3JQAB

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-1,9-dihydro-6h-purine-6-thione (dx4)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 91
structure length 247
sequence length 267
chains with identical sequence C
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqaB00
5A9TA 4GH5A 4DTIA 1U9JA 3B1KA 3F3SA 4Y6RA 1HRDA 3GC6A 1BXGA 1B8PA 4MIEA 4MVJM 3TWOA 1XEAA 1E1KA 4BS9A 2H63A 1N1EA 4AJKA 3UXYA 2EP5A 1CF2O 1N92A 4CLDA 4D46A 2V6MA 1I3MA 4YQYA 1QR6A 2X6TA 3IMFA 3NJ8A 1UDBA 5BNFA 2NV6A 1YO6A 3F46A 2Y68A 4D3FA 2DQ4A 4G2NA 5JY6A 4FBGA 3DHYA 3WGIA 1H0KA 1YQXA 4CMKA 4GMGA 3VH3A 3HHPA 1Q1NA 1EDZA 1LRLA 2JHGA 3OJLA 1HT0A 1RM5A 2ZB8A 1XQ6A 2G76A 4BNGA 2WDZA 3ADOA 3HN2A 5GMOA 4E31A 2WMDA 5T8KA 2TMDA 3SJUA 2FOIA 3DWFA 2Y66A 2FSSA 4DIFA 3C3XA 2BLLA 1QYVA 2GD1O 2AMFA 2NU9A 4OMUA 3BHJA 4IZIA 2OP1A 4FJ2A 1HF3A 4YBZA 1FJHA 5L4NA 5BSHA 2YJZA 2ILTA 1A9ZA 2JCVA 4GVXA 5DDIP 4KWHA 4BKRA 2YZ7A 3IJPA 3UF0A 1ADGA 3WGTA 3JTMA 4W9NA 4DYDA 1NBOA 5FFFA 5DBGA 1H94A 1M6HA 4DPMA 2TMGA 4OAQA 3H9GA 3WQRA 2W90A 4IJKA 3EAGA 3QP9A 4PIVA 4N5LA 3CH6A 1BDMA 4ALNA 1NR7A 2AA3A 2R00C 4GMFA 3WLEA 3C1AA 3U3XA 4IPTA 3HFSA 1ISFA 5J23A 2H9IA 4B3JA 3L77A 2DLDA 2GZ3A 4RLHA 1QYXA 5IXYA 1ZXLA 2AE2A 3LC2O 5T64A 4CM1A 1UDCA 4U7WA 2BGKA 1A5ZA 4FOOA 1OAAA 1LBEA 2IYOA 1ZMTA 1E5QA 4NFHA 2WYUA 1LLDA 1ISIA 4II3A 3VPGA 1WDKA 5KWEA 2C82A 2PZMA 1Q0QA 5IDWA 4WLVA 3UCFA 3C7CB 2PD6A 4NDNE 4D44A 1Q0LA 3GVCA 1NHWA 3PIDA 1I0ZA 4IINA 1L1FA 4BB5A 2VRCD 3C7DB 5H82A 5I9MA 1PGJA 4QUKA 1K6IA 4BB6A 5A5FA 3ICCA 4HX5A 1Z7EA 1KY5A 2DUWA 1QSGA 2JAHA 4XGIA 1R12A 1LLUA 1X13A 2GO1A 3DFUA 1F12A 3PYLA 1W6UA 3CMMA 3ONEA 1GTMA 1RM0A 4IDFA 1O89A 1YWGO 2XPCA 5JXWA 3MCVA 5L95A 3GVXA 1B15A 3H9EO 2HK9A 4JBGA 4XQGA 2PLAA 1XKQA 4JNKA 4CLHA 2NQ8A 2PZLA 5F1KA 3LSYA 1DC5A 5JBIA 1AUPA 5KKCA 4OOFA 3DMTC 4ALIA 1PGNA 1UAYA 3BTUA 2Q50A 4DQXA 5GZ3A 1ZUD1 1Y9EA 3NX4A 3TZKA 3ZU4A 2AEMA 2W4QA 2Q3EA 4XIYA 4JBIA 4BO7A 4IDEA 5B4VA 3WGZA 4AJ2A 3C1OA 3EDMA 3QV1A 4H7PA 4CMBA 3JQAD 4FFLA 1ZO8A 1C0KA 3PJGA 1LSSA 1PS9A 4KUGA 1NQ5A 3CINA 3PTZA 4GL4A 2EKLA 3UCEA 3G17A 1QLHA 3Q6IA 4KMSA 4A5OA 4Y8VA 1FDUA 2VUSA 2P9EA 3UGKA 4IZHA 1TXGA 1YJQA 5I7EA 1HYHA 2AXQA 3KSZO 4A03A 1E3WA 3GUYA 3PLNA 4MVJI 5IZ4A 3DHNA 2PD4A 4IQGA 1RKXA 3ENNA 3OICA 3IQDB 2AE1A 3OQ6A 2VOEA 2Q2QA 3K5PA 3U5TA 2GLXA 2B4TO 4INAA 2VRCA 3BAZA 3C1TA 4UUNA 2G0TA 1X1TA 3HUDA 2YFQA 4BQRA 5JDCA 3IKVA 4L8VA 1U1IA 4XYGA 1I24A 4LRTB 1KIFA 4GGOA 1ONPA 4WGGA 3I52A 4H16A 1NQOA 5I9LA 4RCVA 4UVEA 4YJFA 2BGMA 4N5MA 4BNFA 3O9ZA 4DQUA 5TQVA 1PJCA 2JL1A 2X22A 3MJSA 1Q2XA 3ZH2A 4A10A 3O03A 4WPGA 2G17A 1TT5A 3JYNA 5KNLA 1NFRA 4R3NA 2VHXA 1DIAA 4FFPA 2VZ8A 4XYMA 4CLEA 3PP8A 4FGSA 1IZ9A 1E1LA 1HTBA 4W7HA 3JQEA 2DPGA 2OFPA 4JLWA 1IUKA 4B3HA 5HTOA 3P5SA 3PFWO 1IPFA 4HADA 3VPXA 3GDOA 1EUZA 3GMDA 3JQ8B 4J6FA 5AYVA 1PQUA 2P91A 4A26A 4CMJA 2FP4A 1O94A 2E4AA 4DA9A 4WOJA 2BMAA 2VWQA 4BGEA 1NTOA 3NGXA 4MVJH 3BMCB 3EK2A 1KVQA 1BXZA 3DZIA 2CDAA 4A7PA 1RYDA 1YOVA 2JAPA 4BNNA 4MP3A 1LU9A 3FNFA 3PVZA 1E3IA 4WCFA 3JQAA 4D41A 3M1AA 1Y1PA 1Z45A 1ADFA 2WWRA 3DOCA 2ET6A 4CM7A 3K92A 1IB6A 2GN6A 3OECA 3WFJA 3GPDG 1NFQA 3ZWWA 3STHA 1GDHA 5DOVA 3WDSA 1C1DB 1PJ2A 2X5JO 5ILOA 1PJQA 4OYRA 5LDGA 2DM6A 1XU7A 4O63O 1LRKA 1GV0A 1GYPA 3CPSA 5IZCA 4PG6A 4DLBA 4W9NC 3LVFO 4JP3A 3PHJA 1J4AA 2EF1A 4GSKA 1NYTA 3ICPA 3U4CA 3QWBA 1XHLA 1XG5A 1EVYA 4WE3A 2Q1WA 1C3VA 4U0JA 2EWMA 4Q9NA 4IS3A 1KETA 3IOYA 2GZ2A 2P5YA 3H9JA 1Y5RA 2JFHA 4RPHA 1ULUA 3G79A 4ZU3A 4CMIB 4E5YA 1DOHA 1ISHA 2HMVA 2RBEA 1SPXA 2HJSA 1V0JA 2JCXA 3WFIA 3O4RA 4JJIA 4IDCA 4DIOA 2WD7B 3RKRA 1U28A 1ZCJA 3FN4A 2DC1A 4CR6A 4OKIA 5B4UA 2IXBA 3EY4A 3FNGA 3SC4A 2DTXA 4BO5A 1PQPA 2OGUA 2C7VA 3PLRA 4GBJA 1PZFA 1VKOA 4DREA 1YBVA 4WLEA 2FR1A 1F8FA 3MWEB 1RJWA 3BTVA 4HY3A 4XQEA 1B26A 4E4YA 4II2A 5JCJA 2BELA 4MKZA 1FDVA 4E5PA 1CETA 1NVMB 4M8SA 4F46A 4CM6A 1HE4A 1EK6A 5BQFA 1HSOA 1TT7A 3UOGA 1PJ4A 3DBLB 5KIAA 4ITUA 3JQ6A 1AHIA 2QZZA 2C2XA 4WOKA 5T5QA 2D5CA 3JQGB 4HNGA 1M2WA 1KEWA 2OZPA 4P4LA 3PEFA 1N5DA 3GHYA 1B0AA 4CPDA 4RF2A 3RUIA 3L4SO 4QXMA 2GR9A 4U6SA 2VT3A 2OORA 1ARZA 3L4BA 4GLLA 3FCOA 3PHLA 3V1TC 1UXKA 3AM5A 5CDSA 3BXXA 2IZ0A 3JSAA 4KDEA 4W82A 2R2GA 2PK3A 1DAPA 3VH2A 4R4JA 2D0IA 2NLOA 4CJXA 3C8MA 1LJ8A 4J3FA 3MJCA 4E6PA 3F5SA 2NM0A 3AJRA 4ALMA 3QJ5A 4QQRA 4X54A 1MG0A 4YJGB 5G4KB 4J7UA 2J3IA 2EHDA 2FPPA 3FR8A 3JQ9C 4OXKA 4Z9FA 3RUFA 2RHCA 1YS4A 2PKQP 2BRUA 2WYVA 3TNLA 2D3TA 2VHYA 3I6QA 3OEWA 4CQLB 1EQ2A 1D8AA 3FBTA 4O5OA 1NASA 1UXHA 4BGVA 4CM8B 1JTVA 3BMOA 3KM0A 4D45A 4YT8A 1M75A 1M76A 2VZ9A 3RIHA 4QSMA 3MJVA 5FI5A 3CZRA 5B1YA 1YL7A 2PZKA 4CM3A 2FZWA 1WP4A 3F4BA 3GPIA 4HFRA 4B8WA 4CV1A 2VTDA 4XQ9A 1KERA 3GAZA 2NU8A 3TPCA 3ZW9A 1J49A 3HJAA 3GUCA 3L9WA 4LMRA 3GN1A 2IYPA 4J9UE 4RPLA 5T57A 3NYWA 2Y0EA 3RUEA 1P45A 4AJEA 1E3SA 2XAAA 5HS4A 4I5EA 3HZZA 4KWIA 1CEQA 3DAFA 4WK6A 1IE3A 4BO2A 4UVGA 1SMKA 3PPIA 4RQUA 2EEZA 4J0FA 3E9NA 1HDOA 4ZN6A 2HU2A 3JYPA 5BSGA 3OH8A 3JD1A 1I30A 5FF9A 3SX2A 1T2DA 1DFHA 2YDXA 4YRAA 1E6UA 2H5LA 3IJRA 4YT4A 4B4OA 