2VVTA

Glutamate racemase (muri) from e. faecalis in complex with a 9-benzyl purine inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
274
structure length
269
Chain Sequence
VPRGSHMSNQEAIGLIDSGVGGLTVLKEALKQLPNERLIYLGDTARCPYGPRPAEQVVQFTWEMADFLLKKRIKMLVIACNTATAVALEEIKAALPIPVVGVILPGARAAVKVTKNNKIGVIGTLGTIKSASYEIAIKSKAPAIEVTSLACPKFVPIVESNQYRSSVAKKIVAETLQALQLKGLDTLILGCTHYPLLRPVIQNVMGSHVTLIDSGAETVGEVSMLLDYFDIAHTPPHEFYTTGSAKMFEEIASSWLGIENLKAQQIHLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE RACEMASE
publication title Exploring 9-Benzyl Purines as Inhibitors of Glutamate Racemase (Muri) in Gram-Positive Bacteria.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Isomerase
total genus 99
structure length 269
sequence length 274
chains with identical sequence B
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vvtA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vvtA01
3UHPA 3OJCA 5IJWA 5HQTA 5ELLA 2OHOA 2JFOA 4B1FA 5HJ7A 3UHFA 2DWUA 3S81A 2JFVA 1ZUWA 2JFZA 5HRAA 2W4IA 2JFXA 5HRCA 2JFQA 3ISVA 2GZMA 2VVTA 3OUTA 1B74A 1IU9A 2JFPA 2OHVA 2DX7A 2EQ5A 3UHOA 2JFWA 3S7ZA 2JFUA 3ISTA 1B73A 2JFNA 2DGDA 1JFLA 2OHGA 5ELMA 2ZSKA 3HFRA 2JFYA 5EVCA
chains in the Genus database with same CATH superfamily
2KLHA 3AGPA 4CV2A 4XWYA 1C4XA 4EVRA 3NIDB 3PGXA 4MV9A 2I6GA 2H18A 3NRCA 1GTRA 1V1RB 3T7TA 3OMXA 3SX2A 1RE1A 2P3SA 5E7JA 3A6GA 4PC7A 4C0WA 5FPPA 5BN1A 4R3WA 4KQ2A 4ZVPA 3ABIA 4TQUS 3WX0A 3DE7X 1NX6A 4MAMA 2M2IA 3EG5A 4MW0A 2Y0PA 3K6JA 3GEIA 1CZUA 4R9RA 1UMDB 1WXDA 3S28A 1U9IC 2HDWA 1R4MA 3SSOA 2QRMA 4WSOA 3N5KA 2GYWA 2P2SA 1LQTA 4HAXA 3SLKA 1YDGA 3OIYA 3COYA 5C2JB 1DHTA 4N3AA 3DA8A 3R74A 3X44A 4CF3A 2FZCA 1DTWB 1Y1KE 5C4IA 2EFJA 4JGGA 4HWGA 4DANA 4KMSA 4L08A 1IIBA 1NQUA 3BFXA 4LY3A 3DOJA 2MJLA 4RY0A 4PRYA 5BSWA 4LI3X 4W5QA 1F4LA 1XVLA 1DELA 1YB6A 1JXMA 4DNPA 3ZE6A 5AESA 1D6MA 1E3WA 1ZI9A 3NWOA 4P36A 2PBZA 3SC2B 1WCV1 2ZIWB 1ISSA 1GQQA 1XRQA 2M98A 3DW3X 1CV2A 3D31A 3RYHB 2PMFA 4KREA 1R6VA 1V3TA 2MMCA 3OCYA 8ATCA 1K7XB 5GMOA 5BRJA 2IHNA 2O8CA 3NYWA 4JEHA 3FWYA 2Y2UA 5AVKA 3WGUA 5F9HA 3STWA 1GCOA 1GQSA 4DLUA 5T41A 3GLRA 2WEKA 4UE6A 3T1TA 5HRUA 3ZXIA 5B7PA 1N7IA 821PA 4MRPA 3VOBA 2A9QA 3N6XA 3QPDA 4CDMA 4AI6A 5F9FA 1LF5A 2BTQB 3JSAA 4N3BA 3FPCA 1J4AA 1FDTA 3ZHOA 4MIEA 3DW1X 1Q0UA 5ADUS 3OEEA 2IEZA 2G7ZA 3EH1A 3F5DA 4DGQA 1BN7A 4KQFA 3ZWXA 2XMSA 4S24A 5EHQA 4UFOA 4AY2A 2I03A 3AJ9A 1QYWA 2XSZD 4QBFA 1YC2A 3BWMA 1YDHA 2CMHA 1YMQA 1Q0LA 3HQ4O 1U94A 2JH8A 1I94B 1W85B 3DL4A 2EZ9A 1ZMBA 3FLEA 4WA7A 3IBYA 1OGJA 2XKJE 5L3QA 5JCJD 2EWVA 2ATIA 1XJ5A 4JL8A 4MVCA 1I4TD 4GBED 1KJZA 2GEFA 4AXBA 4DR5B 3FG9A 2GR9A 3NEJA 5G0WA 1U0RA 3MXTA 3OZWA 3SVLA 4RX1A 1YHYA 3LGSA 2HTEA 3MT0A 4JWTA 4DARA 2F67A 2V7XA 2YRWA 1GA4A 4ND4A 1J24A 2ZYGA 1O95D 2CYCA 2MSKA 3PYXA 5C18A 2D1SA 2ORVA 4D5GA 4DV7B 3OJFA 4HWTA 4H7FA 4M0LA 1U0FA 4KUGA 2A94A 1C7ZA 3O8CA 3I2FA 3DMNA 3IAEA 4Y2YA 5J4LA 3GP8A 1R4NB 3NP9A 3BD7A 1N4AA 3M9XA 4HDKA 4IINA 1N32B 1W4ZA 1M67A 3FFBA 1MB4A 2W4QA 3BMQA 1HEYA 3GPCA 3OQJA 3MWKA 4IIJF 2B6NA 1MVOA 4K40A 3UWOA 2BP7A 4LJLA 2XJ4A 3WMXA 3UXYA 3GPBA 4TKVB 4BLWA 4HAOA 2PR2A 3EF1A 4JLPA 3G7UA 4G1BA 1K7FB 2AJ8A 4IEFB 1JF8A 2H2GA 4ZYYA 4YFYA 2R8OA 3L0YA 1KI4A 1SVOA 3R44A 3L7CA 1CDZA 3LHIA 1BX3A 1SN7A 1RWMA 1WABA 3UA4A 3I32A 2O06A 1DOAA 3BC1A 1ZM2A 3SQOA 1GTL1 3JQGA 1L7PA 4XTCS 2G0NA 4N8SA 1ULUA 1KVRA 3WNCA 4HB3A 4H16A 1XT6A 4FFOA 3HH8A 4E32A 1PFUA 1BVHA 4URUR 3TRKA 1AB5A 1K3TA 1UPUA 1GR1A 2WJYA 3ASZA 2BRUC 3M70A 2O8DB 2OO7A 2X1VA 3U40A 1Q1ZA 1JJFA 3P0RA 5BUCA 5AVQA 4DCJA 4KWCA 3HWX1 3HNPA 4FFRA 3T0IA 4IIJB 2M1ZA 2PS0A 4ENTA 1SK8A 4GGPA 3SC4A 1ILWA 4D79A 2C31A 2JBAA 1B93A 4RFLA 3H5WA 1GPJA 2HPVA 3WGKA 4ESVA 3UMVA 3MT7A 4QOEA 3TTWA 1CE8A 2AEFA 3A1TA 4P7JA 4QBKA 3BL5A 1HQDA 5CDFA 3B1ZA 1O8BA 3WZ2A 4W7IA 3KEQA 5ECGC 3PVCA 3R8CA 4RFSA 3EC7A 4P3YA 3W2GA 3SSAA 1OX4A 3QPWA 8MHTA 4PZLA 1U9ZA 4QDZA 1Y34E 3TLAA 4D9GA 5A4AA 1YI0A 3CPHA 4KBYA 2YWHA 4LMBA 4B09A 2O54A 4XCVA 1IZZA 4G81A 3HO8A 1UJ5A 2YQ4A 1JFVA 1UC9A 1HUQA 1ZC4A 2EBHX 3C6KA 1ZJ5A 3C98A 1WVGA 3LWBA 2RB4A 3QWAA 3ZLVA 4FUTA 2HK6A 5A7HA 4ALNA 3JVEA 1CUDA 1GQ2A 1DCKA 1CRLA 1SJ9A 4TUYA 5KTOA 2WIJA 4FKBA 4G24A 4NBVA 2QUZA 5I47A 2JI7A 4AYTA 5FOSA 1BG6A 4QWWA 1BQ4A 4DJFC 4J0HA 1BHO1 4IO1A 4OD0A 2YWFA 2XUGA 2AG1A 3AT1A 4NE9A 1EJ2A 3HDYA 3WE7A 4HCJA 5LOVA 3T5AA 4XZ3A 3EPKA 1G55A 2RHCA 4JLBA 4RS3A 1LS1A 5ALIA 2EERA 4LGMA 2A5FA 2FUEA 5DV9A 5ANRB 3VNQA 5K05A 1LNSA 1CF2O 2QUIA 1LTHR 5EMMA 2LCIA 3LIIA 2FDRA 3BBLA 4HF7A 4XGIA 4ATNA 3QVKA 1MIHA 1XRSB 3H5AA 2NUBA 3ROZA 2DR0A 3CNNA 4Y1GA 2CXXA 1GGNA 4GI5A 4G1MB 4LMAA 1JR3D 1Z0UA 4KWHA 5HRAA 2ZKLA 5JQWA 5MFZA 5J2UA 3WADA 2J9XB 2Q4EA 3LWDA 3U3RA 1DUIA 2ID8A 4QVGA 4CLRB 4F1WA 2J09A 1N6OA 3OTIA 1GRCA 4BGEA 3ZCQA 3H4MA 1QF7A 3G6WA 5JADA 2BJHA 5T6MA 3COVA 3O3MB 5D5HA 1Z4PX 2LDXA 4FHZA 1DAPA 4LJ4A 3GPIA 2F9LA 5I7EA 5FA8A 4KFUA 1IXKA 1ORIA 1A8UA 4FFBA 1YK1A 2FPIB 3U0VA 4RDXA 3BRSA 1H8HA 4G25A 4FEEA 4C6TA 5KWJA 3MMZA 1MPXA 2XVZA 4DM7A 1DKOA 1KF0A 4F4CA 2UU9B 1HSZA 4Z5XA 2NXJA 1JVSA 3T3MB 1FXUA 1UKEA 3HY6A 1ZD1A 3IULA 4RKWA 4YV1A 