1WL8A

Crystal structure of ph1346 protein from pyrococcus horikoshii
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
188
structure length
186
Chain Sequence
MMIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNCEKVLEHYDEFNVPILGICLGHQLIAKFFGGKVGRGEKAEYSLVEIEIIDEEIFKGLPKRLKVWESHMDEVKELPPKFKILARSETPIEAMKHEELPIYGVQFHPEVAHTEKGEEILRNFAKLCGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GMP synthase [glutamine-hydrolyzing] subunit A
publication title Crystal structure of Glutamide Amido Transferase from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 56
structure length 186
sequence length 188
ec nomenclature ec 6.3.5.2: GMP synthase (glutamine-hydrolyzing).
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1wl8A00
4E08A 5JZMA 1Q7RA 4WXYB 1CE8B 3F71A 4BFLA 2LXNA 1CS0B 3CY6A 2YWDA 4ENVA 1OX6A 5BV2P 1VCNA 1JDBC 4L8FA 4BIMA 5K4AA 3TTSA 4JQSA 4Y0NA 3RHTA 4AUNA 3CNEA 3TTYA 3BHNA 2AB0A 3CZAA 3NONA 2YWJA 3B3AA 1PDVA 1QWSA 3MIIA 3P9SA 4RKYA 1OI4A 3PQ7A 4Y1RA 1GPWB 3SF8B 1P7YA 5SY9A 2OR3A 2ZUUA 1GG9A 1VCMA 3TTTA 4I2NA 4B40A 4K2HA 2VRNA 4UZSA 1OX4A 4OGFA 4B31A 2WJZB 4B5KA 3UJNA 2YWBA 3F5DA 1OX5A 1G2IA 1I1QB 1OY1A 2A9VA 2H2WA 2R1VB 4P35A 2GHRA 4Y1RB 1ONSA 4ENPA 1BXRB 1U9CA 3EN0A 3TQIA 4ADSG 3VU3A 1GGJA 1CF9A 4ZDIA 5E9AA 4ENUA 2GK3A 1QVWA 4I4NA 1GGEA 4WINA 4L7QA 2VXOA 4GUDA 4UOZA 1OX4B 2YWCA 3FSEA 4UCFA 3R76A 3PQ2A 5DFAA 1KXJA 1Q2UA 3NOOA 3UMMA 1KWKA 1FYEA 1A9XB 3EFEA 4P34A 1P7ZA 4QYTA 1M6VB 3TTWA 3UGJA 4HCJA 3PQ5A 4QYXA 4L95C 3TTXA 4B7AA 2R1TA 1IPHA 1P5FA 3EJ6A 3OT1A 3B36A 4L78A 3UK7A 4Y1EA 4E5VA 2VPIA 3L18A 3SOZA 2ABWA 1N57A 1GGHA 2ISSD 1GPMA 4S0ZA 4B2YA 4BTEA 4ENWA 4N0MA 1T0BA 1KWGA 3WFZA 3MGKA 1R9GA 3BWEA 4MTCA 3NVAA 3ZJ4A 4ENQA 3ZJ5A 3L3BA 2RK4A 1C30B 3UOWA 4OJYA 4P36A 4GE3A 4MGHA 4AUEA 3NORA 1IZZA 1GGKA 1L9XA 4OGGA 1K9VF 4P5PA 1IZYA 1WL8A 3NOQA 2VKTA 3PQ3A 4Y1GA 1I7QB 1QVZA 2XF2A 4ZDKA 1P81A 4Y1FA 1JVNA 3ZR4B 1KA9H 5LIRA 4ZDJA 1PV2A 1P80A 2FEXA 4ENSA 3L4EA 4UOQA 4AUMA 3FIJA 2NV2B 4I46A 4LRUA 1VCOA 2RK6A 3NOVA 4OIFA 2AD5A 4ZGGA 5IP5A 3L7NA 3KKLA 3TTUA 4ENTA 4MNTA 4N12A 3EZGA 5JZOA 4L8WB 3SF8A 1UCFA 3PQ8A 1SY7A 1GGFA 1T3TA 1PDWA 5SY6A 2R1TB 3ER6A 1QVVA 3OT1B 4R7GA 3P9RA 1S1MA 4UNIA 2NV0A 3M3PA 3R75A 1T36B 4PXYA 2W7TA 1I7SB 2R1VA 2VDJA 5SY4A 5SYAA 1C3OB 4XLLA 1QDLB 1SOAA 2ZUWA 3N7TA 1PE0A 4P2GA 1KEEB 2IUFA 2ZUVA 2D7JA 2ZUSA 3B38A 2ZUTA 4AJ9A 4AULA 4LGYA 1J42A 2R1UA 4L8YA 3P9QA 4RKWA 3P9PA 1VHQA 3EWNA 3PQ4A 1O1YA 3CZ9A 3PQ6A 4OQ4A 3TTVA 1FY2A 2V4UA 3CYFA 4OFWA 3GRAA 3R74A 4D1YA 1QF7A 2RK3A 4ENRA 4GE0A 3D54D
chains in the Genus database with same CATH superfamily
4KQFA 4DNFA 4DC0A 3F3SA 4Q9JA 4IS3A 1ECPA 3WBFA 2Q99A 5BSFA 4TT3A 4WDQA 2OD9A 1OI2A 3I4FA 4I3FA 5EEHA 3HCEA 2FKAA 4UXHA 2QGZA 3DOOA 4EA7A 3GY0A 4UCXA 3DMYA 2E1PA 4KLCA 3UCFA 4YCJA 1DAEA 1ZJ6A 1X1DA 3WMWA 3LZ6A 1XMVA 1FEZA 5FBLB 4WACA 1WDTA 1Y37A 5FFMA 3GJQA 3TTYA 5ALZA 2ZIZA 1VG1A 5CVCA 4NDAA 5M2QA 4LHXA 4CRWB 1L5ZA 1B0AA 5A03A 3GBPA 3WMFA 4GWLA 2A2ZA 2IV7A 4Q9DA 4OB6A 5SZHB 5AJUA 1V39A 1VCMA 4RTJA 5EJMA 1HC7A 2I7CA 4KCGA 3NGLA 2P5SA 1T9GR 1XOIA 2LW7A 1NVVR 2O1WA 5L51A 1ZD9A 2EQAA 2HLDA 2EGGA 1YQGA 1XQYA 2GMWA 3ET4A 3EPLA 4NFYA 4QGGA 2YXDA 1RLJA 3HXOA 3PXBA 4GPAA 2G83A 4TWZA 5HCIA 2O7RA 4L4XA 4ZCSA 3RT7A 5KVAA 4IO1A 1Z0UA 4EW2A 4ZU6X 4WJZA 4ZZ1A 1U0OC 3VI3B 4CT5A 4RFSA 5IAOA 5JYEA 2J67A 1OWPA 3LMKA 1JMVA 3A3OA 3A6ZA 1LXCA 4MPPA 4V38A 3TNFA 3DULA 1NP7A 3WLLA 1QQ7A 2FPRA 4YXWD 1GKLA 4IOKA 3N0VA 1YVUA 3AJEA 3EIUA 3LAWA 4UE6A 1A8PA 5E3JA 2CVQA 3RT1A 3ESXA 3UWMA 4QDKA 2IS2A 2OHGA 3DCNA 1IXYA 2J9RA 2AJDA 3B36A 4TTAA 3NAQA 1P1RA 4YA6A 2QVZX 2DU8A 1TKRA 4JA0A 2RARA 5C80A 1FF9A 3GJ5A 3QU5A 2BKLA 5UKDA 1O95A 1R74A 4JVLA 4Y2YA 1DBWA 4GBJA 2Q50A 1E99A 3ZD7A 3IP7A 3C7CB 3T0IA 1ESMA 3WFZA 3MGKA 4CLOA 3BF8A 3PR2B 2X8WA 2PG3A 4AUKA 1T8PA 3KALA 3RVPA 2WF7A 3H1BA 2AMYA 3ILHA 4AWAA 4R1TA 4GE3A 2FA9A 4RMHA 2YDXA 3NORA 5EJFA 4F4UA 3FPSA 3BHIA 3KB1A 4NU5A 3HE3A 4NZMA 1HSOA 3QXSA 4M8NE 1XD8A 4IHAA 4IHJB 1YBHA 3WKAA 3PEYA 2DXIA 3EF0A 3QYPA 2CDBA 2HMTA 4FYYA 4DDWA 3MWFA 1OFIA 1NUPA 4PYIA 1PFUA 1U63A 1TKAA 4LXHA 3EQ6A 3CNQS 2BBWA 4ALMA 3LCJA 5D7NA 1J9GA 4X8OA 2G5TA 3OLYA 2QV7A 3GAMA 1Z5VA 3QITA 3P96A 4JWKA 4U2EA 1SN7A 1XQXA 2QT0A 1UOQA 1PEDA 1DX9A 2CY0A 1Q6ZA 2VXYA 3HH8A 3PWKA 2MR6A 3N6RA 4JELA 4DR4B 5FDFA 2XUAA 1BDBA 3NUZA 3OLXA 3ZWDA 4UEWA 1WR8A 2LPMA 5A2GA 4LXYA 5FUVA 3VTKA 2HA5A 3TRDA 2WNHA 1KZ1A 3KFXA 4OMCA 1XDBA 4TKUB 5T8KC 3WK5A 4BGVA 1II8A 1Y1SA 1WHSA 2FMIA 4I3HA 1V3TA 1TVMA 2WAYA 3KKEA 3FF4A 1PZXA 4M76B 1GCOA 2C2BA 1V11B 4RYLA 3RU2A 1J70A 1Q1EA 1QOPB 5EZ6B 2DPYA 4AQ7A 1LSSA 3D1LA 2FB9A 1RJGA 4RLSA 5CM2Z 5IAKA 3VHQA 2WU3A 4B82A 1MLDA 1IY0A 4X24A 4CYMA 1QDEA 3IC5A 1GSIA 3LVRE 1E3EA 1U9ZA 3AM3A 3NI2A 4YMGA 1F4VA 1USIA 3E9QA 1GL7A 2JGEA 4MX8A 3WB1A 3Q7PA 3TIXB 3ZUPA 4MIYA 4F2WA 4DMHA 2QM7A 1JGTA 1Z0SA 3WIVA 4CM4B 5A7FA 4NAVA 2PTHA 2FPWA 1JPUA 1XRNA 2OL4A 5CUQA 1YA6A 1PTJA 1HY3A 4G1VA 4H6VA 4M87A 3UJAA 3VGPA 3W9YA 3UC5A 1ZVQA 2YC2C 5HIKA 1W4CA 4R1NA 2Q1YA 1T9BA 2R47A 3BKXA 4JS0A 4EGJA 3EFOB 4F96A 1EMDA 2JJ1A 2FUNB 