4CR7A 2X9NA 2Z1MA 3BHIA 2DBQA 4XX0A 4FN4A 5A03A 1UDAA 1K3TA 4WJZA 4FS3A 1DIGA 3PRJA 1ZEMA 3DC2A 1JVBA 3AW9A 3GZ4A 1KYQA 3HDJA 1LLQA 3H5AA 4TZTA 5L7WA 4DYVA 3H2ZA 3R3SA 2EJVA 3DEYX 4EBFA 2DBRA 3GEMA 2P4QA 1DLIA 1U3VA 1YBMA 2PR2A 4BMSA 4CMCA 1A71A 1PWZA 4G65A 4FFOA 4A2CA 2QRKA 4D79A 3H9QA 3OA2A 1ENZA 1PGOA 3FNEA 1QKIA 3SXPA 3GEDA 2BKAA 4WCFC 4YDRA 4Q3DA 3OIDA 3RC9A 3VVBA 5ENDA 4DMMA 2EKPA 3BHMA 2GRAA 5G0TA 3AK4A 4UVDA 4IQ8A 4WUVA 1SB9A 1ISMA 3WTBA 4M54A 4NJMA 2RH8A 4EJMA 4RF4A 5A5EA 3ZHBA 5TRTA 2YQ5A 3INTA 5EERA 4GQAA 1VRWA 4GPD1 2E82A 4KQXA 4BNIA 1PJLA 5DULA 4DBVO 2J5QA 1LDNA 1U8FO 4L4RA 4RL6A 4HFMA 3HDYA 5G0WA 1DJQA 1MP0A 4UVIA 4EITA 4CLRB 1ONOA 3GRKA 3NTQA 5L40A 2NVUB 4J1NA 4JX8A 1DHRA 1GY8A 3DBRA 2FR8A 1PL7A 4IGFA 5JLAA 1DRUA 2ZJ0A 4MVJA 3SJ7A 2FZEA 1Q7BA 2Y1FA 1XU9A 2DBVO 2CVOA 3NGLA 1N8KA 1G0NA 2P9GA 4E3ZA 7MDHA 3QSGA 1E0DA 2FMUA 1O0SA 3QVSA 5BT9A 1DFIA 4PG8A 2OUIA 4WNCA 4ZD6A 1YL5A 4GX5A 3JD2A 1DXYA 1LDGA 4BKPA 5CPFA 1YH3A 2C2YA 4IM7A 3U62A 3EVTA 2PWZA 2Y0DA 2B69A 2ZYAA 4EW6A 3E18A 4NHEA 4JN6B 3UCXA 5U1PA 3DL2A 3PWKA 5A02A 4MOWA 1FDWA 3RUHA 1P74A 4J1TA 2HO5A 4PZEA 4D3DA 5JAZA 5T6BA 3TF5A 1YJ8A 4H3VA 5I8ZA 3WGGA 3NDRA 5JS6A 4NFYA 4CMEA 3I9NA 1YB5A 5KVSA 3KSDO 1LI4A 2VZ0A 3I3OA 3ZU2A 4IJVA 2AG5A 1ADCA 4EZBA 1S7CA 5IDXA 3B6ZA 3LC7O 4HFJA 4KOAA 9LDTA 2OHXA 3PGXA 1QXSA 1A7AA 1JAYA 1M67A 3JV7A 3KRTA 3QWFA 3HNPA 3NDJA 4PVDA 1Y8RB 2V6FA 2Z5LA 4IY1A 4NMHA 3AY6A 2B4QA 4R68A 3TOXA 5JCXA 3RI3A 1UAGA 5A3JA 1EZ4A 1Z73A 1EFLA 1W4ZA 4O0LA 4OM8A 3L4BC 3I9MA 1I2BA 4TVOA 3DZJA 3WOHA 3PJEA 5DCWA 5B12A 3M2TA 4URFA 3WMXA 1IL0A 2PNFA 4J43A 3DZHA 2IEBA 4PCVA 1DJNA 2QRLA 4WLUA 3BTOA 3LZ6A 3GVPA 2E48A 4J16A 2CVZA 4YRBA 3PGJA 4YA6A 4CR8A 1IULA 5A9SA 1NPYA 2DTDA 1MV8A 2GASA 3ANMA 3UHAA 3C7AA 1E92A 3H6KA 3WG9A 3X2EA 4BGUA 1DIHA 4N54A 2VHVA 4E5KA 4CM9D 2WJPA 3L6DA 3MZ0A 8LDHA 3TSCA 1OFGA 4OQZA 2CSUA 2VNAA 5JO9A 3KSUA 1BDBA 1PL8A 5GZ6A 3FWNA 3AUTA 4B4WA 5L4SA 3GNSA 4YT5A 5CDGA 4PLTA 3VPFA 4QEDA 4Q3AA 3EGOA 2P4HX 4GI2A 2I6TA 3KYDA 1EUCA 2X5OA 2EXXA 1LLCA 3HE3A 2PH3A 2JKVA 4FJ0A 5G2OA 3U4HA 2O3QA 3U09A 1GR0A 1JKJA 2IXAA 3RC1A 3WYBA 2VYVD 3PDUA 4IMPA 4NH4A 4E0BA 4RO0A 4PLCA 1YVEI 4QO8A 2RAFA 3ZWMA 5G0SA 5TNXA 2DFDA 4TWRA 4MDHA 2X0JA 3WX0A 3P2YA 2BH9A 4S3MA 4L74A 1DC3A 4RLSA 3B1JA 4R01A 2O4CA 2PH5A 4M1QA 1IHXA 3LLVA 5EIOA 4UAGA 3CKYA 1HE3A 4JXKA 2OOSA 1VE9A 4R16A 1GAEO 3E6AA 1C0LA 1H6AA 4IS2A 3RUCA 2NVWA 4IDAA 4HWKA 4DIBA 4BO1A 2FRDA 3AI3A 3H3JA 5BSFA 2BFOA 2W8ZA 1NPDA 5AXAA 4NK4A 1EMDA 2VN8A 2W2KB 5G4LA 5L3ZA 1OC2A 3CIFA 4U5QA 4W4TA 3V5NA 1VKNA 2ZCUA 3PZRA 4PLWA 3ZWVA 1A4UA 2BFAA 3PQDA 4ND5A 4DLAA 4LMPA 3DO5A 2JD1A 4HNHA 3IIEA 4IXTA 2POQX 4CM9A 4C7KA 1P1HA 1X7DA 3OETA 5K6AA 1GV1A 5ICSA 3AY3A 5JW6A 4GKBA 4RVDA 2OP0A 5F21A 3PXXA 4B79A 4LSMA 8ADHA 4BKQA 3K2EA 4RDHA 1LNQA 3GFBA 4B7UA 1FK8A 1YB4A 4TVBA 3KEOA 4IQ0A 4UEJA 5IN5A 4CM4B 1XYGA 1YL6A 1B3RA 4YEDA 4DL9A 3ZNQA 2HJRA 4FOSA 1DRWA 4GKVA 1NFFA 2DFVA 3JQFC 3OA0A 1MC5A 3GOHA 4I1IA 3KYCB 4C4OA 4TSKA 1P0FA 1EVJA 2PKQO 3ZHYA 3WIDA 2CMDA 3P7MA 3S8MA 3ZU3A 2NU7A 1ZH8A 3AM4A 1HYGA 5AVOA 3RC2A 3ETGA 4HKTA 5CDTA 4CQMA 3WGOA 3W8FA 4J4BA 5IJZA 1V3UA 3JYOA 3KUXA 4XCVA 2Q1TA 5HM8A 1XQ1A 3RUAA 3V1YA 4BO3A 4Z0PA 4YVFA 4WEQA 3LQFA 2D4AA 2XF8A 3ROMA 5A04A 3ZWPA 4BNUA 1GUFA 2B0JA 4CMHA 1FDSA 4K6CA 4XIJA 3SVTA 2YV3A 5IN4A 3IUPA 2A94A 4RDIA 4P38A 5LCXA 1C14A 1ORRA 4XZ3A 3HFGA 3M1LA 4XB2A 4ZRMA 3H8VA 4KDFA 3RCBA 5BNTA 4JIGA 2G5CA 4R69A 2YHIB 4N5NA 2Z95A 2NWQA 4BMVA 1YXMA 4FSHA 3ZI0A 1QV6A 1T4BA 4JGBA 3FPCA 1PX0A 4E2ZA 5B4TA 2ZB4A 2HCTA 3GQVA 1ZKMA 1ONNA 5L51A 1VJ1A 2XXBA 3MTGA 3H9UA 2HKIA 1P1KA 2Q49A 4PLGA 5KVVA 4IGEA 3R3JA 1EVZA 3JD4A 4YJDA 1LDEA 2EP7A 4OIMA 3T7CA 3U0BA 3F6YA 1T2AA 5EMHA 1LDBA 3RFVA 2H6EA 2OMEA 3Q9NA 1HSZA 1EBFA 2PZJA 1WZEA 5DP1A 1GQQA 5FEUA 1I8TA 3PWSA 3A1NA 1QMGA 1DO8A 2CY0A 1IYZA 2I66A 1EE9A 3WXBA 5AOVA 4PG4A 5TJHA 1P31A 3PIIA 4IJWA 1VLLA 1JDJA 5CEJA 3PJFA 5TJ9A 5IFLA 1PWXA 3JQDA 3FSRA 3VZRA 4I5FA 3H5RA 1HE2A 2F00A 3ZGYA 4HUJA 2BF7A 3KLPX 4XWYA 2ZTLA 1SO8A 3I9LA 2Q46A 1YQDA 3ZNNA 3L07A 4JJFA 3ROQA 3SEFA 4AVYA 3LT4A 2IODA 3D7LA 1JN0A 4YTEA 4K6FA 3DOJA 4W99A 3FI9A 1NX6A 1GFSA 4CMAA 4FC7A 3NKLA 1IHYA 5FI3A 3IP1A 1LDMA 1R4MA 3QLJA 4RQTA 4A27A 4PLPA 3PQFA 3PYMA 2D8AA 3GG2A 1H9BA 4AFNA 2GPTA 3PDJA 1JVSA 4CMIA 2Y67A 4IDBA 1MC4A 1X7HA 5JSFA 4FW8A 1UP7A 1P77A 1LSUA 2YW9A 4IUYA 4UEOA 3Q2IA 3OMLA 2P68A 1ZZEA 2HRBA 2VWGA 4J9VA 4YT2A 3TFOA 1HLDA 4XRGA 1E77A 4XR9A 5IF3A 4GLOA 2W98A 3ANNA 4J0EA 2QG4A 2E49A 2IE0A 1EE2A 4I8XA 4CL8A 2GGSA 3O38A 2EW8A 1B3BA 3JQBA 1B7GO 4DBZA 3ZZNA 1E5LA 6ADHA 4D7AA 3KHUA 1Z7BA 1WDLA 4OO3A 3K31A 5TC4A 2D1YA 3VH1A 2ZQYA 1YE3A 1ZK4A 5TT1A 4YAKA 4AJNA 3GZNA 1TA4A 3S2IA 1XDWA 1BGVA 2Y93A 1SOVA 4GWKA 4GVLA 5DCUA 4Z9XA 3TL3A 3VPHA 3EZYA 1XELA 3LU1A 2HUNA 4EJ0A 2GN8A 5KJCA 5TGDA 5AXCA 4H15A 1GCUA 3X2FA 1JKIA 3I1JA 3LF1A 1MB4A 3JQGA 4ZQEA 5T8KC 1CERA 4CLXA 3TOZA 2PFGA 5TSDA 4Z6KA 4Z0HO 1NR1A 2W2LD 1F14A 3WWZA 1VSVA 3DFZA 1WMBA 3VKVA 2O3SA 5KJEA 5THKA 4B3IA 3A14A 4TZKA 2NACA 