2VVTA

Glutamate racemase (muri) from e. faecalis in complex with a 9-benzyl purine inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
274
structure length
269
Chain Sequence
VPRGSHMSNQEAIGLIDSGVGGLTVLKEALKQLPNERLIYLGDTARCPYGPRPAEQVVQFTWEMADFLLKKRIKMLVIACNTATAVALEEIKAALPIPVVGVILPGARAAVKVTKNNKIGVIGTLGTIKSASYEIAIKSKAPAIEVTSLACPKFVPIVESNQYRSSVAKKIVAETLQALQLKGLDTLILGCTHYPLLRPVIQNVMGSHVTLIDSGAETVGEVSMLLDYFDIAHTPPHEFYTTGSAKMFEEIASSWLGIENLKAQQIHLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE RACEMASE
publication title Exploring 9-Benzyl Purines as Inhibitors of Glutamate Racemase (Muri) in Gram-Positive Bacteria.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Isomerase
total genus 99
structure length 269
sequence length 274
chains with identical sequence B
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vvtA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vvtA01
2JFPA 3UHFA 2JFWA 4B1FA 1IU9A 2VVTA 2JFOA 3OJCA 2OHOA 3S81A 3ISVA 1ZUWA 1B74A 2JFVA 2ZSKA 5HQTA 5HJ7A 2JFXA 5HRAA 1B73A 1JFLA 2DX7A 5ELMA 2DGDA 2DWUA 5HRCA 3UHPA 3UHOA 2OHGA 2JFQA 2JFYA 3OUTA 5IJWA 5EVCA 2W4IA 5ELLA 3S7ZA 2JFUA 3ISTA 2OHVA 2EQ5A 3HFRA 2JFNA 2GZMA 2JFZA
chains in the Genus database with same CATH superfamily
1LTHR 4YDSA 2AZMA 4BQEA 2PMBA 4FINA 3STUA 1RXUA 3VZCA 2V7XA 3C24A 4PAMA 2Q50A 4IJ5A 4MUYA 4BNUA 3WA6A 4CLHA 1NRWA 4FYYA 4D6XA 4YMTA 3VHRA 2Z2IA 1I7QB 3V1NA 5LZ2A 2O50A 5DNVA 5LLSA 1W36B 2ZXUA 5AIBA 1SAYA 6LDHA 4R5MA 1VHQA 1AS3A 5AUQA 3KUUA 1JAIA 4FYHA 2WJ6A 3EOBI 1P19A 3REFA 1T15A 1AG9A 3MS7A 3OZIA 4XWAA 4YAOA 3TW6A 1XF9A 2A78A 3BFPA 1T1EA 3EYAA 4TV8F 2CUNA 4KPEC 3CVOA 3STTA 3ZEAA 2VZLA 2C29D 1CQXA 4BCCA 2AJBA 2C9OA 1HYBA 1F0KA 1RQNA 4O08A 3DXZA 1NJSA 4B3HA 2QKYA 2XYGA 3OC0A 4XDGA 4IRMA 5HFNA 3ZWAA 1NJ2A 1U28C 5DOVA 3WLMA 2YTZA 4YMGA 1GVNB 4GU5A 1IPEA 1WKBA 3K6RA 4XIYA 3MWEA 4XLZA 1KSJA 4O4IF 2YV1A 5F2OA 1BEUB 3AVTA 5JNLA 4UTOA 1JEDA 2OBBA 5JCJA 3RRBA 3NTRA 1DHRA 4TYWA 2V74B 1BOFA 2COUA 4WK6A 1ZQ9A 3T52A 3PIIA 1NXOA 5F21A 4PHTA 4H0NA 4I9HA 4YT5A 3ZWDA 3F4BA 3OZDA 4G5QA 1OKKD 1GG8A 5DRTA 3GDWA 1FP2A 1YR7A 2GESA 3GRFA 1QIMA 4BIIA 3NC4A 1JG6A 1PNTA 1QDUA 4IPTA 3CSDA 3MJDA 3ZHTA 1PDVA 2VWPA 4DLBA 2WTBA 5JY6A 2W2LA 1YHZA 4Q3KA 4KJZA 1NVDA 3FVTA 3T1OA 3MAJA 4CL8A 3LQ1A 2BW0A 3FTPA 4L4UA 1AY0A 4M38A 5GPBA 5HCNA 1E1CA 3HRIA 4Y0AA 1NUTA 2OLKA 3K0CA 4U4AA 4JBNA 5LZ5A 2VUIB 3L4SO 3ZCPA 4LZWA 5HOEA 2E3JA 4DIBA 5J4YA 3DL2A 3UJ7A 4EABA 3GP8A 3DO6A 2WNSA 3D3QA 3GDGA 3VU1A 3O90A 1O95A 2DHQA 5DGDA 2XCTB 3JQ9A 4C7BA 1E1LA 1YR2A 2ON6A 4ACBA 4UUPA 2ILVA 1Q2UA 4ZK6A 1VGRA 5LP1A 3IAAA 3HH8A 1UMKA 3D8SA 2G40A 3KOMA 4UJ3A 1YA6A 3QIAA 3TTTA 5IYZA 4NJEB 4UFPA 1P91A 2ZRAA 3SU8A 4ZI2A 3CX6A 4ITVA 1TVKA 2QI9F 4K9LA 3BXXA 4WI1A 4X71A 5B57C 2HLNA 3STVA 3F2VA 1M2OB 3LX4A 4TLAA 4KYUA 3MSXA 4TN1A 1G4HA 4AJ1A 2GBGA 4YJDA 4QG3A 1K1EA 4NYMQ 3NWBA 1JXOA 3PHJA 1YJXA 3OT1B 3C4QA 2X1HA 3AESB 1ZM9A 4OMCA 2BM0A 4RHEA 3A3KA 1SVWA 4LUCA 2Q2OA 1QJCA 4J94A 3EEOA 4RVCA 5EP1A 1BQEA 2PAFA 4DM3A 1SEPA 3UHAA 1TK2A 1G9SA 1NVGA 1GEEA 1K66A 1YDHA 3Q72A 3ZE7A 1K8QA 1X7WA 3HB4X 5I5GA 4E15A 2I1WA 4RH1A 1TYAE 3HEMA 5FNVB 1RWMA 4MYCA 1GRRA 1SIBE 2A4MA 1X74A 4NE2A 2VDKB 2PK3A 1ODJA 2DECA 1DCMA 3V7FA 4ER6A 3WADA 1IVSA 2YV3A 1GAEO 4YNBA 3E15A 3PEUA 1VSVA 5B1SA 5ILOA 2NAPA 3U1TA 4Z6KA 2MSNA 3GW8A 1SC6A 5DNUA 2E4WA 3NGLA 5CLGA 4A23A 1MV8A 4Z7JA 3SIRA 3HKEB 2Z2XA 1SHLA 2V5AA 1PDWA 4HGZA 2VAVA 2NN3C 2ZAMA 1N6KA 3I0NA 2QUZA 4EJ0A 3GLFA 3JW8A 2C03A 4AZTA 4UBMA 3UY4A 3KRTA 2E2WA 1Z6XA 2EIXA 4HHEA 4LJYA 2WAOA 4BNXA 1COZA 3FCEA 3N6XA 1A9YA 4Y2UA 4XVUA 2MINA 2VYND 1SULA 4W9NC 2FKAA 2XAUA 2P67A 4AL4A 1FSZA 1ODLA 5JJKA 3DWIA 3E58A 2R8ZA 1P61B 3T1YB 1RYHA 5CK4A 2O8CA 2P4EA 1LJ8A 4N7JA 4LE0A 5FO0A 1VBKA 1AURA 1CNFA 1FX0B 5CBPA 2E0IA 4G36A 4Z0HO 4EJ2A 5EZYB 2EARA 1EINA 3HCBA 4D8YA 3CA8A 4ALMA 4B74A 1MT3A 1UAYA 5SYAA 4QDXA 2WNIA 3Q7EA 3T0GA 1QHEA 3ZV3A 3QLTA 1K6IA 3FBGA 1U3CA 3OIGA 3E3OA 2CKMA 2J87A 1MAVA 4UHHA 4NCXA 4KJXA 3ZDAA 5H5JA 4V1CA 4O2BB 3RADC 2BGIA 4GC5A 1LPNA 3ANXA 3F8WA 3VV3A 2R87A 1OVGA 2AZTA 4A2CA 1AF4A 4D82A 4RA9A 2GJKA 4AZ3A 3HL0A 5IT5A 3ZWXA 3K8ZA 4D42A 2R97A 2I65A 4OFZA 4PC2A 2GRJA 1A2OA 3T9FA 4NCKA 3QOWA 3MOGA 1VL2A 3UOAB 4JWTA 4TZTA 1DDGA 4CG1A 3BD6A 4BRWA 2FF5A 1U9IC 2GGSA 5KJCA 1XRLA 3I9JA 2PUCA 2CYAA 4ZN6A 5JQGF 4M86A 3LHKA 1UK6A 4DSAA 5E0OA 1W7AA 1SXJD 3QFSA 4TKVB 4CV3A 4OJQA 2ZUEA 3MINB 1P2DA 1V37A 1R64A 1AHPA 3GOQA 3HZOA 1K3TA 1CHDA 1E94E 4X1KB 4JV5B 2LNDA 2H4WA 2TMKA 1FSFA 1ADJA 3KQWA 4Q18A 3EXEB 5H83A 5EIXA 3L0SA 2OD9A 3H75A 4OBWA 1XN1A 3D6NB 4A1OA 4TMZA 3QXXA 3WISA 4BMVA 3AR7A 5LB2A 4U7PB 1OWLA 4TLBA 4QREA 5FWXA 2R1VA 3TIVA 3U3ZA 3EAFA 1RZRD 1DG3A 3PQ5A 1SXGA 3UCEA 1OFUA 3AINA 1W2WB 3DF7A 3DT9A 4WE3A 4DDHA 2NACA 1MA0A 1EP9A 4ZDKA 1VG0B 1QK5A 2VDOB 3BL6A 3QU2A 5TEWA 3ZK8A 5INTA 1LD3A 1ORWA 4O4HF 4WTOA 1NNLA 1ADYA 3WL7A 2WFLA 1PJ4A 2FDXA 3IKLA 3RYFB 1GRQA 5LQRA 4KI0A 1EFPA 3MF4A 4AG6A 2R0QC 2FPPA 4NBUA 2GN6A 3PRHA 1ZX1A 3GN1A 3W5SA 3RVMA 3BDAA 1N0IA 4RK0A 4ALLA 3OQJA 5L4SA 1FS4A 2QTCA 3R6DA 4PO3X 2HUNA 4R4JA 4ZVVA 1AXEA 