3JQAB

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-1,9-dihydro-6h-purine-6-thione (dx4)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 91
structure length 247
sequence length 267
chains with identical sequence C
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqaB00
4B4WA 5TLSA 3PTZA 4BQRA 3H2SA 3DBLB 4LMPA 2I76A 2PD3A 2C20A 4H7PA 3D5TA 4CM4B 5A06A 4DIFA 1UZNA 5G0VA 3OIGA 3DL2A 4CLHA 3AUAA 4P4LA 3H5AA 1JU9A 2DC1A 3INGA 2FOIA 1E6EA 3KYBA 4JJFA 1QLHA 1D3AA 4PFJA 4CM3A 2DKNA 2EWMA 1I32A 4XR9A 5JAIA 1IOLA 1CETA 1O95A 2VOJA 4M87A 1E3WB 3C1AA 3MJSA 4IBOA 3H9UA 4U6SA 4AJIA 1Z7BA 1IYZA 3LZ6A 5JXWA 5EERA 5JW6A 4TRMA 3IIEA 3V2GA 5C3MA 4BNHA 1NQAO 1YJQA 2ZB7A 2H1SA 3ADPA 1TI7A 1VC2A 1U7HA 3RSHA 3WSVA 4OHUA 1JW9B 1QYWA 4O0LA 4QFCA 3KEOA 4IPTA 4Q3BA 3UHAA 5CEJA 1Q0LA 4I5EA 3F5QA 4F6LA 1NVTA 3WIDA 3DHNA 2YV1A 2I5PO 4WLFA 1YDWA 1WWKA 4CLXA 4UEOA 5CG1A 3RUCA 1UXJA 3DDNA 1WNTA 1Z7EA 1Y9AA 3FR8A 4IIVA 4LGVA 4QX6A 2P91A 4GX2A 5K6AC 2X8LA 4MIEA 3CMMA 4FFLA 3NYWA 2HRBA 5BT9A 5KIAA 1XSEA 1QV6A 4GKBA 4L76A 2G1UA 4JROA 3DZJA 3PWSA 3V5NA 2W2KA 3QJ5A 3ZWCA 4BO9A 3RASA 4CV3A 1R0LA 3CEAA 4RJTA 4GGPA 3PI7A 4RPLA 5KVSA 4WCFB 2ZYAA 3TQHA 3HN2A 3EVTA 1GU7A 1DC6A 3I9LA 3TPCA 3EZLA 3E9MA 5FYDA 4DRYA 5CDGA 4XYBA 3KHUA 2B36A 2ZTVA 3EGOA 3E5RA 1NYTA 4PVDA 1NFRA 1U3UA 4KQWA 3I9MA 3TZCA 5IXYA 2Q2QA 1R4MB 4E4YA 3JQBA 4ND2A 4XKJA 4CV2A 1F12A 5EQFA 3LDHA 2NU9A 1TLTA 4ND1A 1EEHA 2FPPA 4UVDA 1HDYA 5COQA 7ADHA 2XF8A 2DAPA 5CFZA 3FNFA 2Y1GA 4BVAA 4RF2A 4XA8A 4YYZA 4BO0A 4GGOA 4O59O 5A5FA 4PZDA 1HE2A 1KOLA 1PTJA 3NTOA 1B8VA 1ZSYA 2E49A 1NAHA 2QYTA 4IIUA 1HDXA 2GSDA 2NVBA 4YRAA 3E9QA 4B4OA 5T6BA 3JQAB 1HF3A 5MGBA 4PGFA 2YDXA 4IJKA 2EERA 4GVXA 5EIOA 5FI5A 1EVIA 3WGOA 4KP7A 2FN7A 4A7PA 1M66A 3HDQA 2A4KA 4D41A 3BMQA 1Z6ZA 2SCUA 4IQ8A 3I23A 5FEUA 3ZU4A 3JCZA 3JQ8B 4OMUA 4E0BA 3JQCA 2O3UA 1E1NA 4BNNA 3Q0EA 2DBZA 3DFUA 4P22A 4NK5A 4WE3A 1RM5A 5IDXA 3NT5A 3CMCO 3F4BA 3T7CA 3ENKA 2PH5A 1MV8A 4HXYA 4E21A 3ZHZA 1GUYA 2Z95A 3LC7O 3RJ9A 4CM5A 1P33A 3W4KA 1LDNA 1JVSA 4Z9FA 1YDEA 4UVHA 2ZKLA 4CMHA 4A0SA 4JP3A 3KOUA 1KERA 2O23A 1GPJA 2HMTA 1U3WA 3ON5A 3I5MA 4HBGA 3TSCA 1K0UA 2C54A 2FR0A 4FOOA 1YXMA 3JQ6A 4ZQHA 1NAIA 4J49A 3DO5A 4L4SA 2PKQO 4EEZA 3AFMA 1NQOA 4I5GA 5CDSA 2LDXA 1FXSA 4IS2A 2OHXA 3PPIA 1T2DA 3S1LA 1TB4A 3VTZA 3AY6A 3F1LA 1KVUA 3H9EO 3P5SA 1ZK3A 1TXGA 3QQPA 4ND3A 4OXYA 1M2WA 4W4TA 3RKRA 1GYPA 1J0XO 2W90A 4IDAA 1A27A 1H94A 2X5OA 4IDBA 4EITA 1ZJZA 4LCJA 4A03A 1BHSA 1T25A 2NQTA 3INTA 3AW9A 1D1TA 2ZJ0A 2EHDA 4NDNE 4UVGA 2FPIA 2JAPA 2QRJA 2V7PA 4RPGA 4YDRA 4GVLA 1GAEO 2Y1DA 4NFSA 2QZZA 3QRWA 1RJWA 3HZZA 1AXGA 5JCJA 2WEKA 1NPTO 3VDRA 3C85A 1PIWA 2G82A 4CLRB 2JCXA 3DQPA 3WGIA 4W82A 5KNLA 3CTMA 3KLMX 2VWPA 4TRRA 2PKRA 3NT4A 4YPOA 1J5PA 1YJ8A 2DBQA 3RUAA 1EE2A 4QUKA 3JSAA 1NNUA 1LSUA 4YAJA 1T2EA 3SC4A 1E1KA 4WEOA 3KZVA 4M1QA 1FDTA 3C8MA 2DFVA 3C7CB 1DC3A 1V6AA 3ZWYA 5I7SA 4R9RA 3SBOA 5BSGA 1E7RA 3PYMA 4QTZA 5T57A 1P1JA 2YZ7A 1UZLA 3LT2A 2GUGA 3TZ6A 3V2UA 1EMDA 2VUSA 4J7XA 4K9DA 4ZHSA 1PZEA 1Q7BA 1GCUA 2B4QA 4AJEA 1A7AA 1B14A 4J4HA 3U49A 1ZCJA 2ZQYA 3CH6A 5U9CA 3NX4A 1MB4A 3DBHA 2PZJA 1OOEA 4CMKA 3TFOA 1ZNQO 3MJEA 1KS9A 4K6FA 4ZU3A 1B15A 3U4HA 4FJ0A 2DTXA 3JD3A 4CV0A 3AJRA 3ROQA 2G76A 2RHRA 3W4JA 2PD6A 2YUTA 3B1JA 4FC7A 4O1MA 4WOJA 4OGWA 2Q49A 3PHLA 3D4NA 4CJXA 1EK6A 2JFHA 1EUCA 2X23A 2BFOA 2VZ9A 2X9GA 4D0RA 2HJRA 3PVZA 3VH3A 4GMGA 4YT4A 5I7VA 1WDKA 1T4DA 3OECA 1ENZA 3BXXA 3EDMA 3ONFA 3Q2IA 3QVTA 4J1QA 3VVCA 3AM3A 2EW2A 3VZQA 4J3FA 3V2HA 3C1OA 1LSSA 4HY3A 3ZU5A 3ZWXA 3EVNA 4LISA 4AICA 2O50A 5CDTA 3HJAA 2RHCA 1CIVA 3UOGA 2AXQA 1WXDA 4OM8A 5DOVA 3KSDO 1QMGA 1V0JA 1HRDA 3HB4X 5JC1A 1JKFA 3E8XA 2J3JA 3EW7A 3PJEA 3WYEA 4MKZA 3RAJA 4U0JA 1T2FA 3IQDB 3ZWBA 4CMIA 1VJTA 3FR7A 1X1TA 2NU6A 4L4XA 4KZPA 4GX5A 4W9NC 4NFYA 4NBUA 3IJRA 1H93A 2JCYA 3HUDA 3PHGA 1ZBQA 4OH1A 5IDYA 3FBGA 4Z0PA 4B3HA 2NTNA 4FSHA 3CKYA 4HFMA 3V1UA 1KC1A 1N92A 4GMFA 4EJ0A 4EUFA 1PWXA 4L8VA 3HDHA 4OQYA 5KKCA 3SJ7A 1MFPA 1B3BA 2OOSA 2B0JA 1C0KA 1KIFA 1DIBA 3QVSA 5H83A 2NVWA 3RBZA 4CM9A 3KYDA 3QW2A 1ENYA 4OO3A 1AN9A 2AE2A 2OP0A 1BXKA 4A10A 4CUZA 4PCVA 3NDJA 3U62A 3BTUA 3FCOA 4J43A 4DXHA 1PL8A 3PDUA 3DAFA 1NTOA 1I2CA 1KEVA 5I9LA 1E7MA 1ZKMA 4DPLA 4DIOA 1EVYA 4NU6A 3ROMA 5F3RA 4E5MA 3LK7A 5JE8A 2Q50A 2VHZA 3Q3CA 4F45A 4DLBA 2OUIA 1D7OA 2V6FA 2GN9A 3Q6IA 4Y98A 4EGFA 2CDBA 4NJMB 2Y1OA 2DUUA 5AXCA 1ZIDA 4YRDA 1X0XA 3CPSA 1YB1A 2O3RA 2WJPA 1DSSG 5G4LA 3VDQA 4TWRA 3NGLA 1YQGA 2O4UX 3KVOA 4OIMA 1DC4A 3S2EA 4BGVA 4BMNA 3IKVA 3JYOA 4LSMA 5TJ9A 2UVDA 3UCEA 5F21A 3MWEB 1HETA 2OORA 2VYVA 4I9UA 4MVJA 1W4ZA 2X6TA 2BGLA 2BI7A 5IXSA 3PJDA 1U8XX 3F5SA 2UUOA 2VWHA 3JD4A 4GL4A 1T4BA 1VJ1A 1OFGA 3WLFA 1Y8QA 1Z74A 1G0OA 3MJCA 3Q9NA 4ZJUA 4K26A 3GR6A 3ROPA 3RD5A 3V1YA 4GLOA 4Z3KA 3MCVA 2PGDA 3VZPA 2WE7A 4UAGA 1VE9A 4E2YA 4PN3A 4F46A 4XIYA 2IEBA 4ND4A 4JP2A 1EK5A 3LT4A 3NDRA 1JQBA 3WJ7A 5DCYA 2J5RA 4AJJA 3UCFA 2OZPA 5F1PA 3GVXA 4J90A 3TRIA 1PGNA 3GHHA 1C1DA 1PR3A 3LYLA 4NQZA 4BL5A 1UP7A 4LCEA 1K2WA 