2C5AA 1ZJYA 3G1TA 3I9OA 4Q3CA 3MOIA 4J2OA 2Q4EA 3VDRA 3PJDA 3WQQA 4CMGA 1F0YA 4RVUA 3SBOA 3DZBA 5G4KA 4F6CA 4ND4A 2IEDA 1PS0A 4RV9A 4GAEA 3H2SA 2FR0A 1MUUA 2YV2A 5ES3A 4CQLA 2JFFA 2X0IA 1IOLA 4OKNA 4TRNA 1H9AA 3OP4A 4R5HA 1P1JA 3H65A 4BKOA 1E7YA 2V6GA 4K1LA 3VZPA 4NBVA 1A7KA 1JQBA 4E2WA 2Y1GA 1Z75A 3IP3A 4XYLA 3PZBA 3EYWA 2BD0A 4CV3A 3A9WA 2X8LA 1BMDA 2BHLA 2C59A 3FHLA 3TZ6A 1FMCA 1ZNQO 2Q2VA 4BIIA 1Z6ZA 2PGJA 1O5IA 4XGNA 1I33A 1KVSA 3CTMA 1I3LA 4YAIA 2B4RO 5KJ6A 4D0SA 2O7QA 2Y05A 5DZSA 5A1TA 3OM9A 2O3UA 4AJ1A 4WLNA 3D4OA 3E9MA 3TZCA 1H93A 5JMPA 5EPOA 3UAGA 3OJOA 4FDAA 3KTDA 1DC6A 2BI8A 1AGNA 4R51A 1BSVA 1Z74A 3S2GA 3ZHZA 1LUAA 2W2LA 1H6BA 3VAZA 1DFGA 3P2OA 4J7XA 5L45A 3ULKA 3OJEA 3I9KA 4MVJE 1UJMA 4AJOA 3RFTA 3UVEA 1ZBQA 2IDZA 2WYWA 1H6DA 1KC1A 5JFOA 2G1UA 1RM3A 4PRKA 1ZK3A 5I7VA 1BVUA 1R0SA 4ZRNA 2J5RA 2EW2A 2UV8A 4M55A 3WWYA 4R9RA 1I5RA 3HSKA 4FR5A 4RVHA 4U0KA 3HWRA 3DZKA 4B8ZA 2YV1A 4C7JA 2FN7A 3GG9A 3ZV5A 3OHSX 4P4NA 1ZW1A 4MVJG 4KQWA 5JDIA 3AI1A 2R6JA 1LA2A 2CF5A 1PQWA 1B2LA 1B16A 4WCFB 3ON5A 4IXWA 1Y8QA 1KC3A 4R1TA 4IJUA 3UFXA 2UVDA 2C20A 1LTHR 3WQSB 3SLGA 5H81A 1ZMOA 3F1LA 3IDSA 3G3EA 3H5NA 3IKTA 3KBOA 1PR3A 1V8BA 2RH4A 4NPCA 3F1KA 4OH1A 2QRJA 4NNJA 3KOUA 3G49A 1BXKA 5TX7A 4OL9A 1M6WA 3IS3A 2E37A 2GN9A 3ASVA 3I4CA 1QG6A 4CLRA 4QT0A 3DZGA 3H3FA 2HAEA 4TKLA 1HDZA 1U3UA 2EIHA 3TFQA 3WMWA 3UKOA 1R4NB 2RHRA 3ITDA 2NVBA 3G1UA 2HMWA 4KP7A 4PZDA 5AQ1A 2AG8A 1O8CA 1ULSA 3K8ZA 4MVJF 1EBUA 4OXNA 3S2EA 3UH1A 4FD3A 1EUDA 4P22A 1A9YA 2VNSA 5JDCC 3VZSA 3NUGA 4YJHB 1ISGA 3O8QB 1UXIA 2HLPA 4YB8A 5TF4A 3WICA 4ZGWA 3OJ0A 2EKQA 3T4EA 1HLPA 2ZQZA 4N18A 4AJJA 1QP8A 1ENOA 3V2UA 1M66A 1CYDA 2VCYA 3KXDA 3IUSA 2ZATA 3QVOA 3VTFA 4NU6A 3Q1LA 5C7LO 1HZZA 3RC7A 4Y9DA 1B8UA 3OBBA 4E13A 4XD2A 3GH3A 1NWCA 1UH5A 1WAMA 3I6IA 1ZEJA 3WLFA 4JROA 4O59O 4CUKA 3A4VA 2OL4A 2ZTMA 4WNIA 3GGPA 1SC6A 1EEHA 3GGOA 4W6ZA 5F1PA 5K9ZA 4CLOA 4R1UA 3B20A 3WTCA 1ML3A 1YBAA 5LC1A 1SOWA 2QW8A 3E5MA 3NT2A 4PG7A 4WEOA 4BNZA 5C37A 4RZHA 2PV7A 4BNTA 4CUZA 1Q0HA 1NPTO 4BUCA 1SCUA 4UULA 4WLFA 2CFCA 4J1QA 4BNYA 3RFXA 2P5UA 3ZWCA 3E5RA 1ZK2A 3TRIA 2J3HA 3PHIA 4Y67A 4E12A 3WGQA 1WVGA 1PR9A 2NQTA 4LGVA 4XYEA 3GK3A 5FYDA 3I83A 5CEFA 4RVFA 1ZVMA 1PIWA 3FTPA 1GYRA 2EJWA 3SC6A 4E5MA 3V1UA 5MGBA 2Q99A 3BTSA 3JQCA 3GN2A 3OFSA 2X5KO 2OXIA 5I7SA 5A4DA 2DU8A 3VOSA 1KOLA 5IZCC 4TRMA 2DKNA 4QO7A 2UDPA 1CDOA 3I9JA 3QA9A 3L9XA 5KVQA 1KY4A 4FFRA 4BOYA 3PK0A 5DP2A 3H7AA 1C0PA 2O2SA 1SEVA 2ZYDA 3AY7A 3OEYA 3KB6A 3HDQA 2G82A 1E6WA 3DHEA 5L9AA 1DIBA 2WEKA 4NBWA 4G5HA 3BMNA 2ZIZA 2VWPA 3AFMA 1G1AA 2JCYA 4OHUA 1JWAB 3BMQA 3HDHA 4UUMA 3ROKA 3QWAA 4Q3NA 4BNJA 1UP6A 3JYQA 1KEUA 1ZJZA 1TEHA 1X15A 4TRJA 1A27A 1DBVO 4J49A 2PD3A 3QWHA 1ZXBA 1E1NA 1AE1A 3GVIA 3JYLA 3AM3A 1WMAA 1H6CA 3F4LA 4LN1A 5JAIA 1D3AA 4BV8A 7ADHA 2R00A 1C1XA 4YAGA 3HQ4O 4B7XA 3MWDB 4DGSA 3ASUA 4E2YA 3D64A 1UUFA 1ZK0A 2UUPA 2PTGA 5T67A 3ST7A 5FWNA 4AL4A 3C24A 2IZZA 2ZJ1A 2VYND 1DSSG 1KVTA 1P0CA 1T25A 1CWUA 3K2BA 2YQ4A 4ZA2A 1RPNA 3ETEA 3CEAA 1D1TA 1HL3A 3HB4X 4B4VA 2Q1UA 1MXFA 4RGBA 5U9CA 1MG5A 2QYSA 4XDZA 2WM3A 1BWSA 4RPGA 4M89A 4JK3A 3DAPA 2CF6A 1HKUA 2QQ5A 1F8GA 3P19A 1PTJA 3DBVO 5JY1A 2W2KA 1OOEA 4HV4A 1WW8A 1K5HA 1UP4A 5DCYA 5BSEA 2XOXA 2P2SA 2Z1NA 1RM4A 1LQTA 2V6BA 4BGIA 1BVRA 3UW3A 5I9NA 5C5IA 4NJOA 1T1SA 3JQ7B 1PJTA 4OOEA 3ZV3A 1T2FA 1VC2A 2HMTA 3T7EA 4JBHA 4NQZA 2ZTVA 3RU9A 1U3TA 3EMKA 4UVHA 2C7GA 5HWSA 4RPKA 2CZCA 3NTOA 4LSWA 2F1KA 1DDOA 3WS7A 3WJ7A 4UREA 5CDYA 4QECA 3QE3A 3LYLA 4L75A 4LCEA 1BW9B 2BFPA 3R1IA 4I9UA 4BO8A 5LDHA 3KYCA 3DBRB 1HDYA 1GPDG 4CV0A 5JMWA 1P33A 4KTTE 1NNUA 2HDHA 3ETDA 3KV3O 3RVDA 1MFPA 3G0OA 4WKGA 3LF2A 3WBBA 2ZB7A 3IL2A 1IZ0A 4O1MA 5DBIA 1YDWA 2EERA 3W4KA 3AFNA 1E7SA 2I67A 1I10A 3AU9A 4R54A 3RD5A 3RQSA 1VJ0A 1CQJA 1UZLA 4EDFA 1GU7A 3LK7A 1LC3A 3WYEA 5JYDA 4K28A 4RVGA 4R3WA 5KCZA 2HK8A 3GR6A 3FF4A 1SBYA 2ZYGA 3R0IA 5CHEA 3ZWYA 4ZJUA 2GDZA 2ZTUA 2B83A 3VVCA 3MOGA 3D3EA 2X58A 3QWIA 3WSWA 2OBYA 3ZHXA 4LVUA 5KKAA 3D1LA 5KJFA 4MPDA 1GL3A 3L6EA 4KZPA 1UZMA 2UAGA 4P4GA 3WGHA 2WTBA 1XR3A 1XCBA 3NRCA 1LX6A 1EFKA 1U2GA 3W6UA 2X23A 2QYTA 2PY6A 1MA0A 1A4IA 3HG7A 2JHFA 1U8XX 4HP8A 1X1EA 3OIFA 4FC6A 5JAQA 2X1HA 1ZSYA 4OJNA 3CMCO 1N9GB 2WD8A 3D3WB 1NXQA 1P3DA 3WNQA 5EL0A 3WB9A 2O50A 1QYWA 3TN7A 2B5VA 2XXJA 4J91A 3CSDA 2RIRA 1CIVA 3KEQA 4F45A 2QHXA 3UUWA 1LC0A 1PGPA 2C07A 2HK7A 5EJ2A 4YAJA 2HMSA 1T2CA 4BV9A 2Q1SA 2GUGA 1VL8A 4MJLA 1HE5A 1PGQA 3OQBA 3DAGA 4ZQGA 2O2YA 3AI2A 4GX2A 1TI7A 3SLKA 4CL3A 5A9SB 3GEGA 4MKXA 5I7FA 2Y1EA 2DAPA 2AQHA 2NSDA 2O23A 3DTTA 3GT0A 1V9LA 4OSPA 4PLHA 2J3KA 4DLLA 3QW2A 3KVOA 2LDXA 2FY8A 2VYVA 3DBHB 3PHGA 3WSVA 1W0CA 2X4GA 3S55A 2CNBA 2CD9A 5BNIA 3S2FA 5IG2A 3B70A 4GGPA 5GY7A 3FR7A 3DXFA 4DQVA 1K0UA 3AU8A 5IXSA 1T2EA 4FFNA 4BHTA 2DTEA 4J4HA 5JPIA 3NT4A 1EDOA 4I5GA 4E2XA 1DPGA 3N7UA 4OGWA 3INRA 2I65A 3KYDB 3S1LA 4NIMA 3TZHA 4BO0A 1GUZA 4Y6PA 4YQZA 2JJYA 3D0OA 4DWVA 1Z82A 3DOOA 3ZN2A 4CMEC 3GY0A 1ENPA 3C85A 2VTEA 4JCOA 1VI2A 1QORA 4Q3EA 5AXBA 1LRJA 3VZQA 3AOGA 3WYCA 