1LF0A

Crystal structure of rasa59g in the gtp-bound form
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTGGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Transforming protein P21/H-RAS-1
publication title The Structural Basis for the Transition from Ras-GTP to Ras-GDP
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1lf0A00
1Q57A 5C18A 4CEIA 4HZUA 3I32A 1D9XA 5J40A 4ZIRB 5C4MA 2ZE5A 3WRXC 5FTKA 1FNNA 1GP2A 1LV7A 1M6NA 4MRNA 2EFGA 1F2TB 4RD4A 4HDQB 3T1VA 4EPTA 2WAYA 4C0QC 1OJLA 4NBSA 1E2MA 2PCLA 2JJ1D 2O0KA 2QM8A 1E9SA 1TU4A 1NVVQ 4BEJA 5C2JB 4IXMA 1YU9A 1UBFA 2A3RA 4PPFA 3QQ5A 1A82A 4QHTA 2FH5B 1P60A 3OZXA 3IPYA 2DFKB 2NO7A 2QRNA 1CLUA 3CONA 1IHUA 3PENA 2JATA 4LCBA 1ANKA 1U9IA 2OEPA 4BE7B 3KKQA 1ZM4A 1RFLA 5LB2A 4B74A 5FTMA 2Q3HA 4TLBA 4TQAA 2AXPA 4BLQA 3EA0A 3GLHA 3IIKA 2NZJA 1OH5A 221PA 1SVIA 2R44A 4KFTA 1W48A 1LF0A 3ECCA 3ND8A 2C2HA 2ZEJA 1Z3IX 3SJCA 4A8JC 4DLSA 2B92A 4AYXA 3UPUA 1R7RA 3MLEA 3KDSE 3AH8A 3GEHA 1VG0B 2P3SA 4TZ6A 1OXVA 2JAQA 3IIJA 2GCOB 1SULA 1CRPA 1KZGB 3PEVA 1KSJA 2ZYTX 4NCIA 4TLEA 2YV5A 4TWZA 3FHCB 4PO1A 3TE6A 4BFZA 4YMUA 1QZXA 5DNYB 2ZVQX 3MRSA 4NTZA 2DWPA 3SEAA 3IHWA 1E79D 3AP2A 1OXTA 2AKAB 4NZYA 4Q21A 2MSDB 3FKSD 1XXHB 2DYKA 3KFVA 3AVVA 3PEWA 4LYFA 721PA 1F2UA 4BLRA 3IBYA 5TMPA 3ONWA 3SYLA 2MSEB 3SYKA 2JASA 2GA8A 5JWRA 1T6NA 4RZUA 5KSYA 1EESA 1P75A 1EFHA 2FPLA 5E4FA 3Q5DA 1J99A 1W36D 3K09C 2G1KA 5FOWA 2JA1A 2IBMA 3IILA 5F9FA 3OIUA 4EQ6B 1KO8A 1AIPA 1AK2A 3CM0A 4L5BA 3RRMA 5J4KA 1ELOA 1SKYB 4HEJA 5A0FA 2H7VA 4RFSB 3L0OA 3S1AB 5FPSA 3BH0A 1EFUA 2OUKA 4EUNA 2FPKA 4WZBE 4GT1A 2QN6A 3RS3A 2D2FA 1Z6GA 3LWNA 4C7OB 2YJTD 2H92A 2VTKA 3MFYA 4ZDJA 1GL9B 1W44A 1Z22A 4MA4A 4LZZA 3UMSA 2YHSA 3M0EA 2FWRA 2OLKA 3KKOA 3MG9A 5E7IA 4W5JA 3TUJC 4LBYA 4A92A 5B2ZA 2DPXA 1KO5A 3Q8XB 3VU9A 3CKLA 3MWLA 5J4HA 4DSTA 4IFEA 4Q4LA 3H1TA 3FWYA 2WWGA 1DARA 5E7MA 1XTSA 5FOTA 1E3MA 1OYWA 1DVRA 5HKKD 3TIFA 4D81A 2J7PD 4LPKA 4QNRA 1PV4A 4HDCA 2KWIA 2HXYA 3KXLA 2FSIA 2REOA 1KI8A 1TX4B 3OFNA 3OAAD 2VBCA 4A2PA 2IS4A 4RD0A 1GSIA 2AD5A 1G6HA 1S3GA 2QBYA 2JJ8A 1X6VA 4JLJA 4A4DA 1LS1A 1Z6AA 2FJUA 4WW0A 3BBPA 2J1LA 4FXPA 4DEXA 5B64A 4OI0A 1GRQA 3SZRA 4Q9IA 4KSCA 5FTNA 1XD9A 3IO3A 2CXXA 4AG5A 4DCUA 1EFRD 2VHJA 1KZ7B 2CLDX 3FDIA 3FMPB 5JWHA 2GK7A 4XSGA 4B75A 1N5KA 3QPUA 1KI6A 3X1YA 1LW7A 2EFEB 4TL8A 1VG9B 1P6XA 4II7A 3EZFA 2LKDA 1OFHA 4B44A 1MR3F 4AI6A 5KOYA 4C0AC 1KJYA 4D4JA 1X3SA 1K5GA 4P3YA 5DHFA 2W6ID 2GZDA 2WPDD 4E09A 1VDZA 4A36A 4LJYA 2ZJZA 4DUGD 1D8TA 3NBFA 1G3UA 2JCSA 5FFMA 2CEAA 1SQ5A 4NL4H 1KMQA 1Q3HA 4KVGA 4TL6A 3X1ZA 2WSSD 5D3QA 5LD2C 3KKPA 3MWJA 3QG1A 3CX8A 4Q01A 2IUTA 2A5GA 3T35A 5AUOB 1H8HA 1XDBA 1T8UA 4YLGA 5JMTA 4BZPA 2ORIA 5TARA 2ERXA 2OZEA 4Q02A 1G9XA 5D3MB 4TYWA 1GITA 4JL8A 5IDVA 3AUXA 4WIAA 2CLCX 3KFXA 2XNDA 3T1TA 4V0NA 3C14C 1DO2A 1PJRA 1QVAA 3KJEA 3U4QA 1F48A 4NYIQ 1XMVA 1A1VA 3IIMA 3QBVA 4TL9A 1EFCA 2WBLC 3TLXA 2G9NA 5FPYA 1YZQA 4J0QA 3H4MA 4A0GA 2OM2A 2ZS7A 2ZJ8A 3C8UA 4O3MA 2BCGY 2BBSA 1JPNA 1E2EA 1CXZA 8OHMA 2XNSA 3L8YA 5BXQC 2FV8A 3EW9A 4L8GA 4NCNA 1U0HC 1MOZA 1KJWA 1ZIOA 2V55B 1ZD1A 2A5JA 1KSHA 3OF5A 2Q9BA 4PAQA 2XZOA 1WMSA 4P33A 1JR6A 1T0HB 2G0NA 2QM7A 2GWHA 2IXGA 2V54A 3QF4B 5EJEA 1FW6A 1Q21A 1F5NA 1ONBA 4MKIA 2FG5A 4UNSA 3SFVA 3EWAA 1CKEA 2ZUBA 4FMBB 2ZRLA 5CITA 1Z0KA 3NC1C 1O87A 4TMXA 3SHFA 2AX4A 2O8FB 1M8PA 4LHWA 4HLCA 1UM8A 5E95A 3ZVMA 4JBWA 3TK1A 4YXWD 5F3WB 2PZGA 4Q9KA 1YVDA 3R8FA 4QFMA 3QSYA 5DI3B 3NHBA 3O47A 1AKYA 1CU1A 2CHQA 2J46A 2C99A 4ARZB 1JEEA 3AF3A 3GP8A 3BS4A 2OE2A 3I62A 2HYIC 2Q21A 2BM0A 1OT3A 3GLIE 4DEYA 4AWXA 1N6HA 1W5SA 1KYIA 4JLBA 5ELXA 2IEYA 1EFTA 2AHOA 2F9LA 4GOJA 4A6PA 3C5CA 4LC0A 2AR7A 3GPLA 4F4JA 1NLZA 5BN5A 3CR8A 5EZ6B 5G3ZA 2J7KA 3EAQA 1XEXB 3W8RA 2IYYA 4HAYA 4BZXA 5LPNA 1R5OA 2O8CA 3K0FB 5G3YA 1G5RA 1R5NA 5KNBA 1E79A 1KO1A 2BDTA 2OCYC 1Q20A 4OBEA 3THXA 1AS3A 2ZJOA 4PQYA 2VYFA 1BH2A 2P5SA 2ERYA 4PZLA 2QSZA 5K8LA 4LX0A 5FOSA 3AV0B 3C7KA 1E98A 2A5DA 5EP4A 1AQUA 4CEIB 4W9MC 4HZUB 4RCZA 3ADBA 3DMDA 2QP4A 1RRFA 3VAAA 1OKKA 3UG6A 1TF2A 1E9FA 4BASA 2ZE7A 1G5PA 3QVVA 4R98A 3U3JA 1XBTA 4DRZA 2ZRKA 2YINC 5BN4A 3SQWA 2JEOA 2ZI6A 1VECA 5HZHA 4DIDA 3Q5EA 3QNUA 2C77A 4G1UC 2B7BA 5GADl 2GDJA 2OBLA 2BKUA 2AFIE 3ZD6A 4HI0E 4U00A 2VLIA 4JJZA 1ZM2A 3QKUA 1JPJA 3H86A 1HE8B 3IGFA 2QTVB 4B71A 3VTKA 1K6MA 1CR1A 2V4ZA 3GFOA 4TYYA 1CRQA 1OH7A 3BOSA 4HAVA 3WMGA 3SC3A 1SKQA 3OIVA 3OEEA 1XPOA 3KKMA 1HQYE 1U8ZA 3LW7A 4V03A 2JDID 3GLHB 4AKEA 2WKQA 4QHYA 1TU3A 1MH1A 2OFXA 3ZH9B 2OT3B 4AYWA 1UF9A 4P4UA 2WZQA 3FE2A 1AGPA 4Q7JB 1I4LD 5HCIA 2PT7A 1KJZA 3GJ8A 1IN7A 4C0LA 2DBYA 1WB9A 2IF2A 3RS4A 1EG7A 1Z06A 4B3DA 3D6TB 2P6UA 2ODBA 1JBKA 2FFHA 1U8YA 1J7KA 4KLNA 3BB1A 1ZU4A 3BAFA 1GKIA 2ZR9A 4LYHA 4TTQA 4MDFA 2V9PA 2GXQA 3TR0A 4KI0A 2VPPA 3GQBA 1BOFA 5H8WA 4ZDWA 1IXSB 3OAAA 1NBMD 3V9PA 3UMFA 1TAGA 3ICEA 3MWYW 4M53A 4H1VA 2GEVA 2VP2A 1NKTA 1GRRA 3I8XA 1G7SA 3C15C 3B1VA 1N0UA 5E3HA 2BBWA 1FTSA 3RANA 1B23P 4TSFD 2EFHB 4OK5A 1J90A 1E9CA 1KAGA 1ZU5A 3CNLA 2WWHA 3TW4A 3DZ8A 1XEWX 1OF1A 1II8B 1OB5A 