4MLPA 5TDHA 1XKTA 3FHCB 3GLHE 4HXYA 4UAJA 5IF9A 2C42A 2QW1A 2PUVA 5CNMA 3PCXA 4HY3A 4JLOA 2QG9A 2F4NA 1U0EA 3OPYI 4QJ4A 3T06B 3EJ6A 1Z62A 2GZHA 1ECLA 3M82A 2CLMB 3ANTA 3AF3A 1PHPA 3RYIB 1B15A 3LGSA 5JTUA 3C41J 1Q1QA 1IEVA 4BV2A 5BYAA 1OV6A 3ZZTA 1SU8A 3IJRA 5CAEA 2R8YA 4TRMA 1B2LA 2Z2ZA 2LCIA 1KMQA 3SN6A 2G5CA 4NBLA 2RBEA 3H9BA 3IMEA 4PHHA 5ICEA 3GGSA 5JYDA 2HNAA 2YN2A 1JXMA 2WWTA 3WLQA 4DCGA 4EJMA 1MOQA 4KR7A 1BYUA 2FX5A 2P35A 3GBSA 1ECJA 4JLJA 2V7UA 1KQPA 4PO1A 1WCYA 4AJNA 4OJKA 4U7HA 1Q50A 3GV0A 4PQFA 1DAGA 1GL3A 1OX5A 3I6YA 3EN0A 2ZJ0A 2VDVE 5E2IA 3RIEA 5IKMA 3HP4A 2Z5GA 4YAFA 5EIEA 2C2BA 4JC0A 3L5OA 3PRYA 3ENZA 4D4GA 1M33A 2QJRA 3L6UA 3Q7PA 2R7LA 4R84A 5IK2D 1BFUA 1QIHA 2A7QA 3FW1A 3ND8A 3OKFA 4HDRB 4W5TA 2OLJA 3NBFA 5BSGA 2VQFB 3ZY4A 3CWCA 1P0IA 1YFKA 3K1ZA 1FTQA 4MGEA 2OHFA 2EW8A 3RYTC 1SOUA 1HZZC 4D44A 3A9VA 3HO1A 2AF4C 2LIVA 2JLCA 4XDZA 2HF7A 3BWCA 1BH6A 4G81A 4ZAWA 3HNOA 3BE4A 3QPUA 1FA9A 3W9BA 1I5RA 2K87A 1B6TA 1JEYB 1CDEA 2D0IA 2OZKA 1A88A 2Q4EA 2POCA 2M1XA 1D5WA 3GN2A 4US1R 4YJGB 3UTDA 1T5OA 1U0NA 4M1EA 4ZOBA 4I14A 1PGNA 3ZXIA 3HCPA 2J4FA 3AIIA 4D6PA 3NNSA 3MA0A 4ISCA 2JLRA 5JS8A 3QYAA 3RVRA 4XM0A 3W06A 2E18A 3FYTA 3NUZA 2QVBA 1WXIA 4KGZA 2CLKB 1WXDA 4Y7CA 5TRTA 1XEWX 4O25A 4U2FA 1KJYA 2BM1A 3R3JA 3SBDA 4E2WA 1ECPA 1O94C 4JEMA 1XZPA 1ESCA 2RHMA 3H1GA 3ID6C 5A0VA 3NO4A 2JD2A 4IV0A 1HM5A 2ZJ6A 5B2ZA 2G9QA 2GN1A 1IY8A 4HPXB 1O5TA 4QGBA 3QKSB 4A92A 2WE8A 4LJ9A 4PR3A 4PX2A 4WPGA 4BJ6A 4BE9A 3BK1A 2Q2WA 4M37A 4EARA 2XVZA 1BA2A 1S1MA 4TL9A 2DTDA 2VJKA 3CBGA 3DUFA 5ALZA 3P0IA 3X1ZA 1F8YA 2XTAA 4Z3DA 2IV2X 1KNXA 4R2XA 3C70A 3ETLA 1E4EB 5HZKA 2BEVB 4FDAA 3FPBA 3I39X 3CNNA 4L2IB 3BWBA 4MV4A 2FPUA 1TFUA 3IV6A 2ZRKA 3LDHA 1GGNA 3K0BA 4P4NA 3NC1C 2BTQB 1NOIA 3QVKA 5JATA 4GMDA 3PQ3A 2H00A 1G19A 2EYQA 3MJSA 1QV6A 1XMJA 2NAFA 2P91A 2ZLBA 1EE2A 4KAAA 3OO0A 4Q1EA 5HOQA 1HNZB 1KJNA 3KPVA 1XTKA 3B82A 3QX8A 3F6CA 5E1MA 3WFIA 1U7UA 1KAQA 2Z3ZA 4OHWA 3WLIA 1DIBA 1TF5A 4BLPA 2G5PA 2P3SA 1MEOA 3NG1A 1U3TA 1YIAA 2H1FA 2IKQA 4JHLA 1M6HA 4NEGA 4CCYB 2UVPB 4H1HA 3R5SA 1LDYA 1E5LA 3W6OA 2W71A 3DHEA 3Q88A 3TLBA 2ZUWA 2B61A 2FAXA 4YJ3F 2HADA 1JQKA 3UYKA 5AWFC 4QATA 4EI8A 4QPNA 5A06A 5BW4A 1L7XA 3CTMA 2UZAA 3IKMB 1JAYA 3ZBPA 4DAEA 621PA 2O9JA 3K1AB 4LQLA 4PRZA 3ROPA 1RPZA 3MWLA 2JAWA 3E6AA 2XSZD 4WDRA 3RNLA 2DTEA 3TQFA 2FNAA 3U4HA 2J09A 1XNJA 2Z0MA 3PLAE 1NNSA 2W2PA 4RJKA 3UUWA 1TEZA 1AMNA 2JVIA 2OM2A 2FPIA 3M5PA 3EGDB 3PWZA 4GX0A 3SF8A 2DH6A 5I9NA 4QLBA 4RE6A 4GQIA 4H3VA 4HADA 1Y7PA 2I6TA 2PWPA 4FCTA 4JS0A 3P9XA 3FZNA 1MEEA 3K8OE 4RXUA 5C5DA 5T4HA 2H5EA 2RCNA 3E2IA 1USIA 3IHWA 3T6KA 5C52B 4II2A 2JHFA 3GGDA 3TSCA 5L6LB 1M9NA 4MJ7A 2WPDD 4G1EB 5CM9C 3JV7A 3BMNA 4Q0MA 3BJEA 1L0BA 3ENVA 3IDFA 3OCCA 4LY6A 2YXNA 2XUHA 2NYUA 2P9BA 4MZXA 1XFAA 5EIBD 1L5ZA 4XVRA 3RHTA 4TWJA 5H68A 3DAOA 3OCZA 4BAGA 2HHLA 4AG5A 2IIBA 3QENA 4NYIQ 1Q3KA 4BNWA 5JARA 2YXDA 3GR6A 5EUMA 2GNAA 4O6VA 2EG9A 2UDPA 1F3OA 1B3BA 2AWNA 4N9QA 3OZSA 2Q9UA 4QWWA 3GY0A 1D07A 2DSTA 1H8HD 3W1WA 4IIYA 4XX1A 5DYTA 5LYJF 4GYKA 1U5BB 4HG2A 3RRNA 1Y89A 2B4KA 2GNPA 4IMPA 5LC1A 1XQ1A 2D2XA 4BQOA 2HT1A 3QELB 3C0KA 2PL1A 1N1MA 1E8DA 2H48A 1VJ0A 3C1TA 3VR6D 2VKQA 4FE4A 2PJRA 1STOA 2CLHB 3BKWA 3AEYA 3MMNA 3IAUA 3ZHCA 5JJBA 1WLYA 4I46A 2CJPA 2X5JO 1RKXA 3CC8A 4BRUA 4ATNA 3UAWA 2NT4A 3LC7O 1P4GA 2X8WA 1XZEA 1YONA 4HEHA 3PITA 4D4JA 3AL0C 2XKBA 1ZIYA 1GA6A 3BE5A 1DG1G 5D01A 2D3TA 4IDGA 1NN3A 3OP1A 2AR0A 4HAZA 3WK8A 5C80A 1I2DA 1YK1A 3OX2A 3QMPA 3QE2A 1RWQA 3H17A 1VLLA 5IC6A 5JWRA 1C0LA 3V1MA 3KEMA 4CF3A 3GMDA 2C04A 3S2ZA 3HGMA 3A4TA 1W30A 3WLLA 1YJ8A 2DCMA 1QS0A 2HF9A 5CHEA 1JJAA 5G53C 5IDQA 3HVRA 2GAJA 3N0TA 1JI0A 2O07A 2VPTA 5CGZA 3VAYA 3B2EA 4FFWA 2JKYA 4CDMA 2JFUA 4BB6A 4PQGA 5C34B 2C2WA 2PR2A 3SDZA 3EC1A 4OU5A 3PLNA 2GBLA 3W5VA 5I5EA 3JXEA 3QPWA 3ONFA 4X54A 1ZS9A 2EZ4A 3U9SA 2GLTA 4YJ2F 3QVXA 5TT0A 3WKCA 1IIBA 1M2VB 2R96A 1KAGA 1RPTA 1RLOA 1P74A 3KYCA 4GI5A 5CW2A 3ZDZB 5AHXA 3TLGB 3VNVA 1Z22A 2DPGA 3G68A 3DV0B 4HRYA 1AGXA 4XWKA 3M6UA 4HOYA 1R1DA 1QAOA 2ZRMA 5C46F 3GP5A 1GL6A 2RD2A 1UOQA 1NF3A 1SURA 4BDTA 5TMPA 3SD7A 3LDAA 1Z6PA 3KTAB 1RM3A 4L4SA 4YREA 1HLDA 3NHWA 5LMZA 4E51A 1K2VN 1US8B 5ADUS 5DN6D 3EA4A 4U7GA 4KPFC 3QEKA 1K3UB 3ZE2B 4C6SA 1IATA 1CUDA 1CUUA 1AMOA 2FUEA 3RFXA 5A4DA 1AQJA 1Y48E 1C4XA 3EDCA 1LS6A 4WGGA 4Y1GA 1K7SN 1W93A 1QU3A 2J59A 2KBEA 2Q5QA 1WXQA 3RSQA 1UK9A 1MP0A 1D5CA 2YV2A 1QH1A 3DMNA 4YCCA 1LTKA 3MUFA 5DB4A 5LNK1 2E21A 1NQXA 4XIGS 5MGBA 1YNSA 1HFWA 4XR4A 1RCUA 4WZBA 4XLLA 5TT1A 4Y0NA 4REQB 1MA3A 2E5LB 2PM8A 4LRQA 4TV9F 3AEZA 5I48A 2PFSA 2G6TA 2DKFA 3D2CA 3E9YA 1U4SA 3PDHA 2BBWA 5DW0A 3NV9A 2XVXA 2OQRA 4P86A 4MV0A 3V4PB 3GJ5A 2NZVG 4G5RA 4B9AA 1T2VA 4JIMA 1WBBA 3B3QA 1O96A 3KLBA 3M6IA 3RH0A 2ETVA 3GUZA 1I7NA 4FEEA 1KI6B 4OFBA 3MOIA 2W7TA 3H13A 5DTMA 4CI9A 4J1TA 5D1NA 3SYTA 4AN0A 1P1HA 2WM9B 4ROSA 3DGFC 3NTQA 1BQ4A 4Q4HB 3BL5A 4FFLA 1Y7IA 1IWOA 3V32A 1DFIA 8LDHA 1PT8A 3JSXA 3JQ7B 2CLIB 3LPCA 3MTAA 4H7KA 4YS6A 2B82A 2CMFA 3IVCA 4Z51A 5EN4A 1W47A 1XUOA 4Y1RA 2OV6A 2PEZA 3KT8A 2DP4E 5FPSA 4C4ZA 2W6MA 1U2ZA 5L40A 2H2DA 3AR5A 3K4QA 