2VVTA

Glutamate racemase (muri) from e. faecalis in complex with a 9-benzyl purine inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
274
structure length
269
Chain Sequence
VPRGSHMSNQEAIGLIDSGVGGLTVLKEALKQLPNERLIYLGDTARCPYGPRPAEQVVQFTWEMADFLLKKRIKMLVIACNTATAVALEEIKAALPIPVVGVILPGARAAVKVTKNNKIGVIGTLGTIKSASYEIAIKSKAPAIEVTSLACPKFVPIVESNQYRSSVAKKIVAETLQALQLKGLDTLILGCTHYPLLRPVIQNVMGSHVTLIDSGAETVGEVSMLLDYFDIAHTPPHEFYTTGSAKMFEEIASSWLGIENLKAQQIHLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GLUTAMATE RACEMASE
publication title Exploring 9-Benzyl Purines as Inhibitors of Glutamate Racemase (Muri) in Gram-Positive Bacteria.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 99
structure length 269
sequence length 274
chains with identical sequence B
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vvtA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vvtA01
3OUTA 2JFYA 3ISVA 5ELLA 1B73A 1JFLA 2DGDA 2OHGA 5EVCA 2JFQA 1B74A 1IU9A 2W4IA 3S7ZA 2JFXA 5HQTA 3UHOA 2JFNA 2JFWA 5IJWA 5HRCA 3OJCA 3UHPA 1ZUWA 5HJ7A 5HRAA 2JFZA 2DX7A 2VVTA 5ELMA 2JFVA 3ISTA 3HFRA 2GZMA 4B1FA 2OHVA 3UHFA 2EQ5A 2JFOA 3S81A 2ZSKA 2DWUA 2JFUA 2JFPA 2OHOA
chains in the Genus database with same CATH superfamily
5T67A 2DAPA 3ZW7A 4CQNA 3CH6A 3THRA 3CURA 3GUYA 3UMFA 3RSOA 4B44A 2OWDA 5FPTA 2Q3CA 5KU1A 2JHCA 4JI8B 1H2AS 3ZE1B 2RBKA 1CNFA 3L6OO 1PZGA 1DC8A 3EARA 2XSZD 4O02B 3ONFA 1ACMA 4KIWA 1ORVA 2OXTA 4ZYXA 4LZPA 1TMYA 3CLKA 1XD2A 2XDYA 2FZ5A 5JFOA 2PPLA 2YXEA 2BZ0A 1HFJA 1QKIA 2NIPA 1L5GB 1MOQA 3ILVA 4RLQA 4J0FA 5DHQA 5E6SA 1M66A 5C2JB 5LWHA 4IRXA 4OXYA 1TGVA 2QX9A 2CXNA 2JGAA 2ZYSA 2B25A 5F21A 2VQ6A 4OXNA 4XR4A 4O2RA 3EG9B 4EL5A 3JQEA 1BH6A 5HFJA 2JJYA 1FNMA 4JYPA 4XEHA 2HPAA 4XQEA 1VBKA 3SE7A 4BNJA 2LDXA 4V2UA 4MUXA 2X77A 4FXOA 4JFAA 1S4MA 5H3LA 4TMFA 2X3YA 3Q7PA 4K88A 1L4LA 1UJMA 2VP2A 3GHYA 3PF9A 3RS4A 4H1WA 4OHYA 4PAQA 1ND5A 1RLOA 2EDCA 4PSUA 4NV3A 2O8EA 3A36A 3L0SA 2DWOA 2QAGC 4S1NA 1XTBA 3RE1A 4QOSA 4G25A 4MP6A 4H7JA 1ZVJA 2VLIA 2QW0X 1RNLA 3G0CA 5EWLB 1C80A 1VL2A 3S29A 3PJRA 3ML1A 4AM8A 3ZHBA 4NMHA 5JNLA 3G13A 3C7KA 4EUEA 1YZHA 5FT9A 4I5DA 2RKBA 3QHAA 4JJ4A 4OJTA 4BFCA 4NCHA 1YI1A 2QT1A 5DBEX 5DM4A 3TGWA 2UYOA 3UEOA 1OREA 3I2GA 2FYTA 3GLFA 1F14A 1IEVA 3SE0A 1NASA 4AF8A 5KQRA 4NDNE 3P2EA 4ND8A 1N9GB 2JGFA 1PR2A 2CY0A 3R3VA 4OB6A 4QARA 4X7BA 5FV7A 3EGVA 5ALPA 4AZVA 3ROXA 2QTFA 5I7UA 3NJRA 3X1JA 2H5IA 3AYXB 4RGVA 5K1ZA 4KXWA 2ZTLA 4GOLD 4DR4B 1WL8A 2YRFA 4X24A 3TIVA 3L6UA 2GHIA 2D59A 4QBGB 3KQLA 3RF7A 4KHPB 1X14A 4L8WB 2IDKA 2A7QA 1M1YE 3KLMX 4ND2A 4IHQA 1D6NA 1F9AA 4FWBA 5DHFA 1EFPB 2IOFA 1XAGA 1ZS9A 3P9XA 4FONA 1ZNZA 4IG4A 5JZ9A 4EJ2A 2ZJZA 1FMFA 1X87A 3EWAA 4DLYA 5FD8A 4HNAB 3V4ZA 4QUAA 5DYTA 4DIEA 4FYPA 4Q39A 2CBZA 4L5BA 4WADA 3FUVA 3SF0A 3K30A 4ZAWA 3L0PA 4MUYA 1QMPA 5CIQA 5JH7A 3SF8B 2OV4A 1CR2A 4IXMA 2X0EA 1HE5A 2BKXA 2BSQA 1HL3A 3PBKA 1PJRA 2Z3VA 5DK4A 3BZBA 2OESA 2E37A 1O6BA 3ETGA 3KQVA 1IN8A 4M8KA 1DBSA 4KQ6A 3SF8A 3UB2A 5CW2A 5HQ3A 1OLOA 5JXHA 3Q8LA 2LUOA 3ITNA 1EUQA 2W11A 3MAAC 4DY6A 2DR0A 4MRVA 4HG2A 3WTCA 1KBOA 4R71A 1UWVA 2WUVA 3B13B 3QWAA 3L7CA 4QQNA 3IEKA 4JL8A 4Y6OA 1ZP6A 3UGJA 2UXBB 3COWA 1MNAA 1R12A 2WKWA 5FUBA 2VA9A 3KUCA 2CVQA 3IXMA 1FTYA 1RLMA 1HT1E 1U4OA 2XJ9A 3FFBA 3H5TA 4GC5A 2VNIA 2FFBA 3ISTA 1UBEA 3ZDXB 4OSOA 4F4HA 5G0WA 3VO1A 2KYRA 4HDNB 1SC1A 4WGFA 4P5PA 5AKHA 3SX0A 4EG3A 4TT3D 1XTVA 1NXXA 2WT4A 1P2UA 3GQBA 3ZK9A 3IERA 5JAMA 3P71T 4RVUA 5BW5A 5EHIA 2D8AA 3FM9A 3EXG1 1JHAA 4LHZA 1ZM7A 4P8RA 4QEZA 4TYQA 4R2MA 4C43A 4G1EB 3W3AD 4HQKA 3OC0A 1E1CB 1AJEA 3NFYA 3FCEA 5FUVA 4X84A 4EG0A 2YJ3A 5DWDA 1JLHA 3DFIA 5HM8A 2HXGA 3QY0A 5TQVA 1ZH6A 4BO5A 4IEIA 1GFSA 2FZKA 4OQMA 1V7ZA 1KFJB 1YRWA 3RTEA 4HDSB 3F6SA 1ORRA 3PHJA 3GJ4A 2ROQA 2DTEA 4J1NA 3VGJA 5F5XA 2XQJA 4P58A 1H8EA 4JBYA 4KITB 4KRXA 4YR7A 3T7KA 2Q8QA 2GPJA 4O25A 4UHFA 4ABYA 1FTNA 1H2BA 1UPUA 2Y1DA 1E9CA 1T5LA 4EF4A 1HMYA 5FOQA 4HAVA 1TZMA 1E98A 1L4YA 1ANKA 1NKTA 3GRCA 3RCBA 5K6AA 3EBPA 5LZ9A 1OB5A 2BGWA 4E7PA 1PD0A 3HJCA 1SXGA 3L0IB 3TKYA 2DP4E 3MMPA 1D6MA 4BFZA 3DR3A 3WY9A 3C6XA 2AOTA 1ZRHA 4LKOA 4KXQA 4WEQA 3T1YB 3VNVA 3QFCA 1O54A 4QD3A 1Y89A 1BOFA 1E7YA 2FVYA 3PR3A 4GPBA 3UJPA 3ZS8A 5M04A 1WD7A 2C31A 2CVZA 5LMZA 1U8FO 2I1QA 1Q19A 1UPTA 4MZXA 5CFNA 2FEXA 3NNNA 4LC9A 1RLTA 2ZWMA 1CUJA 1ZGAA 3F8SA 2ZROA 4UDOA 1JIKA 2W2OA 3M3DA 3IT3A 3RTCA 4C7XA 2AE2A 3AOEA 5E7JA 4E4TA 1A9YA 5F78A 4O63O 1V1MA 2QD2A 3JQ7B 1N7JA 4M0EA 1SMKA 4QNRA 5CVEA 2DPHA 4BVBA 2FUG6 1AGRA 2IVZA 2W6NA 3AFNA 3H1EA 3NBMA 5IM5A 1D8TA 3HXKA 4CT5A 4RM2A 4AECA 3K5HA 2W22A 2ENWA 3TW8B 3JZAA 3PCRB 3NW9A 2BFFB 5BN3B 4CKZA 5BN5B 1XTPA 3REQB 3EFEA 3C7AA 2DG2A 3EB9A 3SNKA 5CNIA 3FR7A 1GZ6A 4EGAA 3UV6A 4GPTA 1XQ6A 3IBGA 3T7JA 4NIMA 1JHQA 2OCIA 1SN7A 4Q9KA 1OXMA 3JQ6A 1N5RA 5BWLA 3VI4B 3DHVA 2G28A 4EA6A 2R7AA 4NMLA 4GDFA 1RHKA 5EGNA 1FNDA 1AUOA 2PZKA 1VE9A 4BMNA 5ES3A 2GJ9A 3H2HA 5FEMA 4WZAB 2WWIA 4MVCA 4OKSA 1QHFA 1ZA1A 2YVQA 5K99A 3LXRA 2GAFA 1ZRSA 5DTIA 2XDWA 4HLCA 4DVGA 2YV4A 2GETA 1N3BA 2IODA 3EPPA 5L4LA 3C48A 1C0KA 1OJ7A 2VHCA 3SC3A 3IOYA 3SR4A 3VRHA 