3JQAB

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-1,9-dihydro-6h-purine-6-thione (dx4)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
total genus 91
structure length 247
sequence length 267
chains with identical sequence C
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqaB00
1ENPA 1WNTA 2B36A 3NTRA 2C29D 3JQBC 3KXDA 3ZV5A 3PYMA 2GYYA 3DFZA 2D1YA 5FYDA 2PY6A 3GDFA 5DZSA 4RVUA 3UHAA 5JAMA 1VKNA 1A4UA 3GEGA 1PGNA 4JXKA 1M67A 3F1KA 4PRKA 4RO0A 4DLAA 3Q2IA 4E13A 4DL9A 4BGVA 2DC1A 4MVJA 2H63A 3FTPA 1BVRA 2OMEA 3CXRA 4GGOA 2I3GA 3B20A 3GPDG 1HSOA 1RPNA 1C1XB 2WYWA 4AJEA 3Q11A 3SVTA 2WE7A 4E2WA 2CVZA 3OETA 4ITUA 2NSDA 4F6LA 4FB5A 3L77A 3Q0EA 2BH9A 2OXIA 2EW2A 4IDCA 3VH3A 2O23A 3ANLA 1TVEA 4CR8A 1IYZA 1LQUA 3TJRA 1ARZA 4Z0PA 2WEKA 5C7LO 1JVSA 1WP4A 3NJ4A 4R3WA 1N7HA 5F5LA 2CF5A 2VUSA 1KBZA 3RJ5A 4BO6A 3IP3A 5CDUA 4NU6A 3IUSA 1D4FA 4CM4B 1P33A 1V9LA 2AA3A 3FPLA 1JAYA 1DFGA 4EUEA 5A05A 5IZCC 1YJ8A 5TX7A 3WGHA 1ZK3A 4B4UA 3WXBA 2WDZA 2J3KA 3DHEA 4YRAA 2HJRA 5FF9A 1KEWA 2VTDA 5THQA 1XR3A 4XDZA 4BB6A 1ID1A 1NQTA 1ZCJA 3TQHA 4EZBA 2EIHA 1MC4A 1O89A 1JWAB 4I5EA 3NRCA 5F21A 2NTNA 3QVTA 1IUKA 5A03A 3H2ZA 4M89A 1ONPA 3SXPA 1C14A 3DO5A 4AL4A 2DLDA 3ULKA 5EESA 1I3KA 1XQ6A 2E6UX 2FP4A 1Z75A 3UCFA 1WW8A 2FPPA 3FBGA 1ZW1A 4E5MA 1KC1A 2GF2A 1NR7A 2QW8A 4FFLA 5H82A 2C7GA 5I8ZA 1WXDA 4J90A 3K8ZA 2IXAA 2Y1CA 4LSMA 3NT2A 1PJ3A 3I83A 4CM4A 4PN3A 4NJOA 5K9ZA 3NT4A 4EJMA 3D7LA 3EZYA 3MWDB 4BUCA 1AXEA 3MTGA 1U28A 3M1AA 2VN8A 3DBRA 1Z73A 3GH3A 4N5NA 3WQSB 5TJHA 4UUMA 4J0FA 2RIRA 5ILOA 2I76A 1I5RA 1ZBQA 1A9YA 3CMCO 3OP4A 4JJGA 5ICMA 4KTVE 4XR4A 4II3A 1C1XA 4BO4A 1R12A 3FF4A 4WLUA 3FCOA 2NQ8A 1NPYA 3AFNA 1GPDG 2QRJA 2VHVA 3ROMA 2Y99A 4TVBA 3W4IA 3CKYA 2DQ4A 4HNHA 1HDCA 2ZYAA 3B1JA 3PVZA 1DXYA 3ZH2A 2V6FA 3U4CA 2DTEA 4O1MA 3VKUA 1C0KA 1DIHA 4G65A 4WNCA 4E21A 2D8AA 3G1UA 1LDMA 3OA2A 3ZV6A 1F0YA 3EC7A 4CLXA 4WOKA 2FWMX 2E37A 3RFTA 1U3UA 1M66A 1PS8A 3VZPA 4LMRA 2FZWA 3OH8A 2DPHA 4FW8A 3BAZA 2EJVA 1J49A 3TDKA 1A7AA 5A06A 4ID9A 5T67A 1R15A 4NNJA 1QYCA 2EV9A 3TZQA 1O9BA 1QRRA 4D3SA 2XOXA 5JE8A 1BW9A 1D3AA 3OIGA 4AVYA 4CQLA 3JD1A 2V6BA 4G2NA 3AFMA 5T64A 4N54A 5A9SB 1VI2A 1EK5A 1K2WA 1PWZA 1OC2A 1T2EA 2I5PO 5HBRA 1EUCA 2NNLD 2NU8A 1FMCA 4NQZA 5U9CA 5KVCA 4CJXA 5ES3A 3LU1A 2HMTA 4JJIA 4R5MA 4XYMA 3LVFO 3ZU3A 1LDGA 1R16A 4JCOA 4WCFB 1FK8A 3AOGA 3ZDFA 3W6ZA 3U4DA 3WICA 3ZWYA 1A7KA 1DFIA 1T2DA 2GASA 1EQ2A 1XA0A 4D41A 3ANNA 4ZQHA 2EWMA 1YWGO 3W4KA 1V3VA 2HK9A 4GI2A 4DUPA 2JD1A 3K92A 1DPGA 1GV1A 2ZK7A 3F4BA 4RPJA 3UCXA 3WOHA 3OQ1A 1HLDA 2PR2A 2VWQA 3PYXA 3R0IA 4HX5A 4DLLA 3DZHA 3OJEA 3F3SA 1QLHA 1LBEA 1MUUA 2EKLA 4JQCA 4FFRA 1DAOA 2AMFA 2AEFA 3HDQA 1YRLA 4CUZA 4HUJA 3F6YA 1O8CA 4CM8B 2OGUA 4FFPA 4FR5A 4B7XA 3JYPA 2HSDA 4EEXA 3GR6A 3VDRA 4ONEA 4AJLA 4HNGA 3E03A 3GDGA 3WIDA 4HWKA 2GCGA 5L53A 1EE9A 4UVGA 3GNQA 3VH2A 5KJFA 4R3NA 3QJ5A 3STHA 3QV1A 5JC8A 1G0NA 3NDIA 1JWBB 2D3TA 2PZKA 4Q3CA 1JAXA 2I9PA 3ONFA 4ZQBA 1U2DA 5GMOA 2OFPA 4KMSA 3FNGA 5JNLA 4XD2A 2Q1TA 4CL3A 2PD4A 1VSUA 4XB1A 3WG9A 1KVUA 3PWSA 3WMWA 4NDNE 3GGGA 4CL8A 5L3ZA 4IDFA 3ZHZA 1DC3A 3RWBA 3SJ7A 3OJFA 3X2EA 2J5KA 3DBLB 3I6QA 4L4SA 1FF9A 2FSVA 4FOSA 3RAJA 4BNHA 1JU9A 3T4XA 2DBVO 3PFFA 1ZVMA 3OJLA 2PZMA 3NGLA 4NMHA 4GX0A 2RAFA 1DB3A 5A3JA 4MPDA 3E5MA 4J0EA 1E3SA 1Y5RA 1ZMTA 2GR9A 3S2IA 4YAKA 4D3DA 2GNAA 2R00A 3DTYA 1KY4A 4J4BA 4XGKA 3MJ4A 4J7CA 4P4NA 4A2CA 3QWFA 3SLGA 3AM3A 1DOHA 1PS9A 3DBRB 4XJSA 1RYEA 1KIFA 4XWYA 1BXGA 3Q9NA 4JNKA 1EMDA 3V5NA 5L45A 1DIRA 3L6EA 4YYZA 1SEVA 2PV7A 4OMUA 2C07A 2BD0A 1GADO 2OL4A 4FJ0A 4D43A 3DTTA 5T6BA 9LDBA 1WWKA 3DBLA 3L6OO 4EYEA 1PJLA 4INAA 1XHLA 1ZK2A 4QFCA 4TROA 4YJFB 4EEZA 1CDOA 1PU2A 1B3RA 4BNVA 4E12A 4AJHA 3VZRA 1H9BA 1SEPA 4DIFA 4UVHA 4OXYA 2FSSA 4E2ZA 5DBFA 3V2GA 2X23A 1QYWA 3EW7A 3VPSA 3TF5A 1PJCA 4R1UA 2DTXA 2B5WA 2QRKA 3S8MA 3CIFA 5B4UA 2PKRA 2BF7A 4CQLB 1R4MB 1GD1O 2CDAA 4L4XA 1E6WA 3PJFA 4YAJA 1QORA 5A5FA 1M6WA 1Y7TA 3JQ9C 3O9ZA 3ZWAA 5F3RA 1ISHA 4J9UE 1FDTA 4RVHA 4BO8A 2BFAA 5IG2A 2PFGA 1C0PA 3GN2A 3CPSA 1EZ4A 3RJ9A 3PXXA 3QY9A 3RSHA 1P74A 2SCUA 4RF2A 4CQMA 4BNTA 1Q7CA 2JAPA 1X1TA 3HB4X 1HTBA 2ZB3A 1P1FA 2ZB8A 1HDYA 4CLOB 3RU9A 4WLOA 3RC9A 5BSGA 4BNXA 1E3EA 3A9WA 2NQTA 3RROA 3DONA 4FS3A 4NJMA 1JDJA 5A3VA 3BZUA 3ZU2A 3NEPX 4BMNA 1E1NA 3MOIA 4LVCA 1V6AA 4RZHA 2VNAA 1TT7A 3T4EA 4I5DA 1EDOA 1I3MA 4CM7A 3JTMA 2OORA 3IIEA 1YL7A 2JL1A 5AXBA 4BB5A 3EDMA 3V2HA 4CQMB 4ND4A 4E5KA 3AUTA 3V8BA 4IXTA 5CFZA 4E5PA 2FR0A 5LC1A 3VPXA 4XIJA 3LT4A 5K6AA 1T1RA 3BIOA 3FWZA 4XJTA 1E1LA 2AHRA 4IPTA 3WTCA 4I5FA 5LCXA 5DBGA 1PZEA 1ZEMA 1PS0A 3OBBA 4D45A 2Z1NA 4IQ0A 4NBTA 3ITDA 3RIHA 1YGYA 4GKVA 3ZWCA 1RM5A 4AJNA 2VOEA 5B12A 2Y1OA 1N92A 2P5YA 2NU7A 1KVQA 1I3LA 4H15A 1BXZA 1ZK1A 2FRDA 3ONDA 1E6EA 1YKFA 3WLFA 4YB8A 3UCEA 1GDHA 1BMDA 4BO1A 3ENNA 3ZW9A 1NVGA 5TS3A 2DT5A 4O6VA 4CR6A 1ZZEA 1E92A 4UVDA 4AJIA 4BNFA 3HE3A 4PG8A 5IXSA 4FJ1A 2HU2A 2QZZA 2V6MA 1H93A 3OEYA 4II2A 3IS3A 4NU5A 1X15A 4NR0A 2PLAA 5G0WA 1N7GA 3TFOA 3UUWA 3ZNQA 1OC4A 3GF4A 5F1OA 2UYYA 