1LF0A

Crystal structure of rasa59g in the gtp-bound form
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTGGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein P21/H-RAS-1
publication title The Structural Basis for the Transition from Ras-GTP to Ras-GDP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 66
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1lf0A00
1NBMD 2ZRJA 3CRW1 2X2FA 4ABYA 5DN6D 1KO8A 3BB3A 2ERXA 3OIYA 3LFUA 2QG6A 3THOA 5BN5A 2CLCX 4MYHA 3K0EA 3MGCA 3EZ2A 2C8VA 2ODBA 3KJGA 5A0FA 4OI4A 1Z28A 4BRUA 1G7TA 1W1WA 621PA 4I4LA 1P4SA 1TTTA 3RABA 2J41A 1OFHA 4PQYA 4HB4A 1QHNA 2ZYWX 5L3VA 1A2BA 2F9LA 4BZQA 4C0JA 2RKOA 5SZJA 1MOZA 1N6PA 1NLZA 1XEXB 2ZANA 1W36D 4KJZA 3GFPA 4NCKA 4JT2A 1W7AA 4HYYA 2JJ2D 4NL4H 5E3HA 3IHWA 3Q9LA 3SQWA 2ORIA 2OV2A 4OHVA 1M6NA 1T3SA 1KO5A 1DAHA 3KQUA 3A6PC 1AZSC 2VEDA 4XVUA 421PA 2H1LA 3DOEA 3TAHA 3T1OA 4NYMQ 4US2R 3OEEA 4PAOA 4BECA 1VCIA 4NDZA 2R62A 3SYLA 1SVSA 1CRQA 2QTHA 4L15A 3N2EA 1V43A 3KL4A 1M8PA 4Z8YA 3ZZTA 4EUNA 1ZM7A 4TSFA 3ZQJA 1E94E 2BDTA 2Q3FA 3EASA 2GF9A 2WJHA 3VR6A 1KI4A 4R7ZA 4FMDB 2VLIA 4FXPA 4W5JA 4HAUA 3GCGA 1Z2CA 2AWNA 4HLDA 4M1OA 4PC1A 3VR2A 1L4UA 3SFVA 2GAAA 5A4JA 2EFGA 5FUWA 3EPLA 2CCKA 4DVGA 2IYQA 3EG5A 2GCNA 1X8JA 5J4KA 5K8IA 1II9A 1S96A 3CR7A 4PO9A 4D2IA 4Q4JA 1BKDR 1IQPA 1XRJA 2NO7A 3CR8A 2PZGA 3LX5A 4FN5A 4DJTA 2OZEA 2ZSAA 3U3JA 2XGJA 4B3DA 4LHYA 4Q48A 3LY5A 4DLSA 1JNYA 3GLFB 1Q0UA 4E03A 2REBA 1LV7A 5G3YA 1DAKA 3B6EA 3A58B 3CRRA 4WBSA 2D2FA 3LLUA 4PX9A 3WRXC 3HPRA 3O8DA 1W46A 2ZQ5A 4TLAA 3PG5A 4GZMA 4ZCMA 2WWHA 2ANBA 1BIFA 1ZINA 4PSAA 3AP3A 1KNQA 3EZ9A 4XWAA 5HKKD 3TQFA 1H65A 3UG6A 3WMEA 4KITB 1XCPA 1H8ED 5TY0A 5AJXA 2FOLA 2PX3A 1E2FA 1G7RA 1EFUA 3PVSA 1CJVC 4LYAA 3RS4A 5JMTA 2JJ8A 1TMKA 3EZFA 2IWRA 1GNQA 5K8LA 5KOYA 1NY6A 1F2TA 2CXXA 1K8RA 3MFYA 2IA5A 1G4AE 2REOA 4NONA 1S1CA 4G1UC 5EE0A 4AC9A 1OF1A 5IK2A 3RNLA 3TE6A 5KU1A 4MKHA 1OE0A 1XTJA 3B82A 4JVNA 1Z47A 4H1UA 2DFKB 5LD2C 3QKRA 1ZD1A 1AJEA 5TDHA 821PA 3FTQA 1KI8A 1II0A 3TQCA 3CO5A 5GJCA 1FMLA 2MSCB 3B5JA 1Z0FA 3TMKA 1T8UA 5FBQB 4ESHA 4US0R 4HAVA 1E0KA 1Y3AA 2WICA 2ZETA 1P60A 4KFSA 4KYUA 2KBEA 2V7QA 3LXXA 5DN6A 4B3XA 1G18A 4DDTA 1JJ7A 2QQ0A 1SQ5A 3R20A 4K8OA 4IXMA 4O3MA 1W0KD 2PCLA 1KAOA 4Q19A 4I1SA 4Q4JB 3TGPA 1RYHA 5GVRA 2H16A 1GILA 1UEIA 3UANA 1IN8A 4NYIQ 2WWXA 4QJ5A 4B73A 4LJ7A 4IJMA 4IW3B 3SFZA 5JZVA 1KJYA 2WWGA 1FUKA 2OE2A 3L82B 4PZYA 4RZUA 4ZDKA 2ZJ2A 2QI9C 4V0NA 4ZKDA 1KI2A 2JLUA 1Z63A 4P3YA 1FL9A 4A0HA 2JDID 2ZJZA 3PXGA 3U6KA 3TVTA 1RPZA 3SE0A 1RRPA 3K9LA 4GI7A 2ZSDA 3EIEA 2YHSA 4YLGA 3RYTC 4R98A 4QGAA 1UF9A 2CNWA 5L3RA 2BMJA 4LJ6A 2NGRA 5CIQA 3F3YA 4CGZA 3LW7A 2JASA 4PO1A 1OXTA 1L7VC 4HLQB 4HZUA 5KNCA 3QVUA 2QAGA 2A3RA 4FMCF 5C4GB 3SEAA 5FPYA 1PZNA 3L0SA 3K0CC 3OESA 1ZU4A 2GXSA 2GVDC 4IOJA 3REFA 1KK0A 1Z22A 1D2NA 4LJ8A 1VKJA 1S0UA 3OF5A 2CE7A 2CEAA 3QKRB 1I2DA 1E2QA 3GJ7A 2AK3A 2P5TB 4S35A 4RY2A 1F60A 3L8YA 4DSOA 2FWRA 4ZPXA 1VIYA 3ETLA 4LDJA 4PSVA 5BWMA 3DL0A 1YZQA 1G64A 4G0NA 4K81B 2KBFA 1SVMA 4KFRA 4ZIRA 3AVUA 2FE4A 2R44A 2J9RA 5B64A 5HKKA 1IXSB 1WB9A 3U3MA 4EQ6B 1UEJA 5SZIA 3TBKA 1DAFA 4YMTA 4C0QC 1DADA 1KO7A 1I4TD 4PPFA 5HE8A 5HZHA 2QPOA 2GTPA 1H8EA 4NPHA 1A2KC 5FH9A 4B74A 4AD8A 3PV0A 1NKSA 4IEEA 1P9NA 3ZH9B 3CM0A 1MO6A 3GLHA 1PVOA 1G6OA 1YHNA 5B2ZA 4GNKA 4B3GA 1M74A 3EXAA 2R6CA 1ZM3A 3P32A 3T06B 4CEJA 4FINA 2H8KA 4IDOA 1N0UA 4AIIA 3LAWA 5L3SA 2EFDB 2R6GA 1E9SA 1XXHA 3K70C 3BFKA 4F92B 1FOEB 3PEUA 3GJ3A 1KO4A 2NZ8A 1AGPA 3U2QA 2RHMA 2VP4A 2FFHA 2RB4A 3CNOA 4UNSA 5EZ6B 1FTNA 4HAXA 4TYPA 4BFZA 4DSTA 4URZR 1TF7A 4DCUA 1GTVA 4Q02A 4MA4A 4TTPA 3GEHA 4HZUB 1J90A 4FWIB 1ZBDA 3ADDA 3B1VA 4XWKA 3ADKA 5KSYA 4Q7JB 1IN4A 4LI0A 2ZITA 4XSHA 5JEEA 2OLKA 2JLZA 4MKFA 4OI1A 3QKTA 3BH0A 1ZUNB 2WPDA 1XEFA 2QE7D 1R6BX 1FP6A 4TMWA 2XTMA 2GZHA 4Q1AA 1RIFA 2PZFA 3CRMA 5EP3A 1U98A 3AB3A 3BJIC 2ZU0C 5FPKA 4ZV4A 3DEFA 4CIDA 2IXEA 3KKQA 2PJRA 4KI0A 2JDIA 2VRWA 1YJ5A 1A7JA 4ZIRB 1C4OA 4HUTA 1LY1A 3M0EA 1SXJE 4QBHA 4B2LA 2NPFA 3P1JA 1QVRA 5F9FA 1AS3A 2QENA 4PC7A 4I1OA 3U3RA 1YZTA 1ZUIA 5FBLB 3RANA 1OJLA 4HDCA 3PUYA 3CZQA 3VR5A 8OHMA 3PUZA 3EX7C 3WBKA 4JKYA 2QP3A 1LB1B 5KO2A 1MRSA 2YWHA 3GLHB 1AKYA 2ZE5A 3RRYA 3PEWA 3K9HA 4NYJQ 4DLXA 4AY2A 1CP2A 3N2IA 3SYNA 2IL1A 1CS4C 3CNNA 2WKRA 1JEDA 2OEPA 3OAAD 3BBPA 4YDHB 2VH5R 1Q22A 3THYA 1E2LA 1XXHB 4IKEA 1RW4A 4TL8A 4DDWA 4PPGA 2QSYA 4QNMA 3U7HB 4BE7B 4QM7A 3B85A 4RFVA 4JMPA 1NL3A 4QBIA 4ZCIA 2ZR7A 1WF3A 5DHFA 4OHZA 3MMPA 1K6MA 6Q21A 2EQBA 4IVRA 4QM6A 1E69A 1CEEA 3H84A 3B13B 3NBYC 1JPJA 4M9SA 5ELXA 5C2JB 2LKDA 4UNPA 3GJ5A 2PH1A 5HZKA 1P72A 4P4UA 3Q72A 1XPUA 2J7KA 4B33A 2WWIA 1KDRA 4II7A 5E95A 3GJ6A 4C0LA 2OBLA 4NMMA 2YJTD 2DR3A 4DUGD 4O25A 2A5GA 4HLUC 4LJAA 4Q7MB 4IRUB 4K46A 3T15A 5AUOB 1VYTA 1DVRA 1BO6A 1XEWX 3I3SR 4M4SA 2Z4RA 1OIXA 4TT3D 1IM2A 5DSZA 2R65A 3GFTA 5CLQA 4NTZA 4A2WA 5D3MB 3U6BA 4YMSA 5HCNA 1OLOA 4FMDF 1GWNA 1S1MA 3ECCA 4PHFA 2Z4SA 3TKLA 4LHXA 1IXRC 1TL7C 5FI0B 3ZYCA 2ECKA 4DCNA 4UNRA 1OV4A 4M1TA 5CDFE 4A2QA 2FU5C 2DWQA 2VL7A 3DM5A 3C8UA 