3GFTA 5LD2B 1UAAA 4LOAA 1ZP6A 4PPQA 2ZTSA 3BK7A 3KJHA 4QG7A 5FI1B 1PUJA 3I72A 4DIEA 1YR9A 2F1RA 4MRRA 4JYCA 2ORVA 4A0HA 3ADDA 4UXIA 4X8LA 3C41J 1NG9A 1FP6A 1OLOA 1G3MA 4XJXA 3CIOA 5KU1A 5CM8B 4CEJB 1RW4A 3T5DA 3J81k 5FL3A 2QPOA 3LY5A 3TR5A 2P5TB 1W36C 3WMFA 1ZUHA 4DVGA 3BC1A 4Q4JA 1AS0A 3Q72A 1Z83A 3CX7A 3W90A 4LJ7A 1P2VA 5IRCD 4I1OA 5IHPA 1FQKA 3P32A 2WJHA 3VU9B 2XB2A 1FP7A 2JLXA 2J0QA 3DKPA 4DLWA 4QJ5A 3T61A 1VIYA 4UJ5A 2QP3A 4Q9HA 4DSOA 2QTHA 2YOFA 2ZJ2A 3T1OA 3JVVA 4BLTA 4D25A 4CYMA 1H65A 4YDSA 5FI0B 2IYQA 5AJZA 4M1YA 2R9VA 1SVWA 1MRSA 1S1CA 1SXJD 4A2WA 1JAHA 2R65A 4AYTA 4E07A 3KQHA 3RC3A 3PEUA 2BKEA 4EFMA 4PC1A 3B85A 2CK3A 4JT2A 5EUMA 4B48A 4CGZA 1UJ2A 1OH6A 4JLMA 1NI3A 1Z0JA 2P6NA 3M6AA 1ZD8A 2W83A 1W1WA 1M74A 3A4LA 2ZI9A 4GZMA 5FR2A 1QHIA 3FHOA 4KFSA 1NY5A 3B1YA 3I3SR 4URYR 2W2VA 3ZQ6A 1P9NA 1G7CA 2C04A 4A2QA 2D7DA 4LV6A 4LY6A 3T5GA 2NIPA 2IT1A 3JZMA 1EK0A 4FD2A 4F91B 3HWSA 2LWIA 3DPUA 5K8IA 4G01B 4HATA 4Q1CA 5EE5B 3CBQA 3ZGXA 4ZI3A 2WJVA 1KDRA 2IHBA 4MYUA 4B73A 1KI6B 2XJ9A 1G16A 2G1JA 4Q1DA 1KDOA 3ZZUA 5EXPA 4N0EA 1DELA 3NEJA 3CNNA 3N5CA 3TVDA 3MMPA 3HYTA 4HAXA 1GM5A 3GEIA 4PPNA 2ZJYA 1N6RA 2FN4A 4B35A 4P4TA 4RZXA 3RDPA 2PH1A 4XD7D 2Z4SA 1E2NA 1YE8A 4E22A 2YNMA 1T5LA 1P9WA 5KPJA 4AKHA 1M7BA 2DFTA 1LY1A 1VKJA 3AF4A 2Y8EA 1YZUA 4OK6A 4RKEA 1C4OA 4DXAA 1YR7A 4MH0R 5CYOA 2DB3A 5SZHB 2E87A 1N3BA 1E2JA 2HCBA 3UWKA 3U3MA 4JLKA 2GJSA 2RGCA 3QF4A 4QOSA 1HYQA 2DWOA 4RD6A 1GDDA 4Q4HA 4NYMR 4TMVA 1GVNB 3HR7A 1ZAKA 1QHXA 4UKDA 2GILA 1G6OA 4I1SA 1HA3A 4A8JA 2ZRFA 4RD2A 4GOKA 1A2KC 3IQXA 3CPHA 2ZIAA 3VR4A 1VHLA 5AJVB 3SJAA 3A1SA 3R7WA 4EIWA 2NO0A 1R0ZA 1KGDA 3RRNA 4M1KA 2Q6TA 4LI0A 2LCFA 1NIJA 4W5WA 2J0UA 2RGNC 2GF0A 4V0KA 5JFGA 1F3OA 2CLSA 3UKDA 5AJXA 3RSOA 1RVDA 3BJIC 1CEEA 2GNOA 4QBFA 4ARZA 2CMKA 2C9OA 3CLVA 1NLYA 4I1VA 1XCPA 1FX0B 4MITA 3O8DA 5FH9A 2C03A 2MMCA 3DEFA 1E4VA 2BC9A 4JVLA 2FSFA 2QMHA 4ABYA 4BPBA 2PMKA 1N6NA 3T12A 2WJGA 3U61B 2A2ZA 4NYJR 2FDCA 2L0XA 5FBVB 1A4RA 2ZRIA 3AVPA 5CM9C 5FBWB 2RCNA 4N0DA 1ZUNB 2OG2A 2IXFA 1PVOA 2GVZC 2DWQA 4JLAA 1TMKA 4KSBA 1YKSA 1HUQA 4M9QA 3Q7QA 5GJVC 5JECA 3VQTA 2IYXA 1OIVA 4AG6A 4R71A 2QEQA 2V7QA 3PUWA 3IBGA 3NKVA 5DYIA 3A58B 5KYKA 1X8JA 1XU4A 2RHMA 3P1JA 1P4SA 2CBZA 4HLUA 3ZDQA 3KB2A 1ZCAA 3D3QA 2QGZA 5TXGA 3FFAA 1TL7C 3OESA 2V3CC 3A1WA 3WBJA 4CT5A 3QPVA 1VCNA 4UNQA 1W0JD 2J9RA 2QZ4A 2RGEA 4JLNA 1WDTA 1G4AE 1P5ZB 5JSZA 3EPHA 3LLMA 4S2EA 2EYQA 4DB4A 3THYA 5JHGB 2BVNA 4XWOA 2ZU6A 2O8CB 3SBDA 3WNCA 4KCGA 1VCMA 5DGXA 3K70D 3UXMA 2BBTA 2H18A 1U81A 1E4YA 2EYUA 3D7MA 2WKPA 4O2LA 3RWMB 3THXB 3SI7A 1I4TD 2DFLA 4FMCB 5J4VA 4WOPA 1GNRA 4LHXA 3AGQA 3NIBA 4JVSB 1KI1A 1SHZA 3IPXA 3DZDA 2EW1A 3DHWC 3ZZTA 2PT5A 3B1ZA 5TDHA 4IVQA 1XEFA 2WVJA 4FW9A 5FR1A 5AJWA 1CR4A 4K46A 1W36B 2ZS9A 3CF6R 4JKYA 4HAWA 1TTTA 3B13B 4BRUA 2QE7D 1SGWA 1T91A 2BEKA 2IYWA 1VYTA 2VP4A 3W6NA 4OHYA 1KNQA 2NO1A 2VP5A 3PITA 1DADA 1J8YF 4PHFA 4MYTA 4C4PA 5FL7D 4LBZA 2J0VA 1CP2A 1R5BA 1L2TA 1U98A 3X2SA 2O0JA 4TQUS 2GEUA 2ZE8A 1UDWA 1G3IA 2A5FA 2FEMA 4MYHA 2Z43A 4EPYA 4OQFA 4CRWB 1NJGA 2GHIA 4DCTA 4US1R 3PV0A 3BH6A 3HYRA 3PCRB 2JLZA 2YWFA 4EJSC 2B6HA 2QT0A 1OHHA 4LBVA 2CCJA 2GZAA 1AN0A 2ONJA 2ZUDA 4OQLA 2GJAA 2ZM5A 1YZKA 2ONKA 1DAMA 1VYVA 2YWHA 3AF1A 2IA5A 4GL2A 1COWD 2IK8A 2ZETA 2P67A 3QKSA 3THWB 3LAWA 1NVVR 3MD0A 4GP6A 4UXJA 1SVLA 3K1JA 1OSNA 4V02A 1NN1A 2ZS8A 5SZIA 3T34A 3AM1A 4HB0A 5KDDA 1SHKA 2ZI5A 4P0TA 5FBQB 1TF5A 4C9BA 5FUXA 1E9AA 3U2QA 1II8A 4QGGA 2GXAA 5DIFA 4AIIA 4ON9A 3JVUA 2QSYA 1Z0IA 4BFXA 1CULC 2IC5A 4IDHA 3EPKA 1YRAA 3OEHD 5CDFE 3PUYA 2NTYC 4Z1MD 5KSZA 2IXEA 4HB4A 2JIZA 4QJ4A 4HLUC 3FGNA 1J8MF 3TUIC 2ZRDA 1IN5A 5A4JA 1E99A 1T5IA 4CEJA 4R2IA 3KUDA 4MDEA 1DG3A 1P7CA 3NH6A 2F3RA 2ZROA 1PUIA 2FOLA 1JQLB 1NVXQ 4X8HA 2ZI7A 4DLXA 2OXRA 1MO5A 4QXAA 1XF9A 1QHSA 2VH5R 4LBWA 2IS2A 2GXUA 1W2HA 2B8TA 5IK2A 1W0KA 1Q0UA 2C8VA 2Z4RA 3LH5A 4F4IA 2IX3A 3BFVA 3TRFA 1I4DD 2D06A 5A5GA 2ZSDA 1BS1A 5M04A 1UBGA 1YZTA 3OHMA 3P26A 5FUWA 4KODA 1Q1BA 4TLAA 4Q03A 2ZYVX 5BYKA 2CE7A 2G88A 1YZGA 3NH9A 4Q47A 5DH9A 1LNZA 5FOUA 5KUTA 3CX6A 3OIWA 4OHVA 5CJPA 1NBME 4Q4JB 4WZ6A 3RNLA 1KO7A 2PL3A 2QP9X 5F9HA 4TLCA 1X8KA 1DAFA 2E9SA 3V4RA 1OFUX 3EIHA 4B3BA 2HXSA 4OI1A 2VA8A 1KTVA 2H17A 1U99A 3LQRA 2BJVA 2FPMA 2ZSAA 3OE7A 2RKOA 2D62A 4TT3A 4XSHA 3CRW1 2FFBA 4MRSA 2D3WA 4OQNA 2X8AA 3HDTA 4OHWA 1WBDA 1RRGA 4D4KA 3VKWA 3ASZA 1HT1E 2C78A 4M22A 1JAIA 4URVR 4G5QA 3L43A 3P4XA 1P61B 3NC0C 4DBLC 4DHEA 2J87A 2F1HA 2NQ2C 2AK3A 4US2R 1ZW6A 4EPWA 3F3YA 2D2EA 1KOFA 2RGDA 4EKDA 1G291 3TAHA 1W4BA 4GPTA 1MO6A 2OAQ1 1IBRA 1S8FA 5JS8A 5G40A 2MMGA 2UVQA 2VQSA 1GOTA 3AVOA 1G1MA 4HYYA 2GJKA 1WP9A 4Q00A 3TQCA 1UFQA 1UBCA 1XJCA 2HEIA 2IYVA 5K8TA 2ODWA 4Q4AA 1XTIA 2YWGA 1AZSC 1Z07A 1Z6XA 2N46A 4AD8A 1YZLA 3B1XA 3GFPA 2QL6A 3A1TA 5DN6A 3TKLA 3EZ9A 3U60B 4ZCIA 2F43A 5B57C 1LF5A 1E1QD 1SXJC 1N6OA 3BIFA 3I73A 1R8QA 1I2MA 2ZRJA 3NWJA 4D2IA 1DS6A 3FHTA 2WICA 1TUIA 4KV9A 1KDTA 5G53C 3RHFA 3WNBA 1E2PA 3DM9B 1KAOA 2H16A 4A1FA 1R8SA 2JLVA 2FSHA 3KQNA 3QKTA 2CNWD 2VSFA 1SXJE 