4G9GA 3OZAA 4P98A 3RIMA 3H86A 2JLWA 3QEAZ 3TEJA 4UQPA 4MRPA 2RIRA 4ND8A 3L05A 4BFZA 2VDLB 3SC3A 1KRXA 4P81A 3V00A 1SCDA 1H5UA 1PQYA 1C9KA 4K6HA 3CRQA 2XHZA 2WUFA 4LGVA 4QG7A 3I53A 3L77A 4ZXPA 1UL1X 4L8FA 1IY0A 4BN5A 4EFMA 4ZYLA 4KQ2A 4G4SO 5G41A 1FMTA 3D7RA 4IEIA 1WCV1 2Z56A 1GSAA 4R8KA 2VJMA 3F6BX 3QYPA 4PTLA 1HR0B 2AKYA 4F5WA 2C4TA 2ZBPA 3GRKA 1T4BA 4L6IA 1AM4D 4C0WA 1U80A 2JAUA 7GPBA 1NSTA 3BXHA 3LECA 2E55A 4PZEA 4LHSA 4EJ6A 2XODA 5KYTA 3BZBA 4WOCA 3DMGA 3IP9A 1U1GA 3QVWA 4JU8A 2JIZA 3R5KA 4BAUA 1JPVA 3LXMA 2WQ6A 4ACAA 1NI4B 3AMVA 2Z1MA 1YIOA 4MDFA 1R0WA 1E9RA 1ZN8A 2R6DA 2GEDA 3SR4A 3ZPXA 1Z0JA 2ID7A 1TECE 3PQ6A 4ZTZB 5ALMA 2PXAA 5J43A 3PE4A 4N4AA 1VBNA 3QSYA 5CMLA 3AETB 5K3FB 3HWWA 1ABFA 5AI8A 3PDIA 3WK6A 2GJ9A 2XMPA 2A1TR 4L76A 1NMQA 2PKXA 5HKAA 3KAPA 1W5EA 3KDAA 4G4GA 5K0ZA 5DT2A 2NWQA 4L5YA 4H3KB 3MNFA 2ZB4A 3KSMA 4HDKA 3WHIA 2J3JA 2J48A 3TI7A 8MHTA 3M3DA 3O3CA 3D3KA 2B7CA 1FB5A 2PV0A 3ROFA 1MH1A 3D4LA 2IZ6A 3CT4A 4M46A 3S27A 1NVWQ 3SXUA 1C7FA 2A35A 4O4JA 2C5HA 3BD7A 1N9GB 4O3FA 4UTNA 1OLUA 4BGEA 1H3NA 4J0EA 4XQGA 2ZB3A 3WZMA 1PZMA 4Q7KA 1L4KA 2I7XA 3PUXA 4V03A 3S8MA 4BQQA 1I3NA 3AVPA 4YRIA 2R47A 4NCJA 3ZWCA 4IV8A 2X0NA 4FQ7A 4L78A 3G89A 5CEEA 1DAEA 1JRLA 2ZT7A 1NVUQ 3KQYA 3UB2A 1YQDA 4PLCA 1JL3A 1FU4A 2H7CA 2AOUB 1FK8A 5AVRA 3NEAA 4FEYA 4MS4B 4D3XA 5JI2E 4F3TA 1RKBA 7MHTA 3PIRA 3UFBA 3RTGA 2WSBA 4BQFA 1R4MB 5I9SA 3PUYA 2G08A 4R2JA 1KSFX 3OBIA 1HMPA 4U2EA 2BF7A 5AI5A 5DSZA 5FA8A 4BNHA 1W8IA 1RM4A 2B8WA 5AHWA 5DHUA 4BOYA 1Q17A 2ACWA 4BCBA 2O52A 1MXHA 2FPXA 2E85A 2VYCA 3AHDA 3L0DA 3LMKA 3R09A 3KQLA 2Q7OE 1N92A 1ONNA 3OX4A 4ZYVA 4RIIA 2B0CA 3PNOA 2X0RA 4HVCA 3C7TA 2Q4OA 3H6KA 3NHFA 2PHZA 1WXFA 3VOAA 3U6BA 1GGVA 1AS2A 2J0UB 3HJBA 5E9AA 1WXGA 4D6YA 3I61A 2O3RA 2JNWA 3KIPA 3MJ4A 4Q39A 5EINA 1V11A 2EBHX 2WW8A 1FFCA 3C6YA 4BO3A 1S96A 2FW9A 3TTWA 4OQ4A 3B5EA 5JXWA 5J3JA 1F8UA 1I4DD 1X1QA 1T3TA 2XYPA 2YN4A 3F2IA 3I2FA 2OA0A 3ZR4B 4AIRA 3AJ8A 1UK7A 3KUDA 3IVAA 4MI3A 4KHPB 4YCLA 2GZRA 2AC7A 3ZHVA 2YZ7A 3K5HA 3WNVA 3PNLA 3OTIA 3K1YA 3FJOA 3DZJA 4HMQA 4IJQA 5BN5B 2C9YA 3SC4A 3LP6A 4KQIA 3GJ3A 1K8RA 1DNPA 3GFVA 2KQUA 1Y9EA 3ISTA 4RELA 3EASA 3W90A 4F3YA 5FNVF 3DMTC 5L7WA 3H04A 4DR4B 4KK3A 2Z6AA 1G60A 1GFIA 1OA0A 4Q01A 3WB0A 1NFRA 1VJCA 6PFKA 5K3BA 4GBJA 1UM8A 3VU8A 2I2CA 3LGXA 4KC0A 4WESA 2FEOA 3GBPA 5BN1A 3MERA 3L18A 4ZQEA 2JKZA 3RTDA 3H05A 4HQKA 1NFQA 4C2UA 4C5BA 4MH0R 4N7RA 3BMQA 4J6EA 4WN3A 4OB7A 2XKKA 4FFPA 2GFHA 2OV1A 4GLLA 4U39A 2WJZB 2VP6A 2KW5A 1DV2A 1GV1A 4XB6B 4HNHA 4RTOA 1GR0A 1F51E 1SHJA 3F71A 4EMSA 4KPYA 1WOMA 3E03A 4RW0A 1KAHA 1SD5A 1QRTA 1REQB 4NFHA 1JPJA 2HMUA 1HE2A 4P3YA 1NYQA 1BRTA 2Z8YA 2NU7B 4F9TA 3IP6A 4AULA 3FOZA 1AXGA 4DT1A 5HJ2A 2FRDC 1TZKA 3EGWA 4JELA 1GZVA 1IYZA 2VEDA 3EQ9A 1E2MA 4RD0A 2R1UA 2DPMA 2QLBA 1GO2A 1WR8A 2CXSA 1ULUA 2VDRB 2XKJE 2OXRA 4OB8A 2A0YA 3REQB 4R83A 1NURA 2D3WA 1JE0A 1Y34E 1HQYE 4HDSA 3TRIA 3WIUA 1QH9A 2QTVB 4PGAA 4F4JA 2YH2A 3OQ6A 2II6A 3IL2A 1XLWA 1CXZA 3N2NA 3O4RA 3WA7A 2ZIXB 3FN4A 4D3FA 4ND2A 1AKUA 2DG2A 1UKCA 5BP7A 1FFYA 2GN8A 1PSWA 1Y82A 4HK4A 4H3HB 2D2IA 1JDNA 3PJEA 3M1YA 3IP8A 4FQ5A 1L5LA 4F46A 3HQ4O 1E69A 4PGMA 5KO2A 3CNEA 2P62A 2H8GA 2RAVA 3A0RB 3NH9A 4D9HA 1I6LA 1ZD2P 3DZHA 3NAZA 5LJLA 3LKZA 4KQMA 1L7QA 3DOFA 1JU4A 5JDCC 1G6OA 1QGOA 2RHCA 4M7OA 4LZJA 2Q7XA 3GJQA 4ZZ3A 1F60A 3CFYA 2C9BA 3IT0A 2FPLA 4UVDA 1G8HA 4Y2VA 3BXZA 3BGWA 4OA5A 3OFKA 2H2IA 1PJZA 3OZFA 2X5OA 3BS4A 5E6SB 3VR3D 2DWQA 1XWFA 1FXUA 5DYGA 3I2IA 5C4GB 1WB4A 1U9ZA 3BMCB 2X23A 5G0UA 1W0JD 4QDTA 3LF1A 3RSFA 3MMZA 3EGXB 4XYBA 1B1CA 1SC4A 3FB1A 3L46A 3OC6A 4Z54A 2XMBA 1HQKA 1RLIA 3CNLA 2J30A 1Q0LA 2UAGA 3OOSA 3VC2A 2CSXA 4MV9A 3VGPA 1QVZA 4EI7A 2OC9A 1K5GA 3LUAA 4GRAA 4KBYA 5KWVA 2E4ZA 1M1YE 1LNSA 2P6UA 4RH0A 3UJNA 5BQFA 3D4IA 3BHNA 4BQSA 3SX2A 5MHTA 1TCAA 3JYLA 1UXJA 4GVPA 1PX0A 1T43A 5HTOA 4FCWA 3INRA 3AY0A 4FSXA 5HQ3B 1II9A 4IJWA 4JYBA 2IOQA 4K6GA 1A9ZA 3O92A 3DEHA 1RYDA 2FMIA 1F48A 1PLLA 1UBEA 3M34A 2FX3A 2HCJB 3ANSA 2JVJA 4RWZA 5CTAA 5J1TB 4D02A 5FFFA 4QM6A 1ZK4A 2BHRA 4W1SA 3DC2A 3A9RA 2VBCA 3H8WA 1P5FA 4PE5B 3LPMA 3CIOA 3FTQA 2WA2A 3M89A 3SHTA 3VKHA 1Z6GA 4UBLA 1KYWA 1U2DC 4D4MA 4TM8A 4H77A 2C96A 5LKAA 2IZOA 4YVFA 3BQMB 5L95A 1DS6A 1NR7A 1SEVA 1TAHA 3K05A 2G4CA 3EZLA 4EG8A 3IYLW 2ZBRA 2Q3MA 1XZJA 3CONA 4QODA 1RVDA 1JJBA 5AXCA 4KPGA 1NDQA 1P1CA 1G5FA 4G97A 2OV2A 2IS4A 1EKXA 4HDNA 3TIGA 2WFAA 4NXNB 4MGKR 3SC2A 3LT2A 3KHUA 3DNPA 5CDUA 4J0KA 3LKDA 4HNQA 2YIMA 4RVSA 1OTHA 1YZHA 2XMCA 3B5JA 3H0KA 3ISJA 2HXSA 2Q2QA 3D6FA 3QA3E 5AJZA 3UAXA 6Q21A 4EA7A 3EVCA 1D4ZA 2HDHA 2Q3JA 4YRCA 1U6IA 2C3MA 5T57A 1L4MA 2DCUA 3CUTA 1C14A 4P83A 2ILTA 1WY7A 5SV2A 3RK4A 1YHNA 1ZCAA 4ZIRA 3OLZA 5JUWA 2MMCA 4N40A 3C8MA 1EUCA 2BT4A 4ZCMA 2PBFA 5BVGA 5LZ4A 5THQA 3FUXA 4JLDA 4F12A 1NULA 4IVRA 2ZDQA 4N65A 5CA0B 3LPAA 4OHKA 3D7SA 3HKCB 1VJGA 2VR1A 1R50A 1YJBA 4Q5IA 1FE8A 1HA3A 2W6JA 5KJFA 5KNDH 1TUEA 1S9DA 4BYMA 4KR2A 4D25A 5BMVA 2ORYA 3DF9A 2WD7B 2OAQ1 2G6BA 4IWNA 4PU0A 2YC2C 4CFYA 2NO6A 2F8SA 2C78A 4HTFA 2NSHA 4P33A 3UAZA 3THWB 1KK0A 1YI8A 2I4IA 1X39A 1V7QA 3HXKA 1FRQA 2CW5A 3ELUA 