1E2HA 1NP6A 3AV0B 1GDDA 2WJVA 4DIEA 4CT4B 2QZ4A 3F8TA 1N6OA 5D3QA 2ZS8A 3CF6R 1W5TA 1E2NA 2YOFA 2C77A 121PA 2ODWA 3FFBA 3B1XA 3KB1A 1E79A 1HURA 4KLZA 3A1SA 1G17A 3TUZC 4ITRC 4M53A 3GLIA 3P4XA 2FG5A 4URYR 4XSGA 3H0KA 1Q12A 4U00A 4B71A 1L4YA 2PBRA 2BBWA 4M9QA 1IY0A 4D81A 3W5IA 2QA5A 3THYB 5JWHA 4QGGA 2QE7A 3S1AA 2C98A 3WYAA 2CE2X 3TUJC 2PEYA 2W58A 1KK1A 5GVSA 5FTKA 1CBUA 4WXRA 1P2UA 4QBFA 1R0YA 2EFCB 5DISB 1ZP6A 4Z51A 2IS2A 1Y63A 5B30A 4R2HA 4DCTA 4BGDA 1GFIA 3CRQA 3FKQA 1BS1A 1QBKC 2OUKA 1CR1A 4LYJA 5KSOA 2D06A 4YC7A 5FTNA 3F5FA 1N6RA 2R6FA 2IBMA 4TLDA 1YE8A 4URXR 3CKLA 2W00A 1KI1A 4A6XA 4HUQA 5KPJA 1TUIA 3RAPR 1G16A 2QPAA 2NIPA 2J0VA 1W4BA 1GKYA 4RD4A 1KSFX 1U81A 3L0IB 4C3ZA 3K0CA 4MGYR 2JLWA 2JIZA 5HE9A 2P0EA 4PPNA 3HU1A 5LD2B 4PANA 4FWTA 3L43A 4M1YA 4LJ4A 1L8QA 2ERYA 3OAAA 1QHSA 4M1KA 2F3TA 1ZNZA 4Q1CA 2J46A 1WDTA 1P61B 4KO8A 1E98A 3QXJA 5FOUA 3RWOA 1MO4A 1NVUQ 4US1R 2QU8A 2B8TA 4RZ3A 4V02A 4QG7A 5TXGA 1EESA 5JS8A 4KVAA 2FGKA 5J4LA 2FJUA 1N6LA 2QY9A 1DTSA 3ZIAD 1EWQA 2E1RA 3JVVA 2IYXA 3QNUA 1UADA 2C96A 4AKIA 3MD0A 2WSSD 5JRJA 3B60A 1W48A 3AVPA 2IEZA 3QF7A 2VSFA 2IEYA 2HCJB 4A0FA 2RGBA 3D6TB 2G0NA 2CK3A 5CLLA 1KKMA 2BVNA 3UWKA 3GLIB 4JSTA 4OI2A 3ZDQA 1E9DA 3KXKA 4H1VA 2RGNA 4ZDJA 3E70C 4WIAA 1N2CE 3VQTA 3RSLA 5FL3A 2FSGA 1TQ4A 4O2RA 1XBTA 1G5PA 2AHOA 2IYZA 4Q7KA 1AGRA 3C4JA 1SHZA 2ZRFA 3GMTA 3ZS9A 4B44A 1NI3A 5DE3A 4LBYA 2W6JA 3ZJYA 3LQQA 3LBHA 1YQTA 1G3UA 3PQCA 1UDWA 1WMSA 5JJIA 1TU3A 1MH1A 4Q00A 4Q01A 2O8FA 1XMVA 1SKYE 1ELOA 1GITA 4CYMA 1M34E 1DAMA 2A30A 2J59A 1E3MA 1CR4A 2QP9X 1N0VC 2C2HA 4HUQB 4JLBA 3ZZ0A 4BZXA 4IVQA 3KQNA 2JA1A 1ZAKA 2NO6A 3T1TA 4TSFD 1TNDA 1CJMA 4ERNA 3TSWA 4QL3A 1HT1E 2OILA 4C0SA 1S2MA 1JAHA 2BCGY 3T35A 4FIDA 3W34A 1RJ9A 4PTLA 5HR5A 1Q1BA 1GUAA 3VHLB 4G5GA 4ASUA 4EPYA 3SU8A 3A4NA 4JLKA 1E6CA 1EX7A 3NXSA 5DGXA 1E2MA 3IIJA 5B57C 3HJNA 4B75A 5FOSA 4XTCS 3U7FB 1L2TA 1G6HA 1KY2A 2ODNA 2MSEB 3AUXA 1FQJA 4J0QA 5KDLA 3RS0A 2C04A 3IO3A 1DAIA 3RRMA 1XEXA 4NE2A 5E4FA 1OXXK 3VFDA 2IYLD 2GEVA 3A1UA 3DZ8A 4ON9A 4NU0A 4EAQA 3WYFA 3WBJA 2GDJA 4GOXA 4P32A 3UG7A 4PAQA 1D8TA 3WP1B 1AKEA 2NO9A 1XNJA 2GESA 2HYDA 2XJ4A 4Q47A 4QOSA 5H1YA 3TAUA 3WNDA 1NNEA 4PR0A 1CRPA 4JBYA 3FPAA 3R9XA 1U9IC 1AM4D 1G3MA 1KYIA 3QKSA 4DLVA 4E07A 3ZVNA 3LLMA 1GZSA 4FI3C 1DO0A 5DH9A 2H17A 1XD2B 3DZDA 3W8NA 3ZVRA 4BLPA 4P0TA 2A7QA 3K70B 2VSOA 2OBMA 2W6ID 2BMFA 5G40A 5JWOA 3EZ7A 3Q5DA 4UJ5A 3O8CA 1X6VA 3A1VA 2ZAOA 2FNAA 2RAPA 2ZRHA 3RS5A 4G5QA 2WM9B 4NCHA 2JLRA 1HE8B 2O8FB 1XP8A 5IK2D 4D6PA 3ZVMA 2ZRKA 5FR1A 1TPZA 3W6NA 2JLVA 1E1RA 2W2TA 1NKTA 3TSOA 4AURA 3LBIA 2GZDA 4ILEA 4RCYA 2ZI4A 3NBFA 3U44A 1E2KA 1OH5A 2IYSA 2VP0A 1FPMA 2QM7A 4XH9B 5EXTA 2IK8A 4V0OA 1JAIA 2QGNA 2WSSA 3C15C 1FW6A 2QAJA 2V54A 3QVVA 4B6EA 5LBIA 2HT6A 2V7QD 2GCOB 3U61B 3NEJA 1NSTA 5FTJA 2WTUA 3OE7D 4YONB 1ODFA 4IOMA 2VP2A 4FCWA 3UKDA 2Q0HA 3I5XA 3QI2A 3FE2A 3BFVA 1OIWA 2RCNA 4OHXA 4PFSA 3WHLA 2OXRA 2FSFA 4Q4AA 5JJKA 4RVCA 2XITA 4V0ME 3TJZA 1NRJB 4QGFA 2JLXA 5CITA 2B6HA 4RZXA 1Z5ZA 4A0GA 4B34A 1QHXA 1ZNYA 2P67A 3NBXX 4PQRA 3EPHA 1WXQA 3BB1A 2H7VA 4FW9A 3ZGXA 3ND9A 4KFUA 3SJCA 5TVKA 2V4ZA 1N5IA 2ZSFA 2YVUA 2CMKA 3GJ8A 4LJYA 3MRSA 3TSZA 3VR1A 2O5VA 4A8JC 2QT1A 3QKSB 4OHWA 2PMDA 5J5CA 1P9RA 3VR3A 3FOZA 2G83A 2IWHA 1XTRA 3ICEA 4PC6A 3IQXA 2VO1A 3DHWC 2CNWD 2P2LA 1XMJA 2FV8A 2IYRA 2R6AA 2XTNA 1UKYA 1D9ZA 4JT4A 3VMFA 2QSZA 5BW8A 3IQWA 1F2UB 1AQYA 3VHXA 3N70A 2UZIR 4KXFB 3K09C 3SC3A 1R5NA 1P73A 4Q1DA 1W2GA 2IF0A 3TR5A 4RKFA 3RS3A 1ZD8A 3TUIC 3FMPB 4W5HA 4IXNA 3T12A 2ZEJA 1QVAA 4IVPA 2OBNA 2X1VA 1COWA 5DO9A 4B32A 2XAUA 1UBCA 2OAQ1 3NWJA 2N46A 4TMVA 4A4DA 1PLKA 4MUAA 4QHSA 4DWJA 1JECA 5CIWA 1RFLA 4AK9A 4TYQA 3U44B 2ZRMA 5JS7A 4TL9A 4LPSA 3I8SA 4A15A 1HQCA 1ZCBA 2CCJA 1EWRA 4TMKA 2YWEA 2A78A 2WWYA 1SZPA 5C18A 5DNYB 2GKSA 2C99A 2XZLA 4HEJA 1NVVR 2E9SA 1NMZA 4PC3A 1OXVA 1T0JB 2D2EA 5DLQC 2RGAA 1S3GA 3IKJA 1G7CA 1U0LA 2VA8A 1UPTA 1MABA 2QNRA 1SXJD 2YINC 2WMOB 3I5YA 3Q7QA 4Q4AB 1R5OA 1EFCA 2W6IA 2GETA 4GDFA 4BLOA 1KI7A 1ZIOA 2WKPA 2XJ9A 4PXAA 4IFEA 2O8EB 1R5BA 4F38A 4A2PA 1S3SA 3AF0A 3SHFA 1WBDA 1TU4A 2WAYA 3THXA 4TWZA 2AKAB 4DEYA 1WP9A 3TRFA 1VG0B 4YQFA 3DO6A 3OIVA 1YVDA 4LHZA 4GT1A 4G5RA 4ZDIA 4LSGA 2Z0MA 1HY3A 1CTQA 4BFXA 4C0HA 5P21A 1G8YA 3EARA 3B2EA 4GZLA 3Q8XB 4AG6A 4BZPA 4HAYA 1VIAA 2F1IA 3KJEA 3KKMA 2FFQA 2DFTA 1T9HA 1LFDB 3AF2A 1UKVY 4MRRA 3IBYA 1K5DA 1NLFA 3OE7A 4EQ6A 1MO5A 3W90A 4DSUA 1GOTA 1YRAA 4M22A 4UXHA 4YXWA 5HPYB 4EJSC 2GA8A 1IBRA 3A4LA 4Q4HA 2WPDD 4ZCLA 1JBKA 1XTSA 2BBOA 4NBSA 3X1YA 1P2SA 1Z0DA 3EA5A 2ZPTX 2IF2A 3IEUA 4G01B 1AS0A 4PHGA 1WRBA 1XB2A 3BD9A 1HQYE 4Q03A 4LCBA 2CJWA 2V1UA 1OKKD 2K5UA 3CWQA 3K0FA 2DY1A 1ZM9A 4EIWA 4MYTA 3AF3A 1IJEA 5KUTA 3R9WA 1P6XA 4JLAA 2Z5FA 1II8B 5FOWA 3VU9A 4DLRA 3MUFA 4B47A 1MABB 2NG1A 3LBNA 4HI0E 1WCV1 4TLBA 4F4IA 1Z6YA 4D80A 2HLDD 4JYBA 1S9DA 2ZI9A 1UFQA 1G21E 1N6HA 4UNNA 5TMPA 3ND8A 1G3IA 1XCMA 3THXB 4OKSA 5K8TA 3QE0A 1RKBA 1US8A 2PCJA 4JVSB 2H92A 2W0MA 1RRGA 4MDFA 2QN6A 1U9IA 2QTFA 3NKVA 4PZZA 5EJEA 3W8RA 2YKGA 2DWOA 2PX0A 