3CLHA 4JYMA 2XUQA 3KTOA 2G70A 5AOBA 2JLWA 3NAGA 3URKA 3QQPA 2NU8A 4QBHA 1OAKA 2W6IA 3DKIA 2V8BA 4HWGA 4XB2A 1IHPA 5T41A 1UM9A 1TC2A 2AEMA 3ETGA 1Z45A 5EUCA 4O2LA 1LPAB 4K03A 1K06A 3HS3A 3L40A 2OL4A 4MB0A 1Q50A 1Y3CE 2B6HA 2VP5A 3ZK9A 4BB9A 5KOHB 1YZQA 2JGKA 3HR4A 4KU4A 1QF6A 4CIAA 1M2GA 1FLDA 1E4VA 2WF6A 2WINI 3MPUA 5J5VA 4YPOA 4WNYA 3D0QA 1AF7A 3R6TA 3EMDA 4K7JA 2PMEA 1MP0A 4DMUB 1GZDA 3RO7A 1ACMA 2IVFA 2JEOA 5MGNA 1GQRA 2ZIWB 4Z5XA 2VTEA 4DJTA 4NCKA 5C7IO 1S9HA 3W8FA 1SXQA 1XTUA 1RXEA 2GESA 3M3HA 3HNRA 3DBLA 4B3BA 2PZLA 1V26A 5EIEA 4WNAB 2O4UX 2BGLA 2G5PA 5AHRA 3TDMA 2Y1WA 4C0BA 4WBNF 3A3YA 1WHSA 2QD3A 3ANXA 2FW9A 3IS3A 3HO8A 4JP8A 1K6MA 4OJMX 5TT0A 1VLJA 4RHEA 4LC9A 3OQJA 4BWVA 4AZ0B 4FJ0A 3I28A 3QKSA 4JYZA 3AIMA 3I9V1 1TU3A 1Z28A 4XLZA 3N8HA 4XGNA 2ZBDA 5KKNB 3GJSA 4PINA 4QYWA 3ZKAA 1DAHA 1ZL0A 3CBGA 4G0NA 2ZUEA 2Q6OA 3T0IA 1ST3A 2NU8B 1ZMBA 2EW2A 4OBXA 4BNHA 1UM9B 2J30A 1I7NA 3AOGA 3IT0A 1RI3A 1I9CA 1QIMA 3REOA 3WLFA 1DMSA 3JRNA 2AC4A 2L18A 1IZ9A 4HWKA 1WXEA 1C0EA 2Q6VA 4C5AA 1GTG1 2PUVA 2QTAA 3QUBA 3EVNA 3Q7PA 4KG7A 2QJOA 3IURA 3VU0A 2E4ZA 2FPKA 1THGA 2PUBA 4J4HA 4PS0A 3U17A 4LQ4A 4C78A 1N6NA 4YMVA 5F7OA 5IN5A 3FY4A 3E2PA 3EGIA 8LDHA 2RH8A 5BVHA 1NMQA 1NSYA 5EMHA 3A6HA 3DBLB 5AIAA 4LV6A 3UXMA 2JJ1D 3VR4H 1Q7CA 5LMNB 5LA6A 5ILOA 4YCCA 3RVRA 3DBHA 1WHSB 3R0IA 3I3OA 2ZUTA 5A4IS 4X64B 4L5CA 3CURA 2V7TA 2O1EA 4HDKB 1XL1A 5ENDA 3M4ZA 4ECEA 1YB1A 2O7QA 3LBIA 2CCJA 4OHWA 3S2EA 4F5ZA 4FWTA 1T6XA 2A9PA 1MZPA 3O6VA 2GZAA 3FMGA 2HBRA 4CQMB 5KOYA 3AILA 3U6KA 1YD7A 3A2NA 1SY7A 2OXIA 2DRIA 1GZSA 2HOQA 1GM5A 4ALIA 3VA7A 1D4AA 3UJAA 2YNMC 3F96A 3GLUA 4H59A 1IUPA 5DF1A 1F9AA 5I9IA 1NNI1 3U09A 3PQ5A 3AHCA 2JI9A 5DE3A 4DV2B 3EFOB 3S6JA 1A2OA 1C3JA 1UWLA 2MSKA 3A9WA 