3JQAB

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-1,9-dihydro-6h-purine-6-thione (dx4)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
total genus 91
structure length 247
sequence length 267
chains with identical sequence C
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqaB00
3ZW8A 2ZCUA 5ICSA 3TZQA 4N18A 1UAYA 3QP9A 5G4KB 3MCVA 1KYQA 4ND2A 5J23A 2H63A 1MG5A 3RSHA 1C1DA 2CVQA 1CERA 5A9RA 3C3XA 1VE9A 2VTDA 5I8ZA 2WYWA 1YBMA 3HFGA 3RBVA 3TSCA 4XQGA 3OP4A 3K8ZA 1BSVA 1QG6A 2BMAA 4IQ8A 3Q3CA 1HDYA 1ZSYA 4F6LA 4QEDA 1SZJG 2WJPA 3BA1A 2PK3A 4BMNA 1ML3A 3NTOA 1DSSG 3IJRA 5AYVA 3AW9A 2G76A 2X6TA 1BXKA 3JQAA 2PGLA 2WEKA 2Y1FA 3STHA 4AJNA 2P4HX 5TRTA 1RM5A 3FPLA 1O0SA 4W6ZA 1WW8A 5EESA 2O23A 4TRJA 5G0SA 1G0OA 3DDNA 4CQMB 3AOEA 3HB5X 2V7PA 3WBFA 1IE3A 1X13A 2BF7A 2BLLA 3RUHA 4QFDA 1UXHA 2CSUA 2VYND 4CLOA 1C14A 2IEDA 4BNTA 4ALMA 5JCJA 5CAEA 2GF2A 3BMCA 2EHDA 3T7CA 3UICA 4HKTA 3ETEA 2HK9A 2EEZA 2FSSA 3D1LA 4RVGA 1O6ZA 1EUCA 1X1TA 2PGJA 3DAPA 4TKMA 2IEBA 1MB4A 4FBGA 3I9OA 4OGWA 4XYEA 4CMAA 4CR8A 1E77A 4IXTA 4B8WA 4BGVA 4DBVO 3E9QA 4M54A 5I7EA 2ILTA 4KUHA 3IUPA 3A06A 1O9BA 3H2ZA 2V6FA 1BWSA 1LXCA 4K28A 3I9NA 2TMGA 3W1VA 2NTNA 2X0JA 3L77A 1NVGA 1NFQA 5IFLA 2VZ8A 2HCTA 1BDMA 2ZTMA 4PZEA 3TZCA 3GNSA 2QYSA 1BG6A 4TRNA 3MOGA 3KYDA 1BDBA 1DDOA 4E2YA 1VL8A 1Y8QA 3I5MA 3DOOA 4QXMA 1TLTA 1UDCA 4AJKA 3TFOA 4MKXA 4XR4A 1XWFA 4BIIA 2P68A 4J2HA 3JYNA 1QV6A 3S2FA 1RM3A 3UGKA 4QSMA 4U0KA 5L9AA 4WOJA 1LDMA 3HG7A 2AE1A 4E3ZA 1EVZA 3BHMA 4GSLA 2CD9A 4Q3AA 4EI2A 2X5JO 3ZWBA 3OICA 2Y0CA 3UFXA 4BKOA 1JAYA 3S55A 3F1LA 1DLJA 2X4GA 1GTMA 4IZHA 2BGKA 3IS3A 1FDWA 1LRJA 3JYPA 1ORRA 3HWRA 1AHHA 4XD2A 2JFGA 2XXJA 2X9NA 4D79A 5ADHA 2VRCD 3I6IA 4FJ0A 3PRJA 4HFJA 4TRMA 4BNNA 4E5PA 1O89A 4PIVA 3DBRA 1GR0A 2ZTUA 3DZHA 4DIFA 3PLRA 5TLSA 3HDHA 1W73A 4JBGA 2D59A 3L07A 4L4SA 3X2EA 3JQCA 4EJ0A 1DC4A 1I3MA 4R01A 3JQFC 5B4VA 4NBRA 3WTCA 5L45A 2VYVD 3CINA 1ISHA 4ALKA 1G6KA 5L53A 2DBQA 1U3WA 3ZV6A 1NWCA 1ZH8A 1DLIA 5AXDA 3M2TA 1QLHA 2Y93A 1EMDA 1W6UA 