1YE3A 2CVQA 1Q0LA 2OOSA 1P0FA 7MDHA 3PHLA 4BO2A 4EDFA 5HWSA 3W4JA 3AUUA 1U7TA 1R37A 1A27A 3V2UA 4B8ZA 1E77A 1EUDA 1Z6ZA 1U9JA 2E4AA 5A1TA 3H2SA 2QIOA 4RVGA 2IDZA 5EQFA 5JW6A 4GVLA 1Y8QA 4GMFA 1PQPA 1A71A 2NVUA 1JKIA 1ZSNA 4YVFA 1DRUA 1I33A 2FMUA 5JSFA 1HZJA 5I7SA 4YCAA 3VOSA 4GPD1 4RPGA 2O7SA 1NWHA 4XRGA 5KJ6A 2BFMA 4CPDA 4NZ9A 3NGXA 1QSGA 5T5QA 1PL7A 1EE2A 1I2CA 4YA6A 4BNYA 1M2WA 4X54A 3FTNA 2JFHA 3HZZA 4A10A 4BV9A 3RUDA 1NQOA 2PKQP 1WMAA 1PEDA 4MVJM 5L7TA 1PL8A 2GZ1A 1PGPA 3D5TA 4YTEA 1FJHA 2G5CA 2POQX 3NT5A 5KCZA 1V35A 4FC7A 3G79A 4XYLA 3DAFA 2ZYDA 3WTBA 3EVNA 2P4HX 3G3EA 2J3JA 1V0JA 1HF3A 4JIGA 4CM6A 3QWIA 1NVMB 4CMIA 3IKTA 5LDHA 2G1UA 1CIVA 1A4IA 1YB4A 4K1LA 1NVTA 4EBFA 5ICSA 2AQIA 4UVIA 1SO8A 3FHLA 3ZWOA 2AEMA 3I9NA 3C24A 4K28A 5JPIA 3ZWVA 4BGEA 3FNFA 4DMMA 5IDQA 3C1OA 5CDTA 2YV3A 3DFUA 1M76A 3DZKA 1LSOA 3Q6IA 3ZNNA 1MG5A 1V8BA 3JQGA 4KDFA 1YXMA 3FN4A 4FGSA 1PJQA 3DZJA 4BNUA 4XQ9A 4YJGB 2Y67A 4KWIA 3ZWMA 1CYDA 3IC5A 3PHGA 4L76A 4WCFC 2EEZA 2A35A 1U8XX 1H9AA 2H6EA 1T4BA 2WTBA 4CLOA 1IHXA 1LDBA 5BSHA 3C7AA 3WJ7A 1SMKA 2VWPA 5G4LA 2B37A 4H7PA 2IRWA 3H8VA 4PG4A 1F17A 2VHYA 3BMNA 4U0KA 3LZ6A 1QMGA 3U49A 2YFHA 3F9IA 3BHMA 4WJZA 5I7EA 3JYOA 3M2TA 4E33A 4OXNA 3T7EA 3WIEA 1MB4A 3VHRA 4CM3A 2W2KB 4J7XA 1XQ1A 1DRVA 3K31A 2IYOA 1EVYA 4IJWA 2D5AA 2WE8A 4FC6A 1B7GO 4CMJA 1GY8A 1HDGO 1VL6A 2YQ4A 2NVBA 5KOIA 1PR9A 2VCYA 2VHZA 3JQFA 4ZJUA 1LA2A 1IZ9A 4EI2A 3KEQA 2HMUA 1DAPA 1KETA 5CEJA 4GX2A 3AUSA 1BDBA 1YO6A 4WLNA 2A4KA 4UUOA 3I6IA 4P8RA 3RI3A 4QTZA 1A72A 1ULSA 1Q0QA 3W6UA 3ZHYA 4J49A 1GCOA 2JFFA 1VLLA 3SC4A 4CMEC 2NV6A 3BTVA 4PVDA 1P9LA 2BGLA 2EKPA 5EINA 2DUUA 3LK7A 1I36A 1P3DA 2NM0A 4NK5A 2HDHA 5IN4A 3RBVA 4RCVA 1DO8A 3JYQA 4JLWA 1WDLA 3WSWA 3LT2A 4OKIA 3ZU4A 3P2OA 3FWNA 3KB6A 4CMGA 1X7GA 1RJWA 4RORA 1AHHA 2OZPA 2B0JA 3AOEC 2G76A 2QYTA 4L4RA 2X1HA 3VPHA 1HSZA 4JROA 1Z45A 3VPFA 4OXKA 3PPIA 3ZNOA 2C5EA 3H7AA 4PG7A 3KYCB 1LC0A 2YHIA 4WE3A 5DNAA 5DOVA 3JYLA 5T57A 4CMCA 5TC4A 5AXAA 1IPFA 3ETGA 4GX5A 3CZMA 2EP5A 3BMQA 1XSEA 2PK3A 3Q3CA 1R4NB 5DP2A 1EVZA 4PG6A 4K6FA 4J2HA 4FCCA 2TMDA 3FD8A 4WLVA 5BSFA 2C2XA 5JMPA 1H6CA 2Q99A 1LLCA 3TN7A 1UDAA 1HLPA 1N9GB 3U09A 1U5AA 4MOWA 2P9EA 3IUPA 3M6IA 3FI9A 3QA9A 1GAEO 4ZICA 3WWYA 4AJKA 4W7HA 4B7UA 2EHDA 3IAHA 1P45A 3GHHA 1ADGA 3H3FA 4RL6A 5HS6A 3VKVA 3CUKA 2B83A 4J6FA 2E82A 5TQVA 3BTOA 1JKFA 1LSJA 1GFSA 1K5HA 3DZBA 1YB1A 4IQ8A 5G0UA 3RQSA 3ST7A 1DIBA 2UVDA 1SAYA 2BI7A 2QX7A 5DP1A 1E7RA 1NWCA 2A92A 3GMDA 3D0OA 4FOOA 5CP8A 4TKLA 5L9AA 2DBRA 2RHCA 4M87A 3KVOA 5IAAA 1E5QA 1HDXA 3D3EA 2X4GA 2EXXA 1U5CA 2V65A 1ZEJA 3PDUA 3R3JA 3GUYA 3GVCA 5CPBA 3WNQA 3AI1A 3GNSA 4UVEA 1HE3A 1SB9A 1IZ0A 4OH1A 1Z74A 2VYVA 4IZHA 2Y05A 4OJNA 4YQZA 1NPTO 1HYEA 2YYYA 3DXFA 3B6ZA 3IQDB 3UKOA 4FDAA 1R0LA 3K73O 4CMIB 1E7WA 2AQ8A 2EGHA 1FXSA 1ZSYA 3PEFA 4FD3A 1UAGA 4A5OA 1JW9B 1X7DA 3ITKA 3MWEB 2BLLA 1K0UA 1YH3A 4XGIA 3Q9UA 4RQTA 5G0SA 4BKPA 2WYUA 4MVJI 1K6JA 4QSMA 2BHLA 4N7RA 1KVTA 2LDXA 4ALLA 4QUKA 1DFHA 1C0LA 2HCTA 1Y6JA 4E30A 3WGIA 1B26A 1LTHR 5FI3A 4D3FA 1HE2A 3OF2A 3WYEA 3WX0A 2GZ2A 3IMFA 1W4ZA 3RBZA 5ILGA 1BHSA 5DCWA 2O2YA 4GMGA 3E18A 4YJHB 4GWGA 3WJAA 1WZEA 1LNQA 3AWDA 5KVVA 4E2XA 5C37A 3DC2A 3ABIA 5G2OA 3I5MA 1Y8RA 2BELA 4PZCA 1Y5MA 1GU7A 4GQAA 3GFGA 2AXQA 4F45A 4XRRA 5K0ZA 4W99A 3IJRA 1ZUD1 3JQDA 2DFDA 1EFLA 2I67A 3B70A 3LC2O 3GC6A 2EF1A 4PLHA 1HETA 2P5UA 3K96A 1PJBA 2OHXA 4D0RA 4MP8A 1E3JA 3DWFA 3OHSX 4Q3AA 5KVSA 5HTOA 2H1SA 1FDWA 1FDVA 1XEAA 3NUGA 1SCUA 3NAQA 3TWOA 4R9SA 5DCUA 1LRLA 4LW8A 3AU9A 4UUNA 4D0SA 2E48A 2NVWA 1YOVB 1ZK4A 2OBYA 4IGFA 2VWHA 4PCVA 1C0IA 4Q3DA 3O38A 5I9NA 1EDZA 2HRZA 1KEVA 2WSBA 4R16A 2B69A 1U3VA 4NBWA 4QXMA 4FFOA 2HK7A 1LU9A 4UEJA 2O3UA 4MIEA 3JQ8B 2UAGA 4RPKA 1HL3A 1GEGA 4W7IA 4EITA 3LF1A 2JFGA 1SZJG 3JQGB 2X22A 4KTTE 1T1SA 3KHUA 5CEEA 4EJ6A 1Z7EA 1ZNQO 3SEFA 4XKJA 4HADA 4YJGA 2Q1WA 1DC4A 2GUGA 3MZ0A 2X8LA 1P1RA 3AU8A 4GH5A 4GKBA 5DCYA 2PZLA 4D46A 4A26A 4Z9FA 1ENOA 3Q2KA 4J3FA 4OOFA 3I9OA 4FGWA 5ITWA 5JBIA 4PLTA 1Z82A 1OMOA 4PLGA 1OI7A 4YT5A 2D4AA 4YPOA 1H2HA 1BG6A 1QR6A 3QSGA 4RVDA 2VZ8A 1ZSVA 3OEWA 4QQRA 4RDIA 3FBTA 3GRKA 4E5NA 4F3YA 1TT5B 4W4TA 1YOVA 3N58A 2EKQA 1PWXA 1MP0A 1MX3A 4QFDA 3WQRA 4R4JA 1MXFA 2ZB4A 3WGGA 4MP6A 1PJ4A 1W6UA 2PGJA 3QVWA 3ZWBA 2IZ0A 2HRBA 1NP3A 3JQCA 5JDCC 2PH3A 3H6KA 3S1LA 2YZ7A 3K30A 1PZHA 3C8MA 1TI7A 4CLDA 3KETA 2ZYGA 3WGOA 5JDIA 3JQ7B 1KC3A 2YV2A 1AUPA 1LDEA 5CG2A 4DREA 4PLWA 3ZU5A 4BKOA 4IIVA 3BMOA 5GY7A 4BO7A 5F1PA 4EGFA 4HXYA 1E7QA 3NDRA 4YR9A 6LDHA 1HWYA 1GPJA 4NFYA 3O26A 2O3RA 2GDZA 4Z3DA 3MEQA 1UZLA 4IS3A 4IY1A 1VJ0A 3W8EA 4DBVO 5L51A 2ILTA 4LRTB 4RDHA 5IZ4A 5A04A 3GG2A 5J23A 4DPMA 2VNSA 1U2GA 3GAFA 3GZNA 3EGOA 4L75A 5CAEA 1NBOA 4A73A 3DQPA 4B7CA 4WGGA 3I9KA 3BA1A 4IBOA 1JVBA 1R0KA 2JCXA 3L9WA 5G0TA 3JQEA 2YHIB 1MGOA 2IZ1A 3GY0A 4B4WA 2GO1A 4ND2A 3SC6A 4QEDA 4BNJA 4OYRA 5JCJA 1S7CA 1QG6A 2P68A 2X0RA 2YUTA 3DAGA 3PZRA 1MFZA 4IXWA 3MJTA 3LT0A 1O5IA 3TNLA 2PA3A 4BHTA 3PRJA 4B4VA 4N5LA 2EJWA 1VL0A 3K5PA 4YWJA 2Z5LA 2O3SA 3O03A 2HK8A 