2A9OA 1U3WA 3BDIA 3G8YA 4FOOA 4TSRA 3PXGA 1CJVC 3TQOA 4E09A 4ECAA 1RC1A 3CPSA 2X5XA 2B7BA 3ETDA 1QKKA 4R9NA 3RAJA 3OZDA 3F1LA 4AIIA 1L0BA 3RM3A 3TWOA 4ZVSA 4NONA 1MHTA 2RI0A 1B2LA 3I1IA 1UT8A 1GTRA 3MOGA 3QFFA 2YWRA 3I9V6 2QZSA 3EEFA 1BXGB 1FL9A 1OF1A 4CETA 1AC5A 2NTJA 3B1YA 2O8FB 4KN5A 4V0OA 2PH5A 2ZYWX 4M0CA 4XWAA 1JPJA 5K6AC 2BM1A 4D74A 3RNOA 3EEQA 3AVUA 3TS1A 3TTSA 2HIGA 3V97A 3ZZTA 4Z51A 3KQSA 3WLMA 1EM8B 3MTBA 3T15A 3M89A 4DV6B 2ZBUA 4Q3LA 4ITVA 2HDNB 3F46A 1BXGA 1ZGHA 2VF8A 3HA2A 1IQ0A 3BGDA 3HKBA 3N7UA 2HU5A 1USKA 2ID9A 3U37A 4HPXB 3DMDA 4LNUB 4D8WA 4DSAA 1AGPA 1SBZA 2YZGA 3L4SO 5EESA 2QF7A 4EKGA 1E5TA 5JRZA 3OU7A 4D4GA 1FFDA 2QTAA 4LJRA 4BPBA 1VI6A 4LS3A 1IEXA 1UDWA 1M7HA 1ZM2A 2NADA 2PZMA 3HJRA 3RS8A 1MPXA 2O20A 4HUJA 1N77A 4IX1A 3AOEC 4WZBA 2FWRA 4LNHA 1Q11A 1DRJA 2ALJA 3B1XA 4P4GA 2GCGA 3T3PB 2HW8A 4I2VA 4Z1MD 1F4PA 4KRYA 3E3AA 4H1TA 3PNMA 2CCJA 3ABIA 1NVAA 1O2DA 1KQ3A 3DVAA 2VNKA 4ZT4A 2Q2VA 3M1IA 1OTYA 4I1YA 2VAMA 5L9AA 4UM9B 2V7QD 1KYZA 4YBRA 1MOPA 1NLYA 1XKXA 2OPHA 2A6PA 4C7OB 2G71A 2QKYA 2VDKB 3NUZA 4P0TA 1TADA 3R7NA 4D6XA 4CEJA 1U8TA 4LXUA 4TTIA 2B36A 1E1YA 3LUBA 3ZKWB 1E4VA 3ZWWA 4EHHA 3LY9A 4GBGA 4TV8B 2YVKA 4CM1A 4TWIA 3JAKB 1EXWA 3TFWA 4TUYF 4BY9E 1V9SA 3CF4A 4AIRA 5I3ZA 2IZ6A 4KGXA 3R3XA 4JLUA 2FPRA 1XEXA 1QPZA 4DYVA 1X13A 1O77A 5CLJA 3CNOA 2GHRA 1XVVA 4KSBA 4L9AA 4N5DA 2ASEA 1FNBA 1WCWA 1Z4PX 3QELA 4H0NA 5BV1A 3EUAA 2GBCA 3UNXA 3VH1A 4KQMA 5D1HA 1JKMA 3RJ9A 4DUGD 3MCAA 4EVIA 2GBPA 2QZJA 3ZZ1A 5K20A 2R62A 1FK8A 5IRCD 1R5JA 5FL7D 1L5FA 1Y7IA 3DBHA 4GL4A 3CZAA 1T0IA 2QTVB 4F3NA 4I9UA 3FFXA 3KKMA 4GT1A 2ZYAA 4P4UA 4W82A 1H0RA 3U13A 3WGKA 1N6PA 1G59A 1UBUS 5KYWA 2XB2A 4LJAA 3NPAA 2ORIA 3RHSA 3TLXA 1YNSA 2G5GX 1AF4A 1I9GA 1ZDMA 4LYDA 5CH3A 1MQ8B 1S8FA 4JWKA 3JALA 5HUJA 3A6KA 2WUEA 3CN7A 1CX9B 3VDRA 2PFSA 3FNQA 1R1DA 4LOIA 1NJ1A 1SOAA 2DGDA 3E22B 4BVHA 2FDRA 1GG8A 4OYYA 4QDTA 3EVBA 2Z09A 3ZR4B 1YTUA 4RKWA 2I4IA 1L4NA 3WNQA 4LTDA 3KKZA 4Q48A 1TO2E 2P4UA 3H7IA 1OI7A 1EEHA 2RFLA 3AHCA 5LKRA 4NULA 5EMLA 2CJXA 2J6HA 3PFKA 4PG4A 2EWWA 1ZMBA 2FQQA 2J4CA 3P9PA 3ZEAA 1D2AA 1RKUA 2WF5A 3DBIA 4PYLA 3ZWCA 2OENG 4DFDA 2OC9A 4FDMA 5HHTA 1XKLA 3GEDA 3O6VA 1J24A 1X8LA 2R7NA 1ZK4A 3ICEA 5EQTA 5CDFA 2I4OA 3EZ7A 2BGKA 2V7VA 3MGGA 4U2CA 2VRWA 3ANMA 3SHTA 1J6UA 2P3SA 1NIPA 4E2FA 4F46A 4YCMA 3D4NA 4R1OA 4EJMA 2WUWE 2AI3A 5JS2A 3NM4A 3A1TA 2XT9A 3DE0X 4DB4A 3QPBA 1N0IA 4BAZA 4LBZA 1JQBA 4WZZA 2V7BA 4CV3A 5JT1A 5AXDA 3R4VA 4YQZA 5ALTA 5F4BA 3VR3D 4ZALA 4DLTA 3A4VA 1NR5A 4G1CA 4N40A 4UOQA 2BMVA 1II0A 2JANA 3FD8A 1QQ7A 1T4MA 3CRW1 3R3HA 2J33A 3LQ4A 4JLWA 3RFXA 3AHIA 2C9DA 1V5EA 2C59A 4H7DA 5DX8A 2ATEA 2XQKA 1M6WA 3BJIC 1BDBA 1RIFA 1TEXA 1UCFA 1D6JA 1XALA 2QD5A 3O4JA 4YAWA 4YFVA 5DMHA 5GINE 4AI6A 3ADDA 4NG5A 1FNSA 5LA6B 4OH1A 1UBHS 2PLFA 1HQYE 1CYDA 4RMJA 5FI3A 1NN5A 3F3MA 1GCIA 1WUYA 1J97A 3NONA 2RGNA 1JFVA 3SJ7A 2R4UA 3MF4A 5T4BA 2IX3A 1GSAA 3CCCA 3ECCA 2ADFA 4MJXA 1GA4A 1I9CA 1MH9A 3WDSA 1Q15A 3LF1A 3IR7A 4RXTA 4CR8A 5IAOA 3RRFA 4OVKA 4EYSA 3I76A 1GZUA 2Q5QA 1HE1C 4PYRA 3ABOB 5EG5A 5FI5A 3THSA 4N18A 1XNRB 2E5WA 4QLAA 3K71B 5HIJA 2ZVDA 2EF0A 3FWYA 3KXPA 1PQ4A 4TM8A 2B4YA 2I3BA 4AJ1A 3SC2B 3R1IA 4M9RA 2ATCA 2OE2A 3UV3A 1U9ZA 4YQYA 1UXGA 1WW2A 4EKEA 1LNZA 2EEZA 2PO5A 4IINA 3UT5A 3D8HA 3AESB 2QB5A 1RM4A 3OOYA 4S1WA 1GPAA 3JSAA 2H0RA 5LQAA 4EW3A 1XZEA 4IV8A 4JLAA 5IDYA 4BAUA 2ZI9A 3AHFA 3RV4A 1OFIA 1TX4B 3N2KB 4CLDA 1BN7A 1EGHA 3EC1A 3FWHA 3KOMA 4GZ5A 4OUKX 4UARA 3TB4A 2YICA 3EDOA 4ZODA 3LWBA 1NRIA 3IBSA 2JFFA 3LO8A 2OP0A 2IU3A 2I03A 2YW2A 3R3YA 4IDHA 4AUEA 1RYBA 3KKEA 5J1SB 1GPNA 1VFPA 4TQAA 3PHBE 4RDXA 5F2NA 5AM0A 1CJMA 3DDNA 2VAWA 1D2HA 2OQIA 2CMKA 3IAHA 3PB3A 3K2QA 2PU5A 3QLUA 2J3HA 4NQZA 1R6TA 4C22A 3TH5A 4NESA 4MPJA 3CVYA 3B8EA 2ID7A 2I9PA 3SJAA 3L8MA 3EAFA 4TT3A 1A7AA 4FGWA 4M2LA 3QMWA 4YI3A 4O4IB 4E4RA 4Q4CA 1CP3A 1GR1A 3FGNA 4JLJA 1LLFA 1UKAA 2CDCA 4RZ3A 2HEGA 1L8QA 3E9RA 2EJBA 1MG0A 4KDFA 5BXYA 3D9QX 4ZCTA 2ZDHA 1SOUA 4NATA 1UKEA 1U7ZA 1PL7A 3O1LA 3R44A 1JR2A 2WZBA 4LMBA 2BEWA 3ICCA 5LB2A 5K8UA 3KWMA 5IF3A 4WK4B 1HXHA 1RYMA 5KJFA 3OOWA 2BDUA 1QIKA 2VZ8A 4HQOA 1D07A 4MKZA 1TPZA 4QOHA 3V7FA 5IZCA 3GBPA 1ZJ5A 4W1RA 5C7YA 4NAHA 3C7TA 5BWOA 2BFPA 1ZCAA 3PXDA 2Q3EA 3CFYA 4WDRA 2JEZA 3IB3A 1JILA 1M2OA 3NDRA 4EI9A 2RGNC 5B53A 3TVTA 1SKYB 2Q6IA 3LT0A 3OIWA 8OHMA 1L6IA 3UKJA 3ANSA 3HMQA 3G2HA 3SJCA 3AJ8A 3HGQA 2BFOA 4PTZA 1YKFA 1WXHA 1T0JB 1XDBA 4KWIA 4NBTA 2WWYA 1YQXA 1L7PA 2FP4A 4G9EA 1C7RA 2QY9A 4ZVPA 4QYIB 5KQMA 1QIGA 4XZ3A 3F6BX 2Q9AA 1U7HA 3HWWA 1QUFA 2HK7A 1VIVA 2P40A 2W37A 2XUFA 2NUPB 3OKAA 3TE7A 2ODWA 2ZZMA 3NANA 4FT4A 1EE9A 4RS3A 1AK9A 3GO4A 3W6PA 2WJ4A 3UICA 4MQ6A 3OZCA 3CF6R 3WK9A 5HUQA 1L2TA 4CIBA 2UYHA 3LYLA 1GGHA 2FZLA 3TZHA 3A26A 1VHTA 3PEWA 1YZNA 3NBZC 1IAQA 4PSKA 3ZU3A 3OY7A 1QO7A 1QU3A 3GZNA 5CIWA 5FYQA 4DJJA 5ALMA 1NYRA 5DASA 5EWJB 5CYPA 4QGBA 1CIPA 3EXEB 4PZLA 5IANA 3O1HB 4PX3A 4ACAA 1DGQA 4L1KA 4P7KA 4X64B 1T9ZA 4RESA 1NU6A 3CF2A 1A97A 2I2DA 3EGOA 1BA3A 1KZGB 1OSNA 4KXUA 1MQSA 3R3SA 1BDMA 3U4MA 1ZEJA 3HADA 3RKSA 3QLUC 2C7OA 1BEEA 4KR7A 3QA9A 1KXZA 2E4WA 