2I2XB 4A0HA 4HQLA 4RJLA 4ZI5A 4AY3A 1Z2OX 1HEUA 4A8TA 4Q05A 4F9GA 4ZKDA 3RROA 1ZJYA 4ZHSA 2OCBA 4NU5A 3GCXA 5BVHB 1QAQA 3ZWAA 4BUCA 2F43A 4ZZIA 2P5UA 5JLAA 1JFVA 5EJFA 2AG5A 4C29A 5LA6B 4RK0A 4S2UA 3BWDD 1TC1A 4JI6B 1JBQA 4BGVA 4YH1A 4JFRA 4R81A 2VLBA 3MCZA 3IOBA 3RGGA 3UCXA 3QWIA 4DAEA 3TD2A 1U02A 1KI3A 2B37A 3PUKA 2JHAA 3M9LA 4J7CA 2HF2A 4F2GA 4PN3A 4LZPA 4X6YA 3W8NA 3FPEA 3H1TA 1JX6A 1SHJA 2JCXA 3FHJA 3KAPA 4JLPA 4WN3A 3TTWA 2RAPA 4M8LA 5K2OA 1E2UA 3E6AA 4KFCA 1PYOA 3MSCA 1UXOA 3KKOA 3M6FA 1KDOA 3U61B 3KKKA 4FCWA 4NARA 5A0TA 1PK8A 1D7AA 3K2EA 2P5YA 4EHKA 1Q2UA 5HZGA 1LZKA 4RIFA 4TWBA 1IN5A 3TECE 1Z34A 1X38A 1R5BA 1SKQA 4XDZA 1SXJA 2O0MA 3ELWA 3I1YA 3HGQA 4XOUA 3KAJA 3S40A 3ZEIA 3QH4A 1MEOA 3PGXA 4EY6A 1I80A 4CGYA 4W5QA 3IE2A 4MTLA 1VJTA 3IAUA 4DL9A 3OE5A 2OXEA 3H4TA 4G0PA 4YPVA 2OA0A 4N0MA 3RAJA 4H60A 2J4DA 1ZVQA 5EFZA 3EEBA 4IINA 5I9BA 1CR4A 3T4PA 1L4MA 5HMLA 3ZBTA 2V0CA 3W7BA 4UJ5A 4WMLA 1SA0A 1ZOPA 2Z8ZA 4ASUD 1E1RA 1L9XA 5EZQA 3GRYA 2F43B 2FH5B 1SUFA 5E6UB 4TYNA 3RSSA 1XJ5A 1BMFD 3SLRA 1CPYA 2OECA 4P7GA 4X20A 4GI2A 1W19A 1JEQA 3MRTA 5K5EA 1XK6A 3NV7A 1Y98A 4AN4A 1Y9JA 4GO1A 4HXFB 1J90A 3WHPA 4A6EA 4Q12A 3W5UA 3CNLA 2W2TA 3HVKA 3RKRA 4DRZA 2TSYB 3WBKA 2YQZA 3IP1A 3ILHA 4EG5A 9ABPA 2V9ZA 4DA4A 4MPTA 4GG1A 5FBZA 4AWAA 1B8VA 1X9GA 3JTEA 5HFAA 3V55A 5FOSA 3PJFA 4B3HA 3F78A 4MX8A 5CDFE 2D3WA 1Y6ZA 3OCVA 3QE2A 1B6RA 5CURA 3CGWA 3G0BA 4XIGS 3GWZA 4ZO4A 4CM4A 1JDUA 4GKKB 2QVLA 1SXJB 2XUZA 3AOEC 3RQSA 1ZLYA 3QYPA 1AUOA 1F48A 4ZOEA 4LZAA 3BB3A 5BURA 3MLEA 1UJBA 2BFCA 4FSHA 1PR9A 4ODIA 1GA6A 3NBMA 3VPGA 1G41A 2A1UA 1F1JA 3RWBA 3OFVA 1GYPA 1U2DA 3LX8A 1BXRA 4GR9A 5CM2Z 1YMUA 2Z0MA 3OC6A 3SNKA 3WK7A 1I2BA 4NEGA 4EHHA 1QGUA 3CYFA 4DAOA 1ZBQA 4IDOA 4GZMA 1YRHA 