3RHZA 4JD5A 4TWRA 1UKCA 2V7UA 3KQSA 1XEWX 3AFHA 2MR5A 1BA3A 1VKJA 3S2SA 2WTAA 3WLMA 1TQHA 1DARA 1W9MA 2QTCA 3Q8MA 1P33A 4K9SA 4AKEA 4C4PA 1SVWA 1U3UA 2AMLA 1ZM9A 4GOJA 4ZMBA 2CJWB 3IP5A 3PUHA 4F46A 1GZHB 3GGGA 1GU1A 4GYKA 8ABPA 1K0FA 1YDWA 5KSWB 4LXYA 4ZGGA 2XF2A 4FC6A 3H1BA 2PNFA 2PPLA 4HPXB 4QYTA 4U39A 5G02A 4R3UC 4AVYA 1HSOA 3U48A 4AXXA 2VA9A 1NMSA 4KXNA 5H4GA 2KB0A 2A9FA 2HJSA 3ADCA 4JHLA 2DY1A 3DDOA 3BERA 1XZFA 3PA6A 5K2MA 3ZUGA 1O3YA 3NGLA 5ADWA 5JUWA 3VTAA 1OFHA 3FR7A 4JI7B 2AIRA 3LT1A 2F00A 4RM3A 3EGEA 1M8JA 1Z62A 3WGOA 2QD4A 1UT8A 2EG5A 2GN9A 1JA1A 4Y2XA 3VR5D 3FHJA 3EXG1 4KJZA 5AI9A 2HDOA 4E5MA 4I9UA 4OHMA 5B3KA 2H2DA 2F62A 1JHYA 2YXEA 2A4KA 2PK3A 3T1YB 1RHMA 4O4JF 3VUEA 2BEJA 3QU5A 1NQXA 3KSAC 1A9RA 3L77A 4RHEA 4JSYA 3A36A 1J8QA 1E9CA 2H5IA 2YQ5A 1G4UR 3LM8A 4CLEA 2IV3A 2D1QA 2QS9A 5CYFA 4CM1A 3OQIB 2LCQA 4C0LA 3U7FB 2PMEA 4QSHA 3G23A 1CZOA 3C6MA 3HACA 1QHEA 4C4YA 1WSAA 4JYCA 5KOHA 1MO5A 2W8ZA 4OSPA 2PSDA 2Q5JA 2FZ4A 2OXFA 1NN0A 2Z83A 3PXCX 3PC7A 4IXTA 4IX1A 2Q5IA 5KAPA 1P1FA 3SFTA 5EJEA 2XMZA 5HHTA 4ZPJA 3R6DA 2H1RA 5CW1A 2F8SA 4Y3UA 1SHTX 3RRBA 4BJ5A 5TEVA 4KRFA 4PGAA 2VP2A 3PCXA 3AUUA 1KETA 1XRPA 2GM9A 2O1EA 4WXMA 4P4SA 2ZFUA 3W1VA 2A59A 3F5FA 3TSCA 2C42A 1G2IA 1UIRA 2GKOA 5TMBA 2BI7A 2WICA 2WHQA 4M1ZA 2EOAA 3PZRA 4G0VA 4M21A 3ZZNA 2C1XA 3YASA 5MGNA 2BSAA 4PFQA 3TZKA 4UZFA 4A0HA 5JOQA 2HMVA 2OV2A 5JNSA 3E9NA 2C5FA 3V2UA 3JWPA 5FFNA 2QUJA 4J76A 5BYKA 3AZQA 2G9NA 3RUPA 2D2FA 4FXOA 1KVSA 4I99A 2C9YA 2P9BA 4JOBA 2JRLA 1V16B 3K32A 4ZT2A 5CA0F 3PHCA 3T7IA 1NLFA 4OQQA 1U1GA 3T3EA 1RAEA 3MGGA 4Q6WA 2OYCA 4TTAA 1GZDA 1IHXA 4IFTA 4EFLA 1NT2A 4DV1B 1K4YA 3OCVA 4NEGA 3VBEA 3VPBA 5FTMA 4ETMA 1ZX1A 4JU9A 3HVJA 2W6ID 3G9UA 4Z8XA 3QE4A 5ALJA 1I6KA 5C46F 4D26A 3HVRA 3K15A 3MCAA 1U8CB 2O5EA 2IV7A 3DZGA 1FRQA 3HNOA 3MHTA 4KO2S 1JEYA 3G8BA 2N9UA 5EI5A 1E4EB 3M6VA 4I1SA 4FT2A 2ZYAA 1YS4A 4DV2B 5T4HA 1JTVA 1JRLA 1Q1AA 2VDKB 3ZWCA 1UBLS 2HOQA 1YH3A 2C57A 3DZBA 2K87A 4X3PA 2XA2A 4PSUA 5CNIA 2R8ZA 4KW7A 2JFQA 4OOFA 2FU5C 3ROKA 4ENUA 2AOTA 3SOZA 2UYCA 1G7TA 4S0ZA 2EDAA 1U81A 4JSTA 2X0FA 4ZEVA 1W73A 5FJJA 2J4CA 4QASA 5IZ4A 4D9EA 5CA0B 1AT1A 5JSUA 1D1QA 3IUQA 4E5VA 1M2OB 5IU6A 5J1SB 2BFDB 3ETNA 3HCFA 4RD4A 5BSTA 4F8EA 1PTJC 1SCQA 3UPTA 4PM4A 2ADOA 1CYDA 2AWNA 4WE3A 1YUBA 2V6GA 1CY0A 2YYYA 1PR1A 3V7NA 5KNLA 2ZYUX 3NBYC 4RNCA 1XK6A 3HYNA 4S1WA 3IKTA 3QE9Y 2UYOA 2NN3C 3BIJA 2VH5R 4OSEA 5L7TA 1NOIA 1W6RA 2I3ZA 3SK0A 3ZXXA 4D9CA 2QYOA 3LC2O 2AZMA 4G23A 1Q2XA 3A2NA 1Y80A 4TMYA 2Q4OA 4HXGA 2FSVC 5GY7A 2Y67A 3H0KA 4EJSB 3WRVA 4DMUB 1O2DA 4EFDA 3QIVA 4LWQA 2CJPA 3ZCVA 4J1SA 2X41A 4E3ZA 4CCWA 5ABPA 4IUCS 3LUHA 4KE8A 4CKCA 3RADC 4ZOLA 1WOMA 1FLDA 2WMOB 5TQ0A 3G9XA 4UM9D 4RVDA 2F59A 5AI8A 3UAXA 3L0OA 6AT1A 2BYTA 1W5AA 3JAWB 2AK3A 2LP4Y 3JZMA 4G0OA 4QM7A 4RD2A 1ETUA 3KVNA 4CFSA 4L5IA 4XX0A 2NU6B 3GHHA 4MV1A 2CMFA 1KP2A 3MBIA 1YOVA 2XUFA 3OF3A 4TV8A 3JV7A 3RIMA 4ETNA 1XCMA 5H70A 4WZ6A 1QS0B 1RVV1 5LM3A 1CY6A 3CXUA 5BUSA 3ZDYB 3OWHA 3ZE7A 3FAKA 3TDMA 1G1AA 3E1GA 2XY4A 4B44A 4KMMA 4WOKA 1B26A 3DWIA 4DC9A 5KX5A 1CQXA 3DKPA 3PHLA 1KJWA 3MD9A 5F5LA 1E7WA 1GPAA 1Z7BA 4EABA 3URKA 4FMCF 2C8VA 3H7IA 5DFAA 1AA6A 1XIVA 2NUTB 2WHPA 1AOXA 3UT5A 4HUQB 4RZQA 4DZRA 3THXB 4KZPA 4MVJG 4WCDA 4LSMA 2EL7A 1KOLA 2ZW9A 4H7KA 3AH8A 1LLDA 2XJ9A 3DEJA 3K0AA 2RDMA 1KYYA 3C24A 3MTGA 2GEDA 3LBHA 4L28A 5C3MA 3ESXA 3GUZA 2R7AA 1JX6A 2V5VA 2Q41A 3A0RB 3VZCA 4JR1A 4MV6A 5FWDA 2I76A 2HZ7A 3NBAA 4ZWNA 3UMJA 1RKBA 2JH3A 4Z9AA 4Q3OA 1XZPA 1OV6A 2C7OA 3M1YA 3CG4A 3ICPA 5JVDA 4IUBS 5DO9A 4OB6A 3WKCA 1RI3A 3MRVA 1HDRA 4ZVVA 4Q3DA 2Q5EA 5HMMA 5K3CA 3OD1A 3R9IA 4AJ9A 4NFYA 3VI3B 3FA2A 3HB7A 1WLSA 1UPFA 1AZWA 1J7KA 1T8SA 4EELA 3LTEA 1I33A 4LHXA 3TQHA 1WMDA 3KD3A 1LW7A 1J8FA 1FFDA 1BMTA 2X8JB 3BF8A 3CCBA 3GAZA 5T8KC 3ZWMA 4MHTA 2CFCA 4B3JA 4BN4A 1QH8B 1YFKA 3C8HA 4TL9A 4E7OA 1UAAA 5DNDA 2Q9CA 1MC8A 3UFXA 4KXLA 1PNVA 1KC1A 4FU0A 4QEKA 5HUJA 3AUJB 1LLQA 1DGQA 4CHTA 2YW9A 1B1CA 3VO2A 2QW1A 3E6AA 4ZVKA 3WLOA 3HBAA 2CMGA 3B3FA 5GJVC 3L7AA 3ADKA 4NG5A 1VCMA 3CRNA 3GRYA 1NYLA 3A2LA 2JBWA 2X3YA 4D02A 4E46A 1MA0A 2GJ8A 2QU8A 3O1IC 3Q6IA 3DLPX 4PCLA 3QUBA 2G06A 2JFFA 5E4JA 3TIXB 1IB6A 2EKQA 3CB2A 2QRVB 3OZUA 5FL7A 2QRZA 1HDXA 3D2BA 2F9FA 3EBLA 4QHYA 1M7BA 2FRXA 2R4UA 3TR5A 1F0NA 1ZW6A 1C2TA 1A8SA 2JJ2A 2ZJ4A 4JBNA 1T8RA 4HH1A 1HI9A 4NDAA 3W79A 5EXDA 3ZDBA 1N2JA 2ZYSA 1AF4A 3IEKA 3UYLA 6Q21A 4NHEA 3L1KA 4Q1CA 4LN1A 3Q9UA 4B5KA 3SC2A 2WTUA 2Q28A 3O91A 3QEJA 4DCSA 1TKRA 4ERXA 2Q1XA 4F84A 2OHGA 1K66A 3C4JA 3UJNA 2YXDA 1IDN1 1IB0A 4HDRA 5A5GA 2TS1A 4FFWA 3QFSA 4F06A 2GO1A 1C7EA 5E9WA 2FWNA 1HURA 5IP5A 5ITWA 1S2GA 5K20A 4GR9A 3L6RA 5FLXA 3MJ4A 3AOGA 4FEAA 4MITA 5BQFA 3WLJA 4QQKA 3IPCA 4FFNA 1JPNA 2VRCD 2HLHA 4NK5A 1NMQA 4R0NA 4KRYA 2LW7A 3D7NA 2BGNA 4N5NA 4QT0A 4A2CA 4A9AA 5K6AA 1XU7A 1Y4AE 4OAQA 3M2PA 3OUUA 4EF5A 4C0XA 4PLCA 2R5FA 4RD0A 1W36D 4DMFA 3L3BA 4PZEA 3MFYA 4R98A 4ES6A 1YAHA 4CG1A 4Q7QA 3QYFA 4X1IB 2AJCA 4XWGA 1CJTC 1T1EA 2IUSA 3QRWA 3CLTC 3QOFA 4LGCA 4X6UA 5E9QA 2VPXA 2WG0A 3VJKA 1NJ1A 5G0VA 3UANA 1RR6A 3L1IA 2O57A 4B3DA 4G0NA 4LW8A 1PNQA 1BEEA 