4ZVQA 2JD2A 5TRTA 4YMUA 1SHLA 1GYRA 1NJ6A 1QQBA 1IXZA 4J0CA 1ETHA 3RCBA 1LSJA 2BI7A 1W19A 1K8XB 2IE0A 4NONA 5KOHB 1JEAA 5KYKA 1BXRB 2IY9A 5JMPA 4F04A 3C3YA 2YJTD 2EFDB 3FCXA 3D3QA 4MKIA 2V7WA 3LXRA 1RHQA 2TMKA 3UBTA 3AVUA 1UAYA 1KSGA 5JSKA 1I32A 4YJDA 1TT5A 5LB2A 1U1DA 3I34X 3AHDA 4JCOA 1WIWA 1YQDA 3P19A 3RIHA 2A9OA 3N2NA 2QMZA 3RC3A 2ZS8A 2RG1A 4BFZA 1E9CA 3A27A 3GFTA 3LW8A 5IT9A 3GFSA 3KL2A 4RZXA 1W5AA 3IEIA 2P77A 1WF3A 3O8QB 4KO8A 4Q5IA 5F7ZA 3ZWAA 3N2KB 3KSDO 3OH8A 2GBLA 3CE9A 3MTJA 1VZ3A 2IEZA 3Q15C 2BGMA 2O8NA 1YACA 4JWTA 5DH9A 3GUHA 3NYRA 4NPHA 4TMVA 5BQPA 1EHCA 3TL3A 2JJ2A 1FTQA 4DVJA 4KHZA 2PMWB 2HN9A 5DX8A 1VE9A 2L17A 4YR9A 1KYIA 2V7UA 1NSTA 4O4IA 4A0GA 1EDOA 3D8UA 3H1AA 3I9NA 4BMYA 1ZH8A 1G20E 3GWZA 2BI4A 1P8AA 1XA4A 1UOOA 1XKLA 1ZONA 4E31A 4HRYA 4P80A 5AVQA 3X1WA 1XZAA 4W5TA 3KV1A 4I50B 3TSYA 1XVAA 2OUKA 3ROKA 4JB3A 2AXEA 5H83A 1T8WA 4B4DA 4JUFA 3C4VA 3LWBA 4HADA 3V46A 4ZEWA 2AF3C 3QX9A 2KQUA 1RAGA 4GECA 5KYWA 3NHBA 4BQNA 3AIOA 3H97A 3P8ZA 5ES4B 4WCVA 1ZM3A 1RZVA 4L9RA 1KVRA 1P77A 2CYBA 4WEQA 4W9NC 3ZXYA 5AW2A 2G40A 3OIWA 4IFEA 3O92A 3QBTA 4IIDA 1MO3A 4ID3A 4MKFA 1M7BA 4KJXA 5DRYA 3PF8A 3R9XB 1E3QA 2RH9B 5DGDA 1E2FA 5FL7D 3HN7A 1XC7A 1PFGA 2VHWA 3GA7A 1G3RA 3KUUA 3QE0A 2QYHA 4ND7A 3N7TA 4UDNA 4CCYB 4DABA 5KVQA 4L51A 2COEA 1M0EA 4W8OA 5AKLA 3A1CA 4LHSA 4MS1A 4YPFA 2WZCA 4XVCA 2GBGA 3DD5A 1QNLA 3WFJA 4POOA 2WAOA 4QTYA 1WPQA 4AF7A 1MX5A 2Q5QA 4LNHA 5FOVA 3OJCA 3FMFA 4RXMA 4URXR 3OQIB 5CDFE 2O8CA 4PSUA 3HKEB 2JCBA 4BEVA 1JG7A 3JD3A 2GN2A 4A0RA 5I4CA 1AXGA 2P3SA 4RMIA 4JDPA 1CRLA 3CSDA 3RU7A 4DSZA 5LBIA 1E3IA 1ATZA 3UH1A 2NPFA 5BYJA 3LXMA 1IHDA 3F7MA 4HX9A 5KNBH 1VJDA 1JR4A 2EFGA 4BJ3A 5AM3A 3L8FA 1G17A 2PBRA 3R6DA 1PWXA 2BL4A 4CLEA 1JHOA 1Q21A 1E5DA 3S1AA 1RAHA 1AG9A 1RI2A 2GF9A 2WE8A 4JVNA 4OSOA 3H75A 1N3BA 1U02A 2OZLA 1FMJA 2JZCA 1RMQA 2B1GA 1QONA 2RBGA 2WV7A 5EZ5A 2P4SA 1MR3F 5B1SA 1XZJA 5EOVA 1MB3A 4NABA 2HDWA 1JFFB 5FUXA 1QWOA 1KAQA 1Y89A 4L76A 4UM7A 4AB1A 4EI8A 3UHJA 4YUAA 3LDAA 4WT7A 1P4RA 4AS1A 2DH6A 1MT3A 2SCUA 3GLFB 2WJYA 1FFXB 3L0OA 1GGEA 1VJRA 4G4SO 3ZX4A 5TVGA 1PO7A 2Q49A 2PRIA 1Z63A 3AESB 1HT3A 4FCTA 4LBVA 2PMFA 4CG1A 5LXTA 5E2BA 3T3DA 4PSDA 2GARA 4MS3B 3HA2A 2RAUA 1QFZA 3MMZA 4QHSA 4QUDA 3JD4A 4EYQA 2NGRA 4Q4LA 4EY5A 4ZWNA 3C2QA 5H5JA 4JROA 4DCSA 5GTDA 4JLBA 2HA7A 4XTRA 4LF6B 4RD1A 1O96B 2ISSD 1A8HA 4MRVA 1LFDB 1INLA 1T5OA 4A0FA 2YBDA 2YWFA 5AHOA 4TZTA 2QR3A 1P0MA 2E85A 3DBLA 1NXOA 1TAHA 5IARA 3HJUA 4KAAA 4YQFA 3BFPA 4LX8A 2VUHB 2D74A 3PWZA 3UJDA 421PA 1MQAA 1Y8CA 4QXPA 1N7GA 3DQZA 1SCNE 3KHSA 1P3JA 1XTPA 2PT5A 2PS3A 3QOXA 2A0UA 2R5FA 4M49A 4Y1GA 3H3XA 5EHZA 1Z6GA 1LKZA 2W11A 1AU9A 1Z5UA 4PZLA 3O9MA 4B79A 1HT0A 2WE7A 4K9SA 5LVAA 1AMNA 4LGCA 1CBUA 1R4NB 5AKXA 5JDIA 1Y9ZA 1N32B 5A0TA 2P68A 4B3TB 2OBMA 4PG4A 1WS6A 3A9TA 3I2YX 3DZCA 5D86A 2IYNA 1AT1A 2IA5A 5EQTA 4D3YA 2CC2A 2BEWB 4U4AA 4TV8F 3EVEA 5L8VA 1BVRA 4K87A 4CLHA 3GCZA 5LP1A 1KJNA 1CUBA 4XOUA 4DYVA 3MA0A 4X45A 1L4LA 6Q21A 2AXNA 1UBSB 2O50A 3K0FB 3I5AA 4YT5A 4AW9A 3L0CA 1XNRB 4LZNA 2FPGA 1AHPA 3K16A 2PSJA 3N2IA 1YUBA 5EQFA 1U7WA 2ZZNA 4GMFA 1DGQA 2VCEA 1KBZA 2QROA 3CBGA 3DEHA 3WLRA 1FYXA 4HN4B 4CMEC 4HH3C 2ZYIA 2FETA 4JJEA 1T1EA 1NR7A 4UEOA 5DB4A 1FNMA 2QSYA 4OQMA 2TSYB 3VZRA 2PLRA 5SZKB 3FCEA 3PJGA 1ZN2A 3JX9A 2VVTA 3CGGA 4Z99A 1AXRA 1Z4KA 1Z4OA 2HRCA 3BM5A 4FZRA 5ICEA 5IVKA 1RCTE 1RXYA 1R27A 4YP5A 4UNRA 1UPBA 1JWAB 2B82A 3PPYA 5JH7A 4H77A 3FPKA 3JAKA 3L92A 2LGJA 4FHCA 5FHQA 2PH3A 3PGA1 4M22A 3IR7A 4XGIA 4BLOA 3U60B 3QEMB 5EESA 4Q15A 3ROEA 1MNQA 3WGYA 3UKOA 2QL9A 4HSGA 4DM7A 2A14A 2ODAA 2M9MA 3HBMA 2RBEA 3ZHUA 3LHDA 4DQKA 4QAQA 3OTGA 1TEHA 4CKEA 2I4LA 1Y3IA 4FHZA 3IR6A 3TW8B 1XHEA 2XODA 2C1ZA 3HDYA 1QGUA 3RSCA 1P1IA 3SHVA 5JMOA 2XCUA 4MZDA 3O4HA 4L16A 4KFRA 4R2LA 5A9RA 3MJTA 4CM6A 3G8AA 3P2OA 4L0DA 2EKDA 3WG9A 4JT9A 4H18A 3ZBQA 4TZ0A 1WXIA 2G9VA 3A1WA 2QG6A 2PSHA 5MGNA 1U9JA 4R7TA 4O2LA 5A4IS 4HUQB 1JSRA 1TNDA 4G0XA 5LUAA 4DDMA 4MR7B 3BZWA 3H5RA 1G8SA 1SVSA 1BJTA 3L7LA 4Y1RB 3HA7A 1OC4A 3CW2A 3RHZA 1B42A 1GPH1 3S4YA 4JLMA 4PCLA 1EFLA 5TX7A 2ZRMA 2OHJA 2P41A 4DNOA 4KVGA 1L7EA 1SD1A 4OL9A 4AJEA 4ETMA 4H1TA 1Z4LA 2FP3A 5CPFA 5GV8A 5T4FA 2LNDA 3FYUB 5CH3A 5TDHA 1M8GA 2FOLA 4IXWA 2HMWA 3Q3VA 4LRWA 4BQIA 4AY3A 1AQJA 2A9KA 2P9TA 1W49A 1MU0A 3DMNA 1RHJA 5CA1B 2EFHB 1HL3A 1VMEA 2CJXA 2W2KA 2GNAA 1VE6A 2G06A 2ZBGA 3FTDA 2YIDA 4RTLA 4B3FX 4EARA 1Z39A 2CVHA 2ISQA 4ZVPA 5FUBA 4XJXA 3UQZA 4CQMD 1T0BA 3VO8A 3DE4X 3Q0EA 4QNNA 4DJEC 3FJ1A 2CNDA 3K1ZA 4C2TA 3ZJ4A 3EISA 1T5IA 4E5PA 4KR3A 1J2UA 2ZBUA 3QW2A 1BVHA 2RG7A 1LRJA 3DZIA 4URHA 4P92A 4ZMRA 1GZ7A 3ILSA 3IE2A 1M0TA 5DMHA 4C4RA 4PAOA 2GI4A 3DM9B 4HAVA 5E2IA 2ZYTX 3RUAA 4YRGA 4KO4S 2XUIA 5A4KA 1ZEJA 4D4MA 2GA8A 1P81A 1Z45A 3ZCUA 2JHFA 4HDRB 3NIFB 4I6JA 4KFCA 4GFDA 3D8NA 3Q9SA 1FJXA 5KYNA 4I1PA 3SEAA 2Z2YA 1JG6A 1P2GA 2PLWA 3DV0A 1MC5A 3ORFA 4RKRA 4DNXA 4P6VF 3NPAA 4L72A 2VAMA 1ADYA 1FSFA 1XK6A 1PYGA 1N6LA 4N3BA 4YECA 5C8DA 1AJEA 2E55A 1YC5A 1UCFA 2OVFA 1YD7A 1I5RA 3NHLA 1H9AA 3FWKA 3N05A 2PS1A 3K7EA 4DLUA 4TPKA 1QQ6A 4HQLA 3LCCA 3ZZNA 4BLWA 