1Y1SA 4WBXC 4EK9A 2QZ9A 3FYSA 1DDIA 4KR9A 3GCWA 1AUVA 5IARA 3Q7IA 2NVOA 2XE6A 2CD7A 1P0PA 5DYNA 2CE7A 4R16A 5B53A 4B6EA 4D9FA 1LGYA 2YFHA 3K0KA 5HX7A 4L5CA 4M88A 2WWRA 4C20A 1TPYA 2IYPA 1A9SA 3O84A 4ERXA 1H0KA 4EGAA 1QB8A 2POQX 3BIXA 1A0OA 2X2FA 4ZOEA 4Z9BA 4MVYA 4RDXA 2RGYA 1RHMA 1FFXA 4G9BA 4UHJA 2Q5FA 1I0LA 3KU4A 4DCJA 4NJOA 3FMIA 3SMVA 3KXKA 3PGMA 3SKVA 3SP1A 5EA2A 1EFVB 1KGSA 2PXXA 3X1YA 4W6ZA 1FNNA 4AK9A 3SOPA 4R8SA 1SA0B 1KA9H 3SQNA 1U02A 5KNBD 2X5NA 2B6HA 3O9VA 4LDRA 2O2DA 4AROA 8GPBA 4UD6A 1D2RA 2DQ4A 2ZJYA 4XWYA 5T4BA 1G6HA 1SD1A 2L69A 3PDJA 4HWKA 4IOJA 1NAHA 3R5XA 2MR6A 1TYDE 2PANA 1I3KA 1O4VA 2MIIA 2RJ3A 4GP7A 4JI6B 2C57A 3EZNA 4Y2HA 4EA6A 4MPRA 4OHMA 1GPLA 3MMPA 4QUAA 5FWDA 2CCKA 1SVLA 2WSLA 3DCJA 4PAGA 3AI1A 4G09A 1MG5A 4RO0A 1JI3A 3DBHA 2BHLA 1T0HB 2FN3A 3VMFA 4IXNA 1JIIA 3BH6A 4EHFA 1N25A 3P94A 3FUCA 2EGHA 3D6JA 4JC8A 2ICAA 4B35A 4LGCA 1GLNA 4LCBA 4BNKA 4DRZA 1W6RA 4UM5A 4DRXA 4UAGA 3ILVA 3TB6A 4JXZA 1EWYA 1DCTA 5AVYA 1JILA 4JEIA 1KFBB 5KDLA 5BT8A 2GVDC 5FT9A 1V0JA 3RS3A 1U31A 1PR9A 2X9LA 1XKQA 3KVOA 1DJNA 4LDJA 1ZUHA 4MX8A 4QELA 1PGJA 2L19A 2CCJA 2CZGA 4YK7A 2LP4Y 3CSUA 721PA 5FP0A 4FGUA 3U09A 4KYIB 1QGZA 4ND1A 3A2NA 4NQRA 3ZLTA 2WU3A 5A6SB 4XAQA 1IAQA 2EZTA 4WZZA 3L8HA 4CQLB 2YWGA 4BHTA 1L9KA 2A7XA 5KKAA 1FDVA 3KPJA 3ZG6A 4C2AA 4G65A 1NGSA 3T1NA 1FMLA 1TQ8A 3ZZMA 1CR0A 1R8QA 2CVPA 4Y9TA 1UC9A 3GLGE 3V8EA 5DN9A 4E5VA 4FS3A 5DISB 4BFVA 2NXNA 3PRJA 1WO8A 5DBHX 3D4OA 3RDPA 3O8LA 1AOXA 3O8NA 4OHZA 5AK4A 3QBTA 1Y1KE 4KPUB 3AB3A 2B78A 4EHKA 5BN4B 3QOYA 4ADSG 1RWVA 4ESEA 1X77A 5JFGA 2BL4A 3P0JA 1MFPA 3K31A 1NVEA 1EXWA 1R3DA 3L7JA 3SYLA 4LRXA 3W9UA 2I6SA 5DHSA 3CVVA 1NC3A 3RS8A 1G5IA 2MTBA 2F43B 1ANKA 4BN4A 4LF9B 4BKPA 1KP3A 3MRXA 5EE1A 1IY9A 4QT0A 1IAVA 2NUPA 3LCRA 3NTVA 4P3NA 1KYTA 2CHQA 3IMGA 5FA6A 4NNPA 3ZTTA 1YS7A 4P4UA 1M2WA 1QVVA 3BZWA 4KNWA 2HRZA 1DKMA 4D1YA 4FFSA 5A0FA 1Q14A 2RC6A 4N6GA 2I4RA 3B1FA 4MRNA 3RRFA 2QBYA 1EP1B 3KJNA 5FKJA 1E61A 3B70A 4HQNA 4IWYA 3JD2A 1MB0A 4DV1B 3BXFA 1RAGA 2D06A 1M1XB 1EG7A 5DRYA 5LQUA 5IVKA 3PC6A 3I2YX 3BE8A 3RVDA 3RWOA 2ZPTX 2GZAA 5TF4A 3FPSA 2H52A 4O02B 1DJLA 4BEVA 3AHIA 1EG2A 2I7DA 1YQ9A 3MJTA 4H7HA 5AW9A 4L08A 2ZXFA 4OGWA 2Y1XA 3VNBA 4R1UA 3DHNA 1LDBA 4OHFA 4NU6A 4B2IA 3QFCA 3N0VA 2ONJA 5FYQA 3DVRX 1MC8A 2Y05A 4ENRA 3RIYA 1MC4A 5E6RB 3OZVA 1E2JA 4YWJA 3NOQA 2PT6A 2ZIVB 5C8XA 5BQPA 4ARSA 1XAHA 5CNIA 1RP1A 3EEFA 3QQ5A 4QGHA 2ZSUA 3ND9A 3B6MA 2W8BB 3PJFA 1QHYA 1VI5A 4C6TB 4GOXA 4Z4QA 4DM7A 2ZJ4A 3V8BA 2I9PA 2WZCA 3FWHA 3GP3A 3GQBA 4C30A 3OEYA 3P71T 4WEOA 1A4IA 1U8AA 4WDQA 2IU0A 1JVSA 2OXFA 3C6ZA 5FFMA 1PQUA 2J3LA 2ZRGA 3CNOA 4RK5A 5EWJA 4DXAA 3GLHB 4N3NA 4BBPA 3CR8A 4L5AA 4UD2A 4LRUA 4RYDA 5AW7A 4AMVA 1OH7A 4ABYA 3CYFA 4GXRA 1ZI8A 4Z1MD 1Q2XA 2ZVDA 1H8EA 4HATA 4JP2A 2HBZA 1TQ2A 4TWAA 4AI6A 1ZCJA 1NVVQ 2KBFA 1DTEA 1RE0A 3JALB 3WL8A 3O1HB 2QAGC 3PU6A 4QPPA 1ZIOA 5BOVA 3PXAA 4JB8A 4NHEA 1U63A 2QQEA 2WSSA 3IIEA 3MTQA 4OKIA 5DYIA 3T5TA 4ZZ2A 3ZVMA 1M2GA 4XD7A 1EZ4A 4WRRA 4LX0A 1EUDB 1NZJA 3WLTA 4E94A 2A1TS 3BGVA 2J6CA 3IXMA 1JJFA 2GAFA 3X1MA 1FDOA 2YMLA 2WDZA 5IT0A 1QZXA 4RTSA 4WMLA 4KR0A 4DEXA 2LZ0A 4ETNA 1HRKA 3GA5A 1ODTC 1DOAA 1HT0A 4B3JA 3HO6A 1EB8A 3LYUA 4QZVA 2ZM5A 2YJGA 4AU1A 1MX5A 1NXQA 4NNOA 1MV5A 1ZD9A 2EJVA 2LBPA 1RKUA 1NV8A 2CJWA 3I04A 2XCRB 3M1LA 3ZXSA 2DFVA 1J06A 2IHJA 3QKTA 2GPWA 3UWPA 4HGPA 4KK4A 3IVGA 3ZK7A 4QOIA 1M2KA 1Z0IA 4I55A 1XTSA 1ZWKA 4QTUB 4C6RA 2D74A 2KM1A 4XSVA 4C3UA 4IDBA 4H31A 1T6YA 1Y3BE 3EIFA 3IURA 3MUNA 3S1AB 5JRJA 2WDPA 4BFUA 4R51A 1T24A 5IF3A 4YCMA 4KN8A 4X91A 3CUKA 1IWBB 2FFBA 1QIDA 4K9RA 2NU6A 4WERA 2EJUA 2G07A 3R6TA 4GPZA 1Z4PX 2D1SA 4RANA 4IFTA 5KAMA 1AO3A 2GLXA 2G80A 2P77A 1MAWA 1QHHA 3GXBA 4MUGA 1E7MA 2BMVA 4YAWA 1BHQ1 1UPAA 5GZ3A 4O1HA 4TSKA 4LF5B 4A0RA 3CF2A 1KIFA 1SQGA 1G63A 1OT3A 1RKVA 1U7TA 2ERYA 5I4IA 3KQHA 2VK2A 2IS2A 2CXXA 4W8GA 4M60A 1BXKA 1D4FA 1ABEA 3SHVA 4HQ0A 1XRJA 4B9EA 1JKFA 1HI9A 1TO1E 1XAJA 2X2EA 3E1KA 3L1HA 3PX2A 4KR3A 3N05A 1RWNA 4MKGA 3WR5A 3KXPA 4RF2A 1LV8A 3WGGA 5KBYA 2QW8A 5FTMA 2C8VA 3H1PA 1X2EA 4DHEA 2EJCA 5CFOA 3HJHA 4TV8A 2AG5A 4DREA 2DUMA 1BVHA 2Q29A 2O59A 3ILXA 1PFKA 2D7CA 4XRGA 2GILA 2XMZA 3K0AB 2J33A 3H4IA 3ZEIA 3DPSA 4DDVA 4CIXA 4AYWA 3OJ0A 4CDRA 2JCVA 1P75A 5F1KA 5L8VA 3ET5A 1TVMA 2AN9A 2O2ZA 1INLA 1VSUA 4UTXA 3KR0A 2VZ8A 1J00A 2H4HA 2ZFUA 2ZZMA 2GFQA 4G5XA 2OZLB 4O4IA 5KPDA 2VPWA 2D59A 4YX9A 5EKXA 1Z28A 1PFVA 5JS7A 4UAVA 2XGSA 3DTVD 3G8DA 3R0QA 2NQ8A 5D86A 2EF1A 1KU6A 1L5GB 1TZBA 4TWZA 1FUKA 1T26A 3X2EA 2Y1GA 1XCOA 3IRUA 4Q1CA 3NIFB 4MVWA 5J63A 5KSZA 3FTEA 5FL7D 4RY8A 3MG9A 5JS2A 4D4KA 2COKA 3DULA 4W4TA 4ZIRB 5KTTA 1U90A 3ANNA 2H3HA 2GZSA 4MWGA 3R9XB 4M9QA 5KOJA 2HK6A 3EOZA 3I37X 4O0LA 1C0PA 4QDUA 4KFSA 1YULA 1B8UA 3RK0A 5DNDA 4ZVTA 3UKOA 1AKVA 3EZYA 2O2EA 3RUEA 3O4IA 5HKLA 4PAQA 1UM9A 2C7VA 4TVKA 1ULBA 2EQBA 3EQ6A 3F6EX 3LY5A 2DOKA 4GF5A 4HAWA 4PAWA 2GB4A 4D9CA 3ZGOA 4ARAA 1QE5A 1CP3A 2WR8A 2XOKA 4ZP1A 1RBYA 2P1ZA 2OUKA 4G0QA 1XD8A 4IJMA 4OTZA 4UNRA 4L22A 1Y8ZA 4GAEA 1U2TA 1J2UA 1T36A 3I5AA 1JYSA 1ZU5A 1U7DA 2QR2A 2OFOA 2Y1OA 3OJEA 3B2NA 3O31A 4FDMA 