4XR4A 4ND1A 4D42A 2O3RA 2HQ1A 3T4XA 4N7RA 1KVRA 3BZUA 1U3WA 3BA1A 3RWBA 2JD0A 5F5NA 1BXGB 4NG5A 2Y1DA 4LRSB 4BNVA 2NTVA 4CV2A 5EN4A 5ITVA 4FJ1A 3PWZA 1E1MA 5B37A 3M6IA 4GX1A 4BNLA 4S1VA 2AW5A 3Q0EA 1Y81A 4ID9A 4RF3A 3FNHA 4RVSA 3VH4A 4ZVVA 1XWFA 3JQ8A 4RJTA 3FPLA 1GZ4A 2D2IA 1JLLA 3NEPX 3RASA 4BNHA 3A28A 5C7OO 1V35A 2Q2WA 4ND2A 2A35A 3KO8A 4L4XA 3BMCA 1KS9A 4YYZA 2D59A 1CRWG 1WNTA 3HADA 1BTOA 4D0RA 5ICMA 2BI7A 1WPQA 5TT0A 1ENYA 3EZLA 1GEEA 2AQKA 5ADHA 2J6IA 1O9BA 1C1DA 1LXCA 1VL0A 3EUWA 3PHHA 1D7OA 3GFGA 4R1SA 1KBZA 2NADA 1GZ3A 3EHEA 3ONDA 1R6DA 2O3JA 5KJ1A 5MDHA 2A9FA 4IIVA 4MO2A 1NQAO 4NZ9A 1V6AA 3MJ4A 2I3AA 3JQ9A 3QY9A 1PL6A 4AJPA 4J90A 1Y9AA 4YACA 1WDMA 4ILKA 4BL5A 4EUEA 3FWZA 1E6EA 3ENKA 4NBTA 4HXYA 2GZ1A 4Z3KA 3RJ9A 3EW7A 3ZNOA 1UZNA 3F47A 3WR5A 4I5DA 4CQMB 4GSLA 1NQTA 4RZIA 4XDYA 3ZNPA 4YR9A 3U49A 1K6XA 3NJ4A 3W8EA 3D5QA 3LT1A 3FD8A 1AN9A 4OSOA 1KEPA 4NI5A 2WD7A 1ADBA 1PJSA 3W6ZA 2UUOA 1EQUA 4EEZA 3LC1O 4U8GA 5DBFA 3BYZA 1IPEA 3M2PA 5CDUA 4XEHA 1PJ3A 5C7IO 9LDBA 1XLTA 1T1RA 3B1FA 3GAFA 1OBFO 3H4VA 4GWGA 1B8VA 1ZSNA 2AHRA 2X9VA 1K89A 5JE8A 1B14A 3W4IA 2DPHA 1HZJA 5L7TA 1HEUA 1LQUA 5KOIA 1XIVA 4EUHA 2GERA 2HRZA 3CUKA 4A73A 3UICA 1R0LA 1SNYA 2J3JA 2JD2A 3GHHA 4E32A 3Q2KA 4IBOA 4BNXA 3DBLA 4PN3A 2C0CA 1HDXA 4J4TA 1N7HA 3ZWBA 1LSJA 3OJFA 2VHWA 3AWDA 4OQYA 5JC1A 4M49A 4R5MA 4I9HA 4WASA 2QX7A 1OMOA 4UUOA 3E8XA 1OZAA 4LCJA 4ZHSA 5JAMA 4M87A 3FRJA 5A05A 3TL2A 5K6AC 2Q45A 1HWYA 3WJAA 5JCJD 1L7DA 3L6OO 1I3KA 1R15A 3LDHA 4L4SA 3I4FA 1P1RA 1FF9A 1YKFA 1V3VA 2B36A 3ONFA 4IDGA 1I36A 2GSDA 4PFJA 3D4PA 1ZSVA 3RU7A 1SZJG 4MIYA 4FGWA 1WZIA 4YJGA 5IDQA 4E33A 2V65A 1TB4A 4R41A 5TLSA 1PZEA 3AUUA 4CUJA 1BG6A 4KUEA 2PA3A 5BR7A 1YONA 5EQDA 1YQGA 5A06A 4JJGA 3JD0A 1S6YA 4HBGA 2I3GA 4EI2A 2Y1CA 2JFGA 4L76A 1MLDA 3ZWXA 4CM8A 3NT5A 3RSHA 4K26A 4RF5A 4MINA 4UUPA 1P44A 3KETA 3GNQA 4KTVE 1NHGA 1MXHA 3FBGA 4TMFA 1HXHA 1ZK1A 1G0OA 2FPGA 4LW8A 3UN1A 3E9QA 3ABIA 4MP6A 5HS6A 2X9GA 1ZFNA 1YB1A 3AOEA 4L9RA 3ZWAA 3DONA 5COBA 3DTYA 4PLVA 1GQYA 1OI7A 1R4NA 3FTNA 4O6VA 1R4MB 3GDGA 1E3WB 3DR3A 4BO9A 4EYEA 3ZV6A 4R9SA 3QVXA 3DB2A 1Y5MA 2I99A 1F06A 4EGFA 4FB5A 3ZDFA 4YJHA 1E7WA 1W73A 5ER6A 4BO4A 5DNAA 3O8QA 1NVGA 4NBUA 5H83A 3RROA 2Q4BA 3U4IA 4PZCA 3VC7A 2WE7A 1U5AA 3K9QO 1CJCA 1K2WA 4UEKA 3DMYA 2C29D 4FIZA 4DC0A 3E03A 3OIGA 1GD1O 2C5EA 3NTRA 2EGGA 1PS8A 4YJFB 3ZWOA 1H5QA 2O7SA 3V2HA 3F5QA 1DLJA 1HYEA 1R0KA 1TT5B 2IRWA 1OC4A 2J5KA 2A4KA 5COAA 4DXHA 4EJ6A 3U9LA 3OSUA 2WSBA 3R6DA 4HFNA 4TKMA 2GCGA 2BGLA 1XSEA 4J7CA 4CM5A 1O6ZA 2I76A 3TQHA 1PZHA 3GZNB 3ADPA 4R1NA 4EEXA 1AHHA 1HDCA 1DB3A 2PGDA 5IDYA 1XGKA 5DF1A 5DOZA 4E21A 1YGYA 1E3JA 3VKUA 2X86A 3K96A 1PSDA 1D4FA 1QYDA 4BKUA 4RORA 3D4NA 3RBXA 1VPDA 2J8ZA 1ZIDA 1YOVB 3TJRA 5C3MA 4Z3DA 4ROSA 4ND3A 1I2CA 2CVQA 2GNAA 4NBRA 4QX6A 2B35A 2BFMA 5F1OA 1RYEA 3E1KA 3JQAB 4JQCA 5CP8A 1I3NA 1DHTA 3O26A 4QTZA 3W4JA 4F6LA 5CAEA 5HA5A 3ORFA 1ID1A 2RCYA 1EK5A 4DPKA 4XJTA 4QFCA 1JKFA 1QV7A 1Q7GA 5K0ZA 4Q3BA 4ONEA 2O48X 4QFDA 5IAAA 1N2SA 4FPXA 3MTJA 2EV9A 3QRWA 5U4QA 2A92A 2NVUA 4BO6A 4ZQHA 4XJSA 1L7EA 3AUSA 4PG5A 2YUTA 3IAHA 4MIOA 5G0UA 3JCZA 1QLJA 3EC7A 6LDHA 5EINA 1BHSA 3ANLA 3CE6A 2CUKA 2EG9A 1WLYA 4YAEA 1YRLA 1KEVA 1DAOA 1D1SA 4Q39A 5I8WA 4AJ4A 1U2DA 3JD3A 3INGA 2DUUA 4PVCA 3MJTA 1TVEA 4DRYA 2NU6A 1NAHA 2HMUA 1ISJA 1U7HA 2V7PA 3HN7A 3QVTA 3V2GA 3ZCXA 5ITWA 2X7HA 2NNLD 1J0XO 1QYCA 1DEHA 4NFSA 4B4UA 1UR5A 4I08A 1HDRA 4MVJD 3JQBC 1E3EA 4OXYA 4MVJP 4BMNA 1NWHA 1SB8A 1I01A 4AJLA 2VQ3A 2ZKLA 3KLMX 4ESOA 1GADO 1X0XA 1GEGA 3E48A 4AICA 2SCUA 1I2ZA 3NAQA 4IIUA 3QHAA 1GYQA 2FPIA 1UXJA 2VHZA 3PFFA 1LDYA 4BNKA 2Y1OA 1R66A 3QIVA 5A3VA 3I5MA 5L53A 4ALLA 4TQGA 5F3RA 2Y99A 1Y8RA 2VRBA 4YXFA 2X0RA 3GDFA 4WLOA 3GMSA 3DQPA 4LISA 2NUAA 4WECA 3HB5X 3A06A 2P9CA 1KVUA 3K6JA 1C0IA 4NK5A 1FDTA 4J2HA 5ENVA 4MP8A 4XB1A 1NM5A 3GNTA 3MJEA 4F3YA 3VPSA 2NTNA 3VDQA 3CZMA 4IDDA 1MFZA 2GN4A 5ER9A 2FSVA 2NTJA 2AQ8A 4YCAA 3OF2A 1PJBA 3U4DA 4XYBA 2QZ9A 4B7CA 3Q11A 3IC5A 4FQ8A 4Z9YA 5JC8A 3W1VA 3WGYA 2ZK7A 1UXGA 1AXGA 3JQ7A 4BNMA 5CFZA 4Y98A 1J5PA 2UYYA 4ALJA 4AJIA 2PKRA 2E6UX 2DBZA 2Y0CA 5EESA 1FXSA 3K73O 1Y8QB 1YDEA 3ZW8A 3LLSA 1J6UA 1H2BA 4YRDA 4E5NA 1TLTA 3VHRA 4BNWA 1P1IA 3BMOB 2AEFA 3GGGA 4DVJA 5L4LA 4I9NA 3LT0A 1Q7CA 1WWKA 2O3TA 4PRLA 5TIIA 3AOEC 5JNLA 4CODB 4ZQFA 3QQPA 3GVHA 1PEDA 2OBNA 3ZU5A 2AQIA 1BW9A 3GA0A 1V3TA 2YHUA 1GZ6A 5F5LA 4BVAA 3W8DA 3JQFA 4E30A 3Q3CA 3GF4A 1N1GA 3N58A 2YDYA 1U5CA 3D5TA 1A72A 1GCOA 1JU9A 2ZCVA 3L0DA 1LSOA 1F17A 1QRRA 1LEHA 1GPJA 3RUDA 3RBVA 4DPLA 3BIOA 4PLYA 4LVCA 4AG3A 4TRRA 1JW9B 4FFMA 3MEQA 4XGKA 3NV9A 1HDGO 3VTZA 1SEPA 5CG1A 3AUAA 1NP3A 1E7QA 4L0QA 5TS3A 2YFHA 4FCCA 1VM6A 1IY8A 2CDCA 2PGLA 2X0NA 5KVCA 3V8BA 1RWBA 2VT2A 1E7RA 4RPJA 4PLZA 2WE8A 1NVTA 5KTKA 1GQ2A 4YWJA 1G6KA 1DC4A 1U7TA 4ZQBA 5G0VA 3RAJA 2YY7A 2I9PA 4DC1A 5GZ1A 4WCDA 3QVWA 3DZFA 4CLOB 4A0SA 4M86A 4NR0A 1VSUA 3ZWNA 2DT5A 4ALKA 1DIRA 1X7GA 4LK3A 2B37A 3GLQA 5DT9A 4AJHA 3PQEA 1U4OA 1T4DA 1MX3A 5JDIC 3WIEA 5AXDA 4Z0TA 1H2HA 2IZ1A 1PU2A 