4PGFA 5JS6A 4W6ZA 4XYBA 3ZWXA 2YW9A 4QO7A 2ZTMA 3K9QO 1ZO8A 2HO5A 4CV2A 4H16A 2GSDA 2ZTVA 4NK4A 1HZZA 1LDYA 1LX6A 3PWKA 4GBJA 4ALNA 4E31A 4YAIA 2B35A 3OICA 3W1VA 2PH5A 3GQVA 2BRUA 5L7WA 4OAQA 4DPKA 4OIMA 1DJNA 1PZGA 2X6TA 4CLRA 3WGTA 2YFQA 4J16A 4CR7A 1OBFO 1NHGA 3AY3A 2Q46A 3FRJA 2X7HA 2CSUA 4BOYA 4I08A 3WBBA 4JJFA 4ZN6A 2Q1UA 3SLKA 4R51A 1PTJA 3H65A 1BRMA 1RWBA 2Q2VA 2TMGA 3KUXA 3EK2A 3A14A 2DFVA 2XXJA 2W2LD 3JD4A 2XF8A 3ZI0A 3PLNA 3GGPA 3RVDA 5JC1A 1UDBA 1QXSA 1OZAA 5TT0A 2VQ3A 2IXBA 1JA9A 1Y9AA 3GK3A 1ZXLA 3QIVA 1GZ6A 3PGJA 3RKUA 3ZWWA 1GUYA 2JCYA 3VPGA 3ETEA 3G17A 4LVUA 3H4VA 3TZHA 5DT9A 3WQQA 1ISIA 2W8ZA 4WKGA 3JQ6A 1DSSG 1GYRA 3BMCA 5ER6A 1A5ZA 2UUOA 2WM3A 4CLRB 1P44A 2OO5A 5AXCA 4JN6B 4J1QA 2R6JA 2ZATA 4IS2A 4K6CA 4NFSA 2FY8A 2G82A 2YHUA 1LRJA 3U4HA 3L0DA 3RC1A 1CERA 2BFOA 4BNMA 4NI5A 4ESOA 4HFNA 1HEUA 3EY4A 3KO8A 1E1KA 4GSKA 1P1KA 1F14A 3U3XA 1Z7BA 2PGLA 1MXHA 3R3SA 4CV3A 1KERA 3VH1A 4AJOA 2W90A 3HJAA 4YDRA 1YL6A 5G4KA 4CM8A 3HG7A 3ZWNA 1LUAA 2ZKLA 3P2YA 3D1LA 4ILKA 4NIMA 1BXGB 2BKAA 2IZZA 3JV7A 1OFGA 1H6DA 4ND1A 4O0LA 3PQFA 3U0BA 3WWZA 3I9MA 1I10A 1H5QA 1D1SA 4NFHA 4DWVA 3V1UA 1PJSA 3L07A 4K9DA 4U5QA 4CUJA 4RLHA 4DC1A 1NQ5A 2NUAA 5TLSA 1EEHA 4Y6SA 4BQRA 1IL0A 4CM1A 4XR9A 5TF4A 3OJ0A 3GGOA 1IPEA 2HMWA 4P4LA 1Q1NA 4Z9XA 4R9RA 1ISMA 1WDKA 5B4VA 2C7VA 2FHSA 1N2SA 1GTMA 4ND5A 3RUFA 4BGUA 2CF6A 3H9JA 3E8XA 1PX0A 4NJMB 3KM0A 1O94A 3RBXA 4PIVA 5C7OO 3CINA 4R1TA 3K6JA 4HFJA 4WPGA 4RLSA 1P1IA 3AUAA 4AFNA 9LDTA 4C7KA 1KOLA 4LK3A 3QWBA 3RUHA 3ORFA 1XDWA 3INGA 1UZNA 3ON5A 2DM6A 4B3JA 4L73A 4FSHA 4D44A 4R68A 3UVEA 2ZIZA 3W8DA 4MVJE 1VJ1A 3PQDA 4FJ2A 5KKAA 3D4NA 3RC2A 1ISJA 5TJ9A 1Y9EA 4IDEA 2BI8A 4YJHA 3RC7A 1F8GA 2GN9A 1WAMA 4B79A 1ZJZA 2WMDA 2ZTUA 3JD0A 4NBRA 1AN9A 3DBHB 3GAZA 4YRBA 1EVJA 1ZFNA 5AQ1A 4MKXA 2QRLA 2AE1A 4MIOA 4J4TA 4F6CA 1YB5A 4IIUA 1HT0A 1UP6A 1U3WA 4BNWA 4ZVVA 2RBEA 2JAHA 3EUWA 3UW3A 1Y1PA 1F06A 1MC5A 5KWEA 3IL2A 4J1TA 5JCXA 4K26A 1NNUA 2DBQA 3DBVO 4YJDA 3RUEA 1SBYA 1B3BA 4CMBA 5AOVA 3AY7A 3ASVA 4AJPA 2VUUA 2EERA 4E4YA 2P9GA 1KVRA 4XDYA 4BO9A 4J7UA 2VOJA 3KYBA 5JYEA 3Q1LA 2YDXA 3LLSA 3ICPA 3LDHA 3E9MA 3OIFA 1W73A 4CMEA 4ROSA 4RF3A 2ZJ1A 4IDGA 1ENYA 5G0VA 1GL3A 1ISGA 1KVSA 3HDYA 1DLJA 1R6DA 3NTQA 3PWZA 1I30A 2OP1A 3H3JA 1C1DA 3PJDA 4ZU3A 3M2PA 4TRRA 5IZCA 3C1TA 4DRYA 2AQHA 4I9NA 4A0SA 1PIWA 2NACA 2GRAA 5IXYA 3I9LA 4QX6A 3HNPA 2NLOA 1DEHA 4MKRA 2F1KA 4TRNA 1YDWA 3JSAA 4LMPA 3E1KA 3GEMA 1NM5A 4Q3EA 3U9LA 2ZTLA 4OO3A 4N5MA 2ZB7A 5AYVA 3S55A 5EMHA 4LRSB 4BKQA 2F00A 3WBFA 1I2ZA 2I6TA 4XA8A 2X5KO 3RUAA 4OQYA 5MGBA 2DBZA 4BMSA 3D3WA 3KYDB 1GZ3A 1KS9A 3PFWO 5C3MA 1PGJA 2YQ5A 4C7JA 1T4DA 4JBHA 3ASUA 3WFJA 5IF3A 2LDBA 3RFXA 1O95A 3TOZA 2FOIA 2EG9A 1LSSA 2C5AA 2P9CA 3WS7A 4TZKA 1K6IA 2FR8A 3GVXA 3KSDO 5ENVA 4BNNA 1V3TA 1YBVA 2VHWA 1MG0A 3OFSA 4KZPA 4IDBA 3NDJA 2IODA 4ZA2A 2I65A 2PD6A 2R00C 1D1TA 4XB2A 3EAGA 5CDGA 1X13A 4O59O 2A9FA 4B3IA 2WD8A 1I3NA 1IHYA 1NFRA 5T8KC 4CV0A 3UOGA 4JBGA 4KQXA 2P4QA 4XYEA 1EBFA 4OOEA 3DOCA 2PWZA 3GT0A 1Y81A 3DOJA 1W0CA 1D7OA 2YY7A 4KUGA 5BT9A 3KRTA 3D3WB 2C82A 3OIDA 4D7AA 5DF1A 4AG3A 2XAAA 2NVUB 1Q7GA 4RVSA 4IMPA 1ZKMA 2WD7A 4MDHA 1U7HA 1E3IA 4RPHA 4Z9YA 1MLDA 2X0NA 4RQUA 5JAIA 5K6AC 3TSCA 2C59A 1XU9A 5H81A 2V7PA 5AXDA 2I99A 3AI2A 3S2EA 1SPXA 3ADOA 4FBGA 5CDYA 5CDSA 4GLOA 1HE5A 4TSKA 5AVOA 1J0XO 3GZNB 4DA9A 1P1HA 2WYVA 1T2CA 3R1IA 4EUFA 1SOVA 2PZJA 1XCBA 4NG5A 2O3JA 3QWAA 2ET6A 1E7MA 1JLLA 3EMKA 3GEDA 2Y0CA 3RCBA 1B8UA 3ICCA 2CUKA 1UP4A 4CUKA 1CETA 2GLXA 4BS9A 1VKOA 3AK4A 3ROPA 2CNBA 4A03A 1DLIA 3E9QA 4IZIA 1TT5A 3QVOA 1IOLA 4MJLA 3MCVA 1B8VA 4R01A 4Y6PA 3F5SA 5A9SA 4IINA 4A27A 3KLMX 1GR0A 4LN1A 1ONOA 3VZQA 3TZCA 1RM0A 4GAEA 4YAGA 3ONEA 3KYDA 3D4PA 4LSWA 4HBGA 1I8TA 1BWSA 1QV6A 4Z0HO 1HXHA 4RPLA 3BHIA 4PRLA 2Q4BA 1L1FA 3K2BA 4GGPA 5ENDA 3KV3O 4F46A 3UGKA 4CQMD 4YT8A 4JP2A 4BNZA 5CG1A 4XQGA 1CF2O 5EPOA 4URFA 3WB9A 5C7IO 2Y0EA 3NTOA 5FEUA 1X1EA 4EJ0A 2C0CA 1NFQA 3MJEA 2VT3A 3TRIA 1LDNA 4E6PA 3I52A 3GPIA 3WMXA 5DOZA 3H9GA 3KTDA 3MJSA 3AY6A 1J6UA 3BTSA 3R6DA 1LEHA 2G0TA 3V1TC 2HKIA 3A1NA 2AE2A 3TZ6A 1C1DB 2Q4EA 3BTUA 4R69A 4QECA 3VTFA 1V3UA 1WPQA 1IE3A 1CQJA 3LC1O 1TXGA 1I32A 4JGBA 1E3WB 2PGDA 2Q2QA 2VT2A 5EN4A 3UF0A 5L4NA 3F5QA 1E6UA 2PTGA 1G0OA 4FIZA 2NWQA 1E3LA 2Y68A 4FPXA 4UREA 1ISFA 2AEJA 4DPLA 3LYLA 1YJQA 3T7CA 4L9RA 4UEOA 7ADHA 1IY8A 3FR8A 5DULA 2GERA 1NYTA 4WNIA 5I9LA 1TLTA 1ZIDA 4TMFA 3PIDA 2J3IA 4DMLA 1ORRA 2PKQO 3GA0A 1KEUA 1VL8A 3L9XA 3SBOA 2D5CA 4AJJA 3NJ8A 2DAPA 2ZCUA 4UAGA 2B4QA 4AICA 1VPDA 4YRDA 5TRTA 2PD3A 3CMMA 4ZGWA 1X14A 3DB2A 4BMVA 3RU7A 1XG5A 3HADA 5IDWA 4XQEA 3EVTA 2O7QA 3VDQA 3MJCA 3QRWA 1U8FO 3HFGA 3JYNA 2JHFA 3BXXA 3L4SO 5TSDA 1U3TA 4DC0A 1LRKA 1E3WA 2VUTA 4HKTA 3AI3A 1LLUA 1EUZA 3AJRA 5B37A 3KZVA 4C4OA 4TZTA 5EERA 1UZMA 2X9NA 4FN4A 3ZZNA 1LSUA 1UUFA 1JQBA 4M49A 3W8FA 1N1EA 1OOEA 4M54A 5U4QA 4ZQGA 4G81A 1K6XA 3NV9A 4R5HA 4PZDA 3ZNPA 3PYLA 3UAGA 5CPFA 4S3MA 2HAEA 1NTOA 3DZIA 3GN1A 1QKIA 5A9RA 1B16A 2Z95A 4UEKA 5KIAA 3RD5A 5JO0A 3E6AA 3VZSA 1QYXA 