2FN9A 2I4TA 5CM9C 5JY6A 3V97A 3TOSA 3W5AA 1N2BA 2GNOA 1W85A 2P67A 2VCHA 4XJTA 4LRSB 2QMQA 5ECYA 3KKMA 2WIAA 2WR8A 4OXXA 3VKFA 3ZYCA 4MUFA 5DYIA 5E2IA 1GG9A 3W1EA 3PEEA 4EAAA 1MX9A 5EE5B 3UW3A 3FKJA 5H02A 2RHGB 2C7BA 5COQA 2QRLA 2HWYA 3JZDA 3HJAA 3TCXB 1Z22A 4EG6A 2WMNB 1A5TA 2B9EA 2IEGA 4YXWA 2XYVA 4P22A 3U62A 5DGDA 5DEOA 1Z0KA 3OEYA 5CAEA 3MYRA 5AOCA 4EW1A 3BMCB 4A8TA 1PS9A 2I6QA 1RQ2A 1X7WB 4XIJA 3QWBA 2V96A 1ADJA 2O14A 2I80A 1H42A 1W49A 4DFDA 1MJGM 1GCUA 3A1VA 1RDFA 4ARUA 2HF7A 4HLQB 2ZYRA 4D0SA 3DMTC 2ZRBA 1F8XA 2DYKA 3HYRA 5KWVA 1K5HA 3RTBA 4EHJA 3T4XA 3KQPA 5LKRA 4JKIA 1FVOA 3K1TA 3GP3A 1M0EA 2BY4A 4MW7A 2SNIE 1PJAA 1PV2A 2Q1TA 4S1NA 3T3PB 2IODA 2UKDA 1V45E 4CW7A 1ZY2A 2AD5A 4OH1A 5K0JA 4JBIA 1FDWA 5DHUA 1HKUA 4JODA 5KTSA 2LDBA 1ZCBA 1GGHA 2JJQA 1YAJA 4P9NA 1LPBB 2ZI5A 2ZJ8A 3F96A 2GJ9A 3VV2A 1DJPA 4A6XA 3VPHA 2ZI6A 5F1YA 1ZSYA 2XNSA 4W82A 4RY9A 1G4AE 1QJCA 1ZRMA 3VSAA 2XZOA 3JQPA 2SECE 3C5HA 2WTEA 3ECCA 3EZLA 4RDHA 4XGNA 1E98A 2PT5A 4KH0A 4LX8A 1EUYA 1VLJA 4KNYA 4XI9A 1QIEA 2J3KA 1BIFA 4HSEA 3TZQA 2EZTA 2Y4NA 2QSJA 3AOEC 5DKFA 4V0KA 1Q11A 4G4IA 1L4UA 4W8OA 3OHMA 2ZJ0A 3KKQA 3NHPA 1JGTA 3VSDA 1DWQA 1SD5A 2GOYA 5JAUA 4D9IA 3N1UA 4EPVA 2H9IA 1WWKA 4R31A 2AZTA 5IM4F 1AUVA 2GN8A 3F8WA 3KTFA 4BYGA 1X14A 1KFKB 2PFGA 2VDRB 4CKZA 2ZTVA 3RYTC 2E55A 1TPZA 1KZ6A 4Q3NA 1A98A 1QOZA 3W4IA 4HJXA 1Z68A 2COUA 1H94A 4IFEA 1PK7A 2PVCA 1KPHA 1OROA 2WT4A 3UJ8A 3VDRA 4OKSA 4CRWB 2Q27A 4M7PA 4UXJA 1TJ3A 3RT7A 1YA4A 3RFCA 5AIBA 1TUBB 3ZY5A 2KM1A 2WWTA 4DNQA 4Q4JB 1HF3A 3PFIA 4FQ8A 1JQJC 3PDWA 1U2PA 3O9MA 3IDZA 3I09A 1U0SY 2PUHA 3PHHA 5LU9A 3IHTA 4OGFA 4GDFA 4K8RB 4WADA 1YGPA 2BSXA 1RXEA 3GXBA 3HADA 4KL8S 4Q9KA 5CXQA 1UMCB 3ESCA 5KNBD 5JROA 5F2NA 2X9NA 1JB1A 2C3MA 4JJ6A 4QPZA 1FP2A 3PDCA 4IYRA 1MBZA 1PWHA 1XTBA 1JSRA 2Q3EA 3ILYA 4QU9A 3TLYA 4KO1S 3VTKA 1VJ1A 5CNKA 4ZCPA 4EHHA 1PR2A 1NUQA 3S1AB 5COBA 2UYQA 3GROA 3IJ5A 1EG2A 4HSGA 4QQRA 1K5PA 3K05A 1PW5A 5DTJA 4KIWA 4WLOA 3GLSA 4RA6B 3IOYA 5DOZA 4CF6A 1JFTA 2DHDA 1KVQA 1SXPA 3G89A 3MMNA 4L1KA 2V7VA 1X1RA 2R6HA 3G88A 1L8AA 5B58T 3K5HA 3B5IA 3HXOA 1A5SB 3DAGA 2IU0A 2QY9A 3ORYA 1QAMA 4Y9UA 3AI2A 3C2QA 4LGVA 4B4VA 4CLRA 2B8TA 3WLNA 3PEFA 3I64A 3LXRA 5KKCA 1ZL2A 5FF9A 3U3ZA 2G82A 3NBUA 3C6BA 2FX3A 4LKOA 3RTAA 1C3LA 4M22A 4BO8A 2VQDA 5L4LA 3EPLA 3TECE 2ID9A 4HUJA 1VI6A 1M0TA 3PUWA 4IVRA 1E9EA 2ASEA 4YALA 4GPTA 3TOVA 4TWAA 1PGOA 1SBQA 5AVSA 1UJNA 2FPIA 2PH7A 4JLOA 4YDSA 2E4AA 2W2OA 3DTVA 2HMSA 2QPTA 3PD0A 4B48A 4MKHA 4BEVA 1FNCA 1E2KA 2C9ZA 3CZ5A 1YVEI 5FUBA 2J32A 3TUZC 2NWQA 4HS9A 4JIMA 1FRVA 1LV8A 1PG0A 4PYOA 3H2ZA 4WY5A 3O82A 1NG9A 3QOYA 3KB6A 4A16A 4AJNA 4NMMA 4TRMA 3B3AA 5LMUB 2IH2A 3D1LA 3QBJA 3HWSA 5AUQA 1F2TB 1Y6GA 1JKIA 3AVYA 3FYTA 3I2GA 3LT4A 3LCVB 3LUPA 3Q3HA 5G4KA 5JSKA 1O5TA 2RJ3A 2VJMB 4Q93A 4UJ3A 5BW6B 2CJWA 1QRSA 6LDHA 1ZU4A 1PIWA 2B3TA 3KT6A 3PJDA 4QJ5A 4JB3A 2OD9A 4L8WB 3CVOA 3EARA 5IT0A 2HQSA 5EKXA 4E14A 1N5RA 1P4JA 1U3GA 1GV1A 3C39A 3O95A 5EWLA 3H9UA 1YE3A 1Q7RA 1UXKA 1YTLA 2HADA 2ZUBA 4KDCA 5CURA 4CQJA 5KQPA 3M34A 2WK1A 2I1QA 4J16A 4YT4A 1KDTA 3WGLA 4HQ6A 4YQEA 4HNGA 4TZTA 2G36A 5JEEA 4HS4A 2RAFA 1MQSA 2R1UA 2KJQA 3H1GA 1H2ZA 1HK7A 5L7WA 3O7WA 4LJYA 2JAPA 3JQ7A 4HDNB 1RACA 3O5AA 2Y6VA 3V34A 4C43A 1UBKS 2W6PA 3H3JA 2J1LA 2JGDB 3MJEA 1ESCA 2WA1A 4JB8A 2F8TA 1N2CA 1K88A 1P2TA 2VDVE 4L4UA 3S68A 3CJQA 4UVEA 5WRFA 2ZANA 5AVUA 5EFOA 1R0RE 5F98A 4RPIA 3GVHA 4EARA 3ZCRA 4DCCA 2HQRA 2AZ4A 2HHAA 3AB8A 5BW5A 3AB7A 3NV7A 3DF7A 1I0IA 1ZONA 3U0BA 4JQSA 3T3IA 2I3GA 3OIWA 2P9TA 2B2CA 1PR3A 3WL8A 4A1FA 4N7BA 3L6UA 3NIBA 4XQEA 4DYHA 3IE1A 4IGIA 4YROA 1UBSB 2HKIA 2CWWA 3RUCA 5MN6A 3LNTA 4D3XA 2BFAA 5M3BA 2IWHA 4M1MA 1RYYA 4BP3A 4Z51A 4IBOA 4MQ4A 2ONJA 5IUNC 2VQEB 2B4AA 1ESMA 1HL3A 2YXPX 5JFOA 2F17A 1NUPA 4U7PB 3I83A 1NJGA 1HMPA 1XPUA 1N2EA 4A2PA 3PQDA 4P33A 4BASA 3HLKA 3V8BA 4IJ6A 2YQZA 3ILSA 1KFEB 3DE1X 4B8WA 5FADA 4W7HA 3DR3A 4BVBA 4O4JA 5LYJF 5LD2C 5CFLA 4I14A 2OQIA 1LXCA 1KI6B 2VJKA 2WAYA 4JP2A 5AW1A 1G8GA 3B82A 4BMVA 2GAOA 3GLKA 2IQIA 4GC5A 1Q92A 4WFJA 2EC5A 3DF9A 3I1JA 1LC3A 2WIFA 5D6OA 2OC9A 5J4HA 4WK2B 3HCNA 4B4OA 5GZ6A 2JEYA 1PSWA 3ESZA 3AEXA 3H1TA 2QF7A 4RLHA 3OZXA 1E3SA 3GFQA 2XGJA 3IV6A 2GNPA 4DJAA 2ATXA 1FUYB 3OZVA 3PF9A 3TLXA 2JGAA 4DLPA 3TRJA 1JQ5A 2QMEA 2CXSA 3O90A 2ZT5A 1XP5A 1NQWA 3OJWA 4INJA 5F1PA 1L6RA 4YUAA 2V7WA 4F1KA 4EH1A 3B9RA 1WF3A 3D0QA 4I4TB 1RTTA 4GGOA 4R81A 1NKTA 3IHKA 2DERA 2P4QA 3TTUA 1PT7A 1YO6A 7ADHA 3DBLA 5JRZA 5FPKA 1VFNA 3R41A 5CHYA 4CI9A 3HU3A 1T26A 2IYWA 3OFKA 1TT5B 2O2GA 5B58C 3D64A 3ILHA 5TX7A 2JFUA 1ICIA 2WSBA 1UK6A 3EUFA 1LKZA 2JPDA 3EF0A 4H08A 4WRRA 3IPLA 4XDYA 2BCJQ 3BMNA 5LYJB 3E84A 1L7MA 2J9FB 3BGSA 4U3JB 4YT8A 2I7TA 2AX4A 4E70A 1XTVA 5CA0A 1Q2UA 4ZAWA 1E2LA 4N49A 1QG0A 1I24A 1M2OA 2OE2A 2IDJA 2OHOA 3GJTA 2BFDA 4LIPD 2Q0SA 3NHYA 3CKLA 1ZS9A 2JH9A 1RWPA 1XDSA 3ZHVA 1OYYA 1R8JA 1M1YE 3RS3A 4ABYA 1S01A 5JANA 4J4TA 1NQOA 3RI3A 3BXOA 3MJRA 5AWFC 3TBFA 4GQIA 3I9V6 3AK4A 1VA5A 1H8ED 2R8XA 3KU1A 2C00A 1HM5A 4RANA 2I6SA 4QC2A 1IZ7A 1P0PA 2FFBA 4G97A 2NTYC 3V55A 1KI9A 2Y1OA 2HJWA 1VRCA 4L5BA 1NZDA 1JYSA 