2I5PO 2H1SA 3RKUA 4U6QA 1N9GA 2GYYA 3TDKA 3D3WA 3KZVA 1E7MA 3KYBA 3PYXA 3F9IA 4J1SA 3DDNA 1W8DA 1WXDA 4K9DA 5THQA 4XKJA 4NJMB 3COSA 4BQPA 1P9LA 3DMTA 2D5AA 1P1FA 2HSDA 4EUFA 2O4UX 4GX0A 4XRRA 4ZICA 4JP2A 4CM4A 1X0VA 2VUUA 4L73A 5ILGA 1R37A 2YYYA 1BRMA 1X14A 5DN9A 1Y7TA 5JO0A 2AEJA 3TZQA 3E82A 1VL6A 3DBHA 1SAYA 3N74A 1U4SA 1PZGA 1NAIA 4MKRA 1K6JA 3ROPA 3EVNA 3ITKA 2VOJA 1T24A 5L7YA 1E3LA 5A9RA 4TROA 3BMNB 2B5WA 1I32A 4XA8A 5COQA 1HETA 2VUTA 3GRPA 1R16A 3BMQB 4DUPA 4YPOA 2CDBA 2OO5A 2VYNA 3WBFA 2GF2A 2DVMA 5EQFA 1JAXA 4XQCA 4D3SA 1XA0A 4DMLA 1T26A 3CXRA 2ZB3A 5CEEA 4G81A 5HBRA 2EGHA 4Y6SA 3PI7A 2FHSA 3RJ5A 4D43A 1CQIA 3K30A 2FWMX 1JA9A 3LT2A 3OQ1A 4KUHA 3ZV4A 5CG2A 3RBZA 4PLFA 1VJTA 1GUYA 5JYEA 1MGOA 4P8RA 1O95A 1Y6JA 1JWBB 5CPBA 4PGFA 4W7IA 2C54A 4NU5A 1AXEA 1C1XB 2QIOA 3WNVA 5HRUA 1DRVA 2VWHA 2YHIA 4IMRA 4CQMD 1N7GA 2LDBA 3Q9UA 1EVIA 3NDIA 3I23A
chains in the Genus database with same CATH superfamily
5LQMA 4QYIB 3AR4A 5TB5A 4AXBA 2IBTA 4Y6RA 4EI8A 1QX3A 1ZQ9A 1GAJA 5ALIA 4TQUS 3FHCB 4MVJM 3TWOA 4ETIA 5JSUA 4BLVA 3T0FA 2JCSA 1ISPA 3VDNB 1FS6A 3V4SA 3IAUA 2F1HA 4AJKA 3PEEA 2EP5A 1N92A 3F6RA 4RYDA 4LDQA 1EU1A 5C5EA 3KU4A 1JXOA 1S5PA 1QR6A 2AW3A 3NJ8A 3IMFA 4YQYA 3T7RA 2EZ8A 3DE5X 1YU6A 3VU9A 1DAMA 2Y68A 1ZZGA 4XLTA 2WIAA 4PCUA 5JY6A 5KQPA 3PIRA 4QBIA 3F2IA 2W6ZA 3T7SA 1E8DA 2ZUFA 4X92A 3WGIA 2QRVA 4RD4A 1YQXA 4DLXA 3HHPA 1EDZA 4Q24A 4JZKA 2HPHA 4Y2SA 4F7WA 4TM8A 1RM5A 4EO7A 2GCEA 4F2DA 4S1NA 4EVIA 1JGTA 3JR7A 2RKBA 1UCFA 3VRHA 4OHWA 5AK6A 1L5YA 3ADOA 3HN2A 2PU7A 1K3UB 5KTRA 5BN4B 2XTAA 1UOPA 5T8KA 3ET4A 2I7TA 1R8SA 1X8JA 3K8OE 4ND8B 5HP4A 5EC8A 4YCDA 3RRMA 4U7HA 3WKBA 3WK4A 5HGXA 4NECA 3MS7A 3PC6A 1KI7A 2YZKA 5AM2A 5EMNA 4JBNA 1JDSA 4DMFA 4DIFA 5DWQA 3KEFA 5IF9A 4JLUA 1H2WA 5KWJA 4UCQA 4DIMA 1NKSA 1NV8A 3IA7A 5T4EA 2NU9A 3HKCB 4G4JA 5J59A 1F2VA 5C1PA 4FJ2A 1UC8A 1DU4A 3AEYA 3WIBA 1DQYA 1M2VB 2W0SA 3UWPA 1ZWLA 2FW9A 1A9ZA 2JGLA 2ZRFA 4EUNA 1NMXA 3AIIA 1MR3F 3LGAA 1X9GA 1IY1A 1K9SA 1GGKA 2Z8ZA 4KWHA 4OQNA 3C7KA 4BKRA 3G5LA 5KSZA 4HF7A 4U2CA 1F9EA 2PRKA 1XPRA 3JTMA 4BBJA 4LK2A 4IOJA 3K16A 3S3TA 5KDDA 2VDNB 3L4JA 2TMGA 3QXSA 3A1WA 1EUCB 4E14A 1X80A 1CR6A 1FFEA 2IHTA 3HMQA 3QP9A 1B41A 1GZDA 2ZR7A 4WBSA 2OO3A 2R7KA 2FW7A 2AA3A 3G2OA 3N2GA 4GMFA 5DXJA 3C1AA 1JKJB 3WIVA 1U3FA 2ZP1A 5FUMA 3KEMA 4MHOA 1JT9A 1UJ5A 1YZKA 3L77A 4WZZA 5J23A 3FMOB 2AE2A 1ZOLA 5D7BA 4ODIA 3VOBA 2AG1A 5LJIA 5REQB 3UZUA 4BFYA 2XVXA 1QKJA 2Q0HA 3WK6A 5HKBA 4FOOA 1OAAA 2XEXA 1II8B 3DE2X 5KDOA 1E5QA 4ZEWA 4UFOA 2WUGA 2WYUA 5K20A 4GOJA 1EFDN 5KWEA 1WDKA 2OBMA 3SSOA 3ZHRA 4JLDA 3SZ3A 1Q0QA 3IVAA 1RWMA 3UCFA 3C7CB 4GMKA 3LCMA 5FNVF 4D44A 1Q44A 1O5OA 1T3ZA 3UEOA 4RTSA 1BWQA 4M6WB 5FTWA 2WK1A 1JG6A 2QU7A 3AXSA 4DLTA 1QHXA 1J70A 4FDMA 2QMEA 4BLQA 5ALPA 4CNBA 4NMXB 2CYAA 4PAMA 2CV2A 1ULTA 5A5GA 3PNYA 4QUKA 1K6IA 2H2AA 5HDQA 2VP6A 4I1OA 4IJQA 1QSGA 4LA4A 3FSJX 1H3FA 1X13A 4MEAA 1F12A 1JE0A 4WSOA 1ANKA 3PYLA 1VCHA 1RCTE 1W6UA 4CKXA 2ONYA 3NEYA 2IEGA 3MG9A 3IURA 3O4GA 4QDUA 5ITZA 3GFSA 1YWGO 3JAKA 3PFNA 5JXWA 1XO1A 3C5WP 4JEIA 2HK9A 2QZ4A 3AG6A 3E15A 2J41A 4RIHA 3UG6A 4I1VA 4H1UA 2V4MA 1VLQA 2XWSA 4PICA 3WJ2A 5HKKA 4CLHA 3V4RA 1FNDA 1RW4A 4Q15A 2PZLA 4O0MA 1ZM9A 1R5BA 2FCRA 2JGJA 2XA9A 1VBNA 1T5SA 3GT4A 3LSYA 3VM6A 1TOAA 2HU8A 3IMGA 2B8WA 2TS1A 3G0IA 5CA1A 5BW4A 1QCZA 2J4CA 4B4DA 3FXAA 2Q5JA 3FMPB 5GZ3A 3HXMA 2O8EB 1Y9EA 5C5CA 2PMDA 1KZHA 1GILA 5IM4A 4IO1A 3VISA 1AKNA 2W4QA 2FFBA 4XIYA 2ZUSA 4JBIA 4Q9JA 2B2XA 1QE5A 1BGWA 1ZW6A 2C3UA 2I54A 1E6LA 3FOCA 3OP1A 2HPZA 4HWOA 3EDMA 4CMBA 4TKZA 3OIWA 4PYLA 4HVAA 3TCXB 4M0PA 2XUPA 4IGIA 3H1AA 3EPJA 1C5KA 2GAFA 1ODSA 3ZWQA 2RB5A 3C8DA 3PTZA 4Z4GA 5IUKC 4FYYA 2F1RA 3PQ8A 4KH1A 5IC5A 3IMCA 3F7TA 1SZDA 3ILSA 3NJRA 1MVOA 221PA 3Q6IA 4KMSA 4A5OA 2RGXA 4DZZA 5K0GA 3TPFA 2PL1A 4YPVA 3VMMA 3H84A 4UCWA 3VC1A 3KDAA 1JR3D 5A6SA 1W4RA 1JHDA 4KLZA 4XSHA 5CFMA 3Q7IA 2FUG1 1TXGA 1C7ZA 4HJRA 3OZSA 4UZEA 4WX2B 3RC3A 3MT9A 2AXQA 4S05A 3ESAA 1EXDA 2J48A 4Q21A 4TXNA 5K03A 2X40A 3ZE8A 4EJSB 1W87A 2R68A 4ARUA 2GB4A 1NBIA 1XFDA 5KNCA 4MULA 3IBSA 2GPBA 4ZT4A 3MD9A 2DT8A 1NW8A 1T9HA 3L7BA 3U5TA 1CQWA 2B4TO 3A3KA 2YMQA 2VRCA 2HCRA 1XCPA 2JIBA 3BAZA 3R23A 4UDNA 4UUNA 4X94A 1II9A 4GOLD 1O4VA 1PK9A 1YU9A 3HJFA 4L8VA 1PJRA 4NWIA 1KJYA 3T1YB 1Z0KA 2R79A 4LRTB 2JLYA 2FXVA 2OVBA 1ONPA 3QX8A 4BVFA 5ADWA 1NQOA 2HA5A 4HAIA 3VZBA 1AZWA 1U0SY 3B12A 1JDUA 4JR1A 3ZPXA 3KLBA 3KVYA 3IR6A 2CLIB 2ENWA 2Y2VA 2OXFA 3MJSA 1Q2XA 4DT1B 5HVNA 2BEKA 3AT1A 4GRDA 1M33A 1DBWA 3OEHA 5F52A 1WUJS 4F60A 4R3NA 5DI9A 2WUDA 2VHXA 1KI9A 3ZHOA 1U3GA 4XYMA 5EVCA 4CLEA 4FGSA 2HF9A 2WQ7A 2QORA 4H77A 4W7HA 1HTBA 4RULA 1ECCA 1PP4A 2DPGA 4YASA 3ZI7A 3IHKA 1J00A 1L8AA 3FKSA 4LXIA 4B3HA 3PQ4A 3OZRA 3Q5EA 3PFWO 4PXYA 3IOEA 4D74A 3I2YX 3VPXA 3GDOA 1U98A 3PNBA 4MB0A 4KXWA 4CETA 5AHKA 4AZWA 4NYIQ 3JQ8B 1APBA 3KOOA 4AKIA 3T1NA 4B47A 4DA9A 1SVKA 5EJ8A 4BGEA 1XZMA 4R1PA 4EYOA 4ZDIA 5JMWA 3ROXA 1B23P 3DZIA 1RYDA 1TJ5A 3CF2A 3FNFA 3AF0A 1E3IA 2WAYA 3JQAA 3S68A 3M1AA 5LQDA 1ORWA 1QG2A 