3JQAB

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-1,9-dihydro-6h-purine-6-thione (dx4)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 91
structure length 247
sequence length 267
chains with identical sequence C
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqaB00
1R4MA 5ENVA 2PGLA 4KQWA 3FBGA 3GZNA 1WMBA 4CUKA 4TZTA 4Y9DA 3ETDA 2PTGA 1N7HA 2DBQA 1PJTA 2ZIZA 4E2XA 3HFGA 1TB4A 3ZW9A 3D4NA 3AOEA 1R16A 2Y1EA 4ALIA 1U2DA 3GNTA 1P1RA 3KSUA 1HE3A 1VL6A 3K31A 3ZU2A 4XWYA 1D1TA 1S7CA 1NFRA 4ZVVA 4CL8A 1VLLA 1IYZA 1YBMA 4OAQA 5ITWA 1KS9A 1I5RA 1TEHA 1HLDA 4JCOA 4OOFA 5JYEA 1E7RA 4BB5A 7ADHA 3VH2A 4WCDA 3OFSA 1DRUA 3NTQA 2OP1A 1R0SA 1ENYA 1UDCA 3ANLA 3AW9A 3FCOA 4XR4A 3I83A 4TMFA 3EY4A 1Z6ZA 2YJZA 2GDZA 5IDQA 4ID9A 4JP3A 4BO7A 4CM8B 4B4UA 1UXKA 1DIAA 4IM7A 1XIVA 3K2BA 2W8ZA 2DPGA 3WSWA 1HETA 8LDHA 3DAFA 4DYDA 5CPFA 1XKQA 1DHTA 3VTFA 2ZKLA 2OHXA 3W6UA 3JTMA 3U49A 4NH4A 5K9ZA 1T4DA 3PHGA 5JSFA 5TT0A 5HS6A 1ZJYA 3H3FA 5AQ1A 2IZZA 2QW8A 2CF6A 4L73A 5C37A 5L7TA 3M1LA 4FSHA 4YQZA 1LRKA 2O3TA 2Y66A 3SLGA 6LDHA 5KJCA 3DL2A 2X5OA 1CDOA 4E4YA 4C7KA 1FDSA 5JAIA 2D59A 1BMDA 3GOHA 4RVSA 2FPPA 3WMXA 4EI2A 5B1YA 5FEUA 1RJWA 3RCBA 4RPLA 1YH3A 3A1NA 4MVJM 4XA8A 1JTVA 1R66A 4XDYA 3VDQA 4UUMA 4PG5A 1JN0A 3QWHA 3ZWXA 4YRAA 3ANNA 1IZ9A 2DQ4A 1LXCA 2ZTVA 1HDCA 1O9BA 4UVIA 3FNGA 1SCUA 2DFVA 1UZMA 4JJIA 1ZCJA 4IXTA 2X5KO 3BHIA 1N1EA 1T2CA 2BRUA 1CQIA 1JVBA 1J5PA 4TZKA 1YBVA 4GKVA 1UDAA 2IDZA 4AJNA 4BO9A 4DXHA 5I7FA 3FPLA 3G0OA 1MX3A 4EEXA 5B12A 4P4LA 1E0DA 4MJLA 3RASA 3IQDB 2BFMA 1NBOA 4R9SA 4FJ1A 3ZWAA 1U3WA 3G1TA 1ZKMA 4LSWA 1OMOA 1DSSG 3JQDA 4IJUA 2VYNA 2DC1A 3Q2IA 1PR9A 1BW9B 3P19A 3WJAA 1ZBQA 1ZK2A 2NLOA 3JYNA 3FR7A 2Q2VA 2IE0A 2NM0A 1T2AA 4O0LA 1NYTA 5KTKA 3DONA 2IEDA 1HDGO 3DOJA 3EUWA 2P91A 2WSBA 4FIZA 3AOGA 4OXNA 5BQFA 5JDCC 4AJLA 1BRMA 4TRMA 3KUXA 1H2BA 3NUGA 2O48X 2X9GA 5TGDA 4XYGA 1V9LA 2O3QA 3DEYX 1C0KA 2AA3A 3GG2A 1NWCA 4D3FA 3DTTA 4YAIA 1I3NA 1XELA 2DBZA 2HAEA 1PZFA 4KP7A 4A7PA 5EIOA 3Q9UA 4DWVA 5CEJA 3GA0A 1LBEA 1LSOA 3JQBC 1XG5A 2HCTA 3CXRA 4D3SA 3D4PA 4ALNA 2I3GA 2NVUA 3I1JA 1LDEA 4HFJA 1AE1A 3CZMA 5COQA 5KVQA 2Q3EA 3R0IA 3FF4A 4PZDA 4CLEA 5A1TA 2I65A 1TT7A 3NJ4A 4RJTA 4QT0A 1B26A 3PRJA 2HMTA 4ND1A 3VH4A 1XSEA 4ZQHA 2D2IA 3DC2A 4CMJA 4R51A 1EQ2A 2FSVA 4D79A 4DMLA 2GN6A 4CM9A 2IYPA 4RL6A 4J6FA 4K6FA 1JKFA 1SB8A 4AL4A 3HB4X 3H4VA 5CEFA 3VPXA 3DWFA 2Y1DA 4XDZA 4XQGA 2CVZA 4KWIA 2WDZA 1T26A 2YDXA 4DBZA 2AE2A 4TRJA 1E1KA 4R9RA 1JQBA 2D3TA 2OOSA 4GSKA 3K30A 5F1OA 1E7WA 1KVRA 3PZBA 3QWAA 4CM6A 3O26A 4NK5A 1ADBA 3RUHA 1HSOA 3C85A 5KJEA 3ZWWA 4WCFB 3I6IA 1D8AA 1DDOA 1HTBA 1LUAA 4WLNA 4QO8A 1NASA 2A9FA 3GRPA 1E6WA 2ZTMA 1JVSA 2BMAA 2PWZA 1I10A 4XB1A 1YJQA 1B8PA 3KVOA 2OMEA 3ZWNA 5CEEA 3Q0EA 3JQ7A 4Z3DA 1LC3A 4Q39A 1P74A 4B4WA 4JQCA 4YAKA 3INRA 3UF0A 1V3VA 2I66A 3P5SA 4CM3A 3BMCB 1X1EA 4FR5A 4PFJA 1VI2A 2C5EA 2FPGA 1BWSA 2Q2WA 4NG5A 1XDWA 1O8CA 3R3JA 4K6CA 3F3SA 3NT4A 1PJQA 3OQ6A 2EGHA 2OP0A 1UZLA 3S2IA 3CKYA 4BHTA 2FY8A 3H8VA 1E7SA 2J3KA 1Y7TA 1NQ5A 3QVXA 2VUSA 3X2FA 3AI2A 2VZ9A 2C54A 5L7YA 5I9LA 5DBIA 1MUUA 1GV1A 1JDJA 3HADA 1ZMOA 5JAQA 3KYDB 3BAZA 3LLVA 4MOWA 3KTDA 3M2PA 1ISFA 3RQSA 5L9AA 3E82A 3GF4A 4YBZA 1HE5A 1DFIA 1ADFA 5FF9A 2F1KA 2EKPA 2VUUA 4CL3A 4CV2A 2DM6A 3FRJA 4BB6A 2Z1MA 5A04A 1GDHA 1JA9A 4W7HA 1PGQA 4WNIA 1PR3A 2ET6A 3BTUA 1N1GA 4WLFA 5A9TA 3AU8A 4IIVA 3BHMA 3TJRA 3WFIA 2C20A 1KY5A 2QX7A 3GMSA 4MIOA 1GCOA 3QSGA 1XCBA 4R01A 1D3AA 5LCXA 5IN4A 1PL6A 1IPEA 2HRBA 2W2LD 3ZU3A 1F8GA 4A0SA 3ST7A 2B4RO 1LTHR 3PIIA 3A06A 3L0DA 4J2HA 2ZTLA 4KTVE 2NU7A 1HXHA 4J49A 5JXWA 1E3WA 5JAMA 3UW3A 2G0TA 4JIGA 3GT0A 2NV6A 3E03A 3S55A 3X2EA 4J16A 3RC1A 4HFRA 3VVBA 1R15A 3O03A 4WCFA 1PZGA 2X8LA 1EZ4A 3MCVA 4S1VA 4OH1A 2CMDA 2QYSA 1YB4A 3JYQA 4CMGA 3JQEA 4B79A 4E6PA 4XJTA 3OSUA 5TQVA 1PGNA 4YXFA 1HSZA 3PWKA 1A9YA 4NFYA 1E92A 1N2SA 1XU9A 1A7AA 1TT5B 1Q7GA 4Z6KA 3IP1A 4FFLA 3PXXA 3BMCA 1R0LA 4IQ8A 2WE8A 3KETA 1A7KA 1HDZA 1I2BA 4RLHA 3RU9A 3WBBA 2EIHA 3KM0A 3EDMA 2JAPA 4BO1A 2CD9A 3AUUA 3K92A 3AK4A 1G6KA 4N5LA 2HK9A 1HRDA 1BG6A 1T1RA 3DR3A 3PJEA 4XQEA 1HWYA 2J3HA 3ETGA 2V6BA 4RF4A 3PYMA 2UDPA 1X0XA 2RIRA 1M75A 1YO6A 3S2EA 3KYCB 4RF5A 3U4CA 3O8QB 2ZQZA 3QQPA 3MWEB 4D46A 4RF3A 1KIFA 2X7HA 5DNAA 5IDYA 2A92A 2Q45A 4OYRA 1ISIA 3MTGA 4MVJP 3TPCA 5EERA 2JD2A 4FS3A 4LW8A 3H9EO 2DFDA 1NVMB 1ZO8A 2D4AA 3OF2A 1YB1A 4OIMA 2B83A 4TVBA 1Y5RA 1ULUA 1OBFO 2GLXA 3AM3A 4CPDA 4CMKA 3D1LA 1FDUA 4BNWA 1JWBB 3M6IA 2X86A 3PZRA 5T64A 1KYQA 5ILOA 4AG3A 4RZIA 5EQDA 3PHLA 1DPGA 1ZNQO 3PI7A 1M2WA 3ENKA 3U4IA 4OM8A 4RO0A 5KOIA 3EVTA 2D5AA 2Q1WA 3UAGA 5JMPA 2Q4EA 3TZCA 4J2OA 1MG0A 4NZ9A 1SPXA 5A3VA 5TS3A 3GVPA 2PA3A 3QP9A 2P9EA 4QFDA 5G2OA 4DYVA 2EW8A 1OC2A 2YQ4A 2PZMA 3GEDA 3OBBA 3H9GA 1ZSYA 4H15A 1GUFA 1PGOA 2NUAA 4B7CA 3C7CB 4TKLA 1TT5A 2VZ0A 2X5JO 3Q9NA 4RORA 4RPKA 4YYZA 4RCVA 3LT1A 1F0YA 1LLCA 1QYWA 1Q7BA 4U7WA 4ZRNA 1UP7A 3QW2A 2YDYA 4AJJA 2VHVA 2B69A 1MXFA 3KOUA 1P9LA 3ASUA 2OFPA 1QKIA 5CDUA 4EEZA 1H6AA 2F00A 3GHYA 4LISA 4R1SA 3NDRA 