4D3ZA 4IGEA 5CCEA 1Y80A 1F9EA 4LOIA 1QQTA 3B6KA 3SVZA 5JJLA 1U1EA 1FP4B 1QF7A 3CW8X 3JVVA 3UK2A 5KWIA 4OSOA 4HB2A 2CYBA 3A04A 1A5ZA 3B20A 5EHXA 5K0JA 2FWPA 5TC4A 4R8MA 4H7IA 1Y42X 3TH5A 3B1YA 3RHZA 3SM9A 3P1JA 3H99A 1K7CA 3RYCB 1DFHA 2CVZA 1IQRA 2PD6A 1WZNA 2VATA 3EZ9A 5EP4A 3FIJA 3VX4A 4YCNA 4CEJA 5D00A 4KMRA 3R4VA 1KEUA 1B4DA 3A36A 3NB0A 3GPIA 1SCUB 1O95C 4DA7A 4DUGA 2B20A 3IEKA 2Z6QA 4OX9B 3F7MA 3NV7A 1FVHA 3OE4A 4MDYA 1IBCA 3UJHA 1O2DA 4S2EA 3CHYA 3Q6MA 1M7GA 1F2UA 1JR4A 3GWGA 2A92A 4D2IA 2JLYA 1S9HA 3FMOB 3QVGA 3DOHA 3AZOA 4F85A 2H85A 3R24A 4J7AA 4LDPA 4IJUA 4LNUB 2BEWA 4O4LF 2UU9B 1FZTA 4MWSA 4B4OA 2FPRA 2Z09A 4EMUA 3TFOA 1AB5A 1X80A 2OVFA 4FLEA 1M74A 3FAZA 3QXSA 1MJFA 4IVNA 1KWGA 4YQFA 4H4EA 2HJRA 2XCIA 4AY6A 3G2LA 4S1VA 5DE3A 1OH6A 3V2HA 2A1UA 5HHTA 4J3FA 2B94A 5ARBA 4IKOA 3BRSA 1CULC 5C8YB 1TPZA 2C4VA 4ETIA 3PA8A 3WE7A 121PA 1EK1A 5K0TA 2YUIA 2H92A 1P5HA 4RGQA 2APJA 2YY5A 2OG1A 3HZZA 4GH5A 4MR7A 1IIRA 3RF6A 4PBTA 1PNVA 5FBRB 2REQA 2P68A 4J8PA 3RRZA 2ZWOA 1DFGA 3A1TA 4E08A 4NV3A 1JEQA 4EYOA 2EZ9A 1I7LA 3FFXA 3L0OA 1XHFA 4XQCA 5EWMA 1KQFA 1L8AA 1CF4A 1JR3E 4PWZA 2QJTA 3UWDA 1UKYA 3OJCA 3RT9A 3F7NA 1JVNA 3VZPA 2OBLA 4MV3A 1OXTA 1NXSA 4OH7A 5CH8A 3K9NA 2VHJA 4KGXA 2HIGA 3JYQA 4GZLA 3VU9B 5CH5A 1E7QA 2FVYA 2V97A 2CWDA 4UBNA 4UNSA 1U8YA 5COBA 3E27A 3UH0A 5CEFA 4PLWA 1Q1NA 3UKDA 5EEGA 4BRZA 2XUIA 1IRXA 3ITEA 4NPAA 3HJFA 1TJYA 2ODPA 2QN6A 3VR4D 4L27A 3EFEA 4E5KA 1TJ3A 4C7KA 3MMSA 1J8DA 1NV9A 1L5KA 4U63A 1R8YA 4QHTA 3T5GA 3G2QA 3A1SA 1FXWF 2VRCA 2J6HA 3P9IA 2V6FA 3PC7A 3NASA 3CKYA 1DO2A 3EY9A 3SLGA 5BNWA 4TSFA 4KN9S 1N2HA 1GSOA 3LZCA 4PNZA 1RXCA 3OD5A 4M9SA 3TS1A 3DJFA 4WK0B 1TYCA 1UK8A 3G85A 2ONCA 3B8HA 5B4VA 1CZOA 2P4QA 3RAFC 2GTPA 1A1VA 2GTIA 1PJ8A 3U26A 3T34A 3I12A 1II0A 2ZSFA 2CXRA 1E6UA 2RHJA 3IDSA 3RUFA 2H7YA 3G7SA 5F2NA 1I1HA 3NHBA 5ALJA 2GPNA 1QMGA 1RVV1 3U5ZB 1BW9B 2UVQA 3P9PA 4NBVA 1G21E 4E5NA 5BUSA 1I2BA 1OH8A 3VYUB 1P2UA 2ZEJA 3B1VA 4HB3A 1NBMA 3H9QA 5DHPA 5F3RA 3ROKA 2JAXA 1JKXA 5K2MA 3STXA 3P5BA 3PXGA 2XOEA 3CCCA 1KOJA 2IYSA 3C8ZA 4GDMA 2D5BA 4ZYUA 4D56A 3DLAA 1KMHA 1DBQA 2VDNB 3MVEA 2CSUA 3UJ3X 4BC0A 2JCXA 4O4HA 1U7PA 2PMWB 2W2XA 3IPAA 1CUCA 3L93A 5CFMA 4ND4A 4OH1A 3OPYB 4B3XA 4CTOA 1H2XA 3GT0A 1O9GA 3IB6A 4UMVA 4FLFA 2VWQA 3FNEA 4UXIA 1BXRA 1H4VB 2IPOA 1V41E 4A5OA 3LWDA 3H6HA 5AD1A 2HREA 3RASA 3SVTA 5I4BA 3C39A 3CXUA 3EXHA 3WO0A 4WXEA 4B44A 3AEQA 3EXIA 3GGJA 5TQ0B 1E1QD 4NAUA 1JJVA 1R0XA 2BKVA 2QAGB 3MB8A 1T3GA 3UB3A 3RM3A 3O1LA 4NESA 5DGIA 3F3KA 2CVHA 3DAYA 2WD8A 3HCNA 3K72B 4YCJA 2Q27A 3AR8A 4BVAA 4XTRA 3HDYA 5BPHA 4OLFA 4YAJA 4JLAA 2IC5A 3QWHA 3FLBA 2QRPA 4OOFA 4B6QA 4KBFA 1BQ3A 2EKLA 1H2FA 1L7BA 1W2GA 3Q8XB 3KAJA 4J43A 2M6KA 1TEXA 5MN4A 4HXFB 2C2YA 3QEMB 3UPUA 3OTWA 3BTUA 3H0CA 4WKBA 1MQAA 1BJKA 1CT9A 3IAS6 3B8EA 1NQ5A 3DOUA 3CO0S 1MO2A 3KLMX 4GS5A 1SCQA 4LYGA 4PNPA 2BH9A 1TT5B 4K9DA 1VCOA 2EDCA 3CRRA 3KZXA 3GHHA 4FXOA 3C97A 4Q9NA 2JFNA 4QTTB 5KYXA 2DEUA 6GPBA 4KLNA 1SPBS 3C87A 3GAAA 1SBQA 3K3PA 3N2KA 1EUYA 1LDNA 5D3MB 3KTFA 5EP3A 5FADA 3UHFA 1KTIA 3CZRA 4TL8A 4YBRA 3RUIA 1GRVA 5CDTA 1K7XB 3EQ8A 3UJ8A 4H2DA 5AI6A 4BBJA 1PFGA 4G0YA 3CKLA 3HXPA 2Q1XA 5EZQA 4NX2A 3U4GA 2UVDA 5FX2A 1EFTA 5K51A 3WIVA 1UQTA 3KQNA 1AX9A 1G64A 2PPVA 3BIFA 1DC4A 4FD2A 6ABPA 5HF8A 1LWNA 2BGLA 2D0OB 5JBQA 3WIBA 1E5VA 3DZGA 1E0KA 4CTMA 1Y7TA 2YOFA 2XT0A 2OESA 4RA6B 3D59A 4RZ3A 5FOVA 4BO0A 1PW5A 1AF7A 1CJSA 3BF8A 3QXHA 1PGOA 4MW7A 3KQKA 1BMTA 4FMCB 1GNLA 1I9GA 4MV7A 4TTAA 3VC1A 4HNGA 1ES9A 3WRYA 3EXFB 1WDMA 5IU6A 4ZGWA 2ZAIA 2PR7A 4J03A 3THRA 1IHXA 1NX6A 3HXMA 1E98A 2YHAA 1T2CA 3FD8A 3GRVA 4A9AA 4MYRA 2RK4A 1DT3A 1CE8A 4EB3A 3S70A 4M0CA 1QB7A 4ZQGA 1ZL0A 2I91A 2B4RO 2EVWX 1NFFA 3HNRA 2CJYA 2B9VA 2Y71A 2D1RA 1ZD5A 3PXBA 1HWYA 3C14C 1VIMA 1S2MA 1ZNWA 3L5KA 1UZAA 3P2KA 4P80A 5JO9A 2PLRA 3K09A 3KYJB 1KGDA 1N3YA 3P0HA 5DYWA 2CWWA 4Q6BA 3U7JA 4XYLA 7YASA 4FCCA 3AH8A 1CQJA 1H6DA 4QUKA 2X2OA 3UXHA 2B98A 5JZMA 1IN7A 3S2EA 4L8GA 3C85A 1GZ3A 2E4VA 2QY9A 1DEAA 3F6RA 3RODA 7ABPA 1WEHA 1T0UA 4RQBA 4P58A 1ZRHA 1VIAA 2JGKA 1EFRD 3OZGA 4RABA 1VL0A 4OATA 1F5NA 5KWEA 3DO5A 5A4JA 1OSNA 1I5OA 4RVGA 5DLPA 3JZDA 2MSDB 3AW9A 3K9WA 1IONA 5CDFA 4CZ2A 3VA7A 2Y99A 1DEHA 2FK8A 4L57A 4X24A 3EPHA 1S8AA 1VYTA 1YS6A 4F6RA 2I71A 2EJTA 2D1YA 3R0JA 2X7XA 2K7FA 2OB1A 4S1TA 3DDOA 3PSHA 4RTQA 2NSJA 5T4EA 1AKYA 1FVOA 1I3MA 2OWEA 3BOSA 3PHCA 2JJ1D 4JROA 3W2TA 1XRSB 3AF6A 3IH5A 4IZIA 1BXZA 5T8KA 1WDKA 5EE9A 5I7VA 1X92A 1QUEA 3MRVA 3L6CA 5DCUA 4A8PA 4B75A 1JZSA 2QP9X 2YZGA 3MWEB 4DZTA 3AW8A 4P5PA 4RD3A 1VRWA 2IBTA 3LY8A 2HHCA 2BM9A 2KX7A 2WUGA 4K1XA 1M6WA 5YASA 3TLMA 3F4LA 3ED1A 4YT4A 4H7EA 4YRJA 1E6CA 5CB0A 5TE9A 2FEKA 1UDAA 2AK3A 3TR0A 5ABPA 2X9VA 3HDQA 1NC1A 2PU5A 3OIDA 2GERA 3AV0B 1T6NA 2O2IA 1EXVA 5A05A 3L41A 3TLCA 1Y0BA 2ZE6A 4BUJA 1QQ6A 2J3MA 3TLAA 3VDRA 5C1BA 2GPJA 4Q37A 4JLWA 2VPPA 2RHOA 3PHGA 2DFDA 4JITA 3Q3GE 5CGQB 3A2KA 4L4ZA 1GTMA 1N6NA 4QBGB 1C3OA 2R4UA 2X4GA 2GX6A 2ZSAA 1HEUA 2P9CA 1GUDA 4ZVLA 1VPDA 1RFGE 4TLDA 1E1CB 4Y2TA 5I7RA 3JZIA 3CVUA 1PNRA 4BNJA 3WLHA 5DX1A 2QGNA 1M67A 2QJFA 3UJ6A 4C0LA 1Z6YA 