1YE3A 2VTDA 4MVJF 1JVBA 4BGUA 4ALNA 1KEUA 4F3YA 4QSMA 3D5QA 2R2GA 1V3TA 3JQGA 2C07A 1W0CA 5DCWA 2O4CA 3UH1A 1RYEA 3RQSA 3U3XA 3PQEA 2CDAA 2BFPA 4WECA 3D0OA 5IDQA 3INRA 1YQDA 1P44A 1E3JA 1Q7GA 4BO4A 4Q3NA 2CZCA 2YY7A 4ZN6A 2GZ3A 5TX7A 3NUGA 2YDYA 4CM8B 1X14A 8ADHA 3CIFA 2FPGA 3D3WA 3LU1A 4IMPA 4HX5A 4NBTA 1JWAB 1ZMTA 4ZA2A 4R5MA 2C82A 1B8UA 1UH5A 4B3JA 5BNFA 2XAAA 2Z5LA 3PDJA 4MKRA 1UAGA 2GYYA 2X86A 3WX0A 1PJBA 4D3DA 1E0DA 5L45A 3GC6A 2C5AA 3ZNNA 3L4BA 1GFSA 3HADA 1XEAA 5EL0A 2DTEA 3W1VA 2PLAA 3PFWO 3L9WA 1VSVA 3PJGA 5JDCA 1LI4A 1Y81A 2IXBA 5LCXA 5A3JA 1X15A 2P5UA 4RF5A 4XYEA 4DQXA 5L7WA 3RU9A 4CODB 1WVGA 4JBGA 1A7KA 2G5CA 3KLPX 3TF5A 1B7GO 4R68A 3GNQA 3AI3A 2GERA 1F8GA 5L4SA 3FF4A 1O5IA 5L51A 3TL2A 1XU7A 5B12A 4Q3CA 2ZJ1A 3CZRA 3PWKA 1X7GA 5KVQA 1V8BA 2R00A 2GD1O 3NEPX 5MDHA 4NU5A 1ISJA 3AY7A 1PL7A 3BA1A 3C7AA 4JX8A 4R1TA 4YJDA 4ZQGA 1X0VA 2X9VA 3K5PA 4GAEA 5CAEA 3PJFA 3QE3A 2E37A 4XD2A 4XWYA 4BO2A 2YHIB 4R9SA 4P4NA 4CM1A 3WJAA 2ILTA 1H2BA 1I3NA 4EDFA 3HDJA 3OQ1A 3W6ZA 2CF6A 3JQ7A 4MKXA 3KB6A 3OF2A 5ES3A 1BDMA 2QRLA 2B5VA 1YOVB 1SZJG 4EYEA 3HB5X 2P2SA 5THQA 5C5IA 4D7AA 4JXKA 4YQZA 1LLUA 1VL8A 4OYRA 2X0RA 3RU7A 1IB6A 2OP1A 3G1TA 4TVBA 5T67A 3ZV6A 2D5AA 3GGPA 4WK6A 4RGBA 3OQ6A 1PJ2A 5L7YA 3Q1LA 2P9CA 1MP0A 1PR9A 2DBVO 1B2LA 1P74A 1WLYA 1LSOA 1PGOA 1RPNA 3RC7A 4G2NA 3ANLA 3R3SA 2ZTMA 5H81A 1MGOA 2ZTLA 3GRKA 2Y05A 3OICA 4OKNA 1VL0A 2X0JA 4GH5A 3JYLA 2XOXA 3D3EA 2WYUA 1HYHA 1N9GA 4IDGA 5J23A 4J9UE 3AI2A 3O03A 4KMSA 4Z0HO 3VZRA 3WGGA 4MPDA 2B5WA 2YV3A 4FQ8A 3QWHA 4DL9A 1U3TA 3BMOA 1R12A 5CG2A 2AEFA 4BNMA 3OA0A 4II3A 1X1EA 2O2YA 4DMLA 2P68A 3H7AA 5JCJD 3GZNA 1DBVO 4WJZA 5IFLA 3RFTA 3UW3A 2NQ8A 2NTVA 3CINA 1DFIA 1JWBB 2W2LD 4RVDA 1HYGA 4CLDA 4PLYA 3T7EA 1RWBA 3ZWAA 1HT0A 5JO0A 4PLHA 4K1LA 4NHEA 3WIEA 1T2AA 3ETGA 2C7GA 2GRAA 4IM7A 4N54A 1ARZA 5JO9A 3JQEA 3D7LA 2ZB4A 1KY4A 3E03A 1NPYA 2GN8A 5DN9A 4ALLA 1A9YA 3L6EA 4TRNA 1HWYA 1QLJA 5BNTA 2DVMA 1GDHA 4J6FA 4XQCA 2VHVA 4D46A 5C7IO 3K73O 1KC3A 1Y8RA 3BYZA 3IC5A 4PLGA 1HEUA 1NR7A 2I3AA 2IZZA 2HUNA 2I99A 2QX7A 1YB5A 2NM0A 3KXDA 1E6UA 1TVEA 3QWAA 1I3LA 4LN1A 4XB2A 3H2ZA 3BMNA 4KDEA 4B8WA 2BLLA 4OJNA 2HMWA 3WICA 2Q1SA 3PHIA 1Q2XA 4TMFA 2DBRA 5CPBA 2NNLD 3E9NA 5F1OA 1Z75A 1U4OA 3JQFA 2O3SA 4YJGA 4ZRNA 4O6VA 4RDHA 4BIIA 4AJOA 1P1RA 4XJSA 2PNFA 3ICCA 2WMDA 4E12A 3B70A 1LTHR 4Y6PA 4RVHA 4QFDA 1S6YA 4WLNA 1YBMA 2PKQP 3OSUA 3H3JA 3T4EA 3F4LA 3GHYA 5KVCA 4MP6A 3K30A 5BR7A 3NDIA 1GTMA 2ZYDA 4N18A 3TZKA 1H5QA 3PZBA 5FF9A 4A2CA 5L95A 4WNCA 1UP6A 4FPXA 2VTEA 1YQXA 3GZ4A 3AY3A 4H16A 2GGSA 1BXGA 2FWMX 1EDZA 3MZ0A 2EW8A 1DEHA 4BS9A 3TNLA 4E31A 1B8PA 4YQYA 1B3RA 4NJOA 4W9NA 1SEPA 4IXWA 4L74A 4MP8A 4Q9NA 3ZH2A 3DEYX 4BGEA 5TC4A 1N1EA 5CPFA 2HJSA 4JGBA 3DBRB 2WDZA 1GADO 3MOIA 1FDSA 1H6AA 2EF1A 2HRZA 3H3FA 1H2HA 2V6GA 2WWRA 4FFOA 4IDDA 3DONA 4YCAA 1LQTA 3ZHYA 3QWIA 4EZBA 2E82A 2AQ8A 3MJ4A 1MC4A 3BMQB 1GEEA 3AM5A 1E3SA 4IDEA 2FZWA 1SEVA 2PGLA 4I1IA 4RQUA 1LC3A 1QSGA 3AFNA 3M2PA 1LRJA 2YQ4A 4A5OA 3SC6A 4YAGA 2B4TO 2HLPA 1P77A 3GRPA 3WLEA 3TN7A 2VHYA 1PGPA 4DPMA 4ZQFA 3F1KA 1G1AA 1PZHA 3VH4A 4CM9D 2BD0A 4DTIA 4R16A 1I5RA 1PS9A 4GWKA 2PWZA 1LRKA 1O94A 1HZZA 2PTGA 3M2TA 5HA5A 2PA3A 4J7UA 3I6IA 1O8CA 1OMOA 1A71A 2OL4A 2WYWA 2AEMA 1X7DA 3DB2A 1HSOA 2PY6A 4I5FA 4R4JA 4D3SA 1YRLA 2CUKA 3ZDFA 5JC8A 2O48X 1ZEJA 3RBXA 1XLTA 4ESOA 2WD7A 2Y0DA 4XYGA 3S2FA 2RIRA 3L4BC 1NP3A 2D2IA 2CY0A 3KV3O 3GVPA 2HAEA 2GZ1A 3CUKA 2I65A 2DM6A 1ISFA 5JDCC 5I7EA 1T1RA 2AE1A 4RVGA 5L4LA 1PQUA 1HYEA 2CVZA 1I3MA 1QP8A 3ASVA 4D44A 1NR1A 3I9OA 1IL0A 4O5OA 2WD8A 1ML3A 3BIOA 1DHTA 3C24A 3NJ4A 1SMKA 5CEFA 2W4QA 2NACA 1NVMB 1JKJA 3TZQA 3GDOA 1HTBA 2ZIZA 3PFFA 4YWJA 3GUYA 2VUUA 4B4UA 5IZCA 4M8SA 2R00C 4CPDA 2C5EA 4JK3A 4MJLA 2P9GA 2VYVD 4MVJD 5DNAA 4MVJP 4RCVA 1I01A 4YXFA 2EEZA 1UAYA 4TKMA 4YAKA 2HU2A 3GNSA 3SXPA 3DXFA 4X54A 3ZN2A 3WDSA 4I8XA 2CVOA 1BVRA 3Q2KA 1LNQA 1R4MA 2PZMA 1WAMA 3DMYA 3KM0A 4WLVA 5C7LO 1ISGA 4OQZA 4WNIA 3D1LA 4JCOA 3A4VA 5A5EA 1GV1A 3TFQA 4BB6A 1V3UA 3BHJA 3DOOA 1XELA 3DMTA 4FS3A 4RPKA 3GMDA 5DOZA 2QRKA 3FPLA 4XRGA 1GUZA 3HN7A 4D42A 2I66A 4E5YA 4BO6A 1XU9A 1SO8A 3I1JA 4BNYA 1H0KA 4NI5A 4PRLA 2O3QA 2X22A 3UKOA 1AGNA 1B26A 4MO2A 3WG9A 1JKIA 4CR8A 4UUNA 3LF1A 4IY1A 1I2ZA 2Y93A 4XDYA 1A4IA 1P45A 3DBHB 3BMCA 3EMKA 4L0QA 1PJCA 4PLTA 3AUTA 1P1FA 3GGOA 3JQAA 4J1SA 2J3HA 2H63A 4B8ZA 5JMPA 1P0CA 3WQRA 4DUPA 3QWFA 4W7IA 4A27A 3GUCA 4FDAA 1EUDA 3UCXA 3RIHA 4RQTA 2Y1EA 3N74A 3QVXA 1PQWA 3NV9A 2W2LA 2BHLA 2YV2A 1YONA 1Y1PA 2EKQA 2B37A 4NBVA 2VUTA 3D64A 4KTTE 1A72A 1SCUA 5KJFA 2EP7A 4IS3A 3SEFA 3QY9A 4BQPA 3JQ9A 4L9RA 4UULA 4BNUA 1LA2A 3HFSA 3I6QA 5B1YA 1GUFA 3GMSA 3DHYA 1ZMOA 1XYGA 3B6ZA 3JD1A 2XXJA 4FFPA 5FWNA 1DPGA 1DC5A 3E18A 4CQLB 3OEYA 2ZYGA 3IP1A 4MOWA 1DAPA 4LVUA 1R15A 3JD2A 1DO8A 3VHRA 1LSJA 1Q0HA 2Q2VA 3ONEA 2Y66A 3HNPA 5HS4A 2ZB3A 1MX3A 3L6OO 5B4VA 1N5DA 4FBGA 4TVOA 3N58A 4M54A 5IJZA 4JBIA 4JN6B 3U4IA 4ONEA 5EN4A 1DAOA 2Z1NA 1C14A 5JYDA 1ID1A 4YBZA 4XR4A 3I4CA 5THKA 2HK7A 1EFKA 5TF4A 4PLZA 5ER6A 4FB5A 4DQVA 