4RPGA 5C7IO 3E1KA 5JCJD 4IPTA 4J4TA 5JO0A 3L9WA 3RJ9A 5K6AC 3DXFA 1FMCA 3GFBA 3E18A 3SEFA 5HM8A 1IE3A 1B7GO 4TRNA 3QE3A 4PRKA 1BSVA 4IJKA 3ROPA 2BKAA 3VC7A 3NV9A 3QVWA 5H82A 5KWEA 3F5QA 2FPIA 3KYCA 3JQFC 2VWPA 4UVEA 2UAGA 3WGYA 2Z5LA 3ICPA 4FFOA 2IRWA 2FR8A 4OSOA 2PZLA 3DB2A 4ZHSA 5BNTA 4NU5A 4L9RA 5G0SA 2ZCVA 3ZCXA 4BO6A 2OZPA 4IINA 4WUVA 2ZYDA 1XQ1A 2ZB7A 1KOLA 4NBRA 4RQUA 1XEAA 3P2OA 4CLHA 2VHZA 3QLJA 2NVBA 4GGOA 2GERA 1E1MA 1IULA 1PJ2A 5LC1A 1RM4A 2AW5A 3AI3A 2HJSA 3ANMA 3NYWA 4ALJA 5IZ4A 3PPIA 4QXMA 4GQAA 1NQAO 1PZHA 1TI7A 3GHHA 3NKLA 3K9QO 4IQGA 1L7EA 3V2HA 4DC0A 1FDTA 4IDCA 4RVDA 3DZKA 1EFLA 3L07A 2XXJA 4IXWA 3ZWYA 2ZTUA 5T5QA 1V8BA 1DJQA 1YE3A 3KEOA 2O3UA 1SC6A 3GDGA 3ONEA 4FB5A 3QV1A 3I3OA 3N7UA 2SCUA 1GTMA 3JSAA 2Y1GA 4UVGA 1LSSA 2NADA 2ZJ1A 5B4VA 2CFCA 1HYHA 4BGIA 2EKLA 1MGOA 2B35A 4QSMA 3JQCA 4FFNA 5F21A 4BKPA 3RSHA 2Y0DA 3P2YA 3UKOA 1F8FA 5DT9A 1BVUA 2A4KA 1OI7A 5BNFA 5I7EA 3DOCA 3RIHA 4A27A 4PN3A 5JDIA 2HUNA 3RBZA 1L7DA 1UXHA 2IZ0A 3WBFA 2C2XA 4K9DA 4WE3A 3VH1A 3RFXA 5A3JA 5DCUA 2WEKA 4CQMA 4M87A 5F5LA 4PLPA 1Y8QA 2I6TA 1UR5A 1C0PA 4D41A 2EG9A 3BMNB 4II2A 3W4IA 1C0IA 2VUTA 4BGEA 5C7LO 2NWQA 2ZB3A 3CIFA 1HF3A 4CLOA 3ITKA 3L4BA 2Q1SA 4IDGA 5A05A 1NR1A 4J90A 3RI3A 3UN1A 2PH5A 1WLYA 2DTXA 5G4KB 5U4QA 4F46A 4PLYA 2VTDA 2V6GA 4IGFA 2WD8A 2P5YA 3UXYA 4TROA 4KDFA 1VE9A 4UEKA 5I7SA 3KEQA 2G76A 3ZU4A 3DBHA 2X9VA 1VJ1A 3KYBA 3WQSB 4WEOA 4YJDA 2EWMA 4DC1A 1I8TA 2VWQA 2WTBA 3RFVA 3UFXA 4BMNA 4G65A 4MVJH 9LDBA 2G82A 3AY7A 3TZ6A 3RBXA 4NJMB 2ZB8A 3CTMA 3G3EA 3TZQA 3KBOA 2G1UA 3PLRA 5A4DA 1I30A 5C7OO 3U0BA 4E2WA 1ADGA 2Y93A 2JFHA 2C29D 5CDTA 1CF2O 5F1PA 4UVDA 4GPD1 3IMFA 2Y0CA 1DFGA 1R0KA 4AJHA 4EUHA 4BNLA 3NAQA 4W4TA 1HT0A 1X1TA 2GN4A 3PDUA 1TLTA 4CR8A 2ZYGA 1P1FA 4BNHA 1WNTA 1WMAA 5EJ2A 4QQRA 3ZU5A 1D7OA 4DREA 4ZRMA 4J0EA 3R1IA 4M1QA 4WOJA 1SEPA 4MIEA 1TVEA 3FHLA 1W0CA 2DVMA 4FW8A 4R3NA 2C7GA 4B8ZA 1VL8A 1U8XX 3WGQA 1CYDA 2WMDA 5AXCA 3F1KA 2NU9A 3JQGB 3FBTA 4HNGA 4OKNA 1A4UA 3TSCA 1E7MA 1GYRA 1PWXA 5JW6A 3NRCA 4GX1A 4AICA 3TZHA 3TQHA 4OMUA 2VHYA 3I4CA 4CM4A 4M54A 1QSGA 2R2GA 1ZK4A 1XR3A 2VCYA 3GY0A 4H7PA 1V35A 3GN1A 1A5ZA 1I3MA 4G2NA 3RUEA 2GN8A 1GQQA 1HDYA 4PLWA 3JD4A 1N9GB 4E5YA 2HO5A 4HFMA 2B4TO 1JU9A 2C07A 2CVQA 1UP6A 2Z1NA 3PTZA 4NPCA 3ZWVA 1J6UA 4CMIA 4DLLA 1LQTA 1LSJA 1C14A 4I5EA 2YV3A 5G4KA 4ZQFA 2H9IA 4RZHA 3F47A 2NU8A 5TLSA 3PFFA 3ZNOA 4K26A 5FWNA 4OHUA 3F6YA 2AQ8A 4BQPA 1NXQA 2PR2A 3S1LA 1P31A 4BO8A 4GWKA 4WPGA 2Y68A 3GPDG 3Q1LA 1PS0A 1RWBA 2OBYA 3GEGA 3K8ZA 4EGFA 2Z95A 2JD0A 1ZVMA 2GF2A 3W1VA 4JJGA 4WLEA 1PGPA 3NTOA 2EV9A 1MFPA 3LT4A 2DPHA 4NMHA 5BSEA 2C82A 4BNGA 4AJKA 2Q49A 1E7YA 2C5AA 4AJEA 1DJNA 4Y67A 2QHXA 2IYOA 1UH5A 5HS4A 4W7IA 3LC7O 4EW6A 3JCZA 3VTZA 7MDHA 1GEGA 4BNJA 4BMSA 1QLJA 1R4NA 3PK0A 4WLUA 1RYEA 3FTNA 3RKRA 3ZHYA 1O5IA 3F5SA 1EE9A 5IFLA 4OSPA 4L74A 5HTOA 4CODB 2X22A 4F45A 1JKJA 2HK7A 4I5DA 5JDIC 2R00A 2DTDA 2H6EA 4TVOA 4NBVA 2I5PO 1H9AA 5H83A 2VWGA 1E1NA 2Q1TA 1TXGA 2X23A 3JQGA 4LMPA 1HKUA 3LT2A 1ISJA 3FNHA 4QECA 5JNLA 1WAMA 3AUSA 3DFZA 4IMPA 3L4BC 3UCXA 1E1LA 2D5CA 3C1TA 5LDGA 4BNTA 3V8BA 3A4VA 3VAZA 1KC3A 1P33A 1PQUA 2FRDA 3GFGA 4FC7A 3RVDA 5G0TA 2HU2A 4BNZA 4MIYA 3LLSA 1Y1PA 3DMYA 1Q0QA 1N9GA 4FOSA 2CVOA 4BO3A 1CRWG 5IDWA 4AJ2A 1LLUA 1H6DA 1IY8A 1CEQA 2EP7A 5C5IA 1NAHA 4IUYA 3ASVA 3PJDA 2GZ1A 3GR6A 3PHJA 3AUAA 2JAHA 1UXJA 2OGUA 4YB8A 5KVCA 4BGUA 4ROSA 3VZSA 4BUCA 1YDWA 4MDHA 3K5PA 1O89A 4RF2A 1N5DA 1B8VA 4CM8A 4LN1A 1PS8A 3FD8A 6ADHA 2X0RA 3TDKA 3WR5A 1KEUA 1NPYA 4UUOA 4CMBA 1U7TA 5DBFA 4H3VA 1Q2XA 4ESOA 1M76A 3SX2A 3FR8A 2QYTA 3GMDA 1OFGA 1E6EA 4N7RA 1GV0A 5K0ZA 2VOJA 1I2CA 2AMFA 1PGJA 3JD0A 3E8XA 3ZI0A 1DC5A 3ZWBA 4CJXA 5JPIA 3ZNPA 2IXAA 5KKCA 4FOOA 5T8KA 1WVGA 3GH3A 2AEMA 1CIVA 1YONA 4IS2A 5B37A 1JWAB 5L95A 3L77A 4BO0A 3NX4A 4BQRA 1EQUA 1A9ZA 1LI4A 3Q11A 4GI2A 4DRYA 1Z82A 3IUSA 1YGYA 1GPJA 1YJ8A 2HMUA 5BT9A 2ILTA 1CQJA 1PS9A 4BNFA 5ADHA 4DPKA 1E3SA 1VRWA 1GEEA 1GU7A 4YJGB 4XRGA 1YXMA 2V6FA 3WGTA 1NX6A 5CDYA 3BTVA 1IZ0A 3DAGA 2X58A 2A94A 5ES3A 3DFUA 4XJSA 1NQOA 3OH8A 3RAJA 1LC0A 4JJFA 3W4JA 1HDOA 4G81A 3GEMA 5L53A 3DO5A 3BMQB 2DLDA 2B4QA 3B20A 3CMMA 4GH5A 2XAAA 1PJ4A 3AOEC 2C0CA 4JBHA 3ORFA 4Q3BA 4E2YA 5JC1A 4DPLA 2DT5A 1U7HA 1XYGA 5ITVA 3EGOA 2DKNA 2GYYA 1SOWA 2HDHA 1ENOA 2VQ3A 3AM4A 1A72A 2O3RA 5DN9A 4PLVA 2Q4BA 3LQFA 3SBOA 3OICA 1Q7CA 2DAPA 2GZ3A 1I24A 4HFNA 4Y6SA 1BW9A 1T4BA 3OMLA 1HDRA 4CMEA 4CMCA 4DPMA 5I7VA 4GLLA 3AU9A 1H6BA 1J49A 2BGKA 2RHCA 2HLPA 4OXKA 4QEDA 1P0FA 1DIHA 1FXSA 1QV6A 4GAEA 1LDMA 3RFTA 4CV0A 1DLJA 3IAHA 3GN2A 4KUHA 3FN4A 3NJ8A 4NK4A 4MP3A 4B3JA 3ZV6A 2VT3A 1MA0A 2EGGA 1X7GA 1RKXA 1ZEJA 4MO2A 4B3HA 4P4GA 3IKVA 4A5OA 2H5LA 2AE1A 2B5VA 3UVEA 4PIVA 5DOVA 3I9MA 5FI3A 4A03A 4FN4A 3OA0A 1P1KA 1AHIA 2POQX 3DMTA 4ND3A 4R1NA 4AFNA 4B3IA 4F6LA 4HADA 4IGEA 2HMSA 1O6ZA 4R5MA 3DBLB 4YCAA 4J9UE 3JYPA 3B70A 2DU8A 3ZZNA 4CV3A 2YQ5A 1DB3A 3P7MA 1WW8A 3AWDA 3DDNA 2Y05A 3H3JA 3QA9A 4R3WA 3CINA 5EESA 4OGWA 3HHPA 4GVXA 3D5TA 4FDAA 4MP6A 3KHUA 4R68A 4CMHA 4FGWA 2BI8A 