4DDKA 5BSGA 3OIFA 1AGXA 1KZ4A 4L6CA 4CN8A 1KBZA 5JISA 4TTSA 4EJSA 4HB4A 3G3EA 4RH0A 3AF1A 4C22A 4B5LA 1NNLA 4WZAA 4PX5A 1NFFA 4EY3A 1GPDG 1QRDA 2RIPA 1R5OA 3DD5A 4DLLA 3BICA 3OCZA 3SE7A 3VZQA 2CNLA 3AP3A 1U7TA 1RTKA 1Y1SA 2CVFA 2FV8A 4FR2A 5KJEA 4BCBA 1SRRA 2VPIA 2GD6A 4GE0A 2Z3ZA 3AJDA 4B2YA 1E62A 5JI2E 1WHTA 3AJRA 1HEIA 3AHEA 4C4OA 5FDFA 4PBSA 2Q5HA 2IITA 3O6VA 2PD6A 4QSMA 1K9SA 4RHFA 2FN7A 3ENWA 4OQEA 4TKMA 4DBLE 1U6KA 4O2AB 2GWHA 1US8B 2FN3A 5TB5A 5JO0A 2OEPA 1ULTA 5ERXA 4CHGA 4RMGA 5ICCA 1Q1NA 3HI4A 1J20A 3MTEA 4PYMA 1V41E 5FWXB 3ELYA 4FUQA 3TL3A 4PX3A 2K7FA 2IYSA 4UXHA 1NULA 2A5JA 5K8IA 4L5YA 2PDAA 3UAZA 1VHLA 4MVYA 1ZHHA 1Y42X 2XWPA 4M88A 3SVZA 4RMIA 1FVXA 1M9NA 3ETLA 1H8HD 4FGWA 4MLCA 5EHGA 4US2R 3THXA 2R7MA 3UWSA 1EK1A 2ORIA 3B5JA 3KLOA 4TLCA 3BIOA 4P4GA 2NUAA 4HC4A 2FE1A 4YJFA 3P9XA 4AMBA 4I5IA 2ZVPX 3OCJA 4RHXA 1HV8A 2EEZA 1CS0A 1WIWA 5ESWA 3ZS8A 4AJIA 3KQUA 3QXCA 1DEXA 4CLOB 4L3OA 2YR0A 5EIOA 1A76A 1G5IA 5DULA 2O8VA 3FPHA 1HYBA 5FYQA 4XQ0A 3BRCA 3LZ6A 4YP6A 3V9PA 3DBRB 2YNMA 3QITA 1JSZA 3S70A 2GFHA 3T5BA 5DW0A 3MIZA 3MOIA 3MCVA 2QYHA 4MNTA 5A7GA 2BEKA 3VNBA 1VBFA 1XAIA 4DMGA 5JXWA 1KO8A 2OORA 1LNQA 2B0CA 2OHJA 5EJAA 3HR4A 3LLCA 1TX4B 3EDRA 2B92A 4KK3A 3UHOA 1FJXA 1TA0A 1UF9A 1EFLA 1RWOA 1U7XA 2FR8A 4Y7DA 4OI0A 3I5AA 4LZPA 3GJ3A 1EG7A 2PWZA 3PA8A 4WBXC 5T4FA 3T4EA 1NIJA 3U31A 1JI0A 1RP7A 2O59A 1HE8B 1PG2A 1XLTC 3N2GB 4OXRA 3UB4A 1HE1C 4XD2A 1QH8A 1VL5A 4OK5A 4YMLA 1T43A 2EIXA 3HRKA 4F6LA 3UWKA 3IQXA 4ZAXA 1WG8A 2W6JA 1LWOA 3CTPA 4B34A 4ZMSA 3N8HA 4M1TA 3DFZA 3I9OA 1KJJA 2BELA 4FGSA 1ZMXA 3A4IA 1IY9A 4AJ4A 1HY3A 1OI4A 2Q3BA 4UE3S 5EHIA 3KUDA 1UL1X 3D0RA 1JKMA 2QRHA 5TS3A 1TM5E 4IDEA 1T5TA 4M86A 4F7DA 2VAWA 2B5OA 3JYOA 1V6AA 2JFWA 4BMPB 2QRVA 3RO7A 1IJEA 1EAYA 3QUQA 3OG9A 1PJCA 1Y8RB 2PAAA 3O1LA 4KR6A 1SKAA 2NQTA 4KAAA 4TZKA 3D7MA 5DNWA 4W1SA 3R6WA 2IT1A 2R79A 4TTQA 1Q1GA 3KQYA 1HNNA 1NURA 4UTPA 1R74A 4F6RA 3U4MA 1P0QA 2LV8A 1N8TA 4RA9A 4PYLA 4E1VA 3USZA 4OHBA 4EUEA 2WJAA 1YQDA 2HJVA 3A70A 2H1WA 4YAIA 3SF8A 1K6IA 1I2BA 1NUSA 2OFOA 2HIGA 1CUYA 1PJTA 3WSTA 1TF5A 4J75A 1D0SA 5IEBA 3ENQA 2IH4A 4L5AA 2X6RA 4KHPB 2DWCA 2FZKA 3NNDA 4HFMA 4ILEA 1EXMA 5EOVA 5IH3A 2YFYA 1IDOA 4MP6A 4EF6A 3C3BA 1LQ2A 2GHRA 2LIPA 4HMOA 3NORA 1KXZA 2BZ1A 3WZLA 3PYLA 3TMYA 1Y8CA 5T67A 3IBCA 1YJ5A 3OZGA 1TPYA 3ZHBA 2OHFA 2QENA 3H4TA 3Q85A 1B23P 4BEJA 4MJLA 1HTBA 1QNLA 3MD0A 2QP9X 3U49A 1FTWA 5DWQA 5KAMA 3L1UA 5JC1A 5JXGA 4OJYA 1IM2A 3NIGB 2E4UA 3KV3O 3TIFA 3O4HA 4F21A 4QNNA 4BLUA 4PYRA 3WYFA 1W52X 1GTVA 3MZ0A 2MINB 2XQFA 3EQ7A 3FY4A 4Z4HA 1JBKA 1GTZA 2O5VA 3P2YA 5FO0A 1ENOA 3TVYA 1RW4A 4HX2A 4XYGA 4CIAA 1ZGJA 1TADA 2DVMA 5TT1A 4A1OA 3RK1A 1D2RA 1RZVA 2JI6A 3RRMA 3VR5H 2B5VA 1X7XB 1NBMA 1RQNA 4PNHA 1K8RA 1BTOA 1GN8A 2AN5A 4HAUA 1WBJB 4JU8A 3AKDA 4L27A 5B53A 2G70A 4F4DA 4G5OA 5HE9A 1JHOA 2YVLA 4ZT3A 3RASA 4WY2A 1VFPA 2GBGA 2EZ4A 2XEDA 3AFOA 3BMCA 3LXXA 4HEHA 1C5KA 2J9ZB 1X7WA 2I9PA 4C9BA 1L4HA 1UPBA 1ZNQO 4QOFA 5I9IA 1N92A 2KI5A 3CONA 3KKKA 1QP0A 2GBFA 4PIMA 3JZFA 4YJ3B 1C0EA 1R0WA 3RT1A 4TMXA 4S3MA 4RCZA 3N2KB 1S96A 1GJRA 2Y66A 3E23A 1DBPA 2C7VA 2J6IA 5EERA 4N82A 2CCJA 4HH4A 1RIIA 3QVJA 3UCFA 4MYDA 3I8OA 2GCOB 3FZEA 4K1XA 3IERA 3JAKA 4RCYA 2HJRA 4WKPA 4ZFNA 1ZH4A 4D4HA 2PT6A 1GL9B 3LC1O 4M83A 5JPCA 4P3OA 4C20A 1JPUA 1YZTA 2Q3FA 5ES3A 1FYWA 4DQUA 4P3XA 4XX1A 1KKUA 3MCTA 4KAFA 1HQYE 1UQTA 4ZAGA 3P9CA 5B6PA 2H63A 2JC3A 5LL6P 2QD3A 2VF5X 1PF7E 4F2WA 4P4LA 1RKXA 3GCZA 4UTRA 3DZJA 1F2UB 5LLDA 1ONPA 9LDTA 4WVLA 3NHUA 3GFPA 1NY5A 4WW0A 4EA6A 1UBUS 1SQFA 1JEQB 2PX5A 4TLAA 5BQXA 2QAJA 4LHZA 2DFLA 1WMSA 4WOJA 2AVNA 5AKJA 3CXRA 1EQ2A 4C0QC 1A3CA 4Z4QA 3COWA 3S2IA 2LWIA 3TOZA 4V0MA 2VTBB 2GYUA 2VWQA 5AUOB 2REBA 3FJ1A 4OMFG 5EVCA 3GFRA 4URWR 3CN9A 2V6IA 4M0MA 4EUKA 5IVDA 1L5MA 3T35A 3WIDA 5KNDH 1A4XA 3HCAA 1BE1A 1BHSA 4PYQA 1I7DA 3UG6A 2C0PA 3EGXA 3ZNOA 4A8JC 1VHDA 3PR3A 5AM5A 3OHPA 2JFVA 3IUPA 3SPXA 4CM7A 3FR8A 4M49A 3KLMX 2IYAA 3AKEA 4NI5A 3OPYI 2PGJA 2A1UA 1QXSA 1NW6A 2BHRA 2GJAA 4PHFA 1O87A 3HUUA 1OU4A 2CNDA 1PFKA 3AERB 4CMHA 3P20A 2YKGA 3L6BA 3H1AA 1DG3A 2X5XA 2RGBA 3I6IA 3M6IA 1EVEA 5L53A 2EGHA 1D5CA 3CLRD 3I01A 4F45A 1GZ6A 1U90A 4RKYA 4IH9A 2WM8A 3INGA 2A0UA 3FKQA 1KO5A 3PDJA 4HYQA 1R9NA 2HM7A 3BTUA 1UBCA 4I2VA 2QP4A 4D8TA 1RAGA 2QLNA 1GRRA 3AJAA 1GFWA 1XVUA 2AE2A 3OQBA 1E0DA 4JUBA 4R01A 1PUJA 3ZNQA 1QYIA 2PJUA 2ZWOA 1KEEB 3C8MA 1YI8A 5TQ2B 5K3FA 1DO0A 1MG0A 1UMCA 2GYVA 3AEQB 2HQBA 1JIQA 3ZBTA 3EZFA 3LNCA 4AZVA 4DAEA 3RBVA 1QZXA 3L0PA 4FOLA 2GJKA 3CX3A 3AZPA 1U8UA 4MJXA 5IM4A 1U2RA 2BWJA 2FJPA 3GH1A 4W5JA 1UQUA 3OICA 2EW8A 2PL9A 1OHHD 1WB9A 3WK8A 2IYZA 2WIKA 2ZAIA 2IE0A 4UHEA 5K0EA 1H93A 1M0WA 3VR4H 5ICGA 1C30A 2Q07A 3DVRX 2VQSA 5IVIA 5IFKA 2LPMA 4HT3B 3UK6A 1YR2A 2WI8A 4FSHA 3KD2A 3M82A 4PPGA 2R44A 3NPAA 1SXJE 2IP2A 1YZKA 4JX9A 4NDZA 1YDFA 4NZ9A 4MIOA 1VYUA 3B48A 3MWFA 3TZCA 5EY5B 3WJAA 3SHOA 4CCYA 1FXWF 2P35A 1ZXBA 3JASB 1Y7LA 3EWAA 3T3NA 3FTCA 3ADDA 5CDTA 1GADO 3HYLA 4E31A 4PZ0A 3IAS1 1ISRA 3HE3A 1AURA 1J2EA 3NHFA 5AXDA 1IVYA 1ZUIA 1LX6A 3A27A 1KORA 2XMRA 3GMDA 3Q1LA 4HXEB 3Q10A 5FLEX 4CKYA 1GUAA 