3O84A 1Z0KA 5HGJA 1M2KA 1SOWA 4LDJA 5GWXA 3ICVA 4D92A 5IBRA 1NVBA 3ESDA 3PTZA 3GEEA 5H16A 2OXTA 5AVZA 4B3DA 1DJOA 1T35A 2PAFA 4N5LA 4BVHA 1NGSA 2QMOA 4XE5A 4PC1A 3EZNA 3PHLA 4IW3B 4D9HA 1E98A 3ZDZB 1KEVA 2P9CA 4I4TF 3FZNA 2JLXA 2IW1A 3G1UA 2BMDA 3NV9A 3S3TA 3PYLA 4C1BA 1KO8A 3T3OA 2IWRA 2JLRA 2F1IA 3P9CA 3M49A 4EUSA 2JFNA 2GJ9A 2J9YB 4R9RA 3IGFA 4LX0A 1E2QA 5D3QA 1NYQA 1VIDA 4ER0A 3TZCA 3D3NA 3GF4A 4NPAA 4P81A 2ZYHA 3A9SA 1IUNA 4S1WA 2FP4B 1PZFA 1Z8DA 4Q1EA 1NV9A 1NBWB 3FYTA 5DHUA 2ZU0C 721PA 3DEJA 2ATVA 3L4KA 1BKYA 1O9GA 2TS1A 4H7JA 1UM9A 1X70A 4O4LA 4EEKA 2IV2X 4QSMA 4ZO9A 1Z5OA 1MXHA 4XB1A 4RKFA 4FFBB 4EQ6A 1N3IA 1X7DA 3TJMA 4Y2UA 1LNSA 2W2OA 3AUUA 1K7SN 3PRKE 4J2OA 3ZV3A 2GWRA 3BWMA 1US8A 3C3KA 3IUYA 5KHOC 4AN0A 4OBBA 1IEXA 2RFLA 3KAKA 1CK4A 1ZCZA 5EXDA 4DW8A 4E5NA 5COQA 4DS3A 4AP6A 3TQRA 3W8FA 3GEPA 4C2BA 4PCUA 1M1XB 2PKEA 4WZZA 2Y2VA 4EA6A 2XXBA 2C7GA 5JVDF 5E9AA 1RPTA 2CV1A 4B6SA 3UGKA 1QJCA 3SKXA 1JLKA 4ZVNA 4YRBA 1NT4A 4RSHA 4NBLA 5IFKA 1MD9A 3WZMA 2JHPA 3T06B 2JGDB 1OYVA 1LC0A 3IIEA 1IY1A 1JMYA 2OXCA 3RUCA 2RDMA 3PYMA 3OURA 1FU7A 3RAJA 3GLHB 1U4OA 2YUTA 3R6LA 2QL5A 1B93A 2RGEA 1V6AA 1KRWA 1NXSA 4GRIA 3NIDB 4Q4DA 4B35A 4Q3NA 3LPMA 3ETHA 4GSLA 4H1UA 5KZMB 2Q2OA 2II6A 2YJGA 3BJMA 3NWOA 2Q6VA 2ZB4A 3OEED 4OXQA 4TSFD 4I81A 4MVJH 5DN9A 4G8JA 2FSSA 2GX6A 5ED4A 2W6PA 2WMNB 4MWEA 4IINA 1HEYA 1YS2X 1YVRA 4E07A 1DQRA 1SD2A 3EW9A 8OHMA 4Q3CA 2ZJ0A 4G2NA 1M2WA 1WO8A 3MJSA 1GITA 1LH0A 1NY6A 2QRPA 4TXNA 2QI9C 1ZL2A 1T3HA 5JNWA 4UJ3A 3CLUC 4EECA 4BVEA 3DB2A 1XRLA 2XIQA 1I7NA 4Q66C 4AMUA 2HO4A 2QQ5A 1FPQA 3HXPA 2VHTA 4IXNA 3HI4A 4EFKA 2C0PA 1M2VB 221PA 3NETA 4H08A 3TQSA 1CR4A 3JQAB 1DC4A 1N4DA 1TK3A 1SUEA 2B4RO 2BFMA 1U3UA 4RFVA 4LY0A 1QS0A 4DJ5X 1CB7A 2FZKA 1M8JA 5ALEA 3VU9B 3WGKA 1WB6A 2ES4A 4DLWA 2FHPA 1D7OA 1RM4A 3U4DA 3ZKWB 1BHQ1 3C74A 1MB2A 1C1XA 1V48A 3KV3O 3FJOA 4O25A 3OEHD 1PJ4A 4GLFA 1U8AA 4UUMA 1PFVA 5E3IA 2OG2A 4XSHA 2VDJA 2BMAA 3H9EO 3TEJA 2ZTUA 3PNYA 1JECA 5JRJA 4TYYA 4RF2A 4ZQIA 4GKVA 1FDRA 1B26A 4H6PA 1KJYA 3RSSA 4L8YA 2F43A 2O5VA 3TR5A 4EY3A 1MJ5A 1JZSA 1ZAKA 1Z75A 2AEEA 3AW9A 3IODA 3HRKA 5DBFA 3JQQA 1U65A 4ZTBA 5JEEA 3O8CA 1F8FA 4JP3A 1KP3A 2WFLB 4MWBA 1S3SA 3KZ1E 1ZAYA 2VAVA 5ERYA 3QVWA 1IBMB 1OXTA 2D00A 3DAGA 2OD2A 4GZ5A 4P7BA 4OTZA 4E09A 2G28A 2ZSIA 3WQQA 3S2UA 2WYHA 3CZ4A 3U5ZB 1E0SA 2O8VA 1Y9AA 3IUEA 4G1UC 1C8LA 5HVNA 3EAFA 5J43A 1G64A 2CE7A 2P91A 1SC1A 2Z3WA 3U17A 3WK9A 2ZYGA 3KZKA 1DO0A 2NW6A 1QOZA 3KSMA 5G4KA 2JGFA 2NOAA 2XZPA 3S2ZA 4BHTA 1CF2O 2R87A 2YJ3A 3I9OA 3TJRA 3O8RA 5AUOB 2GYUA 4TV9A 4NEQA 1IWOA 1Y9DA 3EZFA 5DLQC 5HM8A 4G25A 1YB2A 1AMUA 2C5HA 3OF5A 5IW8A 2BVNA 4M83A 2VDVE 4X7BA 3U61B 2KYRA 4H59A 3WGHA 2CLCX 1G2IA 1Q44A 1QB7A 2R1VB 2WA2A 2P0YA 1U94A 1QHHB 2KI5A 1IJKA 3QUBA 1G19A 1EPUA 4CBVA 4D8YA 2JJ8A 3QTLA 2RAFA 2JH3A 4P93A 1CF9A 4CDRA 1NTRA 1QHNA 2CDRA 2QD2A 3ILXA 1UFQA 1DX4A 3OFJA 4X61A 5T5QA 4UOZA 2XADA 5CJ2A 4TLBA 1NE7A 1GGNA 4AKIA 1XYYA 2YWCA 3CNLA 4BB6A 2Q4RA 1ZD5A 4NZPA 2A57A 2FMFA 3UMSA 3L1HA 2XQKA 2LD4A 3KPJA 1IPHA 1YR1A 2LWIA 4KQHA 3AHGA 3FNRA 3H5NA 1TJ3A 1DV1A 1M2GA 1TEXA 2DULA 2A0FA 2VZ8A 1N57A 1X1RA 4W8GA 5DW3A 3TDNA 3AEQA 4CEIA 3JQ9A 4JLSA 4GHWA 2ORWA 5LQUA 2E82A 4DSUA 1K6MA 2BM1A 3DMRA 1A9TA 1GO2A 2EEZA 3B53X 3H1TA 2YHBA 5CDHA 1DDOA 1XLVA 1X0VA 1KMNA 1B14A 1T24A 5DOVA 4AXBA 3SE0A 3INYA 4KI7A 4QOHA 1YL6A 3WNBA 3OJFA 3Q3JB 2CCGA 4NXNB 2ZITA 4P2BA 2J1LA 3W7AA 5GINE 1OIXA 4J29A 4CG2A 1OWMA 4YJ3B 2VAXA 1A9SA 2VDKB 5AKYA 4CQJA 1MEJA 4YQEA 5B4VA 4CM1A 2QW8A 1JLHA 1YC2A 2N1MA 2I2AA 3IUMA 4IGEA 1EGVB 1IY2A 4R51A 2CLOB 1F14A 3L9WA 4CUJA 3DZJA 1XTZA 3IRUA 3BK7A 3A31A 2DPHA 3SYMA 3C70A 4Q24A 3QHAA 1HLPA 1VLQA 3NHUA 4L8WB 3K0SA 1YMUA 4RHFA 5HOQA 2JZOA 4GEGA 2A7XA 2QU7A 1BMFD 4EUHA 5F51A 4BCBA 1V47A 3K6RA 3ER6A 4D96A 2O8BB 4RTNA 4R7GA 1C3VA 1RXWA 1TM1E 4CQMA 3QXXA 1FUEA 4B1FA 1K7YA 1QZXA 4RLQA 5SY4A 4OQZA 4WFKA 5IAJA 3U3DA 1W5TA 4Q6BA 3QKRB 3K8QA 1RRPA 3UJ7A 3IALA 4C22A 4B84A 1PJTA 2C3MA 3BL5A 3W8RA 3V8QA 5D51S 3AU8A 4PO1A 2QQGA 3A3PA 3QWBA 2WYUA 2CUNA 3GVHA 1P1CA 2J7PA 1KAEA 1WZNA 4X63A 5I48A 2Q5CA 2XGMA 1JA9A 2O07A 1CTQA 4I1RA 5FI3A 1K4YA 1A69A 1D4FA 3PC4A 4M0LA 4A6DA 4QGBA 5C2JB 5F9FA 2OBLA 5FA6A 4YAKA 5DM2A 1T0PA 4JVOA 1CE8B 2FFHA 4M8IA 3TX2A 3SQWA 1I2ZA 2M6RA 3ROGA 1YT5A 1S7CA 1EWTA 5F1KA 3FPCA 1O95C 1YZFA 2PZ8A 3C5HA 4M1ZA 1ZSYA 4GGPA 5HDQA 3FSGD 4AZ3A 3OT4A 2FFQA 2HBYA 3UUWA 3QOYA 4HSEA 3GARA 1BE1A 2C9BA 3VR6A 4Y2RA 2A9RA 3AR3A 3IQGX 3EDMA 5IH3A 4QM6A 2FG5A 2HIMA 2ZRAA 3NTVA 1CV2A 1BC5A 2ATXA 3LT2A 1ZIOA 2AJLI 4U2CA 2R5WA 3LO8A 2VYVA 3CGWA 1DEXA 4UU7A 1HNZB 1K2VN 2A88A 4PN3A 5EJ8A 1Y5NA 1GFIA 4FB4A 1ZZGA 3ET5A 4HEA6 1NW8A 3E3MA 4QE3A 1PX0A 3MWEB 4KU4A 6ABPA 2WQ7A 4J7XA 1N2OA 4IXMA 1KE2A 4D8XA 1Y6JA 2XTZA 3OQPA 4L9SA 4BJHB 2O8FB 1EK5A 2IVZA 4JZYA 1JXOA 3AETA 4OXRA 2FW6A 1GEEA 4B3RB 2CL0X 2ZXEA 4IOLA 5K0CA 4J7UA 3NR2A 5ECWA 1BS9A 5F2KA 5EIFA 2E5LB 2R6JA 4KIFA 4EI2A 1ENZA 3BOSA 4J4BA 4XQ9A 1Y80A 4M4SA 3V5NA 4B7ZA 3IP6A 3RGWS 4V1CA 4MS4A 3LQ2A 3RUIA 1C30A 2FJ0A 3I01A 5HF6A 3H13A 4CIAA 5IANA 1EAYA 4IH4A 5G1NA 1E1DA 3NCTA 4RZUA 