4IJWA 3MOGA 1QG6A 3FWNA 1EQUA 5L40A 5L3ZA 1JTVA 4LMRA 1D1SA 1WZEA 3JQFC 4HFNA 1QYDA 4WLOA 3ZI0A 4XYLA 1K6IA 3EC7A 4DMMA 4BNXA 5DBFA 2IDZA 3P2YA 3I3OA 2JFGA 1OC4A 3OBBA 3KYDB 5ITWA 1I3KA 3O26A 5L53A 1WZIA 2R6JA 3GOHA 3AI1A 5A05A 5G4KA 1CRWG 1T2CA 4DC1A 2B83A 1MXFA 1BWSA 4DVJA 4YACA 3VKVA 2H9IA 4NZ9A 5FFFA 3DZBA 2NV6A 4B79A 2GPTA 1LX6A 4XIJA 5U1PA 4CLEA 3O9ZA 1X13A 1VPDA 1HL3A 4YVFA 4E3ZA 1NASA 5AXAA 5GZ3A 4LK3A 1PEDA 4I9HA 3VOSA 3DZKA 2OFPA 3HQ4O 1GZ4A 3PLRA 1UXHA 4GX1A 1CJCA 1GYRA 3GNTA 2JD2A 5DP1A 3RUFA 1JN0A 1C0LA 4YAEA 3RBVA 1V9LA 4WLUA 1XDWA 1NXQA 4WEQA 1E7SA 1PJSA 3AUSA 4BKPA 1GEGA 4RO0A 5EPOA 3RFXA 4NIMA 1F0YA 5T64A 3GDFA 2HSDA 1LJ8A 4GX0A 2D4AA 4R3NA 1YH3A 4YJFA 5KWEA 2GLXA 3GEDA 5GZ1A 5COAA 1M76A 4FD3A 1FK8A 1SB8A 4KUHA 2GN6A 3ORFA 2AQKA 4XZ3A 4J9VA 4CQMD 2EJVA 1Y8QB 4YB8A 1ZK1A 4JLWA 4J0EA 3PYXA 5DBGA 3FTNA 2Y0CA 3ICPA 4W99A 3WMWA 4ALJA 2UUPA 5CEEA 2J5KA 1LLQA 2BELA 4I9NA 2VYNA 4MIOA 2JCVA 4PG8A 3WNQA 1EZ4A 3DZGA 1HKUA 2CF5A 1JDJA 4QQRA 4RZIA 1EVZA 1VI2A 1PSDA 4QO7A 4YRBA 1T24A 4PVCA 1GPDG 3AUUA 1C1DB 4DA9A 1H6DA 1BW9A 1E1MA 3CSDA 4D45A 2EP5A 1O89A 2WE8A 4J16A 5ER9A 3LQFA 1P9LA 3FI9A 1SC6A 4I08A 2NVUB 3UFXA 1NPDA 4XCVA 2AW5A 1E92A 1G6KA 5G0WA 3OMLA 2BFAA 4AJLA 2GF2A 9LDTA 2Q3EA 3H6KA 4URFA 3OJOA 3DOCA 3HG7A 3ZW9A 3JV7A 3PRJA 3SJUA 4IGFA 1A5ZA 1VRWA 2DLDA 3ETDA 5ENVA 1EE9A 1UXKA 7MDHA 5IZCC 4WCFC 4MIYA 1ZXLA 5IG2A 4GLLA 1MLDA 4M49A 4ZD6A 5BSEA 3H65A 2Y1FA 2J6IA 2W98A 1XR3A 3D3WB 4FJ2A 4DWVA 5KJ6A 4RDIA 1LDYA 2B4RO 2AQHA 5G0TA 1PS8A 3ZWVA 1Q1NA 4AJ4A 4BO5A 4YAIA 1LRLA 2CMDA 2QQ5A 3SLGA 2AHRA 2YFQA 3OIDA 4FIZA 4R51A 3GLQA 4HWKA 4XRRA 4JNKA 3WR5A 1DRVA 3A14A 3COSA 1C1XA 1U8FO 3BTOA 2HK9A 3MEQA 3U9LA 2BGKA 3PEFA 5A9SA 3H9QA 4CL3A 3PK0A 2AEJA 5I7FA 1IUKA 3DMTC 4TROA 3WB9A 2QZ9A 1QYXA 3RI3A 3B1FA 3RUEA 2CFCA 1OZAA 4H15A 1NHWA 2J3IA 4B3IA 4BV9A 2P4QA 3ANNA 1CYDA 5F1KA 4IXTA 1M67A 2Y0EA 4NJMA 1B16A 2NTJA 4P8RA 4TRJA 4IGEA 1NVGA 1PWZA 2JD0A 5HS6A 2ZK7A 2PK3A 1HE5A 1GQ2A 2DTDA 3ANMA 1NQTA 2IZ1A 4J2OA 1CERA 2VNAA 3ZW8A 4BMSA 4FJ1A 1O0SA 3X2EA 1M6HA 4II2A 4HV4A 4UVIA 1DFHA 4PZEA 1R4NB 2PZKA 4NPCA 3WMXA 4ALIA 2VOEA 1Y5MA 1CDOA 1P1IA 1H6CA 1PJTA 2QIOA 4G5HA 1CF2O 4G65A 3LF2A 1OAAA 5IN4A 2FR1A 2VZ0A 1HDCA 2H6EA 2Q99A 3DZFA 3UUWA 1ULUA 1KEWA 3KEQA 3MTGA 2G17A 2C2XA 2C2YA 1I24A 2Q1UA 3AU8A 3JQ7B 3FTPA 2YJZA 3JQ9C 4BGIA 1OC2A 3VPXA 1LDEA 1K89A 2O2SA 4P4GA 4CLOA 2CDCA 4BMVA 2HKIA 1ZK4A 1H6BA 2OBYA 4D43A 1BGVA 1YWGO 2J5QA 4L75A 4LVCA 4PG5A 4H3VA 4PRKA 3JQDA 1K6XA 4ZVVA 1ZFNA 4CMCA 4N5MA 4MVJM 3ITDA 1I10A 1GZ6A 4IJVA 5ITVA 2BI8A 3O8QA 2V6BA 2FZEA 4D0SA 4BNLA 3NJ8A 1O6ZA 3GT0A 2EGGA 3ZHBA 1YS4A 1XQ6A 2FHSA 4N5LA 3K9QO 1EUZA 2WTBA 3ZHXA 1D8AA 4A26A 3CZMA 3ZNPA 4R3WA 1U7TA 2JAHA 3E48A 4BNJA 1VLLA 1N9GB 3E5MA 4MVJI 1DFGA 1MA0A 1UZMA 1WMBA 4GWGA 4YR9A 3BZUA 5JAQA 1FJHA 4CMJA 3L07A 2YHUA 3VC7A 3GFBA 1KVQA 2VCYA 2YQ5A 3BMOB 4B7XA 4E6PA 5IF3A 2JJYA 1QYVA 1ZSVA 5JLAA 4J0FA 2GN4A 2GDZA 1E3LA 1F14A 1NQ5A 2DT5A 2C7VA 4XGIA 3QHAA 1AHIA 4LRSB 2BRUA 3HDYA 4AG3A 2VN8A 1RKXA 1EFLA 3WGZA 4QT0A 3ZGYA 2POQX 5AOVA 1TT7A 2Q46A 4Z6KA 1E3IA 3ADOA 5KCZA 3DZIA 3QWBA 4IZHA 3AWDA 1CWUA 1M75A 3KYCA 2VRBA 4W7HA 4R5HA 1ONOA 3OETA 5LDHA 3QV1A 2X7HA 2I6TA 2Q4BA 4FR5A 2GO1A 4JQCA 1ZSNA 2Q2WA 1I2BA 3FNHA 1LXCA 4E13A 4RF4A 2OXIA 4BO8A 4WOKA 5CP8A 5DZSA 4BV8A 2IRWA 3W4IA 3QVOA 5DDIP 1U5CA 4UEJA 4OKIA 5CDYA 3PQDA 1B0AA 2EIHA 1UDBA 2D1YA 3GA0A 4ALKA 2BKAA 3P7MA 2VNSA 1SPXA 2VHXA 4B7UA 4DYVA 5ADHA 1L1FA 3RC2A 3DC2A 1XCBA 3WSWA 2GNAA 2NU8A 4R1SA 3BMNB 3P2OA 1QXSA 4BO3A 3JQAD 5KTKA 3IOYA 3D4OA 1ADBA 4XX0A 3UVEA 3RROA 3STHA 4AJHA 1FDUA 4CQMA 5JNLA 4YJGB 1FMCA 4J4TA 1ZVMA 3O38A 5KJEA 4AJ2A 4TZKA 2JFFA 4IDFA 4DQUA 3PGXA 5IAAA 1DOHA 5TRTA 3OJFA 1NX6A 5K0ZA 1MXHA 4JBHA 5JAZA 1DLIA 4YJHA 3Q11A 4JJGA 3DFZA 4G81A 1EVJA 3GDGA 5GY7A 1PGQA 1YOVA 3ZWPA 2BFMA 1QRRA 1HLPA 3G1UA 3VAZA 3L4SO 5A02A 3H8VA 1BXGB 1IY8A 1ISHA 1I30A 1IE3A 2ET6A 1OI7A 1EBFA 4YTEA 3FNEA 4RORA 4GI2A 4RPJA 1ZK2A 1F8FA 1LDBA 1N8KA 4RZHA 2CD9A 3OM9A 4M89A 4U6QA 4XQEA 2Q45A 3IJPA 3LT1A 3I83A 2P9EA 3GPDG 2W2KB 3ENNA 1G0NA 1Z73A 1IULA 5I9MA 3UAGA 3W6UA 2NU7A 2B69A 3AU9A 3VPFA 4AJ1A 2FSVA 4QO8A 4FFMA 1LC0A 4XB1A 3ZV4A 4PLPA 3IMFA 4TSKA 3QSGA 5JYEA 2VWQA 3EAGA 4OL9A 1GY8A 1LLDA 4M86A 3GY0A 3H5RA 2ZCVA 2NUAA 3ITKA 2HO5A 4BNIA 3WXBA 4Z9YA 2OGUA 1Z45A 4DLLA 1ZZEA 2IYPA 1ENPA 4CUKA 5TT0A 5EQDA 4R01A 1TT5A 1SOWA 3U5TA 4EEXA 1U2DA 2NADA 5LC1A 3N7UA 4GPD1 1BSVA 4IQGA 2O7SA 4KDFA 3W8EA 3R0IA 1J6UA 5JS6A 3ZNOA 2F1KA 3ZZNA 3AM4A 2OBNA 4K28A 1ZW1A 3BTSA 5TSDA 3ABIA 4HKTA 3TDKA 1P3DA 5B37A 4NH4A 2A94A 4ZQEA 3KUXA 5L4NA 3G79A 4J1NA 2WYVA 1KVRA 3I52A 4PLCA 3D4PA 3K8ZA 3PHJA 3W8DA 3KO8A 4UEKA 2WD7B 4BUCA 1W73A 4GQAA 3DBLA 3DZHA 4TZTA 5HBRA 1H9AA 3EK2A 4CM4A 4NBWA 3K6JA 1P31A 1BVUA 2G0TA 2B35A 3UF0A 4UUPA 4OOFA 2J3KA 1L7DA 4DIBA 4EI2A 3GPIA 4FGWA 4NG5A 1LQUA 1IZ0A 5DF1A 6LDHA 3OJLA 4KUGA 4UUOA 3VPHA 3BHIA 2Q4EA 4F6CA 1E3WA 4D3FA 1P0FA 4NBRA 2BF7A 3HE3A 4YT8A 2EKPA 1ZEMA 1YL6A 2I3GA 1BMDA 1U1IA 3NT2A 4BO1A 4DGSA 