2Z1MA 1MA0A 3A06A 3ETDA 3IKVA 5U1PA 3IJPA 1PJ2A 3TOXA 1DHRA 3GOHA 1N1GA 4DIBA 4ALJA 2Y1FA 3B1FA 4U8GA 1GUZA 4NBVA 2OBNA 1SB8A 2VRCD 4BL5A 4WOJA 5ADHA 1R66A 2Y1DA 1ADFA 1DC5A 3GNTA 5ER9A 4WK6A 5IJZA 5JLAA 2O50A 2D0IA 3DBHA 1NQAO 1VJTA 3D4OA 3AM4A 3H9UA 2DVMA 3PTZA 4FQ8A 4IGEA 2NTJA 4WEOA 3KOUA 5TGDA 1PL6A 3S2GA 5JY6A 4EUHA 3E82A 2Q45A 5HM8A 1A9ZA 5A02A 2X0JA 4R41A 1VSVA 3DZGA 4Q39A 4YBZA 2J3HA 3F46A 4MVJH 2JD0A 4DQUA 2Q49A 1TB4A 3IOYA 1UXJA 3ZCXA 5IN5A 5KJCA 1ZH8A 4IQGA 2DPGA 3OECA 3TL3A 3WDSA 3PHJA 2AG8A 3C7CB 4KQWA 1HYGA 4BKRA 3CEAA 1YQXA 5IDXA 1H2BA 2W2LA 5KNLA 2O3QA 4HV4A 2BMAA 3AOEA 1XGKA 1HE4A 2BGKA 4ZRNA 1T25A 4DBZA 2QQ5A 4YXFA 4PLCA 4LCJA 3UH1A 4RF5A 4WCDA 2HLPA 3L4BA 2C54A 1I0ZA 1BDMA 1T26A 1X7HA 2AQKA 4FFNA 1CWUA 4L74A 5HA5A 1J5PA 3BMCB 5A5EA 8ADHA 5JCJD 3E5RA 4PLFA 3F1LA 1X0VA 5FI5A 4DGSA 1WLYA 1R4NA 4U7WA 4BNLA 4IM7A 3TL2A 4BVAA 4NBUA 4NHEA 1W8DA 3ZV4A 2Q2WA 4JK3A 1H94A 3G49A 5L4SA 1MV8A 2GN4A 2UDPA 3BYZA 3I4FA 5B1YA 3GG9A 3JQFC 3PZBA 4OQZA 2O4CA 3DR3A 1PQWA 2GZ3A 3P19A 1Y8RB 4J1SA 4XZ3A 1QYVA 3FNHA 3LT1A 5I8WA 5JMWA 4MVJD 3ZHXA 4JP3A 3ZW8A 3INRA 4XEHA 3NKLA 4QO8A 2EW8A 2JJYA 1T2AA 4L8VA 5JAZA 3GVPA 1T24A 4DXHA 1YONA 3VAZA 1EK6A 3OA0A 5I9MA 1UXHA 3E48A 5TNXA 3U62A 3PDJA 3PJEA 4AJ4A 2O2SA 4PVCA 1Y8QB 1B8PA 4ND3A 5COBA 4MIYA 5LDGA 3RFVA 1DRWA 4E5YA 5TIIA 2QHXA 4GWKA 3HQ4O 3GRPA 4MP3A 4PLVA 3K2EA 5TT1A 5JDCA 4OHUA 2JHGA 1FDSA 1IB6A 4WUVA 4WLFA 1CQIA 4BIIA 4BO0A 2X9GA 4DLBA 2FPIA 3NX4A 1ZK0A 3PP8A 2CDCA 3DHYA 1NPDA 4W9NA 3GVIA 1RM3A 1EVIA 1PGOA 1PQUA 5GZ3A 1LJ8A 4FFMA 2FR1A 5BR7A 3KSUA 5COQA 1ZMOA 2X0IA 2HJSA 2VYND 1BXKA 3DMYA 4AJ1A 1WDMA 3PJGA 2I3AA 5HS4A 1J4AA 1QYDA 3ENKA 3GZ4A 2GN6A 4M8SA 3WGYA 1B15A 3WNVA 5BSEA 4TWRA 4HFMA 4YJFA 4UULA 4I8XA 1NX6A 1OAAA 3PGXA 3RUCA 4A7PA 1AE1A 4PFJA 3DMTA 4PLPA 4BO3A 4GVXA 5IFLA 1K3TA 5I7FA 1H6AA 1DC6A 2J6IA 2CFCA 3OSUA 4GLLA 1NAIA 3DDNA 4XQCA 5BQFA 1BVUA 3JQ9A 3L6DA 4CLHA 4CM5A 3CZRA 1KY5A 3UXYA 3JQ7A 2CD9A 1VE9A 1CEQA 5DDIP 4Z0TA 5G4KB 3LC7O 1Q2XA 1HDRA 2IEBA 1EBUA 1L7DA 5GZ6A 4I9UA 3FNEA 3BMQB 1U4SA 4IDAA 4P38A 4R54A 4U6QA 2X58A 3GLQA 4CM9D 4GSLA 1XU7A 3MOGA 4Y67A 3OMLA 3WGZA 1MFPA 2D2IA 3QQPA 3WGQA 1LQTA 3HUDA 1UAYA 3H5AA 5JDIC 1DHTA 1H0KA 1LXCA 4PG5A 4YT2A 3M1LA 4UUPA 4NPCA 2ZJ0A 2VHXA 5CHEA 3WLEA 2NTVA 2W98A 2YV1A 3U4IA 2YDYA 3ZV3A 1QV7A 4ALKA 2NU6A 2VZ9A 3EZLA 3C3XA 4PZEA 3SX2A 4J4HA 2FN7A 5KTKA 2RH8A 5F1KA 3OM9A 2V6GA 4DQVA 3VH4A 1N9GA 4Z6KA 2VYVD 3FSRA 3ROQA 3HWRA 3TZKA 4ALMA 2Y93A 4Y9DA 2CVOA 3JQAA 4OM8A 4H3VA 2BFPA 1JKJA 3PI7A 2OP0A 3OJOA 4DYVA 3ANMA 3JQBA 1BGVA 2BGMA 2RHRA 1C3VA 1TA4A 1VRWA 2HMSA 3PQEA 3WSVA 4BQPA 4ZD6A 3GVHA 1U1IA 1P77A 2CZCA 3MJVA 3O4RA 4RV9A 2I66A 4Q9NA 1HDZA 1N5DA 1P31A 1WMBA 3EHEA 3ROKA 5BNIA 1R4MA 2J5QA 4RJTA 1IULA 4YAEA 2CY0A 3P7MA 3QLJA 4LCEA 1G1AA 1B14A 3RKRA 1M6HA 2R2GA 3BMNB 4MO2A 3IDSA 1S6YA 3HHPA 5JY1A 4D42A 1H6BA 2VRBA 1KYQA 1BTOA 4XCVA 1CRWG 4B8WA 4ZQFA 2H5LA 1EFKA 2VTEA 1O0SA 5JFOA 1NR1A 3BMOB 3HDHA 3FPCA 1ZXBA 4DQXA 3I9JA 3D64A 5JXWA 4E3ZA 2Q1SA 4U0JA 5EIOA 1GUFA 3UICA 1HYHA 1NAHA 1NFFA 3D5QA 5L7YA 4J1NA 1LC3A 4R1SA 3OQ6A 4YQYA 2GD1O 3L4BC 3KBOA 5A9TA 1Q7BA 3PHHA 1XIVA 4OL9A 2QYSA 1RYDA 1HDOA 4Y98A 2JKVA 4J2OA 4JX8A 4N18A 4Y8VA 3H9EO 5JO9A 1YL5A 1M75A 3F47A 4B4OA 1RM4A 5KJEA 4I5GA 1K89A 5T8KA 1DDOA 1KEPA 5BNFA 2Q3EA 1E1MA 2ZQZA 1R0SA 3H5RA 2X5OA 4MINA 3EYWA 1UXKA 4LGVA 1QLJA 1GV0A 3H5NA 4Q3BA 3KEOA 1ML3A 3N7UA 2XPCA 2X9VA 4QT0A 3SJUA 3WR5A 1PZFA 4P22A 4BNGA 4RF4A 2DU8A 4CODB 1QP8A 4BNIA 1ADBA 2H9IA 3LF2A 4OSPA 4WLEA 1UXIA 2W4QA 2IEDA 1NXQA 4W82A 4E2YA 2B4TO 1RKXA 5FFFA 2PNFA 4DTIA 2VWGA 3JD3A 4S1VA 3VTZA 2O48X 3DEYX 4U6SA 4HP8A 4KOAA 4XGNA 3JQ8A 4YACA 4TQGA 1PSDA 2P2SA 4B3HA 4GL4A 1PJTA 5MDHA 4KDEA 4ZHSA 2GGSA 4HY3A 4BKUA 3PLRA 1U4OA 3P5SA 3QHAA 3V1YA 2NADA 1E7SA 1BSVA 1XYGA 4Q3NA 4WASA 3F4LA 3DHNA 4OGWA 4XYGA 3KLPX 2A94A 5L4LA 3NYWA 4ZQEA 5COAA 5L95A 4IJVA 4I1IA 3ZWPA 2X86A 2E49A 5L40A 1NHWA 4MVJP 4M86A 4JBIA 1ADCA 5BNTA 3HDJA 1YQDA 4HFRA 2UUPA 4IUYA 3WFIA 1G6KA 5GZ1A 4ALIA 1VC2A 1I24A 3PIIA 2ZQYA 3COSA 5DN9A 3A28A 1E5LA 4IMRA 1GYPA 1GQQA 4R1NA 1WZIA 2WD7B 5DBIA 5EL0A 4CMHA 2VZ0A 3DOOA 4IDDA 3U5TA 1LI4A 1XELA 3G1TA 4XIYA 1UP7A 2NU9A 3CH6A 3S2FA 3WYBA 4AJ2A 1DIAA 4TRMA 3HSKA 1UR5A 2HMVA 3CTMA 1AHIA 4OKNA 2QZ9A 3GMSA 1CJCA 3RUIA 2B5VA 5CEFA 1LLDA 3RASA 4M55A 1F12A 3KYCA 1Q0HA 1YBAA 1SC6A 3HB5X 2VYNA 3MTJA 3ZN2A 4BO5A 1UXGA 4J43A 4J9VA 3DZFA 3GHYA 5H83A 3C7DB 2Y0DA 2YJZA 1I2BA 4CMAA 4DYDA 2GN8A 2IYPA 3N74A 5ITVA 4G5HA 3X2FA 3PK0A 4KUHA 2D59A 4W9NC 5IDYA 3ZHBA 4O63O 4CLEA 5KKCA 3QVXA 4I9HA 5A4DA 4O5OA 1YVEI 2RH4A 3JQAB 3O8QA 4KP7A 5HRUA 2Q50A 1ENZA 3BHJA 1N8KA 2DUWA 2W2KA 3HN7A 4D79A 4EW6A 1WVGA 1L7EA 4DIOA 4J91A 2ZCVA 3A4VA 4PLZA 3GUCA 4BV8A 3QWHA 4M1QA 1SNYA 1TEHA 5THKA 4BGIA 4YT4A 1LLQA 3INTA 2O4UX 3ADPA 4GX1A 2UV8A 5JYDA 1YQGA 5EJ2A 1DJQA 1HKUA 3I1JA 4E0BA 2HQ1A 4CM9A 1YS4A 3UN1A 4BNKA 1GCUA 2C2YA 3TPCA 1HRDA 1SOWA 1JTVA 3G0OA 4RVFA 4TVOA 5FWNA 2O3TA 2AG5A 4LISA 3TFQA 3LQFA 1GEEA 2DTDA 5B4TA 1P1JA 4E32A 