3WL4A 4BQFA 5HA5A 4O08A 2HV9A 5ILGA 1K8QA 2Z2IA 2HGSA 1KH1A 1RBQA 4NFLA 4Q4JA 1G98A 1R10A 4CDNA 2O4CA 5AHKA 2X5OA 4K6GA 3ZWQA 5CFOA 3UK7A 3LCCA 3GJ8A 5JYDA 5KWJA 2J41A 1ZMOA 3WLHA 2HPVA 3AIKA 4H3HB 4C30A 4D80A 3EFOB 1ZINA 3ILXA 2R65A 5EUQB 4KN6A 4HEA6 4XM0A 4RDCA 2FPWA 1BCSB 3AL3A 2G6BA 3HJNA 4U7JA 2JCVA 4M1TA 4IIDA 3NIGB 4II2A 4ZO4A 1USWA 3OE1A 1UJCA 2H8GA 3LUKA 3PR2B 3RB8A 2BYTA 4B79A 2IOHA 2X7JA 1SUFA 2V96A 3K6KA 3OP1A 5BQ5A 4Q9DA 5GZ3A 4INAA 2B1QA 3NM6B 1K88A 2ZBRA 2J5BA 2YASA 3A9VA 3BD9A 4JLNA 2IHNA 3VPCA 3WK5A 1KMHB 4TLAA 5BUSA 4QBTA 3BMCB 3NTRA 4J76A 3RD5A 2EQBA 2AMYA 1LDBA 3FYSA 3D3NA 1X80B 2Z57A 1XB2A 3G8DA 4G9BA 1MV8A 4M8IA 1S01A 4HNRA 1BVHA 2ZCVA 5AVXA 2O8VA 4YDRA 2H06A 2JJ1D 2AZ4A 4XVHA 1D7OA 1QF9A 3GUZA 4WJKB 4UMVA 3TR0A 4G86A 2YHAA 1G20A 1Y8QA 1JIXA 4DLBA 2VP6A 1E6WA 3LW7A 2JI4A 1R4MA 4JLOA 4BBJA 3SEQA 1I80A 3TR5A 1GZ4A 3T9CA 4DV0B 2A0XA 3BQ9A 5C8XA 3SY8A 3RAEC 1NI3A 1U0HC 2XIJA 5JQGF 3LKDA 3TPCA 2HWKA 4D57A 1X8JA 3GG2A 1COWD 1L7EA 5A62A 5I48A 5KC9A 3O94A 1CEXA 4LI0A 3OZRA 4RV5A 2JVJA 3HDVA 3EHEA 4FFBB 1X42A 3B3GA 2HA7A 2XMPA 1Z39A 1Z8DA 3N6VA 4RABA 5EFZA 3U4DA 1EPUA 3JZFA 4RJJA 4V1CA 2A84A 1QFXA 3DONA 2V54A 3D4LA 3DQPA 2ZJBA 5CYOA 3WL7A 4B76A 5J5CA 2DH5A 2N47A 3WGNA 2ZSEA 4HLUA 3W1VA 1R0XA 3RVQA 2QN2A 2HBQA 1FFXB 2V7QA 4PFQA 4MICA 3AILA 5JFGA 2LPMA 4IG9A 2IS6A 2PS0A 2CGEA 4PLGA 5I7RA 1YK0A 1FSZA 1LUAA 4DLLA 1U9JA 3ROPA 4YXFA 3L8GA 3DH0A 5ELXA 2OGSA 3DE2X 4ZJZA 1VLVA 1D09A 5BVHA 3CUVA 1GUFA 1UWKA 1D04A 2G17A 4E5PA 1XAHA 1G8HA 3N2ZB 3BSYA 2SNIE 2PGLA 3HCDA 3HPRA 1L7NA 4NYIQ 4BX9A 3KPJA 1EDDA 3FZNA 2GQ0A 2WIDA 4YK7A 3EA5A 2XMSA 3L46A 1NRXA 1HYBA 3N0VA 2BKUA 3KDSE 2R1VA 4H35A 4HWGA 5EPOA 2ZIAA 3G8CA 2I4RA 3RC7A 4DUGA 3G0HA 3I6QA 2CNWD 3PQ5A 2O0MA 4XYBA 5JPIA 5JG7A 5FL7A 4ZQIA 4EG8A 3FZEA 4Z6KA 4ZV4A 4X62B 1O58A 1UZLA 4K28A 2G5PA 3F5SA 4JQSA 4PGAA 4RVHA 3V4OA 5JLAA 4YQFA 2BGUA 1GNTA 2FMHA 4C14A 1K27A 1F3LA 2UZ4A 3NEJA 2ZWVA 1ZYUA 3UTCA 3VJMA 1BVUA 3RUEA 5H3CA 1E2BA 4MDYA 5M7EA 1UKVY 1UXHA 5D3ZA 1TM5E 4EJSA 1JDTA 1OXKB 4BP1A 3H2BA 1O8CA 1PL8A 4IQ8A 5B37A 4L5IA 3TAHA 2O0KA 2V5VA 4BZPA 1YIDA 1WNFA 1CERA 2LIVA 4C4OA 1CETA 3IP8A 4TQ9A 4B6PA 5KTRA 2FPSA 4LYGA 3SZRA 4DR7B 1YV9A 3LQ2A 3EN0A 2GZHA 1TUGA 5FUMA 2ISQA 1KEEA 2QWXA 2ZBDA 3T3MB 1N25A 4HNUA 2CFOA 4PAWA 2I8CA 1WUJS 3DEFA 1JEQA 2I4TA 1DJNA 1DADA 1KERA 3OZ7A 3R4CA 4NICA 3CIFA 3W06A 2PUHA 3G8BA 4P83A 2BMEA 2O6HA 5B3LA 2PD3A 4NYMR 3P27A 3PRJA 4XX0B 2KW5A 1UC8A 4PAOA 3LLUA 1HKHA 2P2DA 5AW1A 3R74A 1CRWG 3LC0A 3PQ6A 4TWZA 3VV2A 5B5SA 3T9AA 4C7VA 3G2PA 5B2EA 4G09A 3RKRA 2Y1XA 4HVAA 1PVOA 1IBCA 1U5BA 2H2FA 3NBUA 2R47A 2FDCA 4TYWA 3OT1A 2XA9A 1ZESA 3UMBA 4ARIA 2X5JO 3CEPB 1QC5A 4ZAVA 1N7HA 3BXFA 3CUWA 2I2CA 5H68A 1ADYA 1ACLA 1XCLA 3K2IA 3UM9A 4Y6LA 1AA9A 3H6HA 3OM0A 4I08A 2ZM5A 3F9CA 1DTSA 1FFSA 1PWXA 2YFKA 3BQMB 3IP5A 4M49A 2BTQA 1W29A 1I4DD 1U0OC 3CTMA 4K9PA 4MQEB 4DV2B 3GAZA 1LI4A 2XCUA 1QLHA 1RXYA 1WVGA 4OGGA 2H4ZA 1PGJA 4N5IX 5DW3A 5KVSA 3H3JA 2BIFA 3HYNA 3KJZA 4L6AA 3KZMA 4EMSA 1BRMA 2AJCA 2PR2A 1N5KA 3Q41A 2R8OA 1Z0SA 2RBGA 2IDZA 4OREX 2QSZA 5EJ4A 4A92A 1FMTA 1IHUA 2ATIA 1VHQA 1LDMA 2H92A 2JLQA 2W6MA 2XNHA 3HB0A 4WCVA 5IAGA 1L4KA 5KKAA 4D8TA 5SY6A 1BXKA 1AV6A 2BOVA 4GYJA 2D5LA 3HVHA 2G82A 2IUFA 1CB0A 3IPYA 4DLZA 4WECA 1C9EA 2YFHA 3RC2A 2CDBA 1K06A 3L0BA 1Z8FA 4RS4A 1H0HA 1Q6ZA 3VR6H 3O91A 1YBMA 3TECE 4DT1A 4BXOB 2XCQA 1GWNA 1REQB 3KFXA 1CG6A 4EJSC 4OLHA 4AFNA 1U7PA 5A9TA 1IDOA 3Q2KA 1E2QA 1JFFB 3D1LA 1ZNYA 2J3QA 2Z30A 3BXEA 1YIAA 4JL5A 2KS6A 3PV0A 1D1SA 4OFBA 1L8OA 1MVNA 3H11B 4EY5A 3DGEC 2V74B 4I1VA 2EQ5A 4KUGA 3UPDA 4UDYX 3DMFA 5JQGA 3T7IA 1SKQA 2QUBA 2AOUB 2WUGA 4PR3A 4WXRA 3W0LB 2O19A 3CRVA 4LYAA 4NZNA 4MMYB 1MHPA 3FE2A 4IQGA 2ZSAA 2WBLC 4FCVA 5B6JA 4FFMA 4U0KA 2HHLA 3E6AA 4CKYA 1A2QA 2PY6A 3GLIA 3B78A 9MHTA 3TSAA 1IK4A 1O57A 4MP3A 3IP3A 2IZ7A 3ESAA 3TVYA 3CMMA 4E5DA 3R5XA 1YQWA 5AXBA 1RTTA 4JLSA 1ULTA 5D3MB 1PSZA 2R4QA 3VR4H 1QTRA 1B0PA 3U3ZA 3WOVA 5H59A 4EAAA 1WO8A 3W4IA 1GQRA 4QDOA 4FZRA 1KTIA 4DV7B 3L84A 3UMJA 4LWQA 4OUDA 2XUIA 2B0CA 3SKVA 2NUAA 3I34X 5HPYB 2J4FA 4CL3A 4QJBA 1U8EA 3P5BA 1JG4A 3L4BA 4EB6A 1KDZA 4R5MA 3K5WA 5DM70 1E0AA 3I0ZA 4Y2VA 3MHTA 1DTWB 1FUEA 1PO7A 2JK1A 2QX8A 1Y63A 2OK7A 3MC1A 4H6WA 4MGEA 4LZNA 4JELA 1GPH1 3UJAA 4DILA 7ADHA 2DSTA 4PQGA 3I30X 1VLMA 3BB4A 3KJXA 4XIIA 3DHEA 1G9XA 1SZDA 1Y98A 1ZOPA 3C6KA 3FA2A 3ONVA 5D3QA 4A8JC 3K53A 4DC9A 5H70A 2I65A 2VHWA 5D8DA 5FRDA 4NEQA 1XRLA 1P62B 1G8PA 1PZMA 2P7HA 2YN4A 3KC2A 3KSRA 2DHDA 2ZUDA 3TTTA 4C21A 2ZJYA 5J2UF 4BBPA 4E1VA 3HU5A 1KAEA 2ZT5A 1F8FA 3NKVA 1RYYA 3AQ4A 1JZTA 4I1RA 5FI0B 1BC5A 3I4LA 5TQ0B 4CEIA 2QD1A 4IDPA 1E2EA 2IJGX 3PWZA 5JAIA 2RE8A 1ISHA 1FMLA 2RJ3A 3KXIA 3Q12A 3ZW8A 4C4AA 1V8BA 4AJIA 2PWYA 1H42A 1H9AA 1T9AA 4RF5A 2DXIA 1MFPA 1UM9A 1UDRA 2WYUA 3C4QA 1CE8B 3D6JA 3MA0A 5GJBA 5EIHA 1X1BA 5B55A 1NONA 3ABZA 3JYLA 3PGKA 4LX0A 1C9MA 1TUIA 3E84A 4E94A 4X6YA 4LSMA 1AU9A 4D41A 2M32A 1OV4A 5FUQA 4JI1B 3L1KA 5CB8A 1PEKE 1TD9A 2W48A 4N9QA 1CE8A 3LZDA 4YHBA 3WGHA 5K3SA 2DBYA 2WILA 3FPGA 3KTFA 1UUFA 1YAJA 4Q34A 4RORA 4IIYA 4A0HA 3Q0IA 