1GGHA 2QB5A 3ISTA 5CXXA 3UAGA 2HWWA 1HG0A 4XJTA 4WOKA 2D2EA 5H68A 3V48A 1C7QA 4CM9D 3L8EA 3D3KA 3T0GA 2JK0A 2QQEA 5B57C 4Q4AB 3WWZA 4D0NA 1NVVQ 1T1GA 3O82A 1Q0ZA 3KVVA 4AUEA 3N8GA 4P32A 5E0OA 3A1SA 3LT1A 1EVKA 1JS1X 2EBUA 5F1YA 2Z08A 3Q6MA 1FP4B 1TKBA 3FPAA 3LNCA 4GZLA 3B1FA 1H4VB 3OY7A 1U4NA 2FSIA 1L8AA 2IPNA 3CH4B 1L5GB 3DT6A 4YWJA 4LWZA 2RHBA 4ZEXA 3DT8A 5FLYA 1KP9A 2I54A 3NDBB 4KXNA 4AS3A 2YYAA 3LYAA 5FWXB 4MYUA 1F5SA 5CLFA 3AVOA 1K06A 1PTJC 1NMSA 1V2HE 2XQVA 1C4OA 3WHKA 3HA3A 3I0MA 3WLSA 4A16A 1Y48E 3VR5D 2QTBA 1L7RA 3WGIA 4GP7A 1RLOA 2FNAA 4REQB 2O8EB 4V24A 4C29A 4Y7DA 2VZ0A 3KOYA 1N1DA 1JJ7A 3EG5A 2LKCA 4EMBA 3F9RA 4X1IA 5B3JA 1PG5A 1NHGA 3HDTA 3T4EA 1CUAA 3K9GA 4ARSA 3HO1A 1CJMA 2XRFA 1XHFA 1YRLA 3OEEA 4QJ5A 3UJHA 5JAZA 4RVOA 2B6NA 2H29A 3H8SA 5T6MA 1JAXA 4QBTA 4N5MA 3BIOA 3QBDA 4E1VA 1T9CA 3PUKA 4QOEA 1A9PA 3PTLA 4BO5A 1YBMA 2XV1A 2O3JA 4ZC1A 2HPZA 4LGMA 2XCSB 1CT9A 1E5TA 3PR1A 3BCRA 4HYEA 3PTAA 4J0QA 1RT9A 2HO5A 3NYIA 4LY9A 3FNBA 1JH8A 3EK2A 4IQGA 2XVYA 4K88A 2ASVA 4WOBA 5REQB 3QLVC 4I55A 4C7OB 3T3HA 5LMNB 4WNCA 4KMSA 3DAOA 4ND4A 3IOMA 3ZLBA 3KQOA 3PCTA 1G21E 2GBLC 3QOWA 3FUUA 2HCRA 3EF3A 4Q82A 1H69A 3PFWO 4MQFA 4RDHA 5ESRA 4PPQA 1W46A 2E6UX 3CMCO 1XU9A 2HXGA 5CVDA 2GA9A 4WXRA 2K5UA 5CVVA 3R9WA 4KVAA 2FRDC 1PVVA 2IPXA 1HDYA 2IVFA 1DC7A 4A1OA 3VYSB 3SF8B 1YUNA 1YJAA 4B4OA 5FBVB 2R6HA 4FONA 3R3SA 3O1HB 3TTTA 5DK6A 1M2EA 2R44A 3JD0A 1MOQA 3G2NA 1PFKA 3X1YA 2CVOA 3K71B 1H23A 3NPMA 3NWBA 1GFSA 5DWDA 1WTAA 1DJQA 2I6FA 2QY6A 4F9GA 1X19A 1Z15A 3O9ZA 4PYNA 5FADA 3MFYA 1HQCA 2XGJA 3VVLA 3GDWA 3PV0A 4DA8A 1FLDA 1KFEB 1WP9A 1GGJA 3A6DA 4CF5A 1HUQA 1JDUA 3ICWA 4ZICA 4DV7B 2HT1A 4ENUA 4R8SA 2JLZA 4MGIR 2PX2A 3MWLA 4G26A 4PYOA 2Z9BA 4UMEA 3HFSA 4OX9B 4CM8A 1PJSA 1G8JA 3D7RA 1UKVY 3MB8A 3NH9A 3R4CA 3T1VA 2RI0A 1OZGA 3VPFA 3ERCA 2C5GA 3T8YA 5ITWA 5ICGA 3O73A 2R1TA 1KJJA 3WYBA 3U4QB 1VKOA 2RHGB 2G3YA 3AY6A 4DCJA 3E05A 4MIEA 3QFFA 3DC7A 3ZTTA 2B21A 3AB3A 1KYQA 1NJGA 2HA2A 3KX2A 3T4UA 4N03A 2A3RA 5KYUA 1GAXA 1I6KA 3CUTA 2DE0X 2G9UA 5IKMA 3KEGA 5BWLA 3B13B 4FUTA 2ZYSA 4XIGS 1JMKC 4JB2A 3T1YB 5CEJA 2AC7A 1MO6A 4J1QA 3NXKA 3AOEA 1NQ5A 1LF5A 1ZN9A 2A3NA 4JNCA 4WKPA 2UZ0A 5D3MA 3E9CA 4HD8A 4LE0A 2NTVA 2X2FA 3A4IA 4HT3B 1SURA 2XB8A 1DCTA 1ISHA 3JTMA 3UFXA 1NW6A 2OEPA 2JF0A 3HDHA 8MHTA 5E7QA 1BFUA 4EVQA 3SKYA 4ZOLB 2HF7A 3RAGA 3FR7A 4HWPA 1JPJA 1F9EA 1X9IA 2NV2B 4CIBA 1X7WB 3CEAA 3H87A 5E6UA 3TQCA 4XUCA 3BD8A 4NG5A 5HWSA 3ADDA 1NMEA 3WSWA 2Q5HA 3E3NA 2Q7DA 4J0HA 4GOXA 2NQ2C 4OJTA 3CNOA 1TPZA 4FBGA 4MW5A 1GZ4A 2NSLA 5J4YA 4E03A 4C0LA 2QORA 2WZBA 3H11A 3H4MA 4BB5A 2FN4A 1E5QA 1U1CA 1G8YA 1PDOA 2HXSA 1U2RA 2NUPA 4L8GA 4WZAE 1RYYA 5J2TF 4U9IS 1KAHA 2PMBA 2QIPA 1HURA 2O4CA 3FYHA 4W4TA 2DB3A 5A06A 1EAMA 1XCLA 1WDMA 2X5JO 4YFYA 3KXKA 4RIEA 4LDZA 3T7CA 1R64A 1Y1PA 2NUTB 5J63A 2Q6OA 3ZGVA 8ATCA 3Q12A 3OESA 3SP1A 2AEFA 2Q4OA 1TGYA 3EUWA 2YY7A 2X0DA 2K6GA 1I6WA 2NYRA 3MGGA 4GE0A 3WIOA 2B36A 4E08A 3D8RA 4D3SA 1EFUA 2FWRA 3WHPA 4DYHA 4MVWA 3FTPA 4G84A 3G5AA 4PVCA 1QPGA 3HM9A 2IYLD 2C07A 2P3OA 2NX2A 3HB0A 3HJGA 1LCIA 5A05A 5AW4A 4UMVA 4C0JA 1G8AA 3P0RA 5A2QA 2FE4A 4Z9FA 1UMDA 3CNHA 4FEEA 5D6NA 5EHIA 5C8YA 4UU1A 1RJWA 3FX2A 2C77A 1VE7A 3GPIA 1Y82A 1R15A 3C3EA 4W1SA 1LQUA 1BMFA 1EZZA 2P2CA 3CEPB 2BSAA 1DKQA 2IYUA 1OLOA 3HZRA 1OI4A 4M60A 5BSWA 4LZJA 1IN5A 3AJRA 5F21A 5IK2D 1NLYA 2P0AA 2NAFA 1N2IA 1OXUA 3FRIA 4MRSA 3BGDA 3ZYCA 2WD8A 4HNAA 2I71A 5HBGA 5FH9A 1ZK2A 2RAVA 2D8MA 4R7ZA 3VR2A 4IEFB 1SQFA 3REFA 2WK1A 3O1LA 5C46F 2UUBB 3TIVA 2OBYA 3C6QA 1QTQA 2M1ZA 2OSVA 3AUFA 3QV1A 1FX0B 5JDIC 2QTZA 5DVZA 2OQ2A 2DKFA 1QTNA 1AQNA 1ZU4A 3I9LA 3AL2A 3LY5A 3B78A 1GAEO 3NM6B 4DKXA 2C5AA 5HQTA 3CVYA 1W85A 3DTNA 2IZ0A 2HCFA 4C14A 3HB4X 4GRDA 4O63O 2V7VA 3P32A 4JVMA 3GRFA 1MRNA 2KMLA 3TW0A 1JT2A 3DLIA 4JT4A 2AOWA 3RKUA 3SHFA 1KWKA 3M9XA 3AFMA 1TVEA 2FJUA 4WFIA 3BRWD 3PEFA 1EYZA 1QJ4A 5ELLA 3WNQA 2WIGA 5CNJA 1AKVA 3FSGA 4FFPA 1U8FO 2H54A 1MKYA 5HIJA 1D07A 3PX7A 4U9HS 3HU5A 1H5QA 5DYGA 2RGNA 2X6QA 4WBNA 2MSKA 4RJ2A 2JAPA 2R7NA 3EDCA 3WNVA 2BY4A 4PPFA 4FEYA 1NW5A 1Z37A 3K1YA 1UINA 4UNNA 4UVHA 3UB3A 3GLIA 1CJTC 3M1IA 1TJYA 4ZAVA 4M9SA 1YJ5A 3AVYA 2B98A 2CUZA 4UKDA 4FFDA 3IL2A 3T4PA 1VCIA 4MTLA 1USKA 1DLIA 2PZLA 3ETEA 2IF0A 4JHXA 3ZDEA 1WZUA 3OX3A 4ZKEA 4HWOA 3ZR4B 3DDNA 2ONZA 4QODA 2I03A 2QTNA 1Y5IA 3IIJA 4B80A 1D3AA 4FW9A 1OT3A 5DBGA 5C1DA 2UVPA 1OQAA 3NFYA 2QZJA 3MTDA 2JD1A 1U8UA 1P5HA 3OMWA 4NL4H 4B7CA 4F6LA 3E18A 3LTNC 5BN4A 3I72A 1I0IA 3NHAA 5TY0A 4UREA 3TM5A 5KWJA 1J20A 1B6SA 2GCOB 4DAEA 1J23A 1XPUA 1W48A 1Y1LA 5I8PA 4DV2B 1I3OA 4X6XA 2OY0A 4DBVO 1CEEA 4IVPA 1Y1RA 4Y2GA 4YGXB 1FS4A 3P4YA 4N8EA 5EMKA 2I4RA 5FBWB 2QVBA 3NBUA 4AVYA 1T4CB 1XEXB 1LRLA 1FDSA 3HHPA 3SJAA 4PNZA 4Z0NA 1OBVA 2YV4A 3UB2A 3T3PB 2OM6A 1WETA 5EIWA 2IU6A 2ZSUA 3NDRA 2WF8A 5KREA 2PXHA 1TU4A 3LYUA 4GMKA 4OLJA 3DFIA 4BFLA 1THZA 4O2BA 3EODA 10MHA 4XWTA 1Z73A 1IN8A 3GW8A 5LP6A 3GHHA 1FVOA 5FOXA 4RHCA 1TGVA 3WNCA 5IUJC 4TVSA 4G41A 2H6EA 3V00A 3KIPA 4D4GA 1LLQA 2L19A 4GQBA 1U90A 3TRKA 1ORWA 2IU0A 1JJFA 3GDFA 3QEKA 1IVNA 2KPOA 3T6KA 4O3FA 