4XFKA 2CNWA 1PL8A 4RC9A 2XNJA 1I2ZA 3DOHA 5LSAA 3LBIA 1IULA 2KX7A 4LK3A 3EQ9A 4ZT6A 1A7AA 5HZKA 3JQ8B 1WPQA 4CEJB 3H1PA 3E5RA 4JXKA 3F0TA 1CD5A 2AWOA 4C07A 4RAQA 5JALA 4YC7A 5MN5A 2RI6A 4BZQA 5IVHA 2YYAA 4U7WA 3EZ6A 2WNHA 3W2FA 1F2TA 1ZK2A 2YY6A 5DVZA 4QBGB 4JI1B 4FWIB 4WVFA 3RHTA 1L7XA 5A5VA 4GSKA 5BSEA 4ODIA 4D43A 4J4HA 1U1CA 1KEKA 3ZD8A 1ZP6A 3AHHA 1QQ7A 3EVCA 4NCNA 2QTAA 4M54A 7MHTA 5K3DA 3TMKA 2XIJA 4CKWA 3KQHA 3D3EA 2FW8A 3S99A 4RK0A 3VNVA 2Q4TA 4UMVA 4ZOEA 3NBQA 5FV7A 4Z49A 2GI4A 3F98A 3FCEA 3OQMA 2RI1A 2CXPA 2PUJA 1G5TA 2O05A 1T3ZA 2DWOA 2FPSA 2ACWA 1TKAA 3I2IA 4Y1RB 2M6LA 4EY4A 4M8SA 1G8JA 1YR6A 3OH8A 4N1AA 5AJWA 3PWTA 1D03A 4L4XA 4CQMB 2A8YA 3KSUA 2ZXEA 4UPEA 3LK7A 1FU4A 3OJEA 4HDNA 1CY2A 4NQRA 3OE4A 1I32A 2C1ZA 2WWRA 4BNLA 3Q5GA 1C1HA 1DQRA 2JGDA 1FUUA 1QFYA 1E2UA 1VBKA 1YT5A 2Z09A 4PNZA 4Q4HB 4AB1A 2RE8A 1E2QA 1R6AA 2FQXA 2XRYA 1PR5A 4PHHA 5BMVB 2H9YA 1QG4A 5AW4A 2A14A 4NSNA 3BGWA 2XNCA 1VL2A 1UDXA 4OB8A 2VQFB 4XVUA 4ND2A 1QPBA 3HFJA 3P9SA 3RF7A 2XA9A 3BE8A 1JHVA 1VIAA 3HRIA 5GJWC 3SG0A 3IP9A 4WNAB 4Z99A 1FMJA 3UV7A 1XMXA 2PO7A 5KYUA 1DUVG 4YBZA 2DY0A 1CQZA 2M32A 5I9BA 4H35A 4AK9A 3K1JA 3KE8A 2HCRA 3GA7A 1YL7A 5HIKA 3CJRA 3UJBA 3FIUA 1MO2A 1X70A 4NICA 3ROEA 3BHNA 2GT1A 4OJMX 2LNDA 4PYNA 2C59A 4UBOA 4Y6QA 4Q4AA 5GOTA 3K73O 4L22A 1AS3A 1OLUB 3LBAA 1DXHA 4D4LA 2WJIA 2Z6QA 4NBUA 1V9SA 1AQJA 2AZDA 1ACJA 2OB1A 3OTHA 4GPAA 1DMSA 1HG0A 5SZKB 3RSQA 3M4YA 3LQ1A 3PE6A 1U28C 2IKQA 3IFSA 4QXOA 2IYOA 2HT6A 3PFCA 4MYSA 4D0LB 4KO4S 3UCEA 3BSWA 4OAPA 1ENZA 2PZKA 4R1PA 4ZCMA 1VMDA 2RGAA 3PWZA 2Q9UA 2RGXA 1PV1A 3DZCA 1ZBDA 2P11A 1KJNA 3W90A 3Q9LA 3AIOA 2Q3JA 1TJPB 2QNIA 3CISA 3G5MA 1QBKC 1ZRSA 2D7JA 4P34A 3WLHA 1PEKE 5AVOA 4CU2A 3ICWA 4U7TB 4TYQA 1EFVA 4DQKA 1Z6ZA 2WWGA 4I55F 1CUFA 4LK2A 1GPMA 4INZA 4DZTA 2XWSA 2FXIA 2YV5A 3IP1A 1X1QA 1XFAA 3JQFA 4GAEA 4BBJA 2V3WA 4DA8A 3KXIA 2H06A 2WYOA 2YS6A 4H3HB 3FFTA 2VTVA 4MKRA 3RKUA 3GEGA 3Q6MA 4M7OA 5ISMA 1WXGA 4LC1A 4L7QA 5LYJA 2WU1A 3M6UA 3ZHYA 3O8QB 2DHEA 1HR0B 4H1WA 5AK0A 1X1EA 2BGKA 2HHLA 2WM3A 3H9CA 1WULS 3JQQA 4LQDA 1QIGA 1RM3A 1SCDA 4FGKA 4JC5A 4KIFA 1Y81A 4UUPA 5K3BA 2YOFA 4BO1A 5FBRB 3FYUC 4FD2A 3AM4A 1GKYA 3JRWA 1JBQA 2QVYX 3DLBA 5KNCD 3DOUA 4P4NA 3DV2A 1ZLYA 2I2BA 4YV0A 1DMRA 4M36A 2XA1A 3VFDA 2RH9B 1H9AA 2P6RA 3PVZA 2FSFA 3TLMA 4ZVOA 1GEGA 2QD2A 2X8LA 4QUDA 1JH9A 2Z2YA 1SH7A 3HVHA 3WAKA 1P1HA 4I55B 4KODA 3T9AA 3VSEA 3HKEB 4YCDA 4FYWA 4HL6A 3N8KA 1RLTA 3RC7A 5B6JA 3UO8B 5KJ6A 4IXNA 1NMXA 1RWNA 3IQZA 2IZ6A 5AKKA 2QW8A 4DR7B 2RHWA 2ZJBA 1ZCAA 1QX3A 4PCVA 3ZGXA 3F46A 2WSSA 2C2MA 3LU1A 4RABA 2WUDA 4GU5A 4YQFA 2CVPA 1M1NA 4ZEOA 4DV0B 4F72A 4DSUA 2HJHA 3DFIA 3I6YA 4R51A 2ZRPA 4HMQA 4D42A 5C52B 2W43A 3RIEA 4J3NA 3PUKA 2IEDA 4FIDA 4AJOA 1MVNA 1BWQA 3SEQA 5H9WA 1YQUA 5G4LA 5I5EA 1T1IA 4E22A 3EXHC 2YOGA 1L7NA 3QMWA 3BTOA 4KDRA 4MA0A 4FINA 2PKCA 3WL4A 4C7OB 1QQTA 3HXPA 4QQ8A 4XDHA 4DT1B 5AO9A 3IQDB 4BTLA 1QSGA 2INGX 2ENUA 4JR2A 1WZCA 2HA3A 4X95A 1QYVA 3WWDA 1SQ5A 1LK7A 3DL2A 1OXVA 3D6FA 1BA2A 4MWEA 3SKXA 3TOCA 4D81A 1D6JA 3IUJA 4MKIA 1GD1O 2O3QA 1O03A 5HR5A 1JEOA 2WNIA 1FSZA 1G5RA 1B3RA 3MCZA 4KNWA 3KZOA 3RS2A 1U7OA 3Q8LA 2NMVA 2AMVA 4CR7A 3AUYA 3PDIB 5A4MS 4GMXA 1JE0A 1M1ZA 4AJEA 5EIHA 4NENA 2X7HA 3NZEA 5CFNA 1PVDA 4HGZA 5DNEA 5HKKA 4GM0A 2V7QA 5J5CA 3KDAA 2QMYA 3GGPA 1DVRA 3WGQA 1NC1A 1CNFA 3R3VA 5KYKA 3CBQA 2G08A 3G0GA 3QW4B 4HXYA 5D1HA 2VSOA 3AGQA 4YNBA 1CETA 3STTA 1N0UA 4M46A 1L4FA 2ZS7A 4K6HA 4N7JA 1JYFA 1ULBA 8AT1A 5FBZA 4LOLA 4QGBA 2ZWMA 2IYRA 3ZWKA 3DOIA 4AUEA 4MQFA 5LLTA 2FLWA 2FDXA 2GK7A 3QBVA 2Z9CA 2BGRA 1NXOA 2G40A 1QQ5A 2VOEA 1ATIA 1SU6A 3T7RA 1JKFA 2VP9A 3DQPA 3EQZA 3NIFB 3W4KA 3UT0A 4CLOA 2NACA 5JJCA 3EE6A 4MULA 4MWCA 2X2EA 2OV1A 5JO9A 3UZUA 4WZBB 1WBDA 1K08A 1J2TA 3DBRA 3KSRA 4NBTA 3KKOA 1UP7A 2AC2A 4IIDA 1E69A 2XYHA 1PWZA 4PN3A 5DMHA 1X86B 2C3OA 5AKEA 5JH7F 1HGXA 4QDKA 1C0KA 1QKKA 2PVSA 1Y8QA 2HXGA 4U2GA 5J2TF 2OOSA 4YYZA 5B4VA 5U4XA 3AUFA 1LZKA 4R2XA 4OX9Y 3QLJA 2GSWA 3M4XA 1VCHA 4KXXA 2ZPAA 1QZTA 3NXSA 3RIHA 4HBGA 3U6BA 2ZBFA 3MTQA 5FI5A 3UFBA 4J4BA 3SHVA 2MYNA 2E85A 3N2GA 2PAFA 5C1DA 4WN9B 1AK2A 1Z13A 2YMMA 1ABFA 4RNDB 3M3DA 2WJ3A 4B6EA 2JCSA 2PLNA 3ZTWA 1Z37A 2HCBA 2JEOA 5COAA 1MB2A 3Q3CA 1VE9A 1XMVA 4B31A 1JAXA 1ORTA 1XQVA 4L7VA 3S2FA 3TXAA 5BR7A 4NV1A 1RHRA 5IDWA 3OQHA 4Q48A 5ELMA 3QXHA 4OCZA 4QTUB 2H5JA 1KS2A 2X42A 4CLXA 3P27A 4II2A 4UMEA 3V1YA 1JQLB 1P2SA 2BGGA 4J03A 1JQDA 3RABA 3RBAA 2PXXA 3LG2A 4JOSA 2RKWA 1GYRA 2VXCA 2BFCB 3DEAA 2XZTA 2FZGA 2J46A 1Z4KA 1JV2B 1PWEA 1QYDA 2FPRA 2G63A 1NI5A 1WQ1R 2IBMA 3LUBA 4FJ2A 5JH7B 3PNKA 4M9UA 1W96A 5LP6F 3TW0A 4ARSA 1VP9A 3AM1A 1UDAA 3C3XA 1B43A 1DNPA 2DH6A 5IM5A 2HSDA 1OFVA 2A67A 1YQQA 3BCHA 5EJ2A 1J2YA 1Z3CA 1ZISA 3GDOA 1N2HA 5KMGB 1ZINA 3FCSB 4H27A 5M5BA 1ZAKA 2FHPA 3FCUB 1KVUA 3D4BA 3WQBA 3KQNA 3BGIA 4LXXA 2FPMA 5AVXA 2CE7A 2FEKA 1IAQA 1T6NA 2VDPB 4AL4A 1YUNA 1CRWG 1NASA 1RPJA 2OD2A 1XA3A 2XBMA 1FFXB 1TZCA 3ABZA 1U9CA 2VDMB 3O21A 4YRKA 1G0OA 4ZI7F 2AFHE 4KN5A 1GCIA 2H7XA 4EHAA 1H2FA 2VSQA 4YAFA 1D6NA 2BFNA 3FVWA 2FPPA 4E4RA 2AQ8A 1JHRA 3OPMA 3N2NA 4LFBB 3EUAA 