2G6BA 3EXAA 2YKGA 5GJBA 2I1VB 1QRAA 1KKLA 5BYJA 1Z8FA 4R7ZA 2IL1A 4LHVA 3CUEF 5JZVA 4ZKEA 3ZVNA 4K8OA 4QBHA 3RS0A 1N5LA 2OXCA 4JZKA 5BWMA 3KTAA 1CIPA 3REFA 1JR3D 4ASUA 1M34E 3GJ7A 3GJ3A 4CW7A 4M9SA 2NMVA 2IYSA 3WP1B 4CEHA 3DVLA 4BLSA 4IXNA 3MJHA 3QY0A 4WAUA 2ZQ5A 4AURA 1FX0A 2KI5A 4KYUA 4Q4HB 2QORA 3LA6A 2HF9A 3UWOA 1C1YA 1NL3A 2WWIA 2WKRA 5F98A 2JJ1A 2XOKD 1Q1QA 3QI2A 4A8JB 2RGXA 4C0HA 3AUYA 4JBXA 2IS6A 2VP9A 1XRJA 2DHRA 3TBKA 1N25A 3R7WB 3PFIA 4BEBA 2IF0A 3EIEA 4ZCLA 2OFWA 4G3XA 2W6JD 3CH4B 3GJ0A 4JVNA 4HAUA 4ZPXA 3NVAA 2J0UB 5FTJA 2R8RA 5TVKA 2JLSA 2BWJA 5BQ5A 1T3SA 4ACAA 1NIPA 3R9IA 1O3YA 1TEXA 1XPRA 3CW2A 4A9AA 2OBNA 1CR0A 1E2FA 4XIGS 3ZS8A 1KK0A 1MRNA 2QE7A 1Z6TA 3R9XA 3PEYA 4JLDA 2B8WA 4LDJA 4NYIR 2V1XA 3HR8A 4IDNA 3RRZA 4NCKA 4RJLA 3B60A 5C4GB 2BMJA 2NPFA 3PUZA 1L8QA 4CVNA 1EX6A 2FA9A 4JLPA 3V4FA 3QOFA 4RKFA 2PCJA 2QPTA 3N2IA 4RZ3A 4CIDA 4URWR 1XFAA 1OIWA 2YWEA 4FWIB 3SN6A 3TQFA 5KNCA 1E2DA 4U5XA 4WXRA 3MWKA 4OKSA 1NVUQ 1KY2A 1HE1C 3LQQA 5FPTA 1E9RA 3WYAA 5L3VA 2VHTA 1E9BA 421PA 3R9WA 1S9DA 1W5TA 1ZIPA 4DJTA 3FKSA 2D7CA 4QGHA 1CJUC 3ZIAD 3REGA 1OPXA 1IN6A 2QT1A 4IVPA 3AP3A 1FL9A 1BYIA 2FFQA 2I4IA 3UIEA 1ZNZA 5KNDA 4V0LA 2KBFA 5JSZB 3THYB 4IJMA 4NMMA 3MSXA 4OI2A 3W5JA 3LD9A 1T3LA 4MUAA 4PXAA 2X2FA 2VEDA 3BE4A 1F60A 3GLIA 2YZ2A 1Q3TA 2REXB 2AL7A 3VHLB 2GTPA 1N0VC 1RJ9A 3FB4A 4EPXA 5IF9A 4Q7LA 2FMXA 5IT5A 2NG1A 2VHUA 4FN5A 4KFUA 3SU8A 4B3FX 1CBUA 1YQTA 4JL6A 1UKEA 3FFBA 4BLOA 2JLWA 3SJZA 1W7AA 2QMUA 2FZ4A 3IHLA 2OBMA 3K0SA 4A0FA 4GSYA 4KJZA 3X1XA 1OXUA 1H8ED 1NVWQ 2H1LA 4LJ9A 3K9HA 2WHXA 4PSKA 4L9WA 4QKQA 2O0HA 3AQ4A 2ECKA 2WV9A 4H9GA 4DC9A 3H0KA 4IW3B 4DLTA 3THWA 3K70C 1BMFD 4IHQA 3VR1A 2XGJA 3WP0A 1JECA 2IYZA 3KJGA 5HE8A 2FGJA 4KLZA 4O2RA 3U44A 3AKEA 1RRCA 2OCAA 2C9YA 3EA5A 3DMNA 2JLQA 2IWHA 3BB4A 5HKKA 3A4MA 3SJBA 1G4UR 1EXMA 1W4RA 3GLGE 2X1VA 1XTJA 2J7PA 4C3ZA 2HT1A 2CVFA 5GVRA 5AUNB 2R2AA 2UZIR 2ZJAA 3FPAA 1NSTA 4PSVA 2JLRA 1Z08A 1Q1ZA 2F1IA 2AKYA 2F1JA 2XEXA 3QXXA 5HPYB 3X1WA 3E70C 2GETA 1XJQA 3K0CC 1FQJA 3QKSB 2XXAA 4I99A 2CVHA 1ZJ6A 2OCPA 2UKDA 3ND9A 1OB2A 2ZI3A 4FMCF 2W0MA 4RY2A 3LLUA 4FWTA 1PLKA 1QHHA 2FX3A 4HUTA 2O8BB 4OJKA 1EFRA 4Z51A 5LDDC 5L3QA 1E1RD 4POAA 3TAUA 2BMDA 3PJRA 3B8HA 2P2LA 2O8DA 2HJGA 3U3RA 5B58C 4DLRA 3HU3A 4Q1EA 1RYHA 1MO3A 1T9HA 3QXHA 5FBRB 1YJ5A 4B34A 4LJAA 2GCNA 3P4YA 4EDHA 3B5JA 1N6KA 3VKHA 1CJTC 3EC2A 4LWZA 5EP2A 3IQWA 2DY1A 4MRPA 3TUZC 1OH8A 1P9RA 4PSAA 5HR5A 2Q0HA 1V5WA 2W6IA 2WPDA 4MGYR 4TMWA 1CS4C 1CJKC 4US0R 2WWXA 5JJLA 4G0NA 4QM6A 2V1UA 2ZAOA 2UZ3A 1G64A 1IY2A 2GJ8A 1P2UA 2RGBA 2XTZA 2Z6VA 2YC2C 4DT1A 2IYLD 3LFUA 4DUGA 1SZPA 2A5YB 2XB4A 3EC1A 3NEYA 2QQ0A 2WSSA 3GLFE 3BWDD 4K81B 1TADA 2E1RA 3AP1A 4LHZA 1KDPA 4DB2A 4KXFB 2RGNA 3QBTA 4V0OA 1NG1A 4W5HA 1AKEA 3W6OA 1W2GA 4A0RA 3U7FB 4C2TA 2HCJB 2Q3FA 1KHTA 4P32A 2FFAA 2Z5FA 2GBLC 3QXJA 1EWRA 1QG2A 3LX5A 2EVWX 1WCV1 5FBLB 1RC8A 1GL6A 1WBBA 3FMOB 1E9DA 3DDCA 3A1UA 4OQMA 2BHRA 2O52A 2ZPTX 1KI3A 1XJ0A 4Z8XA 5J47A 1VG8A 4OL0A 1LFDB 4HSEA 1UKYA 5JI3E 2P65A 3I61A 1Q12A 1WQ1R 3BGWA 4F93B 1P2TA 3RSLA 2W2XA 3I5XA 5KO2A 5L8VA 5JJIA 3B9PA 4PO9A 4DSNA 1FNMA 1X86B 1NN0A 4DCNA 4TYPA 2ZR7A 3NDBB 2WMNB 3O8CA 1QG4A 1N6IA 1IONA 4MQBA 4TMKA 4RD1A 4EAQA 5FPKA 3B82A 2IUUA 4XTRA 5L3RA 4DCSA 2CL6X 1W47A 4YC7A 3HP1A 3BRWD 5DI9A 2ZSFA 5TB5A 4L16A 3U3OA 1XWIA 1HT2E 1ZNWA 2ORWA 4PX9A 4BGDA 2XOKA 4KFRA 2NPIA 3WMEA 1RZ3A 3OIYA 4MKFA 2ZJ5A 4IOLA 1L7VC 1R0YA 4TN1A 2LKCA 3K0AA 4NYMQ 1E2LA 1ESMA 4M21A 4WA7A 4YXWA 3RVBA 2J59A 3KUCA 4XTCS 2CCKA 1Q22A 1ZC3A 1XXHE 1G8HA 1IJFA 2ZJBA 4TL7A 4Q4AB 1KNXA 1NMXA 2XX3A 4B43A 5FUYA 2X77A 2PZEA 2F43B 3KB1A 4Y0VA 1BYUA 4NCJA 4ILEA 5G41A 4D4LA 4AKGA 2OFOA 2R62A 1P2SA 2BV3A 4Q48A 4UXHA 2XJ4A 2HDNB 1PLJA 1XPUA 2G3YA 1Q1EA 5FUVA 2Q3MA 5CB6A 1SKYE 4JIMA 2P0EA 1U8AA 3N2EA 2ATVA 3AF0A 1VCOA 2I3BA 3HJNA 1DBSA 1ZNYA 3K9GA 5LBIA 3SDZA 3CH5A 3OFND 2J5XA 3AVXA 4NYJQ 3C4JA 4BFYA 4OYHA 4DWJA 4DLZA 4FMDB 5JRZA 3IO5A 4DLUA 1KSGA 3D31A 2XSZD 1DEKA 3T1QA 1T3HA 3ASYA 1E0KA 3KTAB 4E5UA 3RABA 3FMFA 1VHTA 1AM4D 3VNUA 1DPFA 3CF2A 5DISB 5EZ5A 4I81A 3AEZA 4BFVA 4KHZA 3I1FA 3DKVA 2VO1A 4EPRA 3LXXA 1AQYA 4EJSA 3I4LA 5KPDA 4CEHB 1ZNXA 1U90A 4AKIA 1FOEB 4ITRC 2ZANA 1L4YA 3I92A 5DO9A 2R6FA 1S2MA 4DDTA 2EU8A 3FYHA 1I2DA 1IJEA 1J2JA 1R4AA 1G8PA 2IW3A 3GJXC 4LJ4A 2AXNA 1VPLA 1ZYUA 3FMIA 1KK2A 1W46A 2KBEA 1W4CA 1CJVC 5JJKA 3WRYC 3IUYA 4ZV4A 2W00A 2TMKA 5CDFA 1XCMA 2PX3A 3P27A 1G8YA 4W7SA 2ZVPX 4GNKA 2ZRBA 3EWSA 4B32A 4G5GA 4URXR 2JLYA 1M1YE 3GMTA 1KKMA 4M4SA 4OQXA 3QKRA 1ZM9A 1QVRA 4EFLA 3LBHA 4YQFA 1HY3A 3CR7A 1MV5A 4Q1AA 1NMZA 1JR3E 1H8HD 1YZNA 4QGFA 4CZ2A 1GG2A 2EWWA 1TQ4A 2JDIA 4P31A 2CE2X 4ZKDA 1GILA 1AA9A 4LV5B 4MYCA 2DR3A 2X19A 4YMTA 5KDOA 1XTKA 4PZYA 3CB4A 1OFTA 1R6BX 2ZREA 4LUCA 4Y0AA 4TYNA 4IRUB 2ZRHA 4ZO4A 2OAP1 2Z83A 1T0JB 2F7SA 3EZ7A 4D0NA 3MCAA 2F6RA 4PHHA 4IDOA 1OW3B 2KE5A 4URZR 5AWFC 1M7HA 4NH0A 3Q85A 4KAXA 5EXSA 4BFTA 2BCJQ 1NBMA 3M1IA 5KSOA 4HAZA 3NBXX 2KJQA 1NKSA 3BERA 4B2LA 4KITB 2A7QA 1BKDR 2HJVA 3PR1A 4M2LA 3VR5A 3RS2A 5L3SB 