3KL2A 2ZQ5A 4B46A 2BCGY 4F96A 5K4HA 1Z2AA 4UPVA 4WXPA 1M8FA 2DT5A 2OD7A 4Q4JA 5T41A 4ZEMA 1CUZA 1A9RA 2YIDA 2VSOA 3A1EA 4WA8A 5KU1A 4C78A 5A1TA 1CV2A 1JWAB 2GYWA 3D6UA 3PR1A 4IHAA 4KO2S 4M6WA 4YGXB 3TQIA 4MVJE 1WSBA 3EJWA 2V9CA 3AKCA 4ZVRA 4EG0A 2V6BA 3DWEX 5IYZB 3ZIAD 4BL5A 1U1IA 2BEJA 5BSWA 3OPQA 3UFXA 4NZNA 4UXHA 1TVKB 5U4XA 1P9RA 3CW9A 4H35A 3W8NA 1USVA 5BWBA 2V3WA 5NLLA 5ELXA 2BI7A 4AJEA 3T3DA 1YRAA 3U6KA 3B6JA 2RK3A 3K0HA 4LKRA 5U4QA 5HZGA 2BFEA 3D0KA 4QVIA 4BASA 3I5YA 1DX4A 1XZHA 3E9QA 2AI2A 2NZWA 3LZDA 4N3BA 1I9CA 1VG8A 3LT5A 4MKZA 2ZUCA 3AF0A 4MVCA 3DM9B 4Z3OA 1NOJA 3K30A 3C3DA 3IA7A 4J16C 4AN4A 2W2VA 1OX4A 3AF1A 4EW6A 4G8DA 1RAFA 2HB6A 1LWOA 1X7WB 3L0YA 1A82A 3ONEA 1EFKA 1OBFO 2JGIA 1E2UA 4WCFC 3I92A 4L85A 4BY9E 1ULSA 1TF2A 4MPJA 2PKWA 4ZAXA 3TLZA 3EG5A 1JQAA 4ENTA 1P81A 3MB5A 1LNQA 1X1TA 1XRPA 2BGTA 2PFKA 2Q9AA 2REBA 3DH0A 3DEYX 3KXDA 5DBIA 2YXPX 2PGOA 3ROEA 1T35A 2CUTA 3BIJA 4I81A 1CR4A 4A6PA 1LW7A 4IV5A 4RESA 4OKSA 3FPAA 1MMFB 1DXHA 1S4MA 2YNMA 3HU1A 1IG0A 2NVUA 4GYWA 1VSQA 4JGBA 3GLFB 4A1FA 3LIPA 4J7XA 2ATCA 3KJQA 5HFJA 5FUXA 4IOMA 1UJ4A 4ENQA 3NXSA 1GGEA 2A9RA 2MINB 2ZXEA 3A3YA 4XPIA 3VVBA 2PUWA 5C35A 1B42A 2DFKB 3MHTA 1PSZA 4QYXA 4GP9A 1IEWA 3RFVA 2HXGA 3GUUA 3SY8A 4K9QA 2REXB 3BK7A 5JRZA 1WX1A 4F38A 2QRZA 1LF5A 1DXYA 3WGIA 2O8CB 3DAFA 3RSCA 2XWBF 5CBPB 3LQ2A 4H18A 4D3DA 3PQCA 5CVEA 5JCXA 5HRUA 1GM5A 3IALA 4MCAA 1EBFA 3IOMA 2E37A 3KB6A 5SZIA 2AEJA 4PCUA 2ZYRA 1LF0A 1X1AA 2C00A 3AWDA 3LCCA 1N0WA 3D6TB 3FF4A 4AF8A 2H18A 1O58A 2LXNA 1V7ZA 5MGNA 3ITKA 3WLSA 5JZOA 1HT2E 3BF7A 2WBLC 3GRCA 2Z04A 4KQXA 2XZTA 1G291 4V1CB 5HRCA 1APBA 2WVAA 4D9JA 2V55B 4JYCA 5BWNA 4GOKA 2XD4A 3EUFA 5KYGA 3WO1A 1ZHOA 1DIHA 1E5DA 5KSYA 5C5IA 4RA9B 4AZ3B 4BTVA 1AT1A 2HZBA 3DEAA 5D1HA 4O59O 3WHLA 3NJRA 5CX1A 3VJKA 1H4SA 3G2KA 4ML3A 2GBLC 4LHVA 5E0KB 2FMFA 4FHDA 5H1YA 1L8OA 1XF1A 2O1WA 3CG4A 2GCEA 3HUDA 4JJ8A 3TTXA 3CZAA 3VISA 3WFZA 1B7GO 3G9XA 4BNYA 5B12A 4JD5A 1XZBA 2YWXA 4CM4A 1KYXA 2DPLA 3NLLA 3ZI4A 2JGNA 2EWWA 2G1UA 5BR1A 4QPCA 4K9KA 1KMMA 3LBFA 3O1IC 2UXBB 3GLVA 4Q7EA 3T3HA 1J70A 3AILA 2BPOA 1RQ7A 4TV9A 2AK2A 4B7CA 2GYYA 2QSZA 5L3ZA 1SXQA 3BTSA 4WD3A 4FNGA 1Z4JA 3ZX4A 4BX0A 4DN6A 1BOOA 2RGRA 2RONA 3CX3A 3G9UA 5IX8A 2P5YA 4YP6A 2WB4A 4BU0A 2F3PA 4CYMA 1TM2A 3ORYA 5TQ2B 4B3IA 4UU7A 1ZI9A 4LI0A 1B6RA 5FWXB 2R1VB 4W99A 5CFNA 3H7AA 5AVXA 1I94B 3GUHA 5CXUA 3GL9A 1O5IA 2XYVA 1ODIA 1PT7A 3EZGA 2ZPUA 3VMMA 2QUIA 1NWCA 3A05A 1E3IA 4OIMA 4B47A 1Y4DE 1YGPA 2XIQA 3DMRA 4EHIA 5LFAA 4PSKA 1DINA 3O82A 4NVRA 2WFLB 4Q82A 3N7UA 1EFPB 2A4KA 1RSZA 2FPPB 2GUWA 3GEGA 2CK3A 3VKFA 3WI7A 5KKNB 4Z2AA 3Q15C 1MENA 1RBZA 4RS3A 4UCXA 3CIFA 521PA 1A5BB 4B8WA 4DC0A 1TIBA 3FLAA 5AESA 1N2SA 1V5EA 2HJSA 221PA 4R05A 4C7MA 4CEIA 4XYGA 5B30A 1YOBA 1TE2A 4L28A 1WUKS 3T7EA 3D7KA 2LDXA 1KAEA 2XDQA 1OAOA 1J8YF 2V6JA 4UBKA 3H5LA 2AVDA 4DMFA 2E6KA 3ESQA 1HETA 4OHYA 2JJMA 3EVGA 2RGWA 3VPFA 1KI8A 2EG5A 1SVUA 4A7PA 1ISHA 1M7HA 3MJRA 3MSCA 3OPNA 3TW0A 4CJXA 5CAEB 5IEJA 4J1TC 1PF7E 2GN4A 1VGQA 2BZ1A 4M9UA 3DLBA 1JQLB 3EXG2 1W49A 2I67A 2RFLA 2Y1KA 4M1KA 5K1ZA 4YRTA 5IHXA 1T8WA 1I6MA 1E2BA 4IR7A 3N58A 3TRFA 1OZAA 2YVQA 3WMXA 1OY1A 4UBIA 3WGLA 2AN4A 1ZEJA 2G67A 1VJ5A 1GT6A 4OXKA 4DC9A 3M70A 3U7EB 2WJIA 5IAAA 3B3JA 4JWKA 5AJVB 2QMYA 5EXTA 1EFLA 4PYOA 2FPKA 1DQRA 2HH9A 1NX9A 1U6KA 1EFHA 1T25A 1JHQA 3HBFA 4R3WA 5H0IA 2LUOA 4HVAA 2IITA 1TA9A 2FWNA 5E1DA 4OREX 5L51A 5EE0A 1Q19A 1GL7A 4MGZR 1VLJA 2BJHA 1ZK2A 4LXHA 4B4VA 2QNRA 3ZQJA 2JGJA 4ED9A 3UT6A 3TMAA 1KU0A 2I4NA 2XRFA 2DPYA 4I19A 3C6KA 2QXUA 1KE1A 2J4DA 4S2UA 4QQRA 1GTRA 2FTKE 2J45A 5HMLA 1V5WA 5LUBA 1M54A 1N5RA 3HWSA 4OQYA 1G7TA 3UGJA 4CIYA 1EVKA 1FYDA 3IOCA 1U1DA 4YHBA 5EMMA 3ZHYA 3C15C 4BXOA 3LBYA 5LMCA 4KQWA 2P5UA 1H93A 5CCDA 3TL3A 4XUCA 2BELA 2PBLA 1EPUA 1NW5A 1WU8A 1LLQA 3IDAA 4ZKEA 5JAPA 2H7VA 2KSQA 4TL6A 5D5PA 3QM1A 3TEFA 2IEYA 5AVTA 2AHRA 4Y2YA 4RXMA 5JYEA 4R98A 2PZLA 2WOOA 1SELA 1NL3A 1ZC3A 2LR0A 4PPGA 3UV7A 1N6RA 1R15A 1U1FA 1IEQA 2Z1NA 2FDRA 4AWBA 2PRSA 3UHPA 4YIHA 4HXEB 2ARKA 2Q3BA 4XIJA 1CJMA 1WLSA 1G8PA 3NM4A 4CMHA 4URXR 1UQRA 2MSCB 1SKBA 1PJ2A 5IUJC 2YJ3A 1CS0A 4MA0A 5BSUA 2VUSA 1ZZEA 4P1ZA 3EMVA 4LYJA 3TBKA 2ZCVA 5FV4A 1Z45A 3ICQB 3VR6H 2E4AA 5FQOA 2BH2A 1NVXQ 1CY8A 3DUFB 3O9ZA 4NHOA 3RV3A 4YV1A 1POWA 4UE2A 3LFTA 5EJ2A 4PYJA 1MKYA 4UM9B 3PHBE 1ADGA 2IDZA 3I9V6 4DBLE 2CLSA 4UEWA 2AXNA 1DWQA 3TZCA 1Y9DA 1KI1A 3VSEA 3DAPA 2ZUSA 3ZWKA 1HDXA 2A5DA 3DZFA 2R4TA 4MULA 2PX2A 1W0KD 4EW3A 3TW8A 1SZJG 2BAGA 3PJGA 5CJ2A 1ENZA 1PZXA 4QO7A 1MVLA 2V4ZA 4GWLA 4I50F 5ALLA 2QSYA 3AM3A 1WMBA 4NE7A 3IILA 1AHNA 2CY0A 2XUDA 4NCAA 2GN9A 3N86A 2VHUA 2GF0A 3KT0A 2GWHA 4H7DA 3WXMA 1CZKA 4P7KA 3ABRB 2C84A 3WB1A 1SC9A 5JADA 1A9QA 2OXEA 4GPBA 4RQUA 1A5TA 3IX7A 4HQ6A 2B4YA 1A97A 4HEQA 1DEOA 2KI5A 2KWIA 1VZ3A 2IWHA 2IOYA 3NDPA 3VI3B 3QTLA 3BT7A 4MHOA 4W8HA 5BRJA 3PD1A 2BV3A 3KYDA 1OFUX 2RGBA 4X85A 3UMMA 3P20A 3SF8B 2FPIB 3A6FA 1RJDA 2XVYA 3R2JA 4NARA 4PYQA 5GM1A 1YB4A 4D9EA 4LOLA 2OCYC 2QZ4A 4QJ5A 3EODA 3MCAA 2PRJA 1EE9A 2R8BA 4TLLB 4AJLA 2JPDA 2FZLA 2AFHA 2Z8YM 5ICFA 1K8ZB 1K89A 1IUOA 3BULA 1RPAA 