4RH0A 3WKCA 5LZ8A 5EJ4A 1TT7A 1QFJA 2V8OA 2XVYA 2VFAA 2IITA 4TUYA 3BN3A 3LKZA 1TI7A 1TX4B 5KC9A 3MJDA 2XUHA 1B00A 1R8JA 3MWYW 5J59A 2IF2A 5DSZA 5CFLA 4O3MA 4Q24A 4X20B 4B0OA 1KR2A 1JEQB 4NWIA 5D5PA 2M1XA 4M2LA 2VF2A 3NTQA 2PH5A 3E0XA 3R3ZA 2LR0A 3SGLA 5KNDA 3TLCA 4OP1A 5G4LA 2HMSA 4W5RA 1BEZA 5KAMA 4M9ZA 3VNRA 4BVAA 2FPIA 2FXVA 4JJIA 3GZ4A 4JL5A 2HSWA 2ZRCA 1OHHA 1Z6AA 3KZVA 3WMEA 3TLAA 4EUFA 4HVCA 2P67A 3Q2OA 4KV9A 1KS9A 4JVNA 3K8OE 1M6VA 3QNMA 4GM4A 3THYA 4GQAA 2OBLA 1MGOA 4CM4B 1CEXA 2GD0A 1TZBA 4MJ7A 1K5GA 2PH1A 1MTOA 5JMWA 4ER7A 3NKFA 1XPUA 5IM4F 2FOXA 1DADA 3D0OA 4BWYA 3CHYA 2X0DA 1VJ5A 2DFTA 4G4IA 1ZIPA 2BFCB 1X2BA 2A9OA 3EH1A 4H6VA 2G07A 4JBLA 2A1UB 3K72B 3FAKA 1RCTE 1XC7A 1BXRB 3CR8A 3PCTA 1O5TA 2W6CX 2OGTA 1QGUB 2NO7A 1TZ2A 3GGOA 3KVYA 2PCLA 3NALA 4Q4JA 3JQ9C 4RABA 1NZDA 4RH3A 5FOWA 4LY6A 5JYBA 4S1PA 3PPIA 1V6AA 3KZNA 3Q3CA 3DOFA 4C87A 4EUNA 4RNDB 4MDYA 1VKOA 2BCJQ 3IEIA 3KQNA 4TWAA 4FDMA 1WQ4A 3B1XA 2Q4RA 5H83A 4RQAA 1JLMA 1YB4A 4LV8B 5I7SA 2XCUA 1Z3CA 4EJSA 1M54A 2YWFA 4P58A 4Y30A 3SC6A 1KI6A 3O5AA 4RVUA 1ZA1A 2P6RA 2I7VA 1JAZA 3F90A 1WPXA 2RK4A 4JLKA 4TZ0A 1GLNA 1MG5A 3FF4A 3LX5A 4G5HA 2FPIB 4IEEA 2UV8A 3TNLA 5IEJA 1P17A 1MPXA 1XYYA 2ZTSA 3LL4A 5HEKA 5AW1A 3RHFA 2VK1A 1N5MA 1R0BA 1Y3BE 2CYCA 1Z0IA 3KJHA 2POQX 2ONYA 4KN9S 5A0VA 4AI6A 1ZU4A 1M6VB 1M34A 4H7HA 3THYB 1XFAA 1QHNA 3NIGB 5A3SA 3RVDA 1GJRA 1TPZA 1Q0TA 1ICEA 2AOVA 2FN4A 1M6WA 4LHEA 1AKTA 3RUAA 1HNNA 2HR1A 1I94B 1ILEA 4LDRA 3ZDEA 5HR5A 2Q6TA 3JYNA 4PZPA 3BGDA 3Q85A 1I2ZA 2RHTA 4TVOA 1Z0ZA 4Q4JB 1QMPA 3I9JA 4QDZA 1LI7A 5K8JB 4EABA 5E2BA 2PT6A 2X9VA 5AK5A 3TM5A 4BQSA 3A2KA 1E0DA 4ZC1A 1P9WA 3KYJB 2IYTA 2QX9A 3QMVA 2QSUA 1LI5A 3KQKA 3NFYA 1GQSA 1PNVA 1Q17A 3EAQA 2JLCA 1QZTA 3MS4A 