4XSGA 1XHEA 2OSVA 2CD9A 1F8GA 5AWFC 3RUIA 3T8YA 3IEXA 4FZJA 5C7IO 1OXSC 4Q12A 2CXRA 1DEXA 2PLRA 4KV7A 1TMGE 1UBOS 3IPXA 1U2TA 1SXJB 3LSYA 1U28A 1HOXA 1UQTA 2HO4A 3C3BA 3IAFA 4HADA 3G7SA 4M7RA 2BLLA 5C46F 2H3EA 2ZB4A 1Q92A 4WOBA 2JJ8A 1PCXA 4XDYA 2QJTA 2HJSA 4UKDA 3ZLBA 4J0CA 2NQ2C 4EKYA 5G0VA 5HE8A 5LBTA 2HHHB 1N4DA 2Z9CA 1J9EA 1B3RA 2ZRAA 4UXIA 3TM4A 4CTOA 2IY7A 1BQEA 2R1TB 4H31A 4L4ZA 1UEXC 2Z3WA 4J75A 3KS9A 2J9GA 2CDNA 1X86B 1XTTA 1ZD8A 2AIRA 1OFGA 3IUMA 4P3NA 1GTG1 1VE7A 1VL8A 4JX8A 3V5NA 2QIPA 5IN4A 3Q8MA 4RL6A 1Z6ZA 5PNTA 1P1HA 4TVBA 3AI7A 5KMGB 4PFSA 4B6RA 1LJLA 4QSMA 2YIVX 4LFCB 3KPYA 4ZOEA 3W5SA 4BC0A 3B6IA 2GB4A 2HI0A 5E4TA 4Z7JA 2I6XA 2QRHA 3IQZA 1P0MA 3KV1A 3LVRE 3NC0C 1F3OA 1ISFA 3O95A 2JEYA 1RMTA 1VKHA 4LC0A 3VPBA 5AI8A 1SVKA 2IITA 4QUJA 4G4SP 2FFHA 1W93A 5K6RA 2J0VA 3OPVA 2B5OA 1NRWA 5SYNA 5B64A 4RLFA 3VZCA 4KMMA 4PZ0A 3ZJUA 1T4CA 5E7MA 3C8HA 5F1PA 3G79A 4E5KA 1KI3A 1UBGA 2H00A 3KRTA 3ZW9A 5T6BA 3OTQA 4DNXA 2DERA 3O9MA 1NAHA 2J5KA 2CJFA 2PRJA 2JJ1A 1Z15A 3MQFA 4JN6B 4O3FA 3V4FA 3IVRA 1WY5A 4ASUA 3H4MA 4BE7B 3ACBA 1B8VA 4BLUA 1XL0A 5C8ZA 3PQDA 3CISA 3FCXA 4XPIA 1PEDA 2QJRA 4RTPA 1PSDA 3RPEA 5GTDA 2AG0A 1BHSA 2P90A 4S1TA 3FBGA 2LR0A 1KI6B 4MQUA 3QTLA 3KHTA 1GZ7A 1NF2A 2VT6A 4BRSA 3A0UA 2GASA 1ONPA 1IWOA 4YPFA 4DBLC 2AE1A 4HAIA 3RVNA 3H75A 3S55A 4MPRA 1KZ1A 4BAGA 1Q12A 3FPCA 4KE9A 1EBBA 4UM8B 3VPAA 3DB2A 1PN3A 2AHOA 3CG0A 4E22A 2WHPA 4PGFA 3N2IA 4O3MA 3HB5X 1AHIA 3LPCA 4HH1A 4HNQA 4AMBA 4EHBA 2JRCA 4CIAA 4D9IA 3UAYA 5L4NA 1U28C 4C4TA 1XQWA 1R8XA 1RRVA 3E4CA 4KB5A 4M9ZA 3ZUPA 4BO9A 2C92A 2QU7A 1UBNA 3DEIA 3OJLA 2WUDA 3P2IA 3F8WA 3I6BA 1ZGBA 2GF0A 1J21A 2OZEA 3LK7A 4FNMA 1T3HA 4RTSA 4OX9Y 1QSGA 1HH4A 2CDAA 1FDWA 2I54A 3BXPA 5FPYA 2GZMA 3H83A 3B6MA 3IRUA 2PRKA 2CE2X 3P8ZA 4XCXA 1HQDA 3LQFA 4I8IA 5EXTA 4EVRA 3U19A 1TZJA 4YJ3F 4I46A 4OK5A 1QO0A 2X58A 4N7RA 4X41A 4DCCA 2KHZA 1IL0A 5LZ2A 1N6KA 5KNLA 1RXWA 4TVKA 3GFSA 3QJGA 3NHZA 2WSIA 3SDBA 4BMXA 5KTNA 3ADBA 3H8WA 3PUYA 3KBOA 1A8SA 1P6UA 4LV8B 5LWQA 1WBBA 3MSCA 4MINA 2ZOSA 3ORFA 3BWYA 5HS6A 2FXIA 4IDCA 3LY8A 4TWRA 5AW7A 2CNWA 4EIWA 5HF5A 2HR1A 5J2UA 3CIOA 2CLDX 1NZDA 1BMFA 2ZCUA 3RNLA 5FH9A 1WV1A 1QYDA 1YCDA 2W83A 3KYJB 5DTQA 4Y1EA 2B6HA 2EOAA 1ID8A 4JUIA 3EZYA 3SKXA 4F9EA 1OYOA 1YIOA 2HMUA 3TQTA 2JG3A 2GPBA 1AS0A 1MW9X 3QVSA 5BVGB 1K97A 3EH1A 4KODA 3KL2A 2OZLA 3R75A 4CT0A 3ZCUA 3D4BA 5IAEA 3BMOA 3W5IA 1QB7A 5JPCA 1A4UA 3L3BA 3AR7A 1DJLA 4E7OA 2HCJB 2IQIA 1Y1TA 1LW7A 4F5EA 1S7GA 4OEHA 4HVLA 3QXHA 2IL1A 5DRTA 5BVGA 4QJ4A 3CZPA 3H1GA 4D0NA 1UXIA 4FDUA 1A27A 4H17A 1UDXA 1MZVA 3E61A 5CH5A 3QWHA 1WCIA 2HHAA 4MITA 5E6UB 3HNOA 3ZYCA 2E49A 2F55A 2BBTA 2IPAB 4LF4B 1V5FA 2ZUCA 3ZJ5A 2ZJ5A 3HCCA 2OXRA 1TT7A 3PEFA 1S2NA 4B80A 4QNMA 1GV0A 1L3CA 1YDEA 2PX4A 3I23A 3QENA 2ZSUA 4BKOA 2QL5A 3MQ4A 4DQVA 3GLHB 1GV1A 4X8LA 3EIFA 4IAOA 4ASUD 3P19A 2J3JA 2Z4TA 4ESHA 3GFPA 3ZBQA 1J20A 2JKYA 2Q4TA 3DBVO 4GZMA 5AM5A 2PL3A 1YOBA 3GI1A 1J4AA 5AJUA 4ZVRA 1WRBA 4E12A 2JI9A 5CEJA 2I71A 1KIAA 4X1KB 1UBSB 3K0FA 4UAGA 1I0LA 2D1YA 4N6GA 5DOZA 3FPHA 3CUYA 4I1UA 3T3EA 2WC1A 3INGA 2W4MA 3JY6A 1P18A 2J45A 1Y9ZA 2C84A 2PBRA 1QX4A 3KYIB 3UOAB 4EKNB 1ORWA 1UBKS 3W1WA 1KORA 4KQHA 4TWBA 1AQLA 3PJDA 2P1DA 5CK5A 5JLJA 2QRJA 3CTPA 5LSAA 2CWDA 1NW3A 4ECEA 2H8KA 5KNBA 1QRUA 1BU8A 1P17A 2J1LA 3DTVD 1USIA 3EDYA 4MWSA 2CZCA 5BYJA 2ODNA 4JS0A 4B73A 4BRZA 4JP2A 1J8VA 1KYQA 2GX6A 1XN1A 1PWZA 3P45A 5DEIA 5E0OA 1AGXA 4JI0B 2PVPA 2QPTA 4M37A 3KR1A 1NE7A 2DECA 4W8GA 4ZZ2A 1FDUA 2NZUG 4MV3A 1L5ZA 1TO1E 2XYQA 4YLYA 2ZAMA 1LK0A 2V4ZA 2RAUA 1HC7A 4P7GA 4B82A 4XWKA 3G2KA 3KJFA 2O8CA 3WISA 1NSYA 2YWHA 3ENVA 1NUSA 3VDXA 1Q0ZA 2NYAA 3B48A 3L6RA 2N1BA 3LX8A 3KYDA 2CT8A 2RGUA 4DOMA 3BWBA 1YT5A 2Q5OA 2XB9A 4NMMA 3GXOA 5C8YB 4N76A 3JWIA 3RKUA 4ARSA 4D9JA 3PJFA 5TGZA 1ST3A 2Y1GA 4Y2SA 1TAGA 2O50A 4C3UA 2PT7A 1W87A 2H6EA 1CY6A 1ESEA 2A1TS 4DAEA 1DX9A 2NXEA 3GLGA 2BMWA 4Z1OA 1UMBB 3ORQA 3JQ8A 5C8YA 4XI9A 2ETVA 1USUA 1QGUA 1YR1A 1ZY2A 3GZ4A 4ZAXA 5L3SB 2A1UA 2JBWA 2CV2A 3MJTA 3NG1A 3EW9A 3EIHA 1FDRA 4GWGA 4I4TF 3CRMA 3KQQA 3L7BA 3NHMA 4BC1A 4YP0A 5LQKA 4U2EA 4M0FA 1Y6GA 4MWGA 4RPLA 2BHNA 4I5EA 2ZT7A 3L7OA 4A23A 1DRVA 1XEAA 3WGYA 5BPHA 3THWB 1N6RA 2YMPA 4WK2B 2H2WA 4ROSA 3PC8A 3PUKA 4ALKA 4MS3A 4MV9A 3EPKA 1MO2A 2LE0A 3B1WA 3M5DA 4B6SA 4D3YA 1KH2A 2H2DA 4NJOA 1G21A 2O3QA 4Y2YA 1PZNA 3AW8A 3FCOA 4B3HA 1NNEA 4KNWA 4OHFA 2XVZA 1ZGZA 1J25A 1RKVA 1XO1A 4JGBA 3IVAA 4I50B 1BXRB 1SD2A 1QH8B 1ZOLA 2IYWA 2VTVA 3OFNA 4MW0A 5EZSA 2EKBA 2WHRA 4AS3A 3EPHA 3CR8A 2GVDC 3HBFA 2B8TA 4DLSA 3IIJA 1DEOA 1HR0B 2O7RA 1TJ5A 3C7DB 5HK8A 5LBUA 5BV2P 4C5CA 1IMOA 1LGYA 1YZYA 2RC6A 5LXTA 2R0QC 1Y1LA 4LBYA 1SH7A 4LZWA 3PJEA 4CMJA 2H7CA 1E3WA 4QREA 1HNNA 1YQTA 1X7HA 3D4OA 4HMOA 1NW7A 3UH1A 3T1HB 1K6IA 4OAPA 2WWXA 1T29A 3MWLA 4B9EA 1M34B 1MB9A 2C99A 4Y9SA 2CLHB 4LRUA 4WXMA 3LDHA 2EKZA 4LRTB 2GO1A 2NGRA 2Y67A 1JQLB 3BDVA 3E58A 3IVMA 1L1RA 1ZSNA 5BSGA 2PYIA 5CX4A 4DG9A 3QXJA 2JF0A 1R8JA 3PZBA 4EDHA 2OCAA 5CLQA 3U44B 5K2OA 5JNRA 5ABPA 2WQ6A 3JQCA 1PT7A 1E2GA 2Q0SA 3DVLA 1ATZA 2CF6A 1P4GA 2YMLA 2BJVA 2YJGA 4TKVA 3K1ZA 5ALOA 