3AKYA 2JJ2D 3GLFB 2C98A 2CDNA 2QU8A 3PG5A 4HB2A 4PR0A 5J4YA 2ANBA 3FTQA 4TSFA 4Q9JA 2R6CA 4QGAA 4U02A 4DDWA 1D6JA 2B7CA 1QHYA 1ZINA 1R0WA 4WZAE 4C0JA 3F8TA 2NOAA 1E1RA 1JXMA 1CTQA 1MO4A 1N5JA 3QUSA 2QMOA 3GLIB 2PBRA 3CRMA 2WIBA 1RJ9B 1QHNA 2X2EA 1E9EA 4IKEA 5H1YA 1KO4A 4DZZA 4X8MA 3KQLA 1DTSA 1K8RA 4Q5IA 1S0UA 4GFDA 1JB1A 2QTFA 1PLLA 1KMHB 4QBIA 1GL7A 4HLQB 5J5CA 3FOZA 1XB2A 2WIAA 3CRQA 1ZC4A 4NKRA 2C96A 4KVAA 4P4SA 3O8RA 1TQ6A 1D2MA 2RGAA 2QAGC 4I1UA 2DFNA 2B21A 4NPHA 4PHTA 3W3AA 1SVOA 3CO5A 3I8SA 1CF4A 4UNNA 3Q3JB 1G8FA 3SHWA 2F3TA 4M1MA 3U44B 1BIFA 2YYZA 3KQUA 3LRPA 3ZYCA 4F92B 4U7DA 2O8BA 1KY3A 5BW8A 4PAOA 4LJ6A 2R6GA 1FZQA 1SXJA 3H2YA 3E2IA 1R10A 3B9QA 1FMLA 1WRBA 5KSPA 1BO6A 3MJRA 5EQTA 5SZKB 4DDUA 4WXPA 3WYFA 2XAUA 2ZI4A 3H84A 3FKQA 4YDHB 4DCVA 1HTWA 2NO6A 3DO6A 1OXSC 4LSGA 2GKSA 4GP7A 2IYRA 4TQ9A 5K8UA 4B76A 1G21E 1Y3AA 4AK9A 4FCWA 2XXAB 1OKKD 4B3CA 3U7GA 4KYIB 1SVSA 4Q7MB 1XX6A 4LC1A 4RD3A 2ZAMA 1QDEA 4G5RA 4PQRA 1VMAA 1JQJC 1QHHB 3WY9A 1XTQA 2ZUCA 2I1QA 4GOXA 1ZRHA 5EE1A 3TSOA 3AVTA 5L3QB 1S4QA 4DLYA 2QY9A 2PJZA 5EE0A 2J3EA 2J45A 3TSWA 2O8DB 3VKGA 1ESNA 2QMEA 3GEEA 5LB4A 2FF7A 1KI4A 1ZM7A 2C9CA 1OYYA 4IOMA 4TTPA 4BFWA 2VHCA 1MABA 5J4LA 1Z6YA 4MKGA 3W5IA 4FI3C 4G5SA 3LDAA 1G3RA 1U0JA 3O8BA 1UKVY 1UPTA 3K0EA 3OEED 4B3XA 1UDXA 2VHQA 3W6PA 5ANRB 1NF3A 3NBYC 1RIFA 4BQSA 4V0ME 5SZJA 2FEOA 4WBSA 4C0BA 4DT1B 4XD7A 4XOIA 1DOAA 2YVUA 2WJYA 3CZQA 5EUQB 1IY1A 1M2OB 4MUBA 4OHXA 2H5EA 2O8EB 1LB1B 4PC7A 4B2PA 1ZM3A 4XVRA 1G7TA 3QF7A 4PANA 1JJ7A 2CJWB 3L0PA 4Q19A 3RC8A 3UK6A 4JLOA 1R2QA 1D2EA 2ZSBA 3NG1A 2D4HA 2W2TA 1U9IC 1NRJB 3ZD7A 2N42A 4D26A 2BM1A 1XD8A 2HLDD 3NTUA 4Q7KA 1E0SA 4JBYA 3UMRA 4PAMA 1WA5A 3EASA 4HDOB 5FOVA 2H8KA 3G82C 3KQKA 1Z2AA 4OJQA 3X1DA 2XSZA 2EWVA 1W4AA 1P3JA 4GI7A 1GRNA 3KJIA 4Z54A 2PLRA 1IAQA 1VTKA 3BB3A 4JVMA 4TMZA 1Y63A 5CIWA 4Q9LA 3WXMA 3GLHE 2F9MA 2WSMA 3EPLA 3LO5A 4LJ5A 4LGMA 4L15A 3BFXA 4HUQA 4KBFA 4YONB 3PVSA 2VSXA 3SOPA 4B33A 4XH9B 5JBQA 2ZRAA 1US8A 1Z29A 1T4GA 2QUZA 3L82B 2PEYA 1U2RA 1X8LA 2QROA 2ZR0A 1IY0A 5EE9A 2F55A 4BZQA 1GUAA 4BFUA 4I4LA 4GRAA 1DE0A 2BOVA 1NLFA 2GAAA 4M9ZA 2R6DA 3GD7A 4RVCA 2P6RA 3K0AB 3WBKA 1GNPA 3AB3A 3CRRA 4MGZR 2OSBA 4B47A 2YOHA 3WHKA 4F4CA 3B7GA 2PEZA 3AVYA 4N3NA 2WOJA 1ZBDA 1Q44A 2HV8A 2K5UA 3VFDA 1KSFX 1XD2A 2YOGA 1G41A 1UEJA 1N2CE 4ZDKA 2QGNA 3W3ZB 2WOOA 1AJEA 5C46F 1Z47A 5CK4A 1ODFA 3T15A 2IS1A 4D0GA 2A9KA 4QL3A 1OXXK 3QXSA 1GKYA 1IXRC 2NO9A 1FPMA 2PMDA 4M0LA 3LV8A 1RE0A 3D8BA 4C0KA 3VMFA 3AVWA 5CJ2A 3V00A 5JLJA 1W0JA 3U3KA 1G20E 2QQEA 2CK3D 4F7WA 4M1OA 4A15A 2PX0A 5F2EA 3QVUA 1G3QA 3LXRA 3AGPA 1E2QA 1TEVA 2QENA 1JALA 1T8TA 3GLGA 1XZQA 1XZPA 1G19A 4GDFA 1S9HA 4C0SA 4PTLA 3VX4A 4JSTA 1D2NA 2BIFA 4B3GA 2ZE6A 3AKCA 1E94E 2AK2A 3GJ5A 1VG1A 3C16C 3RAPR 3EG5A 5AJYA 1E32A 2OV2A 1DAHA 4GMDA 1XCGB 5HCNA 2RB4A 3CRVA 1NJFA 2GEDA 4MGKR 2OILA 4PPGA 2JJ2A 2QA5A 2HT6A 1Z0FA 4EJSB 3DL0A 4ESHA 4DSUA 2G77B 3W34A 3F5FA 1R0XA 2FGKA 1GIAA 1NN3A 1NY6A 1VIAA 4L4UA 2QAGB 4L9SA 1G7RA 1S1MA 4JS0A 3K0CA 5FL7A 3U6KA 2KB0A 4ACBA 4UNRA 5FOXA 2W0SA 5CYPA 3HPQA 4XVUA 1NN5A 1PZNA 4MKHA 4B6FA 1GKUB 2VIIA 1ZMXA 2CL7X 2JLUA 1SVKA 1E6CA 5JHHB 4PC3A 2VL7A 4WVFA 3WYGA 4BRWA 2AD1A 4S35A 4QM7A 3IKJA 3QKRB 3KL4A 3HU1A 5JS7A 5TY0A 3GJ4A 1U94A 4PZZA 4Q66C 1FMJA 4Q1BA 3ZQJA 2JGNA 2D74A 5CB8A 1G18A 4QRHA 1U0LA 2OCBA 2V6IA 3G5UA 4DLVA 1A7JA 4FMDF 1QHGA 2GVDC 3WNDA 2ZRGA 1COWA 3ZVRA 3CWZA 5DYGA 4IDQA 3EZ6A 4ZIRA 3IEUA 3E5HA 121PA 1TNDA 1UEIA 4IVRA 5L3SA 1HH4A 3CPEA 1OE0A 4DDVA 2QAJA 3GLFA 1Z28A 2N1BA 4MRVA 1F2TA 2BEJA 3LX8A 3QEOA 3SR0A 1RPZA 2V6JA 4BECA 3MUFA 2PZFA 3M4YA 3QJYA 3UANA 4CDGA 2IEZA 4IOKA 2R6AA 2WJJA 5B30A 3QG5A 4D6PA 1NNEA 521PA 5GVSA 3T06B 2O5VA 3B78A 3ZS9A 2QG6A 2GZHA 3OEHA 4PC6A 4Z1MA 5EP1A 2FE4A 2HF8A 1HQCA 2REBA 3ETLA 2IYTA 4MGIR 3TMKA 1II0A 3BD9A 3L0IB 3ADCA 1FTNA 2GBLA 5UKDA 1KMHA 1X1SA 3RYTC 3BFKA 5DSZA 1YR6A 4LJ8A 2VP0A 4JJKA 2XITA 2FSGA 2VF7A 3DOEA 1E2GA 2IHYA 4D80A 1TUEA 4Q18A 5JWOA 2ZRPA 1EWQA 2Q9AA 4IDPA 5GJWC 4D4MA 3EX7C 1N6LA 1XMIA 1HV8A 3IDQA 1EX7A 3U7HB 1CR2A 1TQ2A 4XWAA 2GCOA 4NCHA 1L4UA 3R20A 1JI0A 4PO8A 1Z63A 1KK1A 2QPAA 1NSFA 2PLFA 2ZSEA 3QPWA 4FCTA 3P20A 3VHXA 4DKXA 2V7QD 4LV8B 1Z2CA 4BLPA 2AWOA 3A1VA 1GWNA 1E2HA 1TQDA 4BFSA 1P73A 2EFDB 6Q21A 1M7GA 4M1SA 1QBKC 1XXHA 3ZVLA 4UJ3A 4AY2A 3NDPA 4ZCMA 3SNHA 4P4SB 1FFHA 1IN4A 3CZPA 4M1TA 5H70A 3SBEA 1JXOA 3K8YA 3NHAA 1LS6A 1S96A 3KX2A 3MAAC 4RCYA 5DLQC 1ZCBA 4CF7A 2J0SA 3B2EA 2WTUA 3SQXA 1QF9A 5P21A 1P72A 1UKZA 2RAPA 1KI9A 2HYDA 5AUPB 2ZYUX 2GF9A 5AK0A 3PUXA 4EQ6A 1C9KA 4RFVA 3LNCA 3PXGA 2PJRA 5EXTA 4NE2A 2CCGA 1N5IA 1E0AA 1SXJB 2HLDA 4YMWA 2ATXA 4RFSA 3TH5A 1IN8A 4YMSA 3U7EB 3UATA 2BMFA 1SVMA 1NP6A 5H68A 3S1AA 1GNQA 1JEDA 1F2UB 3ADKA 4QHSA 4QBGB 4A82A 1D9ZA 3NXSA 4X8OA 4GZLA 3DM5A 2HUPA 1XMJA 3A4NA 3DOFA 3LVQE 4A6XA 4C7OA 2RH5A 4NP6A 2CHVA 5EE3A 1EGAA 2ZU0C 3U5ZB 4FINA 3VNVA 1JJVA 3A6PC 3RWOA 1E1QA 4KO8A 2VP6A 3Q7PA 4GBMA 1DAEA 4O0MA 4OHZA 1Z5ZA 4QJ3A 3TW8B 1XTRA 2ZYWX 2O8EA 2NGRA 1S3SA 2G0TA 2XTMA 3VR3A 2CJWA 2XZPA 