4FGKA 3K72B 4X64B 4CM7A 1ZOSA 2MWMA 3GXOA 3K92A 3BXPA 3BAFA 4ME6A 1BN6A 2GVZC 1H8EA 2PLFA 1H4TA 4ZCQA 3JZIA 1U4NA 1ISRA 4TV9F 3ZJVA 1YF3A 3WYNA 1NFQA 4XVHA 1JFSA 1W4BA 1C1DB 1JQJC 1PJ2A 5ILOA 4BZXA 3G0GA 4OYRA 2IEAA 5ALQA 2O06A 1L1EA 1XU7A 1XKLA 5SV2A 4MHSA 4E7PA 3K1AB 5I6DA 4Y30A 1GYPA 2BI4A 3AHEA 4M8NE 2WG0A 3GLRA 1I6MA 4TQAA 5HF5A 4DLBA 1EXMA 1RPJA 3ZU6A 4B46A 3LVFO 3HY6A 4A6XA 1XF9A 3PKZA 3EXIB 2I2DA 1J4AA 1L4KA 2VPYA 3UPUA 2JJ2D 2QPOA 1SIWA 3FCCA 4K5QA 4ETNA 2WJGA 3EUAA 4J0IA 1KU6A 1XHLA 3P0EA 5KHAA 2DHDA 3TGPA 3GD5A 2XUDA 5EVJA 2EWMA 4MQMA 4Q9NA 3K0EA 3OU6A 5J4VA 1KETA 3ZV3A 4ZVSA 3H9JA 4XVRA 1Y3BE 4E5YA 1ULUA 3G79A 2ZPUA 4G4SP 4ZU3A 2PQMA 2RGGA 2VJKA 5SYNA 5A0FA 4S04A 5KUTA 4JEMA 1FJGB 1SXJD 2B8TA 3H1EA 4KQ1A 3A6JA 3FPKA 1HFWA 3FPHA 4KR7A 2JCXA 3WFIA 3O4RA 4G23A 4DIOA 1K63A 2EG5A 3AHJA 1FLVA 3W5DA 1HDEA 2WPDD 1XOIA 5FUXA 3RKRA 1U28A 1TA9A 3E81A 3FN4A 1BCSB 3N59A 4CR6A 4KO2S 4D25A 4ARZA 1TLLA 3L18A 2IXBA 2CMFA 3EY4A 4JUCA 5FNVB 2PUVA 4GI5A 3LXXA 1YR6A 4QRIA 2H52A 3KKLA 4GBJA 4KPUA 4DREA 1C30B 1VKOA 2RGYA 2VA9A 1HR0B 1IZ7A 3D3NA 4WLEA 3OPYB 3MWEB 1OY1A 1RJWA 2BKVA 4JJ4A 2GAIA 4J29A 1VL5A 3C2QA 3FB4A 4NATA 1Y7LA 1OV6A 1B26A 1ZU4A 4JJZA 2RKWA 3FNQA 2BELA 3DL7A 3F6PA 4IVPA 4MKZA 2GKGA 5I3ZA 3CNEA 1GVNB 1EX9A 1XROA 4CM6A 4D9FA 1GA6A 1VZ2A 3A05A 2NXNA 1MW8X 1PJ4A 3DBLB 4MWDA 1N2JA 2O54A 4ITUA 3E3AA 1E2PA 4OP3A 4C4RA 4TQ9A 2C2XA 1TW3A 2D5CA 3ED5A 2GJ4A 2ZJAA 4HNGA 3BE4A 4UATA 1ND6A 5JSHA 5DGIA 4MS1B 1KEWA 4D5GA 2VJDA 3PEFA 5GJVC 1E9BA 3H2JA 5AJVB 1YA8A 2CCKA 2B94A 1B0AA 2HREA 2P4EA 3AR8A 1DT3A 3L4SO 5AVYA 5LQUA 1DTSA 2GR9A 4U6SA 3AM5A 2HDOA 1GU0A 3O8OB 4ZOBA 1PR5A 4WJKB 4ZXPA 1RJFA 4LUCA 1PCXA 3MMXA 3AESA 1VE5A 3A1VA 3QU9A 1TVCA 3D1VA 4PPQA 2FMFA 4J3FA 4LY9A 5DYGA 5KZMB 3F5SA 1EVEA 2NM0A 4HMPA 4ALMA 2BOVA 1QFJA 4NU8X 4X54A 3RBAA 1T8WA 3ZHTA 5HJ2A 5DHPA 3LCJA 2QUZA 3JQ9C 3P0IA 4OXKA 4DCVA 2RHCA 3EN0A 5H4GA 4QYWA 4MLZA 2BRUA 4NBNA 4QPCA 4LOLA 3VDMA 4UQLA 4FKMA 2QN3A 4HAXA 1TC2A 3EQ8A 3L7KA 4KQMA 3CUVA 4FZRA 3B53X 4WAUA 5K7SA 2P7HA 2X0FA 1JTVA 3B2NA 3TZLA 4D45A 1QZXA 3VAAA 3G5TA 3RIHA 4F2WA 1F20A 1CJMA 3CZRA 2PT9A 3BJZA 3F4BA 4HFRA 1QVRA 4JODA 2VTDA 4XQ9A 3FRIA 3ZDBA 1P5HA 3E3OA 1YZFA 4YAUA 1VRVA 2NU8A 5JQGA 1NVUQ 4FILA 1W8IA 1Y9DA 2EATA 3H04A 3AUKA 3HY3A 4OQXA 4OHRA 4M98A 4RPLA 4YRRA 2OCYC 4INJA 2V0CA 1U9IC 3NYWA 4YCNA 1CP3A 4H4CA 4UTZA 4AJEA 1C8VB 1X19A 1E3SA 3KJGA 3TK1A 3EIXA 3HZZA 3DW1X 3DAFA 4BO2A 1VQ1A 2OHOA 2R5FA 4WN9A 2DFLA 5ALXA 3SQLA 4DCUA 2VHTA 5EIWA 3NUQA 1O96B 2XUGA 1G8KA 3NC4A 1CT9A 1OBOA 4KEAA 3L6RA 4MWZA 4YDSA 1PEKE 1OA1A 4ZN6A 4P3YA 3GEHA 4F9GA 5IYZA 3HFRA 1CUBA 4B74A 3EIHA 2W58A 2ZRGA 4EB6A 5AJTA 2IE8A 1WS6A 2PRJA 3KPJA 3DCNA 2OCGA 3NYRA 2X15A 4CR7A 5TS2A 2PSSA 3AFGA 3WYDA 2PL3A 3CTPA 3QIAA 1UDAA 1K3TA 3AXTA 3IULA 3LIPA 5LXTF 4BFXA 3NMUF 4UAUA 2I1WA 1DIGA 1U2TA 1I94B 3DC2A 1JVBA 4NCAA 5LKRA 2VJYA 3HDJA 4DNQA 3X1ZA 1LLQA 2XWQA 1A7UA 2BZGA 3LY7A 4PFSA 3RQIA 4B5LA 1OIVA 3AEUB 4O2LA 3DEYX 5F73A 1CQZA 2QN9A 4MW6A 1L7PA 2E1RA 4FYJA 1GUDA 3ONVA 1W30A 1FLNA 5E0KB 3CO0S 2BTEA 1X8KA 3I0ZA 4G65A 1MF7A 4FFOA 4NARA 4A2CA 1U3DA 5AKZA 2PEZA 3SBEA 5A3QA 3CZQA 3A3PA 2QRKA 1G6HA 1K1EA 4CU2A 3NHRA 4RQBA 5BR8B 3DYIA 2GN0A 5WRFA 3HB9A 1E3MA 2YCLA 3ESQA 4WBNF 1JBQA 4WCFC 4EI9A 3WXMA 1SXIA 1XFAA 2IOFA 5ECDA 3VVBA 3PEYA 2ZWVA 2GWHA 1C7FA 5LQJA 3DMGA 2GRAA 2PVSA 3AK4A 3K05A 1DCFA 5G0TA 3KZ1E 4IQ8A 2I7CA 4KE8A 4WUVA 1V9CA 4TV9B 1JAZA 4HEA1 4ZXFA 3IFSA 1Z68A 2O2DA 4B6RA 4M88A 1XT6A 4MARA 1SR8A 5TRTA 3INTA 4GQAA 4ZYYA 1UBNA 2E82A 4M46A 1G4UR 2HBRA 5CLLA 1A4XA 5DNCA 3RHZA 4EX6A 2QN7A 3R9XB 3C14C 4UVIA 3UA3A 2W00A 2WLSA 3RAGA 3CX8A 1NRWA 2NVUB 1P61B 4JX8A 3DBRA 1T8TA 4YPFA 1PL7A 3WLIA 1DRUA 2MMGA 2WM9B 1IQUA 2GFQA 1HOXA 2J9XB 3USES 1XU9A 4PE5B 3DOFA 4NV3A 4QODA 2JAXA 4GPAA 3QSGA 3QLUA 4NF2A 3QVSA 1QGUB 4X41A 3VU1A 2C9BA 1KJ8A 4IICA 4J6EA 2PJRA 2OUIA 1DTEA 5A62A 2IQ5A 4WNCA 1U94A 1KFCB 2CE7A 2GH1A 1YL5A 1TKRA 2RAVA 4GX5A 4WVLA 2RBGA 3FTDA 3JD2A 1DXYA 1E61A 4ZVQA 3TLCA 1LDGA 4JLSA 4BKPA 4S0XA 3EX7C 2H1CA 4HOYA 3QW4B 4FFBA 4LE2A 4MWBA 4RWZA 3ZY2A 4HNUA 1GTG1 3L6UA 4O8ZA 3N2KB 1KXJA 2ZYAA 4ZC1A 2AMJA 3E18A 4JN6B 4BMXA 3DL2A 4LNUA 1KMHB 2H0AA 6CHYA 1AG9A 3RUHA 4OMDA 1TU3A 4XAQA 5B7PA 2HRCA 2KSQA 4LJ8A 4D3DA 5BVHA 5T6BA 2B7LA 4QULA 5K4GA 5I8ZA 2DETA 2PL5A 4POOA 4B9AA 4CMEA 3I9NA 5KVSA 1SKBA 2J08A 4QGGA 1SVWA 3W79A 3BVPA 2ETVA 3QUBA 2VJNA 1LI4A 2KYRA 5FTKA 1J5EB 3AUYA 1LWOA 1ST3A 5FUVA 3ZGVA 4PNHA 5HBGA 1S7CA 4PC3A 3D7MA 4M0KA 2IHYA 2OLKA 3DE6X 5FWXA 4LY0A 5C1DA 2XMPA 2MINB 9LDTA 1SXQA 2X7XA 3VZCA 2KI5A 3HXPA 4JGGA 2GYVA 5EXPA 3KRTA 3FKJA 4EO4A 3CN9A 4E2FA 4ZK6A 4X44A 1SCUB 3LHDA 3NDJA 4FKZA 1CY7A 3S81A 4IY1A 4NMHA 3CY6A 1SGWA 1FP1D 2FQQA 3MELA 3TAUA 1E2LA 3RRJA 1ESDA 1UBJS 4R68A 5C8YF 2NUAB 1WTCA 3RI3A 4KMOA 3AEQB 2O8DB 3GJ6A 1RI4A 2PH1A 4HB4A 1IOWA 2WF5A 3L4BC 1U6JA 4IHJA 4EL5A 4W5TA 1U7UA 4FFWA 3B8HA 4YHBA 3EW9A 3W3AD 1I2BA 3PSHA 4TLBA 4HEHA 1A9OA 4D81A 4CKCB 4E94A 4QXAA 4A6EA 3GDHA 5AVQA 4HK4A 3MTQA 4KGZA 1ZN7A 