2FN8A 2NXEA 3O91A 2AA3A 3DJFA 5GM2A 4F9TA 4MCIA 1P39A 5HUJA 4RIIA 3DMTA 1U99A 3ZEAA 2VJAA 4RS3A 1RXCA 2FX2A 4I1OA 3I62A 1G6HA 2EJBA 4L28A 3KTDA 4D9NA 3IPCA 1KPHA 2Y0DA 5BQXA 1D04A 1V25A 3IQZA 2IW3A 5JC1A 3QJGA 4JLVA 3GC6A 2GPJA 3H3FA 4PQYA 2C4TA 2Y76A 2BEVA 2BGRA 1RAAA 3DXXA 4H0CA 4HUTA 1JI0A 4L27A 2C9MA 1JV2B 1RP7A 3JW8A 2WJJA 3CRW1 2QZSA 3CZMA 1QORA 3WYCA 3NUGA 4BMZA 3HCAA 3NANA 4MO9A 4BP8A 1SVMA 3C16C 4INOA 4WAUA 2O8DA 1IATA 4XI9A 3S2YA 1UEXC 3SY8A 1SGWA 5DEOA 5HE8A 5K3EA 3ZV6A 2GK3A 3MB5A 5F9HA 3E35A 1OZAA 3SJZA 1X3LA 1LWNA 4MGYR 1KZGB 5IVDA 5B30A 4EG0A 4U1RA 1QTRA 3CM0A 3U9TA 1WKBA 2VNSA 3IUBA 2XWSA 4TM8A 5HFJA 5F76A 4OH7A 3BXFA 2GILA 1QKJA 3QOFA 2IX9A 2WJHA 5FPHA 2P6UA 3PQEA 4H1WA 2CZQA 3EVBA 5HRCA 1G2OA 2HMSA 1DOZA 1GZSA 1EP2B 2YCBA 5DXFA 4IMIB 5LB4A 3S2SA 4D9BA 1FP6A 4NENA 3BIWA 2PT9A 1L3BA 1N7JA 3CLSC 3O8BA 5CGQB 2GEDA 2MYNA 3LY9A 3RTAA 1GQRA 4MO2A 3VC1A 1VECA 4ZEOA 3BDVA 1NUSA 2HL6A 4HDQB 4A6PA 1D1TA 2A5FA 5CH5A 2QYTA 4KTTE 4Q3BA 4Q48A 2OV3A 1AZWA 1DKLA 1O0SA 2QVLA 3H2ZA 4IR7A 4K9NA 4IDQA 5I9IA 3TD2A 1JVSA 1L5OA 1ZM9A 2ATEA 4C4PA 1AUOA 5EMJA 2Q4EA 2CL6X 4WD3A 2F1HA 3UAWA 4YBZA 1IH8A 4UNSA 3AT1A 1YU6A 4F92B 3HZOA 1JSCA 2IYPA 1JG2A 2J08A 1GQQA 4XIIA 4F9FA 2CV0A 5GONB 2JLVA 4DEXA 3WGGA 2I6SA 3IEUA 2ZDGA 4RVDA 5DM70 1I4TD 4PHFA 3BIXA 2MYTA 1Z5GA 4NBUA 1F1JA 5EXEA 3UMCA 3GJTA 4AY4A 2F3QA 1SHUX 2KW5A 2F3PA 2YWRA 4LISA 1WW8A 2ZUWA 4XLLA 2AIRA 3W1WA 4BZWA 5CITA 4OLBA 4AJ9A 3DAYA 1UF9A 1JJAA 4ZHQB 4K8OA 1M5UA 1PK8A 2JH9A 4FK8A 2ALJA 1PR4A 3JZFA 3B82A 5DDIP 4MHSA 2NQ8A 3QFTA 4ZT7A 3TPFA 3S2IA 3D54D 4HUJA 1K7FB 3AKYA 1XFAA 4QASA 1WD5A 5J2UB 4ZXFA 2BEKA 4B6JA 1USWA 5B5SA 3MJHA 3QHQA 2ZAMA 3RAEC 1BGXT 2CMKA 1CDDA 3QIVA 1F60A 4PW0A 1XD2B 2Z2ZA 1UPFA 3CX8A 3ZWNA 2AR0A 1JN0A 4XR9A 4BNTA 2WIDA 1DWUA 1VL1A 5EIHA 3SDSA 3EX7C 1JWLA 2QTVA 3HCBA 4F2GA 2ZM6B 3P9SA 3RWMB 1X1SA 1ARZA 4EDHA 4D45A 3T52A 1ZRSA 1A82A 3AI2A 2IHBA 2PXAA 3GAZA 4OI4A 4AMZA 4EG7A 4C7XA 4H3VA 3ZHYA 5ALXA 2QN7A 2VJMB 5ITZB 1YFJA 4NE7A 1P18A 3KOOA 3WDSA 3O74A 4YMVA 1TYBE 4P7FA 5CH8A 1BKDR 1ULZA 2B2CA 4IHJA 1U2GA 1E7YA 1OKKD 2WUVA 2CJWB 4RK5A 5DXAA 5GVSA 4KXVA 5B36A 1XR3A 3HCRA 5J5CA 3VHLB 2H2FA 1GKIA 2C54A 2CFCA 1OVGA 2VF5X 3SC3A 4ZEVA 2GJKA 2Q8QA 2ZIEA 3I64A 3V1UA 1RRKA 3LWDA 1OT5A 2VXOA 4I19A 4LC1A 1M34B 1ODCA 4GNRA 2C0QA 2YWGA 3AKEA 4ZU1X 4IDPA 3PICA 4KBFA 2VUTA 3PNKA 5BOSB 2YWHA 3SZLA 4DUYB 4NV1A 1VDZA 1NQOA 2V6GA 5CTAA 1L7NA 1E2KA 2Y1CA 4FR2A 4JXKA 1TTTA 2NSHA 1MCZA 2QN3A 4TKUA 5KNBA 2X9NA 1OI7A 3FNHA 2JFBA 1X7HA 2ETXA 2J0EA 3M6FA 3QPWA 4L02A 4M1MA 4ZU3A 3UW3A 4QUGA 2FUEA 1GHTA 1V11A 4E2FA 1HRDA 1R9GA 1J00A 5DU2A 3UENA 4CE6A 4MEAA 4EB6B 1R0LA 1CC1S 4II7A 1X80B 2YWEA 3TWOA 4CWAA 1RZRD 1SELA 4RL4A 4ZVTA 2BCGY 4JI6B 1QHFA 3RREA 1QIFA 1VKZA 1CKEA 4EJ2A 1ORDA 2AFIB 4XYGA 1QIDA 2Z5FA 2I62A 4P08A 1S2LA 4QYMA 2ET6A 2DFDA 2QTTA 1GZVA 3W34A 2Q3CA 5F3RA 5ALNA 5CX4A 4ZQGA 1WXFA 4CM4A 1L7OA 2VH5R 1AKTA 2HY7A 2YL2A 3NB0A 3IH5A 3PPVA 5TQ2B 4E5MA 4GP9A 5DCWA 2J87A 4BO0A 1Q16A 4RVCA 1ZHHA 1YKSA 3TKAA 3EZGA 4DMRA 4KW7A 1JL3A 4KQIA 4XLZA 1YZLA 3TPCA 2VNJA 4TZKA 1BA2A 4HDNB 4N9QA 5J40A 3EFOA 2CLKB 1HF3A 2LE0A 4ZFNA 4AT1A 4G37A 5K8VA 2EX4A 4C21A 4DIKA 1NDUA 3ZNOA 3RFXA 2HD4A 3GZTB 3PI7A 5EWJA 2HCTA 4ZJPA 5KOHA 3U56A 2V5AA 4MJ7A 1BXRA 2Q46A 4QU0A 4ZJYA 2VYNA 1A2KC 2XA1A 1U0FA 3D6AA 4W5RA 1Y8ZA 2BDTA 3P9PA 1XT6A 4MKXA 1EHIA 1BD4A 4N6OA 1VL2A 4G1FA 1Z22A 2F48A 3DMHA 4L50A 1VYUA 3HBJA 3R2JA 1S2GA 1MF7A 1LTQA 2DLDA 2O48X 2VDUE 4RVUA 2GO7A 1A5AB 2A0YA 2E4XA 4L9WA 5EE0A 3SZUA 4YCMA 4DIBA 2XMPA 3BBPA 3O8QA 4P86A 5AH0A 3N2KA 4TMKA 4NCXA 2WJPA 3NTQA 5CHEA 3RV3A 4CV3A 5K4AA 3JQ9C 4D9KA 4XARA 4KV9A 1VHDA 2E5FA 4GI1A 1KDVA 2J5RA 3SJUA 1H1LB 1C3JA 2VK1A 3R7BA 1JQJC 4NJEB 4XQCA 1F6WA 4WLUA 4J49A 5FTNA 2HGSA 2GHIA 2XUPA 3D0OA 5HJ2A 4GD3Q 5IS2A 1ZD1A 1OGYA 2QX9A 3P71T 4WKBA 5DNVA 3AF3A 3VKVA 2Y1KA 3BWYA 3RLIA 3CR7A 4EHIA 2ZFUA 4JI7B 4IJ5A 1YDWA 4II2A 4X41A 1F8GA 3UJPA 5LMZA 4GMXA 1GRRA 2PYZA 3E23A 4I50A 1B8NA 1ECJA 1V8ZA 3QKTA 4NF2A 4EZEA 3A2MA 5JCJA 4CFSA 1ZVKA 4Q1BA 2HF8A 3EZLA 4OXKA 1OROA 2MJLA 2RCYA 4EG5A 5BWOA 1SXJB 1LJ8A 1QR2A 4IIXA 2WTAA 2OHFA 4NG4A 3GEBA 1DADA 1ESNA 3V2IA 1XTTA 3CH6A 2JGRA 2R8PA 2KBFA 3NAZA 4UZFA 3VOSA 1MAUA 3L6BA 5KSOA 1SBZA 3O21A 3T7EA 3FHCB 2QSZA 4RELA 1HTBA 4IDCA 2JI7A 2AFRA 1XTSA 3R9XA 4MAFA 2TECE 2RHWA 1RWKA 4GC5A 1U0EA 5CU7A 4CCYA 1N3LA 2ERCA 5KC8A 1O89A 4N0MA 4NCNA 2ZKIA 3SHWA 1VRCA 3TQHA 5CBPB 1E9FA 2RBKA 4E4YA 2PYIA 1EWVA 2OYSA 3ASVA 1ECLA 3INTA 1RLTA 1YS6A 1QUFA 4B45A 5KQPA 2YOHA 4URWR 2ORYA 1OWOA 3HVKA 3FZGA 1Y63A 3G17A 4G5HA 2V4ZA 4YCAA 2JCYA 1XB2A 3WBBA 5LQKA 3FM9A 4MVYA 4CMCA 3DDCA 5AM0A 4XD7D 3HKEA 3PENA 1JQEA 1X3SA 1IWPB 2ZRQA 4UHCA 1BQ3A 3NTUA 1FYDA 4KAJA 4MWOA 2OPHA 3KVNA 3ZK8A 5LDDC 4Y2JA 2IK8A 5J1TB 1GGMA 5G2OA 1OH5A 4ARZB 2E4UA 2PK3A 1QQTA 1XWWA 3W05A 3WHIA 4NCJA 1FYWA 2GZAA 1JHXA 2EFYA 2I0FA 2OT3B 2EW1A 3OZDA 3Q9LA 2P1RA 4GOKA 4GP6A 4FFOA 4JD5A 4MRNA 2P5UA 4K6CA 4H16A 5D2CA 4A26A 5ICMA 2PCJA 1YRAA 5FPQA 4ZXPA 2ZIAA 3HU1A 5C4GB 3C4JA 1CIJA 3OMLA 1UPXA 2C29D 3PD1A 4U2KA 4XW2A 1Z18A 3K4HA 