4DLWA 1G19A 1SVLA 3RC8A 1QHHA 2VHJA 3X1ZA 1E32A 1TQ2A 3SOPA 1OW3B 4OK6A 3OEHD 1VDZA 5J4VA 5AUQA 3LA6A 2BKEA 3REGA 4AI6A 2ZRDA 4IOLA 4MQBA 1XZQA 3EA0A 1KJWA 4GSYA 1I4DD 1NBME 2IS1A 1OH7A 4G5OA 3BH6A 4LBWA 4BFTA 4AKGA 1GRQA 2WSMA 5BQ5A 1SXJA 2IS6A 4M1WA 1CU1A 4Q4HB 4U5XA 5C1BA 1V5WA 3PIRA 1PLLA 1CR0A 4OBEA 2YWGA 4RFSA 3DVLA 1QZXA 3QG5A 4C2UA 4TLEA 2A9KA 4DHEA 1E0SA 1U8ZA 1CKEA 2REXB 2ZR0A 3QEOA 1D5CA 2ZJOA 5JWRA 3GFOA 2CJWB 2J0SA 3PENA 1VYUA 1E2GA 1O87A 3CWZA 3K0FB 4HB0A 4Z1MD 2QQEA 1E1QD 2P6UA 2B21A 2VYFA 1N5LA 2JLYA 2V6IA 1EX6A 1JXMA 1Z08A 4B3BA 3U7GA 5H8WA 4Q9KA 1KI3A 3K1JA 1E2IA 3DOFA 5DYIA 1CXZA 4D26A 5CYPA 3VU9B 4Q9LA 3AKYA 2LCFA 4WVFA 3HU3A 1DBSA 3PUXA 4B3CA 1FX0A 3LX8A 2DFNA 3JVUA 4RZ2A 3TLXA 1F48A 5CK5A 3KDSE 1XU4A 4B3FX 2VF7A 2ZSBA 1E79D 4P31A 2QGZA 5DHAA 3ADCA 1JALA 1JPNA 3HYRA 4IFBA 2O8DB 1M7HA 2CLDX 3BERA 3CX6A 4KFTA 2IS4A 5EQTA 1E9FA 1KNXA 2BJVA 5FBRB 1S4QA 1US8B 4QJ3A 2ZJ8A 3IIKA 2GXAA 3C5HA 1VG9B 3IDQA 2OLJA 2C03A 2IW3A 3RHFA 1SKQA 2B8WA 1A5TA 1J7KA 4HAZA 2WWFA 5D3MA 2YV5A 1C1YA 2ZRIA 1OKKA 3W6OA 4B48A 1QHHB 1SULA 2ZUCA 4WOPA 4QRHA 2ZI6A 1JEEA 1IN6A 4X8HA 2D74A 2YYZA 3SHWA 3SS8A 4MITA 1Z0JA 2HCBA 1Z3IX 3HWSA 4C0BA 2FFBA 1SVOA 3HYTA 3OIUA 3RS7A 1Q3HA 2NTYC 3UIEA 3NG1A 3R8CA 3ZQ6A 1K5GA 1GG2A 1SXJB 4PZLA 1YZNA 3I73A 2AFHE 1GKUB 2VIIA 5CDFA 1N5KA 3AVVA 2RH5A 3IGFA 3HR8A 2HLDA 4RFSB 2JIZD 5A5GA 3A8TA 1Z6GA 1Z06A 4IEIA 2F6RA 3CH5A 4JLOA 3VNVA 2V55B 2CDNA 2WOOA 3X1WA 2WOJA 3LH5A 2XB2A 1GIAA 2OESA 5EXXA 2Z83A 3WP0A 5AJYA 2C5LA 5AUPB 2HYIC 3PJRA 3QOFA 2GNOA 3RC3A 2H57A 5KYKA 3RRNA 3IUYA 4LPKA 4OYHA 3KXIA 4EFNA 3QF4A 2RGCA 1FFHA 1VCNA 4KBFA 4N0DA 2ZAMA 2AL7A 5AJVB 2O8BA 5SZHB 2IUSA 4BFVA 1FX0B 5FOVA 1Q20A 4JLVA 2ZYUX 3OEHA 3R9IA 3GJ4A 4FMBB 5ANRB 4XJXA 5JSZB 1DAGA 4M1MA 2QMHA 3SNHA 5DYGA 3LNCA 4B76A 3VNUA 1AA9A 5JI3E 2CK3D 2OFOA 3GD7A 4TQAA 4NH0A 1MO3A 2FX3A 1Z29A 3DM9B 1JI0A 2ASEA 2ZR9A 1EG7A 1G3QA 2QTVB 1BH2A 4D0NA 4EPRA 4NYMR 1NVWQ 1GP2A 1W49A 5DI3B 1TAGA 2A2ZA 4JLMA 1SVIA 1O3YA 3B78A 3ZLJA 3K70D 2AWOA 2ORWA 5AUNB 1KZ7B 4DDVA 2W6JD 2WBLC 2GCPA 2C9OA 4A9AA 2GAOA 4CW7A 2XB4A 1CR2A 1ETUA 3FHCB 2GHIA 2JJ1A 2EYQA 5BN3A 4PC2A 5AK0A 3I92A 4JBWA 4Z1MA 1E2JA 1F6BA 3QEJA 1E1QA 1TF2A 3QENA 3WMGA 5KSZA 4KAXA 3MWLA 1TUEA 2JATA 4V0KA 3SR0A 2D4HA 3QG1A 1U0JA 3CB4A 5JHHB 1Z0KA 2P3SA 1DE0A 4YMUA 3L0PA 1AK2A 3OZXA 3GEIA 3KKNA 4JLDA 4JIMA 1KDOA 5EUMA 3AH8A 1Q21A 2O0HA 3CIOA 4E5UA 3EPJA 2G6BA 2IYTA 4A92A 4ASUD 1HTWA 1IY1A 3Q3JB 3R8FA 4CEIB 1EXMA 2OCBA 4DRZA 4Q18A 1G1MA 1Z8FA 1KGDA 1G8HA 5EXPA 5JLJA 3T1QA 2P6RA 3I62A 2FGJA 3G0HA 4MRPA 1XD8A 4BQSA 2F1JA 1DARA 4MH0R 2GRJA 2VP5A 2Y8EA 4Q1BA 3EC1A 1NJFA 5FL7A 4PAMA 1KDTA 4Y0AA 3QF4B 1P5ZB 5E7IA 1KMQA 3UMFA 4BEJA 4BFWA 2O8BB 2CL6X 3CW2A 1VMAA 1JQJC 4D4JA 2WJJA 3CPEA 4R9UC 4JL8A 4TYNA 1Q44A 2FF7A 1NY5A 2CHVA 2XEXA 2FPLA 1ESNA 3QXCA 3QJYA 1ZIPA 5BYJA 4D25A 1IOZA 3AVOA 2ZRNA 4MGIR 3MWJA 1UKZA 2IHBA 4MDEA 4MRVA 3GLGE 2VPPA 1IN7A 1Q3TA 1XEWY 2YOHA 2ZE8A 3D8BA 2A5JA 3U4QA 2Q3MA 2BOVA 3CZPA 4C30A 1HH4A 1ZU5A 2OCPA 1QG2A 2J7PA 4JS0A 1IY2A 3WRYC 3X1XA 2QRNA 4TMXA 4XVRA 3W9YA 1YR6A 2GILA 3IILA 2O0KA 1RE0A 4DCSA 1F3OA 5HTKA 1QDEA 1CIPA 3ASYA 4KYIB 1MT0A 4KVGA 1E9BA 3BWDD 3THWA 4DC9A 1E1RD 1QRAA 3LVRE 3QUSA 5AR1A 1OXSC 3U5ZB 4OQXA 4TTRA 4XIGS 4OHYA 2A5FA 3N5CA 1U8AA 4NZYA 4MKGA 4PO8A 4L9WA 2ATVA 4XWOA 1U8YA 1TF5A 4NYIR 3U7EB 2CCGA 2VHUA 1P9WA 2ZIAA 4Q7LA 4RD6A 5E7JA 5F98A 2P5SA 4KSBA 3V9PA 2BM0A 2ZE7A 3FMIA 3I8XA 1JR3E 1RC8A 4OQFA 3UMRA 5IT5A 3FMOB 4JLPA 4JL6A 1G7SA 2W83A 5H68A 4Q4LA 4C4PA 1Z6AA 1XD2A 4DEXA 3NTUA 2XXAA 1VHTA 3CNLA 5J4YA 4FMCB 3C16C 3QSYA 2EW1A 4XTRA 3NDPA 3NEYA 2OCAA 4JYCA 1JJVA 1KKLA 4PPQA 3BOSA 4HLCA 4Q21A 2IYUA 3GJXC 5BN4A 4DLTA 1Q1ZA 4YDSA 2QROA 4MYUA 1SVWA 5C46F 1ZC3A 3SYKA 4OL0A 3T1VA 3U3KA 4DCVA 1CJKC 521PA 2QMUA 4G3XA 2W0SA 1FMJA 3FKSD 3K0SA 4G5SA 3O47A 1P3JA 2O8CA 3KUCA 3KJIA 4LYHA 221PA 4KLNA 4AYTA 2NOAA 3F0TA 1SKYB 2IXFA 5J4HA 2UZ3A 2UKDA 3CLVA 3W3AA 4F4CA 3AVTA 2GJ8A 1W4CA 1AZTA 1UBGA 4S2EA 4X8OA 4CRWB 3U4QB 2GCOA 2WJYA 5FPTA 5GJWC 4BUJA 1N6NA 4RSGA 2ZUBA 1W36C 4LGMA 1R4AA 2ODEA 2ZU6A 2GWHA 4DXAA 1OFUX 3AP2A 4DB2A 1E0AA 1JQLB 4JLNA 4NP6A 3ASZA 3SQXA 4BLTA 1COWD 1XDBA 2HXYA 4URUR 2W2XA 3O8RA 1NN0A 1KOFA 2PT7A 3THWB 2RGEA 4Y0VA 3FHOA 3T5DA 1KK2A 4DLYA 1UAAA 2G0TA 2XSZA 2E87A 1VTKA 2PMKA 1E2EA 3IPYA 4V0MA 4XOIA 1BMFA 2GEDA 1YZUA 2GJSA 4YMWA 1QF9A 4QHYA 4DDUA 1NMXA 2ZJAA 1U90A 1G8FA 2R9VA 3SDZA 3LO5A 2FFAA 3E2IA 4JJKA 2QAGC 1VECA 3AKDA 4LC1A 3H4MA 4Q1FA 1T8TA 2J87A 2ZI3A 2KE5A 4P4SA 3KB2A 2XXAB 2V9PA 2YZ2A 1F2UA 1A82A 1EFTA 3KZ1E 5F9HA 1SHKA 4I81A 4WA7A 1GL6A 1J8MF 5CJPA 3WXMA 1B0UA 2R6DA 4A6PA 1KJZA 2R2AA 1RRCA 1R8QA 3MWKA 4KV9A 2G1KA 2VTKA 3U3OA 2X77A 2GXQA 4PSKA 1XJCA 3D31A 3ZD7A 2O8CB 3KKOA 3RVBA 3UMSA 5JCPA 3WNCA 4TQ9A 1OYYA 1I2MA 2ZRPA 4JSYA 4PHHA 1H8HA 2AXNA 5TB5A 2IYWA 2QM8A 1HA3A 1KSHA 3PUVA 1KK3A 1IN5A 4HLUA 4RD2A 5B58C 1FQKA 1IHUA 4EFMA 3EWSA 4TLCA 4POAA 3C41J 4PHTA 3PEYA 4LX0A 2MMGA 5EUQB 2H5EA 3UXMA 4YXWD 2O52A 1R7RA 2GZAA 5GADl 4I99A 2Q9AA 1ZNWA 4XD7A 