4FC6A 3HHPA 3ZV5A 2TMDA 4BNZA 1TEHA 4HNHA 1ADGA 1IHYA 3DHEA 3VZSA 1P1KA 8LDHA 1Y7TA 1PS0A 1VSUA 3AOEA 4Z0TA 3RWBA 3CE6A 3L77A 2XXBA 4HUJA 4PLFA 4XGKA 4Y6SA 4IMRA 1UJMA 4FOSA 5A1TA 2ZATA 3UGKA 2RH8A 4E5KA 3RKUA 4RVUA 2HMSA 3F6YA 4U0KA 1NWHA 4IINA 4M55A 3C3XA 2E6UX 2ZTUA 2VYND 4QXMA 1BRMA 3NGXA 1SAYA 4RL6A 4Y8VA 4ND5A 3VKUA 2Q1TA 3UICA 1BXZA 1VJ0A 3E6AA 5A4DA 1TA4A 1I36A 1N7GA 3WYBA 1HDZA 1ZJYA 3DBRA 5GMOA 5JY1A 4A73A 3BMCB 4KOAA 1ULSA 5L7TA 4WCFA 3GEGA 3ST7A 2I9PA 4HP8A 1FDVA 3PLNA 1QYCA 3ZNQA 4CMGA 2IEDA 2VZ8A 1GQYA 5AYVA 1KBZA 1EBUA 4WLEA 2UYYA 5JDIA 3LC1O 1Y9EA 2FRDA 4BKUA 1E1LA 3WQSB 1P1HA 5T8KA 3R3JA 5A9RA 5JFOA 1HXHA 3I9KA 4D79A 5EJ2A 2OO5A 3C7DB 3PHHA 1NFQA 3GN1A 4DBVO 1AHHA 1UDAA 3BTVA 3WGHA 1YB4A 2JKVA 4EW6A 3PQFA 2A92A 4J7CA 2FMUA 4N5NA 3S55A 5BQFA 1YL5A 1E7QA 2WSBA 3LLVA 1GYQA 1HDOA 4CMAA 5CDUA 4QEDA 1I33A 2Y1CA 3A1NA 4XQ9A 2IODA 5AQ1A 2UAGA 4HNGA 1HSZA 1DLJA 2GASA 4WASA 2XPCA 4FN4A 3ZWWA 4MINA 1WPQA 4B4VA 1SBYA 4PLWA 1R37A 4BNTA 4BOYA 5TIIA 5TT1A 1EQ2A 3IS3A 3OP4A 1DHRA 2I67A 4BKRA 3BAZA 5KVVA 2WM3A 2HMUA 3H4VA 3JQ8A 1E77A 1W8DA 5IN5A 1JAXA 1GV0A 1E6WA 2Y67A 3FHLA 4FW8A 1VKNA 4GSKA 1U4SA 4UVEA 3MJVA 3WBBA 3UN1A 2EJWA 2IYOA 4BNKA 1LBEA 4Y67A 1K3TA 4CM7A 2LDBA 3IAHA 4EBFA 3GVIA 1SNYA 4J2HA 1MC5A 4INAA 4C4OA 3AK4A 3IDSA 4BNGA 5I8WA 5BNIA 1GR0A 1DRWA 2O7QA 5AVOA 1XA0A 1LLCA 1WDMA 4E2XA 3GF4A 1PJQA 3WS7A 3WGYA 1M6WA 1RM0A 1KYQA 4KWIA 3PIIA 4AVYA 2IZ0A 3GG2A 1Y5RA 1D4FA 4PLVA 3PWZA 3C1TA 3U4CA 4GBJA 5G4KB 4ILKA 5TJHA 2Q1WA 4Z9XA 1AE1A 1I8TA 5ICMA 1F17A 1DIAA 2RCYA 1PX0A 2QW8A 2E48A 3QP9A 3FPCA 4OOEA 4YT2A 3IL2A 2HDHA 5C7OO 1RM3A 5C37A 3ONDA 4I5DA 2J8ZA 3WFJA 1R0SA 4CMIB 3S2IA 1LUAA 5DULA 1U3VA 3VTFA 5IZ4A 2HQ1A 4NNJA 4CV1A 4E2WA 4TQGA 1E5QA 5G0UA 3WBFA 3L0DA 3S2GA 1WDLA 4R69A 1U9JA 2E4AA 4W6ZA 1R16A 4GKVA 4Q3EA 1E5LA 1ZXBA 4RF3A 2PD4A 3A9WA 3GAFA 3OFSA 4KQXA 1XWFA 4DLAA 2X5JO 1N7HA 2GZ2A 2PGJA 3ULKA 3WFIA 4DYDA 2DFDA 3IUSA 4NK4A 3NTQA 4C7JA 1UDCA 4CLRA 1KVTA 2CNBA 4PZCA 4HADA 4CL8A 5B4TA 2EXXA 3ZWNA 2P5YA 2JD1A 3G17A 2EKLA 2AG5A 1K5HA 1WP4A 2OMEA 4IDCA 4YJFB 5H82A 4N7RA 5JSFA 1LDGA 2RH4A 3ZWMA 1MG0A 3GGGA 1ADFA 3UXYA 1NFFA 2UDPA 2DQ4A 3DWFA 3G49A 3OHSX 4BB5A 3M1AA 1YBAA 3B1KA 4XDZA 2GR9A 3LLSA 3WYCA 1QR6A 1DIHA 3GVCA 4ROSA 4YEDA 5G2OA 3ROKA 4BNWA 1BDBA 5KKAA 3MTJA 4EUHA 4U8GA 3RJ5A 3WGQA 2D5CA 4CQLA 3ZWOA 2X9NA 4OSOA 4L73A 4EUEA 5B4UA 1R0KA 1SOVA 4NMHA 2V6MA 2DPGA 4UREA 2RAFA 4YA6A 3L6DA 1E7YA 1PJ4A 1FF9A 5ILOA 2HK8A 2DPHA 2A35A 4CUJA 4DPKA 1LEHA 3QVWA 5GZ6A 1BW9B 4IQ0A 1AXEA 3EYWA 1A9ZA 5IDWA 4ITUA 4RVSA 2EG9A 3VPGA 3IUPA 5HWSA 5JBIA 1ZH8A 1DB3A 4WKGA 1HE3A 3PZRA 3IKTA 1V3VA 3BHMA 4ID9A 2FSSA 5HTOA 1ENOA 1J49A 1UP4A 3TJRA 4DREA 1XIVA 1GZ3A 1DDOA 1PGJA 3TL3A 4CMEA 2PH3A 4AJNA 3I9JA 3VPSA 3LT0A 4XQGA 1IHXA 5JY6A 1AUPA 4Q3AA 4BNVA 1YKFA 3RC9A 3A06A 4Q39A 5T5QA 1XG5A 1BG6A 2PR2A 3LSYA 4Z3DA 2AG8A 2DU8A 3AOEC 4WCDA 3T4XA 4ALMA 4AJPA 4E5NA 1DXYA 4TKLA 5A9TA 1C1XB 1F06A 5JMWA 1YVEI 3EUWA 5EMHA 1YGYA 2O3JA 5TQVA 4E32A 1SB9A 1HLDA 3WWYA 3JQBC 5A9SB 3EZYA 2PFGA 4OAQA 5A3VA 3V8BA 2X0NA 1C3VA 3W8FA 1UR5A 1U28A 2VRCD 5FI3A 5TGDA 1KVSA 4ZRMA 1Q7CA 3HFGA 2C59A 2X0IA 1IPEA 3U09A 3ETEA 1IPFA 3GH3A 3DTTA 3M1LA 3QLJA 3DOJA 2X1HA 3JQGB 5KJ1A 9LDBA 1ADCA 3FBTA 3GEMA 3F3SA 3F9IA 1GCOA 3DAPA 4BHTA 4P38A 4E30A 2V65A 4O63O 2YFHA 5U4QA 3F47A 4IUYA 3RUDA 2HMVA 2JHFA 5KJCA 4XYMA 5F5LA 1XQ1A 1A4UA 3U4DA 3EHEA 4LW8A 4MVJE 4JIGA 3K2EA 3JD0A 3PGJA 5I9NA 1E7WA 2CVQA 2YYYA 3NRCA 5JDIC 1CEQA 1U5AA 2FR8A 2C29D 2ZQZA 1I0ZA 1WMAA 3V1TC 5T8KC 1OBFO 4AL4A 3ZU3A 4GSLA 3RFVA 1YO6A 5JPIA 3FNGA 3ZV3A 1C0IA 2X58A 4XEHA 5EESA 2YW9A 3G3EA 1W6UA 3ZCXA 4AFNA 3RVDA 4CLOB 1MG5A 2IXAA 1PZFA 5ICSA 3U0BA 4K6CA 2AQIA 1XKQA 1ONNA 2UV8A 1X7HA 3MJTA 3ZU2A 5K6AA 1GL3A 3VH1A 4RLSA 1JLLA 2FP4A 3L9XA 3HWRA 3K96A 3P19A 3A28A 5L9AA 3E82A 3TWOA 1ORRA 3I9NA 3O8QB 3OA2A 1T1SA 2NLOA 4R41A 1QORA 1ZUD1 2FY8A 3S8MA 2D8AA 1FDWA 4CM6A 1Z82A 2PV7A 2X4GA 4E33A 1Q0QA 4DC0A 3GK3A 1ISIA 2TMGA 4YT5A 5F5NA 1QV7A 4E2ZA 3GFGA 3GN2A 1MFZA 3RCBA 2C0CA 2QYSA 4BO7A 3DR3A 2NVUA 3NAQA 4KUEA 2VQ3A 4WGGA 2F00A 2VT3A 3QIVA 1S7CA 3WGTA 3KSUA 4PG7A 4R1UA 3K31A 1DRUA 5LDGA 3H5NA 2HCTA 2VWGA 5EINA 3KBOA 3GG9A 2IE0A 3RC1A 3FRJA 2QG4A 4CMBA 1QKIA 5HM8A 3MWDB 1YBVA 5TS3A 3SVTA 2W8ZA 3LVFO 3GVHA 3JTMA 4PG4A 4MVJG 2DUWA 1O9BA 1V35A 4KTVE 3R1IA 4PG6A 2ZB8A 4ZICA 3GQVA 1ONPA 4CQMB 5JAMA 5CHEA 3SLKA 3WWZA 5A04A 5JCXA 3KTDA 2EV9A 3KYCB 1DJQA 4U5QA 3WTCA 4EJ6A 4L4RA 5DP2A 1H9BA 4R1NA 3DTYA 4HFJA 4FFRA 3KRTA 3NTRA 5DCUA 4OXNA 1XGKA 1NBOA 2BMAA 3I4FA 4JJIA 3VH2A 4QECA 2O3TA 4MVJH 1MUUA 3OJEA 3KSZO 5A03A 1VKOA 3TOZA 3F46A 5DBIA 5DT9A 3OH8A 2GCGA 3B20A 4OSPA 1VM6A 2PZLA 3OIFA 2H5LA 1JA9A 4BKOA 3TOXA 1HDGO 1PJ3A 1PL6A 1PU2A 3JYPA 4LRTB 4IZIA 3OJ0A 1UUFA 2D3TA 5BSHA 3DBVO 3H9JA 4J4BA 3HSKA 4CM8A 2P4HX 3WTBA 1NM5A 1T26A 1UXGA 1CQIA 1LDMA 1R4NA 1GD1O 1NHGA 2Y99A 1E3EA 3GZNB 4NR0A 3CXRA 4RPHA 3RUHA 2NSDA 3PIDA 5ENDA 3IP3A 4NFHA 3PP8A 3LC2O 5AXDA 1CQJA 2QHXA 3K92A 4DBZA 1ZO8A 5HRUA 4Q3DA 4AJKA 1L7EA 