2X0NA 5AXAA 1H94A 2HJRA 3NT2A 1D1SA 3DHYA 1F12A 1YWGO 4BO5A 3E9QA 1XWFA 2AG8A 3DQPA 3RUAA 4CLXA 4EDFA 1ULSA 3EK2A 4HX5A 2RBEA 3LF1A 2R00C 4YJGA 2ZATA 4E31A 4M55A 3RWBA 4BIIA 1H93A 1WP4A 3A9WA 5JY1A 4RVUA 4YT2A 4O6VA 1K6XA 2GSDA 2J3JA 1YQXA 4Y6PA 2QZ9A 3U9LA 5CFZA 1WZIA 3PYLA 3ZDFA 3MJEA 3PHHA 2EKQA 5JE8A 4PG7A 5JBIA 3BMQA 3IC5A 2JFFA 1QMGA 4JK3A 3WGGA 4DIFA 1M67A 1OC4A 3HG7A 3UCFA 2X9NA 4IMRA 3T7EA 1PZEA 2OUIA 1IOLA 1OOEA 2ZQYA 1ZMTA 3VDRA 3WXBA 1UJMA 3DHNA 3ZHXA 1GADO 1C1XB 3U62A 1LDNA 2E49A 1SNYA 4ZN6A 1ZJZA 4WASA 4NR0A 4RDHA 3WTBA 2BF7A 1E5QA 3PQFA 4M8SA 4J7UA 2GR9A 1PWZA 1YQGA 1R37A 4J9VA 1UAGA 3V5NA 3MJ4A 1I33A 2B0JA 1M66A 3MJSA 4FJ0A 5KKAA 1XQ6A 5COBA 2VRCD 5T57A 1GCUA 5BNIA 1Y81A 3I9KA 1T24A 1ZSNA 2NVWA 1V6AA 1G0OA 1DIBA 1X15A 4J1TA 1HE2A 4B8WA 1B2LA 1VL0A 1X7DA 3KLPX 4PZEA 4YRBA 3HUDA 3VKVA 3DBRB 3EVNA 3M2TA 3WYBA 3D7LA 4W6ZA 3HSKA 2BELA 3HE3A 5T8KC 1H0KA 3I9NA 5L4NA 1U5CA 1ZSVA 2QRKA 3DBLA 1VJTA 4Z0HO 3DOOA 4EBFA 3TOXA 1NP3A 2PFGA 4XIYA 4XX0A 4RPHA 3GAZA 4RVGA 1GQYA 3ITDA 3KYDA 3TRIA 2CUKA 2I3AA 4I9HA 3JQ9A 2Q50A 1DRVA 2D0IA 3MJCA 2VHXA 4IDBA 5DBGA 1DEHA 1JAXA 4BKQA 5FYDA 2V7PA 5DOZA 4WKGA 3BXXA 1QYDA 1HL3A 1UDBA 2FMUA 2E37A 4LK3A 3LT0A 1HE4A 5THKA 4H16A 4UVHA 2BD0A 3PVZA 3U3XA 3HN7A 3OJ0A 4J1NA 4Q3CA 5FFFA 3LYLA 3WJ7A 1K6JA 2W2LA 3U09A 1Z75A 1DC3A 2H63A 4OOEA 1R12A 5AYVA 4O5OA 2JHFA 1T1SA 2VYVD 5H81A 3I6QA 4L4XA 4A26A 4I9NA 1F06A 4GMFA 1EMDA 1LLQA 5AXDA 4CMEC 2YHIB 3D5QA 4FC6A 3ZWMA 5EPOA 2W2KB 3V2UA 3RROA 2WJPA 3QHAA 4O59O 4GLOA 1C1XA 3R3SA 2FSSA 1U9JA 2I67A 4E30A 2X1HA 4D3DA 3VPSA 4YAJA 5LDHA 1YL5A 4QTZA 1UZNA 1LQUA 3TNLA 4P22A 3ZW8A 5I9NA 3FWNA 1B0AA 3AY6A 3KB6A 3AM5A 1EVJA 4XCVA 5AOVA 4PLHA 1I3LA 5DDIP 3SC4A 4INAA 3ZWOA 2QG4A 3GK3A 1ZUD1 1GAEO 2JJYA 3KSDO 5CHEA 1DIGA 4OJNA 4B7XA 5DF1A 5KVSA 1X14A 3I9JA 4ZJUA 3SLKA 1GUZA 1N8KA 1HEUA 4FJ2A 1K0UA 4MVJD 4AJ4A 2AQKA 3V2GA 1KVUA 4YAEA 4CM5A 4KTTE 3OEWA 3ICCA 3F46A 4XQ9A 4CQMD 5BSGA 1BTOA 2CY0A 4NFHA 2CDBA 4J91A 2GNAA 4PGFA 1KVQA 5AVOA 4AJOA 2YZ7A 1Q0HA 3JD2A 3EW7A 1AXEA 5A5FA 2NTJA 3LU1A 2WE7A 3O8QA 5EQFA 5A9SB 3PHIA 3OIDA 3ENNA 3RUCA 3OEYA 3V1YA 3PQEA 5JY6A 4RV9A 3JQAD 3DZBA 3ZNQA 3VZRA 4CQLB 1DHRA 2HKIA 3LVFO 4YWJA 4BNNA 1N92A 2YUTA 1K6IA 2XXBA 4ZQGA 3T4XA 2GPTA 3PEFA 2NTNA 4CR6A 4ZICA 2DUUA 2JD1A 2AQHA 2EF1A 3C1AA 1W73A 1ZZEA 1F14A 4WCFC 2BGLA 1B15A 3OECA 4TSKA 4HKTA 1EUDA 1LRJA 5AXBA 5KJ1A 4DIOA 1DC4A 4I5FA 3COSA 1ADCA 1ZW1A 3H9QA 4AJIA 3N74A 4PG8A 1U3TA 3CPSA 5CDSA 2FHSA 3DAPA 4CM1A 5TIIA 4II3A 2W2KA 3MOGA 1P44A 1L1FA 4U0JA 3ZNNA 4DIBA 4WEQA 4IZIA 4JN6B 5KJFA 1AXGA 1IUKA 3GLQA 1NFFA 2GD1O 1V3UA 4EJMA 3C24A 3OIFA 4KDEA 5FI5A 4GSLA 3JD3A 4Z0TA 3GRKA 1ISMA 3GNSA 4S3MA 3EZYA 2AQIA 3MJVA 5JAZA 3WICA 4HUJA 4GL4A 4I5GA 4BNUA 2JCYA 1AGNA 3LF2A 2HRZA 3H5NA 1ONOA 3IS3A 3B1FA 3QRWA 4MP8A 3C7DB 1JKIA 1ENZA 1LEHA 4TRRA 4W99A 1GFSA 3IJPA 3L4SO 1AUPA 3Q3CA 2BI7A 2CF5A 2BFAA 4MKZA 2VZ8A 2VT2A 5T6BA 4RVHA 4JP2A 3MZ0A 2JKVA 3WGZA 3PWSA 3V1TC 5EN4A 2R6JA 4HV4A 4Z0PA 3EAGA 5A9RA 4RPJA 3JQ9C 3GG9A 3PJGA 4B4VA 3OQBA 1O94A 4CMAA 1Z7BA 3HNPA 3GDFA 3GVXA 4E32A 3GZNB 4BS9A 3NGLA 1LNQA 4XIJA 4Y8VA 5JCJA 3E48A 2O4CA 2D1YA 4NFSA 4L0QA 4QX6A 2P9GA 5I8ZA 3AJRA 3HDYA 4D0SA 4N5MA 1KY4A 1E3EA 4XYBA 4Z9YA 2TMDA 2VNAA 3C1OA 3UICA 3WDSA 2ZJ0A 4AJPA 1FDWA 1NQTA 4C4OA 4GMGA 1HYGA 1PU2A 1B14A 1RM5A 1H9BA 4R16A 1HDXA 2W4QA 4B4OA 1ZK1A 5JFOA 4NBTA 3TZKA 3IJRA 2PLAA 1ZEMA 3H5AA 5IG2A 2FR1A 1KEWA 1QRRA 4MVJE 1DO8A 4CR7A 1FK8A 1SOVA 5GZ1A 4HP8A 5GZ3A 1I01A 4QO7A 3LDHA 1I36A 1MV8A 1FDVA 1NAIA 2WYWA 1AHHA 4WOKA 4E5PA 3TL2A 4EUFA 2HMVA 4AJ1A 1GUYA 4YQYA 3S8MA 2HMWA 2EEZA 4IBOA 1U2GA 4DTIA 2EJVA 3LC2O 4KQXA 4DQXA 3BMOB 4XEHA 3GVCA 5A02A 5IN5A 1SBYA 1V0JA 3VPGA 4LVCA 1D4FA 2YW9A 1I2ZA 4J0FA 2BGMA 4YACA 3RJ5A 2I9PA 5CDGA 3ONFA 1PQWA 1P3DA 2VRBA 1XLTA 1HLPA 1BXZA 3BTOA 3L6EA 5ICSA 3Q6IA 3JQBA 4YEDA 2W98A 4JXKA 1JW9B 2J5KA 2C7VA 1Z45A 1JLLA 3ABIA 4WNCA 2OORA 5DULA 1BDMA 1E77A 4D42A 2EXXA 3MEQA 3V1UA 2PKRA 3B1JA 1LLDA 3QY9A 4D7AA 3KXDA 2JCVA 4LVUA 1GYQA 1V3TA 3BZUA 1ID1A 2PH3A 3I4FA 4YTEA 4WECA 4CLRB 4YDRA 4XYMA 3PIDA 3HZZA 2O4UX 4DL9A 1U4OA 1T2EA 1WDLA 3I9LA 2Q1UA 4K28A 1K5HA 1N7GA 1TA4A 3DBVO 3BMNA 3K96A 4M86A 4P38A 5HRUA 1Y5MA 3H9JA 1VKNA 3E5MA 3M1AA 5L4SA 4DMMA 3GVIA 1YOVB 3VH3A 3W8DA 1EEHA 5JLAA 1YQDA 4GVLA 1QV7A 4A10A 2PNFA 2GZ2A 4PCVA 2VYND 5JS6A 2LDXA 4D0RA 3E9NA 1QR6A 3DHEA 1U5AA 9LDTA 1P1IA 5A5EA 1PJSA 3U4HA 4FBGA 3JQ8B 3ON5A 2PD3A 2ZK7A 4TWRA 1LRLA 3ZV3A 4BNVA 4NJMA 1CETA 2UUOA 4PLZA 5IJZA 3OM9A 3PYXA 1MXHA 2NQ8A 4D45A 1E5LA 2FZEA 2VOEA 4E33A 1NTOA 2GGSA 2XF8A 2O2YA 3HDJA 2X0JA 2C2YA 5L3ZA 5BSHA 1VKOA 1BHSA 3PQDA 3GPIA 1IPFA 4U8GA 3OP4A 2HSDA 5G0UA 1J4AA 5T67A 1BGVA 3IUPA 2B5WA 2PGDA 3BMOA 1NVGA 3GGGA 1B3BA 3OJEA 2QQ5A 3H6KA 3ZGYA 3L6DA 1MG5A 1P1HA 4FCCA 1DIRA 4OO3A 4ZQEA 2NVUB 1E3LA 5L7WA 3EC7A 5ER9A 1LA2A 3WS7A 4E12A 4FGSA 1U8FO 4L76A 4DA9A 3RC7A 1UUFA 3F4BA 3LSYA 3SVTA 2CSUA 2YY7A 3G1UA 4J4BA 2J3IA 3GQVA 5CAEA 4IDAA 1PEDA 3F9IA 4CM9D 3H9UA 3PGXA 4OL9A 4ALMA 5KCZA 1ZK0A 