1KEKA 5B55A 1GTRA 3PXXA 4RD2A 2XWPA 4GX1A 1JFFA 1MAWA 1RVV1 4G4IA 4IRMA 2FHSA 5FR1A 3LWNA 3IE1A 3B85A 1NG9A 3G79A 1FRVA 1TA4A 3VNAA 3VPBA 2IYVA 4KLRA 2Q7XA 2UZ1B 3ML1A 1RSZA 1QGYA 3QPVA 3TTVA 4EPXA 3PFIA 4BAZA 3JASA 4IJWA 1W2WB 4PZAA 3X1ZA 5BNWA 1OH7A 4IGIA 3BD6A 3T5CA 3SF0A 2J3KA 3B2QA 1LSOA 4KN5A 3LLVA 4X7PA 2P9HA 4MS3A 1R0SA 2EWMA 5IDVA 2AG5A 4K9QA 1O77A 2F1OA 2VT2A 3RYFB 3GUVA 3HI6A 1BHJA 1CY6A 1MC4A 1O96A 2HF2A 3EQ8A 3MTIA 4NY1A 3G2HA 1ZKDA 3SKVA 3E70C 4ESVA 4X91A 2H52A 3U3OA 2XVZA 5G0VA 3BVPA 4C3ZA 3CPJB 2Z9DA 3WGMA 3L2OB 1EFRD 4HGYA 1EP9A 2O7VA 2WQ6A 1EUCB 5EN4A 3KAQA 5K6RA 1RC0A 3WK6A 2G8NA 2QRLA 2OKCA 3A6HA 5IC4A 4X94A 3QELB 4UOEA 1UBRS 1X1TA 3LU1A 3AY0A 1U0JA 3BK1A 4F86A 2P6OA 4YQZA 4UBMA 4DNQA 2PU5A 1R4NA 1U5CA 1WBJB 2VNHA 4YJFA 3NIGB 3M5PA 3B52X 3UXMA 1QGDA 1UC5B 1FA9A 2FUG1 2BEWA 1C4KA 3RG8A 3PR3A 4PEVA 1LVGA 4A8TA 4EJ6A 3TRFA 3I42A 4PZPA 3ADPA 3A4TA 3K2IA 4KN6A 1TEVA 3C8ZA 4S1NA 5B3JC 1NE2A 1NC1A 4G9EA 5TS2A 3I04A 1DTSA 3K0FA 5CAEB 3GFRA 3F5MA 4YT2A 2EGUA 1AKNA 5KCMA 3SCZA 1E2PA 3PKJA 3AVQA 4RKQA 3VBCA 2X7HA 1EUDB 5FYDA 5G1OA 1E2BA 3WWPA 3W9SA 1NQWA 1A2OA 2EZUA 2Q21A 2XUQA 3QVTA 2QTGA 4QC2A 4ZT4A 1F38A 2D8AA 5ES3A 4G0MA 1MB9A 2JFQA 3RFTA 2JH8A 2OHHA 4EHKA 5I9LA 4TN5A 4CG3A 3IJPA 4RLHA 1AB6A 3UXYA 1VHJA 5TMDA 3GLGE 3UMJA 3QK7A 1JB9A 2QSJA 3HB5X 1ODJA 2WABA 1WCWA 3GT7A 3KO8A 4OEHA 2I4IA 1OKKA 3I1FA 2C97A 4BUCA 1PNQA 3O9VA 4X1YB 1EKXA 3BFXA 4DCUA 3CLHA 4L5CA 3VDNB 1DKUA 3PEEA 3QEMA 4DA6A 5HS4A 1DQPA 1XP8A 2VI5A 3HWRA 3R3HA 3EJWA 5E1MA 1CQXA 5ISMA 3LUKA 4H7FA 2XXAB 1YDFA 2QTWB 3F78A 3QU4A 5DZSA 1GCUA 4QXOA 4I8IA 3VH1A 4DXAA 3KR2A 4E3WA 1EZ1A 2WWHA 4OXIA 3TW8A 3CJRA 4WW0A 3IEKA 3NUQA 1L2TA 2E4VA 3CUEF 1DJPA 4WXHA 4QHTA 1GZ6A 4KMMA 2I6GA 3TLKA 2ERYA 3BIJA 4RE5A 3SLRA 3KTOA 3RS2A 3TB6A 3ZE8A 3JYLA 1I7PA 2BGNA 2O0MA 4EYEA 7YASA 3OLZA 3HYRA 4RO0A 1UIMA 1QHEA 4HUQA 3DLTA 3QX8A 5K09A 3W6UA 3GEIA 3E0XA 3E22B 3IUNA 1NX6A 1N9ZA 1OWNA 1Z4MA 3KZVA 3O3MB 4MR7A 4PM4A 3SEZA 1EUYA 2PUBA 4KAXA 5EPEA 4RZ2A 2VJNA 2QW1A 2B2NA 2FLWA 2Z5LA 1Y3FE 4ER5A 3ZWWA 3ZYZA 5YASA 1D2NA 1TQ2A 4GOMD 4BMDA 1G0OA 2BUCA 3O4IA 3FYUA 2XBUA 3OX2A 4DCCA 4QX6A 2D5LA 5E0KB 2V1UA 1EA7A 1SULA 4B3CA 2LXNA 4ARBA 2H7CA 3L7AA 1KOJA 5CA1A 3IQHX 2ARKA 2GPNA 2R8OA 2JW5A 2OBBA 4H9GA 2VF2A 3CCFA 1G5TA 1RD4A 2IGTA 3EEQA 3U80A 4MA4A 4QGAA 3G6WA 4QJ3A 3OJEA 1THGA 1UPTA 3RTEA 1PP4A 4DV0B 2B7LA 1Y8QA 4XYMA 3FUCA 5DRTA 5IHXA 4YUZA 4QRIA 1A72A 2GBCA 3VGJA 1TJ5A 1GSHA 3O6VA 4KL8S 3HCDA 5LZ5A 1RTTA 5CLQA 3HK2A 3NNDA 4Q7KA 3QEOA 3KQLA 1U9IA 1A2QA 2ODTX 4JGBA 1WZCA 4GI2A 3QUAA 4AZVA 1A71A 2C7VA 2EYUA 3D0QA 3RJMA 4E1AA 3GJ4A 2DAPA 2VTEA 4BMVA 3VU3A 5LYJF 2C03A 2HPAA 1E0DA 4ACAA 4FR0A 3TECE 3AJ9A 4Z4CA 2YJNA 5C5EA 1E8MA 4N3CA 4L3VA 1SUAA 3CRRA 4C04A 1FFBA 1M67A 1RC8A 5HKOA 1Q12A 4HQ0A 1ZDMA 4QYTA 1E7QA 2MSWA 4AN4A 4UTXA 2V65A 3EXG2 1PX2A 1PN3A 4JQZA 2SHKA 3LL7A 2DR2A 2ZJYA 5M04A 4D2IA 2IYRA 1YAJA 2G9ZA 3L18A 4J94A 3HADA 1KEPA 1JIKA 4TXLA 1YQTA 3UHOA 4YAEA 1BDMA 2HK7A 1Q57A 4FCWA 1ZOPA 4I6GA 4DPLA 1QVAA 2OOKA 2PL1A 3LT5A 4DR3B 2HM7A 2VK8A 2YDYA 5DT9A 3ROPA 4LK2A 4BMSA 4OG2A 4TQAA 1I33A 3FRHA 1I94B 1P2FA 3GLIE 1U3VA 2OCXA 5EAIA 2HDNB 1VFNA 3DBIA 4UDOA 2DPGA 4ZQHA 1GKUB 1SKYB 3K5WA 4I66A 4LTNA 1VM6A 1VYTA 1Z7GA 2C83A 2WBLC 3GQBA 3VZCA 3PHGA 1KH3A 4NK4A 5FBHA 3WLJA 5LIRA 4N76A 1LPOA 3RHFA 1D6NA 3AVVA 3GUZA 1V0JA 2FP4A 3ANYB 2AJBA 3RE1A 3AIMA 4LNAA 2OO3A 4F4CA 1ID8A 3L0PA 1A8IA 3M9LA 3W8DA 1O08A 1N2CE 1O6FA 1WXGA 2FOIA 3Q88A 5L7TA 3HFJA 4F45A 5DBHX 5K5EA 4FFBA 5EJIA 4A92A 3MBKA 2BHLA 4Z4HA 1AGXA 4PONA 3HWSA 2QGNA 3LPAA 2QZZA 2XUGA 4NEHB 2V7EA 5LZ7A 1OILA 2Y93A 1AZSC 3BQNB 3KC2A 3RASA 1JUDA 4DJDC 1G5FA 1VSQA 3B1XA 3CTPA 4LDRA 4ZZ2A 4R01A 4BNHA 1H1DA 3PQ6A 2J7KA 1NY5A 2WHYA 2IKSA 4S0XA 3D5QA 4QHYA 4TMTA 4XD7A 3UHPA 3SX4A 4B48A 2I7TA 4Z6KA 4LOIA 5LM3A 5CR9A 4NDNE 3PNVA 3KKNA 2HYDA 1ODIA 3LVQE 1PS8A 2GHQA 3S55A 1Z7YA 3L02A 4QZVA 5GIPE 4JR1A 1ECFA 3L0SA 4MR9B 2P4EA 3GLHA 4DA0A 4ZN6A 4P58A 4OFZA 4I6EA 1JEJA 2RGNC 2XYGA 4L8FA 2G77B 2B61A 3ZD8A 2CJYA 3T95A 1QH8B 1Z6XA 3WRYA 4B76A 4I1YA 3N2ZB 1ZUNB 3J80A 1GVNB 2C3YA 4AZ0B 1C0PA 3F1KA 3OZSA 4B4VA 3LNTA 2H7YA 1W6RA 2PSSA 5ESDA 3I5XA 4LFBB 3GPCA 1GPWB 3G5TA 4Q9AA 3EOAI 1MTZA 4JC8A 3PUXA 1EVEA 4KO3S 3I09A 4MWSA 1KYTA 4EVIA 3P0IA 2MMCA 4PCVA 4M0PA 2XGSA 4CKCA 5DNYB 2VRNA 1N2CB 5D87A 2VBCA 4ISCA 2EL7A 1J25A 4TTRA 1ESDA 4PV7A 4CDGA 5E4JA 1TTQB 4LXXA 3HXLA 1I3CA 3LHSA 3NTLA 3CB4A 4UAJA 4YRLA 4A4DA 1JNXX 1M2VA 4TWJA 4AAYA 1K7EB 3JQAA 3HCWA 2Y9MB 1BFKA 3FUTA 4FI3C 4JYPA 1NUQA 4QTUB 1A97A 1FLAA 2FUCA 2X3FA 4KIWA 5GGYA 1A27A 1GV0A 1LTHR 4FVTA 4AIIA 1SZDA 1X8JA 1SG6A 3I05A 1O6CA 3N2YA 2IEYA 5EE5B 2WF9A 3KPWA 1XZCA 3VKFA 4UQPA 3SSMA 2FCAA 4GX5A 3KKMA 5SZIA 3ZKWA 4FDTA 2QP4A 1XZPA 1T29A 4TGLA 4GBMA 1LGYA 1C9MA 2VF7A 4R2XA 1NHWA 3E7DA 3JAWB 4LYEA 4YP1A 1EFRA 2CJFA 1RE1A 4IV5A 1U0RA 2PX4A 4AU1A 4B8ZA 3LK6A 5F35A 2PKQO 2B34A 3I39X 3COWA 3ZJ5A 1KZHA 4QG7A 4C88A 1UK8A 1GCAA 4WK0B 5LP6C 4CL0A 3SXUB 2WFLA 1YI8A 2EDCA 4OV6B 1UDXA 2G70A 3WYGA 3ORRA 4PLZA 4JP5A 3B7PA 3G2LA 4QXMA 2NO7A 4QUBA 1WOMA 2O5CA 