4JKIA 5KTYA 3EZ2A 4D0LB 3AKDA 1MABB 4QC2A 5CLLA 1OHHD 4OI4A 3RRYA 5C1BA 2CNWA 2ASEA 2AFHE 3L2OB 1IOZA 4ERNA 1RRPA 3BXZA 4O25A 3EPJA 4FCVA 4EFNA 3PIRA 4TZ0A 1GAJA 2ODNA 5JCPA 2V8OA 1Z0AA 4IEEA 3W9YA 4C2UA 1XEWY 2ANCA 1XNJA 2GCPA 3JZAA 2KSQA 5JI2E 2ZRMA 1JR3A 3WHLA 1AS2A 3L0SA 4ESVA 4H1UA 4XWKA 821PA 2BJWA 2Q9CA 1KIMA 1MKYA 5EP3A 3BH7A 1FUUA 4G5OA 4M9XA 2VF8A 2WMOB 4KBGA 5AUQA 3SFZA 2ZRNA 3LBIA 1XMSA 2GAOA 1YHNA 4JYBA 3RLFA 4IEIA 1N0WA 3EARA 4B2IA 4JLVA 2JIZD 4PHGA 3KZ1E 4RSGA 2MSCB 5HTKA 3TNFA 3SS8A 4OK3A 3SE0A 4D82A 2A30A 2OLJA 2QBYB 4TLDA 3CPJB 4ZI2A 1VCIA 4TYQA 2ZITA 1KI7A 1KK3A 1CJMA 5DHAA 3VR2A 1YRBA 3KKNA 2A78A 3AF2A 2W6JA 1WE2A 2RHDA 2GRJA 2VRWA 1TPZA 4R9UC 5JEDA 1IM2A 2WM9B 3K9LA 3R8CA 1AGRA 1A5TA 2QRZA 3HU2A 4YMVA 4EPVA 4HUQB 4JMPA 1HEIA 1G17A 3EIQA 1JNYA 1ZVQA 1E2KA 3ICQB 1US8B 5KDLA 2WWWA 3AVUA 3FVQA 4IFBA 1W0KD 1G8GA 1E0JA 3C5HA 4NU0A 5IK2D 4JL5A 3K9NA 3VR6A 4M1WA 4LK2A 2CHGA 5D3MA 1P62B 2Z0MA 3BORA 3K53A 1UADA 4Z8YA 2GESA 3RS5A 3TSZA 2XTNA 4LPSA 5JRJA 2XZLA 1LTQA 3ZJYA 5JCZA 1W49A 1E2IA 4JSYA 3QENA 3LVRE 1XP8A 2EQBA 2FZLA 3CNOA 4KU4A 2EFCB 1G5TA 2H57A 5TV2A 5CIQA 1Z0DA 4GMXA 4QNMA 3F0TA 4UNPA 1YR8A 3CWQA 2OO7A 1OFIA 2CL0X 3KXKA 1RKBA 3L8ZA 3RS7A 3AVQA 2QNRA 1MT0A 1XD2B 1J70A 1OV4A 4E03A 1VYUA 3OE7D 3TJZA 1UBEA 3A36A 4CT4B 2OESA 1WF3A 2WJIA 1NMYA 4TT3D 3VX3A 1F6BA 1E96A 1DAKA 2WWYA 4BUJA 3PQCA 2ZRCA 3Q9LA 4LHYA 5GJCA 3ZIAA 1N6PA 3A8TA 4ZDIA 2J41A 4IOJA 4URUR 5CK5A 1WXQA 4HLDA 3ZLJA 2GJ9A 5CLQA 2QI9C 3U4QB 4NONA 5BN3A 1DAIA 1ETUA 621PA 3ZZ0A 4PFSA 1DG1G 1FUKA 3GCGA 2C5LA 2FNAA 4PC2A 3CF0A 2QAGA 2O8FA 5FPHA 4C30A 3LBNA 3N70A 1II9A 3TVTA 5E7JA 3K70B 3GLGB 2WAXA 5HZKA 3QEJA 4TMTA 5HE9A 5DI3A 3LW8A 5FTLA 2BMEA 2RMKA 3SYNA 2C95A 2IWRA 1ZD9A 3QIAA 4Q1FA 2IYUA 2ZXUA 1E69A 2AWNA 4N1AA 4B6EA 4NDZA 1V43A 5DN6D 4XVQA 4AC9A 2DCUA 1K5DA 1LVGA 2RGGA 5EXXA 3TGPA 1GTVA 3KXIA 3THOA 2VSOA 1H8EA 1HURA 5JEEA 1GFIA 2WWFA 3E1SA 4HB3A 3I5YA 3A37A 3W8NA 3QE0A 4JT4A 1A2BA 4LYAA 4LRWA 2AN9A 1KI2A 2FU5C 3K09A 3U6BA 1XEXA 1BMFA 2OHFA 5DE3A 5AR1A 1AZTA 2YC4C 4LYJA 1TF7A 2W58A 2XNDD 4NHOA 3GJ6A 3K0FA 3QXCA 4HZIA 1X1RA 3UG7A 1OIXA 2SHKA 1B0UA 1IXZA 1IQPA 1RYFA 4M8NE 4PQFA 3HPRA 2IUSA 5KHOC 3MGCA 2GK6A 4ASUD 2G83A 3NBZC 4BWYA 4R2HA 4F38A 4UQOA 3B6EA 1D5CA 3IEVA 4FIDA 3G0HA 3B1WA 2ODEA 2BBOA 2NZ8A 3PUVA 1GZSA 2GXSA 4V0MA 4RZ2A 1DO0A 1DAGA 4TTRA 1ZUIA
chains in the Genus database with same CATH superfamily
3V3TA 1Y3HA 3NHFA 1D9XA 1UMCB 1PEDA 3WWOA 3O7MA 2W5UA 4P84A 3WRXC 3PD7A 4ZIRB 5CRIA 5KX5A 2JIMA 1FP4A 4HKTA 3F73A 1M6NA 2JGDA 3C3BA 3AJRA 4DA7A 2KW5A 5JOQA 4C4SA 1SCUB 1E0DA 2OENG 1K0FA 3CUUA 1IDN1 3T1VA 1RACA 4B6RA 3A9VA 3KR0A 1T0IA 3ROMA 1X13A 2C9DA 3AI3A 3P19A 2OZKA 4NBSA 4C0QC 3OTQA 3TEMA 2JJ1D 3OTOB 3M1YA 5KTKA 1JT2A 2ZUSA 2QM8A 1E9SA 1NVVQ 3AJDA 5JSKA 4EY4A 5C2JB 3FCUB 1UBFA 2YNMC 4WFIA 3QQ5A 1T2CA 4RIGA 2P7IA 1PP4A 1SHJA 4F5DA 1P60A 2H7CA 4ZQCB 4PRKA 4CHGA 2BKAA 2QRNA 4RUKA 1CS0B 1BXGB 1LLFA 1O95A 4UM9D 4E5SA 2DFDA 1IZ9A 2VPTA 3BMCB 4ZRDA 3J7TA 4JK3A 4BE7B 3GDHA 3OO1A 1D1SA 3IIKA 2QL9A 1FK8A 1OBVA 2R44A 4M98A 3LP8A 1ZGCA 5KCMA 4CCYB 3PE4A 4X24A 1Z3IX 2QM3A 4A8JC 2EG9A 3ZVKA 4AYXA 3OOSA 4FEGA 3BZUA 1JVSA 1UC9A 3AU8A 3MLEA 2JK1A 1H2ZA 3KDSE 3UOAB 5I48A 3UPUA 3M6WA 4NFHA 1YCFA 3GEHA 1OVMA 1VG0B 1K97A 2EP8A 2GD2A 3RRJA 2HSGA 2ZSUA 5EXEA 3HUEA 1YKGA 1PGPA 3PEVA 1MORA 3C1OA 3TI9A 3U31A 4L8VA 3MNFA 5IARA 4YMUA 1MAVA 1FY2A 1TQ8A 3VHXB 4NTZA 1OBHA 3WIDA 1Y8RA 3I45A 4U0KA 3K9QO 3W7BA 4TROA 4CM8A 4D4GA 1Y4DE 3K20A 2APJA 4UU8A 3ZE9A 4LY3A 4JI0B 4P93A 5HA5A 1LWNA 2MSDB 1RXVA 1K63A 1TYCA 1XXHB 4Q3DA 3S1LA 2IXAA 3NQ41 2WVAA 1GA1A 4E08A 2YJZA 3BG5A 1EE2A 2CXTA 3IBYA 1XDWA 2RJOA 3ONWA 3SYLA 3OJXA 3SYKA 3P9NA 1L5MA 5KSYA 4I3HA 1EESA 1P75A 2FPLA 4D9MA 1JRLA 1UINA 3IRVA 4KXYA 4KOEC 2IBMA 3IILA 5F9FA 4G2NA 4JC8A 3G0IA 4ZVLA 1UK6A 1JJAA 2IV2X 4AJ4A 1E2UA 3OPXA 5KJ1A 3WGUA 3ELUA 4FB4A 5IH3A 1M5RA 1AK2A 3CM0A 4L5BA 3B3QA 3EGEA 3QFFA 4YUYA 1ELOA 1SKYB 1UWVA 1QG0A 2AE2A 3C3YA 5FFFA 4CV1A 3B6ZA 5A0FA 1Q0RA 4DV7B 1G20A 5D00A 4O2AB 4RA6A 5ALJA 4DJJA 4QLBA 3DGFC 4JBNA 4KVZA 1LD3A 3NCHA 1ECFA 4Z99A 5CMLA 3WGKA 3DL4A 4LFCB 1DNPA 5ED0A 5HMMA 3ESRA 3L0BA 2OUKA 1PRYA 4GT1A 2QN6A 2R6JA 3A7DA 1KJQA 1Z6GA 2IZZA 3LWNA 3PRKE 4L72A 1RFGE 2YJTD 3LQKA 2W8BB 4A2CA 2PS9A 4GLBA 1IEXA 4RQBA 3LY7A 1DKNA 1GL9B 2LZ0A 1W44A 2XRZA 1N34B 1RI3A 4L0QA 1ODTC 2CKMA 4XDHA 2Z9BA 3K31A 4MARA 4NQZA 1XNQB 4LVUA 4O8ZA 1R8JA 2IV7A 2PUVA 4E7PA 3GLGE 2DPXA 1C80A 2DUNA 3Q8XB 4MWBA 4A8HA 3F49S 1VC2A 3DO5A 3EQ6A 3WIVA 2OO5A 3WV5A 4EA7A 1S6YA 3FGZA 3K2BA 5DTMA 4CLHA 5KOIA 2P2NA 3H1TA 4KPGA 3TZ6A 1AZLA 2C2BA 5CVTA 1XTSA 2X76A 5KTMA 1ZOIA 3PGVA 1OYWA 4PZCA 5G4KA 3S99A 4EA8A 3GRYA 5AHKA 1E3TA 4PYNA 4ZVVA 2RH4A 4U0JA 3TOCA 4LPKA 4QNRA 6REQA 3HV0A 3SC2B 5IAAA 3VO2A 1KPGA 3OMXA 2WI8A 1FP1D 4B7AA 4PXYA 2CXPA 3OFNA 3OAAD 2V6GA 2OXFA 3QKIA 4AECA 2LD4A 1NYQA 2IS4A 4CMBA 5IVPA 3OLYA 5IEBA 4W1PA 3UJAA 5JJBA 4R0NA 1G6HA 1BX3A 1S3GA 1LBHA 1USUA 2RHTA 4R8LA 3VO8A 4FDUA 2ZCJA 2DWUA 1FXSA 1LGYA 1D04A 5HW0A 