1ZJYA 2G17A 4IJUA 1GQYA 3CSDA 1YBMA 4XX0A 2JCVA 4P4GA 1JN0A 5KJ1A 3CE6A 2RCYA 4CV1A 1O6ZA 2X5JO 1DBVO 2WJPA 2OUIA 1DIGA 6ADHA 3HN2A 1AXGA 1XWFA 3WYCA 2JD2A 2HUNA 4MVJF 3LSYA 1E0DA 3UFXA 4TRJA 3I23A 3DMTC 3H9QA 8LDHA 2J5RA 2QG4A 4KWHA 3FR7A 3DL2A 2CDBA 2AW5A 4TKMA 1XLTA 2IE0A 3HFSA 5F5NA 1GZ4A 3VVBA 2FZEA 1GYQA 1I01A 1GQ2A 1UJMA 2WWRA 4WEQA 3ZGYA 1FDUA 5JAQA 4OSOA 3B1KA 1P0CA 3QE3A 4KUEA 4WCFA 5C5IA 4NH4A 1EQUA 1VM6A 2EP7A 1ONNA 2EGGA 3VVCA 5I7VA 3C85A 1F8FA 2GPTA 4WECA 3AM5A 4MVJG 1T2FA 2Y66A 1B0AA 3LLVA 1YDEA 3OQBA 3IP1A 2C20A 3E9NA 3GDOA 5KVQA 1UH5A 4Z3KA 5EQDA 4DVJA 3I4CA 1ULUA 3JCZA 4RGBA 4L0QA 4YEDA 2Y1EA 3QVSA 3QW2A 4RZIA 4MKZA 3QP9A 4ZRMA 3GFBA 2FPGA 1NASA 2XXBA 2DKNA 2P91A 1XKQA 2J8ZA 1BW9B 3JD2A 1E7YA 4IJKA 2B4RO 3C1AA 3DAPA 1D8AA 3I3OA 2CMDA 1B2LA 3JQAD 1PR3A 3O8QB 3PHIA 2Y1GA 4CMKA 3KSZO 4PLYA 1PGQA 3AW9A 3VC7A 1X0XA 4Y6RA 1UDCA 2VRCA 1AGNA
chains in the Genus database with same CATH superfamily
3BWXA 1WCYA 2DFLA 3QU9A 1QZUA 4Y2SA 1WNTA 2ZR0A 3OTIA 2B36A 2FOXA 2GRUA 4HLUC 1FQKA 2PWAA 3CB4A 3GEBA 3JQBC 3CEJA 3GUHA 3KXDA 4FDUA 5KO2A 5KZMB 1J1ZA 2GYYA 1Q77A 3K0FB 3LIIA 5FYDA 3RK4A 1VCIA 2QUAA 3GDFA 4CIWA 1E4VA 3BXPA 3FPGA 1UQUA 2QTVA 4DR3B 1JDUA 2HJGA 1HT2E 3H18A 1DP4A 1A4UA 3GEGA 2V4UA 2GDJA 3M83A 1L7PA 1TADA 4PRKA 1JSXA 2RGDA 4DLAA 4E13A 3ZK8A 1BU5A 5DPMA 1Y89A 2A9VA 1P7WA 1RHQA 2OMEA 3PDIA 3RF7A 4CNQA 3IH5A 1S89A 4RVOA 2GHTA 3IEXA 4GGOA 4X1YB 2EFHB 2J6BA 4QG3A 3Q41A 5LVAA 2EFCB 2JHAA 1CUAA 1NN0A 4A0RA 1EX1A 2GFIA 2XUFA 4IJMA 4V0ME 4HZUB 1V5WA 3E1GA 1TTTA 2CVZA 2BCGY 1XD2B 2FGKA 3IHWA 3LY5A 4ITUA 5KU1A 1D2GA 2N75A 2R8XA 1RMQA 3EXIA 4BZWA 1L9XA 3VSEA 5FP0A 5KQMA 1OT3A 2QN9A 4YAFA 2VH1A 3ETCA 4FONA 2O23A 3ANLA 1TVEA 3TNDA 1LV8A 1TEXA 1T8TA 4DC9A 1LQUA 2PV0A 4ZYTA 4DANA 5F52A 3B8EA 1ARZA 5DTIA 1FUKA 2ERCA 3M9WA 4ZU6X 3ZYZA 4Z99A 4DIUA 5BNZA 5JRJA 4HOYA 5HZKA 4RC9A 4R3WA 1PBTA 2I6UA 3B1XA 4L22A 5F5LA 5JQGF 2XYPA 3RJ5A 1S2LA 3IP3A 3RNOA 3IUSA 3WAKA 5AI5A 4U4AA 4UMDA 3FCEA 4RD2A 4MQUA 4NBKA 2WR8A 2YWEA 3IIJA 1L1RA 4F8JA 3WGVA 1ZC3A 2CV1A 2IH2A 3HO6A 3GA0A 4HVTA 5FNVA 4OK5A 4PXAA 4FOLA 1SXGA 4HPXB 5REQB 1CS0B 3REFA 1ST2A 4B4UA 1OTXA 1F0PA 2JA1A 1C1HA 3DHEA 3FBWA 4DG8A 2OM2A 5ESWA 2DQKA 3ABQB 2OENG 4BB6A 1A9RA 3JYHA 3D0QA 4XPZA 5B7NA 1ZCJA 3KTAB 4PQFA 2P0EA 3TQHA 4F4FA 3BORA 5F77A 2X4DA 3EISA 1Q1BA 4IQ4A 2IOFA 4TUYA 5KPDA 1OJ7A 3NRCA 4YP0A 2WM2A 2I34A 3T99A 1VMIA 3VGJA 1ONPA 3C41J 4PC2A 1TK3A 4AL4A 5EESA 1I3KA 2F7SA 1XQ6A 4TTVA 1BDIA 4G4SP 5AVTA 1X94A 2GF2A 2HZ7A 1NR7A 2O2GA 2ISSD 3GEPA 4FFLA 3N28A 5H82A 1IAQA 2JK0A 2IXAA 3T9AA 2Y1CA 4LSMA 5KU7A 3KZCA 3I83A 4BFTA 1S0UA 2HTFA 3IDQA 3L04A 3NT4A 1IQUA 2ZBVA 3EQ6A 3TRDA 3LBAA 1IU9A 4GPTA 2R6DA 3TRHA 4D8WA 1X77A 4JBXA 4NKRA 4O4IA 4K9MA 2XGGA 1Z5NA 4B83A 4BVLA 2VN8A 4QWWA 4KWEA 4BBPA 4YV7A 2VBGA 2F90A 3WQSB 5TJHA 1W5SA 4FKMA 1XWIA 3S1AA 4S05A 2RIRA 4PX5A 1KZYC 2J0UA 2XMRA 4PSUA 5BVHA 1U1EA 4M1KA 3RUPA 1TMOA 4U6NA 3R9KA 3GFOA 4H6WA 2UXDB 1V71A 3OP4A 4LRQA 5K8CA 3E0QA 3NTUA 1Z08A 1TKRA 1X7YB 5ICMA 1W75A 1OILA 3CU5A 1J56A 3OFKA 4II3A 3UB4A 4LXIA 2CNDA 3EB9A 4O2RA 2YMQA 4RS4A 5KEIA 4QTXA 1U63A 1Z0ZA 2UYOA 4ZT5A 5KCMA 2IUFA 1NPYA 1ZM9A 1R0YA 1ZIYA 2FZGA 2HNKA 5A62A 1ORHA 2R8EA 3CBQA 3ROMA 2GNOA 2UZ3A 4YRNA 2Y99A 5BPFA 3W4IA 1HR0B 1ZNYA 2DQ4A 2XE4A 4I6GA 3PICA 3VPDA 1KK3A 2GPWA 3B1JA 1SUAA 4EHIA 3U4CA 3E22B 1T9AA 1R3DA 4RSHA 4E21A 2WJWA 1OIXA 4UATA 4BZZA 4E51A 3G1UA 5ALFA 2ZYIA 2JGDB 1QIJA 2VKQA 2VSFA 1KZGB 3OA2A 3ZV6A 3AVVA 2O8BB 1F0YA 2Z2IA 3EC7A 4CLXA 4X8OA 2I7VA 1PYDA 5CVEA 3U3OA 5TPWA 4XCXA 2E37A 2BI4A 4Q24A 3QEBZ 1FTWA 1VLHA 2M98A 4TWBA 4B46A 3WKBA 2GZAA 2ATXA 2B4YA 2G3YA 4KPUB 4S0ZA 4LMRA 5B30A 2FZWA 3PEYA 4DDKA 4HAOA 1EFAA 2DPHA 3NHWA 1J25A 2A6PA 2FYTA 3MCTA 3BAZA 1NNI1 1TMYA 2EJVA 1A7AA 1Q6YA 2Q6KA 2XTMA 3G7NA 3KJEA 4DMUB 1W48A 2R47A 3ZBQA 1QYCA 2EV9A 2G6TA 4DQKA 5CNJA 2A57A 1BW9A 1D3AA 2HU5A 2WFAA 2WPDA 1BWPA 3H2IA 4FX5A 4LIPD 4WFQA 3UK0A 1AT1A 4JUIA 4MVXA 1SCJA 2UUBB 4I6EA 4Q7MB 1L1QA 4OQLA 3RHZA 4N01A 4AZTA 3UA3A 4YRPA 4R2KA 4NMLA 1OC2A 3FWPA 3CXUA 1GRRA 5HBRA 4JV5B 2GB4A 4M6WB 2NNLD 1C2TA 2QAJA 2O2ZA 1FMCA 4NQZA 2ECPA 2BFBA 1HA3A 2RH9B 4GM1A 4L3VA 5F2OA 4X94A 5KQGA 3R9XB 1JDBC 2Q1YA 4WZAA 3CX7A 2R6GA 4C30A 4IDOA 4JCOA 4KSYA 3A0RB 5CVJA 1H1LB 4LOKA 1AO0A 1ESDA 3G8AA 3QHPA 4HQFA 1U8EA 3RGGA 3WGJA 3D6AA 4TL8A 3CBGA 1EQ2A 1SU6A 3TLEA 3C8HA 2SBTA 3AXTA 4GM4A 2CV2A 5B1IA 3SC2B 5H8WA 4BPRA 3AC0A 5BOSB 3Q6NA 1W96A 2HK9A 2J45A 3CE9A 1DRJA 4WDQA 4DUPA 1SQGA 2C8KA 1WUIS 2GD0A 3JALA 3CUYA 3K92A 4L78A 1GV1A 4V0LA 2DQSA 2QAGC 2Z3VA 3HJHA 5BN3A 3KL4A 4EJFA 1XQYA 3EEYA 5KX5A 3UCXA 3IVGA 1CUBA 1HLDA 1ZRHA 2PR2A 4HX5A 2OYRA 4BJ6A 1R6BX 1LNZA 3UG6A 4C03A 1LBEA 1C9DB 4ZCSA 4PZAA 2EKLA 3EZGA 4KRGA 4JQCA 4FFRA 1J0AA 3E58A 4EK9A 1ILEA 1VJGA 1L7AA 2LXNA 4G63A 5J2TB 1N4AA 4QJ4A 2ANCA 4Q1BA 4Q0MA 2GHIA 1GG9A 2OGUA 3A31A 3Q7TA 4EA9A 4FR5A 4ECEA 4YCNA 4HDAA 3JYPA 3STXA 4BDSA 3V7YA 4EEXA 4WINA 4ONEA 3EVFA 4UAVA 3T1TA 4AYWA 3N5CA 4YWHA 3WIDA 3ICOA 5IK2A 3MXTA 5TEVA 3IL2A 