1JA1A 1RWBA 3WMRA 3GU3A 1VG9B 3DBVO 1BX3A 5TIIA 3WIBA 2B5OA 1JU9A 1M72A 4AQDA 3A1FA 1EGQA 2WG2A 1S2NA 1WABA 3DMTC 2CXTA 3IS3A 3LY8A 1G38A 3U3RA 3IT3A 3I0NA 4MDFA 2X7JA 3JV7A 1E69A 2WAXA 1F0YA 2Z3VA 3DDSA 3Q2IA 1C50A 1G7RA 3R5KA 2PX3A 3UUEA 1SBTA 3OSZA 4I9HA 1BH2A 1JJBA 1IBCA 4QOFA 7GPBA 1HZZA 1NQUA 4JGGA 3UJBA 1Z0DA 3VR0A 4AX8A 1CZHA 2I1WA 2ETVA 5EUBA 2FYTA 4DJTA 2R1VA 1RHRA 4BN4A 1UZNA 1QHHA 5BN3B 1EFCA 2XB6A 3FFWA 4DIOA 4F3TA 1RR6A 2VRWA 3FOBA 5I45A 4YACA 5AJVB 4DBLC 4FX5A 1TT7A 2AZXA 4KV7A 1F48A 1PTKA 5EKDA 2AQKA 5TMBA 5K6TA 1YDHA 2QL6A 1NAIA 3P5SA 4RJIA 1XLWA 4DA4A 3P94A 3ABRB 3U31A 2KWIA 4YV2A 2ZI7A 4DILA 3RANA 1GKKA 3NFRA 5JAPA 2O6LA 4XRRA 3NHJA 1CQWA 1I36A 3KAPA 4ERNA 4FDVA 4EF6A 2Y68A 2VP0A 4UNQA 5H82A 5BT9A 1G4HA 3JYOA 1WDKA 2GEBA 2RD2A 2V3CC 4HX5A 2EJUA 4LY6A 3JQFA 2G63A 1VA5A 4W6QA 4TT8A 1XZKA 4M99A 1GG2A 1HNXB 1JZQA 3HDJA 1OA1A 3GRYA 1E58A 3ACCA 2ZUDA 4FJ2A 4GG1A 3RSOA 1ZITA 1U81A 3QFSA 2ZWPA 1N6IA 4YUVA 3M70A 3MMPA 1K6EA 3RUEA 2ZRHA 2QTFA 3UF0A 2PZBA 2BDUA 1N9KA 4K9OA 4TS3A 2BBTA 5C31A 2Z5GA 3OZBA 5I7FA 2EKPA 1OLXA 1LC3A 3AR5A 2F64A 1BHO1 4HGOA 4NMHA 4C4AA 5KKCA 2LBPA 4YV0A 1DTWB 3LPCA 3PYXA 5EIOA 1XZHA 3I6IA 2A78A 1V16B 4F8JA 4GL2A 5IXYA 3OIFA 3G9UA 3WAKA 4X8MA 3SWWA 4IICA 2AMVA 1UBUS 1AS3A 2G82A 1HYBA 3ESYA 5LA6B 3K9FC 1PW5A 4ZI7B 2O8BA 4GVXA 3OCZA 5JSQA 3CU5A 1S4MA 3OU6A 1XXHE 4BGDA 3QKRA 4PS1A 1GVHA 4X84A 1SO8A 5DLPA 2OFFA 2GQ0A 2XKAA 1P0FA 2GEFA 3WB9A 2GFQA 4N0PA 1NA5A 4RX1A 5BV7A 2QN6A 1JKJA 1EESA 2BHTA 4OA8A 3R7LA 2QPAA 5DM60 2IOFK 4JR0A 4MGHA 1NBHA 4RKEA 1IZZA 5ALQA 1YCGA 2A0XA 3K5PA 3PC2A 2WF5A 3DE3X 4FZ5A 2V59A 2ODEA 1VZ2A 2XYPA 4M6WA 2B4AA 2ZB2A 1CE8A 1Z13A 2HB6A 2NXCA 1ST2A 2VJYA 5EXPA 3ANNA 3FNIA 4NATA 5JV5A 1PAUA 3L43A 3L8CA 4O2AA 5IRCD 4KNYA 1KETA 4NH4A 1AGYA 3DWGA 2OESA 2B92A 2BFPA 1I4LD 4JP8A 1Q22A 4X7MA 2I2DA 3B6JA 3DS8A 5CB6A 4QRDA 3TLAA 1RMTA 3C7KA 4LSWA 4XSVA 4ZGGA 3DVAB 5JW6A 4Y8VA 4RIHA 3ZS9A 1ZM7A 3GELA 3R0IA 4U2BA 4UC0A 4C0KA 2BM0A 1WCV1 4DR7B 1FTNA 1JIUA 3P2MA 4PNPA 4QLBA 2W6CX 2B8NA 1Q0UA 2GK4A 3TSZA 4DA7A 4XZ3A 1U2GC 1KTVA 2G6TA 2R2GA 4ZOAA 4G5OA 1ZA1A 4JYZA 1GRVA 2EF1A 1GPJA 4JU9A 4BAUA 1XNHA 2W6QA 2PXCA 4XCXA 4Y6OA 5DNEA 3ZV4A 5JS2A 2GN4A 4V1CI 3HL0A 2O2GA 3FHJA 3MWEA 3LBFA 3OQJA 2PH1A 1UEJA 4R1MA 2DWPA 3IPAA 1J8MF 2O8FA 1FFYA 2ZR0A 1CNFA 4N18A 1XCMA 4UM9D 3VR4H 1PZMA 3FMIA 3NBYC 4F7DA 5B6JA 3ZDBA 4EL0A 4KZPA 1ZG3A 2DOKA 4L6CA 4YO7A 3FTEA 3Q9NA 3AHFA 3EGOA 3RLFA 1NQAO 1POXA 5FPKA 4PRKA 2R8RA 3ELYA 3K0CA 4ZYVA 4X20B 4XWOA 4XRGA 2D5AA 3KJHA 4JBHA 3DHEA 3RS8A 3WQBA 1W0JA 5JJLA 1VHLA 4FQ5A 3VVMA 4WLFA 4Q4AA 5KNDH 2COKA 3O38A 2AKYA 2MSCB 3NGMA 2V3WA 3EMBA 3LC2O 4LYHA 5IX8A 3O4JA 8AT1A 3K2EA 4H6XA 4DEVA 1F8YA 3OSUA 3ZIDA 4PIMA 5CD9A 4WZBB 1FU4A 2FPIB 1I2DA 3CEMA 3PVSA 3UUGA 1EFHA 5CA0F 5HPYB 4IWXA 1SA0B 3E3OA 5IYZF 3SIXA 4NFLA 3TLMA 4F60A 5HX7A 2QI9F 2FWMX 5FWXA 3GVXA 1DMRA 1V9SA 2BKVA 1UMKA 4BYGA 1ZR2A 1Z2DA 3ZWQA 1KQPA 1Q77A 3LCVB 4M3NA 1PWHA 2PNJA 5DTEA 2O8EA 5K2MA 5CHYA 4NJMA 1SEVA 1X77A 4BNDB 2OZKA 3JVDA 4NECA 2MSEB 4YMWA 4V2UA 4G6ZA 4RH1A 2X9LA 4KX3A 3TM4A 2CD9A 1DLJA 2J07A 1HDRA 3B5JA 3BUSA 4L95C 2OCIA 2DFVA 4P3NA 2ZZMA 1D2AA 1HDZA 3SOZA 1U3CA 2X22A 5CVJA 1QRDA 2DLNA 2HQ1A 1N34B 4EGSA 2D1QA 1PUIA 3DMGA 1A50B 2XCIA 4PZDA 4YH1A 4DV4B 3EGEA 4B6RA 1TPYA 4QU9A 5FYQA 4FJ0A 2WHPB 2TMYA 3BWEA 4EYSA 4TTIA 1SQ5A 1T6YA 3LUJA 3CLTC 2JLCA 3VR1A 2W42A 3W8NA 1CERA 4QBKA 3UAOA 5REQA 4A82A 3K0HA 4PLGA 5DULA 3KSAC 4QWMA 2GETA 1DG9A 2J0UA 2JPDA 3IVMA 4OHFA 5IKOA 4C7OA 1QBGA 4RACA 3BGIA 2IHZA 1MTOA 4BKOA 3WMXA 3L6UA 2IHKA 4EG4A 1LNQA 2NZ2A 4JU8A 4MRPA 3CT4A 2OK7A 2O2YA 3AP2A 3K8OE 5KPDA 2AS0A 1N92A 2H85A 3AF4A 4CT0A 2Y1LA 4OHRA 3BILA 4XM0A 4XPIB 3O47A 1D6MA 4LDQA 3T3EA 1YF3A 2Q62A 3NT5A 4ZJZA 4WSOA 1GM5A 2NTJA 3VV2A 4DN6A 3EZYA 1JU3A 1NWHA 5ALTA 3SF8A 4HWKA 1YDMA 4BTLA 3KLPX 3ZGXA 1U2ZA 4BFSA 2D5BA 1A0OA 2X7XA 2HIGA 4UD2A 1W9HA 2MCFA 2PJDA 4C0SA 3KSBC 4HNRA 3QWHA 4JI0B 3RS9A 4EZIA 2YN4A 4P5EA 2PQ6A 4F3YA 4R8VA 5JQGB 2QN1A 3BDIA 1YQEA 1E6CA 2HLNA 4IEEA 5L4NA 1HKHA 1V7CA 1KI4A 5DHRA 4YFVA 1I30A 1YMQA 4OYYA 3DGFC 1OE0A 1EVIA 3CWQA 4RZHA 1YCFA 1FNBA 2NTYC 2NSYA 4TXJA 1M1YE 1CW2B 2BYTA 1FFEA 4I1UA 1T6NA 3ECAA 1J22A 4F3NA 1I3KA 3DFFA 2IQIA 5KYTA 4OMDA 1C9YA 4I1IA 3LRTA 2PFGA 2PWZA 1RHMA 2D5IA 4YB8A 5KX5B 1NBMD 3HXKA 4ICIA 4B43A 1R1DA 4GZ6A 1GNQA 2HSWA 4MYHA 3WGQA 1NF2A 1HQKA 1XEFA 2JIMA 2W2VA 2YRWA 4GSKA 1DKNA 5B1HA 1EQAA 4IQFA 3RC7A 3WY9A 3I58A 2IUSA 2ZBRA 2PUVA 1WCXA 4J07A 4TVKA 3VYRB 4YX9A 1Q83A 2X2PA 4LC0A 3AHEA 5ALSA 2J33A 1DUVG 5G0SA 3FHTA 3D1JA 4C07A 1IFXA 2IIVA 4C6HA 1QDUA 4DDVA 3K9NA 1PHRA 1LJUA 1NJSA 1NUHA 1USGA 2HADA 2JCGA 5LOVF 3LHIA 3EVFA 2FMXA 3HVRA 1B43A 1F2TA 3D3EA 2PKWA 3NHYA 2GGSA 3IP9A 5ALFA 4J16A 4NU0A 3IIMA 5JAMA 2QLMA 3MCAA 2VO1A 4CR6A 3F5QA 2EW2A 5FFNA 2VHVA 2HPHA 2HJHA 3KOMA 4ZOLA 1NJFA 1ZNWA 3T41A 1XQWA 2GLUA 4PYLA 3GJSA 5B3KA 2H63A 1X7WA 3HBLA 2JARA 2J0QA 1SRRA 1BYUA 1CQJA 1HEUA 1FFSA 2H51A 3OZUA 1ZY2A 3WGVA 2A0WA 4JSTA 1VA4A 1ZD8A 2ZIUB 1KDYA 2XZTA 2PU7A 1I7DA 2DERA 5DK4A 1GTZA 2JBAB 4J3NA 5LKAA 3M1LA 1P3Y1 