3EODA 4H17A 1Z5VA 1T36B 2MJLA 3ABQB 4MB6A 4MX8A 3RASA 2XRYA 1JVBA 2CL5A 4TUYB 2NYVA 3UUFA 5LQUA 5FTNA 3WFIA 4ISCA 4P92A 2YFQA 2XTAA 1AH2A 2VHJA 1EHCA 3KQTA 1HT0A 3KB6A 4JEMA 1CG6A 4TV8A 1MIHA 1SA0A 3QEMB 4CU5A 5TMBA 2DLNA 3RKUA 2H4FA 3QPUA 1G8KA 2H52A 3FSGD 6AT1A 2EFEB 3ZXIA 5BWNA 3MS2A 1Z26A 2H1CA 4IDAA 3SHWA 2HLNA 1VQ1A 2P7HA 3EZFA 3IKVA 1UP4A 5IDYA 3UUWA 2I91A 1MR3F 2AF3C 1YVEI 1KJYA 2B2XA 4ZZ1A 1X3SA 3EVEA 4L2IA 4OH7A 2AJDA 2WHPB 3CLRC 3M81A 4KDEA 2UXCB 1BDJA 2W6ID 5AOVA 3RVKA 1W581 4FONA 2AUMA 2H5IA 3D6FA 3P52A 1VDZA 3IV6A 3V7WA 4IIHA 5HRCA 4A1OA 1SO8A 1UXOA 3UFBA 4DWVA 2CBGA 1P18A 3FRIA 3NBFA 3W04A 4ETWA 2IZ5A 2JCSA 3L18A 1Z74A 3O4JA 4GEGA 1XTTA 4MK4A 3KTFA 1SQ5A 4WKOA 5IKPA 4KVGA 2EEZA 4O4IA 1LWOA 5JXJA 2F3PA 1C9NA 4XWWA 1U2PA 1H6BA 3X3HA 1HDGO 3SWWA 2AE1A 4MR7B 1VI5A 2A5GA 1QGUB 2B1RA 5AUOB 1XDBA 3TRKA 5JMTA 5LOVB 2F90A 3TX6A 1SM4A 1W5EA 2ERXA 1H1LB 2X7HA 2FHSA 1G9XA 2BMVA 2CVQA 3D1LA 4NAUA 4RELA 4U2KA 5TQVA 4NBNA 3QWHA 5BRAA 1DIRA 2ZAIA 2GAIA 2W6ZA 4N65A 2CMHA 3KFXA 4WIAA 1CR6A 2JLAA 3HL4A 4WKPA 4EB3A 1PJRA 5ES4B 2VDRB 3HSYA 2DKNA 1SBCA 1ZVKA 1QDLB 3QBVA 2V9ZA 3EEYA 5HM6A 3S5UA 1WLYA 3VYTB 2WBLC 2YCBA 1SIUA 4QDOA 3LZCA 1GQOA 4N6OA 5I47A 2HQOA 3C8UA 5TGDA 2XNSA 2FV8A 1U0HC 1Z18A 3RTAA 1B14A 3NFYA 1M9NA 4BVHA 3CE6A 2G1PA 5EZSA 2A5JA 5KVCA 2FX2A 1KSHA 2GEKA 5BUQA 4RE5A 1KORA 1P0FA 3IHKA 5FDFA 2Q9BA 3GZNA 4OVKA 1WMSA 4CIAA 1T0HB 2H9IA 2Q3EA 3DV0B 2FVYA 2X0FA 2B25A 4BNGA 4BUZA 4BJ1A 5A0TA 2H2FA 3P2YA 2QM7A 2ISSD 3LU1A 5IC4A 2IXGA 3DE2X 1MAUA 2BD0A 1AHPA 1LQUA 1PWZA 2FG5A 1EKXA 2XYVA 3ORQA 2FWJA 3FH0A 2F3SA 2ZUBA 3CMCO 2ZRLA 4F3NA 1YS6A 3R7BA 5I9LA 4DR3B 3L3BA 1O87A 3PFHA 3SHFA 1SQ6A 3KYDB 1QZTA 3RUPA 5FRDA 3EH2A 2ZXFA 3OCVA 3KG2A 3MYRA 1ZOPA 4KXWA 1JB9A 5F3WB 2WIKA 5SYNA 3VGJA 1QIKA 2QLMA 3NHBA 3W78A 2VJBA 4UEJA 3L8HA 3KXPA 3KE8A 1VPVA 1PZMA 4NG4A 2F64A 4PIVA 5DASA 1RWXA 2B4RO 1JEEA 3MTIA 3ZHSA 3BS4A 1B8UA 3V1YA 2QR2A 1XDZA 1VJRA 3IXMA 2FWIA 3UGJA 3UMYA 2HYIC 2ZUEA 4HEA6 3AG5A 3FR8A 4AWXA 1X1TA 1N6HA 1S8OA 5LA6F 4IHJB 2FZVA 4JITA 4FLFA 1TIKA 2EQ5A 1V5EA 2B1IA 1JV2B 5EQDA 3ZTTA 2AR7A 3I4FA 1IZ0A 3FOWA 4E5YA 2VPQA 4F4JA 5BN5A 1UDRA 5EZ6B 4OXXA 1NXWA 4JP3A 4DMMA 4EP1A 4EGCB 4MS4B 5IM4F 4ZTZB 2I55A 2WYOA 3D3KA 3HU5A 4TKVB 1MX1A 3KKLA 4MIEA 4BO5A 4ZYUA 1G5HA 1OX6A 1R5OA 5LPNA 1VP9A 1BN7A 1SPXA 3K0FB 3TTWA 4CNQA 3MTBA 3H16A 1UM9B 5JCOC 2LDBA 2GZSA 4DLKA 3UMGA 2YXEA 5H9WA 5KNBA 1SVNA 3D4IA 4PGGA 5EHNA 4BXOA 2AFHA 3PGJA 1Q20A 4N3GA 5EFZA 2Q3CA 3GFGA 2PD6A 1EVZA 3RKRA 1VE7A 2DM6A 2J9YB 3EMVA 3RAGA 3E9MA 4PZLA 1YCDA 4EUHA 2NUPB 3VPAA 3C7KA 1S7CA 2GBIA 2P90A 4IY1A 2NU9A 4QOIA 1Z2EA 1GTG1 5IYZF 4MR8A 3ADBA 2JFOA 4INJA 2QP4A 3VKFA 5KX5B 1FP4B 1RRFA 4ETMA 2JGDB 3OIFA 1KP9A 3OT1A 1DCFA 4BASA 4JD5A 4ZVQA 3QVVA 4BLWA 4XUCA 4DRZA 1CVRA 3G8AA 4UTNA 3E1GA 1GY8A 2Y0BA 4DRXA 2WJWA 3N87A 4NXMB 3A1DA 4J91A 3RHTA 3QNUA 2B7BA 2DECA 1BS9A 2GDJA 4OPMA 4V2UA 4X1KA 3BXOA 5JPDA 2WU4A 3E61A 4ND6A 4EBFA 2WD7A 3DV9A 4U00A 5EJMA 1J2EA 5G0SA 3UK0A 2BFFA 5HG0A 4AJHA 1PJBA 5A9RA 1QRTA 2DTDA 3QKUA 2RGRA 2A33A 2HK6A 1LPSA 1PT6A 4B71A 1J56A 1TIPA 2J6HA 2HTFA 3ON5A 5DRYA 1GZHB 1Q7CA 1JLHA 6YASA 3GFOA 4C05A 1M10A 3C24A 3AT1A 3DMYA 1WXDA 4NF2A 1ATIA 1XPJA 1NUHA 2GM5A 3IYLW 3OIVA 1ISHA 2WUEA 4IMPA 1HQYE 2Q1SA 1QCDA 5CFOA 5K0SA 1T0BA 1XYGA 2PH5A 4WNIA 2FMTA 1HLPA 1UF9A 2OBFA 2WZQA 2HRZA 1SIBE 3IOMA 3LQ4A 4DBZA 3ZTYA 2W6NA 4NNPA 4XYLA 1IN7A 1E5LA 1PFGA 4C0LA 4KHPB 2H08A 3RS4A 3JS5A 2PH3A 4IWYA 2PWZA 4P82A 1BHSA 4IJ6A 3MCTA 4RKYA 5L7WA 1VDMA 4WSOA 4KLNA 4W63A 1S3FA 3QE9Y 1ZU4A 3DSRA 5EJAA 1UQRA 1IB0A 3A3KA 3AYXB 2YQZA 3BAFA 3NC4A 3TOVA 4MDFA 2V9PA 1E8DA 4RKWA 2GPNA 3M1AA 1UQUA 2QLTA 2V7TA 2VPPA 4KI0A 4MKRA 2XVXA 1A88A 1Z35A 2XUIA 5DCLA 5G0VA 4CM8B 3IIIA 4KPFC 3HH8A 1ONSA 3OAAA 4EO7A 1E59A 3V9PA 2Q1UA 1DEHA 4QASA 1O57A 3IULA 3QU4A 3O3NB 4HQ0A 1WF6A 2GEVA 2OCLA 4MV1A 2O54A 4WD3A 3DKIA 3KKKA 4YHBA 3V48A 1E2BA 5CCEA 3E84A 3I8XA 2P9TA 5IN4A 5C5CA 4MAFA 3CF4A 2IRWA 1F2DA 5E3HA 4LHSA 3RANA 3UT5A 2GN1A 2O7QA 5EMLA 1V16A 3S2GA 3IV9A 4Z2YA 2BUBA 4GLFA 1NJ5A 1KFJB 2WWHA 4LTNA 2VYVD 2VK4A 1OF1A 4F84A 3KLMX 3GFTA 4QTXA 3K92A 4WNCA 4LOAA 1I3MA 3N8KA 2HX1A 1QHFA 4PPQA 4R9SA 4MQMA 2ETXA 4X6XA 3KJHA 1CQIA 1G20B 4QG7A 1LRJA 2JNWA 4LSMA 1YR9A 1Z8HA 4G36A 4ND1A 2H0RA 4KIJA 3VJKA 4X8LA 3EF1A 3Q2KA 4KYVA 3KDAA 2YW9A 4L3VA 1NQXA 1FP6A 5TPWB 1G3MA 1G2IA 4E3WA 5CM8B 3PUKA 3BHIA 2V7GA 1N9ZA 3ZLVA 3LY5A 1MLDA 2PRYA 3UA3A 2NVUA 2IU0A 2SKEA 3CKYA 4L76A 1MEEA 1W8DA 3FHLA 3VO1A 1ILEA 3EEBA 4FNGA 4BNJA 2J48A 4H0NA 3HZOA 1AS0A 2VJMB 1RAGA 1INLA 2V45A 3HEBA 1WVMA 1ZK2A 3OJCA 4IZOA 2V98A 2YR0A 3EH1A 3ZJUA 5B1EA 3MBOA 4GMGA 4QU8A 4BKRA 4EL0A 3TRHA 1NBHA 1I5OA 1TXGA 1UKBA 4YRCA 4ER6A 2JLXA 1NV8A 2TSYB 4A8PA 2QP3A 1M1UA 1NP7A 4Q9HA 4N3BA 1A77A 3ER6A 3T1OA 2Y71A 1RI5A 2Z3ZA 3N6XA 4BNMA 4DQUA 4EF4A 3A9UA 2WILA 3UK7A 4A2WA 4M1YA 3HYNA 1OUMA 1MRSA 1S1CA 1SVWA 1SXJD 2R65A 4FFRA 4PLGA 5DMHA 1FFDA 3RVLA 4D9FA 2P68A 5A3RA 2XHZA 3RC3A 1OC2A 3PNBA 1BNCA 4QVIA 1ZK3A 3OZFA 1DIBA 4PC1A 1CUEA 1JIVA 