1UBMS 1PNVA 3DV9A 1WSAA 3N2YA 4RE6A 4DR6B 5GPBA 5A3QA 2C3OA 1F4LA 4YAGA 3U44A 2JHAA 4LZOA 1EXDA 1RBZA 1XLWA 4WQMA 3FH0A 3O90A 2VYCA 1JVNA 3AGQA 4DJ5X 5CFZA 5FOSA 2G1UA 4ZI3A 4HNTA 3I2KA 1KDVA 5LCXA 2VATA 3S1AA 4LV5B 3PNVA 3HWX1 1KRHA 2O2XA 5SZHB 4Z0NA 1NTOA 5KINB 4TL7A 2BONA 4XCVA 1JSZA 4E5NA 2ZVPX 5KHOC 3EWNA 2MMCA 1PI3A 3IR5A 2VRNA 1T6NA 2ORVA 2ZWIA 1YJ8A 4YECA 4D9GA 2C5SA 3EODA 3IDAA 4E33A 1CZRA 3ZHZA 1LBIA 3JYNA 4HQFA 3ZWKA 3FVTA 1T8PA 1R8SA 1PR3A 4DKXA 4QFMA 1XTZA 1NNUA 5EP1A 2OLKA 4Y2GA 4KPYA 1TVCA 5B6PA 1VE5A 3PC8C 1DAGA 3HG7A 3KOOA 1P33A 3D3KA 3CEHA 4QFBA 4U39A 2XKBA 3OTGA 3R77A 4R1SA 4UHJA 4F38A 1K0UA 3L7KA 5FWYA 1LI5A 1FQJA 3SQXA 3DO8A 4CMCA 3IJEB 1U7WA 4OIFA 4EWLA 3PIIA 4EA9A 1HE4A 4HYQA 4Y7DA 4O1IA 4FZVA 4YGXB 1VSQA 3EZNA 1BQ4A 2I7CA 2VXBA 3HRIA 3L8FA 4J8PA 3UCEA 1GZ5A 2WWVD 4G5QA 3IE0A 3QVLA 4LHWA 1AQUA 1SUCA 3C1AA 1PL0A 1ULBA 3AUAA 3MRVA 4HQ0A 3GVHA 3T4UA 3TOXA 3OKPA 2BUCA 4QWWA 5KKCA 1TEZA 2PSEA 3F47A 2D1RA 7ABPA 3TDNA 1NZFA 1OGJA 1KGSA 2GNOA 1C4WA 2XZTA 4L8FA 3TLBA 3COSA 4PHGA 5K8IA 4PO8A 1GNSA 1GAJA 1KY2A 3I5YA 1QZUA 3R6TA 3THXA 1ZUHA 2O0LA 3PNKA 4FOPA 2Q7DA 2XIQA 1B41A 3UK6A 5EGSA 4DANA 5AUPB 5IBQA 1WF6A 3MNFA 1CZOA 2XEDA 3K9QO 3FUCA 3DM9B 3SSMA 3X2EA 4CLRA 3A3YA 4KWCA 1CB7A 1ZM3A 1XNJA 1R0CA 2NU9B 1SHTX 4Z7NB 4YAKA 1KQGA 1HZZA 3SAJA 2AN9A 4LXYA 1Z37A 2B5WA 9LDTA 3IP7A 4XQGA 1Q0PA 2B9EA 2QBYB 1MDFA 1IB6A 1KKUA 1M1YA 2J5XA 3FTCA 5B2FA 1Y8RA 2WJZB 2VO1A 4HN2A 1QFZA 5HFAA 3UENA 5ARBA 3Q3JB 2MYPA 2BEJA 3DMHA 3WJ2A 4U7GA 2FB9A 4M7WA 4ZVMA 3VSDA 3QE9Y 5AESA 5KAMA 2C5GA 3JYHA 4X97A 1W76A 4POAA 3S1LA 2PXXA 1HLGA 1THGA 1IQUA 3TINA 4F91B 1PFWA 3S68A 1MRNA 1MTZA 1X77A 1E5XA 2JI8A 2H18A 2VKTA 3CH7A 1ZX1A 2IYOA 3EJWA 3UUGA 3W9BA 5IC5A 1JNXX 4JMPA 4TV9F 4CM8A 3DT9A 4I4TA 2R79A 1WPRA 3P0IA 3ZQ6A 3WDKA 4HI0E 2VCEA 2WICA 4OI4A 5EQJB 2O59A 1CVLA 4IVPA 4X5OA 2F9LA 3DWEX 1COZA 1DAPA 2JFZA 3JS5A 4X0EA 1SBYA 5B1EA 3URMA 5BORA 2IZOA 5KTSA 1FUYB 4CIXA 4C89A 1CQPA 1JKIA 3BMQA 4RVNA 2PBLA 4ARUA 3G9XA 4ZXPA 4BLPA 4WFJA 1Y1RA 1GGVA 1M6EX 5DYGA 3ANLA 3JWPA 2DUJA 3QOWA 4FMDB 4UFOA 1ZJZA 2ZQ5A 1NBEA 3H1TA 3CNEA 4KUHA 2WDZA 3NH9A 3RG2A 1W4AA 1WMEA 3FTDA 3PNSA 4OMCA 2C42A 4QRIA 1CD5A 2GTIA 1P0FA 1NMZA 3NIBA 1FZTA 1G18A 1K8RA 3KO8A 2IU0A 4Q3BA 5IJWA 2XBLA 2QW1A 3KOXA 3OA0A 3RVRA 2FW6A 3WWZA 2YYZA 3FI9A 3WQSB 4NBUA 2DBQA 1R37A 3V3KA 4TLEA 2GPSA 3TTWA 1TZKA 2UUAB 4IEEA 1P39A 2JCGA 3BMNB 5L8VA 1TQ8A 3L2OB 5LQDA 4ZU1X 1M9NA 3OFSA 3EGXB 4FI3F 3B1JA 7AT1A 3G3EA 1PFQA 4FEYA 1AA6A 3IHTA 1AKNA 2MU1A 1L5SA 4HGPA 4PRZA 4XB6B 2O8DA 3DWGA 4V0LA 3U39A 1VHWA 3OY2A 2RC5A 1X1DA 3ZV6A 1Z5ZA 1G1MA 3AU8A 2QVBA 1VPLA 1E61A 2C07A 1M76A 2HUPA 2OXEA 4MYUA 1TT5A 4UXHA 2AOXA 2OC4A 3LUHA 5C52B 2YS7A 3AWIA 4IZ6A 4F21A 4JT9A 1QS0B 4JB3A 3OICA 1EFUA 1QVVA 2GN4A 3AL2A 1GNPA 2VPXA 2BGJA 1T3SA 2ONKA 1H2ZA 5JAQA 1X2EA 2W6JD 4AROA 5DHTA 2WAOA 5P21A 1Z47A 1E66A 4RDHA 1AX9A 3HLKA 3ICQB 5CVCA 3BB3A 4J7AA 2FSPA 4MH0R 1U3DA 2FHSA 1V8PA 4P4TA 2BP7A 1DAKA 2FJ0A 2QY6A 1KPHA 4K9DA 5AP9A 3WWPA 1QHNA 4AULA 1E59A 2UVPB 5CNJA 4HH0A 3E15A 2AR9A 1KAMA 4MVJI 4EB0A 2P6UA 2QJFA 1GSHA 2W2QA 3HBLA 3PNYA 4JXJA 4REQB 1I14A 2CMFA 2PWAA 2NP7A 3G2LA 5A3RA 1SBTA 3SOPA 2O8BB 4Y6RA 1MH1A 3IKJA 1QV7A 4ILEA 1TQDA 1VL1A 1ODLA 2ASVA 1Z2PX 1ZZGA 2WTMA 4J7UA 5D85A 1J07A 2BDTA 1H4TA 4JIGA 5T4EA 2GNPA 2P4SA 3OAAD 2CB0A 4LXTA 3SSNA 4QPJC 2PK3A 2FF5A 4X71A 1E60A 3S2IA 3MJEA 1E3LA 3UT6A 5ICMA 5FORA 4YIKA 5DBHX 3SHWA 2F1IA 3D0RA 4KXXA 4M9XA 4YA6A 5L53A 3P0RA 3G02A 1T26A 3IEUA 1XU4A 3Q85A 1LXCA 4YMIA 2X19A 3CUUA 1GR0A 4OOEA 5E6RB 5CVDA 1EK1A 3PQ4A 4Q6WA 1DG9A 4A1FA 5FO0A 4KREA 4KQWA 5EUCA 3QG1A 1DJOA 5ANRB 3DTVA 4NCXA 1PJQA 4UDXX 1JMKC 2AEMA 4ZO6A 3SZGA 1WY7A 1JKXA 2CUNA 5ADWA 1Z83A 2UVDA 5CLLA 5E6RA 2B34A 2FK7A 3ZNPA 1BE0A 2BEVB 4E0BA 4A7PA 2D1SA 3PQ3A 3KSDO 3C1TA 3GNTA 2IZ0A 5ICEA 3IAM1 2SCUA 3E7DA 1SAYA 4TWJA 4IIXA 4BNTA 1N1MA 2E48A 5G0TA 1X7YA 4L95C 3JWEA 5L95A 1EK6A 5BSKA 2QTCA 1YZ3A 4U3JB 1PZXA 3ANNA 1N6NA 1OC2A 3K6JA 2CLKB 3E1SA 1A8QA 3GARA 3WTBA 1JYSA 4QDJA 1Y5MA 5IBRA 4BLRA 1MENA 2VC2B 4UCXA 4P4SB 5AI9A 4HUQA 2CV1A 1ULSA 1GU7A 2O6LA 1P7VA 4V0RA 2AG6A 2O14A 4L4XA 3UUFA 3WNDA 5IC4A 3KLPX 4TV9A 4G8DA 4MV0A 3CC8A 4Y0VA 3RS7A 1IUNA 3I01M 1PNRA 1P0CA 2PJRA 2HLDD 2X23A 2PR7A 3M6VA 1LLUA 2A3NA 2V7EA 4EPWA 2K87A 1K8XB 1W49A 4GSKA 2IYQA 3HCAA 5AK5A 2QXYA 3DV2A 4G41A 1NNSA 4ZYYA 1BX3A 4PGGA 3WZMA 3ZE6A 1JAZA 4JJ8A 3HY3A 4LTNA 4CHGA 4FHEA 1FEZA 5G4KB 3WGVA 5CBPB 5DXAA 1JA1A 1NG9A 3LL7A 4C2AA 2CL0X 5EWMA 2ZRFA 2FW9A 1JAYA 2ZUTA 1MF7A 3STVA 2C2KA 1OLSB 4RY8A 3DUFA 4AF7A 4HUTA 1YACA 3CWZA 2JAXA 2WFLA 3RAPR 5G4KA 2A30A 1DSSG 2WSLA 4FWIB 3K3PA 2X5KO 3OLCX 1MB4A 2GKSA 2Z5GA 4V0QA 2PSFA 4ZT2A 1X3SA 3QHPA 1YULA 3S7ZA 1XHLA 4LJ9A 1E2JA 1Y1KE 2AMLA 3L8EA 4N47A 3OT5A 1RXUA 3LX5A 4YV0A 2GXUA 2GN6A 1S5PA 1ISPA 3OQOA 3AR9A 3GGPA 3PNQA 1I13A 1EFAA 5LZ8A 2R7KA 3ZH2A 3TFOA 5IUJC 4F2HA 1FLNA 4OHKA 4WCFA 1QQAA 1RP7A 3AI3A 3H5IA 3GAAA 1IZ9A 2JFUA 1LDNA 1A04A 4QLOA 4TM7A 4A6EA 2WA2A 4CDGA 1PTKA 2VHZA 1LEHA 2Y2VA 3I37X 2Q1XA 2FKNA 3CV3A 4HXFB 2Z0MA 5BMOA 2EYUA 4INOA 1OVGA 1YB4A 