4MS3B 4Q1FA 1FJHA 4RE5A 3VR1A 4ERNA 4FP9A 2G07A 5H7XA 2VJPA 4FNAA 5FFMA 2PH5A 1T29A 3U1BA 3C6QA 2VZLA 2ODEA 3CG0A 4HR7A 4B71A 3MQ2A 1COZA 4BNIA 3LKBA 1QIHA 1NQVA 1SUEA 1T34A 1IZ8A 1VLVA 1UZUA 1Q21A 2PU7A 4FDLA 4E13A 5AW7A 4GX1A 4RJLA 2Z43A 1Q74A 3EIFA 3RTCA 1BKSB 5IZCA 5JAIA 3WP0A 2FW6A 1RAHA 3SEFA 3V4SA 3MTBA 2BFEB 1VJGA 2F9MA 2FUNB 4MDHA 1OB5A 5JAOA 5IAGA 4M87A 1X7XA 4WZZA 4Y6GB 2P4UA 1QIJA 3LDFA 2DM6A 1G19A 4ISCA 2VYFA 1W5FA 3EG9B 4ZI7B 1FFEA 1ECFA 5JCZA 1YS2X 4JK3A 3ET5A 3PJEA 3QKIA 1S2LA 2A9KA 4MUBA 4RD1A 2Q0QA 1KNXA 1YHNA 5EHZA 5A1TA 4C2UA 4K2AA 1D7OA 4O4HF 4I5EA 1GPUA 2YUIA 2J3IA 4QYWA 1NUHA 1VXOA 4MQ5A 4P53A 3SF0A 1RFLA 4E94A 1J8DA 4JI8B 2O50A 3WP1B 2YH2A 1RBMA 3PGKA 4NVRA 4RTKA 3DL0A 4Y7CA 3CVUA 5EIXA 1LB1B 2NTEA 1IZ0A 4UMFA 1EESA 4RPHA 4PTLA 1QHXA 3U7EB 1CRQA 2CFTA 2HJ9A 2GFQA 3PX2A 4JJFA 1IQ0A 3NM6B 2QDXA 2BMEA 2R6AA 1DOHA 4BVLA 3EH2A 3NNNA 5AJVB 1AX9A 3BJEA 5KTTA 3ICVA 5FD8A 4Q5IA 1EXDA 3HLTA 4GVXA 1KO4A 2IY8A 1G1MA 2OHVA 4X97A 1F3OA 3EQ2A 4IHKA 4ZAFA 3K0HA 3E5HA 4DQXA 2GFIA 3F67A 3K9HA 4GGMX 4D57A 3FWZA 1I5RA 1L4NA 1Y9ZA 1V3QE 1GZSA 3VU1A 1NXTA 1UADA 2A1TS 2NZ2A 1F2UA 2C82A 2QORA 4N5DA 4YEDA 4C5CA 3H5RA 5CFOA 1HMYA 3F5SA 4G09A 1JEQA 2Y3IA 1V2GA 4AW9A 1NZFA 4JIGA 2D1RA 3DZDA 3HB9A 4KQGA 1YNSA 1Q0PA 3HHEA 5TGDA 1XALA 4RTQA 2B8EA 1R0KA 1MNQA 1QE3A 1Z06A 3NNSA 3S8YA 2IC5A 2WIGA 5TR9A 2HLDA 2I6UA 4W5OA 1T4CB 1UC5B 3A6ZA 1P4GA 3WK4A 1WMBA 1A7JA 1Y9DA 3QUAA 4WGGA 3QEKA 4PZYA 1FYFA 3S2UA 3OECA 1RRVA 2OKCA 4ZEXA 3WA7A 5KQGA 1IZ9A 4IPTA 3ZOKA 5E0KB 4EW2A 4HGPA 4TSFA 1M6VB 3MS4A 1P61B 4BFSA 5C5DA 3KAQA 3EMVA 1XG5A 3WISA 5DOVA 3H1FA 1Q84A 1TF7A 1P75A 2LGJA 4MPTA 4TS9A 4GXNA 4EJ6A 4E1BA 1Y63A 5GVSA 3FMFA 3ILXA 2H00A 4N54A 3O8OB 3RUAA 3FTFA 1ADGA 2GQ0A 3BD9A 1AA9A 2HSGA 1X3SA 3BEOA 1E1NA 1ZQ1A 2P7HA 4XOIA 3VPSA 1T2NA 5FUXA 4HK4A 2QJTA 2XRFA 3FNFA 1E3IA 3PC2A 4NMWA 1GP2A 4TVKA 1TKCA 4NAVA 1DAKA 3WIEA 3DC7A 5BNTA 4NEQA 4Y1EA 3RARA 5C8VA 2P2LA 2WPDA 5E1BA 3ZD7A 4R1MA 5JAPA 1QVWA 1AQIA 4ZO8A 5TQ2A 2DEUA 1J99A 3AEQA 2I66A 2G9ZA 1C4WA 4U6QA 4MRRA 3HZRA 2A9VA 1M1YB 2I1WA 2IUYA 3HY3A 3SQDA 4NOMA 4WCFB 2VT6A 1OOEA 1R10A 3LRPA 3UG7A 1N2GA 2FPLA 1P8JA 2G1JA 5HTKA 4JJEA 4F4JA 4PSDA 1W5TA 3PRJA 5EJIA 4MI3A 3WIBA 1H6BA 1KP9A 1GT6A 2GJ4A 3EW7A 4I3FA 3HVKA 2YOHA 3CEJA 3K9FC 2XE6A 5TMEA 1XXHE 4BU0A 5C4MA 1I4WA 4AZ0A 1NBEA 1NSYA 4A3SA 4MR7A 2DCUA 3NC1C 5F2EA 3L4KA 1P4AA 4PR3A 1JLLA 1QOQB 1VG9B 2A57A 3PYMA 4B6RA 4BFTA 2QK4A 1LPPA 4F5YA 2BUAA 1GQRA 4MAFA 2DJIA 3OPYA 4G0YA 3SX0A 4Q1BA 5HUQA 5JRDS 1XZLA 5AM4A 2X77A 4WMLA 2ZJOA 2ZSUA 3ZV5A 1RWBA 4ARAA 3LS2A 521PA 4QAQA 1GOTA 5LZ7A 5CNMA 3ITNA 3JASA 3TVDA 3QQ5A 1U8XX 3TNLA 1NI3A 3G85A 1CT9A 2JI8A 2XT9A 3RS5A 1SHKA 2H4HA 5HFAA 3HV2A 4ZO6A 3RU2A 5TVKA 5FUWA 2AR0A 1U3WA 1UXJA 3L0BA 1O97C 1Z75A 1OH7A 2HA5A 2HXYA 3UJ9A 3FSJX 4ABTA 4P7BA 1R8YA 3IODA 4UAUA 2C96A 3W3AH 4EA7A 4DR1B 4WXYB 1ZAYA 2YJ3A 2XE7A 3FVRA 3FVTA 3G2PA 3GLGA 4ZU1X 1KQOA 5EHNA 3KJQA 1DKPA 3AU9A 3L4EA 1YZNA 3AW9A 3MIIA 1SUAA 3U7JA 2FPWA 1XD2A 2VJBA 1XLVA 1LA2A 1ZD9A 4EECA 2W93A 1CERA 4M7RA 4PQEA 1VE3A 5ENVA 4IG4A 2Z0MA 3H19A 4KLZA 2CV2A 3MQ4A 2IOFK 3GNSA 4JL5A 5F21A 1MB3A 4ZVUA 3V4VB 1O0BA 1BYUA 4MJ7A 3M1IA 1M5TA 4QAJA 1FXWA 1IG3A 3GCXA 3CRVA 4LOAA 3U4IA 1DXOA 1I13A 2A9JA 3LBYA 5CEFA 4RV5A 2SKCA 4ND8B 4ALIA 5KSZA 5BNFA 1VJ5A 1THZA 4O2LA 1PU2A 1WDMA 1XE3A 2BN4A 2J4DA 3MAJA 4Y1RA 1Z2CA 4HLUA 4CQMA 2X9VA 4D46A 4ZVNA 1MN6A 4LWZA 5CM8B 5B4TA 2A58A 1E1CA 1MAUA 2Q3MA 2QTHA 5H1YA 1VKHA 4B75A 9MHTA 4Q4HA 5CYPA 1QDEA 3DHWC 4NWIA 5CR9A 4K9QA 1Y33E 5JD6A 4CFZA 4H1HA 1DAMA 4KH1A 2HSWA 1DQYA 4K6MA 7REQB 3BG5A 3P9IA 1LLCA 2PTHA 3S29A 3VC7A 4CCAA 5IF9A 5ADHA 1MJGA 1DBSA 3PQ2A 2B78A 1SQ0A 1L2TA 2C5AA 4M9QA 4NC9A 2Z5GA 1ZQ9A 1PZEA 2V6MA 4AQ7A 1Z6TA 3FRHA 1QGDA 4WNAA 3UTDA 3EXIB 2EJBA 2A2ZA 1N0WA 1JDUA 3H5IA 4V2IA 3IPAA 1HRDA 5FNVF 3RKSA 2H5LA 3PR1A 2QTWB 5KSOA 1HETA 1SFRA 4IJVA 2TYSB 2ZM5A 3VM6A 1RI4A 2D5LA 5DYNA 2RHDA 3LV8A 4DEVA 1AKUA 3TK1A 3N0VA 1F20A 4FKZA 3VQTA 1Q0HA 2HK8A 2WTXA 4B4KA 1YFJA 1B4DA 4R8VA 3V1MA 2RGDA 1C50A 3SMQA 1XFDA 4XR4A 4QJ4A 3SHWA 1FQOA 3Q15C 1RABA 3SZLA 2ADMA 1HE3A 2O8NA 3A1CA 3SHFA 2CJYA 1SD2A 4CL0A 3PVSA 3NTRA 3VAZA 3E3AA 2CLOB 1RFGE 4KEAA 3U9LA 1ZVQA 2WM9B 1DHRA 2X0JA 4KQCA 2XOKA 3MTIA 1NJ8A 1EA5A 1U2EA 1RXCA 4U2EA 3W9SA 4AO8A 5LFAA 1N3BA 1TEHA 2VHJA 4XVQA 2FEOA 4BGUA 1KO7A 2IZOA 5FTKA 2XUQA 4L9AA 5THQA 4MCIA 1IBCA 2FUG1 1XTIA 3MRSA 1LC0A 3NT5A 3WFZA 2UAGA 4JVLA 1KHTA 3U1VA 4B7CA 2QRNA 1XROA 3JQBA 2XBUA 1W2HA 1OZ0A 1VCIA 2WU0A 2RHBA 2NO0A 1OT5A 4MR8B 1SHJA 5B1HA 4LOJA 4DWWA 1KZGB 2WD7B 5K0CA 2OCLA 2FJ0A 5A6SA 2NNLD 3INRA 1KJIA 2VKTA 4MUNA 3IMCA 3CRW1 4OQNA 4C4TA 3K70D 2V7PA 2FMKA 3C7KA 5EXSA 1AQUA 3WSWA 3ZGNA 3UMMA 3JXEA 5IN5A 1RKVA 5U4QA 1KAOA 2ERYA 2WWHA 2C9OA 2YBEA 1FP4A 1QGUB 3FKSA 1GDDA 1XMSA 2PEZA 2DT8A 3BFKA 4BQSA 5GJCA 4C1NA 3SZOA 5JZMA 4B33A 5IVPA 5DF1A 3O8QA 5K4AA 3GI1A 3UKOA 1NF8A 5JWOA 3EPHA 3B6JA 1PFYA 3ZD9A 3RBXA 4Z9BA 4MZDA 3RYFB 1TYDE 3DKKA 2BBWA 4H6XA 2PA3A 2VDQB 5JJBA 5LKAA 1C1DA 4NF2A 3ZU5A 1UT5A 4D4KA 1RNLA 3ODGA 4MLZA 4DLYA 2BE9A 1T8UA 2ZLBA 1E3QA 1RIFA 