2GCGA 2Q6OA 3BQ9A 3OIUA 1PDOA 3O73A 3QG1A 1JG1A 1XKXA 1AIPA 5EKXA 3BWBA 3QPUA 4LTMA 1L5KA 1T0UA 1LPSA 2LPMA 1NP7A 2E55A 5EXPA 1WHSA 5HIIA 5JC8A 2NZYA 1QC5A 1ODLA 5K3FB 2PZKA 1LPMA 4Q3CA 5B7QA 3ZD6A 1JAXA 1F4PA 1NLMA 3Q7RA 1U2DA 4K88A 4C4YA 4RIFA 2YVAA 3B53X 2FWAA 3AKZA 3EZXA 1GXSB 3LQ4A 1EBBA 1PDVA 3OEEA 3WMWA 3AG5A 1VLZA 3L7CA 4D8YA 3GGGA 3DHWC 4CL8A 3IVCA 4G24A 1UF9A 4A0HA 1SVWA 1ZVQA 1RP1A 1SU8A 3RS2A 1K7EB 3OJFA 2J5KA 3IYLW 5LJLA 3GLGB 1AZWA 4MI1A 1XRMA 1ZLXA 2Y6UA 1FF9A 2GI4A 1O8BA 1JB1A 1HKHA 4QHTA 1SCAA 2V1UA 2P77A 4PBRA 3T4XA 2CJYA 3NR2A 3WK8A 3PFFA 2EQBA 4BNHA 1ZVMA 4EY7A 4YLYA 721PA 1ABBA 3NGLA 4Q34A 2R4QA 4GX0A 2OZLA 4X6XA 4INOA 4BFVA 1FXWF 2NU8B 4EKGA 1RJGA 2GARA 1KYYA 2DRIA 1Y5RA 1ZMTA 3AZQA 4RK1A 3C3WA 1S3IA 4Y2TA 2EWWA 3P0IA 5FUYA 1FVOA 5LZ8A 2GNAA 4LJ7A 3QXXA 4F9GA 1RS0A 4J7CA 2H18A 2WJIA 4R8LA 3SLGA 3AM3A 4EUKA 4F5YA 4FGKA 2CCGA 3RS8A 1PS9A 1XDUA 3BEOA 1UC9A 2IHBA 3L7DA 1KIFA 3C5EA 3QKWA 1EMDA 3N1UA 3P5BA 1KGSA 1JXOA 2ID7A 4NATA 4MROA 3EMBA 4Q1DA 4R9UC 2HHAA 5K4AA 2YVLA 5CT9A 4C1BA 4ITRC 2DOKA 2C1ZA 3CJRA 3U44B 4FJ0A 3L0ZA 1XAGA 2G25A 2B1JA 5HGJA 4DCTA 3FNRA 1M6VB 2Y9PB 2JIBA 1G8HA 3QTBA 1WWKA 4GSYA 1SH7A 4DIEA 4FMDF 9LDBA 1ES9A 3DBLA 4J0HA 3T5TA 1G2OA 4KAFA 5BMVA 2ZIFA 1PJLA 4INAA 1ZK2A 4U2DA 4YJFB 3U2QA 4EYEA 1CXZA 3SYKA 1CDOA 3TIGA 1P5ZB 3A1VA 2WWFA 4GI7A 3KTFA 3VC2A 5KMGA 2DHRA 4DIFA 3JU3A 2GCNA 4OXYA 1VYHA 4E2ZA 1NW3A 3O3MB 4GO1A 4IKOA 4X66B 4MJ3A 3VPSA 3AIOA 1XTVA 2C92A 4R1UA 4P3KA 2KPOA 2X8JB 1E66A 1NXTA 1BDJA 2IF0A 3PQ3A 1NW9B 2CLCX 5DMHA 3MS7A 4EY3A 2PKRA 4FYKA 3BCUA 2HT6A 4DFDA 2QVZX 3EXG2 4FDVA 4IIGA 4LXXA 1GD1O 2UYHA 4L4XA 1VL1A 4JYZA 1AK1A 3BX1A 1IG3A 2WPDD 1KI4A 5AI8A 3GJQA 5A5FA 2VQEB 1NQUA 4TZ0A 1PVDA 4O4IB 2EDCA 1NF3A 1RJ9B 3ZWAA 1BCSA 4K9NA 4P84A 5F3RA 2PUAA 1KH3A 2V7QD 1FDTA 1V39A 4MRAA 5DK6A 3BXHA 3MD9A 2GHQA 2FLVA 1C0PA 2ZYRA 5AKYA 4M0FA 2QVYX 1HRKA 3RSHA 1S3GA 3P20A 1N3IA 3FPEA 5LP6C 3KC2A 2Z6VA 1PT9A 2QTCA 1Q7CA 1XZDA 1K27A 4H4CA 4MW6A 3SR0A 1GNQA 3E9EA 3LUJA 2NSLA 3ZW7A 3E0XA 3OFJA 1P1FA 2ZRBA 4OUDA 4EAAA 3OCZA 4WLOA 2ONJA 2FZ4A 2R4TA 1WUTA 1D09A 3RC9A 5I4IA 4K6KA 3IR6A 5I5GA 2A88A 4JJ6A 2Q5IA 3VJMA 1MN6A 2HU8A 4HB3A 1Q83A 1V7ZA 4K2AA 1CKEA 1E3EA 4DCNA 3LDGA 5JHGB 1Z4MA 1YIDA 3CJQA 4NOJA 3IEMA 2AJBA 2VXCA 3RGWS 3ZU2A 4Z4FA 3VZQA 3A2KA 1WJGA 3NWEA 1OA1A 4AZWA 5E2IA 1OFUA 2I2DA 1WHTA 2V3WA 3K1JA 1HEYA 1C7QA 1NY5A 2CK3A 1TT7A 2QDXA 3T4EA 4I5DA 1SR8A 1I3MA 2E4ZA 4X44A 4XVRA 4ZARA 3IIEA 1YL7A 4BCBA 4BQQA 3ILYA 4HLCA 2DETA 5KYUA 4TWJA 1IB0A 1BWRA 4YFVA 3QQ5A 6YASA 1A8IA 2LV8A 4CQMB 4JEUA 1V1JA 3ODPA 3E9ZA 1N2HA 4WD3A 3IDAA 1XFAA 1Z68A 1PFVA 3EZ6A 4IXTA 4E5PA 1GRQA 1E96A 2NNWB 4F4HA 2N1MA 1F2VA 1Z07A 3C87A 2OMKA 1JAIA 3LNTA 3L4KA 5PNTA 4DILA 4LF5B 3TLMA 3IT2A 1SQFA 1BC5A 1GFZA 4Q93A 5THXA 1KTVA 4WFIA 4QOGA 3WTCA 5LCXA 5DBGA 7MHTA 4QNMA 1PZEA 3MT7A 4EPVA 4PPYA 1V1RB 2YV5A 2P6UA 3RIHA 1DNPA 1YGYA 3C4JA 3QIAA 2C00A 1U0GA 2ZR7A 2H5EA 5EKUA 5IJAA 4LBYA 1INLA 3V3TA 4BNDA 5B12A 3PXBA 4B76A 5LSAA 1AA9A 4X8HA 1NC1A 5BORA 2Q6TA 3B51X 4UBNA 5FFMA 4EAQA 121PA 1KVQA 2OILA 3L8YA 1E6EA 1YKFA 3CRW1 4IDPA 4O8CA 5G40A 1U80A 3WKDA 4YB8A 3FAZA 4A8JA 1AQYA 1BMDA 3ENNA 4BO1A 2QTAA 3DFIA 4Q4AB 1FW8A 3OE1A 1PT7A 4QDKA 4UVDA 3LYUA 5IUKC 3OEYA 3HWX1 1H9CA 2IXEA 3F8TA 3HKCB 1GPLA 1RKQA 3ZDBA 2WVJA 2I2CA 2GBPA 1JMVA 4G9EA 5HXAA 1XP8A 1V8FA 1XTSA 3TFOA 2XT6A 1M8GA 2NUPA 4OU5A 1OC4A 2I4TA 2IPAB 1JLHA 1JX6A 1U11A 4D4GA 1AD2A 2JLCA 3TLZA 2LUOA 5B1DA 2GH1A 4JJZA 3PHLA 5K0LA 4BO2A 5HWSA 3A1FA 1VE1A 4HYQA 3V2UA 1RXCA 1EUDA 1U9JA 5A1TA 4PE5B 1MT3A 3N07A 3H2SA 4PM4A 3S5JA 1C8BA 1MB2A 2IDZA 5EQFA 3SG0A 3B8HA 1PJAA 3GL9A 3HJTA 4DJTA 3NC4A 3FH0A 4MX8A 4TV8F 4AQDA 1YRQA 4O33A 4DUYB 2H1WA 1SXJA 4NARA 4YVFA 4MV6A 5ALXA 5BT8A 2OBLA 2EBHX 3ZVLA 4GRDA 4GYWA 5I7SA 5JI2E 2AK2A 3R3UA 1AKWA 1ZUIA 5CVUA 3N0VA 1T10A 1MTOA 1RZVA 4Y6LA 2BFMA 3VKGA 1NLYA 2RBKA 3G2LA 5JTTA 2XQVA 2JGLA 1S2NA 3NCTA 3V4LA 1R9MA 2EL9A 4WN3A 2OCPA 3QX8A 1RWOA 3R7AA 5KSYA 3RYIA 2PQ2A 4RIIA 1AUOA 3TQIA 2J0VA 4X54A 5C81A 3ENQA 1KAHA 3RUDA 1XNQB 4HLUA 1W5FA 3U4MA 4LHSA 2V55B 2J7PD 3CKKA 3O8OB 1PL8A 2R62A 1T5SA 3HFJA 2BFDB 2YASA 2YJNA 4YTEA 4WXEA 3SIRA 5HKAA 2FWBA 3DCJA 3UHPA 4HH3C 1JS1X 5K8IA 1ECCA 3T1YB 3G79A 5A4FS 3IP7A 4YS6A 1U8YA 2Y8EA 3A1DA 3EVNA 4F6RB 4LV6A 5JXHA 2J3JA 5U4XA 4KMRA 3DAOA 4UU1A 1CZHA 1HF3A 4JIGA 3V9PA 1GG8A 2Z9BA 2A5JA 2CE7A 5LDHA 1CDZA 1ZM2A 2G1UA 3K0AA 1DBQA 3GRRA 1A4IA 3K1ZA 4K1LA 3MLEA 1JI0A 2XMGA 4RKYA 3WLJA 1C0EA 1ZOOA 4GOKA 4N5DA 4MHOA 3MUEA 3FNFA 4ZHQB 1Q44A 1QDUA 4NC9A 2H17A 3EOZA 2CXPA 1M76A 3BSSA 3DZKA 3Q6IA 3CWZA 1QANA 4PC3A 2XRFA 1C3EA 5GQSA 3ZGNA 4KDFA 1U5BB 1CNEA 1ZOPA 1TKCA 3KELA 4BRZA 1RU3A 4MR7B 1G41A 1GPH1 4CKEB 3DZJA 3NYQA 1SBQA 1B0ZA 4XQ9A 1HG0A 1RYFA 3EY9A 3KJGA 1JHOA 3KHKA 4X61A 4JC0A 3IC5A 1F5SA 3LO8A 3ZWMA 2JFZA 3PHGA 5AW6A 5K3OA 1NN3A 4PSDA 4AI6A 2XA9A 1PR6A 1KF0A 3ZKAA 4ERXA 2RGWA 3HACA 1H9AA 3BDIA 3D1JA 1O94D 5EMMA 3UC5A 1MABB 3IR7A 1T4BA 4FSXA 1OT5A 3KWMA 3LRTA 2H08A 1LDBA 2FZLA 1W5BA 1WVIA 3C6XA 