3VKUA 3VX4A 2PKXA 4JEMA 3ZU4A 3ZE0B 4EYKA 3KB1A 3VR5A 4EJSB 4V1CA 4BQOA 3LY5A 2VRNA 3RUCA 1KI6B 1JEAA 3AR3A 4Q9HA 3UMVA 5HPYB 1ZMTA 2VP9A 3DP9A 1CETA 3MTIA 3WGJA 2IIBA 4X84A 4PPGA 2XT9A 1M1YA 3V2IA 1Z4OA 3P4YA 3ADDA 1OMOA 3JARA 1MLDA 4Y1GA 3R8XA 3DDSA 3L06A 3D54D 8MHTA 4AF7A 3PTAA 3MTAA 2P1DA 3KV1A 1HTBA 2C7GA 1M34B 2BHTA 4IFIA 2IT1A 1JAHA 2XZOA 5G1PA 2GASA 1NBOA 1P0FA 1KARA 3BE5A 3JZFA 1AGNA 1U31A 1X42A 1ZH8A 2N47A 1FJHA 4D81A 4QDUA 4NOLA 2GGSA 1IBLB 4RGQA 2FQ1A 3NNSA 4PLGA 2GN1A 1JFRA 1HETA 1OX4B 1PLLA 4L4SA 4LBVA 4UUQA 1MH9A 3DTVD 2V55B 3ZV3A 4OYRA 3P2IA 4HEA1 5JPCA 3BWBA 4XWKA 5C1BA 4YMIA 4I19A 1JJFA 3JQ8A 4GYWA 4RZHA 3LUPA 4G5GA 2P2DA 3BGWA 1P4SA 1YIAA 4L5AA 2CWWA 1J06A 1RQNA 4YAOA 4E5NA 3RVLA 1KIFA 4BVFA 1POWA 1R74A 1ULSA 2SECE 2VATA 3OA2A 3T3NA 3ECAA 2JG3A 1ZIOA 3DWEX 3LT2A 1A98A 4GOXA 1YR6A 2G28A 2W2NA 2X9NA 3L3BA 4V1CB 3VDXA 4EB8A 4K6GA 2QN8A 2ZTHA 2XJ4A 3IIJA 5GGYA 3IOCA 2O8DA 1JLKA 1U04A 1AKMA 1U9IA 2JFVA 3L1IA 3JD3A 2HHAA 3BGOS 4BZXA 4ZEVA 3VGPA 4H1HA 5FFFA 2V1UA 1M1YB 3NDRA 3NO4A 4FFDA 4INPA 4OXQA 2XOKD 3JARB 3UK7A 4IUYA 1Q74A 4MIYA 3VKGA 3PFKA 2R8EA 1QP8A 5K3EA 4J0FA 2OCDA 1GPAA 1YVRA 4M99A 5CW1A 3KR0A 1YNSA 4G5RA 3UTDA 1VHQA 5J2TF 1E2PA 5B3LA 3GXBA 4AJHA 4G1VA 1PJRA 2F00A 4EGCB 2WM3A 3KWLA 2FSVA 1FXSA 2MYNA 3ROPA 3WL3A 3BZWA 3UWDA 2GJ8A 2BZSA 2J45A 1OFUA 5EUMA 5F1PA 4F9EA 2VDWA 3O8QA 1ULTA 3QLEA 2BFOA 2PSDA 4BQEA 1JHQA 3ISJA 1OXKB 3ORQA 1XNRB 3BG5A 1C30A 3LT5A 3PHBE 5LJLA 1HMPA 4QOEA 5JMPA 3RYFA 2BF4A 4HDRA 4PR3A 4YUAA 1KJQA 1D03A 3QUCA 3CKMA 3N7UA 1KVQA 1YTLA 3GX1A 1TMYA 1Y0BA 1Q3KA 2YJ6A 1SKAA 3NJRA 1M8GA 4QG7A 1WE2A 2BI7A 2C1ZA 3OTGA 2ZM5A 4LYFA 5FBRB 5KVVA 1YZNA 5BYJA 2WZCA 4B79A 2QM7A 5IG2A 3ZDBA 2O2IA 1THTA 3HEBA 4W5JA 2IODA 3TLBA 