2BZ0A 2XVXA 4GI2A 4N65A 4FW8A 3VZPA 4NOJA 5TIIA 3EBPA 2HMAA 2B1QA 4W5RA 4WESB 3QTLA 3T7CA 4EBFA 1I5EA 5ALVA 3W5DA 4MQEB 1ZXXA 2YJZA 1F51E 3QEMA 1SXHA 1ODFA 4MGYR 1BX1A 2DUWA 2H85A 4UU8A 5CFPA 4XEUA 4I55A 3RAGA 3NDJA 4FCTA 4PRZA 2W58A 1TZ2A 3ABOB 3QXXA 2YWEA 3VGJA 1YB2A 3JVUA 1IXZA 3MF4A 4OA8A 2J5QA 2G9QA 3G8CA 1E0JA 5DNAA 1DX9A 2DG2A 1RLOA 3H11B 2Y1DA 2O2CA 4X84A 2PO5A 3PNYA 3KJFA 3NH9A 4RZSA 1CJMA 3OTWA 5LZ8A 4UTNA 1KWKA 4R2HA 2K5UA 3QVVA 3OQ1A 3X3HA 1G6HA 1NRWA 1F5SA 3VSBA 1QP7A 2O9JA 2ZTLA 2FPGB 4RKRA 3BS4A 2IPOA 2OVFA 4C7OA 1ODIA 1KARA 4DT1A 2ECFA 2L17A 1DAOA 1PK8A 3OEHA 5FQOA 1PR6A 4IICA 1E79A 2N1MA 1M83A 4NBNA 1AQ6A 2VP5A 4Q15A 5DYWA 4EPXA 3SVTA 1OBOA 4IIYA 4YGXB 2H1OA 4AMUA 2ZJZA 3PIIA 1Y6ZA 5JJKA 1P29A 2DC1A 3BILA 2XXAB 2E3JA 2HHCA 1T15A 2UUOA 1U3VA 4J0KA 1ZN2A 1WKCA 1MT3A 4ZGWA 2HPZA 4MIYA 5KYYB 2P9YA 1HC7A 3C3WA 3CGWA 2C95A 2I22A 3DVAB 4OO3A 5HF5A 3BWCA 4AKSA 4TGLA 2JAOA 4BMCA 3WWEA 4N12A 2OZLB 3GEHA 3GJ7A 4FFVA 1JHAA 5KYNA 1C3JA 2Q6VA 3HYSA 2ID4A 4MPRA 4UCQA 4DCUA 5J58A 4BP8A 3NUGA 2XF8A 3BHJA 2CSXA 3HO6A 1MHPA 1ENYA 4G0ZA 4JLJA 4POOA 2ONYA 4X7RA 3A28A 3VU3A 3ZJYA 1Z8DA 3QG1A 4WNIA 3L9XA 4YT2A 4ZPXA 1J5EB 3OUZA 4Y2PA 3NJ8A 4GP7A 3I5MA 1USKA 1BROA 1UJ4A 4LDNA 4F3YA 4E3WA 4A03A 4DOMA 1UZAA 2YZGA 6YASA 1P9OA 2VRBA 3KLNA 2YDYA 4IF4A 3EIWA 5EWMB 3TQQA 1OLSB 1T8WA 1ZIXA 3A7DA 3BM5A 4EZIA 4W9MC 2A86A 2NSHA 3Q0EA 4KTVE 4C0BA 3X1KA 2GXSA 4WZBA 1OV4A 3EX7C 5K0ZA 2L82A 5DBIA 3HN7A 2QN6A 1F17A 4WXPA 3ICCA 3UHFA 2WYHA 3QGMA 3IAHA 3CRQA 5HYVA 3TFOA 4PFSA 4YACA 2OCIA 4WAUA 1MAVA 2YZMA 4TMKA 2RI0A 1W7AA 1OIXA 3I30X 3N0TA 4GX5A 4HAVA 3V33A 3ZWQA 3LX8A 4O3FA 1RRCA 3SJBA 5DP2A 1LD3A 2QYTA 3DHVA 3JQAB 5AP9A 3WLEA 2H5EA 7AT1A 3FCCA 4Q3AA 5FORA 1E3DA 4C5BA 2I8LA 4ZHQA 2EKZA 3CQ9A 1HT3A 4P31A 1DDGA 3MTAA 5ALMA 1NF9A 2GZRA 4WEQA 1WPXA 1J9ZA 3LK6A 4K0RA 5C8ZA 1G21A 1BJRE 5DBEX 4MB6A 1CJUC 4OTZA 4E03A 2V0GA 4LWPA 1KDRA 1OI2A 2MSDB 2ZYTX 3RROA 4ZZ0A 2AS0A 3FLMA 3CF4A 1NSTA 1CU1A 1TU0A 1M7GA 4BJ6A 1I7SB 4LYFA 2PS9A 2GLUA 4BX8A 1FFSA 5KYTA 4GNRA 4ZRMA 1YS1X 1TC2A 3MBKA 5C1PA 1FL9A 1SA0B 2ERXA 4M1KA 4MUIA 5FTJA 3F7MA 3P9RA 2BBSA 1X1TA 2CVZA 2PIDA 2WHEA 2OV4A 2VTKA 3C1OA 3ESQA 2REOA 3ITDA 3MG9A 3SGLA 4I4LA 2GRAA 2WM2A 3R6GA 1KHHA 1WY5A 1XAHA 1MKYA 2XKKA 5JH7A 4FLMA 1NI4B 1IYZA 1P4SA 3BSYA 3ISTA 3PQ4A 1SXJB 4FKMA 4XKJA 5J2TA 3R7LA 3FSGD 4BGIA 1GG8A 4IZIA 1E8MA 2QV0A 3U6KA 2WB4A 1I2MA 2UZ1B 3C7DB 3AIMA 3KJNA 4X61A 3WRYA 4HVCA 3K0CA 1QP8A 4JUIA 2UZAA 3VDNB 3CUWA 1L7DA 4FIZA 5HIMA 5KMGA 5A7FA 2JFOA 3KC2A 3AHIA 1AKQA 3RQSA 4D9FA 2NV2B 3C70A 1BN6A 2XRZA 1T13A 3B6KA 3D6AA 2D7DA 5AJYA 4JAVC 1VPVA 3JWHA 2WVHA 1W25A 2QEQA 1I3NA 1ZU5A 3EVDA 1QB7A 1YCHA 1VKRA 3WGMA 2I6FA 2AG0A 3QHQA 5DGIA 3I2YX 4AP9A 4ALLA 4OHPA 2Z4SA 2BGIA 3SJCA 2VPQA 4IS2A 4MYHA 4N0MA 3K3PA 1L7OA 1D1SA 2ZU6A 3WS7A 3FHTA 1KU0A 3U60B 4CGZA 1A97A 4WWHA 2JJ1D 4OKNA 5DM0A 4DA4A 4ZJZA 4N48A 1LBQA 4O4LF 5G3YA 3HVIA 3OSZA 4Y98A 2QG4A 3GBPA 1ABBA 2WLSA 1E3LA 2P2NA 4IOLA 4EG4A 5KOIA 2H7YA 1WSWA 5LP6A 4KTTE 1M6YA 3U4CA 4OX9B 4TYWA 1VIDA 2QVBA 2XVAA 1W1WA 2XUPA 4PC2A 1ZN8A 4NYIR 4X24A 3SCZA 1H23A 1TM4E 2A0YA 1DEKA 1YASA 2LE0A 3H83A 4F85A 3L6CA 1CP2A 1EFPA 1EVLA 2E5FA 1U5CA 2R2GA 3E7XA 3KKEA 5DRYA 3A1WA 4Q0MA 4YTEA 3RAPR 5K9ZA 1VSBA 3R3UA 3I2HA 5HZMA 2PXAA 1OXSC 3F5QA 3IUMA 4JWKA 2D2IA 1FK8A 4JR0A 1ND6A 4EMTA 3EG9A 3KU4A 4ZI7A 5NLLA 3UPUA 1C1XA 1FQKA 5JIBA 3CF6R 3SMVA 2O6LA 2DPYA 4OJQA 4GR4A 4EHIA 3QPVA 1W6UA 1E99A 1UKYA 4BO6A 5BQOA 2OXIA 3LFTA 2DUJA 2IIPA 1U7PA 3EVBA 3G2OA 1ZD8A 4L3WA 4QYXA 4TLBA 4XE5A 2MCFA 2HYDA 4O4LB 1W2WB 5FWYA 4Q02A 1OI7A 1NVMB 1Y98A 3C3MA 4TS1A 2JGMA 2F3QA 2VDWA 5EYPB 2JDIA 4DMMA 5AW2A 2XXJA 2NO5A 4L8FA 5HUHA 1OIWA 1YS9A 3LI2A 3C3JA 4AJHA 4EBBA 2Z3VA 4YJGA 3MNFA 1J2JA 2PKRA 3GZNA 3I9MA 4I19A 3PI6A 5JCOA 4O1IA 2V7BA 5CDFE 2IOYA 5EE1A 3HKBB 1E2DA 3FGZA 2FF5A 3RJZA 2WSSD 5TLSA 1F6DA 1OBVA 3HCWA 3GR6A 3TD9A 6PFKA 3AO0B 4QOIA 4L9RA 2XCQA 2XHEA 1NAHA 1SOVA 3UJ6A 5HSGA 4ZV9A 4HFRA 2J9RA 3H5LA 4FMDB 4EKGA 1CHNA 2HD4A 2OZKA 5U1PA 4UDOA 3KTAB 3CLVA 1G38A 2QBYA 1EFRA 4MVJD 4HEQA 3D7KA 2NO1A 2X15A 3FWHA 4BJ1A 2QUHA 2RBEA 3FHLA 4O4HA 4EB0A 4EIWA 5CPFA 1N5MA 3DLHA 1P1BA 2DOKA 4DIDA 1NXPA 1C0PA 2C9CA 1YB1A 2OYRA 3LPDA 4GX0A 1R0LA 2X4GA 3BFVA 3QX9A 3PEYA 1N3IA 1QYRA 1SIWA 2BMDA 4NRDA 4E5DA 4BQNA 1T4CA 1MABB 2GUGA 3FNEA 2H4ZA 3BDAA 4KSYA 4KN9S 4LTDA 3HB5X 1RJWA 1Y6JA 5ALOA 1V1JA 3LUFA 2Y1LA 4CMKA 4YUYA 2Q3DA 1P2UA 2D1FA 1CLEA 3G0HA 2C9MA 2QX8A 1M6VA 3V8PA 4DE5A 2X86A 4M0KA 1WB4A 2I99A 4NBRA 4U5XA 4O0MA 1WD5A 3K4HA 4BXOA 2DSTA 2GZ2A 2J85A 5F12A 4Z0NA 1E1RA 1FNDA 1WOYA 1EKXA 2JZOA 4J91A 4NU0A 1GUDA 1T0BA 4E5SA 1ZCFA 2XMCA 4MRVA 2ZI4A 3V8EA 2PX6A 3ZDFA 1YZUA 1R0XA 2RGCA 3O8RA 2O3SA 4JXZA 1S6YA 2ECQA 3TTTA 1VIMA 2WDPA 2CLMB 3OCXA 2IPAB 1XVAA 4FDUA 4GRDA 4JT9A 3UC9A 5AD1A 1J7JA 2P6NA 3AHCA 3BAFA 2UV8A 2P3LA 3FF1A 1YRWA 4R83A 1A2KC 1SAYA 1C3OB 3QKWA 4HY3A 5TMPA 2ZBRA 2L69A 1GU7A 3SJAA 1AY0A 4OHFA 2IYVA 3NKLA 1HZZC 1Z0JA 2BE7A 3UXHA 2CK3A 5FWNA 3QLUA 4B4DA 3M6XA 1OQAA 5LB4A 3AKZA 5LA6F 1U2GC 4WCFA 2CLHB 3L4JA 3AVUA 5D3KA 4H7DA 3A1UA 4P82A 