4S0ZA 4UBIA 3TRDA 1B23P 3FJ1A 1JEAA 3P9IA 1ETUA 3BE8A 1SHJA 1FSSA 2DKFA 1IEWA 2EJTA 4MTLA 1TM3E 3QU4A 4Y6GB 1NJ8A 3RYCB 3CO0S 4GSLA 3FPEA 4CM7A 3LA6A 3C3EA 3AJEA 2RHLA 3BFKA 4F56A 1AUVA 2NVUA 1NBMD 1IJEA 3H4TA 3WGZA 3C8UA 4INJA 3MB8A 5KO2A 1JXAA 3M4XA 5DHSA 1N0UA 2HJVA 3NHWA 3ZGXA 4ES6A 2G6TA 5BYBA 1XROA 3PKZA 2HNBA 4UNNA 4WNAB 4WUVA 3IIMA 5LQSA 3H42B 3ZGNA 3WYNA 1X8KA 5BURA 1BROA 3LIIA 4IIVA 3T9EA 5C1PA 2WV7A 1MVOA 4C0LA 1ZI9A 5E9AA 5EVCA 1BJKA 2D5AA 4M6WB 4WJLA 4B6EA 1KWGA 4E5SA 1UP7A 5JAZA 4RIGA 1HTTA 5HE9A 2CNLA 4IGFA 1JHRA 1UOEA 4ND4A 3HJAA 4OXRA 5EY5B 2Q1TA 1YR7A 3QKRB 3QUSA 4BVKA 4DC1A 1TCAA 4FYYA 1CR6A 3O31A 2H3HA 2I3GA 3QNWA 4CUKA 4Q4HA 3SU8A 1ZAKA 4IJ5A 1JLLB 4ARZA 1H2EA 4RTKA 3E7XA 2HTFA 3KKNA 1ZNXA 3HYRA 3IJ5A 4I55F 1N2EA 3F5QA 4XD7D 1MX3A 4EQ6B 2PUAA 4DJFC 4WESB 4QOFA 1OBCA 4US2R 3QKIA 3FFAA 1GGEA 2QMUA 1NUTA 1TD1A 4NZOA 3WOHA 3NALA 1EIWA 4BMDA 5FBVB 1NM5A 2PZ8A 1TW3A 1DAEA 1ZVQA 4UBKA 4HDQB 3JAWB 1J1IA 2PDAA 4LY0A 1BKSB 2GM3A 3LOUA 2IHJA 2X2PA 3EWSA 3M49A 4ZCQA 1YOVA 4Q3EA 1Z82A 3GFFA 4Z9XA 5I9TA 5AVYA 2ZUFA 1ZUWA 5TPZD 3VC3A 3FRIA 4G65A 3ON5A 1ZCZA 4LMRA 1HORA 4Q9IA 3SIRA 3PG5A 4Z4HA 3ZDDA 4FI3C 4WCFC 4N39A 5ARDA 1U0TA 3JAWA 1Z8NA 3PUVA 1QOZA 4CFZA 1XP8A 1J5EB 4X00A 2XVXA 3GW8A 1RXCA 3NAMA 1E0KA 4URZR 3PVSA 3DAOA 4K6KA 3HACA 5FFMA 1PNOA 5TY0A 1HDIA 3PFGA 4CM3A 1XPOA 3MJCA 3LDUA 5EA2A 5LOVF 4NBWA 3NWOA 2WQ7A 3ZDAA 1RPTA 2JFHA 3RIMA 5F4ZA 2O2JA 1KI1A 5LP6B 1OBHA 2AR0A 5ALXA 1WDMA 3ZNOA 4Q1DA 1P4AA 1YFLA 4CF7A 2NPOA 1V8ZA 2P2CA 1C1DA 4D5EA 3TG8A 3ZI7A 3WDLA 2XOXA 1GUBA 1X74A 2AHRA 1P81A 2Y77A 3ROMA 2FWJA 3VR2D 3LNCA 1G17A 1TZ2A 4FQ7A 4LYYA 4ZOLB 4E5VA 1DO0A 1VJRA 3NTXA 2CCGA 3N2EA 1NULA 3NUGA 3IS3A 1O0CA 4NYJQ 5JJLA 3H5OA 1GCGA 2WWHA 2ZAYA 3GRFA 4CDRA 5ADHA 2QRKA 2ZIUB 4BVEA 1ML4A 2NVWA 5IVIA 1ODIA 1QBGA 1PAUA 2VK8A 1ESDA 1WP4A 3NWEA 4KU4A 5T57A 2YTZA 1Z0IA 1VTKA 3QWIA 4UUMA 4XQ9A 3A6DA 3T4XA 1JMVA 5L6MB 1GVHA 2XLCA 3DEHA 3UAGA 4IUYA 4C6TB 4JD5A 3REFA 5DIFA 2W8ZA 3M6FA 4LDPA 5G02A 1B7GO 1R64A 1WXWA 2P6PA 2JATA 2VTDA 4DM3A 1SULA 2ZRJA 4XH9B 1Z0DA 1T3LA 5EAIA 2YHIB 2PU7A 1WTCA 4WACA 1U3TA 3COZA 3TL2A 5BW8A 5JD3A 4YT5A 4Q7QA 3TW6A 4K2HA 5DNVA 1BS2A 4I4NA 1BFUA 1DL5A 2V4UA 4PFJA 3HLTA 4B7ZA 5B1DA 3LGAA 5EMKA 3H5AA 3U26A 3ZI0A 1J0CA 1W5AA 4HBGA 4LJ8A 1LBTA 3O8QA 4FLMA 1NQAO 2YHIA 4L0QA 1M74A 4M36A 1VGQA 3N59A 3U3KA 4FWTA 2TYSB 4GXRA 3DHNA 4F60A 3OG9A 1O5IA 1JQAA 4WKOA 2YIDA 4X8HA 2KBFA 3T12A 2J8ZA 5CJ2A 3ONDA 3B3AA 4RSHA 4RIFA 1ENZA 1RRMA 1L5KA 1ESCA 2F43A 1NM5C 1IN4A 4G37A 5FI1B 1KBZA 2A4MA 3QE2A 2CD7A 1Z2EA 4DMLA 5TPWA 3KQTA 1QVWA 4ZO9A 4FB4A 4EYGA 2XRMA 2P0AA 4CL2A 3EH2A 1NNLA 1B26A 4XCQA 4OFWA 3IE2A 3PRYA 3TSCA 1XZ8A 1W5FA 3NKFA 4OQEA 3TLCA 1GKYA 1YHZA 1W2HA 3LCUA 6Q21A 2YHUA 3GMSA 2AQHA 3LBAA 5HDQA 5CDUA 4WOCA 1O08A 2LW7A 4MCHA 2PNJA 4RK7A 2C1EA 2A9PA 2G70A 5KQSA 3UWKA 1Q22A 3C3YA 4X54A 3BHIA 3EXHA 1LPAB 3HWSA 3TAXA 1L3IA 4TTPA 4BNVA 4BQIA 3V4RA 4H08A 3RRBA 1JKJA 4FOTA 2PUBA 3TQRA 4ODIA 4IIBA 5KNCH 1HNXB 2FN4A 2VPZA 4HDCA 2W6JA 1L4BA 4N0QA 3VGPA 4RBNA 1DOAA 1MABB 3OF3A 3C6QA 3FYUA 4W8OA 1QXSA 1T5IA 4LXHA 4A2PA 2DTDA 5IUNC 2X9NA 1EFCA 2O1WA 2Y6UA 4R8RA 4D0RA 4DKJA 2IYLD 1XTQA 1FLDA 3LPLA 2XODA 2F67A 4RLSA 1G41A 4H7HA 3LT1A 1M8KA 1T4DA 4J4HA 4Z9AA 1URPA 2F59A 2PBZA 2Q6LA 3I5UA 3BFVA 4KRGA 3H3FA 2YJ4A 3RANA 2HRCA 2RMKA 2UZAA 1SPBS 2P30A 4DE5A 4YN3A 1ULUA 3KCNA 5KWIA 2RHGB 4MUJA 3VR6A 1H2XA 2PMFA 2WMYA 3K4PA 1RD4A 1GQ2A 1VL0A 2PGAA 3RRYA 1AGNA 4TT8A 5D7NA 2HU2A 1R66A 1P6XA 3QBDA 4K8RB 4JUCA 4UNSA 4C3ZA 3LRXA 1RAHA 2PWBA 1V3TA 1JLKA 4YT4A 4XASA 1L3BA 3PIDA 3WB0A 5HKBA 5IT4A 2OFPA 2EP5A 4CQLB 2PS9A 4KP7A 4ZQEA 1JEEA 1W8IA 3NOOA 3RFTA 2FOXA 3U17A 4I55A 3OCXA 4MB6A 2YWCA 1UANA 2MT9A 4EG6A 4DMRA 1V16A 3CZQA 3DXZA 5H0IA 2WA1A 3C74A 4OHMA 3SQDA 1G63A 4ZTBA 3ZLVA 2W8BB 1NVDA 5C1OA 3HDGA 5KYNA 4DCNA 4F4FA 4MUBA 2NTEA 5L6LB 4FHGA 5ALKA 3LCVB 4IIGA 5K51A 1G42A 5LN1A 3A4IA 1VLLA 3X1KA 5JCJD 1FTQA 4NY1A 1JHVA 3K9HA 4FKZA 2K7ZA 2XYRA 4LDZA 2W8BA 5H02A 5FPKA 3VR4A 4BNXA 4EO7A 2BDEA 3HEMA 2A8YA 4RKFA 3PGMA 2BEUB 5M3BA 1C3EA 4AY5A 3PUXA 3HA7A 1Z0AA 3CS3A 1Z22A 5CDGA 1E4EA 1W0JA 1WE2A 2QG9A 3HR7A 2HCTA 2QW8A 3GMTA 4R16A 5CPBA 4BBAA 1BDIA 2QLJA 2HEIA 3EXHC 2ZT6A 3FNGA 3FVQA 5J23A 3GT0A 2QEQA 3EGWA 5LOVA 3PD0A 3LYAA 4MAAA 5BV7A 5CYGA 4YAEA 4BO0A 2ZTUA 2HU7A 3OQVA 1CY0A 2WD9A 3HKCA 4C6SA 2I3ZA 3QXCA 1YMVA 3T1TA 4Z8XA 1WCYA 1OKKD 1T8YA 3FYUC 1L7VC 1O89A 3LWNA 4IUBS 4RHCA 3R9KA 4ZHSA 1VPDA 4B3DA 4NK5A 1NBOA 3F4LA 4YYEA 2YVUA 3MS7A 5A7HA 3BRWA 4YRQA 1JYFA 4DLAA 3JU3A 1DC6A 1TTPB 2BHTA 5C31A 4BO4A 3VYUB 3LHDA 3ASZA 3NBXX 2EZ9A 2XTMA 3HKEB 1GG5A 5F3DA 4YRNA 1KAHA 1P5RA 1SIUA 3OHMA 4COKA 2HU8A 4RL4A 3NHUA 2QNIA 4NU5A 1ODKA 3DMRA 2GTHA 4UE2A 4H3KB 5DP2A 2FH5B 3HKDA 1VSVA 4YRKA 3QLTA 4NH0A 1WKCA 3A6HA 5FCDA 1H9CA 2ZXFA 2EZTA 2QSUA 4TYNA 3R7WB 3R9XB 1ZQ9A 2JIZD 3O8DA 4J1TA 3UC5A 5D3KA 4DQLA 3KQKA 3VKGA 1NBHA 5LD2C 3K6SB 1GQOA 4ON9A 2FCRA 1I94B 1VHDA 2OBNA 1PQUA 2FMIA 1I2AA 1S3GA 4JCOA 5LP1A 1AHPA 2HOQA 2G1AA 3UJHA 4AP5A 1N34B 5E4JA 3F71A 2FFJA 2WVJA 1TEVA 1H6CA 4D44A 3QA3E 1EXNA 5AKKA 