1TLFA 4LI0A 3M2TA 4PANA 3QTTA 1P7WA 2PNFA 5JHHB 4J43A 1M6VB 2IEBA 1RWOA 2QRLA 4WLUA 3NM5A 4TTIA 5C31A 2G08A 3FYTA 1AM4D 4YA6A 3RSLA 3KLNA 1IULA 4CR8A 5CT5A 3DE4X 2XCTB 2ODPA 1NPYA 3GT7A 2DTDA 4MK4A 3ANMA 5FA6A 5JVDA 3AUXA 3ISTA 3UHAA 3WG9A 3LUFA 3WC4A 4F71A 3X1JA 2DPLA 4CEJB 3ZVMA 2VF7A 4BEVA 3CRZA 1HRKA 2VK1A 1NXWA 5JG7A 4BMDA 4OQZA 2ZAOA 3A0RB 4NBSA 2A1TS 3G85A 5JO9A 3UT5B 2R8EA 2W6JA 3WOVA 5GZ6A 5B3LA 2C8VA 3WRXC 2Q9BA 2XOEA 3OX2A 3BF8A 4OI4A 4B4WA 5KOJB 5L4SA 1ESEA 2ADFA 5K0CA 4MKFA 4OI2A 1A8PA 1L7RA 4YT5A 2PKXA 4MWSA 3VPFA 5HTKA 2O2ZA 3F73A 3EGOA 2P4HX 3EMBA 3A3NA 3EIWA 2Q4RA 2X5OA 2EXXA 1T0HB 3BF7A 1LLCA 5E7QA 2FEMA 3NWEA 1IJFA 2FJUA 1N36B 3EB9A 3U09A 2O3QA 2OZLA 2IXAA 3RIGA 2JIDA 3IAS1 3O8NA 4Q93A 2Q21A 3WYBA 1D2NA 3AJEA 4PLCA 1MT3A 5FFNA 2ZJYA 5G0SA 4TWRA 1K7EB 4I50B 4L3WA 2X0JA 3UV3A 3ESDA 4LWPA 4I4LA 2EFJA 2BH9A 1IHOA 2ERYA 5F78A 3FUXA 5KSOA 4WFJA 2ERCA 5T3UA 2QM8A 1ZISA 2H92A 1ZXXA 2O4CA 4FMDF 2I2AA 2JFXA 5HIAA 5EIOA 3A6PC 1RZVA 4OX9Y 5LXTB 2UXDB 3ZLUA 4JXKA 4F5EA 1FTNA 4AW9A 3FSGD 2OY0A 4HDKB 4IKOA 1YS7A 1UBTS 2HNKA 1E9CA 2VXYA 2J6BA 1SJ9A 1YDMA 3NBQA 3NANA 3DL0A 4JKOA 5CM2Z 4LHWA 4YMHA 3G2JA 1OTYA 2M6SA 3K0FA 1SFRA 2NVWA 5LWQA 5K0TA 2W6MA 3TM5A 5AVTA 1RLTA 4ZI2A 4UM9B 4MLPA 3LY9A 1ZAKA 1NJ6A 2XNCA 1NM5C 2QX8A 2G71A 2BFOA 1Y5LA 3B48A 3CLKA 3EXHA 2FSVC 2ZYWX 2O7NA 5HOQA 1FX0B 4EBBA 3M49A 4HDRA 1OX4A 3KCQA 1OC2A 1U2RA 3OE7A 3V8NA 1J1ZA 1OHHD 1RHMA 2QTWB 4PYRA 1CFZA 4WBNB 4U5QA 3L0IB 3V5NA 1QF6A 3NHUA 4Q00A 4XB6B 5G3YA 4Y2RA 2ZYVX 3KEGA 3F3MA 3PZRA 1SBZA 3U1VA 3AP3A 3DZCA 2BFAA 2JBWA 3PQDA 3UJ8A 4YRZA 1VJDA 4HNHA 2JD1A 5AKXA 1J1IA 1XHEA 1CJBA 3FUVA 2WAOA 5AK0A 1P1HA 2QS9A 1GNPA 1ZJ6A 4Q4JB 5DYIA 3LQ4A 1C9KA 3VR4A 4Z54A 1QFZA 3IPCA 1PVOA 2Y71A 3R24A 4PSAA 2ZWAA 2PBRA 3IAXA 3WI7A 4D99A 1DC8A 4GKBA 3NPAA 3R5SA 4UBKA 1LNQA 3LKZA 4ABTA 2MSCB 2FZKA 3BXFA 1YB4A 3B85A 5IN5A 3OE4A 3G2LA 4IQ0A 1XYGA 1A96A 4DL9A 3MQ2A 2K7FA 1UADA 6Q21A 3PF9A 5JMOA 4D3XA 3OQNA 1NFFA 3NV7A 4D4LA 4RKQA 4OEHA 4C4OA 1QFXA 3RGGA 3FYSA 1WCXA 5FA8A 1M0TA 5LLTA 2CMDA 1PZXA 1TIKA 3L02A 3P7MA 1ZUNA 2A86A 2OHVA 2C7PA 1XMSA 2NO1A 3HA3A 5BQ5A 4B09A 4QLBA 2E5LB 4HKTA 1Y80A 4FYWA 1H5UA 2Y4OA 3PFCA 3UTCA 4C03A 4GEKA 4JJ8A 3PEUA 4DQLA 2QBYB 4J4BA 2CXTA 4MUIA 3BZWA 1TIPA 3L04A 2FEWB 3NONA 1J9ZA 3OUTA 2Q1TA 1RQ2A 5DHUA 3T5MA 1T3SA 2BGWA 2PXHA 5D51S 4BO3A 1GU1A 2QMOA 4YJ3A 3WBKA 3NU1A 1WKVA 1JIXA 1BCRA 1FUYB 4JP5A 3ROMA 2WA1A 2MHCA 2R6DA 1MOSA 3N8KA 3OZVA 3ZZUA 2O1XA 3R40A 4P4UA 3EZ2A 4K6CA 3S70A 4CMHA 3K70C 3NS7A 2JATA 2PQ2A 2FKNA 3V6MA 3IUPA 5IEBA 2IGTA 3IJEB 5AK5A 3T7TA 1IDOA 3H8VA 3K3PA 4P7FA 4DNOA 2VK4A 1D09A 1DZIA 2YHIB 3MTEA 5IANA 4ETMA 2JGNA 4HPJB 1IEXA 1YXMA 4MYTA 1J07A 4FSHA 1WABA 2E18A 2YOGA 5FPYA 4E2ZA 1H4SA 1KAOA 2VRNA 2YN2A 1EG2A 4BEWA 4YRCA 1ZKMA 4B45A 5KB3A 5KDLA 3EPLA 1MC8A 2JFUA 2XXBA 1EHYA 2FWJA 3MTGA 4LRUA 2I6FA 4X84A 4BCCA 4EB8A 2GI4A 2ZJFA 4F4JA 2HKIA 3D8SA 2Q49A 4LNHA 1X7XB 4N5IX 1P4SA 1DKUA 2HLDD 1SU6A 4NRDA 1XQWA 1LDEA 5H3CA 5I9TA 5K8VA 5AW2A 5EMHA 2WM2A 1Z56C 1LDBA 3HA5A 3COWA 3RJTA 1YOBA 5BYAA 4NBKA 3PBKA 1GQQA 2A5JA 2CJPA 2CLLB 3O31A 5CH3A 5EJ9A 4KIWA 3R3HA 4P84A 3PCTA 3QVVA 4FEEA 1DO8A 1XNQB 1IYZA 5D6OA 3VMFA 4CNQA 4B3TB 1HNNA 5TJHA 1VPLA 3LVRE 3PGKA 1ZH6A 1JDJA 3SXUB 3LGXA 3TW8A 2IEIA 2REXB 4HLDA 4KR2A 1WEHA 3BJRA 4NYJQ 1EFVA 1FSFA 3SS8A 3HVRA 3VZRA 1S96A 3HEBA 4QDZA 5JWHA 4JMPA 2F00A 1XQVA 1PT5A 2QDKA 4IIEA 4HUJA 4OXQA 3I9LA 2YC4C 3GEPA 2Q46A 5DX1A 3NHWA 3K4HA 1JXAA 3CEHA 1QHHA 5EQDA 5FPSA 3AFOA 3SEFA 4DMRA 1ODTC 1KBOA 2G6TA 2V7GA 2WIFA 1XP8A 4C30A 3RAPR 3T61A 4AVYA 1JN0A 2R0QC 4K6FA 3CLTC 3DOJA 4RSGA 3E9ZA 3M6MD 1GKKA 1Q0RA 1S0UA 1Z39A 5B2FA 1AKVA 3CKKA 1T9CA 2ZYHA 4LAFA 3NKLA 1YQUA 3A1SA 4NONA 3CCBA 4MRPA 3E22B 1NMYA 1C3JA 3G82C 4MDFA 2I7XA 5CUQA 5ABPA 5FXMA 4NOLA 1YAJA 4MW7A 2Y1XA 4FCTA 2F6RA 3FAZA 4NKRA 5TGTA 4CKEA 3OUZA 3ZBUA 3J81k 4KO8A 3QUAA 4KCGA 2CMKA 2I6XA 4IRXA 4PV7A 1WMDA 3S1AA 3TLXA 4IUYA 1DAGA 3HKEA 2ZYSA 1CS0B 2P68A 2HRBA 4XUCA 4D9CA 1BD4A 4J9VA 5CVJA 1VP3A 2W6OA 3QKWA 5CYOA 2JZOA 1AGYA 4K9MA 1FXWA 3GAAA 3E23A 3OLXA 4BQOA 4DM4A 4F72A 4NCXA 4F3TA 4QVGA 1G6Q1 5KYYA 5LZ4A 4GLOA 1U9ZA 3UMBA 1RKBA 1KYTA 3D4BA 1AURA 3VTAA 1CUCA 2W37A 3EMVA 2IE0A 4LIPD 3QX9A 4I8XA 4OL0A 2GGSA 1CY1A 4LYHA 4DUZB 3ZGZA 1B3BA 3BIWA 1O0CA 1CR4A 1DUSA 2XE4A 3JQBA 3QXXA 5KO2A 1QP7A 3TG2A 3SVLA 1QDEA 1E5LA 1CSEE 4X00A 2A9RA 3ECSA 3KHUA 4ED9A 1MC1A 1Z7BA 3X3HA 4CWAA 2IPAB 4O4LB 4P9NA 5FUWA 2D1YA 2QZJA 1Q74A 4RTOA 2XCLA 1BVHA 1AKTA 2PUWA 3GZNA 3L79A 4MR9A 3QV2A 2Q5IA 2Y93A 4GWKA 4LXGA 4ZVRA 5PGMA 5JNVA 4KB5A 1IJKA 2HEIA 3GLFE 1F6DA 4MR7A 3M1IA 5ALKA 2MIIA 1OLSA 1ZUHA 2FSFA 2GETA 2ZI6A 3A1EA 3P2EA 5AXCA 5FBVB 2A5DA 4MA0A 5F5XA 1PDOA 3BIJA 5FPQA 3JQGA 2L42A 4P3KA 1BMFA 2OKGA 1ZVKA 2PFGA 4TL6A 1OE0A 4W8HA 1T5LA 1F14A 3OSZA 5DFAA 3MHPA 3DFZA 3VKVA 2ON6A 3AIMA 3EXFA 4B3IA 3IT2A 2XRZA 3LQQA 1ZJYA 3A6LA 3VR6D 3E0QA 5K3OA 2QVGA 4Q3CA 4MUEA 3ETHA 4XDGA 1OLUA 2P65A 2PMWB 1IMOA 3VHXB 5ALMA 1QMPA 4J2OA 4F4HA 2BFNA 1NI4B 2B34A 3KXLA 1E1DA 