2O8DB 3IYLW 2Y9PB 4KODA 3BIWA 3RWMB 2WJWA 1YAJA 4BQRA 2X7HA 1HM5A 1N0HA 1NWCA 2FW7A 3L82B 4LE1A 5EZ6B 4BAUA 5HX7A 5KQMA 3VO9A 1NONA 2WWIA 1O6ZA 5MF6A 1ZEJA 4IMPA 3W0LB 5CUQA 4G0YA 1M8JA 3A0RB 3MGGA 2HK7A 4NONA 4C4SA 4QATA 3T7TA 2C59A 1EFAA 3OZCA 4P82A 4Y6PA 3ZN2A 1DAFA 2QN7A 1IPEA 1Y1PA 1E5TA 1NLUA 3PQCA 1DFHA 5JPDA 3AVTA 4JVSB 2IDKA 1T36A 2GHRA 3O8QB 1TCUA 1X70A 4PAWA 3W2HA 5KS2A 2QZJA 3QWHA 4FI3C 1PSDA 1C30B 1IMJA 3OC0A 1IPHA 4EPTA 2H2AA 2IOQA 2V7PA 3O8CA 2C83A 2C4KA 3RYFB 1INLA 2C4VA 3HCOA 1YFJA 4HQFA 4FMPA 5MFZA 3RSOA 1KPIA 1XWFA 1VRWA 1G8PA 6Q21A 4ZT7A 3MF4A 1DJPA 3C3YA 3PI6A 3K2IA 3GRVA 3HVRA 3PF9A 3FDXA 1QIJA 3F4LA 3P52A 4HEHA 2HN9A 3T4XA 4Y2TA 1ZNZA 4L15A 2JFOA 1ZQ9A 4BYMA 1NI3A 4JYCA 1SC1A 3BB4A 3GRFA 2QG9A 1JA0A 1NBAA 1Z5WA 1PFVA 2QYOA 2B99A 3DZHA 4LN1A 4LK3A 1VLZA 4UZFA 2PKQO 2BVNA 3O4JA 3T41A 3IALA 1I7QB 2RGNA 3NKVA 4G5SA 4UTXA 4IV5A 2HV8A 2LBPA 3L7LA 3F6PA 1MZVA 2VOEA 2ZJOA 4KXYA 3HO6A 4DRYA 5K0BA 4RDXA 3DJYA 3L6DA 5CB4F 2NPFA 5DNVA 4I1UA 1JWAB 1RHQA 3WJ2A 4LYDA 1YZ3A 5GONF 1F5NA 2VDPB 2EJTA 1KFBB 3CLSD 4NX2A 3OO0A 2MJLA 2Y1LA 1T36B 4E5PA 2VRCD 3T9CA 3VO8A 1CUJA 4IR7A 5I5GA 5HVNA 3OZBA 5DBIA 1ZM7A 3S1AA 3ADCA 3FETA 1T8RA 3ABRB 4G6ZA 3P26A 1PZGA 2M6LA 4IXNA 4B3MB 2E5FA 2OCXA 2Q99A 4PVCA 1MA3A 1J49A 5JH7F 1QH9A 4I7EA 5AVOA 4DV6B 1I5OA 5IJXA 1ADGA 3I8SA 4ME6A 2CXQA 1P2DA 2NM0A 2V74B 1SRRA 5HF5A 1GYRA 2QE7A 2X15A 3PC4A 1JLLA 1TU4A 1F6BA 3E3NA 4L51A 1XD8A 4WKGA 3U3XA 1R4MA 1L4FA 4N54A 4UAJA 2CZCA 2G5CA 2UKDA 1NVWQ 3UK0A 4RKFA 3KX2A 4PU0A 1L7BA 2MTBA 1E94E 1GCOA 2EZ9A 1Y8AA 4Q4LA 3TINA 4B2IA 4B6EA 2Y1XA 3QWBA 4O3FA 2BY4A 1JL3A 3IVMA 1P1RA 1O0CA 3P20A 3IXQA 2AEJA 1F20A 2JK1A 2Q9BA 4E5MA 2QR3A 2IU6A 1SEVA 1SUCA 1U3FA 3BMOA 4P4GA 4WW0A 1XKQA 5D01A 