4S3MA 2JL1A 4PIVA 5KOIA 4Y9DA 2X5KO 4S1VA 4CR7A 2Z1MA 4KWHA 3EY4A 4YJHB 1YL7A 1R66A 4C7KA 3WNVA 1WW8A 4MDHA 2EGHA 2ZCUA 3M6IA 1DIGA 3WOHA 3PYLA 4FFNA 2A9FA 4FCCA 3R6DA 4B7CA 1BTOA 3FWZA 2D59A 1EDOA 1N1GA 3AOGA 1HDRA 3NKLA 4J1TA 4U7WA 4R54A 4LSWA 4E5PA 1Y8RB 1ZK0A 5COBA 1KEPA 2BH9A 3JYNA 5ILGA 1DIRA 1KY5A 1PQPA 3FN4A 1HE4A 2VT2A 4ZGWA 2AA3A 3FSRA 1U2GA 3H9GA 4ZQBA 3O4RA 1IZ9A 4XJTA 1PJLA 2VHWA 5AXBA 1J4AA 3K2BA 4MP3A 4J91A 4EJMA 4RVFA 1HZJA 4BNFA 1Y6JA 5K9ZA 1JAYA 1R6DA 2RBEA 3GAZA 2CSUA 3VVBA 3OEWA 4Y6RA 3JYQA 3X2FA 2AMFA 3TZHA 1ISMA 3G0OA 1RYDA 2YHIA 4BKQA 3DAGA 1UXIA 3SX2A 4WPGA 2D0IA 4HFRA 5TNXA 3E1KA 1KETA 3FD8A 1TT5B 1VL6A 4CMEC 4UUMA 5I8ZA 4RV9A 1C0PA 6ADHA 1PZGA 4CR6A 1GQQA 4WUVA 2BGMA 4FGSA 1XHLA 1NWCA 3PXXA 1RM4A 4RLHA 5BSFA 4OXKA 3ASUA 2VRCA 4IJUA 3KETA 1N2SA 5G0SA 2NWQA 3WQQA 1K6JA 1LU9A 3Q9UA 2JHGA 1DJNA 3QA9A 3RUIA 3OQBA 4XGNA 2Y68A
chains in the Genus database with same CATH superfamily
1WMEA 1U8TA 4B4WA 5E2BA 3V4PB 5JZMA 3IAM6 3T3NA 2FXVA 4EAQA 3A31A 3DBLB 2VAMA 4HPWA 2YOHA 2ZFUA 1I6WA 4LV6A 2CHFA 3D5TA 3CRNA 3R6LA 2B94A 4KLNA 2CEAA 4KRXA 1OWMA 2QT1A 1UZNA 2HSGA 5GP1A 1NY5A 2RI6A 3WB0A 3PPWA 3AUAA 2ZJZA 4P4LA 2HPAA 1K8RA 4J29A 5A71A 3HA2A 5IASA 4UM7A 2MMCA 2WG1A 4ZYVA 2FOIA 2XWSA 3KYBA 3UK7A 1Q57A 3OZUA 4HK4A 4XR9A 5JAIA 4G0UA 2B0CA 1R6BX 1SU8A 4M87A 1E3WB 3VKGA 5DM70 4QAQA 2PX6A 1T9KA 3A6EA 3QHQA 2AS0A 3LZ6A 3QLUC 1RJDA 5EERA 3IUYA 1M34B 1E2LA 1Y9ZA 1DWOA 2C9DA 3SDBA 1NQAO 1YJQA 2I8AA 1QGUB 4N0QA 3RS7A 3SSMA 4DCGA 3Q87B 1VC2A 3FGZA 5JFTA 4QYXA 1XEWX 3MYRA 6ABPA 1JW9B 3ZQJA 4QFCA 4JEUA 1PX2A 4MI1A 1SK8A 5CEJA 1YZFA 2HN9A 4BV2A 5KTRA 2Z4SA 3T1OA 4LQ4A 1QHEA 2P9QA 3FMFA 3WL8A 4ZRDA 2ZRIA 5KQGA 2QAGB 1RWOA 2JVJA 1F5NA 3WIDA 1YJ5A 2PX4A 2I5PO 4WLFA 1Z3IX 1G8SA 4N8SA 5KOHA 4YUVA 2CLOB 4NATA 4HVAA 1WNTA 4H7JA 4FHGA 3K1YA 3RC3A 3K9NA 1YCFA 4IIVA 3CLUC 1XA4A 2CEKA 2VDVE 2P91A 2WIAA 3DDSA 3RDPA 1NNEA 3A6GA 1LLFA 2RG1A 4TSFA 3C14C 1FYEA 2QTVB 3NYWA 2NX2A 1RWQA 1QHNA 1AUOA 1M1NB 1XSEA 2H85A 5E6SB 1II8A 4TOIA 4AW9A 4GKBA 4AYTA 5KSYA 3CKKA 3DAHA 2UZ0A 4WSOA 3DE6X 3DZJA 3PWSA 3WLJA 3QJ5A 2YXBA 3S44A 4KRGA 3D2CA 3EIHA 1IHUA 2Z8ZA 3JAWA 4FBMA 2BTQB 2JASA 3HBLA 2GJKA 4GUDA 3QEMA 4GGPA 2VJMB 4JYBA 4RPLA 3T7KA 2ZYAA 5IKOA 4RIEA 3OO0A 2YWXA 1XZDA 2ZIEA 2ADFA 2FW0A 3EZLA 4EJSB 3WK6A 3E9MA 2IOHA 4NBNA 4CIXA 3JZMA 4V0MA 1YR8A 4DRYA 1YQWA 1YTLA 1XWIA 3NCTA 1Y3CE 4KR7A 3V42A 3KHUA 3EGOA 2C7OA 3E5RA 1K4YA 1NYTA 4PVDA 1P2SA 5CH5A 2X8BA 3D3JA 3SC2B 1NVVQ 3I9MA 3SFTA 3PTAA 1JEOA 1IEWA 3IULA 3E8MA 2Q2QA 3QI2A 3R7FA 2X8JB 4H4CA 5EA2A 1LVUA 4FXPA 5CVVA 3HDGA 4N01A 4QUAA 2QG6A 1TLTA 1IAQA 5CA0A 4Y2YA 1BO6A 1GPYA 4G0QA 4G1CA 5ARBA 2C2BA 3ENVA 7ADHA 1VIMA 2DAPA 2ENUA 4MV5A 4D82A 1GPKA 1IM2A 1XQXA 4BVAA 5A6SA 3WKDA 4N6GA 3LQYA 3QG5A 1N0IA 1TM1E 3KL4A 4O59O 3WJ1A 5JZBA 5A5FA 3ER8A 1TCVA 3GOQA 1HE2A 4BZXA 2WNSA 1FDRA 5FA5A 4TXJA 5C35A 8MHTA 4ZT5A 5B5SA 1Y1SA 1B8VA 2E49A 2QYTA 1NAHA 4PQFA 2GSDA 1CXZA 2JI4A 4OP1A 4XUCA 5JJ5A 4Y0NA 3BRWD 3UAZA 1A69A 2ZBFA 3MQ2A 1DQPA 1H5NA 4PGFA 1UWVA 2VL7A 2YDXA 5EKSA 1O6FA 5FI5A 3WGOA 1N6KA 4HSEA 1GFZA 2EKDA 4K86A 5AVKA 3EW9A 3KP1A 2I7TA 2QNBA 2AG6A 2SCUA 4IQ8A 1QIFA 4E51A 2J41A 2XWPA 2R86A 5BP7A 5I7WA 2O3UA 4OHCA 1N8NA 1WBBA 2DFLA 2PMCA 1FFXA 4DEXA 5IDXA 1Z39A 3R6TA 2BGWA 3MJDA 1W6RA 4P58A 3BQMB 3VNAA 1SULA 1I4TD 1TU3A 1V1JA 4OVKA 3T7CA 4JI0B 1NM5C 4ZVRA 2ZBQA 1JBQA 1V41E 1XRMA 2WTXA 3C1UA 2H48A 1GUYA 3CEPB 4KV7A 4MGZR 2Z95A 3WYAA 4KQGA 3IUEA 3OG9A 3U1BA 3LC7O 3MSXA 3DOFA 3RJ9A 1P33A 3U1TA 2B30A 4QGGA 3BFPA 3R8CA 4D3XA 1WX1A 3PICA 4ZVLA 1KI1A 2PVSA 3MWKA 4LHVA 3KOUA 2NMVA 2YRFA 5AIBA 5AVVA 2NSHA 1KGSA 1U3WA 3I5MA 1B6GA 1K0UA 4GPZA 4CIVA 3HYSA 1PRYA 1GCGA 4P36A 4RW0A 2BSQA 2WIKA 1P7WA 2PLRA 2BDTA 5KYXB 4Q7MB 1U9YA 4L4SA 2PKQO 1WXWA 2BEUB 2X0FA 4EA6A 4IS2A 3KZOA 3PE4A 1T2DA 5KINB 1M0WA 2ZDQA 1MX9A 2LGJA 2I7XA 2VSNA 1MC1A 3P5SA 4EHHA 4KO4S 1TXGA 1Z8DA 1SN7A 2W22A 3FGOA 2QD1A 1HM5A 2LPMA 1JXQA 5DYTA 2W6MA 4MUNA 3QEBZ 2AUNA 4W4TA 3SXUB 2R3SA 1J0XO 2NYAA 4IDAA 4I2NA 4XUDA 1H94A 3H3XA 3IP8A 4LCJA 2IP2A 5FYQA 2XBMA 1BHSA 1U2GC 2XYGA 1WABA 3X1JA 4BFVA 2WT4A 3AKDA 3M70A 2JEYA 2K4MA 4OMCA 4UVGA 3VDXA 1FMLA 3R3YA 3KS9A 4ZI7F 4GVLA 2Y1DA 1BCSA 3F6BX 4URWR 4BPBA 2AZXA 1G2OA 3L7DA 3LUBA 4BZPA 3EEOA 4RKEA 1OXBB 1V45E 3MW8A 3U13A 1XDSA 2P78A 4B71A 2G82A 1Q1EA 2JCXA 4CLRB 1I7SB 4OXIA 4LHSA 2UZ3A 2WG0A 2BMDA 3VTKA 1JSXA 5AKEA 4AMZA 4DDHA 5AI9A 3VPBA 2D2EA 4P54A 3NT4A 1FXWA 1L8LA 5FRDA 1CR1A 5HEKA 4YPOA 1NYQA 2RC6A 1OD6A 4ZI2A 3TQCA 4L8LA 4NULA 2D1TA 3ABRB 5K09A 5IMSA 3Q4GA 3C8MA 4B80A 2DFVA 2JBHA 1V6AA 2X2PA 2EZTA 3C7CB 3ZWYA 2QTMA 5BSGA 3KWMA 5CLFA 3WLMA 4FQ5A 2LNDA 3PYMA 4KYUA 5LA6A 5EIHA 1XO1A 1GGEA 3LT2A 4WRRA 3A2MA 3T3PB 3TZ6A 5KSPA 1YCGA 4W63A 2QVXX 4Y18A 1JSZA 1KQOA 1SIOA 1ZVQA 4K9DA 1PZEA 3IRVA 1QHHB 1GCUA 1YB2A 1GITA 2B4QA 2QL7A 4QXQA 4TMTA 2JDIA 1A7AA 1B14A 2FUNB 4BE9A 4DMKA 2QGZA 4NU0A 5FWXA 3UMVA 1PHPA 3K0CA 4HXFB 2Q6VA 3EWNA 4EPWA 5HF9A 4ND7A 1K68A 1UPUA 3TFOA 2C7QA 4OLAA 3MJEA 1XJQA 4FDMA 