4ZDWA 3IEVA 4MUBA 3BK7A 1XF9A 1ZVQA 4LY6A 2XZPA 4V03A 4JBXA 4L5BA 3FB4A 1FP7A 2BM1A 2R8RA 2O8EA 1G3RA 2VF8A 1VPLA 2JLSA 2EYUA 1G5RA 5IF9A 2ANCA 3HP1A 3HU2A 3IPXA 2OAP1 3V00A 3FKSA 2ZREA 4MRNA 4M9ZA 5G41A 4CZ2A 4NYJR 1ONBA 1BOFA 2D7DA 1VG1A 3CRVA 4C2TA 3B1ZA 3MJRA 4OK3A 3QXSA 4QJ4A 3AUYA 2GK6A 4DBLC 2OM2A 2PL3A 2FEMA 1Q57A 4P4SB 2AK2A 3L8ZA 2ZRGA 4MRSA 3NH6A 1W47A 3CF0A 4QC2A 5GJVC 4BFSA 4CDGA 2GXUA 3QY0A 3PCRB 2WAXA 1E4VA 3EZ6A 1M7GA 1NN5A 2IHYA 3ZS8A 1EFHA 4Q9JA 4JZKA 1XPRA 2JLQA 5TARA 2D7CA 5CM9C 3VTKA 1KSGA 5KDOA 1GM5A 4O2LA 3IBGA 1W2HA 2HUPA 2BCJQ 4URVR 1LVGA 4WZ6A 3ONWA 1NIJA 1XJ0A 1IAQA 2HXSA 3MJHA 2Q3HA 4EKDA 3BIFA 4X8LA 2ZS9A 2BMDA 3IHLA 4W5WA 4AYWA 4WZBE 2YOGA 3QIAA 2MMCA 1Z0AA 3T34A 2HV8A 3BS4A 4UXIA 3TVDA 3GLFE 2DYKA 3MCAA 4C7OB 2BEKA 4GMXA 2ZI5A 1HEIA 4OQMA 3V4RA 5FUYA 1YRBA 3PITA 2XNDA 1IJFA 1CULC 4LV8B 1ZRHA 2F9MA 5HCIA 3KFVA 3MG9A 1S9HA 3ICQB 2ZXUA 5AJWA 1II8A 5F2EA 3AVQA 3SBEA 2OCYC 2XX3A 1VG8A 4DLUA 3W6PA 5JHGB 2ZJBA 2N1BA 3VX3A 3GQBA 2FPKA 1G8PA 4MKIA 2JAQA 3I4LA 3RDPA 1OT3A 3B1YA 1GKIA 1GRRA 1XFAA 4EFLA 5FBVB 4HZIA 1OXUA 2D62A 1LW7A 2NQ2C 3I72A 5JEDA 2PT5A 4NHOA 3PFIA 1R8SA 2OT3B 4LK2A 2VHQA 1W0JA 1ZM2A 4KU4A 3TW4A 2P6NA 1FNMA 1KIMA 1U94A 5KSPA 3GPLA 4N0EA 3RLFA 2TMKA 3A4MA 2IX3A 3KQKA 1N3BA 3EIQA 5TV2A 4WXPA 3HDTA 5IRCD 5L3QA 4LBVA 3H86A 2CL0X 2GVZC 3QXHA 4TL6A 4GOJA 3SJAA 3KTAA 4L9SA 4CEHA 2KI5A 3NC1C 4NCJA 4TMTA 1E4YA 2EVWX 4X8MA 3BORA 3KUDA 2DFLA 3B1WA 2HEIA 3NDBB 5CYOA 5CK4A 2F3RA 4EPTA 1IXZA 1JR6A 2I1QA 1UM8A 2WKQA 4EPWA 4IOKA 3B9PA 3FHTA 1M1YE 2JGNA 3NVAA 3B7GA 2Z6VA 4GL2A 3LVQE 2CHGA 1J70A 4JVLA 1E9CA 1W5SA 3WY9A 3DMNA 1NBMA 3NBZC 1Z83A 4ACBA 2HJVA 2ZYTX 2AKYA 4D4LA 3TIFA 4E09A 3FGNA 1T5IA 5IDVA 4C0AC 2HJGA 1J99A 2ATXA 3C5CA 2BEJA 2ZVPX 1RVDA 3TW8B 2C95A 1KMHA 4U02A 1J2JA 1KI9A 2GJAA 5J40A 3CF2A 3D7MA 1D2EA 1D9XA 1C9KA 1OIVA 1TQ6A 1E96A 2X19A 3B8HA 2JJ2A 5FPHA 4LC0A 4P4TA 1A4RA 2OHFA 1UJ2A 4ZO4A 4B2IA 2WV9A 3P27A 3A1TA 2F43A 4TL7A 4DT1A 1WA5A 4BFYA 1EFRD 1MV5A 2FZLA 5FBWB 4ACAA 2O8DA 4HDOB 1SVKA 3GP8A 4B6FA 1KHTA 2SHKA 2CVHA 1AIPA 1YR7A 4LV6A 1KY3A 1Z6XA 2LKCA 1YR8A 5FUXA 3M4YA 3M6AA 2VP9A 2FZ4A 2W2VA 4GP7A 1P7CA 1R2QA 2QL6A 5EP4A 5JBQA 1OH6A 1LS1A 3B9QA 1KTVA 1NSFA 1RRFA 1TQDA 4WW0A 3FMFA 1M7BA 2FA9A 1R0XA 5L3QB 3E5HA 1CF4A 3K9NA 1F2TB 2IYVA 3KTAB 4RD3A 2CVFA 1RZ3A 3AGPA 4QBGB 4CEHB 2A5YB 1ANKA 1I4LD 1U99A 2L0XA 2P65A 3AEZA 1T0HB 1DELA 2WMNB 4IDHA 4HDQB 3TH5A 1MKYA 5KHOC 4TZ0A 4B2PA 2FH5B 4D0LB 5CJ2A 1Z07A 3BRWD 3K8YA 4FD2A 4QXAA 4R2IA 4EPXA 5J47A 4DB4A 1DEKA 2GEUA 5LPNA 2LWIA 4DIDA 2H18A 5JI2E 2NO0A 5EP1A 5EXSA 2C78A 4LYFA 4BLSA 2Z43A 4ZI3A 5EE3A 3LRPA 4DZZA 1YZLA 3LDAA 1ESMA 1P2VA 1U2RA 2YWFA 3NHBA 4EDHA 1E0JA 3Q85A 1Z0IA 4AWXA 1IONA 2I4IA 2DWPA 3DMDA 2JEOA 2XOKD 2XZOA 2G88A 2XNSA 2FEOA 1PV4A 2Q9BA 1LNZA 3KXLA 2JJ1D 4TZ6A 4M8NE 4OQLA 1KI6A 2IUTA 2HDNB 2A5DA 2ZRAA 2IUUA 2AD5A 4BLQA 1KMHB 5EE1A 4L8GA 2BKUA 1W36B 4LBZA 5FTLA 2FSHA 1T3LA 3C7KA 2NMVA 1RYFA 3UWOA 3BE4A 2RGNC 4RKEA 3QBVA 2QMEA 3R7WA 2F43B 5EP2A 3AVXA 3EWAA 3OIWA 4RD1A 2WHXA 5JSZA 2WZQA 4U7DA 4DT1B 3AM1A 2VBCA 1F5NA 3QPWA 1P2TA 4HB2A 1B23P 3P4YA 4GPTA 2XTZA 1VCMA 1T91A 4V0LA 2F1RA 5EZ5A 1X3SA 1N25A 3Q7PA 2C9CA 3K53A 1FUUA 2VHCA 5DI3A 3O8BA 1FTSA 2YNMA 4RCZA 2BWJA 4BLRA 1R0ZA 4GMDA 4A8JA 1JR3D 1KZGB 3MAAC 3ZD6A 1M2OB 2KJQA 5FL7D 4BASA 4Z8XA 2KSQA 3AQ4A 4D82A 5KNDA 4GBMA 4MGKR 2QAGB 1OFTA 3CUEF 3LD9A 1T5LA 3SBDA 2HT1A 1KSJA 4WAUA 2FN4A 2RGDA 2WJGA 4AYXA 5EE5B 1XTIA 2O0JA 1UBEA 1OFIA 1W0KA 4OQNA 3C14C 3NC0C 1GVNB 4Q9IA 2QP4A 3EC2A 1X86B 1XPOA 4RD0A 3K09A 3VR4A 4JVMA 5CB6A 3D3QA 4NKRA 1P75A 2X8AA 1JXOA 4KHZA 5BYKA 2ZROA 1YZKA 3TR0A 4QFMA 2OFXA 3LXRA 4TYWA 1E99A 3HR7A 5FOTA 1NMYA 3VKWA 5KNBA 3QPVA 3QXXA 1LS6A 4QHTA 1CLUA 5KPDA 1EFRA 3U60B 4CEIA 1KAGA 2C9YA 3BAFA 2CHQA 2IXGA 3P26A 3P20A 2J7PD 1D6JA 3NHAA 3EW9A 4KSCA 2QT0A 3ZZUA 3FWYA 1PUIA 2DPXA 5LB2A 3A36A 2HF8A 3JZMA 3UATA 2BBTA 3GLHE 1ZJ6A 2QRZA 1KI6B 1FNNA 3K9GA 4N1AA 1VHLA 4L4UA 4FCTA 4D0GA 5F3WB 1E9AA 2I3BA 2OG2A 4KCGA 2ZE6A 1GAJA 3FYHA 4A82A 2Q9CA 5SZKB 1YU9A 1BYIA 2VQSA 2ZVQX 4HAWA 3ZVLA 1A1VA 1XXHE 4R71A 2BBSA 1TEXA 2I1VB 2FSIA 4CEJB 4BWYA 3R7WB 1ZC4A 1E9RA 5CM8B 4F4JA 2ORVA 2WVJA 2OXCA 3OHMA 5L3SB 4CF7A 2GBLC 3A37A 2VHTA 2GK7A 3ADBA 1VCOA 2ZJ5A 4D4MA 1UKEA 4KODA 1NF3A 1YR9A 4C9BA 2ONJA 3CH4B 3KFXA 4UQOA 1ZMXA 4A8JB 3CONA 4LJ5A 1HE1C 2AN9A 3GLGA 2MSDB 2XOKA 1Z6TA 3DKPA 5K8UA 3QBTA 3VKHA 4LJ9A 4LRWA 1Z2AA 3SZRA 4LUCA 4ZI2A 5FTMA 1OHHD 2OSBA 4DKXA 3LW8A 4ZKEA 2ZRCA 4F91B 3G5UA 4W7SA 2Q21A 5JCZA 4TQUS 3NH9A 3W3ZB 4UKDA 5LB4A 4B35A 3RRZA 3QKUA 4O0MA 2ZI7A 1YKSA 4D4KA 1NN1A 3QQ5A 5G53C 2ONKA 3X2SA 3FFAA 1DAEA 1HT2E 4EJSA 1NVVQ 1XWIA 2ZYVX 4CVNA 2X2EA 1XCGB 1MRNA 4LOAA 2AR7A 1HV8A 1X8KA 4Q66C 1DS6A 1ZNXA 5H70A 1XTKA 4BRWA 4B43A 1R0WA 2ZTSA 1EK0A 3CX8A 4M9XA 1AN0A 4UNQA 1GNPA 2Q6TA 3NIBA 3DDCA 3AGQA 1XD9A 2G3YA 4E22A 2RMKA 2JCSA 2V6JA 2PLRA 1JR3A 2J45A 3EAQA 2OO7A 3H2YA 2F55A 1NIPA 2B7BA 1AQUA 1CJUC 1TADA 1LF0A 3EIHA 1G5TA 2FPMA 4F93B 5AWFC 5LDDC 2J1LA 3I32A 2XSZD 1NLYA 4LWZA 