1LRKA 3U13A 5JPIA 5C8ZA 4LJ7A 4O02B 4RTKA 1NMXA 4DM4A 1NG9A 1AKUA 3OCWA 4ZAYA 3TZBA 4D25A 1SVSA 1FS6A 3FWNA 4US0R 1SVIA 1EAYA 1J8MF 4DB4A 4FQ8A 4LPKA 3VR3D 1NP7A 3OQPA 3JSXA 1ORIA 2GF0A 4CFYA 4MINA 1FX0A 2XNDA 3NYIA 2BGMA 3S1AB 3SZMA 3TDNA 4B7ZA 2IELA 3TAUA 2OAQ1 1W85A 4FEAA 1UBRS 1H2HA 2HBQA 4EMUA 1RZRD 3BH0A 1Z73A 2P4QA 2XLBA 1IB6A 3PXDA 3DMNA 3G7UA 1CRPA 4OJTA 3WGIA 5I8PA 4FZRA 5CXXA 5FBKA 5JNLA 1E2NA 3Q8LA 1A8UA 5JCJA 3PX2A 2W90A 1Z74A 4CODB 3U5ZB 1OOEA 3N9IA 1RAHA 1R4MB 1NKSA 1VA5A 3I04A 3ICWA 4M88A 3OQ1A 3GN2A 2F1JA 1W4BA 5B2FA 4FMDB 2GD2A 4XKJA 3IERA 2Z8YA 3G59A 1OXSC 2QPAA 3RUEA 3WE7A 1Z83A 5JASA 1SXIA 2ZYHA 2AUTA 4DIEA 3WAGA 2XB9A 4J6EA 5KOIA 3WGNA 5BWNA 4CR6A 1PU2A 3L18A 4FYMA 4ND3A 4WQMA 4YRCA 5BPHA 4L57A 1QRUA 5EKDA 2FRXA 2QUJA 3NTXA 2QWXA 4N47A 4LYJA 4F3RA 4YV2A 1X94A 1QVZA 3RS5A 5C35A 2VYVA 2Y2VA 2CV0A 1U7HA 4UU7A 5EJAA 1URPA 1HL3A 4QBGB 1G19A 4BLWA 4J7XA 4TL7A 2G25A 1DC5A 4WI1A 2JARA 4GR5A 1BRTA 3NWEA 4I55F 2QR2A 3CZ5A 5H9VA 1N0WA 4G5YA 4HQRA 5B1YA 3WA6A 1MX1A 2NO4A 1PFQA 3NHUA 5L51A 4CTOA 2I34A 2PRSA 1BWQA 1FX0B 3DL0A 1UFKA 3NBFA 4MQ6A 1JQJC 3HJTA 1O94C 1JHYA 1TD1A 4N6OA 3V1YA 4D8XA 1D4OA 4DCTA 1W85B 2WIJA 4C7VA 2QLLA 3I01A 4L5IA 2A5LA 5JLJA 2W2MA 3C3MA 1SR8A 1C4OA 1GFZA 3CNQS 3LS2A 2JIBA 2KJQA 5AKIA 1E9BA 1N2GA 3O95A 4CDNA 2H4JA 2Z1NA 4YRBA 1E89A 1K6XA 1PSZA 2FEPA 2ZJ2A 4BNMA 2IP1A 4CHTA 1EFLA 2FCAA 4MRAA 1G8GA 1P9LA 2X8BA 3L0DA 1YDGA 4NR0A 3QPAA 4X6LA 5IVIA 5ULLA 1BJKA 4BVJA 3CVWA 1AZWA 2TS1A 1GL7A 3L8CA 1XCJA 3K8ZA 2H52A 3ESCA 4AMGA 1ULHA 1N25A 1JHDA 2FRVA 1H3NA 2NTYC 3KFLA 1EX1A 2GFQA 2ETXA 2X22A 2F3QA 3OSZA 3DOJA 4YP9A 5JIBA 4BASA 1NVKA 1PJTA 3DHNA 1LTHR 1T4BA 3D6JA 3KQPA 1SQ6A 3F6EX 1W0CA 3H5RA 1ZI9A 5BR7A 3RJ5A 3NP9A 1AGRA 5B6JA 