2B6NA 2H9AA 5IXJA 4OGLA 3P9IA 5DT2A 4RVUA 3PPXA 1NBAA 1KDTA 3DZBA 5G4KA 1NUAA 4ZVLA 1R8YA 3KQMA 4MQBA 4RV9A 4URWR 1M5RA 5T41A 5IMSA 3MHTA 3GP3A 2BTQB 2J7PA 4HDNA 4R40A 4D56A 3ZYZA 1KIAA 3NCTA 4R5HA 4E1BA 4EPTA 1WUTA 4YRNA 3H65A 3OFKA 1E7YA 2XDWA 1OSNA 3IUYA 4BATA 4JI0B 4CG3A 3DC7A 4GKAA 1T6ZA 2YYAA 4E2WA 3OFJA 2Y1GA 4N49A 4NENA 5E7MA 3UKDA 4BRSA 3EYWA 2IOHA 1PR6A 4CV3A 5E4TA 3L7YA 3LUDA 3B6EA 4EF5A 2AD5A 121PA 4MKIA 2VJMA 3TOSA 3FHLA 1SKYB 5HUJA 1OA0A 4GNKA 4QQ8A 4GD3Q 3HJGA 4JT4A 1CE8B 2R6R1 4YCSA 1U7DA 2XNSA 2BCEA 1R6AA 2R8OA 2BDTA 3GLGA 1C3EA 1G5QA 3D8TA 5ENZA 4H6VA 4EAQA 3IO3A 2FTKE 3I30X 5D3MB 4ZU1X 4D3ZA 5KJ6A 1SHZA 2O7QA 1IBCA 5DZSA 1DUIA 5AVSA 4AJ1A 2G0NA 3V4ZA 4AO7A 1IUOA 3GQBB 4Q66C 4E7OA 4DCJA 3CH5A 3CJQA 1QX4A 2B1QA 3DLTA 1TF2A 521PA 4M9ZA 5TXGA 4CCAA 5HM6A 1EA5A 1AF4A 1TFUA 4UPVA 3UAGA 2ADMA 3PUYA 3S99A 1DC6A 4M1TA 2IHNA 5AW0A 3M9XA 5CLIA 1GAQA 3Q9LA 1BSVA 3SC3A 3GD7A 3QFFA 5IP5A 2HHLA 1Z74A 3S2GA 3U81A 3BICA 4ZANA 4DFDA 4E51A 1NT2A 5CJ2A 3CA8A 4Z4IA 3FHTA 4PZPA 1DFGA 1E6KA 1AQLA 4J7XA 1EHCA 3GRVA 2PLNA 3PHBE 2BSQA 4MVJE 1L8XA 1Q0PA 1SCNE 1UJMA 4ZO7A 1TUBA 4JLVA 2WU4A 1RS0A 3ZDDA 4KNWA 3O0DA 1H6DA 4Z2YA 4A23A 2JIZD 3SK0A 1RM3A 1OR8A 4G1MB 1IN1A 2PZ8A 4Z7JA 4X65B 1ZD1A 1M73E 3IP9A 3TQIA 4HWRA 2EW2A 2UV8A 4M55A 3W5UA 4TM7A 4V24A 1DXOA 1JWLA 3HSKA 4RJKA 1E1RD 3DZKA 1NUHA 3W5IA 4C7JA 2FN7A 3GG9A 3ZV5A 5BQ3A 1XTQA 4MVJG 3JAMA 3BEOA 2BJWA 3TAHA 5EPUA 3KPUA 1LA2A 1OASA 2B1IA 2Y8EA 4WCFB 1B16A 3C3EA 1MV5A 4JZYA 4Q7JB 3RTAA 4ZMRA 1YRYE 1PX2A 3D2CA 4IXWA 4QRHA 1NUTA 4Q6WA 4RW0A 3UFXA 1MX1A 5K3SA 4JGIA 3F1LA 8AT1A 1K5GA 2O19A 1AKMA 2IL1A 1ECBA 3H5NA 2JW5A 1PR3A 1P7YA 1V8BA 4IDNA 2XBUA 3F1KA 4L8GA 1AH2A 4ZT3A 3NP7A 3R44A 4PTYA 3G49A 3RANA 4X45A 1CB7A 3I5YA 3FNIA 2VYQA 3I4CA 3ASVA 2JGMA 3P9ZA 2XMGA 1WMSA 3PSAA 1FUKA 4X1KA 4TS1A 2ONZA 3EODA 3C6MA 2EIHA 3WY9A 3Q7TA 4OB7A 5BN5B 3UKOA 4HUTA 4GXRA 3LUAA 4KP7A 5K3CA 4EM6A 4UE6A 2ZBGA 1EXVA 5IKMA 2AG8A 1PO7A 1RQRA 1O8CA 4P4SA 1KKUA 3UH1A 3W3AH 3Q3VA 2NAFA 1A9YA 5AJYA 5JDCC 3OO1A 4CEIB 3NFRA 2VPIA 4HZUA 2WAMA 2CUTA 2QTVB 4DJEC 1I51A 2X9LA 1F7VA 4KBYA 4AZVA 1RHUA 2A1IA 4UOQA 1UXIA 2ODBA 2WZDA 2WKSA 4TVSA 3KKOA 3WKAA 2ZDQA 3QKRB 1MU0A 5EZQA 3P9NA 1VYUA 5CTJA 2EKQA 4XIGS 3T4EA 2XUOA 4B32A 4FHFA 4J0CA 1KJ9A 1QK4A 1TCAA 2XCUA 3PRKE 4YMWA 2Z2KA 5JBNA 3IUSA 3DE3X 2BGIA 3FG9A 3QVOA 1U2ZA 1RBYA 4LY3A 4TLLB 5C7LO 1G5IA 2HFKA 10MHA 1B8UA 4AS2A 4BBPA 1KQPA 1MAWA 3CR8A 4PRZA 3GH3A 1YHNA 1HI9A 5FTLA 1WAMA 1X7ZA 1W19A 2HA7A 3CB4A 3I6IA 3WLFA 5F3WB 1Q6YA 1WB5A 3I9V6 4V2IA 3CLSD 3BERA 2ZTMA 4LHVA 1K5DA 1XWIA 3GGPA 3S6JA 1B2RA 3G5AA 4W6ZA 1A69A 2CXOA 4R1UA 5EZYB 4DR3B 5E1DA 3N05A 1TMOA 2AZ4A 5GV7A 5SZKB 4S12A 4DRXB 3B8EA 1JEJA 2LVBA 1CPYA 3NT2A 4WEOA 1JEYA 4EW1A 3RAFC 2WJWA 2JVIA 1N5IA 4RY0A 2I3BA 1SKQA 3O2SB 1OZ0A 4WLFA 1XQYA 2QLFA 1W2WB 2P5UA 4G1VA 2EWWA 2ATCA 1P7VA 2TRSB 2V0GA 1ECGA 1WVGA 1MJNA 1YZGA 2GBFA 1PFKA 2MR6A 2NQTA 3L8GA 1E9DA 3PFIA 3Q6MA 4LGVA 2CZQA 4XYEA 3THWB 4FYIA 4YAOA 2CYBA 4BN4A 4KX3A 4Z1MA 3L6BA 4AIIA 2PXXA 3DKIA 3VR0A 4GECA 3NHFA 4I66A 5EYPA 4M2LA 1LV7A 3HGQA 5I7SA 1SN7A 4XD7D 5IAJA 1WD5A 2A0KA 3AR7A 3VOSA 5A4DA 3O4HA 3E7DA 3E7WA 2NP7A 2C95A 4R9VA 1P8AA 2DKNA 4GR9A 4IZ6A 3ICWA 3UWSA 1KZGB 2UDPA 2VL7A 1YIOA 3UBTA 4BBAA 1QHGA 5K0FA 1Y3HA 1IN7A 5KVQA 1LVGA 2W6ID 4DUYB 4YFVA 1KS2A 1N6PA 3NALA 1Z13A 1L7VC 1K98A 1SEVA 3R5XA 3D2LA 5E7JA 2BZ0A 3HDQA 1QGOA 4D9HA 5L9AA 3DHEA 5CVCA 4K9QA 5FFMA 4QYMA 1MBZA 2IZ7A 3K32A 4QOGA 1PUIA 2WJHA 2WV7A 5GV8A 1DIBA 1V37A 4NBWA 4KVZA 4QPJC 4ZKEA 1PYGA 2VPQA 6NULA 1VECA 1Y4UA 2J4DA 2VWPA 3AFMA 3NTLA 1XXHA 2LV8A 2ST1A 1I7SB 3THXB 3BMQA 3MNFA 3T9DA 1JXQA 1UZAA 2IXEA 1VJRA 3P20A 3A3YA 3D9QX 1MABB 3NHKA 5IAGA 1OI2A 1C1YA 4Q3NA 4YLYA 2RIPA 1KEUA 2VUHB 3HJRA 5AR1A 5IK2D 4NS1A 2HU5A 3V4OA 1O9GA 2PD3A 3GFVA 4BU0A 2XZPA 4B3XA 1W5SA 2HI0A 2IPOA 2EDAA 1NC1A 2F3TA 3NVMB 1UIRA 4H4DA 1BH2A 2DWCA 3BRSA 1WMAA 1H6CA 1UODA 4FMCF 4AKEA 1Y3AA 3OPVA 1NLUA 2R00A 7ADHA 3X1KA 1I5OA 3ZQKA 3EZFA 3KJZA 3OWOA 4MA5A 1L5KA 3UGTA 4B7XA 1PR2A 2NP6A 3RLIA 1UUFA 3ST7A 3SF8B 2JEYA 1UAAA 1TYZA 2IZZA 1J8FA 5FR2A 4ENVA 3ZY6A 4QYIA 2FPIB 1IWOA 1KVTA 4O2AA 2OC4A 1EK2A 2YQ4A 3A25A 2QQEA 1NI5A 1KJIA 1GGJA 3A4IA 3X1XA 4XX0B 4YRPA 3CEAA 4JL5A 5E6RB 3URKA 3QPAA 2NO9A 1X1CA 1G63A 1HL3A 2F4NA 2XLBA 3BX1A 3QE2A 2Q1UA 4JLBA 4PYIA 4WVFA 4AWAA 4RGBA 2QAJA 4X60A 4EFLA 1C7IA 3KFLA 1TUGA 2FPOA 2H4HA 4ZVKA 1EUQA 3AEXA 2QTBA 2X0DA 5DLQC 4C4ZA 3L1KA 4QVIA 3NHZA 5KQMA 1RMQA 2RSLA 4YAFA 2Z4SA 4OK6A 3IPRA 2BMWA 1E1CB 2GJSA 4H59A 3IELA 4BC1A 3F98A 3N0RA 3DBVO 3P19A 5JALA 2GM4A 1OOEA 3AUFA 3EIOA 3VJKA 4HV4A 4QKQA 1K5HA 3TTSA 3L0OA 4QOFA 4DY4A 2FEAA 2NYRA 1DIOB 1JLKA 2P2SA 2XOXA 2Z1NA 3ODPA 5LYJA 3WL5A 2Q4OA 4U00A 1CY6A 4C0XA 3FTCA 1BVRA 5BN4A 1I7PA 1W36B 3UW3A 1YASA 1OZGA 1QE3A 4ND8A 4RD0A 5IUNC 3D6MA 3Q7QA 1P60A 4N7BA 4KN5A 3SYNA 1VC2A 2HMTA 3HR4A 3SZOA 1NDUA 4Z2AA 4DCTA 3HCEA 4V0ME 4RDXA 2ZTVA 4CCYB 2FLVA 3HKCA 3EMKA 4XCQA 1UM9B 1Q3HA 1SXJC 3LI2A 1J21A 2QX4A 1UT5A 2BP7A 3FFWA 1M2VA