1G9XA 5JECA 1TX4B 1E9EA 4YMVA 1BMFD 1MR3F 2V8OA 1XTQA 4LV5B 1XJQA 4AG5A 4ARZA 2RGXA 4HATA 2PJZA 2G9NA 4AKEA 1ZCAA 2BV3A 4GP6A 4UJ3A 3WYGA 4A1FA 2PLFA 3CPHA 2BMEA 1N5JA 4IDPA 1DG3A 1Q1QA 2KB0A 1NG1A 5FOXA 5C4MA 3AF1A 2WWWA 1GRNA 1G291 4I1VA 2VP6A 1T4GA 3OFND 1X1RA 3JZAA 2NZJA 3IO5A 3SN6A 4ESVA 5JRZA 1OH8A 3GLGB 2UVQA 3CBQA 5FUVA 4TYYA 4EPVA 1E2PA 2EU8A 3PUWA 3E1SA 1DG1G 1OYWA 3PEVA 4QKQA 1PUJA 1AS2A 4JJZA 2CBZA 3TNFA 2HF9A 1T6NA 1KO1A 1R10A 1UDXA 1ZUHA 3GEEA 3LWNA 4KBGA 2FDCA 4GRAA 5AJZA 4LHVA 4W9MC 1OB5A 3RWMB 2QUZA 3BC1A 4A0RA 3UK6A 5IHPA 1U0HC 1H8HD 2GJKA 4EJSB 1YZGA 3UPUA 4MGZR 3AVYA 1UBFA 1LTQA 1OB2A 1PLJA 1ZW6A 2FMXA 1QHGA 3A1WA 2DBYA 1GL7A 4MYCA 2CL7X 1OSNA 2RGGA 2J0UA 2N42A 5GJBA 5FR2A 3Q5EA 1N6IA 1D2MA 2WIAA 4XD7D 4PQFA 3I61A 2F1HA 3H1TA 3SJBA 5DIFA 2G1JA 3GLIE 1GL9B 3DKVA 2AX4A 4IDNA 4M21A 3VX4A 1W4RA 2EWWA 4JLJA 1XX6A 2GJ9A 3T5GA 4QGHA 4DLZA 4L16A 4C0KA 4URWR 1G4UR 3FDIA 1N6KA 2QEQA 1NG9A 3FVQA 1OHHA 1G8GA 3L0OA 3QPUA 5UKDA 2PZEA 4HB3A 1FZQA 2B7CA 5DI9A 3X1DA 1P62B 3PR1A 4DUGA 3WNBA 1NVXQ 1NJGA 2IC5A 3DPUA 3SJZA 4ARZB 5BXQC 3S1AB 3EPKA 3AF4A 4DSNA 2F7SA 1HUQA 1X8LA 2PEZA 2NO1A 4NCNA 4TT3A 3KJHA 1KDPA 2QORA 1G41A 5EE9A 2ZSEA 5M04A 5JFGA 4M1SA 1Q1EA 2G77B 1CJTC 3AKCA 1W44A 1ZM4A 2DHRA 1J8YF 1SGWA 3OEED 1VYVA 1X1SA 2J5XA 2ZRBA 3KKPA 2ZS7A 4M2LA 3LQRA 3K0AA 3SI7A 4LZZA 5G3ZA 3J81k 2DB3A 2BIFA 4IDQA 2D3WA 3LV8A 2VSXA 1TEVA 2OFWA 4Q5IA 5FPSA 4F7WA 4OK5A 2QBYA 1HYQA 2QMOA 2BJWA 3KX2A 2GF0A 4BEBA 1WBBA 4JL5A 4Q1EA 1WQ1R 4BPBA 4P33A 4OI0A 3BH7A 4Q9HA 2DCUA 1XZPA 3MWYW 1EGAA 1T3HA 2AD1A 2ZJYA 3KQHA 4OJQA 2WIBA 2XNDD 4IHQA 3RS2A 3BGWA 2EFEB 3AKEA 2J0UB 3V4FA 4H9GA 2IT1A 5CB8A 3KQLA 5KDDA 1XMSA 1ZD9A 1XMIA 3HPQA 4QNRA 3MSXA 3CX7A 721PA 4NCIA 1LF5A 3OFNA 3GJ0A 3CPJB 5E7MA 4TN1A 2QPTA 4OJKA 4AKHA 1E2DA 4BFUA 2AFIE 5FFMA 4RJLA 4A36A 3TK1A 1W0JD 2ZUDA 2YC4C 3MLEA 3VAAA 3WHKA 3WMFA 2WJIA 2V3CC 1G20E 2V1XA 4HSEA 3L2OB 1GSIA 2GBLA 4WZAE 3AVWA 3W5JA 1ZYUA 5JJLA 4GFDA 4GOKA 1NN3A 4CT5A 5KTYA 3VKGA 2YC2C 4LHWA 3T61A 5L8VA 1QHYA 2RHDA 4Z54A 3BXZA 2CLSA 2ZRLA 1DOAA 2BC9A 2B92A 3BFXA 1W4AA 3G82C 4C7OA 2EFHB 1QG4A 1S8FA 3AP1A 4FCVA 2IYYA 1SXJC 1DPFA 4I1UA 3BB4A 2J3EA 4TMZA 3M1IA 1OPXA 4UXJA 2ZM5A 4M0LA 2BHRA 3IIMA 3K0AB 4TTQA 3GLFA 5FI1B 1N0WA 2J0QA 1GNRA 2KWIA 3ZIAA 1PJRA 4JKIA 3RSOA 4N3NA 1WE2A 1DO2A 1BYUA 2AXPA 1QHIA 1JB1A 2EWVA 4XVQA 3I1FA 2QBYB 2NPIA 1RJ9B
chains in the Genus database with same CATH superfamily
1KQOA 4BATA 4ABYA 1Z5VA 1BG6A 1XTBA 4ITUA 4PPYA 3UT5A 4LMBA 4BQPA 5A5DA 2YY5A 5EI5A 5F12A 5DN6D 1TJ4A 3THOA 3T4PA 4ZEXA 1VE7A 3EZ2A 1T24A 1G7TA 4UHBA 3DXFA 1V26A 1QOPB 5KC8A 4HB4A 1QHNA 2H08A 2VJPA 2ZYWX 1PV2A 2R7LA 3NVMB 4Y3UA 4J0FA 4O63O 5SZJA 4OB6A 2ZANA 2B5VA 3MB8A 1N8KA 1C0KA 1X87A 3GFPA 1JU3A 3PYXA 2YX1A 2YJ3A 2XYRA 3IHWA 4ND8A 3ENVA 4WK2B 5FYQA 5MHTA 4JJAA 2OV2A 4LN1A 4X7MA 5EJ5A 3KQUA 3NBAA 2WYWA 3DOEA 3O3OB 4UCWA 4K6GA 4FLMA 1ZIYA 4YMGA 1HKUA 3OPNA 3WRWA 1HFJA 1VCIA 1WPXA 3K9BA 3SJ7A 4BL5A 3UV6A 1SVSA 1I0LA 2AOTA 2PWYA 2A67A 4ETNA 3A9CA 2QTHA 4L15A 3N2EA 4U7FA 4Y9TA 4BJ3A 3T3NA 3QX7A 4FZ5A 2UYQA 4Z99A 3ZZTA 4RMHA 1ZM7A 4UC0A 1OA0A 3FNHA 1FXUA 1E94E 2Q3FA 3EASA 1JF8A 2GF9A 2WJHA 4QQ8A 2B5OA 1DMSA 1ZD4A 1QGUA 1RKQA 3W5BA 5J2TB 3HDHA 1EZ1A 1CUAA 1Z2CA 1TVMA 1ZITA 1CT9A 4PC1A 4TV8B 3T94A 3VR2A 5A9RA 1WSAA 5IABA 3LHKA 3B48A 2PPVA 2FMHA 3DWGA 4H4CA 4JBHA 2EFGA 4QOEA 9GPBA 2IYQA 1X8JA 5J4KA 3IEKA 3DJFA 4YACA 2QUHA 1JX6A 1ZDMA 2XQVA 3CR7A 2ID8A 1PZGA 3DE4X 3NFRA 1FNBA 4LWPA 4D2IA 4FN5A 3LX5A 2NO7A 4C3VA 4DJTA 1JA0A 5AM3A 1NXPA 2VUHB 3O4JA 2XA9A 1JFLA 4EG7A 4LHYA 4I08A 5FA5A 3ND7A 1P3Y1 3L0YA 1Q0UA 5KJEA 3ED1A 2REBA 4F6RA 1PQPA 1M0SA 4E5VA 1O95C 1D3AA 4WBSA 2D2FA 3LLUA 3TNYA 3R0XA 1W1UA 3ETDA 3HV2A 4ZP1A 3NX4A 2ZQ5A 3BIJA 3N9IA 2G9VA 1WD7A 3PG5A 1GADO 4RVNA 2YXPX 5EJFA 4EVRA 4LECA 4ZCMA 1JEQA 2ANBA 3H8WA 3NHFA 2GFHA 1BIFA 3OKPA 1ZINA 4UUQA 2ESRA 5TPWB 2PTGA 4IO0A 3ANLA 3BYZA 2M98A 3AI1A 3NB0A 2FZKA 1YJBA 3U1BA 3SSOA 3DHYA 1RT9A 4PAGA 5FWXA 4FDVA 3TQFA 1H65A 1ZGZA 1H8ED 3HA3A 2H1CA 5DOVA 3TL2A 1GPUA 4LYAA 4OMFG 1C8BA 1ZNQO 4BZWA 3EZFA 1L4MA 4HMPA 2FEAA 1I0IA 5KYWA 3RU7A 2P9CA 2FSVA 5E1MA 3RUIA 1VMIA 1G2PA 4LKRA 4KVZA 1WZIA 4KR2A 1NUAA 1QC5A 3M6WA 3PE3A 3T5AA 1QNLA 4WZZA 2G80A 4BPRA 4EECA 1M8FA 2J5QA 5DTQA 3IIIA 4G1UC 1QKKA 2OB2A 1WS6A 1F8YA 4AC9A 2Y2VA 4HXFB 4LZLA 4M0MA 1THZA 5E0OA 5MN4A 4MKHA 1OE0A 1DINA 1T0BA 5LL6P 2GN4A 4BQFA 3GQVA 4B9EA 1JYEA 4G85A 1AJEA 4EEKA 5B3LA 3QUTA 3DB2A 2IKSA 1XJ5A 2PXCA 4QXMA 5EZYA 5T7BA 4ESHA 3GRCA 3P9YA 5EXDA 3HKDB 1UWVA 3A04A 1QFZA 2G71A 3EQ2A 3RROA 3VPSA 2ZT5A 2BFNA 3RSFA 5DN6A 4E3ZA 2V9CA 1M33A 3HA5A 1TVEA 1LSSA 2X3UA 4M1ZA 4DDTA 1ZJYA 3D1JA 4YB8A 1JJ7A 1J1IA 3R20A 4K8OA 4ROTA 3ZY4A 4R8RA 4BTLA 4F5DA 3DE2X 2PCLA 5DM2A 4Q19A 3GAMA 3ZLVA 2CXSA 3PJGA 1GPH1 2H16A 2WK1A 2C2OA 4DNOA 1BS2A 3L7IA 4JEHA 2PDAA 3ZGLA 5ESRA 4U9HS 4LJ7A 2P77A 3EZNA 1H22A 1DI0A 3KSDO 4QNNA 1ID8A 2ZGVA 5JZVA 1K92A 1KJYA 1Y9EA 2H1OA 1HTTA 3MGKA 3OZDA 3LSYA 3R24A 4WCVA 4DYVA 1L1FA 3B3FA 4MJXA 2OE2A 3L82B 4RZUA 1E5XA 