3X1XA 5CBKA 1SMKA 5G4LA 4E03A 3O8BA 5JVDA 2DE0X 2WA2A 3PQ6A 4JP8A 4MW4A 3TTTA 4B6EA 2BSQA 2Q1XA 5DGHA 4YPFA 1I94B 4LF6B 3EFHA 3KL2A 1QMGA 4PHTA 1VHDA 4RENA 3PF8A 1Y8CA 1A95A 3RK1A 3VHRA 2W2KB 3DMDA 4H7EA 4DG9A 1XQ1A 2CE2X 4G0VA 3MFQA 4IJWA 3QTTA 2WE8A 1MAVA 3KJNA 3VX3A 4IRUB 3OCXA 4ZYLA 3CSUA 2VRNA 1C7EA 4X1KB 3WBKA 5JJIA 1KI8A 5JADA 1DBIA 2VCYA 4QVGA 1DC8A 1ZU5A 2GJ8A 2I33A 4HDRA 1IZ9A 4JLKA 4EVIA 3NWBA 4CG1A 4DDHA 3R09A 3AUSA 1SXJB 2QXTA 2R7KA 3HM2A 2PSEA 4GX2A 4HN9A 4LVNA 4MI3A 4Q1EA 4WLNA 4BFLA 4ER6A 2V0GA 3ZHOA 4LGMA 4FMDB 3GLHE 4DWWA 2XUAA 1N4DA 5IYZF 4J49A 1GCOA 1F2TB 3R44A 3T3EA 1F9AA 2QNRA 4MS4B 3RYFA 2HNAA 4O4LF 2OYSA 3D7KA 4WAUA 1G8AA 3NBKA 1G5PA 5SY6A 1T6NA 4PVDA 4W1QA 1ZNWA 3RSFA 3A9VA 5JSYA 3U7QA 5E7MA 4LJRA 3DLAA 2DUUA 1BJRE 2J9YB 2A9KA 3LK7A 4HVCA 2K87A 1DJPA 1FYXA 2EW1A 1I36A 1P3DA 1L5RA 1RHRA 2I6XA 3GJ7A 3IKLA 2JLYA 2Q4DA 3AUXA 3ZGLA 3RG2A 1QHEA 2JIZD 4JLWA 2Q9CA 4KQ9A 4DCGA 4ZWNA 1CDDA 2IV7A 1P5JA 1DKQA 3ZU4A 5ICGA 1ZUHA 5CMLA 2FXVA 4ZJZA 1AHHA 2OZPA 4DR1B 2B25A 4BWVA 5KQSA 3CVWA 2XBMA 3AOEC 1EFVA 3S27A 2X1HA 3VU1A 2HWWA 1HMYA 4OXKA 3M3DA 2EX0A 2Q0QA 1HUQA 2PZGA 3WL7A 1E59A 2PLFA 1DJLA 4RD3A 4OJTA 4HNUA 3HRKA 3AVXA 4IDHA 4OXRA 1M8KA 1ORWA 1W36D 1I7NA 4JBYA 2YN4A 5K51A 5T57A 4CMCA 3K4HA 1WMSA 1JYSA 4BP1A 3QX3A 2EP5A 2AOTB 1YR7A 1XSEA 2NYRA 2CN1A 2Y71A 3IE0A 3Q3CA 4MQ5A 2ZRFA 4N49A 4QU5A 5DP2A 4F3CA 1KEKA 1OLUB 1OYWA 2V45A 1LWOA 4GXRA 4K6FA 4TS1A 4A15A 2TMDA 1A8SA 2QR5A 3MQ2A 5CG1A 5JMPA 2AL7A 5HFNA 2Q99A 3FFTA 4X6YA 4FFBA 5CHYA 3X1WA 4CEJB 1YVPA 5DSZA 2RONA 5FUBA 4DLTA 4U9UA 3QA9A 3OUZA 2P9TA 1XPOA 3K9NA 3RS0A 3DAYA 2XUHA 2OHHA 4LSZA 4PC1A 3WWYA 3A70A 4KL8S 3DFFA 1N6PA 4W7HA 5DYNA 1MB9A 3C6KA 1R8YA 1I4OA 1AQNA 4FEGA 4LYHA 3WMEA 5DLQC 5HDBB 1WUJS 4G3XA 5FBZA 1I4WA 4C7OA 1YU9A 3ZCRA 1GFSA 2H7CA 2IUSA 1K5HA 2PZFA 1SQ5A 3DGEC 3RQSA 3W5IA 4Y18A 1NZFA 3U3KA 1Z4NA 3CUWA 3FI0A 1NWCA 1EZ1A 3DOHA 3EOBI 3IQEA 1WLSA 5CK4A 3SZ3A 1PFGA 5J47A 3KVVA 2PE5A 2P2YA 1HC7A 2D1RA 2PGIA 1NBMD 4Z86A 3PDUA 2GBLC 4LF9B 5LZ9A 1XP5A 1SB9A 5H5JA 3T9CA 5JQGA 2PR7A 4HRYA 1JIQA 5T4BA 2VJAA 5CIWA 3T4UA 4IZHA 4RV5A 4EHJA 1JEAA 1Z28A 1GQRA 1UZUA 2KBFA 3HS3A 2VCEA 1WZCA 3EIHA 4TTIA 4B8YA 5BV7A 1NF9A 1RMYA 2Q3JA 3B6ZA 4YMHA 3OO1A 3U7GA 1ZJWA 3R7BA 1WO8A 2X6RA 4NESA 4LEIA 3KKKA 1WSBA 1KEEB 4LYJA 1EVQA 1E79D 4M7WA 4WTOA 5GPBA 1FXSA 4A5OA 1MO6A 1UAGA 1K0UA 5I9SA 2O07A 2OHJA 3Q9UA 1UBFA 3G02A 2WYUA 4E6EA 1K6JA 3L8FA 4QSMA 4AO8A 3EGIA 2QXUA 5EZSA 4AYTA 3RH0A 2ZI9A 3BCSA 4E30A 1ZXXA 2EBFX 3GA5A 1ELOA 4C6RA 3LX8A 4D3FA 2ZR9A 2CMHA 5C8YA 4UTNA 5CYPA 1GG2A 4GMGA 3B3AA 5KTPA 4GI5A 2JHCA 3WJAA 2H51A 3ZBPA 5JS8A 1KJQA 1GZDA 3B12A 1TJPB 1E64A 1DKNA 4E2XA 2NU6B 2XE6A 2Q3BA 4B87A 3DC2A 2SICE 4FK8A 3JASA 1J9ZA 2BELA 2C9CA 1ZDMA 3QUTA 4GQAA 3GFGA 2AXQA 3MW8A 5EJ7A 1VP3A 4RFLA 4XRRA 2NU9B 4MKGA 2P3OA 1A0OA 1NUPA 3JQDA 2DFDA 4KODA 3LC2O 3PCRB 4P7KA 1TZCA 5KNBD 1HETA 3TVTA 3CVYA 5B58T 2EATA 5JS2A 4TSFD 4YRIA 3FTCA 4D0RA 4MGZR 4URXR 1E3JA 3S8EA 3OHSX 1NIJA 2FQWA 4BN0A 5FB3A 5ICCA 1FDWA 3NUGA 1S2IA 5AM3A 1W94A 2Y3IA 4QRDA 3TW8A 5EE0A 4ZVKA 2DCMA 4R9SA 4TQUS 2GKOA 3PFKA 3TTVA 3AERB 2F1JA 3T0GA 4KQCA 1QF9A 4PGGA 2FF5A 3U1VA 1UBHS 2RHWA 4YO7A 3R0QA 3BREA 1UM9A 1K8RA 3B3JA 5JRDS 3EIQA 1JHVA 2HRZA 2WU3A 4R1MA 4RX1A 3B5IA 1L5GB 2D62A 4MLCA 1N2ZA 4R16A 4JVLA 4XASA 4AJ9A 3RFUA 3ETNA 1UJBA 4NBWA 3CN7A 3DPUA 1VDMA 4PQEA 1Z6AA 5C32A 3R7LA 3U48A 1IUPA 3Q9SA 4MIEA 1Z5VA 4IXMA 4RPKA 2A5DA 4RELA 1APBA 3AR2A 5KKNB 4PONA 2WIFA 4W7IA 5DWDA 4RQBA 3FYUC 5HP4A 3LF1A 3CZ5A 1IN7A 2WJJA 1KI6A 1O3YA 4RTMA 4KTTE 2VDVE 1IRIA 1YZQA 1DAHA 1E69A 3B7GA 3ZPXA 3RK0A 4AZVA 1NDHA 4OY3A 4EJ6A 1I3CA 3LQQA 4ZDJA 2H48A 3HEMA 1DC4A 3MZ0A 4WN9A 2X8LA 1T5IA 3WLLA 3OAAD 1Y8ZA 3A27A 3SR4A 1UM8A 2GWRA 1JSZA 5DCYA 2PZLA 1NJ5A 5IP5A 621PA 4LI0A 4BJ5A 1H0HA 1P1BA 2GK6A 1NRWA 4MVYA 1T6BY 2VNHA 1VG9B 4FGWA 4NMXB 3TOSA 3MGGA 3EDOA 4HAYA 3IIMA 1Z82A 4PLTA 2HPHA 4G86A 1GO2A 5JNWA 2D2XA 3L02A 2D4AA 5JSUA 4GM0A 1GTRA 2PYZA 1QCYA 4D6YA 1ZSVA 2QIPA 4E94A 1A5TA 3GRKA 3FVTA 1E89A 1T4CA 1TT5B 1YZUA 4E5NA 3PR1A 1U7DA 1MP0A 3KKMA 3LD9A 2CL5A 3WQRA 1K97A 2O8NA 3A1UA 4MP6A 1ICEA 1W6UA 2PGJA 2JFWA 3FKJA 4L95C 5FPQA 3TCKA 2HRBA 2J48A 1RFLA 2OT3B 1RWNA 1XJWA 5JDCC 3FGPA 4F9TA 1Q6ZA 3NIBA 2RK3A 3JAWA 4M9XA 1JQAA 3BWCA 2IUEA 2UVPB 3ER8A 3S1LA 3TZBA 4FR0A 4I55B 3T6KA 3VR3D 3C6BA 4X91A 4DJEC 5JZSA 1VPLA 1PZHA 2Q9UA 3ZQJA 4W8HA 4WA8A 4CLDA 3OQJA 3PD0A 2JI6A 5KOHA 2SKDA 4TXNA 1Z5PA 1RE1A 1AUPA 2P0YA 5F9MA 3RRBA 1QDLB 2VF7A 5KX5B 4IIVA 4UXJA 5AW2A 3E9YA 3F5DA 1DC7A 4BO7A 1I7SB 2PQMA 3ENVA 1Z0UA 4NPAA 4LFCB 3A4TA 5J43A 1TYZA 1HWYA 3ZE8A 4NFYA 2F4NA 2VCHA 2O3RA 1QS0A 2GDZA 5J5VA 3MEQA 4Z3DA 3W05A 4QC2A 3LTNC 1CY7A 2DUJA 1VJ0A 3O3NB 4IY1A 5FR1A 5L51A 3QMWA 4QKQA 2IK8A 2MTBA 1TM3E 4FNMA 5FA8A 5A04A 1EHYA 5BWNA 5IZ4A 5J23A 2VNSA 2XQKA 3KQMA 1OZGA 3WIVA 1CLEA 4N3BA 4DKJA 2J9FB 4IBOA 1JVBA 3RF6A 4AP5A 1C4KA 3JQEA 5KTOA 5ESXA 4F2PA 1GP2A 1RPTA 2FG7C 3GLHA 4X45A 3CIOA 4QEDA 4BNJA 1Z39A 3PUZA 1Q84A 2EGUA 2HK6A 5JCJA 