2H5JA 3D3WA 4NBSA 3OO1A 1GV0A 4KE8A 4NBKA 4W5HA 5EQTA 5HDBB 3ESXA 3UHJA 5TARA 3NDBB 4PZ9A 5ERXA 3BJZA 3BMNB 5FUBA 4BUZA 3RIGA 4IO1A 3BWYA 4HFJA 2VBFA 4M1YA 4ON9A 3SZRA 2JH8A 3VH1A 1WF6A 2PX3A 1P4HA 1TJ4A 3ZCQA 1ZIXA 3CLSD 5JSQA 4EYSA 1DP4A 4W5OA 4FBLA 2EHDA 3HDVA 1ZN2A 4BVFA 3Q0TA 2VLIA 4ZJPA 1VE1A 5ADHA 5JAMA 1A72A 1N8NA 3I9FA 3IOBA 3ZQ6A 1CUAA 1Q6YA 4PINA 5EAIA 4CG0A 1XCPA 2NQ2C 2WUVA 3W79A 421PA 1AXRA 1DIAA 4FB4A 2WKSA 3OZXA 4CLOA 8AT1A 3HABA 4CCAA 1ODSA 4BLSA 1SBZA 3R44A 1GTZA 3NHUA 4BX3A 1RMYA 2YHIA 3K0FA 1WZIA 4MVJG 5FPYA 1C9JA 3VRHA 3ZE8A 2O8BA 4ZCRA 2PL5A 4H16A 1LI7A 3JQDA 2BKAA 2PQ6A 1GEGA 3VR2D 3ZNOA 1U7HA 5JG7A 3DR5A 5CURA 3E3MA 1EVZA 3F1LA 3F1KA 4IIXA 1ZK0A 3BRWA 1GGMA 3C74A 1YU6A 1NF2A 3FNIA 1CY0A 2M6LA 3WDSA 1NG1A 3FCYA 3U80A 4HFNA 1TXGA 2NTVA 2QXTA 3H1AA 3HXLA 3LXRA 4KB5A 3UAOA 3WV4A 4ESOA 2VYVD 2VSXA 2QVCA 5DEOA 2CT8A 4GLJA 1EAYA 1VA5A 4PHCA 1VE7A 2NX2A 1A7AA 3B53X 5HG0A 2H0RA 1D9ZA 3MGCA 4KBGA 4NU8X 3QPDA 3EZ2A 1C2YA 2IYVA 5ITVA 3ZKWA 3KSDO 5K6RA 4CNBA 3O26A 4UKDA 2AI3A 3HM9A 1QS0B 4AP9A 1K6JA 4EB0A 3GAFA 4X1KA 4GKKB 3MWDA 4EUFA 4GI2A 5BWLA 3CNBA 4ZWNA 3KWFA 1I51A 1XQVA 1W87A 2DJIA 2J46A 3IESA 2VN8A 3IT2A 3K2IA 5BYJA 3AUTA 1FUYB 2I3ZA 5JBNA 5LM3A 2O4CA 4DCMA 4WBNF 2PGLA 3QX3A 1ENPA 1JNYA 1MUUA 2HLPA 2AD5A 3JASA 3LLMA 4FDTA 2IVFA 4L5IA 4I1SA 2DBRA 3KKEA 3KYCB 5DGCA 3VO1A 3UGQA 4W9MC 2PUGA 4L0CA 4IIUA 4A0GA 1QTQA 4KLAA 5E7MA 4D3YA 2GEJA 1L7PA 1CB0A 2I6GA 2I8CA 4PSVA 3T7AA 3UXEA 3ZUPA 2VNIA 1DO8A 2JANA 4FC6A 2RHRA 2VHZA 5KVSA 3UB4A 1DJPA 3Q1LA 1KFKB 5BUQA 1Z6AA 3QVUA 5E1OA 4FYJA 1DAHA 3S40A 1P0CA 1G42A 1SCNE 3MJVA 3TTYA 3ZWVA 3LAWA 3ROTA 4EBFA 2ZJ7A 1WRBA 3H7IA 1EQAA 4J9VA 1YBFA 2DR3A 4BMCA 2FSSA 3KVNA 4TQAA 5AKIA 3U81A 1CR6A 4K6KA 3ESBA 4DCPA 3IPYA 3QZUA 3K70D 1X70A 3Q3HA 3QYFA 1DC5A 4GPIB 4EECA 3V4VB 5KNDA 2X40A 1BN7A 3FSJX 4D74A 1UJ2A 1SKYB 4FMBB 4UMEA 5AVWA 5I7SA 4JUFA 4YYZA 1EDZA 4NOJA 3SICE 1XTRA 1QH1B 3SSMA 3VZQA 2O4UX 4H60A 4NH4A 5JRDS 3EWSA 3D0QA 1HE4A 3K53A 4WZBB 4F06A 4TQGA 1PTJA 4MZDA 1CUXA 3I01A 3W4JA 1QAMA 3DOCA 3AKDA 1B14A 3QNMA 4IHQA 2H1VA 4MRAA 2V58A 2GXSA 3K7EA 1IDOA 2BIFA 2ZITA 3FLEA 2ZRDA 1TQ4A 5C51B 1ZVMA 3G82C 4PFKA 4RNDB 4XRRA 1O96B 2F6RA 5L53A 1M8PA 1RRFA 4IDOA 2ZBEA 3GZ4A 1Z5WA 5K2OA 5K0CA 4QHSA 3SEFA 2G5GX 4EFDA 1KDRA 2C5EA 3THYB 1E9CA 4NR0A 1D8AA 4KXMA 4CVNA 1T4GA 1C3VA 1JIVA 3DYBA 5CB8A 2AYZA 4K0RA 4KAJA 4F93B 3TXYA 1D2GA 4I7EA 5IZCA 1JDUA 4IFIA 1I10A 1Q16A 3TAUA 1YMQA 2JI6A 3I62A 4G0XA 4Y1RB 3B48A 4G41A 3L0BA 3WGVA 2H8KA 1N4AA 4DKXA 1I4EB 1NNI1 2WZQA 4P3OA 1Z75A 2M98A 3OZEA 1I14A 4G8BA 4MMZB 4E03A 2Q0QA 4AO7A 3JQPA 2SECE 1U5CA 1PQ4A 1EHYA 3L06A 4KIFA 3KP1A 2RHGB 4LHEA 4MJLA 5TPZD 2H3EA 5A03A 1V8FA 3OOJA 1KZ1A 4FMCF 1FNCA 3MD0A 4ND8B 2HWKA 2IXGA 4PC7A 4PHFA 4QUIA 4ZV4A 2QQ5A 4AYXA 4X8HA 4BGDA 2YXBA 5EMLA 1H2BA 5CM8B 3G02A 3RAPR 4LXTA 1Y1QA 1LBQA 2HU5A 4PO8A 2OBFA 1OD6A 2PKQP 3GRPA 1WB9A 1M34E 1QVRA 1CP2A 1KL7A 3HJUA 4FX5A 1HQDA 1WZ2A 4X8LA 2WF9A 2ZIWB 1BO6A 3TJMA 2FXIA 2A1IA 1PX2A 1EGHA 2B2NA 3VKUA 4QUBA 1Q92A 4IP0A 4RZIA 4ZYTA 1SVMA 5BQXA 5C3MA 1XE3A 3RVJA 2WSIA 4DA0A 3LQQA 4MRMA 1Z63A 3P2YA 2HWXA 1QYRA 3T41A 2A86A 4LOHA 1T1GA 2NZ8A 1Q83A 1PJTA 2GAAA 2MOKA 2BEVA 2FWJA 1ZCZA 5IZ4A 1XL0A 2VOEA 3E9DA 2JFGA 1J0EA 3W5BA 1QJ4A 2O2YA 5HMMA 4QUJA 3WDMA 5CA1A 4TL7A 1L5SA 2BMWA 1XG5A 2W58A 2XDWA 1VL5A 3AHHA 3P2OA 1P6XA 3EWAA 4IF6A 2R25B 4NZPA 3U1BA 3P0EA 4KRXA 4RTKA 2QE7D 3PDIB 1GNRA 4BECA 3RBAA 1E18A 3PI6A 3DQQA 2H9AA 2ONKA 4WFJA 2HNKA 3B3AA 2YFYA 4CWAA 1R0KA 3P9NA 4LW8A 3W7BA 5ALHA 4HDKB 1QGDA 1A8QA 1G3UA 1T5BA 4EI2A 1I7PA 2V6MA 4RJ2A 3TKYA 2GF2A 2AC4A 4DA8A 5L4LA 3SXUB 1PYDA 1D04A 4G5HA 2B7BA 2B36A 1II8A 3EAGA 4O4JB 1HDGO 1SUSA 1Z26A 3ER6A 1OLUB 1YHYA 1KDYA 4NNJA 2ODEA 1OUMA 2YUTA 3S4YA 2PRYA 3VKVA 2NO5A 4AUKA 4EAAA 3NQ41 1NVTA 4U9IS 1LY1A 3A27A 3ZHBA 4IOLA 4B6RA 2ERCA 2VJAA 1J9EA 1ELOA 4U2DA 1ISPA 4Y30A 1HV8A 4BNTA 2UYCA 5IAGA 1S1CA 4F5DA 3QG1A 1LSOA 2QLNA 4HEJA 3UO8B 4CKCA 1JG7A 2YQZA 3L7CA 3HFJA 3EVAA 4JUDX 3TTUA 1E6WA 2VTKA 1GYPA 3OIYA 1GLVA 4N3AA 4OLJA 3RC9A 3TBFA 2MYPA 3B6IA 2RGNA 2G88A 4TRJA 1V39A 2GJ8A 2ZU0C 2ZRBA 4JAVC 5K3SA 2LD4A 1U2RA 4V38A 3S81A 1B74A 4RVUA 2FSGA 2PEYA 4P54A 1RRCA 2XCUA 3FZYA 5BNZA 4MWDA 3CCBA 1ZMRA 2C3PA 4IEFB 5K6AA 2B37A 4B8YA 1PEYA 2GEUA 4YMLA 1NVBA 3PICA 2ZS7A 2IPAB 5DBFA 5KYVA 1XEWY 5KYNA 4HDAA 1Q5PA 5C8VA 3GJ0A 4QUDA 4MVXA 1W6UA 5IYZF 3NS7A 3KBOA 3CSSA 3O4HA 3BRCA 1NOKA 4JJIA 1UDCA 4KUEA 4K40A 4H6PA 1ZPDA 1V11B 2RHHA 5HW0A 1J5PA 2UZ4A 3S6JA 3SBXA 3E7XA 4PW0A 4Q21A 6NULA 3MW8A 4XGQA 1L4UA 3RQIA 2WF5A 3ILSA 1YAJA 3G7UA 3H97A 4MOWA 3ICWA 3JQAD 3AFGA 3R5TA 1X7HA 2F64A 4N49A 5AM4A 3VV2A 1PR6A 2WNHA 1FFWA 4TKMA 2V9ZA 2ZSJA 3ELYA 1U8EA 3GNLA 1EZ1A 4OQLA 2CL5A 2RGUA 5FH9A 5EQJB 5LIPA 1BE6A 3G17A 3LP5A 4FLMA 3M9XA 1SBTA 3CU5A 3X1XA 3AT1A 1HDYA 1RYFA 4JA2A 5ECYA 1NUHA 1WUIS 1NBWB 3QNUA 1X0XA 3G59A 3C5HA 4DNQA 1GTSA 3FJ1A 1NVFA 3W5IA 1WJGA 4ZO6A 1V16A 5IJ0A 4YHHB 1WW8A 3C3YA 3T3EA 5B36A 2HRBA 4IVQA 1R3UA 5CFQA 4YECA 1HSZA 1JG4A 2HWWA 2GHRA 2IYZA 4FFDA 4FBGA 2C98A 4WESB 4BATA 4CM8A 2PYDA 3F3MA 2VP0A 3FUWA 