3HDHA 2PGJA 3B6ZA 3K73O 4CLRA 1VJ0A 1E3IA 2OXIA 4XYEA 3KZVA 4HXYA 3BHJA 4EYEA 4ZGWA 1ISGA 4OKIA 2VNSA 5KJ6A 2OO5A 1SEVA 3MJTA 3GUCA 3WWYA 1KETA 4UEJA 4ZQBA 2YV1A 3AFMA 1YOVA 5G0WA 3VPHA 4BNXA 5IDXA 3ZV4A 4BO2A 4YVFA 1GZ3A 4ZU3A 3RBVA 2E48A 4JBIA 4MKRA 4YA6A 4M89A 3I52A 2GCGA 4IJWA 3ZH2A 5IAAA 1SO8A 1VPDA 4CUJA 3I9OA 5JO9A 3MTJA 4ITUA 2RAFA 4IZHA 2OBNA 3CE6A 3JQ7B 4LRTB 2AXQA 2PV7A 3JQ8A 3WGOA 3KRTA 2Y99A 3WYCA 1G0NA 2OL4A 1Z74A 2BH9A 2PKQO 4PZCA 3UUWA 2V6MA 1IHXA 1K89A 3INTA 1DC6A 1MFZA 5TF4A 1U4SA 3GUYA 5GY7A 4C7JA 3R6DA 3F1LA 1U3VA 3OHSX 4KOAA 1P0CA 3W4KA 1GZ4A 2J5QA 3FSRA 1NM5A 4PVDA 4EZBA 2CDAA 4Q3DA 1PX0A 5ILGA 1PL8A 4EITA 4F6CA 1PJ3A 2TMGA 4R1TA 2QRJA 1R6DA 4IDFA 3AY3A 4RLSA 1A71A 3CEAA 3T4EA 1RYDA 1WDMA 2YFQA 4I9UA 4P4NA 3ROKA 1ZH8A 2O7SA 5U1PA 1A27A 3LZ6A 4XR9A 3WX0A 2DUWA 1Y9AA 3VOSA 1MC4A 1NNUA 3EMKA 2EJWA 1B8UA 2J6IA 4Q9NA 4PG4A 3VZPA 2CDCA 2X6TA 1EFKA 3VVCA 3NTRA 3S2GA 4KWHA 4BOYA 4QFCA 1QORA 3D4OA 1IHYA 1B3RA 3T7CA 1ONPA 1E7QA 4JBGA 2FP4A 3G17A 3PP8A 3IKTA 1KBZA 1C3VA 1X7HA 3UCEA 4G5HA 4E3ZA 1VC2A 2NACA 3JQ6A 5B4TA 3O38A 2P4HX 1PTJA 4RGBA 3BA1A 4BKRA 5TC4A 3FTPA 4E21A 1ZXLA 4PLFA 1EVYA 4BL5A 3BYZA 3ULKA 3ETEA 3ZWCA 4UAGA 1E3WB 1HYEA 4HNHA 4N18A 3QJ5A 4UUNA 1AN9A 2CNBA 3EHEA 4K1LA 3RUFA 1NWHA 1XGKA 1NHWA 4ND5A 5BR7A 4TKMA 4PRLA 4J1QA 5IZCA 1UAYA 4P8RA 2PD6A 4FQ8A 2FOIA 2O3SA 3NT5A 4AVYA 1HZZA 2I76A 4BV8A 3G79A 4Z3KA 2W90A 1GY8A 2EP5A 2P9CA 4YJHB 4DLAA 1XA0A 3IL2A 2P5UA 1VSVA 4W9NA 2FN7A 4XB2A 5A06A 2BHLA 5KNLA 4UEOA 1BXGB 4U0KA 2QIOA 1LSUA 5TNXA 4MPDA 2JL1A 1MB4A 4Y98A 4E2ZA 4F3YA 1ORRA 1B16A 2B37A 4TQGA 3GGOA 4DUPA 3WOHA 4XGNA 2Y67A 1EUCA 1O0SA 2Y1OA 1YKFA 1Y8RB 5ER6A 1QYCA 3D3WB 4N5NA 3ROQA 3U4DA 3QVOA 4U6QA 1GQ2A 3ZV5A 4A73A 4J43A 4J3FA 4O63O 5BSFA 2LDBA 1LX6A 2CZCA 4KMSA 3DTYA 1MC5A 1H5QA 2WWRA 1Y6JA 1A4IA 2JHGA 4X54A 4YJFB 1PQPA 4LCEA 2DBVO 2Q46A 4NJOA 3WG9A 2ZYAA 3BIOA 3DZHA 4FD3A 2FZWA 5JCXA 1RM3A 3HN2A 3WGHA 3F4LA 3HDQA 1T25A 2PKQP 4E0BA 4FFPA 3TL3A 4URFA 4XGIA 3KLMX 3SXPA 3ZWPA 5K6AA 3H7AA 3DZJA 3WNQA 5ENDA 1W4ZA 2XOXA 4L4RA 1SMKA 8ADHA 1T2DA 1E6UA 1NR7A 2PD4A 5G4LA 3LC1O 3DZIA 3HB5X 1EK5A 3I23A 1W6UA 1WZEA 4RDIA 4BKOA 5HBRA 3GDOA 1YL7A 3JQFA 3OETA 1DLIA 3PLNA 4BVAA 4ZD6A 3GZ4A 4IQ0A 5TSDA 1ARZA 3GNQA 2WD7B 4YT8A 5IF3A 5TJ9A 4LSMA 4BO4A 2WYUA 3WNVA 4NQZA 1E3JA 5THQA 2JFGA 3GGPA 2H1SA 1PSDA 4CM7A 1DAOA 4IY1A 4R5HA 4UREA 4Q3EA 4XZ3A 3TN7A 4FFMA 5A03A 3HFSA 4GKBA 4OQYA 3AUTA 3AFNA 3GC6A 4LRSB 3PFWO 5CPBA 2NU6A 4BNKA 4GX2A 4L8VA 1T2FA 3NDIA 1OAAA 3RD5A 1W8DA 4LGVA 4I08A 3JV7A 4DQUA 2YV2A 1ML3A 4YJHA 4BV9A 3OJOA 4A2CA 4BNYA 4YRDA 1K3TA 1MLDA 1BXGA 1P1JA 1RPNA 4GBJA 3WSVA 2J5RA 3CZRA 4MVJF 5EL0A 5TJHA 4YAGA 3A14A 3H5RA 4R1UA 3KO8A 3OA2A 2NSDA 3FNEA 4GWGA 3EYWA 1Z7EA 4GGPA 3IOYA 2UV8A 5ICMA 1Y8RA 3D3WA 4JLWA 4YT4A 1EDOA 1YL6A 1F17A 4LMRA 4YPOA 3INGA 1QYVA 3MWDB 3RC2A 4U5QA 1ZK3A 4YJFA 4IJVA 4XRRA 5L45A 3H65A 3IP3A 3TOZA 4R4JA 2V65A 4E13A 1DBVO 4J1SA 1PIWA 1DXYA 5JYDA 1M6HA 1NPTO 1GZ6A 1EVIA 1JAYA 1K2WA 3PDJA 4QUKA 5JC8A 1CERA 3ADOA 5TRTA 3D3EA 4ND4A 1DAPA 3TF5A 4MINA 4OQZA 1GD1O 4FPXA 1KEVA 3PJFA 1YDEA 4NU6A 4FFRA 2AEFA 1P77A 3QWFA 3SJ7A 1DOHA 1IL0A 3RKUA 1YBAA 3PWZA 4MVJG 2Q99A 4N54A 5COAA 2JCXA 3WFJA 3CUKA 1XHLA 5F1KA 4NHEA 5F3RA 5B4UA 2UVDA 2IODA 1KC1A 2WD7A 1PJLA 3WTCA 4BGVA 4YR9A 4W82A 1QYXA 4PLTA 5IZCC 4GX5A 1C1DB 3TFQA 4XYLA 2UYYA 4NBUA 1NVTA 3QWBA 1YS4A 4NNJA 2PZKA 3ZHZA 2VRCA 3DMTC 4ZA2A 4XGKA 4W9NC 2QRLA 5CP8A 1LDGA 1PL7A 1YRLA 3UOGA 2GRAA 2ZB4A 4IDDA 3TWOA 3WLFA 2GASA 1ZFNA 2VHWA 4BNMA 1QXSA 2RCYA 3WGIA 1J0XO 3DBRA 1KERA 3C8MA 3OQ1A 3NDJA 4BMVA 1EK6A 3A28A 1Q1NA 4DGSA 1VSUA 3JD1A 4MKXA 1MP0A 1WDKA 3WQRA 5JMWA 3JYOA 4E5KA 5HWSA 4L75A 1Q0LA 1BVRA 4KZPA 1XU7A 2EHDA 3UHAA 5KVVA 2FWMX 4KUGA 1G1AA 4R54A 4EUEA 1I32A 2Y1FA 4U6SA 2AEJA 3KSZO 3RU7A 4CQMB 4I8XA 1I0ZA 3ADPA 1H2HA 4GX0A 1Y8QB 3VZQA 3VHRA 3QWIA 2NTVA 2G5CA 3QIVA 5L51A 1EBFA 3E6AA 2O7QA 2Y0EA 4WLOA 4DQVA 2BFOA 4CLOB 3B1KA 1DFHA 1X13A 2Q2QA 3GVHA 3SJUA 4BKUA 4D44A 4ILKA 3DZGA 2AHRA 2RH8A 2YFHA 5L4LA 3WMWA 3JQAB 4WK6A 2E4AA 1FF9A 1P45A 2YHUA 1M6WA 1QLHA 2P2SA 3LK7A 1IB6A 1QP8A 2A35A 2HQ1A 4J7CA 5TX7A 2RH4A 4KUEA 3DBHB 1LDYA 5MDHA 1KEPA 1U1IA 4CV1A 2WM3A 1ENPA 3UH1A 4JNKA 4Q3AA 4JGBA 4WGGA 4PG6A 4HWKA 1CJCA 2VYVA 4RVFA 3WB9A 3K2EA 2J8ZA 3Q2KA 4WJZA 2PK3A 2YHIA 3L6OO 4NBWA 4O1MA 3VPFA 3AI1A 4DBVO 3QVSA 2BFPA 4PLGA 4Z9FA 4E5NA 3FNFA 3VKUA 5DZSA 2IZ1A 5KIAA 1GYPA 3DZFA 4MVJI 1FJHA 1EBUA 1QG6A 2C59A 5CG1A 4R69A 2GUGA 4XQCA 5GMOA 5CG2A 2DBRA 2P4QA 2HK8A 5GZ6A 1C1DA 4NIMA 1EE2A 1NFQA 2D8AA 4CUZA 3I5MA 2NNLD 3C3XA 4HBGA 2YYYA 5EMHA 1OZAA 3HQ4O 4I1IA 1HZJA 2PZJA 5J23A 5I9MA 2O3JA 3OJFA 3ROMA 1ZXBA 2Y1CA 3L9XA 1PJCA 1WWKA 2VWHA 4WLVA 4XKJA 2BLLA 5DCYA 3NGXA 3RC9A 3STHA 2XPCA 1UP4A 3O4RA 2O50A 3GAFA 1SAYA 3IIEA 4PVCA 5U9CA 1EDZA 1NHGA 4UUPA 3QVTA 3H2SA 1SZJG 3W8EA 1O95A 1S6YA 2EW2A 3K6JA 4EJ6A 1R4MB 1Z73A 1WXDA 1KVSA 3CMCO 2IXBA 3WIDA 1RM0A 4MVJA 4UULA 2B36A 1BXKA 3WQQA 2EERA 3E9MA 4IS3A 4Q3NA 3PGJA 4JX8A 4RQTA 3UGKA 4CM4B 5C3MA 