4TMXA 4V0LA 3RJ5A 3IPXA 3NYQA 2RHCA 4LOHA 3BRSA 1W34A 2V74B 4XEUA 3LLMA 4XOIA 3LLSA 4GSYA 1ZOLA 4F84A 2X19A 5ABPA 4PZYA 4MQUA 2Q2NA 2IEIA 1F06A 2PSEA 2GDZA 2V9ZA 4X85A 5DEIA 3J7TA 1OXKB 3I9V6 3KCNA 2NUTA 2I7VA 5CURA 5F4ZA 1C2YA 2GAJA 4IGFA 1GUBA 2IXAA 4KYUA 1W36B 3UOWA 1DDGA 4AMVA 1U5AA 2JFPA 2ZJFA 5FWYB 4Z9YA 3VO2A 2QLFA 1J1ZA 4PHHA 2HRBA 4ZAGA 4BVFA 1H66A 4QOSA 2Q6LA 4TS4A 4Q9KA 1OJLA 4PYJA 2RHTA 1LA2A 2G04A 4KPFC 2GN0A 2ERXA 4OHWA 1IM2A 1T5TA 3HP1A 2LCQA 4ALIA 4BNVA 4F4IA 5H8WA 1G291 2P4UA 4WH0A 2CYCA 4KGVA 1E3JA 4A3SA 1EFTA 3K8YA 2FSGA 2VP3A 4K86A 3V7YA 4MPTA 4FGUA 3WYNA 4D9GA 4F1JA 3AYXB 2Z98A 3N75A 1FRNA 1ZXXA 2Y67A 4NMMA 4RESA 2YFQA 1JE0A 3C3AA 3ND5A 4PBSA 5DGHA 3W5AA 1YUMA 3Q1KA 3L6DA 1X7GA 4YRRA 5SY6A 3T7DA 1DT5A 4BMPB 1ZO8A 2UUPA 3PRHA 3WFIA 4AC9A 5HOEA 3I5YA 1B23P 1LBSA 4WIAA 3D7SA 1YZGA 3ZU3A 2ZUCA 4OXNA 4M1EA 1LDEA 1TCVA 5JNUA 2QA5A 3PHJA 1G9XA 1NBAA 2A1IA 2DFNA 3QBEA 4R5HA 4X3OA 5JXIA 1IOWA 1RQGA 3I1IA 2R1UA 3T7KA 3VVCA 4O5AA 1JR3D 1YIAA 4OFBA 4K0KB 3EWNA 1H8ED 1PHPA 4YRFA 1BEUB 5HGXA 1XZLA 3ID6C 3N8IA 1EUQA 3GOHA 1I10A 4QVGA 3T15A 7ABPA 3D4IA 1L5MA 5GVRA 2RC6A 4K6FA 2KS6A 1LUAA 3FG9A 3HS3A 4V0ME 2IXFA 2OLEA 4AG6A 4EHNA 5EUQB 2ZRPA 3HR7A 1SXPA 1KDTA 1RQNA 2XDAA 3C24A 3DBHB 5T64A 4J7CA 4HL6A 4MINA 4RETA 2WC1A 3IKJA 4GLOA 5ETJA 4BAGA 1I4WA 2EQBA 5HIIA 3D2LA 3QENA 3BL8A 3C1UA 2WWGA 3F6YA 3Q87B 1C4XA 1CZRA 1FX1A 4ZC8A 2YOFA 2B3TA 1DIAA 4OHPA 1G41A 2OR3A 3JR3A 2AX3A 4ZD6A 3T1QA 2WSBA 1AS2A 3CPHA 1Z6AA 1IIBA 2GM4A 1KRHA 4HPWA 5LMUB 3FYDA 2KLBA 1RIFA 4IX1A 3LUBA 1T2AA 3C87A 4BQSA 1Y7TA 1SFRA 2VRCA 3DNMA 5KKAA 3UT0A 1LF0A 4BWFB 4INJA 1GXSA 1W5FA 2ASEA 2GEJA 2VQSA 3Q7IA 1EDZA 2V6IA 3K20A 3KB2A 3TBHA 3UVEA 3UV3A 1QYWA 1ISFA 3KKQA 2EEPA 3QRWA 1BW9B 3U39A 2IU4A 4ER7A 1VDMA 1I4DD 3IJ5A 1QYIA 5AJXA 1PG2A 3FKSD 4HCJA 2OV1A 3JZMA 4UVIA 3DE0X 2BHNA 2ZDHA 4ZVMA 3W7BA 3ZI7A 4BNWA 1KMQA 2YV3A 2XD4A 1T4CA 3BMNB 5FD8A 1XEXA 4C7VA 2G08A 1B74A 1FNDA 4FD2A 3VJLA 5BNIA 3X1DA 2DWUA 4C89A 1RLIA 3PNOA 3OZXA 5DI9A 2HBRA 4G9BA 2JIPA 3MS2A 4LWPA 2FUKA 4OATA 5EIBD 3PFNA 2P2GA 3FYUC 1CY4A 3RVRA 1GGKA 2NU9B 2C7PA 4FQ7A 2V54A 4WZ6A 3BXPA 1Q1QA 1CX9B 1W1UA 1RXIA 4ABYA 3E82A 4OCZA 4W5WA 1NX9A 3EXEB 3W90A 4WJLA 1KIMA 1NSYA 2O57A 3NEAA 1NW4A 5EJGA 3TSWA 4EH1A 3DMDA 4CHTA 4JASB 1TM2A 1NVDA 4E5DA 4FHDA 5AJWA 2ADFA 1CB0A 2BJHA 2ZE6A 2XCRB 2RK6A 4MVJP 1UWVA 3RWOA 3C6MA 2BMJA 3TTUA 1N5IA 2CF5A 3Q98A 2GASA 1RYHA 2D0PB 3DFMA 3MT7A 2YJ5A 4J6EA 4P38A 3TDKA 3IXLA 4DTCA 4PSAA 3KQTA 1EHYA 4DUGD 3O8OB 3F67A 1EA5A 2Z57A 2I91A 4MCAA 1YHZA 3F74A 4R69A 1L7MA 1FCJA 2LDBA 4O4IF 1E1RA 3RU9A 1U9IC 5KYWB 2K2QB 1TJ4A 1IQUA 1C7RA 1E5LA 1P9RA 7ADHA 4EA8A 2YRFA 1BH6A 3LBIA 3ZH2A 3V4ZA 4Q3OA 4BTVA 1E8NA 2XY4A 2PEYA 2ZT7A 3WIEA 5F3DA 1NM5A 2XE7A 1YZUA 3DUFB 1C5KA 3NEYA 5TE9A 2C4UA 2R6GA 2YV5A 3ECSA 1A98A 3CVUA 1FZTA 4CKWB 1UXHA 1ZCFA 3HPQA 4YAUA 3H7IA 2P69A 2ZT8A 5B2EA 3RC2A 4BKPA 3HGTA 1I6MA 2XAUA 5BRAA 2HU8A 2DBVO 2Q41A 4N54A 3UPUA 3J81A 2JCXA 4B87A 2PO7A 1XAIA 3TZLA 5D00A 5BYKA 5JECA 1FQJA 1C9JA 2Q5JA 2BFEB 2QUZA 4NX2A 4F8EA 4JIMA 1W7AA 4GPZA 4ZREA 4BWVA 3ZBUA 2YWJA 4N3NA 4ZALA 5EP1A 3SG0A 4TYMA 4D8VA 4F5ZA 1WSAA 1E2IA 3GOQA 5L4LA 3K70D 5I9TA 3IUPA 5DN6D 4PPGA 2CB0A 2XNDD 2ZQZA 2QAIA 4NH0A 1SKUA 3JRWA 1NFFA 2HA3A 4X0EA 2M98A 3IDAA 4HNGA 5AI6A 5SICE 4XH9B 2NVUB 4DYDA 3LUGA 1KEUA 1XDDA 3IAXA 1XX6A 1UPUA 4QPZA 4ZRNA 5B58C 1FTYA 1X8KA 3S1AB 4NKRA 5COAA 4PC7A 4TKMA 2H57A 4GQAA 1EX9A 2ZB7A 1RLUA 2P40A 4FFNA 3O1IC 1QR6A 1I5EA 3IELA 3K2QA 3GH1A 3D7LA 1EBFA 2JIZD 3F9CA 2WWFA 1THMA 2L82A 3R7AA 5JFGA 2QTRA 1FXWA 4M9QA 1S2OA 4G0QA 4HQFA 5BW5A 1VL8A 3PEVA 1W8DA 5GONA 5EGSA 3VYWA 3UGJA 3NKVA 3FN4A 2Y1XA 3PRYA 1PNVA 3U44B 3NHFA 2Q3JA 3LGXA 4X65B 4F3CA 5IEBA 2P67A 2PIDA 2HEIA 2WUGA 3CKLA 1H22A 3EF1A 5CG2A 4U5XA 5E9WA 1SKMA 1IEQA 2QRHA 3I52A 3CH7A 1Y8AA 2NO5A 2RI1A 3DOEA 5JATA 3GYBA 2ZSKA 3HEAA 4ZHQA 5JD3A 2ZUFA 3IBCA 4YN3A 3O8NA 2POCA 1EE9A 3NDJA 2A94A 3TG8A 1U7ZA 2AC2A 1J33A 2NZWA 2XT9A 5C1OA 1XJCA 2C4WA 4WN3A 4D43A 4MUXA 4WA7A 3FMVA 3OWHA 5DV9A 3STXA 4BEBA 2G09A 4TQUS 3DTTA 3WKDA 5J2UA 1AKYA 4LBZA 1M2NA 2QMYA 1OWLA 1Q0SA 2AYXA 2R2AA 5LXTF 2DPLA 3WRYC 4EO9A 1KY3A 1XD2A 5B7GA 4LRUA 4FMPA 3C41J 3A9UA 3LWZA 4CV2A 4MW6A 3OJXA 3E1SA 4U00A 3IUJA 5EP3A 3U7JA 3GBSA 3D2BA 3N86A 3R40A 4FMDF 4YDSA 2C59A 4P84A 4AYWA 2RE8A 4CV1A 2VPPA 3OQHA 4W5NA 1IHOA 4S24A 5ITZA 1RJ9B 1ZLYA 2PLFA 2VJMA 4DMLA 4LRXA 3U19A 1NFQA 1YNOA 2MSDB 3M5WA 1W4RA 2QJWA 1MIHA 4HI0E 1XZNA 3R75A 3I6QA 1F20A 2IZ1A 2WJWA 1O0BA 2ADOA 1UT8A 2CJWA 3QI2A 4IG4A 2EDAA 1XQ1A 5ALUA 1ONPA 1OU4A 3JY6A 2DHQA 2H7VA 3G5MA 3RRXA 3BE6A 4C78A 1KFCB 4MMYB 3RT9A 4MLDA 5AMXA 2FPGB 1P6UA 1DAOA 4BE9A 3LC0A 3MWDB 1M34A 2ILTA 2IYAA 3T1OA 4OHYA 2ZP1A 4OB7A 5EHGA 3TSOA 1IHPA 3MVEA 5F5LA 3FVWA 2IZZA 3JQRA 5FA8A 3BA1A 4JDUA 4JQOA 5BOSA 1BE8A 3NBXX 5C53B 3ZDQA 3LTEA 4O2RA 2FCRA 2CKDA 2WHXA 2OHXA 3A2NA 1ZD3A 1UL1X 4MUAA 4DIDA 1Q74A 2Y05A 1M83A 2PGXA 4JQSA 2ZM5A 2DFKB 1RXEA 1D2GA 2WPDD 1HT1E 2JIOA 2NO0A 3SGLA 3SSOA 2WD7B 1SBNE 3RKRA 1COWD 3MS7A 1V3UA 4DC1A 3GGDA 1FQWA 1J2RA 4CL8A 4QLAA 4EB6A 4P0PB