3LI2A 5ITVA 2BHNA 2NZ2A 1WR8A 4V0NA 5FNVF 2HA0A 3SR3A 1PWZA 5TJ9A 4MR7A 2JDID 2UUCB 3DVAA 2C9ZA 2ZJZA 3RGGA 1EUYA 4EUKA 2ERCA 3SE0A 3LPMA 4EY6A 4G0VA 1J9ZA 1R0BA 1RMTA 1RRPA 3M1YA 4G9EA 4MHSA 4BP9A 1WXWA 1WDWB 2PJDA 2YHSA 4YLGA 3IODA 1U1DA 4OUDA 1UF9A 4QGAA 4UDNA 3ZKAA 2B8EA 3N76A 1Z63A 2FQ1A 2ENWA 1KE2A 3F3YA 4IV0A 1LQUA 3LW7A 4PO1A 4ZO9A 1L7PA 3DZJA 3BHIA 4MQ4A 3B2QA 3AIKA 5KNCA 4U6SA 5DLDA 2BD0A 2ZXFA 1XLTA 4CM9D 4OP2A 2BTQA 3PZRA 2QV7A 3RU2A 3CLKA 2WHQA 2D3TA 3M5DA 2JAUA 3GGJA 2O9JA 3O8QB 2X0FA 4C4YA 3UHPA 1ZOSA 3VTZA 3AHEA 2OYSA 3D8RA 5FPYA 1VQ1A 2QJTA 3N5KA 1Z2DA 2WU8A 3BTVA 3L1HA 4TMFA 3OESA 2QIOA 5IZCC 2O7QA 2GVDC 4IOJA 1PBNA 5EXEA 1L4NA 2OZLA 3VZPA 3QKRB 1LJUA 1TJNA 3QELA 1E2QA 1R4NB 4EKYA 2P5TB 3TB4A 3KR9A 5BNIA 1SC3A 4DVJA 1YA4A 3TNDA 4LDJA 4PSVA 3AU9A 5KTRA 4G0WA 4KIFA 3ISVA 3VTAA 1AURA 5ERGB 3RREA 4G0NA 1JW9B 2MINA 4DC0A 2NZUG 4M8KA 1SVMA 4ZIRA 2C29D 1B16A 2IEIA 2R44A 1N9KA 1YFJA 5FYDA 1F20A 2YV2A 1DJMA 3TRDA 3U3MA 2YJGA 3UGQA 4YMTA 5BRAA 3Q2OA 3W5VA 1DADA 1KO7A 1I4TD 1WB4A 2PKRA 2Z9BA 3CLSC 2QPOA 4NPHA 1DC3A 1H8EA 2B20A 2NXJA 4KE9A 2FQXA 1VXRA 5JY1A 1QP8A 2PBFA 3FJYA 4LYDA 4IEEA 3Q6MA 4J7AA 2RI0A 3RHSA 3Q2IA 3ZH9B 3CM0A 5BWNA 1PFUA 2AG0A 1PR4A 5L4LA 1CQPA 2G82A 1M8GA 3FAZA 3ANTA 1YHNA 1EGHA 3K2IA 1VKHA 3C2QA 1A9TA 4GNKA 1M74A 3EXAA 2R6CA 3C74A 2YZMA 3E0QA 2NYRA 3JQBA 4JODA 5DIZA 3WHIA 1YGPA 4FINA 4D6YA 4MGHA 5EZSA 3HI4A 3EODA 4NWIA 3IKMB 5L3SA 3NPAA 3S81A 2EFDB 3C6KA 5HIJA 3BFKA 1MIOB 1YJCA 2X40A 3KPUA 1A4XA 3PEUA 4FC7A 2Q6IA 2FQQA 1SUFA 1KO4A 1Z74A 1QOZA 2GMWA 3GJ3A 1F3LA 3LLSA 3ZU2A 1Q3KA 3NJRA 3C6ZA 5U4XA 2VP4A 1IBSA 3R8XA 2GEKA 3TIIA 3DBLB 1W76A 4PSDA 3VNQA 3QEMB 4DSTA 1NVBA 2VTVA 4J1QA 4NZOA 2HCTA 3ZDZB 4TROA 3ZDEA 2XRFA 5E9QA 4MA4A 4DV2B 2X58A 1J90A 3PPVA 4FWIB 1UBOS 1SELA 3GPIA 5DWDA 3RTAA 3ADKA 5K4AA 3BN3A 1PEKE 2ZITA 4LI0A 4XJSA 4AZSA 2JLZA 5EIXA 1QU3A 3T3DA 2JW5A 4WEOA 2A1UA 4OI1A 4QJIA 3HGMA 2OQIA 3D6JA 4BMYA 1EGMB 1ADJA 4UATA 4AZ0A 2YCBA 4MW6A 4QEZA 3QV2A 4LG1A 4MV4A 1Z68A 4NRDA 4AY3A 5TF4A 1FP6A 3GOQA 4EBFA 2XTMA 3V8VA 1ODCA 4AQ7A 1NE7A 4Q1AA 1P2BA 3PGVA 2EW2A 1RIFA 1U98A 3BJIC 2RGUA 3OG9A 2R751 3R3XA 1Y3DE 2FDXA 2Q7XA 2ZU0C 4PNPA 3ZJUA 1A8UA 3U7RA 4XKJA 3MINB 4PGGA 5L7YA 3D4PA 3DEFA 1R9MA 2R5NA 2NZXA 3KKQA 4I19A 4JITA 2JDIA 3O4RA 4KI0A 1SQSA 2XDQA 3VSAA 3W1VA 5LN1A 2GNPA 4BQQA 2O3QA 3GG9A 1F8GA 2LDXA 3T7IA 4C5BA 3CZMA 3R3YA 5GV8A 2QENA 4JJ4A 2NUAB 1J4AA 3ELUA 1YSCA 4AU1A 4ECEA 1ZGJA 5JQGB 1XRMA 1XLWA 2G25A 2ZUWA 3MRTA 4NNJA 1M5UA 2VEOA 1LC0A 1OJLA 4O2AA 4ENPA 3OUZA 4CUKA 3DLBA 2FP4A 2A9RA 8OHMA 4J1SA 3EX7C 1AHNA 1EXWA 5KC9A 4WOCA 3AHDA 1IC6A 1E59A 5KO2A 2YWHA 3FH0A 3GLHB 3OUUA 1Z25A 3PNSA 3HACA 4AX8A 1IJKA 3K9HA 4NYJQ 4DLXA 5F5NA 3N2IA 1ECBA 1M6YA 1UFRA 1YRQA 3CE9A 3E82A 4CTOA 2VNAA 3CNNA 3QFRA 1XWWA 1HZZC 2B34A 4YDHB 3RBXA 3I30X 1U9YA 1B8OA 4PGHA 4FJ1A 1XZKA 4M89A 3KHUA 2M1XA 1J09A 3KR0A 1E63A 4X1YA 4PPGA 4QNMA 4F9FA 3U7HB 4N7MA 4QM7A 1P0CA 4DGSA 2JFOA 3O74A 4RFVA 4Y0NA 3C4VA 2HPHA 2CXHA 4QBIA 4ZCIA 2IPXA 3JVIA 1RQRA 4CHTA 3MMPA 1E62A 1K6MA 2EQBA 3IDSA 1Z17A 3KQQA 3MUNA 4IVRA 4XOUA 3H84A 3RVPA 4M49A 1LQTA 5L7TA 4QOGA 4DR5B 5ELXA 1L1QA 4EHAA 4UNPA 1W5EA 2CFCA 3GJ5A 4UCFA 5I4IA 3DAPA 3PQ6A 1XRSB 2XGOA 4DV4B 3A2NA 3DEJA 4P4LA 3T3MB 3VPFA 3Q72A 1XPUA 2MYTA 1V7PC 3H5RA 4II7A 2F9FA 4K2AA 3FBWA 4LZWA 3C3JA 5KSWB 4I4TB 1XZHA 1JDUA 4O25A 2JHFA 1QGOA 4JXXA 2QDKA 3CX3A 1GDHA 4QDJA 4OXYA 2JEZA 2H54A 1IWOA 3OZGA 2HX1A 1DVRA 1XLVA 3R7LA 1S2NA 3I3SR 2P6OA 3PFKA 4M4SA 1OBVA 1RSZA 4BC0A 3WA7A 3I2GA 2R65A 1A5SB 1V5EA 2VLBA 3B89A 3GFTA 4A2WA 2DLCX 1DTWA 3DEKA 1L5NA 4YMSA 5HCNA 4OA5A 1OLOA 4J0EA 1U2DC 3OM1A 4PHFA 2C2GA 2NZYA 1ZQ1A 5ILGA 1SUEA 3RUFA 1T29A 3Q40A 3FOEC 2I9PA 3IT1A 4RACA 5E2IA 4ZALA 2B98A 2DHQA 4PLPA 5FI0B 3ZYCA 4DCNA 1HBJA 5EQDA 2HL6A 4UTXA 1DB3A 3OT1B 2XY4A 5CXQA 3ME5A 2PZBA 1HL3A 5CA1A 2CV1A 4LA4A 3SF8A 3AV0B 2WE8A 2WJVA 3K20A 1N6OA 3ZHOA 4LGYA 5LWQA 2JVIA 1W5TA 3FZGA 3RSHA 1AO0A 3S1SA 5IAAA 4QU9A 3PJFA 3VU1A 3C43A 3FFBA 3C3EA 3IP7A 4XR9A 3U13A 5ALZA 1KJNA 1ZJ5A 3F9CA 1AKRA 2TS1A 1JIIA 3C3BA 4M99A 3I5AA 4I50B 1Q0PA 2D1RA 1YOVA 1Q16A 1YRWA 4GKBA 3VO9A 1KP9A 4XSGA 1Q12A 1FBTA 3PEFA 4QICA 1HSZA 3QWIA 2GCIA 3O3CA 4M9QA 3VTFA 3OO0A 5IBQA 4HWOA 1UZNA 1W94A 2NUTB 4G1MB 4DBVO 5JWHA 3AR7A 4CQMB 2JARA 2AMLA 5GQSA 2Q5EA 3AUTA 4I55F 4IIHA 4UVEA 4UVDA 2V45A 4QBFA 3PXUA 2EFCB 3LHIA 4OSOA 3LMKA 4AJLA 5DISB 4DDVA 5I7VA 1ECFA 2OKGA 4G9BA 5KVAA 3F73A 2IHNA 4DCTA 4G1EB 5KAMA 5JZMA 4Z4FA 2AQHA 4X92A 3OHPA 1OOEA 3NM5A 1PT8A 4XQCA 2IJGX 1LBHA 5FTNA 5A1JA 1N6RA 1WCWA 2R6FA 4W6QA 5A4AA 1CUWA 4BKQA 5L9AA 2LE0A 4IRMA 3N6RA 4Q9AA 1G5QA 4URXR 1CZLA 4KR6A 3NDRA 2VZ8A 4A6XA 1H1LB 4HUQA 5KPJA 3I6YA 3WK7A 5ILOA 1C7QA 2V8BA 2OGWA 3H11A 4HCJA 3FDFA 3ZWQA 3MF4A 1G16A 2QPAA 3IMGA 2X5XA 3MCVA 3QVLA 2J0VA 3PWZA 3HB0A 3BWEA 4YRKA 1SKAA 3KQMA 2VC2B 2FW6A 2XKBA 3HKCA 1QO0D 4C3ZA 5L3ZA 5I7AA 2CUTA 4XX0A 3NPMA 4IIDA 2RJNA 4YXFA 1A9ZA 2DUUA 3MYYA 4W1SA 1ZRNA 4FWTA 2WJ3A 4WXYB 1NYLA 2ERYA 1PJTA 5ESXA 4B4UA 1R4MB 3AG5A 3QHPA 2C07A 