3IEMA 1REQB 3OP4A 4J2TA 3E58A 3AU8A 3E0XA 4KFSA 3G5AA 3G9ZA 1J09A 1WVMA 2P27A 4IVPA 4F97A 5DGHA 4WKOA 3GUYA 1L7RA 3L7JA 4WLFA 1ZMOA 4FGJA 5LMNB 2FFQA 1TYEB 4TLLB 2XB6A 2I4OA 2ZI3A 3FZQA 1NL3A 2H17A 4ZVSA 3SZUA 3PD7A 4LYHA 1F1BA 4TVOA 4B87A 5EEGA 1FS5A 2QQEA 3E9DA 4OQPA 1TUGA 3C45A 1GQOA 4NNPA 5IDXA 3OSUA 1O89A 4BATA 3IC5A 4QJIA 4UM5A 1GNSA 3C85A 4YRBA 1H2HA 2R8BA 3LUCA 2ZB4A 4KLNA 2RONA 3L8MA 4RD6A 1I3OA 3HBLA 1R8QA 3HN6A 4NE7A 4F9TA 2BUCA 1GM5A 1T0IA 2IYNA 2V54A 3INYA 2VUSA 4DV6B 3BWBA 4J1QA 2Z6UA 1E92A 2XXBA 4M9XA 1OB2A 1DDIA 2WW8A 3KYJB 2H59A 3IKMB 3OM9A 2ID7A 3BXPA 4BNHA 1UPAA 2ES4A 1Z26A 2B34A 1XMIA 4TRNA 3KVYA 1D2EA 1Q1QA 3CCCA 1OASA 1QRUA 3OE5A 4C4RA 4XB1A 4RF4A 1U6JA 3IEIA 2IHBA 5E3HA 2FSPA 3ROFA 3K92A 3RUFA 4EZEA 1EGMB 1I4OA 1E9AA 2GM5A 1SBTA 1OE0A 5E7MA 4C21A 4UNSA 4TKUB 1KZ7B 5HVNA 4L8VA 1XWFA 4BAZA 1DOZA 2PA0A 4YV2A 3ND6A 4ZQEA 5EGSA 2O5CA 1X74A 3C5CA 2OGUA 4HFNA 3X2FA 1G3MA 1L4MA 3V7WA 3H8VA 4MGZR 5IKOA 1J00A 4H0NA 1Z35A 1FPQA 4EUNA 3OQPA 5K1ZA 2RHJA 4LCJA 1G0NA 1MGOA 2YWGA 2DQZA 4HGYA 4TWIA 4RHYA 3VOSA 3KOWA 5AK5A 3IB3A 4ND8A 3UK2A 4R1LA 1Y9EA 2Z98A 5AKIA 1FLAA 1Y8AA 3BT7A 2GF0A 3I62A 1YOBA 3BGOS 2DH5A 3AYZB 4YO8A 2ISCA 1BYIA 4LV5B 4HDSA 2YWBA 1KQNA 2PKQO 3B6EA 2LR0A 2IP1A 2L2QA 1WUTA 1G9TA 2JFGA 1G3QA 4JP1A 5JW6A 4CM4B 3SHTA 1R9GA 4CMGA 2QTFA 4PN7A 2WZCA 2XMGA 3BDIA 2R8YA 4R2JA 3V1NA 3WMRA 4DQDA 5FP0A 1ZGCA 3AEYA 3TLBA 2IXAA 3CX6A 5CLLA 1D1PA 3MCWA 4M9CA 7REQA 1Y7IA 5K4HA 3ZDCA 1SBIA 3ONDA 3P97A 3C4QA 3SBDA 2I55A 2Q6OA 3TVTA 1BMDA 5K2OA 1DFHA 3BB4A 3HCDA 1DO2A 4HDMB 2Q46A 4IZHA 2PGDA 2W71A 2C3YA 3D02A 2ZRAA 1W29A 1T1JA 4C3OB 4CUZA 4M8NE 1N57A 1Q0QA 2VYQA 4RSRA 2GYYA 2SKEA 3O9VA 4U2KA 4HRVA 5DX1A 5HDQA 3ZWYA 1RKUA 2AT1A 1OU0A 1YD7A 4OHVA 1NPDA 4K3VA 3T9FA 3KQQA 4DRZA 4F4HA 1V5GA 3COSA 4QEZA 4HX9A 1W0KA 4LQCA 4D3ZA 2WU3A 3CUTA 5DHTA 1AMNA 1AKYA 1RD4A 1Y82A 2PUDA 3EWSA 4G85A 2ZU0C 3AESA 3LQFA 3EVAA 2X1HA 3PRYA 5C8XA 4FS3A 1DAEA 2BISA 5EMKA 3QY0A 4I3HA 1SIUA 4H7JA 1EDEA 3U19A 4EI8A 1UWVA 2OVBA 3NIWA 3DZIA 3VGPA 1EX1A 3GIDA 3K4PA 4PTZA 4KR3A 4YONB 5CG2A 4KE6A 2ZIXB 1GNRA 1LBSA 4W1PA 3AF6A 3NEYA 1C9KA 1MTOA 4XUCA 3WG9A 4GOND 1N6IA 1SOMA 5ALEA 3U5ZB 4EM6A 1BO6A 5KU7A 3W7AA 2R6ZA 1JJ7A 2R96A 4R84A 3VHQA 1R5BA 3CBGA 4AU1A 2QVGA 2QM8A 1TYBE 2C0QA 2F3SA 4FYMA 4IDCA 4NL4H 2GF9A 5CVDA 3ZHSA 4MOWA 4AULA 5FNVA 2QG6A 4DCMA 1EBUA 1EIZA 5G2OA 5JTUA 4LE2A 3V6LA 1V5EA 2JKYA 4NJMA 1CDDA 4M37A 4Z7JA 1TEZA 1N5LA 2AFHB 2QJRA 4IVQA 1J8VA 4NPCA 4X94A 1KGSA 2YHSA 3B52X 4E2ZA 3WWOA 4G0UA 1P9NA 4BO0A 3FETA 4XJVA 2A5LA 4KFCA 4MQUA 4EG7A 3PFWO 2FP3A 3D7SA 1DPFA 4WUVA 4BZZA 3SWWA 1HDZA 2CL7X 3WTBA 4IS3A 4BO7A 2DLNA 3LYLA 2WHYA 4QYIA 1FIUA 1V6CA 2BRUA 1LSJA 3Q0IA 4REOA 4EG0A 1CFJA 3QE2A 3DEYX 1NXWA 3HV0A 3AXTA 3IMFA 3MGBA 3DV0A 3GGSA 2N46A 3TXYA 1NATA 4PVDA 1AG9A 1Z17A 2OXEA 1S2IA 1FYXA 1YI1A 3Q12A 4L4RA 1JALA 2NV6A 1OBHA 1TVEA 2FN4A 2I7CA 4V24A 3VVLA 4AFNA 4OQZA 4WESA 3ABQB 4KQ1A 4MQEA 1NM5C 3E3LA 4X45A 1DLJA 4ZCIA 3A4TA 3LQYA 1Q19A 3DVQX 1TJNA 2GASA 3CKYA 1T4DA 5L45A 4BLSA 3I1IA 1KFJB 1I3KA 2WPDD 2X6TA 3HB4X 3MT9A 1ZW1A 2W6NA 3HJGA 5SV2A 1AZTA 2WT9A 1WAMA 4DJJA 1VBMA 3JQEA 1EH5A 2PNJA 1POXA 4D4MA 5KU1A 4QRHA 3IO5A 1Y7PA 1IXRC 3PWSA 2FX5A 3WLQA 4TM8A 1IOZA 2VPPA 1EX6A 1P9RA 2C03A 2IOHA 4DYDA 3TG8A 2XQKA 5DN6D 4GOXA 1CWUA 1X9HA 1AKNA 1M2GA 5L3VA 2FMXA 2ZR8A 3EVEA 2QGFA 2Q6KA 3LWZA 3P4YA 1JH8A 1XN1A 5M2QA 4OJTA 4GMDA 1VTKA 2FPGA 1SXGA 2FQWA 3FM9A 4Q9NA 1ZH0A 3URMA 3E27A 4UNQA 2PRIA 3KB8A 1IQUA 4DHEA 3U80A 4IJWA 9GPBA 1E5TA 4EOGA 2DQ4A 1XTZA 5CX1A 5IJ9A 2ZXUA 3EFBA 2G3YA 1E1MA 2WQ6A 5CGZA 3NVKI 3FI9A 1OAOC 2R1ZA 2GTHA 2YHBA 4R05A 2VHQA 1SEVA 4TTIA 4YCBA 4WJLA 1PL0A 4N6OA 1GSAA 3QNWA 3G0OA 1GO2A 1FJGB 5KYYA 3NTOA 1GZVA 3PLNA 4FE4A 1FDUA 5CDGA 4GECA 3G02A 4NX2A 4GT1A 4DDMA 2NXCA 2ZT8A 1XYVA 1ZOPA 5JSQA 3O1JC 1X2BA 2PRKA 4PONA 5AOAA 5T4EA 2O4CA 1AZLA 4B3XA 1OWOA 2RHOA 1TZJA 2ZDHA 4KNVA 5ALSA 2DZDA 4ER7A 4P86A 2L18A 3AR7A 2QMUA 4UM9B 4PW0A 4RGVA 3QYPA 4NR0A 5ALLA 1Z8FA 4BDTA 1DTSA 4LEIA 4BV9A 1IN4A 1FMLA 2VWHA 2ZDGA 3A4LA 1R4ZA 3RAJA 4NV0A 3PGA1 3QSYA 2EJCA 2ZEJA 2H2WA 2DWPA 2NUPB 2P9ZA 3R4VA 4IV5A 4YRFA 2HWKA 5F1OA 4JLKA 3ZZ0A 1JDBC 1A8PA 3RFFA 2AN3A 1OLSA 3NALA 2R1TA 5IF3A 5ALUA 1MUUA 4Z86A 1DFGA 2R87A 1RCUA 3VDXA 3IBGA 1I14A 1WY7A 2Z2KA 1CC1S 4QELA 3I5XA 1Q1EA 2J08A 4UCFA 1LDYA 4EZBA 3Q8XB 2W6ZA 3TX2A 2A5YB 3M1LA 5JAQA 3W06A 2XGGA 1E1QA 4I6JA 7ABPA 3JQAA 5FTLA 4RIFA 4KO8A 4BFCA 4L4YA 3FFWA 4C03A 4DBVO 4A5SA 5D8DA 3IVAA 3TTSA 4D45A 3OT5A 1LX7A 1EE2A 4KLRA 5AVZA 3DUWA 5MDHA 1F5NA 2CLIB 2J5RA 2Y99A 2ISSD 5SYNA 3FOEC 3ECAA 4ZYWA 3QEAZ 4NH0A 1O5OA 1QHIA 3IAUA 3WNVA 2RJOA 2X1MA 5EEHA 2P30A 3H6GA 2O4UX 4U7HA 4X3CA 4TYYA 5KTPA 2VHYA 4MUMA 4IDGA 4OBBA 3QX8A 4M8IA 1VJCA 3ZU4A 4EP1A 1XXHB 1ZSNA 2FFJA 3WYNA 1FRNA 3UAYA 2I6XA 5F52A 3BK7A 3PXXA 2J6CA 3T7AA 4BO3A 2BHLA 3LWNA 2PGNA 1Z36A 2PVPA 3E2MA 4TX1A 1NI4A 3FI0A 5GQSA 1KKMA 3QTTA 2RK4A 3V80A 3ORRA 4K9LA 4IDQA 3B7PA 2UZ1A 1HFWA 1HQCA 1XHEA 2GN4A 3CUVA 3GCGA 3K72B 1QPGA 4WOCA 5REQA 3BJZA 3P2EA 3LLVA 1IL0A 4UBJA 4Y8VA 3SIRA 2VJCA 3KTDA 4YPFA 1DZIA 3D6HA