4J76A 1E2BA 3JD3A 4J0DA 4JVSB 2INGX 3OEHA 2IXEA 2G76A 2RHRA 2AKAB 3D6MA 3IA2A 4ISCA 3VAAA 3YASA 4NNPA 3JU3A 1QH8B 1QH1B 1TU0A 4JAVC 5D3ZA 5K0NA 1KOGA 2IXDA 1ZD3A 3D4NA 1R8XA 4M3NA 4RA9A 1BOFA 4W5WA 4BCCA 5EHNA 1XB2A 3GLIE 1K98A 3P27A 2B3DA 2FMFA 1DKLA 2CBXA 1J8FA 1HO3A 1F38A 2GF9A 3DA8A 3KPUA 2X23A 4WBNA 1KI6A 1O95C 1RKUA 1OIVA 4Z7QB 2IKQA 2WJWA 3A6ZA 4OFBA 3HS3A 1M5RA 5J4YA 4IX9A 3WFZA 4PNPA 4KPEC 3JATB 1JEYB 1J56A 3A4TA 5I7VA 1MHPA 2IA5A 2R6CA 1T4DA 3BXZA 4MV7A 3VA7A 2BCJQ 2DZDA 2FW1A 1AO3A 3ONFA 3Q3EA 3QVTA 2XNDD 4YV1A 5BRAA 1TUBB 1DRJA 3AM3A 4L0MA 5FD8A 3VZQA 4J3FA 5DX0A 3RT1A 5JARA 5EIXA 1NXWA 4W5RA 4L57A 1PNOA 4TN1A 4Q1DA 4K81B 3EVNA 2O5CA 1L4HA 4RA6B 1D5CA 3U44A 1OWPA 3HJAA 2WG2A 5AVZA 1WBDA 2RHCA 3D6AA 4NOMA 1XXHE 3A3PA 3IBFA 1VTKA 3LA8A 2G9ZA 3LWBA 2ZJ2A 3N6RA 3KPVA 4HDMA 2PCJA 3KSDO 2J9ZB 1V0JA 3HB4X 3G0DA 3ZXYA 5JC1A 1JKFA 3UEOA 5BO5A 1US8B 3PJEA 3WYEA 3BKWA 4ESHA 1JJVA 4LRWA 4U0JA 3D6JA 1XD2A 3FTDA 3ZWBA 4UZEA 1LI5A 5KYYA 3GD7A 4CMIA 1NA5A 4L4XA 2H16A 4G5SA 3IT2A 2DSTA 3B3AA 2YYZA 1IN6A 5CM2Z 3N8KA 4F8JA 1QIIA 1LBTA 1WXIA 5I5GA 3LCJA 3PHGA 4COOA 3RK1A 1VJRA 1CS0B 2FJ0A 3FBGA 2NTNA 4FSHA 2HQBA 1U65A 1LK5A 5KHOC 5EWLB 1G1MA 4MICA 1N92A 4GMFA 4LXYA 5DMHA 4EJ0A 4QEZA 1C7RA 4UBIA 1JHYA 4E07A 5JSZA 3TAUA 3HUEA 3I92A 3SJ7A 2W6JA 3O1JC 4X60A 4ECAA 1KJWA 2V0NA 2A33A 3KVRA 3M6XA 3AXTA 4GVPA 4RDCA 2XY4A 4ZOLB 4CM9A 3KHTA 2H1CA 2C3OA 2OGTA 1FU4A 3F9CA 3PD1A 3TB6A 1ENYA 3BWMA 4MLDA 1B8OA 5JAHA 3UWKA 4OO3A 4TQAA 4E4TA 2UZIR 2WKSA 1KJ9A 2EFHB 4A10A 2HW8A 2ODNA 4IHJB 4O4IF 3KR0A 4HVCA 4OX9B 1PL8A 5E0KB 3CW8X 3PDUA 4LZLA 2GARA 1I2CA 4XPZA 1ABEA 3O2NA 1ODTC 1JHQA 1RHKA 3W3AA 3UA3A 3V4VB 1NC1A 1EVYA 1L5ZA 1UC5B 2WAMA 2ZAYA 5GIPE 2AN4A 3E9CA 1O7JA 3LI2A 2GTIA 5EE1A 5TB5A 3LK7A 5JE8A 4KBFA 3Q7PA 5K3SA 3K6KA 3GV0A 1OHHD 3Q3CA 3NR2A 2FP4B 5DN6A 5BW4A 3B89A 4Y98A 3WMGA 7GPBA 4YDQA 3RSFA 3R5SA 3C3EA 1YR2A 2IQIA 2CMFA 2JHAA 3ZVKA 3CPSA 4O3FA 1O3YA 2OKGA 3OTGA 4ZPXA 1KU0A 1N2CA 3FPHA 4TWRA 4L85A 5EI5A 4D80A 3CEJA 2FQXA 4JD5A 3U56A 2IY8A 3KL2A 3DTVA 5DGCA 3S2EA 1PCXA 3QLUA 3G5LA 3REQB 1GGVA 4Q9JA 1E1QA 5A3SA 3UCEA 3PC6A 5F21A 1G55A 4BRUA 5BUZA 4QJ5A 2J87A 3RVPA 3AW8A 2IS1A 5DM0A 5KTNA 4C2BA 4GM0A 3B12A 5IJWA 2BI7A 2XECA 1U8XX 3MG9A 3P9RA 4CZ2A 2UUOA 2VWHA 1FNDA 5DTIA 4K6OA 1EJBA 1RCFA 2ARKA 2FSGA 3N6VA 1VJ1A 4GL4A 5ELLA 3WLFA 4PNEA 5HPYB 3EZFA 3LRPA 1EGAA 1FFWA 4FGKA 5AJYA 1J1ZA 3OIVA 3V4LA 3RU2A 1RE1A 1TKCA 1UMBB 3MRTA 5J2UB 2FAXA 3QZUA 4ZEVA 2AIRA 5I4KA 4RAQA 1BX0A 1VBMA 3GROA 3MCVA 4LV5B 1ANKA 1IQUA 4DCTA 3BGSA 1Y3IA 4IUBS 4UAGA 3SQLA 4YUWA 4FNGA 1GKUB 1KDOA 1SG0A 2JIPA 1AXRA 2ATEA 2F1IA 5BYAA 1U0FA 4JP2A 3SZLA 1SH7A 1TZCA 4XW2A 1BHJA 1P4RA 4RUKA 3OIWA 4BRSA 1NRJB 5DCYA 1VIYA 6GPBA 4CL0A 3HRIA 5F1PA 4J90A 3I09A 1GUDA 3QFCA 5AUPB 1E59A 3F7NA 3D1JA 1DBWA 2LBPA 3L40A 4RD1A 4LDQA 2K7ZA 2R7NA 1VMDA 1E6KA 3LE8A 2XITA 4EHAA 2XXAA 1F6DA 3UB2A 2IOFK 4WN3A 5KWVA 1YE3A 2VTDA 4NSNA 3S1AB 2ZSHA 4BGUA 1OFUA 4QUDA 5G1NA 1KEUA 3E0QA 4F3YA 2W2MA 2GFHA 1X74A 2DCMA 4G5QA 4TLEA 1LW6E 3D5QA 1SBNE 2Q6TA 1FVHA 4G89A 3TW8B 2EX0A 3DBOB 5C1OA 1QHGA 2O6HA 4ZYZA 3LUHA 1RYEA 3KK0A 2IS4A 1E3QA 2H2DA 3CURA 5GVSA 1YJAA 2IYLD 2PZGA 2P3LA 4OLJA 1L8OA 1JEAA 4YK7A 4X84A 5FWAA 5AHWA 4P4SB 2CZCA 2PKYX 2YZGA 2GZ3A 1ZVJA 1YR9A 3PKJA 4PINA 1X14A 4CM8B 8ADHA 5ICCA 3E27A 3W2EA 1OF1A 4BJHB 3CIFA 5EOVA 2OWEA 4HX5A 1CQIB 1L1RA 3N2IA 3RTGA 4IIXA 3FJYA 3ZTYA 2JHPA 4RGVA 1RLOA 1GL7A 3DW1X 5EQJB 2PJDA 3C6MA 2C82A 1GNPA 3NUQA 4NZYA 1YAJA 1ZA1A 2JFNA 3CGWA 4Y30A 2H9YA 2QMUA 5DNWA 3ZWKA 3THYA 1PYGA 4HH4A 1NLYA 5JQGA 4YP7A 2BJVA 1JE0A 4MKRA 1YA4A 3L4KA 1HNZB 4DRXB 1VE7A 5JD3A 4B3TB 2D6FA 2Q3LA 4D3DA 5L45A 1WPRA 1NXXA 4LBZA 4LBWA 1VA5A 3L4BA 1GFSA 3LUAA 5K3DA 3W1VA 1IUNA 5GVRA 2PLAA 3RG2A 3WGMA 5C4MA 5DNYB 1FYDA 2H5IA 1VSVA 1AGPA 2J0VA 3Q88A 3T15A 1LI4A 4TM7A 2IXBA 2X2FA 5LCXA 4RF5A 3FAZA 4XYEA 1XD8A 3L0ZA 4DQXA 2GHTA 5ITZB 5LPNA 3ED5A 3X1ZA 5A4FS 1JZQA 3UV3A 4YJ3A 1VPVA 1XMVA 2XYRA 3E3OA 1ETHA 3T35A 3TF5A 4FYHA 1YC5A 4PX5A 2ZXFA 2CLSA 4LJ5A 1F8GA 1ND5A 1C9MA 1RYMA 1Z35A 3N3AC 3NB0A 2P2DA 3CXUA 3FLEA 2F7SA 5BXYA 4Q3CA 1G6OA 2ZJ1A 3CZRA 4IQ4A 4Q19A 4QYSA 2O0KA 1Q74A 3A2LA 1YE5A 3DOEA 3OZAA 3A9RA 5KVQA 4Z4CA 2JGNA 3NHSA 4WT7A 1A8PA 1P2VA 3HUUA 3NEPX 4LDRA 4NU5A 1VPEA 1ZGAA 5AKHA 3HXLA 3FUWA 4S0XA 1RWNA 3E35A 3WRWA 2I1QA 4DXAA 4FK8A 4F56A 1QG0A 2EX4A 1RPAA 3WGJA 1DL5A 2JF0A 3A11A 4L08A 4DA4A 2NT3A 4DA7A 5HKOA 3C7KA 5ALXA 1WEKA 3PJFA 2E37A 4BO2A 4U02A 4R9SA 4CM1A 1CB0A 5A2QA 1K3FA 3W6ZA 5A3RA 2A7XA 3JQ7A 4MKXA 3EQ2A 3HJNA 4HWGA 5ES3A 5HK9A 1E0SA 3GQBB 1IK4A 1I1HA 2QRLA 5K1ZA 1YOVB 1N2EA 2C2MA 4EHBA 4EYEA 3HB5X 1NG9A 5EFZA 1Z5WA 3BZWA 4CKEB 2ZUEA 4CKZA 1VL8A 2OHFA 3OCYA 4OYRA 1T3SA 2BGTA 2WTAA 3AGQA 3EFBA 4L8GA 5JH7F 3PC8C 1J0AA 4TTQA 5AM1A 2XAUA 2VZEA 1PJ2A 2D8MA 2HRRA 3N39C 3DD5A 4PSAA 3SHWA 2PO5A 4HOYA 5K4GA 1R2QA 4RJIA 4B82A 3FSGA 5DHFA 1AMOA 1Q1GA 1FTWA 4YY3B 3RC7A 3RYIB 1K4MA 1X7WA 5F9HA 3ANLA 2FRXA 1M10A 3M89A 2Q7OE 2XE4A 1FSGA 4BXOA 2R6ZA 5H81A 2ZTLA 3OLQA 