2ZCUA 3JYLA 4IDEA 1VM6A 3TFOA 3CH6A 5TT1A 4CLDA 1Y9EA 1ZIDA 5F5NA 1NPDA 2G17A 4IIUA 3ONDA 1GR0A 3NEPX 4M49A 2I99A 2AG5A 2GN9A 1YB5A 3IDSA 1UXGA 5A9SA 2X0IA 2X4GA 4J4HA 3BTSA 3S2FA 4ALKA 3E5RA 3H2ZA 3D64A 1WPQA 4ND2A 4CQLA 1KVTA 4XD2A 4CMIB 2O2SA 2GO1A 1BDBA 5L40A 3JQAA 1EVZA 3FWZA 1LU9A 3EZLA 3KV3O 3CSDA 2FR0A 2O23A 1DRWA 1PJBA 1YVEI 1LJ8A 3D0OA 2QZZA 3G49A 4NI5A 4ONEA 4Z9XA 4EJ0A 4R41A 3WLEA 1UXIA 3HWRA 4DLBA 5I8WA 5IXYA 5JDCA 1U3UA 1CWUA 2DTEA 2VN8A 1SB9A 3MOIA 3HJAA 1I3KA 1C0LA 3W8FA 5G0VA 3OIGA 3ZN2A 3WWZA 4OXYA 4D43A 5IXSA 3RUDA 1GL3A 3W6ZA 1LDBA 1EUZA 2RHRA 4J7XA 4LCJA 3U5TA 4DVJA 4Y6RA 2PY6A 4ALLA 3RUIA 3O9ZA 5DP1A 5MGBA 3N58A 1ONNA 1H6CA 3FI9A 3OJLA 4YT5A 2UUPA 5HA5A 3ZHBA 4PLCA 1R4NB 1U28A 2WYVA 4JROA 4NDNE 1GPDG 3FPCA 2P68A 5DCWA 4L4SA 2E82A 5DP2A 3SC6A 4HY3A 5EINA 3WYEA 3C7AA 3WIEA 1X0VA 2IEBA 2E6UX 1ISHA 4BNIA 2NQTA 2VTEA 4B7UA 4E5MA
chains in the Genus database with same CATH superfamily
1JG2A 5GV7A 1KEZA 3EQ2A 3R5HA 1W87A 1B42A 1N2ZA 3HR7A 3FPAA 3FBGA 2RHBA 3GZNA 4M3NA 4CUKA 5E6UB 3UAVA 2P9BA 3FMOB 1GNPA 3ETDA 2BUCA 2UVPB 1N7HA 2X3YA 3AF1A 2DBQA 3BG5A 3LHKA 4MWGA 1YR8A 4MQEA 2IGBA 4OQNA 3WNZA 1OAOA 3ZE7A 2JLCA 1J1UA 2OZVA 3WK4A 1L7MA 2AFHA 3VKWA 3ZGYA 1G64A 2FG6C 1R16A 2VG8A 4EDHA 2GK3A 2HIHA 3KSUA 5AOCA 3L6BA 4LGCA 4LJLA 4DDTA 5C1DA 3ZDEA 3K31A 4JMPA 3ZU2A 4XWYA 4ZVVA 4CL8A 4QARA 4OIFA 1ES9A 4L72A 1X8KA 5HZMA 3ZD9A 3O1LA 4OAQA 4MCAA 5D6OA 2JAOA 5ITWA 1KS9A 1NU6A 1PP4A 3T34A 1A9QA 1YTUA 1QIDA 2VDRB 6REQB 1WXEA 2ZT6A 4G5YA 4Y1EA 4EF4A 1NC1A 4QYMA 1BS1A 7ADHA 4DOMA 3H97A 3OFSA 3F71A 4IILA 3U1VA 4XR4A 2JI8A 4LV5B 3Q4GA 3QENA 1Z6ZA 4JB8A 4ID9A 2QVXX 4BO7A 4B4UA 4K3VA 4PBSA 1OTHA 4FEYA 2G06A 3V6LA 3P4YA 2Q6VA 4HYQA 3R5KA 2NXJA 2QJTA 3U56A 1P6XA 3U4GA 1NONA 1XKQA 3L1HA 5K8CA 3VTFA 2ZKLA 2WLSA 1AZWA 1ULHA 2JJ8A 3JQQA 3Q7TA 4NH4A 5K9ZA 1PHRA 1Z6XA 2PL1A 3ZZMA 4E94A 2NUTA 5HS6A 3TLJA 4XUGB 2IZZA 5C37A 1FX0B 1Y34E 3OEHA 4MRAA 3UEOA 1SJ9A 1WF6A 3DT6A 3DL2A 4E4YA 2YUIA 1P3Y1 4FZJA 1CQJB 1NT4A 4RVSA 4EI2A 3IV9A 3U4AA 3QEAZ 1FXWA 2VHTA 4Y7DA 1FOEB 1L4KA 1R5JA 3A1NA 2XYRA 4Z4QA 3ZG6A 4XDYA 2Z9BA 4LG1A 1O95C 4PG5A 2J5XA 4WKCA 1G5HA 2E4YA 3MIIA 4B09A 5ALJA 4U7PB 1IZ9A 4BQIA 4V1CB 1GU1A 2VPQA 3MVEA 5DBOA 2IWRA 3GRCA 4P98A 4UVIA 1CX9B 4MYRA 4U9HS 4ND7A 2FK8A 5ECWA 1ZCJA 3K20A 3K6RA 3NIBA 4L5YA 5DWQA 3BBPA 3BHIA 4LV6A 1N1EA 1T2CA 3MTQA 3WZ2A 4EGJA 1CQIA 2PRZA 5BSMA 4TZKA 4GKVA 5JCPA 2J5BA 5JVDF 4AJNA 2C9CA 5I7FA 3G0OA 4ZZ2A 3VDMA 2EKZA 1JQ3A 3A6HA 1SXJD 4BIMA 4P4LA 4QD3A 4QDTA 1JFTA 4FJ1A 1U3WA 2IX3A 4JYMA 3QYJA 2FNAA 4CTKA 1OMOA 2OENG 1JHQA 2A1UB 3ET5A 1GLGA 3U31A 6NULA 1Y42X 4KWTA 1O4WA 5EKUA 3HY6A 2DC1A 5JADA 3P19A 1WMEA 2GJ8A 2R79A 3DULA 4RWEA 2ECOA 3WJAA 5KINB 3NONA 3F3KA 4AO8A 2NLOA 9GPBA 2D00A 4IOJA 2VTVA 1NYTA 4RMNA 5KTTA 1HDGO 1KK2A 3EUWA 2P91A 4G0ZA 2XMZA 1VYVA 2WVGA 4TMKA 4DR3B 1CKEA 2HDWA 3KPUA 1GPNA 2RHOA 4OGFA 2IS4A 2R68A 3OZXA 3OU7A 4ZV7A 1DAMA 2ECFA 2KJQA 3BBLA 4ZANA 4F97A 1EX6A 2ALJA 4OHMA 2WIAA 3AEUB 3I6YA 1S1MA 1GTZA 1NWCA 3LCJA 4OLJA 1CR4A 3Q5DA 4V0QA 3H87A 3TQQA 4D3FA 4YAIA 1MVLA 2RGNC 1YDMA 5EG5A 1PZFA 4A7PA 3X1WA 4DWVA 4BB9A 4V24A 4ZOCA 4AMYA 3IEKA 2O0LA 1RXYA 1CLUA 4N7MA 4Q15A 5TQJA 1LSOA 2AHOA 5CDFA 2QN8A 3CXRA 3MRSA 2ZBFA 1D6MA 2BC9A 3D4PA 2WVJA 4AMVA 1ZMRA 2OORC 1GPWB 3I1JA 3KZ1E 3C3EA 4AKTA 3HP4A 1L5YA 5JSZA 1DJPA 1WOMA 4L5BA 4CLEA 2C2ZA 2WTXA 1ZNXA 5A1TA 1TT7A 4HGQA 4JVMA 3DEHA 1B26A 3C5HA 1ZKDA 4HTAA 4I6GA 3W90A 3VH4A 2O8DB 3PG5A 2WVHA 3CLKA 4MPTA 4OA5A 4JL6A 3G0BA 3OUUA 3SXUB 4QG7A 4L78A 5FQNA 4D79A 2QENA 1I2MA 4ARAA 5CB6A 5IF9A 2AI2A 1GQSA 1ND6A 4TMWA 3IX7A 4ZQIA 3U7EB 4J6FA 3AIOA 3QGMA 4K6FA 4UHEA 3HB4X 4CE6A 4B3GA 3QV2A 4WXPA 1DCTA 2Y1DA 2BOVA 4ND8B 2FETA 3ZDYB 1M10A 1G8MA 3G2JA 3F7MA 3QFTA 3L5KA 3VX4A 4DV6B 1UQRA 4NDAA 3LXMA 4TV8A 3T9CA 1JJVA 1AZSC 1D09A 1F2UA 1JHUA 1KI8A 2AE2A 5JATA 2O54A 1XEFA 2D3TA 4GSKA 4UOQA 1T5IA 3HCRA 5CLIA 5D3MB 5F1OA 3W79A 5DEOA 3QELA 3FOEC 2EKBA 4E22A 2AIRA 2FSGA 3QE9Y 4RLQA 3MFQA 3HCAA 1F1BA 1HG0A 3O8OA 4YV1A 3KSBC 1D8AA 1U2ZA 5AKHA 1D1QA 5JHHB 4QT4A 4RH0A 1O9HA 3J81A 3TKAA 4MR7B 1E6WA 1YIAA 2ZTMA 3LUDA 4AWAA 1J06A 1JVSA 1OX4B 5G40A 1ZBDA 4UD6A 2J67A 4XB1A 4DR1B 2A57A 1B8PA 1CJKC 2OMEA 1QFMA 2WP8J 2YW2A 3M4JA 5DW0A 1KWKA 3VBCA 3H7IA 3CF6R 2DPYA 5BYJA 4Z3DA 5GJCA 4E1VA 1P74A 4IF4A 4B4WA 1L9XA 3A2NA 2LV8A 4YAKA 1M2GA 1Y1SA 1I9CA 3P5SA 1FRFS 1RXIA 3LBHA 3BMCB 1SUPA 2IU0A 1T3ZA 3CUVA 1K3UB 4FR5A 4G5SA 1KU6A 4PFJA 4EB8A 2CDRA 1A0OA 1J0AA 3PKJA 1PV2A 1NNLA 2YXPX 3AFIA 3K9HA 4M9ZA 4NG5A 4PWYA 5DM0A 3R3JA 5ECDA 1FS5A 1J9EA 2PNJA 1P7WA 4DCCA 3F3SA 3OQ6A 4QJ3A 3TI7A 3TDMA 2EGHA 1Z33A 3CISA 3OOSA 4MQUA 2D1QA 5EHGA 5AUOB 2FY8A 3H8VA 3K1AB 5EZ5A 3RU3A 3T94A 1Y7TA 3ZI7A 2FQQA 3CUUA 2Y76A 3FAKA 4YCSA 5KVAA 3QVXA 5GINE 3X2FA 3PLAE 2XGGA 3AEQA 2HWKA 3CM0A 3N07A 1ATZA 1Y4ZA 1KXJA 1DMRA 5L3QB 2GFQA 1WUHS 3AJ9A 1J9ZA 2C78A 4MV7A 1MIOA 5L7YA 1B6TA 4JXZA 1F2TA 3U3MA 1JDJA 3DPUA 3II6X 3N6RA 5JAQA 3KYDB 2C4KA 4LYYA 2VCHA 3LYAA 2VK4A 4QUHA 5A2QA 3CWCA 1FL9A 3G8AA 