4JT2A 1C9MA 1NUAA 3GVHA 4Q3BA 3KU4A 1UJ2A 1AF7A 3ENQA 1GZUA 2MDTA 2NTJA 3N8NA 3QFCA 4JLMA 1V3TA 4E5DA 1OH6A 1NI3A 1PTJC 4EUFA 3G9UA 1ZD8A 1RXSA 1W1WA 1ZLXA 4RVOA 1ORWA 2ZIUB 3A4LA 2ZI9A 5E1OA 3V34A 1G8SA 1QHIA 3ZU6A 4DMGA 2X9LA 3B1YA 4O2AF 5JATA 4UUQA 2XB8A 3WIBA 1P9NA 1RWNA 3LUCA 4G56A 4X1YB 3WJ2A 3ZQ6A 2DQSA 4C7KA 2D7DA 1NVMB 2HH9A 4YCNA 5KSWB 2NIPA 1NMEA 4U7GA 1KERA 1NR7A 5IANA 4J1TC 3DPUA 2DUWA 2D1FA 1MJGA 4WV3A 3ZIDA 4OJYA 3RIHA 4TV8B 4RMGA 3IALA 4FGLA 1SA0B 3C39A 4G01B 5EE5B 3ZGXA 3MCVA 4N82A 2IHBA 3NOVA 2JIOA 1C9DB 2HFKA 1BHQ1 3A3OA 3IIEA 1SD1A 2A59A 2XJ9A 3PXUA 5A4AA 2G1JA 5K05A 3BE8A 3AZQA 3I09A 3ZCVA 1THGA 1G6KA 1FLAA 4N0EA 4WZZA 1GT91 1KP2A 3YASA 3NEJA 3RO7A 1FJHA 1DMSA 4L2IB 2E4WA 1L9XA 3HYTA 2NXWA 2XWSA 5ERYA 4DF3A 2I67A 2VCHA 2VZEA 3OT5A 1GDHA 5BSWA 2HIAA 4IZHA 4U2EA 4P4TA 4RZXA 4B4KA 4YY3B 2X0IA 1N5MA 4HEA1 3WA7A 3KU1A 4MHSA 1DWUA 4O4IB 4DABA 1XU7A 4PCLA 3UCXA 1J23A 2HO4A 3DHEA 3EXG1 1M8JA 3PYMA 1M7BA 3PXCX 2PE5A 2R79A 4TVKA 3FD8A 1LY1A 2O3RA 1MQAA 3DDWA 3O2NA 3KJZA 4TXNA 1F7UA 1P0MA 1NNSA 1C4OA 1V4BA 1X1DA 4DJ5X 4ALIA 4MH0R 5CYOA 4K1XA 5CPFA 5SZHB 2E87A 1OI2A 2C4WA 3U49A 4OHOA 4UTXA 1T26A 1XAIA 2VDWA 1Q1NA 1YJXA 2RGCA 2ZXEA 2DWOA 3ES9A 2QR3A 4G0QA 4PU0A 4QOSA 4D4HA 4Q4HA 3MMZA 4RIFA 3HJAA 1QO9A 4TUYF 5AKJA 1H85A 1NX9A 1GVNB 4I2VA 5CBKA 1QHXA 3L5OA 3I83A 3N75A 3RU9A 3WLSA 2GILA 2HA6A 3IAFA 2D6FA 3F3MA 3CZCA 3ZJ4A 2R60A 3CPHA 1G8AA 3JQFA 3Q7EA 1KFBB 2H4HA 3HEMA 3R7WA 3SJAA 4EIWA 5EFOA 4QVGA 3ZDXB 3KVYA 1D2CA 2X23A 2WW8A 5JVDB 2Q6TA 2Z56A 3RRNA 3FTNA 2LCFA 3BWMA 1ZL2A 2J0UA 3K1YA 3GHYA 2RGNC 4V0KA 5ALDA 3JWGA 1PJLA 5JFGA 1F3OA 1CEEA 1PL8A 3RSOA 4KN6A 3GZNB 4CM4B 3NO4A 1VL2A 3EFEA 2AN5A 5EIWA 5D7NA 1DJMA 1G21A 2P5UA 2RAUA 3P71T 2MIIA 3IB6A 5IBCA 1CP3A 2CDAA 3VNSA 2C03A 3DC2A 3PQ6A 1E4VA 4NFLA 2O3QA 2QMHA 3WBBA 5EHGA 4BPBA 1SKAA 3ITEA 1QK5A 4CF3A 2WJGA 1SMKA 2PN1A 2XMSA 1PU2A 3LLSA 3MT7A 1DC7A 2ETVA 2DHCA 4NZ9A 1L5GB 2LVBA 3AVPA 5CM9C 4ZQBA 3S2YA 5A05A 2IXFA 1I4OA 1RWQA 4N54A 4QU9A 3LPDA 1TMKA 3KE9A 4KSBA 1RHRA 1HUQA 1QIIA 2I4OA 4G65A 3Q7QA 3VMMA 5BMVA 1Z68A 4FGSA 4P7FA 3VQTA 1SIWA 2FR8C 2H85A 5ELMA 2QEQA 1PR5A 2V7QA 4OJTA 4WZBA 5MN5A 1AG9A 2YY7A 3IBGA 3PUWA 2DRIA 5DX0A 4D8UA 1QF6A 1UDBA 3WLJA 1NR5A 5AW0A 3NMUF 3ESQA 4OHPA 3O0DA 4MWOA 5TXGA 4AWAA 2DT5A 4D8YA 2O5RA 3N8GA 1N2GA 3A1WA 3SDSA 3O1HB 5C34B 2B4KA 3RC7A 1VCNA 4UNQA 5KQSA 3LC2O 1O4VA 2J9RA 3GGDA 3EMBA 4JLNA 1WDTA 2QN1A 1G4AE 2Z58A 1HTTA 4PG7A 4C6RA 1YK1A 2QLJA 4AT1A 3PFCA 2ZU6A 3MGBA 3EHEA 3G9ZA 3VPSA 4ECAA 4MJ7A 2VS1A 2Y3IA 1CY6A 1MTOA 1VCMA 1O7JA 1XN4A 3D4NA 3NBMA 4HFNA 4XQ9A 3MJEA 5FP0A 3S40A 4Z6KA 3K70D 2FG6C 2PWAA 4BXOB 1E4YA 2AFHB 3STHA 1Z5NA 4KIGA 4YAWA 3RWMB 1VSUA 1GXSA 2AFRA 1JKFA 5DTRA 4FMCB 1PAUA 3MWGA 3R0VA 4K6OA 4O1MA 1WOMA 4EELA 2NXEA 5THKA 5I8WA 1Z8NA 1ZN2A 4ENUA 2JIBA 2V7XA 4F8EA 1I3CA 1NXVA 4MR8B 4Q1VA 2WVJA 4FW9A 5A71A 4PTZA 5FR1A 5AJWA 2FMHA 1LDGA 3QV2A 2C7OA 4OHYA 2XODA 2BEKA 1USGA 5C4IA 2XDYA 3OT1B 3UZUA 3V97A 3E5RA 2VP5A 1V8FA 4MYTA 4G4SP 1UCFA 3C48A 3MELA 4WUVA 3WIUA 4C4PA 1SUWA 1CE8A 4DRXB 4EMBA 4LBZA 5I4IA 5KOJA 2CHUA 1TVMA 2QDKA 1HRDA 5CHYA 3P2OA 1L2TA 3X2SA 1J8QA 2O0JA 4M0KA 4JGBA 4IHJF 2YZKA 4JQOA 5EJ6A 2WD7B 1UDWA 3CRNA 5IULC 1VB3A 2Z43A 5GM2A 5THQA 1NJGA 2Q46A 4WQMA 4DCTA 4GO1A 3DHNA 1GPMA 4DBVO 3C85A 1NWCA 3R44A 4GIBA 3V1MA 3SZUA 4LSZA 2J85A 2QT0A 2XF8A 4LBVA 4CLOA 2CCJA 3JPYA 2WE7A 1QIFA 1J8FA 2G4LA 3GB9A 1BQ4A 2ZUDA 1X92A 4OQLA 2I87A 2ZM5A 4LMBA 1RP7A 4JUAA 5IBPA 2C0QA 1NQUA 5HUJA 4I2NA 4EMTA 3TEJA 3OZBA 2IA5A 2CBXA 4QOFA 5DLDA 3LI2A 1XFDA 5BNIA 5AQEA 2QXUA 3HP4A 3THWB 1AU9A 3MD0A 1YF3A 4RA9A 4UXJA 1SVLA 1NAHA 3K1JA 2RH9B 2GM4A 1N8SA 1CZOA 2ZS8A 3IA7A 3VPFA 4CM9A 4UTRA 2CDBA 2X8BA 2RD2A 4XLZA 4YP7A 3D7SA 4LRUA 5AW2A 2P41A 3NIGB 4JJIA 4MB0A 4Z9FA 3HL0A 5FUXA 4QGGA 1RM4A 3L41A 4J75A 2DP4E 1BGWA 2I4RA 1RPAA 2X7JA 4ON9A 2QSYA 5DIFA 5IC5A 4BFXA 1CULC 4IDHA 3ZGYA 3OEHD 1U7DA 2PRJA 2NTYC 2F8LA 2II6A 1A8PA 1XK7A 4L5CA 5FAXA 1MX9A 3TTXA 3WLOA 4DFDA 2BGRA 3AJ8A 3ETEA 3OI7A 2HMYB 4OQPA 4K1LA 4X63A 4O2BB 4WL0A 4J3FA 5E4JA 5EJ2A 3TUIC 4HH4A 3RJ9A 1T5IA 2I6SA 3L6UA 4CEJA 2I5PO 3ZNNA 1Q3KA 3KUDA 1P7CA 4OIMA 5KYNA 1H4VB 1VL0A 2N3ZA 3UT5B 4P0PB 1SOMA 4J0DA 3C2QA 1NVXQ 3TINA 3LS2A 4IPTA 2OCIA 3FTCA 2J3DA 3K5HA 4GS5A 4WLVA 3VI4B 4EB8A 2W22A 5JMWA 2PUAA 2G9VA 1QQ5A 1MO5A 1NW9B 1SD2A 4KXNA 4TOIA 4ZAWA 2H1WA 1TUBA 2H4JA 3NR2A 3Q41A 1BA3A 2VH5R 4LF8B 2GXUA 1AKUA 1W2HA 1TW3A 1CQIB 1W0KA 2JGJA 2QD3A 1Q0UA 4F4IA 1T1RA 3AK4A 3ZY4A 3KLPX 4H16A 4BWFB 5FUWA 4KODA 1Q1BA 2XYQA 4PW0A 2XCRB 4HD8A 1V47A 4AKSA 1U0OC 2VCEA 1V2GA 4QQNA 1P45A 2NVUB 3MJFA 2Z8ZA 3IQFA 1YA4A 1J2UA 4R1MA 1P0IA 4OHVA 1SC4A 4WKNA 3HLYA 2SICE 2J32A 4LXIA 4W7HA 1KO7A 2PL3A 3JSAA 5F9HA 4K26A 1R0SA 1ID1A 2I3AA 2O1WA 4EYQA 2QOEA 4JBGA 4OI1A 3KAPA 4NQRA 5M29A 1EE1A 2ZSAA 1BWQA 2D62A 1C9JA 4IQ8A 4XSHA 3ANNA 2FFBA 3RUEA 3HB4X 2D3WA 2X6QA 1SFRA 1ZO8A 1NXXA 2JANA 2OORA 2QSJA 3PHLA 5BUCA 3FVWA 5EZQA 2HA5A 3QFHA 3ETNA 5DP1A 5DYYA 1IM8A 2JI7A 3E03A 4XFJA 2PMEA 3EFOB 1RXCA 3SPXA 5AKXA 