3I2YX 5FOUA 5A6SB 3K1YA 5ALOA 3OQIA 4I5IA 1MO4A 2QV0A 4IJVA 3L4JA 3PSHA 2B8TA 4V02A 1LPOA 4QG7A 3TE7A 1DCKA 2B4AA 2DU8A 4I8XA 5DWQA 3C6XA 3TMAA 4ER7A 4OFBA 2QY9A 1N6LA 1EI9A 2G4LA 3NBUA 2BMAA 4LY3A 2E1RA 5FLXA 1KRHA 5HSGA 2IYXA 3EXG2 2AN5A 2WZBA 2C96A 1MEJA 4AKIA 1MQ9A 4LJSA 3T3HA 1MPXA 4YEDA 2CT8A 3B60A 1OLUA 2X4LA 1FK8A 1W48A 2GZ2A 4FYWA 1YZYA 2OSVA 3ZDAA 3UAVA 2BFBA 2PN1A 3AJ9A 3D6TB 2G0NA 4TWAA 1ODLA 4EHJA 4DIFA 4Q9NA 1KOGA 1A50B 2BVNA 1BFDA 2CDBA 3KAJA 3ZDQA 1OXBB 3IUJA 2DH5A 4JGIA 4EH1A 3PPIA 4DG5A 1WUIS 3K9WA 1OZAA 3DW3X 1PJCA 4AMVA 5D2CA 3VU3A 3X1MA 1G9TA 1XBTA 2AHOA 3GX1A 1CJBA 2XMGA 2KW5A 3ETNA 1GKLA 1P4RA 1XCLA 1AGRA 3H42B 4FFDA 4MX8A 4FOPA 1SHZA 1YBFA 2ZRFA 4AQDA 3P52A 3JYOA 3KOOA 1OAAA 3H0EA 4LBYA 1DC7A 2I8CA 5C8DA 3KE9A 1G20A 2B25A 3E84A 3GA7A 5TGDA 4CCAA 2IPNA 2J67A 4EMTA 4E46A 1Y6FA 3SHOA 3ZJVA 1E7WA 4EG5A 2OAEA 4ZVPA 2WAMA 3KYDA 1GCGA 3QM1A 2Q62A 4KL8S 4N3BA 4Q00A 3MWFA 2Z5GA 4CM4B 1SKYE 3M3HA 3U31A 2AC2A 3NHUA 4URFA 1M34E 1O6BA 2J59A 2QP9X 1N0VC 2H11A 2CXNA 3CMCO 5FCDA 1E64A 2JZOA 1K0FA 3KQNA 4QGSA 3I9KA 4YFYA 4QO8A 5K3FA 4CR8A 2ZULA 1GQRA 1TNDA 5AHXA 1M2KA 1ZMOA 2Y93A 4HEHA 5KKNB 2OILA 4C0SA 4RQTA 4G1FA 2BCGY 5EJAA 5TEVA 4ZYUA 4PRZA 5AIAA 5HR5A 4ZQIA 4G5GA 1R15A 5IVDA 1J06A 1NUPA 3IP5A 4ZQEA 1DGQA 5I7RA 3SC2A 3PGMA 3FFWA 1H4TA 3H9GA 4P93A 3ZXYA 1HNWB 1HMYA 5FOSA 4P54A 2XUIA 3U4IA 1NVEA 1Y48E 1KY2A 3AUXA 1QTIA 4M7RA 1BQ3A 5KDLA 3RS0A 5CFNA 3IXQA 3RRMA 1R74A 2G06A 2YXDA 4P34A 4U3JA 1OXXK 1EFAA 1DX6A 2RAFA 3A1UA 1F14A 4QBKA 4PLWA 3HXOA 2WF7A 4P32A 3RCBA 3ZK8A 3F49S 4PAQA 5DMXA 1QDLB 1D8TA 2BFCA 5T4BA 1VPWA 4MQ6A 4EBBA 2PAFA 3TAUA 3ONNA 3HM9A 1V45E 1ZN8A 4PR0A 3I1YA 3FPAA 3R9XA 2MDTA 2IRWA 1D1PA 1Z3CA 1AM4D 1KYIA 2M32A 1ZMBA 2EKBA 2ST1A 4Y2HA 4HMQA 5B12A 1GZSA 1DO0A 4HDKB 4QODA 1T1EA 2PX2A 4R0MA 1N2OA 1TJPB 2OCKA 3VVLA 1CD5A 2HLNA 4P0TA 2A7QA 2AFIB 1QO0A 3P2JA 4F2WA 3B5EA 4OJTA 1DRUA 1Z5UA 1DCMA 1ZMTA 1YFZA 2L18A 5DBEX 2B35A 2NTNA 2BMFA 4C7JA 1KE1A 4BGUA 4BKPA 3Q5DA 5JWOA 3O8CA 1X6VA 3A1VA 2ZAOA 2FNAA 3GJZA 2IVZA 1RWPA 2EP7A 2MU1A 4C4SA 1E1YA 4G5QA 5IAOA 3P4UA 3ZOKA 1O5IA 2C2XA 1GEGA 5CTJA 4YY3B 1XE3A 3FNBA 4DIMA 2FSUA 4O33A 5KWVA 4DUZB 1U9JA 1XP8A 3HDVA 3NM4A 3ZVMA 2ZRKA 2HKIA 1V11A 1WNTA 2OO5C 1T8SA 1C50A 2QRLA 2W2TA 2IXBA 1THMA 1NKTA 2Q41A 4AURA 4LNUB 3HFRA 1Z26A 3LBIA 2GZDA 2H48A 4PXYA 5KYYA 4H0CA 5A4FS 4IXWA 5JAMA 1CS0A 1JTEA 1PR9A 2V03A 5HQJA 2QM7A 5LOVF 3AESA 2BH2A 4ZT5A 1BX3A 3KPYA 3ORSA 4JJ7A 2V54A 1IVNA 1SHLA 2DT5A 1KPHA 2ZYRA 4KQIA 2NU6B 5KS2A 3CRZA 1NMQA 2X7XA 3ESQA 5KZMB 3E9ZA 4KWHA 4QOJA 2DLNA 2R00A 3C0KA 5EKXA 4C14A 3UMCA 4KHPB 2Q0HA 2Q1TA 2YVLA 2JGJA 2PH7A 1JQ3A 3QI2A 1YS4A 2RCNA 2OGZA 1CDDA 4RHTA 4LJLA 4DLBA 1RYNA 1K3FA 4XVCA 1IEQA 3GUHA 3OZUA 1S8AA 2FSFA 4O02B 4Q4AA 1TAHA 1P33A 4RVCA 3UOWA 2PD3A 4V1CI 4GM4A 4FR5A 1DDGA 4QGFA 2B6HA 4RZXA 4EJFA 5AUNB 4JDUA 1DLJA 1NVGA 3KB6A 3QPBA 1Y5IA 2BONA 3OPXA 2QX9A 5EHNA 5IUKC 3ZGXA 1GT6A 2ZCVA 5KVCA 3HBNA 5TVKA 2WKWA 1N5IA 1VL1A 3ZGNA 2YVUA 4LJYA 5B2EA 4A6DA 2O2IA 3MRSA 3R6WA 2O5VA 3BDAA 3QKSB 3WWEA 4CNQA 5J5CA 2PKQO 3BWMA 2G83A 1P0IA 1XTRA 3W78A 1QO7A 1DT3A 4BV8A 2NVUA 3U3XA 1GG9A 2P2LA 3OZTA 1XMJA 2PT9A 2XTNA 3BXXA 1D9ZA 4UUBA 3TOCA 4NBUA 3ZKWA 2AN3A 3QHQA 1F2UB 4OPMA 2RARA 4W6ZA 3N70A 2UZIR 4R1NA 5LUBA 1NKVA 4FFOA 3ZE6A 3OMLA 1P73A 2W6QA 2H2IA 2HMUA 3L7OA 4Q1DA 4BCDA 1G59A 1WHSA 1I94B 1PZXA 2VJMA 5EJ6A 1FTYA 3T12A 2M6RA 2ZEJA 2OBNA 2X1VA 5FPPA 1ZJJA 1EIZA 3RSSA 3FWKA 5MGBA 1V4VA 2VHWA 5CVUA 4EB0A 4BO6A 2V98A 1PJZA 4RW0A 4A4DA 4PW0A 2JVJA 4RL4A 4BXOB 4MUAA 1XZIA 1I2BA 1VJ1A 4CFSA 1JECA 4JY7A 3IPLA 3OLVA 4OHBA 2X8JB 1BAPA 4TYQA 3W9UA 2ZRMA 4CL2A 5M7EA 1CP3A 3KDPA 2FXIA 3ADOA 1ZCBA 3V3KA 1EWRA 1Z4NA 1F8FA 2YWEA 5CPBA 4DHWA 6GPBA 4YJ2F 1SZPA 2ZTVA 4EVSA 3NGLA 5DX1A 3VVBA 4Q39A 4F3YA 2GD0A 4ARAA 2C99A 3BWVA 2R7KA 1RP7A 3B6MA 4GC9A 2E9SA 1NMZA 2OQVA 1IZZA 4OHFA 2B1RA 3M34A 3EVBA 4YP5A 5K0LA 2BGJA 4KH0A 1JKXA 1N1MA 5JAUA 1D7OA 4R6XA 1KOJA 1G7CA 2QL5A 2YFYA 1T9DA 2VA8A 5LQCA 3TLYA 4K9LA 4Y2XA 2WMOB 3IP9A 4ZEMA 1XNGA 2VXBA 1EQUA 1PHPA 3P5BA 4RHUA 3Q0IA 2SKDA 3B2NA 3UEOA 2WKPA 3O8OA 2A7XA 1Y9ZA 2X7HA 2Z58A 1R5BA 1S3SA 3HS3A 3X3HA 3L9WA 4IRXA 4C29A 1WBDA 2YMQA 1Y1TA 2QZ9A 1DC4A 4RXMA 4UAVA 3ZHTA 3AEKB 2QN8A 3JSAA 3FOFC 5D5PA 2WTEA 2GKOA 3O9MA 1PJSA 3DO6A 4FUQA 4JJGA 3PNLA 2I03A 4IZIA 1N1DA 1R8YA 3ORFA 1V16B 1HY3A 4LSGA 4BFXA 3BKXA 3B2EA 2B2XA 1T3ZA 1GT91 4WLVA 5GOTA 5JW6A 2F1IA 4HUJA 1KDZA 3D6FA 5BUCA 2QLMA 4RF3A 4LQ4A 1KXZA 1BNCA 3DE5X 2GN2A 2CJXA 1RWXA 3V2HA 2EQAA 1Y9AA 3U9SA 2PGOA 1YI0A 3S2UA 3E0XA 3V5NA 4Q05A 1E4EA 1U1IA 3MLAA 1GOTA 1L5GB 4DS3A 4YUWA 2O0LA 5ALQA 3RRFA 4AECA 3RFVA 3HA2A 1J0EA 5DTJA 2KLBA 1IBRA 2VVTA 3I01M 2WPDD 3W5SA 2V4UA 3IKLA 3I4CA 3Q7RA 3KRTA 4Y2UA 4X1KB 2AI3A 4Z0TA 4A7PA 1XTSA 4NBSA 1WPQA 3WJ7A 3WKEA 3HJUA 1V1MA 1FJGB 1P2SA 2XW6A 3WLAA 2GQ0A 2ZPTX 3JWGA 4KO3S 1AS0A 4CM7A 1G5IA 3FRIA 5IS2A 1G9SA 4XYBA 4XASA 2NSHA 1M66A 2UZAA 4LCBA 2QUIA 2CJWA 2IIQA 4WEQA 5GMOA 2HPVA 3WGLA 1OKKD 3ZV7A 2FW0A 5A3SA 3ZU5A 4BNNA 2V59A 1QSGA 1FE8A 