4IRXA 3TNJA 5JH7F 1K63A 1IBSA 5J3JA 2QTFA 2XVYA 5AVKA 3U9TA 2IP2A 1KEEA 2E4XA 2GA9A 5FF9A 4CL3A 4PO3X 1EA7A 1G66A 2F1KA 2RHMA 4G01B 4BB6A 5A04A 2JASA 2EAUA 5F98A 3Q5GA 1T8TA 1VBFA 3U5ZB 3K9NA 2ET6A 4WLFA 1D2AA 1N1GA 1DTSA 3AIMA 3AU8A 5K01A 4NV1A 1Z0KA 2GN2A 4GBED 1SA0A 3MAGA 1KY5A 2OO5C 3A2KA 3F5DA 3HRKA 5ECGC 4YNBA 2R7KA 5AHRA 3HYSA 1BWPA 3CH4B 3MTAA 4DIMA 1OZGA 4QFBA 4GLBA 4INZA 4NZNA 2QX9A 2QU7A 5CNJA 1EUQA 2VDPB 1UK9A 3H5TA 4JLPA 1SBNE 2W2LD 3RHZA 4TLAA 4G0WA 4IZOA 4ZVQA 1L3BA 1M6EX 4EW2A 4IVPA 5EJ4A 1CUWA 1M5TA 3ST7A 3TLEA 1FFXB 4DCSA 2H06A 1C50A 1N6NA 1IHUA 3W5UA 1KNXA 1L7XA 2E0IA 2ZTLA 2NU7A 4KTVE 1Q6ZA 5IEBA 5KC8A 5KEIA 3RQIA 5JAMA 2PBRA 1G9SA 2H3EA 2OV4A 3GCZA 4EKYA 2ONJA 3DLHA 3E9CA 1T3TA 4YP0A 5JSKA 3UAOA 1DC8A 3HGMA 3I4LA 1FRQA 5HIKA 4IVNA 4L4YA 421PA 3Q9LA 1ZI6A 1XCLA 2OWEA 3FSJX 1GNTA 3HJBA 2XNDD 3MCVA 2WZDA 3N2EA 3CZ4A 5AHKA 3STWA 3RK4A 4HEA1 4JT2A 2XNHA 1Z37A 2ZIEA 1FUIA 1Z8FA 4HSEA 2A0XA 4LJRA 2H1IA 3OSUA 3F6RA 1EZ1A 5TQVA 2RBGA 4LC9A 3PWKA 2VC2B 1OD6A 1A9YA 3PXBA 4QDXA 1SQ6A 3I2GA 3IUYA 4ZYWA 4QULA 4K9KA 4DLTA 5D3KA 1TT5B 4FONA 3IP1A 4FQ7A 3SSOA 4FFLA 1WMDA 1CB7A 1ECPA 3HH8A 1UPAA 2JAQA 4HAIA 4HOYA 1T8YA 3Q2OA 1HDZA 1I2BA 4RLHA 4B76A 1SUBA 2WUDA 1V41E 3WBBA 4KVZA 1AN0A 2XMBA 3EDMA 2JAPA 3T4PA 3RT9A 3WZMA 4ZQCB 2ZAIA 3AUUA 3ELYA 1KJ8A 3RODA 3U26A 5E2AA 4LJ7A 4N5LA 2JIQA 5JD6A 3DGFC 4UATA 1HRDA 4LZNA 4F84A 1X42A 3CF0A 1RMQA 5HE8A 1ECLA 1BOOA 2AG0A 3IP5A 4XPIA 4XQEA 3W9UA 4O3MA 2JJ2A 2PMEA 3PPXA 1E58A 2ZDHA 1Z5ZA 1PCXA 4NX2A 1I4EB 2VBCA 3GCXA 3TUZC 1X0XA 3LNCA 2HO4A 1M75A 2A1TR 3FH0A 1G7SA 4QHYA 4FCWA 2BHSA 5HKAA 2ZBGA 2DF8A 3N6XA 2FSPA 3QQPA 4GYWA 4AG5A 1JDNA 3PX3A 2Q45A 4UPDA 4FNAA 3MTGA 1PTJC 2EYUA 2H1CA 2VPZA 3EVFA 3IDZA 4CU5A 5KYNA 1SUAA 4LW8A 5FBWB 3BGWA 3RHTA 1NVMB 3EA4A 2XEDA 2D4AA 1MJFA 4QXOA 1FLDA 3EXHC 4J29A 3KYIB 1CEEA 1RQGA 1W34A 3N5KA 1YKSA 2OXRA 3M83A 4OIMA 5FNVA 4QHSA 4TT3D 2XCLA 2QMEA 5LJLA 2GLXA 4IZ6A 3AM3A 1XXHA 5T3UA 4CMKA 3D1LA 5E6SB 5EEHA 3UANA 1IIRA 1UKZA 3H2GA 4PTLA 4B2LA 4EUNA 2QAGC 3QUBA 2ZJYA 4KJZA 4CG1A 2QQFA 3PZRA 2BM1A 1QUEA 2R48A 4KMRA 1KYQA 3TSWA 5ILOA 4AG3A 2X5XA 1EB8A 1Y63A 2QGNA 1DPGA 1M8KA 4J0GA 4RO0A 3VOBA 4PYJA 1WB4A 4ZAYA 4YV2A 3A7EA 1I7NA 4GYJA 2R1UA 2DP4E 1WD7A 3TZCA 1GG8A 5KKNB 1XRQA 1CFZA 3KPJA 2I55A 4ZZ0A 2ZR9A 3FPEA 3GVPA 3IUQA 4DE5A 1II8A 3QP9A 2G67A 1Z8HA 2P9EA 4QFDA 5C5CA 2YQ4A 4OUDB 4RMHA 3A6LA 3H6HA 4H15A 4UHBA 3DMPA 3F0TA 3WIBA 2REOA 4W9MC 1WCV1 3AETA 1GUFA 5ALTA 1EX7A 2HXSA 2E2WA 4FSDA 4BWVA 4BE4A 1A8IA 1Q0TA 3A2LA 1PLKA 3C7CB 2PVPA 1C2TA 1X7XB 3H11A 1N33B 2X5JO 3H04A 3DF9A 1DT3A 4AF8A 3WQHA 2GBFA 2Z08A 2YY5A 4FZRA 4RCVA 5HP4A 3LT1A 3PC6A 1F0YA 5TMDA 5FUYA 1CRZA 2QYOA 4K87A 4N76A 4ZRNA 4BBPA 4CDMA 5C1IA 2WHPB 3QW2A 1CR6A 1ZAKA 2GT1A 4NC9A 3I73A 1ZAYA 1C7IA 1O95D 4ERXA 1TRHA 2Z3VA 4WFKA 3UB3A 1MXFA 1KR5A 3HC7A 1P9LA 2G36A 1JHYA 3ASUA 4ZO8A 3A9UA 2QM8A 5CDUA 2ILVA 1P17A 4EEZA 2XUJA 3GHYA 4R1SA 1M1UA 1R9MA 2NNWB 3NDRA 4O0MA 3DWGA 3KL4A 4P7FA 3CN9A 3E1KA 5LZ7A 1GJRA 4IPTA 4J4TA 1NBMA 5JCJD 1NN1A 1S5PA 3RJ9A 5K6AC 1OILA 3V1LA 4G5XA 2B20A 1JEJA 3E18A 3SEFA 2W37A 4DDWA 5HM8A 1IE3A 5EJMA 5JECA 1K7EB 3AF4A 4B6FA 1BSVA 1L9KA 4OM7A 2P6MA 3AVUA 4HAYA 2AN3A 4ZALA 4F4UA 1WB6A 4ZI2A 1OTXA 3KYCA 2RGGA 1VIAA 2J3QA 3A1UA 4UVEA 1SBHA 1T5OA 4PCLA 5DM2A 5AVXA 1JWLA 3R7DA 2Z5LA 1DV1A 1QONA 3B9BA 1DAFA 1ZMXA 2PZLA 2HL6A 3TTUA 5AUPB 4K2HA 5B30A 5BNTA 3T3IA 1Z2OX 2EFGA 1Y89A 3ENZA 4OXRA 4R2WA 3QLUC 4XD7D 1YS9A 2ZYDA 2W6CX 1TYDE 2UZIR 1EM8A 2CK3A 2X13A 3DAHA 4URYR 4RK0A 4AMGA 1QO9A 8GPBA 1XLVA 4E15A 1M2OA 1QM5A 3T5TA 1H85A 1P9OA 3SNKA 4B44A 1JHXA 2AW5A 1P0IA 4KQHA 4BEJA 4HX2A 4F92B 3M5WA 3SQMA 1FDIA 3T0GA 5KYTA 2FZ5A 2Q5EA 1NQAO 4GQAA 1FIUA 3RG8A 3JQRA 3QEBZ 4G3XA 1IXSB 1P75A 2CJYA 2EFEB 3GLRA 1WMFA 2DUMA 1CY2A 1NNI1 1FDTA 3CCFA 4JQOA 4K7JA 4KQ1A 5E4YA 4A5SA 2QTVA 3DZKA 4IXWA 3L07A 4QRDA 1JSXA 4KVGA 1MB3A 5T5QA 5A4FS 5JAOA 1QCZA 1H4TA 4FOTA 3SMVA 4ZVOA 2O3UA 4EA8A 1X8JA 3TIXB 3GO4A 3ONEA 1VIMA 4AZ0A 4FHZA 4UE3S 2UU9B 5MHTA 3GRZA 1LFAA 3FROA 1GTMA 1T4MA 1K9SA 2ZVJA 3VR3D 2GKOA 5LYJF 1YA6A 2HA4A 4MQFB 2CFCA 1HYHA 2BGIA 4BGIA 2BTOA 4W5WA 5HZKA 2F43B 3S2UA 3JQCA 4MRMA 1MTZA 4FFNA 4BKPA 4DA0A 5TPZA 3B1XA 4C3UA 4IF6A 4YCBA 5AVRA 1XV5A 4UDYX 1SKUA 4Z2AA 5BSWA 2ZRPA 3ZE9A 1E4EA 2B92A 1J8MF 2IVZA 4B80A 2IL1A 4BVHA 4PR3A 1SOAA 3RIHA 4F8YA 4CIAA 2HUNA 3ER8A 1UMBA 2IZ0A 5GJVC 1L3IA 2C2XA 5A3JA 3N8GA 1HNNA 4PZPA 3SBXA 4E1BA 1GNQA 2G5GX 1Y9ZA 1IUPA 1XMVA 5F5LA 2FG5A 2P4SA 2PLWA 3AG5A 1CRLA 3HVKA 1QAQA 1Z6GA 4M0FA 2YHBA 2R97A 3KQSA 3PE6A 2VUTA 4A6EA 1SCNE 3WIVA 2I22A 4B47A 3BC1A 2NWQA 5BR1A 4ZREA 5EHIA 5IAKA 4CLOA 2A0UA 1GRCA 1XMSA 4CG3A 2PSSA 1NR1A 2H65A 4J90A 3SHWA 3DUWA 2YCLA 2KYRA 2PR7A 4O4LA 3CXUA 1WLYA 2PKEA 1VMDA 4RA6B 1K9VF 3FJYA 4F46A 2PQ0A 2CMGA 1POXA 4JS0A 2VTDA 2R1TA 2O1XA 4IGFA 1Y1LA 2WD8A 3H2JA 4QQFA 4P9NA 5DLDA 3UXYA 4AN0A 3ER9A 1FRZA 4CEHB 4FHGA 3D7MA 1I3OA 1HG1A 4KYTA 2IEGA 2VF7A 2X9VA 4UNIA 4YJ3B 1VJ1A 2BPOA 3GMIA 3WQSB 3L40A 2ZRDA 3AESB 3TB6A 5JI2E 