2FU5C 2VT2A 3V1NA 2ZBPA 4G07A 1XCGB 4JNKA 2BFWA 3TJZA 4ARVA 4POOA 3R8FA 1W19A 4KFTA 4DDMA 1M1XB 3R76A 5AVUA 1Q95A 3WMWA 1RQGA 1RZVA 5LYJF 1OBVA 2IPXA 3DAYA 4IWNA 2G9UA 3B53X 5ED0A 1K7EB 1K98A 1I3LA 1U0NA 3DZCA 4MUFA 3LDGA 3AVYA 1AZWA 1AGYA 2FUNB 3CX8A 1K7FB 4XTRA 5ALDA 2Q49A 3K32A 3TQIA 3WMGA 4C01A 3F7TA 4KI0A 4E13A 5EE3A 3TUIC 2K5UA 5SZIA 4F3RA 4EPTA 4RK1A 5F9MA 4F8JA 4YONB 2BI7A 3QI2A 1U9YA 1B93A 3HSYA 4I3GA 4F3TA 4YXWA 4FFWA 3NXKA 3GT3A 4G4JA 4M1SA 3GXBA 4EA8A 4BDTA 1BD4A 3UKDA 4O0MA 3GCXA 3B6KA 3AUJB 4HYEA 2V03A 1OWLA 5DYIA 3RT1A 1MLDA 3G0GA 3MAJA 4Q05A 3I52A 4A82A 1U31A 4UUPA 1EK0A 3KEQA 4GYKA 4HDRB 3F73A 2HN9A 1U3GA 3QX8A 5DH9A 4D4HA 4PLZA 3SJZA 1KQFA 4V38A 4AK9A 2ZDQA 2DPGA 3SVLA 3EXFB 4UZSA 1ZN8A 3RW9A 2Y1EA 4HNGA 5GIOE 1C8VB 1KR5A 2ECOA 4AY4A 3EF1A 4R05A 1XRJA 1JEDA 3TK1A 3NEYA 1QHSA 1S2LA 1Y4SA 3PGJA 3EZFA 1I2ZA 4WSOA 3STHA 3HVRA 1ILEA 5KWEA 1HG1A 4YFYA 1JLMA 2QM8A 1XMJA 3W04A 2DJ5A 4JLVA 2ZSKA 4KC0A 3T3HA 3G2NA 2C3PA 4JLPA 1QLWA 3GRZA 3O4FA 1XF9A 5IKMA 2XCRB 1CCWA 1NW5A 4FZ3A 3ZBPA 1LRJA 4JJ7A 3L8ZA 1G1AA 1OLUB 3LL4A 2JGIA 1U0SY 2OYSA 4RWEA 4UREA 3CKLA 2PH3A 4CG1A 4QGSA 3DVQX 4J1TC 4L85A 2F9FA 2W6PA 3MHPA 3FDZA 5EIAA 3CNBA 2AJBA 3F6PA 1R88A 1QIJA 1YA8A 3GU3A 3ZBUA 2M2IA 3EEIA 5C32A 2OO3A 2CBGA 1XRNA 3B2EA 4RUKA 2APJA 4YCDA 3ZKAA 4C4ZA 3PFNA 1J70A 1V5WA 2FWPA 5KNDH 1F7UA 3O2SB 3GYBA 4FS8A 4JUFA 1XN4A 4TS4A 4C5BA 4D7AA 4WKGA 3ZXXA 5DGCA 5DBFA 2F8LA 5DTEA 3AETB 4O1MA 5AKXA 3U7EB 1H6BA 3T7RA 5F3WB 3SBDA 5JWHA 3U4QB 3JTEA 4OB8A 4ZYLA 3MAGA 3P96A 4D9BA 4HO1X 1XMPA 2QP9X 1N1GA 4TN5A 3BA1A 4KXNA 2AN3A 3A32A 2PXHA 3H5LA 3B5EA 2R86A 2VOEA 3INNA 3LZCA 4M1WA 3HR8A 2ODTX 1LLCA 3PLNA 4BUJA 5CA1F 5JXIA 2FPIB 2I2BA 2REOA 4JGGA 3SX4A 3ZXUB 4DEYA 2OP1A 4KQ1A 2DX7A 2POQX 2QORA 4MS1A 5ETJA 2C2GA 5ELMA 1WDWB 2X4DA 2VT7A 2Z2KA 4UD2A 3WB1A 4J1SA 2I6GA 3SLRA 1PEYA 3PPXA 4BV2A 2BHLA 3RYIA 4HSEA 4W7IA 3DUWA 3Q5DA 3L7YA 1JN0A 2A33A 2X76A 1EVKA 1DT5A 3M9WA 1OTXA 4YQEA 3PZRA 3JQFA 1MC5A 5F2OA 3A9CA 1Z63A 2NXNA 5FLEX 3IFSA 3A9SA 1CS0B 3O3NB 4XARA 3E0QA 2C5EA 3TSYA 4IDNA 4DPLA 1YE8A 4NV0A 1V1RB 2BV3A 4MGIR 3SOZA 1DEHA 3BDAA 5EJ8A 1WQ4A 3A28A 5A02A 2J9RA 2EATA 1KEVA 3DC7A 4UU1A 2WSSD 5IMSA 3OX4A 4RHUA 5KKNB 1BKYA 3KD2A 5B7PA 2PX6A 3MPOA 2NNLD 2UYCA 1NYLA 1E2UA 1FVHA 1NVVQ 1R6UA 1F5SA 2JLRA 4PCAA 4ZKEA 3DAFA 3RYHA 4GKKB 4LE1A 4F2GA 4W5JA 2AEJA 6REQB 3H4IA 3IA7A 1IE3A 3KU4A 3UAVA 3AM3A 5KOHB 3EW7A 4IHAA 4G5OA 2WU3A 3R9IA 4IICA 4FCWA 4ZC8A 2E4UA 3IMGA 1MP0A 1KU0A 1N2BA 3OMWA 2E4XA 3E5RA 4C4SA 1ZXXA 1ZVKA 4ADSG 3DULA 4PY2A 1EVYA 3OP4A 1Z7EA 2YHSA 3WLFA 3GUHA 1Q2XA 1YZUA 3MELA 3IODA 2Y0BA 1Y5RA 1A2KC 4JA0A 4DLUA 5KUTA 2BFMA 4INZA 4NENA 1NAIA 4MPPA 3KYCB 2PN1A 5E3JA 2JRLA 3RSLA 3TIXB 1TECE 1TIKA 5DKFA 3P4YA 3AXTA 3GFVA 4Y9UA 1TM2A 4J0DA 4UBLA 5ED4A 2UXDB 4YAOA 1BYIA 3DDOA 3PS9A 2XZPA 1N36B 4JVSB 1RWMA 4RKYA 5FTLA 3IEVA 5I7VA 221PA 1RCUA 2BM9A 3BHMA 4KDCA 4D3FA 2W6IA 5LYJA 1I7PA 2VSOA 2ZE6A 4NOKA 3LKVA 5EZYB 3P2MA 3NUQA 2JAPA 4MA5A 3X0DA 2UZ1B 3UJCA 2DPXA 2PMEA 1GPBA 5CT5A 1POWA 1JSRA 1E62A 1WIWA 2HFKA 1I1OA 3ADKA 1HY3A 2BR5A 4I6EA 4NL4H 3RSCA 5KNCA 3ABSB 3CRNA 4G5YA 5U4XA 2PSHA 1JMYA 3B60A 5TX7A 2ZRBA 4D4JA 2VNJA 4GWLA 3R7BA 4ENWA 3KAJA 4FUTA 2HM7A 3V32A 1ZCFA 5HDBB 4G0NA 2VDWA 5KTOA 2UZ1A 3O3OB 3D6MA 4EX7A 5FA5A 2A5DA 1TKRA 1M10A 2HX1A 1CUZA 2IP4A 3DV0B 3JRNA 5JCZA 3RAFC 1E9FA 4I66A 4QC2A 1CQWA 3M3HA 4RSRA 1UBTS 4ACBA 4IM7A 2JLBA 3K0AB 3JQFC 4N8SA 3MUNA 3SHOA 1IG0A 1IOVA 1NTRA 5ICCA 4JYAB 5EJEA 3CX7A 1A5TA 1FXWF 3DCYA 4BTVA 2GT1A 3K4QA 1GQSA 2W7TA 2IW1A 2FN3A 4ZCLA 4LF5B 2HRZA 2FWMX 1U02A 2NSHA 3FTFA 4NJMA 3ZDEA 2WB4A 2W6CX 4HLNA 1NJ5A 1QQ5A 3A06A 1B0UA 2J0UA 4CF5A 3LK6A 4R6XA 2HYIC 1Y8CA 1T2CA 4JWTA 1RSZA 1OQAA 4A26A 1KETA 4KAJA 1NP3A 5JNTA 1PUXA 4BQQA 1PKEA 2EG9A 3OO0A 3RRMA 1FFEA 3WIDA 4W5OA 3KQMA 3K94A 3K70D 1W4BA 5JSQA 3A37A 4DIOA 5IT9A 1UXOA 4UBOA 1LH0A 3EY9A 2B8JA 5DCWA 4A8PA 1F5NA 1W25A 2C98A 3B3FA 4NEHB 1CBUA 1NF8A 2PUVA 3TDKA 4XFJA 2PTGA 3L0ZA 2VHYA 1E6KA 2O3JA 4RANA 3TNDA 4QLBA 3GDHA 3FCCA 1MC8A 1N6LA 2GYVA 4GAEA 4F85A 3IBTA 2JKZA 2XGSA 3KUDA 3EMKA 5FDFA 5I9BA 1RMYA 2UZ0A 3FMFA 1TA9A 3GDFA 4FFNA 5TV2A 4UUAA 4ATNA 4C4RA 2ZEJA 4QJ3A 3RVMA 1JSLA 1P4RA 4AXBA 1AZLA 1VJ1A 4X85A 5I7AA 2FX2A 4H7KA 1TPYA 2P9HA 2Q5FA 3C87A 4DAOA 3EISA 3JQGA 3R5FA 4N82A 1S2OA 4FS3A 4F5DA 3TPFA 3EBLA 5H4GA 1U0GA 2ZT8A 2WW8A 3PGVA 1Y6JA 3KXLA 3GVPA 5HYVA 3D5QA 4G84A 2E5FA 1X2BA 2X2EA 4RJIA 1T15A 2OD7A 2O2DA 5I5GA 3H16A 4OAOA 4I19A 3TB6A 4Y1FA 1D3AA 3D81A 2F1RA 1EP9A 3O8OB 3W8RA 1SUBA 4O2BF 1ITZA 1ISJA 1JW9B 1SCQA 3BAFA 4MVJM 1C30B 4IIJB 4WMLA 5E2IA 1KKLA 2WOOA 1WMFA 1ZFNA 4QPCA 5CA1A 5AHWA 2D7CA 3A14A 3O8NA 4R8VA 4UM7A 4IRMA 4Y9TA 1G6KA 1RJ9B 3H9JA 4HZUA 4W63A 5COQA 4A2QA 1H3NA 1R0RE 2LCFA 4MKRA 4KO8A 5TE9A 1JHYA 1YBHA 1U81A 1GUAA 1NHGA 1Y7TA 4FDLA 1AQIA 4JU9A 5KYYA 2FMFA 2OCBA 2ZB7A 4FYWA 4MRNA 4PHCA 3DXXA 1JIVA 3TZBA 3ESCA 2IU4A 3A2KA 4FJ2A 2J3DA 2B1JA 2ZJAA 3E2IA 4MRMB 3ZJTA 1E4OA 2WZDA 3WVNA 2PXCA 3MPUA 1NVUQ 4LNAA 1Q0HA 3I0NA 2UVQA 4MVXA 5JXWA 4RSGA 5AI4A 4YPOA 1OPRA 1FP4B 1EGQA 1QYCA 3OQ1A 1U1EA 1FFHA 1U2ZA 