4FYVA 1OF1A 3RKRA 1AK2A 3N70A 3BCHA 4I1PA 1GPAA 5JCOA 3BMQB 5GVSA 4W63A 2FW7A 1GZHB 2COEA 3P5SA 3HVKA 2R7KA 1ADFA 3GIDA 2IPXA 3T5DA 5I47A 3FFTA 2DFTA 2IIQA 1QH0A 2PY6A 2L18A 1Z56C 1QQBA 4JUCA 4DB4A 5KS2A 2VK4A 3TOZA 1A27A 1B6GA 2Z9CA 2Y67A 2UXCB 2M6SA 3DCYA 1UIRA 3IKTA 3BGDA 1DARA 4QU5A 3I04M 3KFVA 4DT1B 1U9IA 2W48A 4TSRA 4OJYA 4X94A 2PD3A 5IVIA 5GIOE 3ZC3A 3W8EA 1TMOA 4WHMA 2G0AA 2WAMA 1SQSA 2P3OA 2VTEA 1QP0A 1E9DA 5L9AA 3ZNQA 3GBVA 4EPYA 3URKA 2L82A 4QYTA 4HDSB 2GF9A 2IUEA 2AG8A 1VI2A 5CHYA 4CKYA 2DXIA 4X64B 4J0CA 5AK3A 4LQDA 1RAEA 5I8PA 1P3JA 1QNFA 1HUQA 3PT9A 5FULA 3F67A 2SKCA 2VAWA 1KKUA 3V4SA 1HPLA 1RLTA 3OCWA 1KKMA 4BV8A 5C1OA 1PT5A 1NQWA 2WTNA 3C6MA 4G1VA 3SDBA 1FQJA 3IPXA 5L3QA 2B1GA 4JDPA 4CT5A 4CGYA 4F5EA 2PRZA 4OF4A 3MWKA 2W0MA 4EPXA 2AZ4A 2X4LA 3P4UA 4PGFA 2J9ZB 2OFPA 3O83A 5TQJA 4QJ3A 3A25A 1DTWA 4ZDIA 3AU9A 4Z4FA 4EKYA 2VHXA 1E99A 3E9EA 4BO5A 3FNQA 1DBRA 1F8GA 2WAAA 1L4HA 5B7PA 3VPGA 3MTJA 4Q12A 3I4FA 3S3TA 1TUIA 3E9MA 1Z5GA 4BZXA 3BN3A 1XX6A 4B6FA 1UUFA 3ZH9B 3AJ9A 4E33A 4C4RA 4QEDA 5KJ6A 2XUAA 1N8KA 3R4CA 4RHTA 2F1KA 1KVRA 2HRDA 2P9GA 3INTA 4WJKB 1AGRA 2B1JA 3EXG1 1Q1EA 2F62A 1L5VA 2QM0A 2RKBA 5LMUB 4NH0A 3O9MA 5J5AA 2QB5A 4WL0A 4RSGA 5GTDA 1PG2A 1DZ3A 4N82A 4YUZA 3R5FA 4TTQA 3IIMA 3WQHA 2Z57A 3TGPA 3FOBA 3BUSA 5KNBH 2ZRFA 4URWR 1XA4A 2BFFA 1ISIA 1G2OA 1H65A 2GTHA 3DL0A 4JLUA 1YNOA 3A8TA 4HT3B 1TVCA 4ZRNA 1JFVA 3CB4A 1XK7A 3ODGA 3FOWA 4AS2A 1NKVA 3G23A 2O5RA 1P77A 1NI3A 1M6VA 2UYYA 3T15A 3V7WA 4LPSA 2VDPB 4IX1A 3BPSA 4EZBA 4KFRA 1BEEA 4TUYF 4NMMA 4PFSA 2JARA 3LKBA 2GRUA 1RP7A 4ZT7A 4ZC1A 3PUVA 5ARDA 4HNSA 2JB9A 5KQRA 1H9BA 2K4MA 4UNNA 3LBIA 4LMPA 4JP3A 4TT3D 2YZNA 3HPQA 1Y5IA 3OQBA 4HDNB 4MTCA 3CRMA 1T8SA 1BMFD 3SC2B 3ZIUA 2V3VA 2G7ZA 4PIPA 1OU0A 5BSRA 4BWVA 2QT9A 3WC4A 1UANA 4B3FX 4MA5A 1L1RA 2B9EA 1Y5NA 2QUJA 1E62A 2M2IA 1NP3A 4PX9A 4BZQA 4CF5A 1RRGA 1H0RA 3LU1A 4DNFA 3G2IA 1TD1A 4ITUA 4DEYA 4PNEA 2PZ8A 1HL7A 2ATVA 1EUCB 3FGPA 5KWSA 3P27A 2Q4RA 1MC1A 5LA6F 5JHHB 4NS4A 5G3YA 2NXCA 3A3NA 4HYEA 1XQ6A 4JQOA 1W25A 1HL3A 4U02A 5F33A 4RM2A 2ZR7A 3PC2A 1VG9B 4B6PA 1FVXA 1TA4A 5BMVB 3I1FA 3N7TA 3N76A 5DHAA 5TGZA 5IJZA 2KHZA 3AB7A 3H2BA 1ZHFA 2ZG6A 4CQMD 1E1MA 1T3HA 4ZVQA 1ZD8A 4HTFB 3SXJA 2Z08A 3QV2A 1SD2A 2B34A 3ICCA 3TBHA 4C88A 4B3RB 1Z06A 3OFVA 4N03A 3WQQA 4LJKA 3RTEA 3OF5A 1N3IA 1IN4A 1FDTA 1GPJA 3I30X 4Q9DA 4Z99A 3RBVA 4A6XA 4R71A 4HCJA 4ENVA 4DDWA 4O0MA 3OZRA 1XRQA 1UKBA 4POOA 5AUPB 1E79D 2EX0A 3O47A 2VH1A 3TAHA 4DQUA 1D6NA 1TO6A 2ZYTX 4UUNA 2QU8A 1OE0A 4HMOA 1JMKC 1PD1A 4QUGA 1B2RA 4ZOCA 1LQ2A 1TGVA 5I9LA 1QYVA 4RH3A 2FSHA 4P08A 2EFDB 4YP0A 1XCBA 3BM5A 2HQRA 3G88A 5M29A 1JQ5A 1FFXB 1RM5A 1XP5A 3N87A 2O0JA 2VF5X 4TMXA 3CEPB 3UUFA 1AGNA 3ZCXA 1Q7EA 1RWKA 4X1IA 1XQ9A 4JBGA 3SZOA 3MTEA 1R0SA 1O97D 1NW8A 3UBMA 3BSYA 1HFKA 3QUCA 4MUBA 4FB5A 3PRKE 3P9KA 4UOQA 1F7VA 2X0DA 4O4LA 4JC4A 4KO3S 1QR6A 5BR7A 2ZWPA 2QTGA 3USCS 3A4LA 5HF5A 3TZEA 3T7TA 3VQTA 1IDN1 1MDBA 2ECPA 3CN7A 3UV3A 2VIIA 1TRHA 3ACBA 5EJAA 4LFBB 1FSPA 3OIUA 5GY7A 3H4VA 3ZLBA 2W42A 5A1JA 4V39A 2F55A 2OZVA 3ZZUA 1E3MA 2CVOA 3MMXA 4RYLA 3QP9A 1ZVKA 3HR7A 3S1SA 2O57A 1G8YA 3EZXA 3Q7SA 2GDJA 2ZIUB 4EHHA 1JHYA 3DBHB 1LI4A 3U4MA 2C2GA 3HB0A 4UEOA 5HWSA 2B1QA 3FKJA 5EEHA 1PJBA 4LZNA 4TTSA 1WDWB 1YKGA 3O91A 3F5DA 4KRYA 3ZVRA 4C0AC 2BFPA 4E3ZA 1K63A 2WIFA 4INAA 4DRXB 1UDWA 1X19A 1RIFA 2ODWA 4GKBA 4PZ0A 4TLCA 2XW6A 4N18A 2GSDA 3W5UA 2WSYB 4MLDA 2WJYA 1XR3A 2SKDA 3E5RA 2HJ9A 1KO5A 4HAYA 1RYBA 2O23A 4HXGA 2ATEA 4LXIA 4WCDA 4DR2B 1MJNA 4KUGA 4N54A 2H9IA 1SG6A 2AUNA 2QN2A 4G2TA 5PGMA 4ARBA 4E2ZA 5F9MA 5EIHA 4C4YA 2F1JA 4LHYA 2XMRA 2DWOA 3G13A 2RH4A 3QVMA 5CT6A 3RTAA 2V5UA 4COKA 5K03A 1Z5OA 4H7JA 4CIVA 4C0QC 4OM8A 1H1LA 2ECQA 3GNQA 4QO8A 2VCHA 1Q21A 2ZJ1A 2FR1A 4K9SA 5EG5A 4F45A 1WZCA 2WM8A 3UJDA 4MDHA 3OX1A 1WXHA 5FR2A 2O1SA 3VPHA 3TZBA 5DDIP 2G71A 4XOUA 1L8QA 4P7JA 3R5JA 4E70A 3WLKX 4DY4A 4GX1A 1PWXA 4BEJA 3FYDA 4CRWB 2Q3CA 3K5PA 3QBJA 2G77B 4YV7A 2SKEA 1W1UA 2G0NA 4JH0A 4LIPD 1ZH4A 3OI7A 1IM5A 4UCQA 4EOGA 4WNCA 4XWWA 4ZXFA 2NTYC 3NPAA 4YGYA 4AXXA 1Q11A 4GMGA 4L4YA 1Q7CA 5GAJA 3F8TA 4LK2A 4DUPA 1AQYA 2NUPB 3ZCVA 3IE2A 4LFCB 2OP0A 4WY2A 4GECA 4EKDA 3HYRA 1T8YA 1Z2DA 5IJ9A 3WDKA 1QRAA 2W37A 2VDWA 3CLTD 4RF4A 2C92A 3QU4A 5DU2A 1E2GA 2B5OA 1SG0A 3V4OA 1TEVA 4IHJF 4IXDA 1FC0A 2QBYB 4LWQA 1K98A 3LCJA 4CPDA 4DR7B 4LZLA 1F7UA 3SBOA 4AN1A 3E18A 4P31A 1H5QA 2ZCUA 1PWYE 1NYRA 3R3VA 3V3KA 4MS1A 4MSUA 5CUQA 3EB9A 2I6FA 4MUXA 1Z8DA 3LUHA 2HA3A 3WMFA 5JR3A 3EPLA 2AFHE 4R1NA 4FHEA 5AVOA 2JGAA 4IZOA 2Z9BA 1HH4A 2DGDA 3D4NA 2F1RA 2QL9A 3EDYA 1WCWA 3HDHA 1NP6A 3O75A 5AICA 4QYWA 3RD5A 4N48A 2Q0SA 1NXXA 3WGMA 2FZCA 3AUKA 5F98A 1PFWA 2MJLA 4M49A 3GRAA 4EJSC 3N59A 3IQIX 2ZIXA 4YONB 3F5MA 1NN1A 4BMOB 3ABZA 5SYNA 4Y2RA 2Q1SA 1OKKA 2A59A 3FVWA 3NDJA 1Q3HA 3S2YA 1FBNA 3N2IA 3WJ2A 5K0SA 1R0ZA 2OBYA 3EBOA 2ODBA 1NJ8A 2OTCA 1PWEA 3VH4A 3WMRA 3CN9A 3U61B 3RJ5A 3ZJYA 4HH3C 3SDSA 4AJ9A 4BRSA 3H9GA 4XI9A 5DTQA 3VO9A 4YAGA 2CNLA 1Q84A 1Y7HA 2PZFA 3MGAA 3GQBB 4R1PA 5GZ6A 5LD2C 4KFCA 5ILGA 2WMYA 3FNFA 1ADCA 2FGKA 3JR7A 3OG9A 2NO0A 4R54A 4Y67A 4ZQBA