1WM1A 4MS1A 4F3RA 5KMGB 3G5AA 4RSRA 5DB4A 3JYLA 1XZFA 2R79A 3IVMA 2WYUA 3GRVA 2FF7A 1XCJA 2BKEA 2EBHX 3LL4A 4WA7A 2PGNA 4IDGA 1YRHA 2ZU6A 4H60A 1BGXT 3F6SA 3O03A 421PA 3VZRA 4Z0HO 3SZRA 2OVFA 2FSHA 2YN0A 4LYJA 1SY7A 5D7NA 2CCGA 2FXIA 3PQ2A 3WGGA 2FMTA 1HE1C 2JI6A 1A50B 2M2IA 4FQ8A 5LYJA 3DDCA 3QWHA 4A8JB 1UBGA 5IU6A 3HXOA 1CY6A 1O6GA 4DKJA 5ED4A 2IDMA 4AY2A 3WGNA 5CG2A 4U63A 1NVDA 1HH4A 1UPCA 5IULC 3W5SA 3TCNA 2O2YA 1XK6A 2XE6A 2XZDA 3OZBA 3RB8A 4NXMB 1U90A 2A3NA 2P68A 3B51X 3F3KA 2B99A 1ZGCA 3BD6A 1V11A 4ARUA 1LNSA 1DBVO 2YC2C 1YHYA 1C4KA 2C3YA 2CLCX 4ZYYA 1JMVA 3NRJA 2AYXA 4MW7A 1HYGA 4PLYA 4MRMB 1DU4A 1RWBA 5E7IA 1N9KA 3T7EA 3ZWAA 3RKSA 4ZCMA 1HT0A 3OPYI 5JO0A 1Z6TA 4K1LA 4K5QA 2H54A 4HH3C 2FW9A 4PLHA 2W58A 5IC6A 2PSSA 3GBPA 1XCOA 2R87A 4BJ1A 4DILA 1T6NA 3SDSA 1ARZA 2EL7A 5JZSA 2GWRA 3GAMA 4IWXA 3H1FA 4MPTA 4PC7A 3T52A 4BAUA 3E03A 1KY4A 1NPYA 1CRLA 2GN8A 3NTLA 3L8FA 3MLEA 5J2TB 1AM4D 1NUSA 1JG3A 1QLJA 1GDHA 2DR2A 3H04A 2P79A 4QWWA 2PIAA 1FZQA 2OVBA 2VHVA 4XQCA 3EHDA 3O91A 1KC3A 1QONA 3BYZA 4IUDS 2JDID 3MOSA 1ZRMA 4KK4A 4RWZA 3K6SA 3VM6A 2JNWA 2CXHA 4K05A 4OD0A 2Z4RA 1NLUA 1K6MA 1YB5A 4DMGA 2JGMA 3PPXA 5MFZA 1E6UA 1MEOA 1MQ9A 2GPWA 4LN1A 3OTOB 2W00A 2BLLA 1JTEA 4OJNA 4R2KA 5LFAA 1TF5A 2LIPA 1X19A 3OEHD 4JYCA 3DMPA 2G1KA 2Q1SA 3DEIA 4IKPA 4X0EA 2AOTA 5F1OA 3TQQA 3COYA 1Z75A 1QRSA 3JQFA 1L5RA 2VA8A 2XKAA 2V55B 4YJGA 1JEEA 4RTNA 4BKMA 4AJOA 1CY8A 4XJSA 2PNFA 3ICCA 4MDYA 4MUXA 1ZH4A 4LJ4A 4D4LA 1HV8A 1LTHR 4YMWA 2X4DA 2A5DA 4BB0A 4R71A 1NMQA 4ZMRA 1V8DA 2BISA 4YO7A 4WLNA 3MWLA 1JHOA 3OSUA 3A4MA 4P5DA 2YIDA 4ZU1X 3T4EA 4F4UA 1JDNA 2J9YB 4GE3A 4MP6A 3NDIA 2BTEA 1UK9A 1GTMA 4N18A 4DDUA 3H2IA 3PZBA 2RAUA 2WDPA 1YMQA 1EUYA 2MSWA 4FUTA 1E9AA 3IR7A 1SVWA 3BJZA 2PRSA 2QRPA 4H16A 3GLGB 1LTQA 2BYTA 2FWMX 1EDZA 5CX1A 5DRTA 1WHSA 1WOMA 2FPPB 4QYIB 4F3CA 4BS9A 3RRNA 2DUJA 4HH0A 2DQZA 2P40A 1KO7A 3QI7A 2OBBA 4IXWA 1VLMA 4DSNA 3PG5A 2IYAA 3DDUA 3IO5A 3SF8B 3ZW7A 5C80A 5FUWA 1KI8A 1S2MA 1U0GA 2BMFA 4OF4A 3FYTA 3HO8A 5ESXA 5TC4A 2Y1KA 2HJSA 3HJGA 3NBZC 1H85A 2C9BA 1XEFA 1QRTA 4YCJA 3H2GA 1ST2A 2AR0A 2C5LA 3H3FA 3K4QA 4OP2A 4UCXA 3SM3A 3DLPX 4YASA 4IQFA 3ZCSA 4G07A 1N3BA 2WYIA 1FS6A 4OSEA 3VUEA 3DONA 1JEQB 1LQTA 3B3FA 3HWX1 4DBLC 4AUNA 4EZBA 1EHIA 1GQOA 3MJ4A 5ALVA 3ICOA 1MC4A 1LJUA 3JARA 1IJBA 1ZZGA 3TNFA 1N2JA 1TM7E 2FZWA 3T3DA 4N47A 3EVGA 1ESEA 1SC4A 4MO9A 1LC3A 1JHVA 4A5OA 1W4CA 2IPAB 2GK3A 2HLPA 3GRPA 4YRGA 1LKZA 4Q21A 5H4GA 4KX5A 1GPBA 2W6JD 3CJQA 4F2HA 2Q5JA 1QLWA 4GP9A 1S1MA 4CM9D 3BWEA 4B0PA 4DTIA 4R16A 1I5RA 3T95A 4RHUA 3C97A 3L7AA 1ZJ5A 5L3QB 5NULA 4LY9A 2PTGA 3M2TA 4TV9B 4OJYA 3EH2A 3FMGA 1NXOA 4EGQA 3OC6A 1OMOA 2CLHB 1ICEA 1VMEA 1KEEB 1X7DA 5M2QA 2PY6A 4G01B 3DE2X 4I5FA 4D3SA 2GM4A 5JC8A 2CUKA 3W3AD 2PX8A 5FV7A 1U7XA 3GFPA 4ESOA 4XYGA 3OPQA 2VS1A 4KMRA 3S2FA 2RIRA 2YZNA 3LL7A 3HDTA 3SYNA 4D9FA 2OKCA 2X4IA 2RHHA 3DMRA 3CUKA 3D7MA 4UU8A 5KREA 1ISFA 1NN0A 1WETA 2ZJ3A 3TQTA 2X8AA 4FKZA 4MWTA 1XCMA 4EW2A 3J81A 1EWQA 2QQ0A 3ASVA 3KYJB 3IR6A 4S2UA 4D44A 2W71A 3ESRA 4AKIA 2IXTA 2QM7A 3DQZA 3J7TA 1ML3A 4RHEA 3BIOA 1Z15A 1GA6A 1DHTA 2AFVA 3L8YA 2IS6A 1GPLA 5KB3A 2PKXA 2YH2A 2RDMA 2G1PA 4PTLA 1L9KA 2PSEA 2CE2X 3TZQA 4F7WA 1HEYA 3C3MA 5HUHA 2H8GA 1WCWA 1T5HX 4QUJA 3GUYA 1G7CA 4A4DA 1L5HA 3DTVD 3K1TA 4TUYF 3V3KA 2FPIB 3NMUF 3QVGA 3UYLA 5KYNA 1E1QD 2IW3A 2J4FA 3LUKA 2Z2IA 4LVNA 3H5WA 2P9GA 1SG6A 3N59A 1LPMA 4TXLA 5D2CA 1RZUA 2IH5A 1N2HA 4XVRA 4P7GA 4EHJA 5DASA 3CPEA 3EZ6A 4A82A 2EEZA 5KNBH 4QU5A 3TKYA 3BC1A 3OF3A 5AVTA 4UBOA 4DWJA 2XVYA 2RGXA 1VSBA 2HXSA 1P7YA 4JGGA 4X54A 3WDSA 5BUQA 4YALA 2JK0A 3QPWA 1FTYA 1SQGA 3KM0A 3NHJA 3TFWA 4PS0A 2PJRA 4WNIA 1WSAA 1E4OA 2Y27A 4P93A 1K2VN 1T9HA 1UJBA 1KI2A 3A4VA 3MWGA 3TQSA 5K8UA 2AVNA 1XZLA 4XVHA 3GMDA 3TR0A 1V4NA 4BX8A 2C1ZA 4NMMA 1TDJA 2CLLB 2NV0A 2ZWIA 1LV7A 3M4NA 4JP8A 3AJEA 5DHQA 3TMAA 3WK4A 1FP2A 1N3IA 3ZKWB 1GTZA 4BO6A 3I1JA 3LX4A 4NI5A 1BA2A 4GEKA 4YHBA 4KN9S 2H2FA 3IEKA 1MZVA 3DMHA 5IBQA 4MO2A 3WG9A 1JKIA 3KXIA 3LF1A 5L3RA 1L7QA 1RI3A 3NVMB 2HR1A 3VR4A 5CTJA 3SS8A 5K8VA 1KH3A 1YU9A 4L0QA 4Y1RB 2CT8A 1PJAA 1PJCA 4F04A 3TIVA 3JQAA 5BMVA 2J3HA 1GPH1 3VJMA 1JRLA 2CKDA 3E7PA 5HFAA 1P0CA 1WL8A 4V2UA 1PSZA 3H75A 3T9AA 2ODTX 4QIHA 1E64A 1ZUNA 2XBLA 1Z4LA 2B21A 2QDKA 1QV9A 2R6HA 1DTEA 2RK6A 4G0NA 4A27A 2FEMA 4GDFA 3G9QA 3HY6A 1G21B 1KFEB 4XVCA 1TZKA 2Q5OA 3KR1A 4CV0A 4UTVA 2GHQA 4DANA 1PQWA 3UXMA 3HKBB 3K15A 2W2LA 2BHLA 3GPBA 5DTJA 1CNFA 1YONA 2PFKA 4Q7JB 4HQLA 1JLRA 3D64A 5KAPA 3DULA 2NPOA 1A82A 2J07A 4G86A 3UTDA 5CRIA 1XAGA 3JQ9A 1XDZA 4QXOA 4UULA 3ZHQA 4URVR 4G2TA 2PVCA 3ET4A 4HDNA 2QUBA 2HWUA 4X93A 4TYWA 2OXTA 1E2FA 3KVYA 3VGPA 1S0UA 2VKQA 2R96A 2C2OA 3OCVA 4C4YA 4UU7A 3JD1A 2Q5IA 2XXJA 2XCRB 1DPGA 2I6GA 3HY3A 3IV9A 3Q3VA 1IY2A 2F55A 3E18A 1XVVA 2HA4A 5JI2E 3IP1A 1CY2A 3GUVA 1Z0SA 2WAYA 2GAOA 1G4HA 1PUJA 3BWVA 2OK7A 3AF4A 4HGPA 4KRFA 3I58A 1T29A 4QQNA 3EGWA 1OLXA 4HN2A 1NBAA 4NZNA 1K7CA 2IPOA 3JRNA 2WOJA 1MX3A 1N5DA 2OUKA 2VT7A 4GXQA 1Y1LA 4P3XA 3X1XA 3CLVA 3I2GA 5BSVA 3X1MA 