2ZU0C 3MA0A 4P4TA 4GO1A 3TAUA 4BMNA 3L82B 2I0FA 2NPIA 3C3KA 3HXTA 4NJMB 3RBXA 1IHDA 3D0RA 1KYZA 1O96A 4H7DA 4C4RA 1OH8A 5AQEA 3CTMA 5C7OO 3LM8A 2JFHA 2C29D 5CDTA 2AZ4A 1CF2O 1KMIY 1J2EA 3A3NA 3RTGA 4GPD1 1OZ0A 3IMFA 3AGPA 4KIWA 4KN6A 5EUQB 3IEPA 1KFJB 3THSA 3ZWKA 1DFGA 1FTWA 4LE2A 1R0KA 1EFAA 1PG2A 2BKUA 2WUWE 3AIIA 4AJHA 4CI0B 2BF4A 3NAQA 1XKTA 5FADA 3P9ZA 5IM4F 1MABB 3F97A 3TIFA 1TLTA 4CR8A 3QKWA 1P1FA 4LUCA 2GN0A 3ZYCA 3TS1A 2WUFA 1NLFA 3WIUA 1W48A 3NHSA 5EMNA 1Q22A 3CLRD 1TVCA 1IHPA 2QL9A 4MWTA 3O0TA 4JJAA 4C0AC 3HCDA 4MIEA 4ENPA 5IANA 3COJA 1RTTA 5F4BA 1JKJB 4GPZA 4Q16A 2QPLA 4MYCA 1RRFA 1W0CA 3QPAA 1Y6ZA 2AH5A 4L22A 5DO9A 2BJWA 4ASUA 2C5LA 4B6RA 4B8ZA 1KQFA 5FBHA 1B0UA 1UBMS 3JS5A 3KBBA 5EMLA 4DDHA 2WMDA 3BK1A 2J4CA 5DLPA 3KEMA 5AXCA 3C43A 1IOVA 5TMPA 3FBTA 4OKNA 1NVFA 4LVOA 4N48A 1AV7A 3RVSA 5BWMA 2G5PA 4LQ4A 3NRCA 5IAOA 2NSLA 2W4MA 1OCEA 1XN4A 3D7SA 1YHZA 3WL7A 3UBTA 1CY8A 1KR2A 4GDFA 4M54A 4OB6A 1ISSA 4A8JC 2ERYA 1U11A 1YCHA 1V35A 1A50B 3USCS 1A5ZA 1QVWA 1Y3DE 2R3SA 1I3MA 2GN8A 1K86A 1VIVA 1HDYA 3RW9A 1K92A 1M6VB 4CFYA 3LDFA 2HO5A 4HFMA 4DRXB 4E5YA 1F0PA 1KOJA 4PQGA 4EQZA 3AKZA 2AFIB 2CVQA 2O57A 2TECE 3DHWC 1H2FA 3DHVA 4Q7JB 4WFQA 5JWHA 5M3BA 3UK0A 1UBRS 2V5AA 2C8VA 2P4UA 3K0HA 4RIIA 1XC7A 1BXRB 2AMLA 1U0TA 3EGDB 3WK6A 1J6UA 1F8UA 2ACEA 2H7YA 3BL5A 3EMVA 1BEZA 1LQTA 4RHXA 1B8NA 1XVUA 4CMIA 4DLLA 2LKCA 1XCJA 2YV3A 5AO9A 4QGGA 5TXGA 2Q7OE 1N2EA 5C3UA 3T8YA 4RZHA 4B3XA 4K81B 4HPXB 1S2IA 5KO2A 1M1YB 5BN3A 2ID4A 4KR7A 1AK1A 5TLSA 2VA9A 4C6RA 3UMFA 3I1IA 5FWNA 3A9TA 5H4HA 1ZHHA 3MLEA 4AWXA 4JI7B 1P4JA 1VHQA 1P7YA 3FPJA 1QYIA 4NEQA 1OLXB 4Y2UA 2B1GA 1NXQA 2Q3LA 3ELDA 3E3NA 4H3KB 2FEPA 4D4IA 3H99A 3KOYA 3MBOA 1USUA 3S1LA 4Z7QB 3Q7IA 4NNOA 1N8NA 2DR0A 3OPVA 4CT5A 1UEJA 3EQZA 1WUJS 4HS9A 3V7YA 3GEGA 5K05A 4A8TA 3HVRA 4LX0A 1UPTA 4FB4A 2JD0A 3DLIA 3EDCA 1DTWB 5GIOE 4WLEA 3BWXA 5F3WB 1ADYA 5C2JB 3CX3A 1EEXB 4D99A 1I7DA 3OF3A 4AWBA 1AQNA 1MFPA 1QHHA 2C82A 1O8BA 1H66A 4DUGD 4QM6A 4YRGA 4I2NA 3KVVA 2O7RA 5JEDA 1UFOA 3N28A 4HLQB 5CVEA 2PUFA 1EE1A 2C84A 4QBKA 4C1NA 1NF3A 1TM7E 4FCTA 3TR0A 5KDDA 4EW6A 4J76A 4UMVA 4IIEA 4EKEA 1VRVA 7MDHA 2LWIA 4AYTA 1OLUB 1R4NA 3PK0A 5IJXA 4CKZA 3AXTA 3HA3A 4KODA 2UXCB 4OSPA 5C8ZA 2C58A 2X22A 5JDIC 4EELA 1KZGB 2HIAA 2YVAA 2GZDA 3WNCA 1LW6E 3NQ41 1R0ZA 1WV0A 4OV6B 5C32A 1T3GA 2DTDA 2H6EA 2PUAA 5TMBA 2OE2A 4RKWA 1E1NA 2NZUG 2Q1TA 3REGA 4GRDA 4ENTA 1TXGA 1TYZA 3DQQA 4KLAA 4ZKEA 2PWAA 1VYTA 3HFJA 3O8NA 3ZLTA 1QGAA 2JBAB 4BRWA 5G1NA 3HY3A 1EG2A 5JNLA 1V6SA 2C4NA 3SN6A 3AUSA 2GM3A 1OXMA 3TVTA 2C9OA 1F51E 4IMPA 1HNZB 1Z2CA 3KZNA 3UCXA 4HDOB 2D5CA 1RCUA 2XRMA 4NBNA 1TKCA 4C0WA 4OFXA 3LW7A 1HGXA 3AINA 1IQRA 3GFGA 2VDVE 3GEHA 3QVJA 3W2GA 1KI6A 3RVDA 1GSIA 3Q7QA 4DNOA 4UUAA 2E21A 4MIYA 4LNHA 4N3GA 1N9GA 4FOSA 1FQOA 4YGYA 4TWZA 3FKSD 3BWEA 4Q4LA 3VO1A 1PZMA 1XVIA 1IY8A 2EP7A 1TUBB 2ZGVA 3AYXB 3GGDA 3KZCA 3QTBA 3RIMA 4BFXA 4V0SA 1Z2PX 2HA6A 2J9FB 4U6NA 4KV7A 3PHJA 1DX6A 1ZOLA 1BH2A 3GLHB 1JQDA 1V16A 2BWJA 4UTOA 4YB8A 5HW0A 4TUYF 1SKBA 4BUCA 1BGWA 1PFWA 1YDWA 3RSSA 2ONZA 5JG7A 2B8EA 1JZQA 2WPNA 3K5PA 3R41A 1O89A 3ORRA 1OZFA 4RF2A 4OHVA 2O59A 2DFLA 1B8VA 2Q3HA 4M22A 2G70A 2COUA 1NVVQ 4LN1A 2EIXA 4A16A 4CM8A 5KSOA 4EB3A 1IUOA 2QRVA 1U7TA 4E46A 1KI9A 3A36A 5DBFA 5AOAA 1Q2XA 1SBTA 2X2PA 3SX2A 1U3CA 3GMDA 1E6EA 1M2VB 2XRYA 3MERA 5K0ZA 2NUPA 3IH5A 3ZI0A 1XZKA 3LWBA 5EJEA 1HH4A 5JPIA 3ZNPA 1TAUA 1MBZA 2R7NA 3FWPA 4V38A 3H8JA 3L8GA 4FOOA 5BNWA 3C3AA 4Q1CA 1L4NA 2WTNA 2QUHA 4CF6A 3LTNC 3GJXC 1JWAB 4ZP1A 5L95A 1YD7A 3H3XA 1EFRD 3NX4A 4Q7LA 3UMVA 2VF5X 4GI2A 3Q11A 4N5IX 1PI3A 2OFXA 4RVNA 2EP8A 1L8AA 3IUSA 2W2OA 4YWHA 5KOJB 1RBYA 2LKDA 3FHOA 2FPXA 4Y9TA 4TTJA 4ZGGA 4V0NA 3EXIA 3PA6A 1PEKE 1RKQA 5TPWA 4DPKA 3HM2A 4LF8B 1GEEA 1LNZA 1L4YA 4QM7A 2DXIA 4QUAA 1WEHA 1YXMA 4LCBA 2HHJA 4N0EA 1JI3A 2VP5A 1T0HB 5ABPA 2XITA 3NDBB 1Z6AA 2YWCA 4TS1A 4M9SA 1F4PA 2DT8A 2BFFA 4UARA 4A2QA 2GWRA 3SICE 3FYSA 4UFNA 5FLKA 1ZONA 1E3MA 5K3EA 5KYWB 3IBGA 4YV7A 1NQOA 2GPNA 1E2MA 3OH8A 2NUBA 2RG1A 3RAJA 1U7OA 1L4UA 4JJFA 4MROA 3T3PB 3IHWA 2C3PA 2XQJA 4BZXA 2Z2ZA 4S2UA 3QKSB 3DO5A 4E08A 2DLDA 2E1RA 2O14A 3GGSA 4GH5A 1SPBS 1SU8A 3DUFB 1DQRA 3DD1A 1XEWY 1KPGA 2NTYC 2ZUCA 2BFWA 4TTAA 3DKRA 4MAAA 2XMCA 4EKIA 1JFSA 1RP7A 3ORFA 4Q3BA 4X1OA 3TTWA 3IBSA 3WAJA 5HEKA 2PT7A 2O0MA 1QIKA 3LX5A 3RLFA 2Q5IA 3STVA 3OO1A 3B9PA 4B71A 2JFXA 1Z5GA 2YFYA 3O21A 4ETIA 3IQXA 2P90A 1ENOA 3AM4A 1A72A 1WKVA 3P9NA 3FDZA 2WA1A 2VHUA 4G9GA 2XKAA 4GYKA 5DN9A 4KFSA 3TSYA 5A0TA 2R8OA 3E15A 4D6YA 3KXLA 4URWR 5DNYB 1IBMB 2GO7A 1KGSA 3L8FA 1KAEA 1OJ7A 1Z47A 4G0PA 4OXKA 1OIVA 2OHOA 2JFUA 1P0FA 1E1CB 2R4UA 2FX2A 1BNCA 1DIHA 1QV6A 3T9FA 5BW8A 4NXMB 3RFTA 1MB0A 1DLJA 3ZIAD 4JC8A 2ZBEA 5E4FA 3CRVA 1L7AA 3F9CA 4NK4A 1V37A 2EKDA 3ZV6A 1X7GA 1CS0B 4L95C 2H5LA 3S2SA 1ZM3A 4RSMA 3EFOB 1K5DA 4YCJA 1SXJE 3H83A 4FN4A 2WIKA 2QMYA 2R62A 3KG2A 2OV1A 3QA3E 4R1NA 2CLIB 1W29A 2AKAB 4RACA 5H68A 4B3IA 4HADA 4F6LA 2HMSA 2IA5A 1H0RA 3FZEA 4R5MA 4Z53A 4IVRA 1RS0A 3P9CA 1YR1A 3JYPA 4CU2A 