1BW9A 2R8RA 3OZEA 4CVNA 2JPDA 3Q98A 2ARKA 1E3QA 1GRCA 1WD5A 4KFSA 3WNZA 2V7GA 3ER6A 4WX2B 3DFMA 3LUPA 1M75A 4B40A 4UHDA 1XYVA 2QNRA 4DDWA 2ZJOA 3ROFA 3NTOA 3OPQA 3QU7A 1AK2A 1QM5A 3EBOA 3UAZA 1JXMA 1OH7A 1DKQA 2Q0XA 1R8QA 4CEHB 2XPCA 2IV7A 3UMCA 1DPFA 4F4JA 3R5JA 3IUNA 2A0KA 2J9FB 3U5TA 1U1GA 3AZOA 1MR3F 4I4CA 4ISCA 1WUHS 2JFYA 1SURA 3HP4A 3Q40A 4KW7A 4DIMA 3W34A 2CL7X 5FBLB 4B3JA 4ID3A 3QVXA 5DGTA 1Z28A 3B9QA 2FQYA 1ZMXA 2J9FA 4L8YA 4TSFD 1FQWA 2HQRA 4DIBA 1P9RA 3PXXA 3VQTA 2YXDA 3I6ZA 4EYKA 2HWWA 4MUAA 1VP3A 5E8RA 2DFVA 4RMIA 3ZY6A 2PUDA 5FJJA 3TW4A 3HB9A 2Y1CA 4HDMB 6NULA 1NBAA 4CTJA 2YZKA 2YWBA 3PLRA 1EUDA 1UP6A 1YDHA 1B8NA 2FJPA 5DM0A 3LOQA 5ALJA 4DWVA 1G3UA 4CKCA 1FFGA 3KD3A 1FSPA 3NP9A 4DM7A 1I3CA 1IFXA 5MHTA 1UPXA 4MDHA 4UHCA 3NDBB 1IU9A 3TIGA 2ZIEA 5FTKA 5JV5A 3IPLA 4B5KA 2LKDA 4PF1A 4AWXA 2XEXA 3WFZA 3AF6A 4WN9A 5U9CA 5CUQA 3WWEA 1L8XA 3IALA 3P94A 1FIUA 1RQ7A 1Z13A 1YHYA 3CWCA 4TZ0A 1W46A 3AKCA 4HDKB 1KR2A 1PIWA 1DU4A 2EBUA 1GL7A 4S05A 1FQOA 4MQFA 3HHPA 1GN8A 5IYZF 1OI4A 1H0SA 2COEA 1K8YB 2MDTA 3PCXA 1FVXA 1TM7E 3NBQA 1FXWA 1SB9A 1YRHA 2C2ZA 1NY5A 4RA9A 3KQYA 3UO8B 2OM2A 2UDPA 1M2VB 4G0PA 2DEUA 3IV9A 1N9ZA 2XB6A 2VZLA 2RIPA 4KQEA 2OCLA 2BL4A 4FFSA 5SYAA 3VM6A 1Q1NA 4K46A 5CDTA 1G0OA 2W2KB 1AKVA 1SVLA 5JI2E 5JS8A 4IDBA 3BKXA 2HIMA 4FHCA 5DW0A 3TD6A 1KSFX 3P0JA 2PAFA 2PRIA 3M83A 1JQDA 5EJGA 4DNOA 2DR2A 1OAAA 1GLNA 4RJLA 1E2DA 1ZWKA 3ILSA 4TLDA 4L0CA 2C88A 5TLSA 4MUNA 1W52X 3QX7A 2ZIXA 4HKTA 4WVFA 2FF7A 5A06A 5KX5B 3T0FA 3HB7A 3I09A 3AKEA 5E0KB 4J0EA 5G3YA 4GMKA 1J8MF 4DA6A 5IW8A 3RFUA 2ZPTX 5JMWA 2Q4OA 3N0RA 2JAQA 3ICPA 3AJRA 1O03A 4TKZA 3WKDA 3JWHA 1NT2A 1P0QA 2OAQ1 3BSSA 5KX5A 1EP2B 4YJDA 3FPJA 3GDGA 5A3JA 4OHRA 5KQGA 1QFJA 1O0SA 3F9IA 3MTJA 3V1MA 4OX9B 4H4EA 4V03A 3E9CA 4NARA 3AUUA 3LXUX 3VZDA 5EXDA 1IBLB 4IXTA 4QAQA 4KO2S 3WAGA 3L7LA 4JASB 4J6FA 4ME6A 3RBZA 2D5CA 1GTSA 2EKPA 2A35A 3U9LA 5AVRA 1U0EA 5AHRA 1N0HA 1PX0A 3V1YA 1CUEA 2C2OA 4YX9A 4OQNA 5JCPA 2Y05A 1SVIA 2D74A 3F8TA 1F20A 3LF2A 2C4VA 1CUHA 2ICAA 4FYHA 4H0CA 4NABA 4O2BA 5DPMA 2OQ2A 2AUMA 1DEAA 2IS2A 3CJTA 3BGOS 2CHFA 2KX7A 2WJWA 3IP6A 2YN0A 1WX1A 3B20A 1CW2B 1ELOA 4Y6PA 3JZIA 1GG9A 1NV9A 3ZHRA 2R6DA 1K9SA 4WLFA 4UULA 3GLRA 1PD1A 2BC9A 1QHXA 2AA3A 3GJ3A 4P32A 4UM5A 5K3OA 4OXQA 3OTOB 3P4XA 3G9ZA 5J9FA 4ESVA 3OI7A 2QMYA 1CZLA 4V0ME 3A4NA 3D0QA 1TFRA 3T9FA 3BH0A 1QH9A 1O3YA 1E7RA 1SCKA 2ZJ6A 3N3AC 5JAPA 2VWHA 3UB3A 1KF0A 1WPQA 5BOSB 2DSNA 4KXVA 4S24A 2E0IA 2BJWA 2OHVA 5TS2A 1RAEA 3RFCA 1DQZA 2D0IA 4Q9LA 4M53A 3IAXA 4AL4A 4PBTA 5KSZA 4LI3X 5K9ZA 1PNQA 4BFWA 2PQ0A 1PT6A 1ZITA 2NXJA 1A88A 4G5XA 1U0FA 3WIVA 1GUZA 2W90A 4Y2PA 2B4TO 4HPJB 4NBNA 2AFVA 3LBYA 2OBYA 4V3CA 1BHJA 2EP7A 3Q1LA 1QCZA 4KAAA 5A6SB 4JK3A 3PTZA 2V6BA 3ZNNA 5IT5A 1C3LA 2H85A 1GZSA 4JOSA 4U5QA 1E92A 1ZJJA 1RI5A 3U0BA 2SBTA 3K0CA 3DKKA 1E4YA 1UF9A 3HS3A 3W79A 4U02A 3MWEB 2ZI6A 2CXUA 4PCVA 3W7VA 3ULKA 4WBSA 3S81A 5TEWA 3UA4A 1H9BA 2C2WA 1FP2A 2PXAA 3I04A 3K2EA 1SHLA 1VXRA 3OUTA 4OMDA 4QQRA 1CRQA 1M6VA 2B4QA 2Y93A 5EXPA 2TECE 4JKYA 3RVPA 3DBRB 3MWEA 2XNDD 5DTRA 1P7WA 1RQNA 2NNWB 1XZDA 4FC6A 4BN4A 1VBFA 4QNNA 4CG2A 1JDUA 2VDRB 3C2QA 2FSGA 2DRIA 4GS5A 4PE5B 4NBVA 3RROA 2V3WA 3A9RA 3SN6A 4KLZA 3DBRA 2YZNA 3D6AA 3PXBA 3DEYX 4XOIA 4FX5A 4BQOA 4IX9A 3NU1A 5D01A 1U0RA 5TJ9A 2H1SA 4MAMA 1Z35A 3IXQA 3LQRA 1Z0KA 2DCUA 4EUSA 4P4LA 3HCRA 1IHDA 2CEAA 3HH8A 1JALA 3MN1A 1PZHA 1QNFA 4R6WA 3OQIB 1N5IA 3S8MA 3DOFA 5MN5A 5IDXA 4I8XA 2ZANA 4F84A 5BYAA 2A88A 3LPMA 1BGVA 4B87A 2E9SA 3WA6A 5T7BA 4K86A 3RQIA 4DC0A 2RSLA 3OCZA 4YJ3B 3S70A 4EG5A 1DCFA 1Z0ZA 3C1OA 1U1IA 1WHSA 5AVVA 4RV4A 3PITA 4G56A 5ERXA 4DA0A 5KYUB 1DLJA 1INLA 1CJTC 3I2JA 4TS1A 4ER5A 2HSDA 1YZKA 5CB4F 4JZYA 5ECYA 1ZISA 4E1AA 1K5PA 1OXBB 1RI3A 3IYLW 4IJMA 4Q9AA 4OA5A 5AUQA 3I45A 5HKOA 1L4HA 1OX4B 2HF8A 1NQXA 1JE0A 4C0KA 2VNAA 2F2TA 1TZBA 2QLTA 4ZCSA 1KK0A 1VG8A 2BGMA 3MUFA 1ONNA 2WAAA 3IV6A 3T06B 1VIMA 5BMVB 3TTVA 4RPIA 1E5VA 1JHZA 2H07A 2XZOA 3JVEA 1NX9A 3EYAA 2M1ZA 1G3RA 5IDWA 5ESDA 3A6ZA 3AI2A 3RAGA 1T8SA 2GRAA 1NYTA 2VPYA 2YC4C 4HBZA 2YC2C 1S9DA 2BD0A 4O2AF 1CC1S 4EHJA 1DRKA 2P6OA 2WKRA 1QRSA 4JJIA 3K0CC 4O4JB 3HUDA 5TSDA 3MWKA 3T5GA 2Q5IA 3RYTC 4W1QA 2D06A 1LV8A 4DUZB 2FW1A 1X39A 1DAOA 1Q1GA 3HLYA 2AEEA 1JR3D 4WXEA 4MDEA 2IH4A 3TI9A 3V2HA 1Q3TA 1XMSA 4KCGA 1IXKA 2CLMB 3ESQA 4YRRA 1VGRA 1OLXA 3BOSA 1G4HA 2E4YA 5E1MA 2YYYA 3UGKA 3MGCA 4HNHA 4XGKA 4P81A 2W43A 3SFTA 4PLHA 1Y5LA 3ENKA 3V00A 4LSWA 4B6QA 3WBKA 5BSVA 5KHAA 1YQ9A 2XB4A 3F2VA 1JA9A 1LFAA 4BMYA 721PA 5B3AA 4G0WA 1MU0A 2PRYA 1I0IA 1P75A 1T0HB 1JF8A 1UJ4A 2L42A 4FMBB 1B8PA 3DXFA 2XUHA 3MERA 4W99A 5IWCA 3MINA 5BR1A 3L4JA 3VNBA 1RW4A 2QVZX 3OF2A 1RQLA 1ZA2A 2H17A 2GF9A 2QTZA 4OGWA 3LLCA 1Q7CA 2ZJFA 3PF8A 2WUFA 1U0BB 1IZ8A 4X20A 5D87A 5EKSA 1A96A 3W78A 1XZMA 3GF4A 4LRYA 3AERB 2C57A 4NCIA 3BIJA 3IHKA 4JLBA 4PX2A 4TMYA 3TE6A 4CMHA 1L8AA 4NPAA 4OU4A 2I6QA 4D9FA 4Y7CA 4EUKA 5AOCA 2HMAA 1SQGA 1C81A 3OEED 3PUIA 5DNYB 4ZYTA 3LSTA 2X86A 1WZCA 5JATA 3IURA 2P1ZA 3K15A 4GG1A 2RK3A 3L93A 3AJ9A 4WTOA 1T36B 1HDGO 3H4VA 2PD6A 1M0TA 1SKYE 4M1EA 5H1YA 3NYQA