4JOSA 1XPUA 2GEJA 3LVFO 3O26A 2J87A 2NQ2C 1R74A 1UT6A 1Z5UA 3ODGA 5FF9A 4M9UA 3FZNA 2EZTA 2QF7A 5BT9A 4W99A 2XBLA 2D2EA 1SUBA 3L7NA 1YHZA 1HKUA 4WXHA 4GPTA 3X0DA 4CWAA 3F8WA 4PN7A 1QTNA 3HXMA 3EFBA 4BQOA 1KIAA 4IDBA 3G3EA 1L5SA 5C7YA 2VQEB 5G40A 1EK6A 1C7RA 4ZANA 1IN1A 1RXIA 3ZWCA 3TQCA 3D5TA 1Y8ZA 2EGGA 5DF1A 4A27A 1QIDA 3DEZA 1XZJA 1JQDA 5A3SA 5TC4A 5IWAB 1DHTA 1XTIA 3KIPA 4Q4AA 4TTTS 1X1QA 2IPLA 2N46A 3F9IA 3AETB 5SY4A 3VOBA 3A1TA 1UPCA 3EZ9A 1ZGAA 2YY5A 2F43A 1UC5B 1LF5A 2RC6A 1KZ9A 1SXJC 1E7MA 3DTVA 4GRDA 3UJ8A 3MT9A 4YCBA 4D2IA 3FHTA 1K88A 2H1RA 2MYPA 3G49A 4ZODA 5B1HA 3G8BA 4DQXA 1TYEB 2P2YA 4LQCA 3WNBA 4FM9A 4LI3X 4RQAA 3VR3D 2CV0A 5K3OA 2RHGB 4TRRA 1Q92A 4OAOA 1R8SA 3KQNA 2ONYA 2CNWD 3H2HA 2VSFA 4FW8A 1C7JA 3Q7IA 3WKBA 4QYSA 2Z9CA 2YKGA 5TGTA 4OBXA 2FW1A 5E1DA 3UH0A 1ZQ9A 3GGPA 1CB0A 1KKLA 3HNOA 5ALUA 2B78A 1FU4A 3SY8A 4R7ZA 2K7ZA 1K6IA 2NUTA 4TTIA 5JZVA 3O21A 2CLKB 4XJVA 1DUVG 2OXCA 1IPFA 1J9GA 2OC9A 2VP3A 3I9LA 1JR3D 1MC1A 4M7RA 3P9XA 1WB5A 3QVMA 1CCWA 1SC6A 1A5BB 4CMEA 1XVIA 3HG7A 4F4DA 1BJRE 1N2ZA 2BFBA 4J3JA 2JI8A 2V5VA 3UTCA 2B3DA 3ZUGA 1U6JA 3HSKA 4WN3A 1RHKA 2HUNA 4YP5A 3RYCA 3EDYA 4YROA 3IQGX 1NQVA 4FZJA 3GUHA 1SQSA 3Q3GE 4JP1A 4KLRA 3EDQA 3QY0A 4WRRA 1B74A 1QK4A 2VDWB 4UZSA 1W5AA 4FFOA 2QORA 2JAPA 2Y1XA 1BVRA 2V59A 3DLAA 2VDOB 3E7WA 3IQIX 4FTWA 3GVIA 2FPOA 3N2KA 4HVLA 1AK1A 1JDUA 1GPKA 1YDFA 5EEHA 7ABPA 1QPBA 2H07A 3BD8A 3FLAA 1C8KA 5F64A 1PDOA 4M8KA 2RGXA 4C0HA 3IAS6 1PVVA 3RYHA 2VP9A 2N75A 2Y6VA 2VUHB 1VGQA 4RHEA 3R7WB 1JDBC 2V0NA 4WT7A 2IF0A 2JB9A 4BEBA 2JH9A 3ESZA 3WHIA 1YC2A 4L28A 2OFWA 1U9JA 4BIIA 5KEIA 4JVNA 4LF4B 2A86A 4X45A 4ZPXA 2J0UB 5ES3A 1NVTA 3QUQA 3B1FA 5TVKA 2UUPA 3AI2A 1T3SA 3N9IA 1EWYA 4FGKA 1P31A 1QLJA 3CW2A 2Q5EA 2QTNA 3EGVA 1FFYA 3BMXA 3MYYA 3RJZA 4XIGS 1MRNA 2UYOA 3R0QA 3PEYA 4IAOA 4ZJYA 1SRQA 5AP9A 3TQSA 2EW2A 4UDNA 2QJWA 1O6BA 4BE4A 1TKBA 2AMYA 3EIOA 4MS1A 3DJYA 3KPWA 4FC6A 1EK2A 3PNVA 4FJ1A 4RJLA 5C53B 4O4IF 1CFZA 2BMJA 5COQA 1ZI6A 5JAQA 2NPFA 3PUZA 3QWBA 1KZHA 4ZN6A 2FA9A 5JNSA 3A2MA 3QFRA 3Q3IA 4N5IX 3V4FA 5C1PA 1D0SA 4FS3A 2H1SA 4RZ3A 4FYVA 2DJIA 4HDSA 3GNSA 2HPVA 4U6NA 4FYXA 2I8LA 1F8FA 2CJPA 3MWKA 2IEIA 5BMVB 1UWCA 4MW2A 1DQNA 1E9RA 1UH5A 2Y4NA 2FUCA 3TIXB 1LJUA 3JQPA 2DVMA 4L4YA 4G5HA 5CVDA 3ZHOA 2AYXA 421PA 1FRFS 2C4HA 1XQVA 3R9WA 4NMWA 1W5TA 1I3NA 3FSJX 1ZICA 2D7CA 4LWOA 4CIWA 3F8SA 4JXZA 3ILYA 4IGAA 2QT1A 4IVPA 4B7CA 4DYHA 5TJ9A 3SCZA 1TVKA 3CF4G 3EXHA 1BYIA 2FFQA 2X1HA 2QD5A 4MLPA 1ULHA 2HK8A 4IP0A 1CF9A 3UIEA 5JVDF 1WZ2A 4GPIB 1RRMA 5CH5A 3CEPB 4K6GA 4V0LA 4UU7A 2AZDA 4JI3B 4IJMA 3MSXA 5KBYA 1FZTA 1R18A 4OI2A 3W5JA 3ZGZA 1PGQA 1T3LA 4WFJA 2IGBA 1Y6FA 1HORA 3GLIA 4MIOA 1L7QA 3O8QA 5KWVA 2ZIFA 3ITDA 1TLFA 1S4MA 2VAWA 1Q3TA 3G6WA 2AL7A 2D5BA 2BEUA 3NHRA 4PLTA 1CERA 2FMXA 5AXAA 1MJGM 1GXSB 2VHUA 2QN8A 3H0CA 3JYLA 3EPRA 1T8WA 3MQ4A 4B3FX 3OPNA 1QGAA 4RM2A 4U6SA 3NJ4A 4J29A 1IQ0A 2HHLA 2BFWA 3KT3A 4E3ZA 4BLOA 2L42A 3Q8KA 2QMUA 4MIKA 2Q4RA 1OASA 3CLKA 1VXRA 3PU6A 4EATA 3IHLA 2ZUTA 3U9SA 4LX8A 1BAPA 1TCAA 2AJTA 2DH6A 3HI6A 3OIGA 3X1XA 1OXUA 1Z9BA 1H8ED 4L8WB 5M5BA 1NVWQ 2H1LA 3A0RB 4HWKA 9ATCA 2BM8A 3D6AA 1RRKA 4PSKA 5LUAA 3V2HA 4X6YA 1N8NA 3MZ0A 1CE8B 4DLTA 5DLPA 3K70C 3FYCA 4MO9A 4ZYVA 2Y0DA 4ID3A 1YXMA 3JY6A 3FR7A 4J9VA 3UICA 1AE1A 1PG5A 1XMXA 3KJGA 3ZS9A 4KPEC 3S5JA 1QV6A 2ZOSA 3AKEA 4UCXA 5G2OA 2WA2A 5CW1A 4UZEA 1IHYA 2JLQA 3AF5A 3DMNA 4WN9A 2WF9A 1BD4A 1EFLA 3F1KA 4XB2A 2CWDA 1G4UR 1EXMA 2H06A 3BL5A 2X1VA 2P27A 3O7WA 4IFTA 3SJBA 3W77A 4CLOB 4CQJA 4CKWA 1RNLA 5JJKA 1T4CB 2CVFA 4DVJA 3L1JA 5LQMA 2Q4OA 1BFUA 2QX6A 2RAVA 5ALVA 1JR2A 3UJNA 2JLRA 2C4TA 2ZB8A 3LYLA 1TA0A 4FFBB 1GPYA 3ABRB 2AKYA 2F1JA 2XEXA 2EJBA 3DW3X 3NM6B 3NRJA 2BONA 4GKBA 3LT5A 2I2BA 3OC6A 3X1WA 1XJQA 2QY6A 2Z2ZA 3AW8A 3IUMA 5JNTA 4BB6A 3VR5D 4RA9B 1P4AA 5KJ6A 2IBTA 2UKDA 4RF5A 3CXUA 2HJWA 1U3DA 1WZCA 3WK4A 3IBTA 1Z3CA 1USIA 2W0MA 4FMCF 3LLUA 3ED5A 2RHLA 3NASA 1TM3E 3MGAA 3OU7A 1A2QA 4OXIA 1FSPA 1XZHA 1DRKA 1IZ7A 2IX9A 3ADPA 4OJKA 1QRUA 1VI6A 2NU7B 1FNCA 3G9QA 5ESDA 2O8DA 3SP1A 3O4VA 4TKZA 5JZSA 4TWRA 2G9QA 1OTXA 4G0OA 1RYHA 4CIVA 3NTRA 3QXHA 3AY6A 4TGLA 5HF5A 5BSTA 2V96A 4B34A 4LJAA 2OGZA 2QJTA 3G2LA 3P4YA 3A6DA 3P9QA 2DBZA 3LQ1A 2JIPA 2ZJ0A 3VKHA 1Z8DA 3EC2A 5EP2A 1M66A 3UPTA 2DY1A 2XCLA 5KTRA 1GUFA 1EVQA 2XLBA 4RK0A 5B1SA 1M83A 1OBFO 1DWQA 2K2WA 4PBTA 5T5QA 3D64A 3TLAA 3VKVA 1M34B 1Y3FE 3EXHC 5E2BA 4EDFA 5LL6P 4QWMA 4US0R 2WWXA 3BQNB 3H5NA 1R0BA 2FW8A 4G0NA 5IASA 4QM6A 5JJLA 2UZ3A 3ZKWA 2XTZA 1L8AA 4J1QA 5FLEX 4DT1A 3I8OA 3ZU2A 1YA8A 2K2QB 1GG5A 1SZPA 5EQJB 4CF4A 1EXVA 2QKYA 2A5YB 2P35A 3EC1A 4ZO6A 4WJLA 3G8DA 5F21A 3T0IA 2WSSA 4J94A 1RCTE 1X38A 3GPIA 3TE7A 3WRWA 4D99A 2LE0A 1TUBB 3O4GA 1Y4ZA 3QX8A 3PHCA 3G0BA 1WUTA 4M46A 1WPQA 4BMYA 4DDKA 3E9ZA 4H7IA 1VIMA 4JJ6A 2Y6UA 3PTAA 2VDQB 3EG9A 3NGMA 4OQYA 3NTOA 1FMCA 4C2TA 2HCJB 1KHTA 5AVUA 4AJJA 4TN5A 3QXJA 2I29A 3VC3A 5I7OA 1DQRA 4Q6WA 1GGEA 1ZGZA 5KC8A 1LC0A 1Q74A 4I4IA 1HO3A 1WCV1 4Q7QA 2BH2A 2K7FA 5CA0A 3FMOB 1WBBA 4HQNA 4R41A 1E9DA 3DDCA