3TOVA 1AA6A 4REMA 1FP4A 1LBIA 2P35A 1DB3A 3Q3EA 4B6GA 4OP3A 4D0GA 3LPCA 4XX0B 4DS3A 5CXUA 1AKVA 2JH3A 3CINA 5EESA 1EP3B 1WXWA 2C5HA 3IEIA 4R68A 1TJ5A 3CNOA 4MP6A 5LU8A 1SIOA 4FGWA 2J0UB 2J45A 4TTIA 4CEIB 4WZ6A 3DE4X 2OFFA 3FCCA 5IAJA 2DZDA 2RAVA 1SUEA 3MS2A 1U2TA 4MUJA 1QTQA 3D31A 4ZCRA 3KWMA 4JVSB 4CLXA 1NQWA 3ZE1B 1TCVA 2KMLA 2A9JA 4ARCA 2RAUA 3PVCA 3ZOZA 2R00C 1UJ2A 1KKUA 1Q1QA 1VKRA 4HPWA 4ZU1X 4CKCB 3MYYA 1N8SA 2BRUC 3NHFA 4OVKA 1U8EA 5C8YA 5CX1A 3EXG1 3S70A 4BIIA 4BVJA 5IX8A 2B78A 2WAYA 1NR5A 2AK3A 3OC0A 4B3SB 2P6OA 2PBZA 4TM8A 3V8MA 3CZ9A 3PUWA 4G0OA 4O6VA 2Y1XA 3QXJA 1K6XA 5JNVA 2IH5A 3UOWA 2Z5VA 1G5PA 1E4YA 3CKKA 3QEKA 3RRYA 3U9LA 3M8KA 1FSFA 5IK2D 1CVLA 1Z4NA 2DE0X 3ESQA 1QH8A 4KE6A 5G3ZA 3GEBA 4CN8A 2WJYA 4HDQB 4JHXA 3R9IA 1QMGA 3CW9A 4NCXA 4GG1A 1Z6PA 4EW1A 4EAAA 1AO0A 1CE8B 3ESAA 4IMRA 4C4ZA 1D2NA 1UK7A 1JEDA 1PZEA 4UE6A 5F52A 1TEZA 4B84A 1IOLA 3FOBA 3LWDA 5GGYA 2ZQYA 1ZMTA 1MORA 2EEPA 3R77A 1IATA 1UJMA 1W9HA 3GELA 4HH1A 4YQEA 2I3ZA 5GM1A 1W47A 4WKOA 4XI9A 3U62A 4X64B 3QE0A 4IXMA 3N2NA 1ZJZA 4WASA 1T5TA 5IVKA 1WSBA 5E8RA 3WTBA 2BF7A 1VKZA 3U9SA 2NZ2A 4J7UA 1L4BA 1U0EA 2R9VA 2WU3A 2Q6IA 2IYSA 1R37A 1ZOPA 4EMBA 3V5NA 3MJ4A 3QXHA 1X8XA 1V4NA 1M66A 1FFEA 3MIZA 3MJSA 3MWYW 4FJ0A 5COBA 3KHSA 2VRCD 5BNIA 1RQLA 5FV4A 3QF4A 1H1TA 5K09A 3C6ZA 1CQWA 3GJ6A 1Z16A 4BLTA 5JANA 2NVWA 1X15A 2ZS8A 4J1TA 2P3SA 1FVHA 5JD5A 1B2LA 2QF7A 2A5DA 4PPFA 1MQ8B 4LYAA 4Y1RA 3KLPX 1C9NA 4S12A 2O2EA 4OJKA 1KPIA 3COVA 3WYBA 1JFFB 5DXFA 3WKCA 3H2YA 1WQ1R 1WUKS 1G3UA 2CXUA 3EE6A 4UXIA 4X3PA 5HTKA 1YF3A 4RM2A 3HSKA 3HE3A 5T8KC 4UHDA 2X0DA 4DSTA 5P21A 4WJLA 5L4NA 1LBHA 1U5CA 4AF6A 1VJTA 2IS2A 1QO7A 2IHZA 1I6MA 1O4VA 4WACA 4RVGA 4O4LF 3R76A 5B1EA 3EN0A 7YASA 3M0EA 4M1WA 5DH9A 2OMKA 5EGSA 2R5WA 3JQ9A 3RC3A 2COEA 4ZEOA 4ZJZA 3K4HA 1XZIA 3W3AA 5AHWA 1DEHA 2I3BA 1UC4B 3D3NA 4LX8A 3PC8C 3SKXA 3FZYA 2I7DA 5DIZA 2HHHB 5CT9A 5DOZA 2ZWPA 3RG2A 3RYFB 1I0IA 2PUVA 4YUYA 2MSLA 1OYOA 3IUNA 4JITA 2E37A 821PA 4ZC8A 2LIVA 3LT0A 4J0HA 4COOA 1XZAA 2V3VA 2RGRA 2BD0A 3U3XA 3ZWDA 1NC3A 3ML1A 3N2GA 4TYWA 4HNVA 1NNSA 4J1NA 5SY9A 2XVXA 3LYLA 5HFAA 5LQAA 2Z2XA 4ZTBA 3TX6A 3WJ7A 4ARVA 4QBFA 1DNPA 2FWJA 3DM9B 4NEGA 2H63A 4OOEA 5ESXA 3SM3A 1HA3A 4PYOA 4QKQA 2JHFA 1T1SA 4ZIRB 1VGQA 1NU8A 2RFLA 3MXTA 4L0DA 5FJIA 1MO6A 4L4XA 3AUKA 2RHDA 2JKYA 4A26A 4JR1A 4I9NA 2G04A 1F06A 1EMDA 3KQWA 4JKOA 1VJGA 2YHIB 3D5QA 1T3HA 2B99A 3UJ6A 1T2UA 2WY2D 4C0QC 2W2KB 3OPYA 3Q0TA 3SYNA 3RYCA 4PSKA 2IHVA 4C0HA 4GLOA 1EP1B 1IN7A 2MU1A 2YNMA 1M2NA 1DKQA 2I67A 3RARA 3PSHA 4JYPA 3TO5A 4D9KA 5B1IA 2X1HA 1KNQA 2EQ5A 4D3DA 4E3WA 2QT0A 4IV5A 4YAJA 3KZOA 5LDHA 2DY0A 3T99A 4D81A 2QOEA 4TYMA 1YL5A 3TNLA 1LQUA 4HLCA 3GQBA 4YGXB 1U3DA 3IDAA 5ESWA 3KB6A 4BAUA 3G88A 3G59A 4P5PA 3G2IA 2QMUA 1ADJA 2ZRLA 4DG5A 1I3LA 2XQFA 3DLPX 4INAA 4ITRC 3SC4A 2QG4A 3GK3A 4URHA 4D80A 1VJCA 1ZUD1 1GAEO 2QG6A 4ZI7A 3N8HA 4OJNA 5HDQA 4N0DA 5EHXA 5HKBA 1M3SA 3YASA 1JXQA 1X14A 3D8NA 4MWBA 3SSNA 3ZU6A 4G9BA 3VPAA 1TMYA 4FMCF 4FJ2A 1HEUA 4MNTA 4XTCS 3RK0A 3ZY2A 1K0UA 1LK5A 2XQGA 1OXTA 5LNK1 4QBIA 4UZEA 2QB5A 1VLJA 1KVUA 3SC2A 4YAEA 5CH8A 4KTTE 1JYFA 3ICCA 2VDOB 1U81A 3HVUA 4FYIA 2DJIA 5BSGA 3I37X 5EE1A 4K8OA 1BTOA 2C77A 4KE9A 1EHYA 1OFVA 5IYZA 1CTQA 3IODA 2GNAA 1PUIA 3KOXA 4DR4B 4PGFA 4CCAA 2VTBA 1P91A 4AJOA 2JRLA 1SCBA 4KREA 5L6LB 2NTJA 3T1YB 3LU1A 4LNAA 3O8QA 4TMTA 1J99A 3HKDA 4GE3A 5D2CA 2CJFA 5EQFA 3TMYA 3RUCA 2BEJA 4PTYA 1OLSB 2ZUTA 2HWXA 3IALA 4A2PA 1ZJ6A 2W7TA 3F6EX 3PFCA 4M60A 3SNHA 1FUYB 1PK8A 4UM5A 4KQFA 2B5OA 2HKIA 1X8LA 4BNNA 2YUTA 1K6IA 3EG9B 2W43A 3DXYA 3DW3X 1N5JA 5NLLA 4TZ6A 5EVJA 2G83A 3QVVA 3PEFA 2HJVA 3KR1A 2DCMA 2ZJBA 4XDGA 2DHRA 2AQHA 3IQFA 2YTZA 4BVLA 5LDDC 1ZZEA 3QHPA 1DGQA 4H4DA 4S1OA 4TSKA 4C04A 1QV9A 1U0JA 3IPLA 1EUDA 2OCLA 2V45A 5L3RA 2JLQA 2G09A 2R87A 5ALPA 3COSA 3RS9A 3H9QA 4P33A 1FC0A 2RHHA 3I04A 4YFYA 4GGMX 1GL6A 3T7DA 3T41A 4AJIA 4KQ2A 3IEUA 4H17A 1A7UA 4W1RA 1RBZA 3FGZA 3CQ9A 4II3A 3ISTA 1OJLA 4C5AA 1M8FA 1V8PA 4KW7A 4WEQA 4BLWA 2IYEA 3L5OA 3P71T 2PMKA 4WN9A 2GD1O 2QYHA 2WPDD 4EJMA 3C24A 1QIIA 1WU8A 3IR5A 3OIFA 4KDEA 2BSXA 4MRRA 1ZNZA 1P19A 1BMQA 1X80B 3GNSA 4Z0TA 2VHJA 3N8NA 2Q4RA 1Z26A 3SG0A 3WICA 1GA4A 1MC1A 2HBZA 4ESHA 5BY2A 3NBXX 1C7ZA 3SM9A 2BAGA 4ZYUA 4KYUA 1M2EA 2HRZA 3QRWA 1E4VA 1ONOA 3B1FA 3ZVNA 2I6SA 5TF0A 2PKYX 3QITA 1JKIA 4W99A 1GFSA 2FF7A 3AB8A 3VUEA 2F64A 1O0CA 1TMOA 2ZQ5A 5EJ9A 1Z68A 3ELUA 4NICA 1IBKB 1TQ8A 3M70A 3W6NA 3OLVA 3GMTA 4JP2A 4KOEC 3S7ZA 4AD8A 3HCCA 3RF6A 3ZX4A 3MZ0A 2JKVA 1MT3A 5B3LA 3LECA 4WZBA 3PWSA 3ZS8A 4H6PA 5EN4A 1JPVA 4BX9A 1EP9A 1CUUA 4OHBA 4ZYXA 1V95A 5I9IA 1GGVA 3SGLA 5EAIA 3EISA 1EXNA 4UHKA 2DFTA 3PJGA 3SZUA 2VPWA 2GEBA 3OQBA 4B4VA 1SKQA 1R0WA 1U7WA 4RHYA 3T9AA 3AEXA 3ND8A 2V6IA 3SZMA 4E32A 2XA1A 1NIPA 4JNCA 4Y8VA 1Q50A 2FYTA 1MH9A 3OQIB 2D1YA 5D86A 2X19A 3UWMA 4A0HA 4NFSA 4FI3F 1IAQA 4L0QA 1TW2A 3SOZA 2WSSA 4QX6A 5CA1A 3IKJA 2YHSA 5H1YA 1NUSA 1WR8A 1L3CA 3IEVA 1KQPA 5H4GA 1D0VA 3C1OA 4QU0A 4JBXA 2QG9A 4GMGA 2R44A 1HYGA 3E1SA 4FNGA 1FUUA