1THGA 2B4AA 2RB4A 2X0RA 3THWB 5ECWA 2A86A 1QHYA 2QR2A 1MFZA 3F7TA 3FMOB 3N2LA 5H3CA 3MJTA 3LHFA 1TMKA 2ZYUX 1ZS9A 2YWRA 2RC6A 4TOIA 4A8JB 3W2TA 4YWJA 2JJMA 2Z5LA 3JRXA 1GTVA 1NG1A 2G63A 3NASA 5GADl 2VP3A 1MV5A 3HYCA 2HK8A 3G2KA 2RC5A 3ECSA 4MDEA 3O8OA 4XYBA 2BMFA 1KP9A 4QO7A 1OU0A 3Q0TA 5JWOA 1ZGHA 1E9SA 3IVXA 2WUFA 3DM9B 2MWMA 4QL3A 2ZTVA 3IMCA 1HZZA 4KXYA 4YAIA 3A04A 3OICA 1AQLA 4RHYA 4QDZA 1II0A 2VSXA 1E4EB 1M2VB 3HGQA 3KU1A 3TR6A 5K4GA 1DJNA 2YFQA 4CCYA 4FD2A 1JJ7A 3ZY6A 1G5QA 3ESXA 3CPJB 1ZGZA 4WOCA 2JGNA 1KDZA 2V5VA 1PUXA 4TT3D 1DU4A 5M04A 1F20A 5AVYA 1IXSB 4LVOA 4E5VA 1S2OA 3SZMA 5HGXA 4BOYA 4ADSG 1SVOA 1ZM7A 1W2WB 1Z0DA 2I80A 3IIKA 4JJFA 4KIUA 3TW0A 1NVAA 3I37X 3LLMA 3SLKA 5JYCA 5KNBA 1PTJA 1ZONA 3N3AC 2Q2VA 2TMGA 3KUXA 3NH6A 2QPAA 1B23P 3MIZA 2CV0A 4DBLE 2W6JA 1NNLA 1WL8A 3D6TB 2XF8A 3IT3A 3ZI0A 1PZXA 3C3BA 3JAWB 3PLNA 3RVDA 1UDBA 1ZGCA 1V5EA 1TA9A 1JIIA 5AW1A 1DEOA 2VQ3A 4G0XA 4XVHA 2WZBA 2KMLA 1SVNA 3DVSX 3EA5A 2HRCA 3ZQUA 3EXFB 3K8YA 4LRWA 5JASA 1Y9AA 2R1TB 5DI3A 4BX3A 5ECDA 5EP1A 1GZ6A 3PGJA 3RKUA 1GUYA 1WCIB 3ETEA 3G17A 4LVUA 3MUOA 4DADA 4WHMA 1KRXA 3H4VA 3HPRA 2ZSFA 2X0KA 1N5IA 3DEZA 3T7TA 3JQ6A 1DSSG 1GYRA 3BMCA 1E1QD 2BHRA 2XGSA 2UUOA 3AEQB 3ZDRA 2JIOA 3O92A 1HQKA 4XPIA 3FDIA 2R1VB 4GOJA 5LNK1 5TGTA 3P71T 2QN3A 2HCFA 2I55A 4E31A 4OBXA 3CG4A 1P60A 4OMDA 5GIPE 4IEEA 4TYNA 4DCUA 1YMQA 3DXZA 4C3VA 2G82A 3VTAA 5C4MA 5E7IA 4HWSA 3U4HA 1XO1A 1UFQA 2BFOA 5JFGA 4ESOA 2NZ2A 1Q74A 3U7JA 2D3WA 1HEUA 2WWVD 1ACMA 2ON6A 5ESRA 2VLIA 3OPQA 4C3OB 3SVLA 3RT9A 3WIBA 1E94E 2WOOA 1L4YA 5E4YA 1SCDA 5HBGA 3TIIA 3U3XA 2PGLA 3R3SA 4K5QA 4A82A 4CV3A 4C7XA 3VH1A 5G4KA 1ESEA 3AHJA 4V38A 4Y6OA 1F8XA 4FKZA 4YDRA 3WLTA 3L7AA 3PKIA 2GZSA 2QG9A 4N0MA 4C01A 5JNTA 1YT5A 1DUIA 3I6MA 3JV7A 1JECA 4G4JA 1NM5C 3KUKA 3IODA 3PQFA 4MUNA 4OIFA 3SXUB 4D9KA 4EZIA 3V1UA 2P9YA 3L07A 4U5QA 3VR4A 3M6WA 4RLHA 3RHSA 4DC1A 4HQRA 5TLSA 5B2FA 4Y6SA 4LY6A 4BQRA 4ZODA 1AKQA 1EP3B 1R18A 3OLCX 2W48A 3Q5GA 5DHQA 3VR5A 2H92A 3Q10A 3R3YA 2YUIA 1TQHA 1ISMA 4Z3OA 2CSXA 4J8PA 4NZOA 5B4VA 2XHEA 2FHSA 1N2SA 3LWDA 4RHXA 2YIVX 1PX0A 5AW7A 4HQ6A 1Z6QA 3KM0A 4KIWA 4MAFA 3K2IA 3NONA 4EW3A 1Z15A 4RLSA 1JIXA 2MMCA 1KTIA 2FEMA 4ZV9A 3EBPA 1GZ7A 1B8NA 3FCSB 3H0EA 1YR8A 4NOMA 2A0FA 3WLNA 6PFKA 1NMEA 2ERYA 4KKVA 3U16A 1FFXA 3IB3A 2CHQA 2DJ5A 2VSYA 5LA6B 4DCPA 5IXJA 2G08A 3UVEA 2I8LA 4CEHB 1C81A 2HEGA 1V2HE 2H9YA 1VJ1A 2QP9X 5KKAA 1DKUA 4CKBB 3SOPA 4DW8A 1ISJA 3HXKA 1K8QA 3DFKA 1RPJA 5TJ9A 3SFTA 3KOYA 5G53C 3NW9A 3VYUB 3K09C 3DO8A 2BI8A 2GF0A 5ALPA 3AZOA 1SBNE 1TAHA 5HIAA 3EA4A 2WMDA 3JD0A 1NJ8A 2OV8A 1AMNA 4O08A 2FFAA 3D8HA 3V8VA 1EVJA 4REQA 1L4LA 3ET5A 2X0EA 5JQWA 3EJ6A 4PYRA 1SKAA 3JZFA 3FXAA 4J4TA 4IIUA 2IHZA 1P2SA 1Y6QA 1G8PA 1JPJA 2JAHA 2QRVB 3E8SA 3LQKA 4W5JA 2QQGA 4K05A 4AQYB 4J1TA 4F86A 2DBQA 3DBVO 2OPHA 3RUEA 1SBYA 4F93B 2OOKA 3KKQA 1WZUA 5JZMA 2NQ2C 1SCIA 4JAVC 4D9EA 5AOVA 3V33A 2QYOA 9ABPA 3ASVA 4M0UA 3IPXA 1YE8A 1D9XA 3B89A 2EERA 3QYFA 4IYJA 4IZOA 1PG5A 4XDYA 1M1ZA 5JXIA 2DWOA 2OGWA 3AR4A 3KYBA 1NJFA 3LX6A 4L6AA 5JYEA 1FVXA 5GJBA 2YDXA 3EXEA 1ND6A 3LDHA 2XB4A 3E9MA 1Q21A 4IUCS 1RTTA 4D92A 4ROSA 1EFPA 1UBNA 2ZJ1A 3HO8A 4RF3A 3N0WA 4WY2A 1JBQA 5TB5A 4UBKA 3HDYA 3VHXB 5CA1A 5JAPA 4Z4CA 3O1LA 1VBKA 2FE1A 4LE2A 2AN5A 5DU2A 3PJDA 1A9SA 3LPCA 4G25A 4GOXA 3M2PA 4TRRA 3X1DA 3C1TA 3RJMA 1P91A 3A4IA 5I5EA 3VR6H 1JRLA 2ID8A 3KVNA 4I9NA 4EELA 1PIWA 3T3MB 4RH1A 2CLEB 4YQEA 1KR2A 1PZMA 3HNPA 3TBHA 2NLOA 4OFBA 3AV3A 4EF6A 1XLUA 3DXXA 5CFOA 5DXFA 1UKYA 1T36B 3EFBA 4U8HA 2X0DA 1FVHA 5IMBA 1Z8DA 2LNDA 1HZZC 3FLEA 4M1TA 1NM5A 3EWNA 2H0QA 5BN3B 3NLLA 4YP7A 2ZB7A 3FTDA 2QQ0A 3CTPA 2SNIE 2QD4A 3GFSA 4UHHA 5GGXA 1VYVA 3GLSA 3N05A 4LRSB 5EMHA 3D0KA 5FA6A 4UBMA 3T41A 4B2YA 4DUZB 3BD8A 4FNAA 2W00A 1I1HA 2I6TA 1E99A 1JEDA 2PAAA 2X5KO 3EXG1 3LS2A 4LUCA 3S5UA 2GJ4A 2DBZA 2XAUA 1GZ3A 1Q91A 5AI9A 5FADA 5C3MA 1T4DA 4JBHA 3ASUA 4MO9A 5IF3A 2LDBA 5I7UA 3ENWA 1I5EA 4TS4A 3RFXA 1HK7A 3RS5A 2CDNA 2QGFA 3I2YX 4FZRA 2JG3A 4EG8A 2TECE 2DHDA 2P9CA 1J2TA 1GVNB 3DVLA 3WS7A 4E5SA 5DBHX 5BYKA 2EL7A 3TQFA 3KSDO 5ENVA 2Y4OA 3WKEA 4BLPA 2PZBA 2DJIA 1P5RA 1N2CB 1V3TA 4IFBA 4XPIB 3L06A 5EKDA 3WRWA 4RM2A 1WHSB 2OCKA 5CFLA 4V2IA 3DO6A 4KZPA 2IS4A 4K9PA 3S2YA 2PUFA 3GLGE 1QKKA 4CWAA 1WW3A 2I65A 2R00C 1FFSA 2B21A 3BQNB 4GQIA 4ND7A 5H9VA 3WDMA 3CB2A 4C4TA 1BKDR 5KSOA 4B3IA 2ZJFA 1AO3A 1IHYA 1PV2A 3H5OA 2IXGA 4KVZA 1YVUA 3OZRA 4KQXA 1CQIB 4JOBA 4ZALA 2P4QA 4XJXA 2BHSA 1EBFA 3KZOA 3TPZA 3FCYA 3CA8A 3K4PA 1U9ZA 3NVDA 3TQOA 4EG0A 3BUSA 2G1PA 4X71A 4HI0E 1B00A 1U4NA 2IYWA 4NV0A 5EVJA 4D7AA 3KBBA 4AG3A 2QLJA 2XAAA 3SI7A 1B6RA 3ZH9B 1BS2A 4MDHA 3CRZA 4Z9YA 2YJ4A 2X0NA 4RQUA 3T54A 3SQMA 5K6AC 3CKLA 4FBMA 4R51A 1S1CA 3QLVA 1OAOC 4ZZ0A 4AG6A 1DTWA 4Q1FA 3GEHA 4BBZA 2VAPA 4MMZB 4U7PB 3IMEA 2VBIA 4HHEA 2V7PA 4TWAA 3RRZA 3SS7X 1I7DA 5D51S 1IBSA 3AI2A 4NWIA 3VZBA 3F5MA 1CY4A 2IYLD 4FBGA 3BWYA 3SC2A 4BZQA 3TXXA 4GLOA 5BQOA 1DBWA 4RKWA 3ZKWA 4HVLA 3K70D 2VJCA 3FFWA 3GZNB 1P1HA 2OHVA 1ULHA 3ZV7A 5H0IA 5EE1A 1LZLA 1XCBA