2QTGA 5BQ3A 4DWOA 1O0BA 5F51A 5KYGA 1HG1A 1CSEE 3HCWA 1DIRA 4TUYF 1II8B 3VU9A 4R05A 1RDFA 3ROZA 1WKBA 3LBNA 1WCV1 3EFEA 4BQNA 4TLBA 1F4PA 1X15A 2YUTA 3ECSA 1RXUA 1B0ZA 3FNQA 4D4GA 4MVJD 3EEYA 2VKTA 4BMPB 1YQQA 1S9DA 3L06A 4WESA 4YMIA 4HVCA 5BVGA 5EMJA 4Q6BA 1SWVA 3FOAA 4OGKA 5E2AA 3DKRA 1RXWA 3V8RA 3DMHA 3IULA 2XDYA 1QU2A 3CLRD 3QE0A 1RPAA 4UTVA 2PCJA 2J6BA 1RRGA 1QKJA 2W0MA 2C5AA 4REQA 3CJRA 2QTFA 3NKVA 4Y6SA 3HEBA 3FI9A 2YKGA 4X44A 1C9DB 3VGJA 4U7PB 4DY6A 3RC8A 4GMFA 2VHJA 4CMEA 1I3NA 1E32A 1GARA 4CIAA 2JI8A 3GZTB 4RK6A 3NHYA 3P2OA 1GPDG 5A71A 1Z2NX 1ZS9A 3VJMA 2ISCA 1WXHA 4O4HF 5FLYA 3C8MA 4IG4A 3LVBA 1I4DD 1OAKA 1ESCA 4X6LA 3BH6A 2AJLI 4LBWA 1GRQA 2VA9A 2WSMA 5BQ5A 3C5VA 4J2TA 4U5XA 5C1BA 3SXUB 1V5WA 3LY7A 1UQUA 1ZIDA 4EUFA 4R2KA 4RV9A 1GUYA 2V74B 3EISA 3PT9A 4KXXA 1VDMA 3SHVA 3TLEA 4KN6A 2W93A 3OF3A 1P7ZA 2R7AA 5ELMA 4DHEA 5LYJB 4C2UA 3S8MA 3FJOA 2ZATA 4N0PA 1DZ3A 1GU0A 1A69A 1DBWA 3QU7A 3ILVA 4JGGA 1I36A 1OCEA 4JQSA 5AJHA 3GLKA 3LT1A 5HS6A 3P9NA 3G23A 1GGFA 1Z2OX 2NQ8A 3F46A 4FGJA 2V0NA 3M70A 1A1SA 1FVXA 1J20A 3K1JA 3CINA 2G9QA 1CXZA 1V95A 3ROTA 3T54A 2UXDB 5IJ9A 1ZZGA 3W04A 4D26A 3J7TA 4FR0A 4WVFA 1WG8A 2REQA 4Z4QA 3PUXA 1CNEA 4Z0PA 4E33A 1FX0A 1NVAA 2DFNA 2DRIA 3LX8A 5ALWA 3W1WA 3TLGA 4XIYA 1E6MA 4EYEA 2J3KA 4EHDA 5CK5A 5CBPA 4WN9A 1RM4A 2ZSBA 1TJ5A 4P31A 2FZGA 2QGZA 4INJA 4RMNA 3DE3X 3VO2A 4HH1A 3HJFA 2O8DB 5GY7A 1M83A 3CX6A 2IS4A 4PF1A 3K1AB 5AKLA 1NNSA 1LVHA 1E9FA 1KNXA 1YB2A 2HOQA 4GP9A 1L9KA 5BNZA 1X19A 4TXJA 3KKEA 5T6BA 1US8B 3UJ9A 2GYVA 1VG9B 1YWGO 4GI1A 1R64A 3DLHA 3ZWPA 4W9RA 4RVGA 8ADHA 5DFAA 1FDSA 1QO9A 1DEOA 2C03A 2IUEA 2G08A 4KGXA 4KKXB 4LVNA 1FFEA 1A5TA 1IHOA 4B48A 5D3MA 1C1YA 2HNKA 1OKKA 1YA8A 2QSJA 5COAA 2AMVA 2AJCA 3G6WA 3GLRA 4ZQHA 2ZUCA 1TEZA 2HCRA 4YT2A 4B3TB 2V7VA 2ZJ0A 3PSAA 2JJYA 2PXXA 3DT8A 3MUEA 4U8HA 4YAIA 5BPHA 2OC4A 4HGRA 2YYZA 3F4BA 3CE6A 3EXFB 3TL3A 2UXCB 4MITA 4F9EA 1Z0JA 5FFNA 5C53B 1Z3IX 1NXXA 1GEEA 2FFBA 3HWSA 3HYTA 5F5LA 5T57A 1Q3HA 3RS7A 3VPDA 3ZQ6A 2GJ4A 1K5GA 4MUIA 4MIEA 4OHPA 5B6IA 1YZNA 3A28A 4DXDA 3SMVA 1GKUB 3AVVA 1E5DA 4WRRA 3ESBA 3H2HA 3IGFA 3HR8A 2XA2A 1MT3A 4MVJA 3R7FA 1M2NA 3UV3A 2JIZD 2GLXA 2JFVA 2YN2A 4JI0B 1WUTA 1X1EA 1X7XB 2XCUA 1Z6GA 3A8TA 3B51X 2Y4OA 3PCTA 4IEIA 4EEZA 4YHHB 1YKFA 3CH5A 1PL8A 5C7IO 1YMUA 1RS0A 2A1TS 5TT1A 1P6UA 4MAMA 2AFHB 2P30A 3W5HA 3WRXA 5LXTB 3K6SB 2WOJA 4NMXB 3LH5A 4X3PA 4FYMA 2XB2A 2QR5A 3HCAA 5K1ZA 3WP0A 2C4KA 3QOFA 4HGPA 2GNOA 2DECA 4Z53A 3OU7A 1L5KA 1ZOIA 1YQDA 3KPJA 2W71A 3CT4A 3KXIA 4OYHA 4XD2A 3QF4A 4KC0A 4EFNA 1RM3A 5EESA 4PZPA 2BGIA 2AL7A 3HZRA 4KBYA 4ZZ3A 1KWGA 5SZHB 2IUSA 2W70A 4XZ3A 3I2FA 3O93A 2R6ZA 4NDAA 2WNSA 1BE0A 3GJ4A 3G2JA 2IY7A 2H5IA 4J0KA 1W88B 1YZVA 4J7UA 4XJXA 1TB4A 2XZDA 3SNHA 5JSZB 3S27A 4B76A 4GMKA 1AA9A 1AGXA 1HDGO 4CMJA 2OFOA 4TQGA 4H7EA 3V4LA 2JD1A 1QTQA 4TQAA 4GLFA 4NH0A 1MO3A 4EJMA 1LLDA 1NBOA 1Z29A 2VHYA 1JI0A 2VT6A 4L50A 4RZQA 5EJ8A 4EG1A 1D0VA 4CBVA 3GRVA 3HGQA 4CLRA 3UJNA 1NVWQ 1O94D 2VHZA 5MN5A 3OX3A 1WAMA 4ZTUB 2YHIA 2JJQA 2A2ZA 3NTQA 1CR6A 1A8PA 5P8WA 1WCXA 1JWBB 4S1OA 3GROA 5AW8A 4KDCA 1QAOA 3ZCVA 2W6JD 2WBLC 1XVIA 2C9OA 3F3MA 4CW7A 4MS1B 3P0JA 1T1RA 1RQGA 2EYQA 2OV4A 3DOUA 4OSPA 1QHFA 4PNHA 3QENA 1TF2A 3WMGA 3GI1A 5E3IA 4NDNE 5KQPA 5CTAA 2IY8A 3H87A 4JUDX 3H5LA 1LJ8A 4QQFA 4Z9BA 2AXQA 3I2JA 3RKUA 4MUFA 3FGPA 1VYHA 1Z0KA 2P3SA 1DE0A 3L7AA 1X8XA 3PYMA 5AOAA 3L0PA 3T7AA 3L6RA 3MQFA 5JSYA 4YMUA 3OZXA 1U7DA 3QWFA 2QPLA 3MT7A 5T5QA 2XDAA 1KDOA 5EUMA 1RP1A 2JGAA 1EUCA 1MB0A 1EFLA 2VATA 3BEOA 4ASUD 4A92A 3ZHSA 1IY1A 2OHXA 2H00A 1G1MA 1KVSA 4MCAA 1AT1A 2X41A 5KQSA 1C1DB 1AKQA 1Y1KE 1EXDA 5JROA 1G8HA 1P9LA 1T26A 5CHYA 1RWVA 3IEMA 3CVJA 2QX6A 1S01A 4V38A 4RSRA 1P9OA 1X9GA 5FWYB 2IDMA 3EC1A 1BA2A 1NJFA 3U49A 1KDTA 4KTTE 3W2FA 4ZI7A 3ZDCA 4MUJA 3HYNA 3DPIA 1BDMA 3BQMB 4BFWA 4K6KA 1NUSA 1KF0A 5ED0A 3O2NA 1PD1A 2OL4A 5G4KA 2I3DA 3MEQA 2HMSA 1M1UA 2I4TA 3RC7A 1ZRMA 1FLDA 3FPSA 4E1AA 1U80A 3OECA 3WKAA 4CCYA 2WJJA 3CPEA 2BELA 1EVKA 4JL8A 4GX5A 4MQFB 3VDNB 1Q44A 3PUJA 5F7ZA 1HE3A 4LRSB 1M54A 1PSWA 3UGTA 3QXCA 4JOCA 3QJYA 3I5XA 3JW8A 4LDAA 2XIQA 3AVOA 2ZRNA 5DULA 3C5EA 5BR7A 1UKZA 2DQ4A 1IEVA 1Y4ZA 2IHBA 1N4AA 4UTNA 3H2JA 1Q3TA 2ZE8A 4QD3A 4TGLA 1K8XB 2LIPA 4LF4B 4OREX 1TJYA 4I1PA 1NWCA 4PG7A 1EFPB 3U0BA 3DZHA 4DC1A 2BOVA 4C30A 2HI0A 1E9VA 1HH4A 4CL8A 1WLYA 3OU2A 1A77A 2OGSA 2J7PA 4HPXB 4JS0A 5TQJA 3BF7A 1V8DA 2Y6UA 2H2GA 3OTQA 1A9XA 4D8WA 4ANFA 5B3KA 3A2LA 5K0CA 1WCIA 1HE4A 3WRYC 2QYTA 2QRNA 4D8XA 3W9YA 2GILA 1HPLA 4U5QA 1QV6A 4H18A 6PFKA 1CIPA 4LKOA 2QL9A 4L95C 4KVGA 4EB6B 4C01A 4F5WA 1E9BA 1Y8CA 3BWDD 4FGSA 4MPPA 4YRIA 1QRAA 2X9NA 3LVRE 5AR1A 4FDAA 1AKVA 2VPTA 4XIGS 5C5IA 4OHYA 2D13A 2NUPA 1ZOLA 2H9IA 1GZHB 3ABQB 4FHDA 2OMKA 1O77A 3JASA 2DTXA 3JR3A 4CMGA 1EAYA 1M2EA 3HJBA 3HVUA 3N3BC 4UFPA 1JVNA 2ZIAA 4Q7LA 2QLJA 4IJ5A 1SEVA 2W4MA 3ET5A 1WSDA 1LCIA 3II6X 1ZO8A 2C2BA 3V9PA 4A91A 2RHOA 4UREA 3M1AA 3QWBA 1GG8A 1RC8A 1VHQA 3T7JA 1MC8A 1T36B 2XWQA 4I4IA 5T4FA 3UMRA 1RABA 1G7SA 2W83A 4A5SA 2R8ZA 5AI6A 3TD2A 3WLSA <