1QTIA 3AVQA 3N58A 1R6VA 4M54A 4MYCA 2LXNA 4ONEA 4HQOA 1DAOA 2Z1NA 1OGIA 2NU6B 3VKWA 4IRXA 1G291 1GNVA 2E9SA 3HP4A 4HWTA 3EXG1 2DJIA 1B0ZA 4IOLA 4YBZA 5E38A 3W6OA 4Z4FA 1D2MA 2QWXA 1AO0A 1Q2UA 2Z5FA 4LOHA 4C4ZA 1MJGM 2BCEA 2VSYA 4YJ2F 3TKLA 2VAVA 2CXPA 5JSHA 4ZYXA 4H6WA 3KT3A 5JZOA 2DHEA 1EQUA 5JCZA 1CNEA 3IP6A 1K5DA 2YYAA 3QYAA 4JH0A 2OAQ1 3DZCA 4HFNA 5CLIA 3ZI0A 2ZAIA 4J07A 4A0RA 1MAWA 3AT1A 4GOXA 4J3JA 2RHBA 2IDZA 5JNTA 5EGSA 1QQBA 3RV4A 2OSBA 1FFYA 1G60A 2WJHA 4KODA 5JRJA 1Q0TA 4F11A 5KOJB 3BXGA 3ROGA 3W34A 4I6GA 5KU1A 3RTAA 5L53A 2R6JA 3GOHA 3LNCA 3TEJA 4ARCA 1WZUA 4X62B 2JGIA 3HJUA 1CRWG 1FFDA 1UBSB 4JBLA 5G4KA 5A05A 2F6RA 1VG1A 4KIFA 1ZOLA 2WSMA 5BVHB 3CX6A 1MXFA 1UT5A 1BWSA 4DVJA 1DCTA 4MUJA 4DCOA 2XZLA 5EJ9A 3VKVA 2FDRA 3IEPA 4OXQA 2C00A 4OBBA 3IERA 1G5RA 3PKZA 5FFFA 3DZBA 1PTKA 2O52A 4HNTA 5KDDA 1AKMA 2DETA 2GPTA 3QOYA 1WZCA 1U2QA 1XTSA 3O9ZA 3ZU6A 3MLAA 3GRYA 2GUWA 1M8FA 3COVA 5TPWA 3U37A 1NATA 2FPXA 4YVFA 5C4IA 5AXAA 3C43A 4IVPA 3VOSA 2C9YA 2E5LB 4NKRA 1UM9B 2QNRA 2ZT8A 3SCZA 1PJRA 5CLHA 3PFNA 3ZGVA 1UXHA 3OE7D 5HIJA 2JJ2A 2GN1A 3IO3A 4P3YA 1CZHA 3MTQA 4D4KA 5KO2A 1U98A 2OR3A 3AXSA 3JVEA 4F2PA 1BU8A 3OX1A 3M33A 4TXNA 2X3UA 3LBFA 3CVUA 3WMRA 1XDWA 3E3AA 2BEWB 1PZMA 1NXQA 1WSWA 5DSZA 2QRVB 1F2TA 1PKEA 3IOCA 4KW7A 4RO0A 5EPOA 3HGMA 3HVRA 5AK3A 5FBWB 1F0YA 4O33A 1LJ8A 2D1FA 2XDWA 2N47A 4WN9B 4I1SA 5B7QA 1L4GA 4PC1A 4YJFA 2GLXA 2CJWA 1NRWA 3HUFA 1X7ZB 3B5JA 3PD7A 1M76A 3AHDA 1FK8A 1SB8A 4KUHA 4EQ6B 3BE5A 4G8DA 4X3PA 2V7GA 2FNAA 3B52X 4J9VA 4CQMD 2EJVA 1OT3A 2VPPA 3FI0A 4Q03A 2PX3A 4KVFA 2XNCA 2QL5A 3CR3C 5DBGA 4D1YA 1R8YA 3KOWA 1SRRA 3OFJA 4QBFA 4C1NA 5C8DA 3EWIA 4Z9BA 1MVLA 1SUSA 1ZG3A 5CEEA 2AG1A 5G1OA 3WKEA 4EABA 1HZZC 2BELA 3DEHA 4NJEA 3DUFA 4MIOA 1CHDA 4UFPA 2GEBA 3MXOA 2P6PA 3RSLA 2YQZA 5AKJA 4F4FA 5E9WA 4ZOQI 1EZ4A 2JC3A 2W11A 5KZMB 5HNKA 2C7RA 3DZGA 5CCDA 1QB8A 1AKUA 4NAUA 4QQRA 3ZHSA 4GI1A 3EASA 1OZHA 4Q01A 2QORA 4QO7A 5J40A 4IH9A 2IYSA 4PVCA 2DR3A 4WK0B 4G63A 1N6RA 3UG6A 2ANBA 4US1R 1J8QA 1GZDA 4A6PA 1TF2A 4AX4A 5HGXA 3NORA 2GCPA 1BW9A 1E1MA 3JASB 5SZHB 3UB4A 1COZA 1SC1A 4L5IA 5YASA 3S7ZA 3V46A 1F3OA 2F3TA 2D7CA 3UFXA 4I08A 3U1VA 1A4RA 1X3SA 1Z5NA 3E2MA 4I99A 1N5MA 5HOQA 1E2KA 1CV2A 2J08A 4E15A 4YXWA 2W0MA 5JD4A 3RRXA 1R9GA 4N40A 1RRMA 5G0WA 4KQ1A 2BFAA 1WPXA 1QVVA 1P19A 4ZPJA 2Q3EA 2VNHA 3DOCA 3HG7A 3V55A 5MHTA 1G4AE 5E4YA 3SJUA 5LQDA 5BSTA 1QHYA 1TMYA 1C50A 1LFAA 2J59A 2C1EA 1G2PA 4MPPA 5FO1A 4MVXA 4HAIA 4N6NA 4GLLA 3N0XA 4KPFC 3PR1A 2MINA 5FBVB 3C87A 4EJSC 3D3WB 2FE4A 5AT1A 3RSQA 4YRZA 5AD1A 3LTEA 1RLMA 5KJ6A 4QELA 3E7DA 2AQHA 1USWA 1PS8A 1W5TA 4JIMA 1Q1NA 5G0TA 3WYDA 5AFSA 1KDRA 5BQPA 4DNFA 4IIHA 4R51A 1S2LA 1SXGA 3GLQA 4HWKA 2GKGA 3NHMA 4C6HA 4JNKA 1E4YA 5FLYA 5J1SB 3WR5A 3AEUB 4HLQB 5E7MA 4GOLD 1C1XA 1U8FO 4ENVA 3FPGA 1H1LB 2XT9A 4ZV4A 1Y6FA 1V2GA 2BGKA 4BEWA 4QKQA 2FU5C 1K8XB 4Q05A 1J7KA 3GO4A 3LQQA 4FZRA 3BE6A 4ZIRA 5B7PA 1AZLA 4WGFA 1OIWA 3P9XA 3IVAA 4YIKA 5D51S 4EG1A 5FPKA 5I7FA 5CBPA 3K1AA 5DBHX 2PCLA 5IHPA 3DMTC 3WB9A 4KBYA 3RPEA 2GJ4A 3RI3A 1TAHA 3KR9A 2O9JA 2O5VA 1GVHA 1T10A 1DG9A 1WHTB 3KIPA 2RAPA 5JSKA 5B58C 3A2KA 2CZGA 1CYDA 2A9RA 5FHRA 1N6NA 3AKEA 3O0TA 4HUQA 3QPBA 1M67A 2Y0EA 2ZPTX 2NTJA 4MUHA 5FWYB 5IDVA 1B0PA 1CDDA 4M1KA 2PK3A 4LHWA 5K0SA 5ISMA 4J2OA 4UAJA 5DM4A 3VI4B 2A5GA 2ZUDA 1G38A 1A5SB 4DLTA 4E11A 2HZBA 3E3NA 2HSJA 1E9SA 3N53A 3QKSA 5AH0A 3ZHOA 2EU8A 1QTQA 1R4NB 2PZKA 2AD5A 5EYPA 1SQSA 3GFVA 1CJUC 2ECPA 3PGLA 5CB4A 2AB0A 2XOEA 1Y5MA 3QEKA 2BR3A 4GNKA 1CDOA 3O4JA 1PJTA 4G5HA 4FHFA 3LF2A 1OAAA 1UBHS 1UL1X 2ZT6A 1J2UA 2Q99A 2ZPUA 3DZFA 4QHSA 1G3RA 1KEWA 1ZNYA 3FFXA 3OZTA 3MTGA 3GP8A 2CZQA 3WGVA 1T3TA 1H3EA 1N5KA 3GLVA 2YKGA 5AVJA 2XR1A 2YJZA 4K6MA 3LWZA 4URHA 1OC2A 4BGIA 2WZQA 3EF3A 2QUAA 4P4GA 1K89A 3FCSB 1Z4QA 3VPXA 4ZP1A 2M32A 4KDRA 1LPAB 2CDCA 1QQAA 3VR3A 3Q7SA 1OU0A 2BBOA 4X6YA 1JR3A 4RTLA 1C7QA 2IP1A 2COUA 3H1EA 3ADKA 2LWIA 3JQDA 4GLFA 4JVLA 4ZVVA 5IVHA 2GK6A 1N1MA 1NN3A 4ERXA 3BHNA 5FUQA 1P0IA 1I10A 3GDWA 1LFDB 1EAMA 4IJVA 4LOIA 5ITVA 4V2IA 5IABA 3WIUA 2FZEA 1MU0A 2ZI7A 4BFUA 1LW7A 2XYQA 3DL7A 2ZE5A 3ME5A 1T3HA 1FY2A 4G41A 4DSTA 2P5SA 3EXFB 1WW2A 3HY4A 3MRVA 3UAVA 4YMUA 3GEBA 3ZHBA 3G68A 1YS4A 1L1QA 4LMAA 2BKUA 2IITA 4OJMX 3TX2A 1SUBA 1SXHA 3U4QA 1JG7A 3GLHE 4NE7A 4CG2A 4V1CI 3R4CA 1IY0A 2IBSA 2OHJA 1H22A 2NO4A 1N9GB 4CG1A 1MA0A 3KWLA 1BEUB 4GWGA 5JAQA 2EARA 2SKEA 1RPTA 1R5OA 1ZIOA 2YHUA 1Q19A 1V9SA 2WJGA 3GFBA 3L07A 5FI1B 2QRMA 4IXNA 4BVFA 1YZKA 4JUDX 5DGTA 3U7RA 1KVQA 1V47A 2YQ5A 4MUGA 5D84A 2W70A 4E6PA 2AR7A 2A59A 2ID4A 2UXBB 4J0FA 2QX9A 1XZJA 2GN4A 3FNBA 4Y2SA 4EHDA 2APJA 1E9DA 3QHAA 4X63A 4XGIA 1SXPA 1JHAA 4M1WA 4A5SA 1X39A 1UFRA 4D9NA 4H7DA 5FJIA 1YASA 5JTUA 3WGZA 5B1HA 4NZZA 1NJFA 2H29A 2POQX 4R1QA 5DWDA 3TEFA 4QBKA 2JIRA 5KCZA 3A1FA 2BKVA 1QVWA 1WY5A 3QWBA 3CF6R 1CWUA 3PNBA 5J5VA 3KYCA 2VRBA 2AN1A 4W7HA 2LE0A 4F6RA 4KREA 2YWFA 4UMVA 4IOMA 5FCDA 1HK7A 1N2IA 5TMEA 4A8HA 3QE2A 1J0CA 2C03A 2YXNA 4JKOA 5CXXA 2Q4BA 3VX4A 4OMFG 4FR5A 3IB3A 4H59A