1RRPA 1RWBA 4ON9A 1ZXLA 3QLVC 4WLUA 2XUGA 4HNRA 2QAIA 4KBFA 1MB3A 2VKQA 5HTOA 4X61A 5IHPA 3V8NA 4TKVA 1JB1A 1T26A 2RHOA 1GSOA 2YBDA 5TQ2B 1W1WA 2C99A 1HDOA 4YUZA 4L4ZA 2C5SA 1YV9A 3IP9A 3LPAA 4LJ9A 4C04A 1V3TA 5C31A 2VZ0A 2XD9A 3H84A 4B9AA 4ABTA 4C2AA 2IOYA 3F5DA 3QUQA 5ALGA 1N3IA 4L9SA 2RE8A 4F56A 4WBXC 4EVSA 4LXUA 1UBNA 3ZK7A 4W8OA 1UZUA 3QKUA 3SXUA 3UA3A 3Q3HA 4UNPA 1R7RA 3DOIA 4Z1MD 3EFEA 4ARIA 3OPXA 4BFZA 4NYMR 4P08A 4DY6A 4EUSA 3JR3A 2D5IA 4D1YA 4P3NA 2YWHA 3OCJA 3RC7A 4AZVA 3ZLJA 1TYCA 1DKOA 2Q1SA 4P8RA 1HDRA 1F14A 1M8FA 4JLJA 2A0UA 3MYRA 4QBTA 3VYUB 4FEEA 5FL7A 2FRDA 2BFDA 2XF2A 5U1PA 2B7BA 4XVHA 5TRTA 1JDSA 1QV9A 4TMKA 2NMVA 1C81A 3U4IA 1EINA 2VP2A 3CH4B 4JLAA 1HSOA 1K0FA 1XUOA 4O4LF 1ORHA 2DQ4A 3E7FA 1NYLA 1U7DA 4XX1A 5EIOA 2EZ8A 3W3AH 4NY1A 4B85A 3TAXA 3CUUA 2CK3A 2V7XA 1VBNA 3O7WA 3HR7A 4HRVA 4P53A 1FUYB 3MT8A 1YBVA 1SBQA 4FGKA 1GSHA 4PX3A 3RSCA 2HDWA 3DO6A 3EGOA 1IHDA 3U4MA 3NM6B 4O1MA 3TKLA 3UG6A 2G0TA 3U7HB 1EDOA 3WK4A 2C8LA 2ZFUA 4EZIA 5KYTA 4TKVB 1CT9A 5I9TA 3M5PA 1MC5A 5EPEA 3THWA 2XODA 2BDEA 2Z83A 3CUYA 4IEFB 1VJDA 2NSDA 3HY3A 3K20A 1NYQA 5H9WA 5HGJA 1ISRA 5LQAA 3AR9A 1THZA 4DR3B 4DJAA 4RTJA 1T0JB 3SXUB 2ONKA 1L5LA 1O95D 4JMLA 3USZA 3ZGNA 2Y1DA 3VZRA 1RBYA 4ETMA 2WHQA 4OIFA 2PKRA 1RPZA 2I7XA 2RMKA 1KNQA 2CCKA 1JAIA 5DGIA 3USCS 4NQRA 2QT0A 5A5EA 4KBGA 4L95C 4XZ3A 2C1XA 1CZOA 3DFMA 4LSWA 1J2YA 1GPH1 1YQ9A 2AFHE 2E6KA 3H5OA 3K5WA 3L1VA 1ULZA 3LUKA 3DWIA 4IF6A 4IJWA 2PMFA 3F67A 4YXWA 1ZNYA 3ESDA 5M7EA 1NBEA 4KWTA 3IEMA 2RGEA 4DANA 4XIIA 2C4UA 5ADWA 2D0DA 1JKXA 3F3MA 2WVAA 3FFXA 2MMCA 2QQGA 1FDWA 3AB3A 2R86A 1BZYA 5IPFA 1J9EA 4Y2YA 3RYIB 2A9VA 4TLAA 1FP7A 4C22A 4AP6A 4MQEA 3RTAA 1MUUA 2I5PO 5EE1A 3MJ4A 1XZLA 4E3WA 1CY1A 1NXOA 2GB4A 3O73