1P0FA 3NDIA 4CMBA 4R9SA 3ZNQA 1DIGA 3FNFA 1SNYA 3NYWA 4AJ2A 1T2CA 1K89A 1ZNQO 3M1LA 5L4LA 1DRUA 1ZZEA 1WDLA 3L6DA 5BSHA 4BKUA 4O1MA 4PLYA 1GAEO 3IP3A 1UDBA 4C4OA 1I24A 3GHYA 4RCVA 4ND1A 5KJ6A 1KEWA 4ZRNA 3VDQA 4CUKA 1E5QA 4OHUA 2GZ2A 3MEQA 2C29D 1DPGA 3FSRA 1P33A 4EGFA 2I3AA 3OQBA 1YB4A 2JCYA 5DDIP 5DOZA 3T4XA 5I9NA 1E3WB 5BSGA 4DQVA 4Z6KA 1PX0A 3F3SA 3SJUA 4ALLA 5KKAA 2W2LD 3UCFA 1DJNA 3CXRA 3SX2A 1H9AA 1ONPA 4NFSA 1PWXA 2FPIA 3AOGA 1VI2A 4CM9D 1DBVO 5B4TA 2WYUA 5KVSA 1O8CA 1I33A 4GWGA 4RVSA 4YWJA 3G1TA 2J3HA 1RYDA 4NDNE 2FZEA 2Y05A 1EQUA 4RORA 1SO8A 1I0ZA 1HKUA 1ADBA 1OI7A 3H3FA 1YDEA 3MOIA 4BB5A 4KWHA 4I5DA 1TVEA 2Y1EA 3H9QA 3JQGA 2VQ3A 4GI2A 3ZV4A 4PN3A 3K73O 1XU9A 1E7YA 3VAZA 4AJIA 4CUJA 1T2AA 3E82A 3EY4A 3OJFA 4YJGA 5KNLA 1RKXA 5JAMA 3JQ8B 3COSA 4QQRA 4NQZA 2B36A 1SAYA 1ZW1A 1JTVA 1E1MA 2DVMA 4E5KA 4CL3A 1A72A 1F0YA 4ZU3A 3M6IA 4I5GA 1A5ZA 1ADCA 3LQFA 1GV1A 4BMVA 1YOVB 3NDJA 3OA2A 1LBEA 2P9GA 3WMXA 3DMYA 2Z5LA 3KOUA 4MOWA 3KSDO 3GMDA 3P2YA 5F5NA 1WDKA 2DC1A 4B4UA 5L95A 2GGSA 1SBYA 3D4NA 4DQXA 4HX5A 3PJDA 3JD0A 4BKRA 4YR9A 4IINA 4N5MA 5DP1A 1OMOA 2DKNA 2NTJA 3DHNA 3JQ7B 4GX1A 5T64A 2YY7A 3JQ9A 3H2SA 3GPDG 2ZQYA 1XGKA 1XDWA 1I3NA 3F6YA 5HA5A 5CG1A 4NH4A 4XQ9A 4IDCA 2V6BA 3JQAD 3TNLA 3OJLA 3WYBA 3RC2A 3AI2A 2VHYA 1Z75A 2Y1GA 3WQRA 3L4BC 4WASA 1RM4A 1GEGA 1NAIA 5TGDA 4Q9NA 3AUUA 3BMQB 3K96A 3QJ5A 3LYLA 5F1PA 1HTBA 3IAHA 4ALNA 1WZEA 1GCOA 1RPNA 3W6UA 3UUWA 3X2FA 4FC6A 4W99A 4CM8A 1UDAA 4EBFA 1R4MB 3I52A 4J49A 1C1XA 3LC7O 3A1NA 4Y8VA 1WZIA 4YACA 2HO5A 4FQ8A 5DBGA 4M87A 1R66A 3O8QB 5COBA 3V2HA 5KJFA 1PGJA 2GNAA 1YB1A 4OKNA 4WECA 1PJCA 4WUVA 4Y6SA 2DPHA 3AY3A 1CRWG 4E12A 4BNXA 5DBFA 1HLPA 3WB9A 1VM6A 3NGXA 3QA9A 5G0UA 4CQMD 4AG3A 1P1IA 3FHLA 2RH8A 1LA2A 1WNTA 5A9SA 2AQIA 3Q9UA 1HSOA 2Q49A 1C3VA 2Q1SA 3O38A 4KUEA 5JMPA 3U5TA 1PQPA 2B5WA 4PLPA 4QUKA 3PZBA 3CPSA 1XLTA 4ZGWA 4BKQA 3VPHA 1HZJA 3L4SO 1H5QA 3ZU2A 3KYCA 4BQRA 4M49A 1KC3A 1LLQA 2OBYA 5LC1A 4B4OA 1PJBA 1GEEA 4WNCA 2HK8A 3WIEA 1XKQA 3EZLA 3ASVA 3DC2A 1DIHA 1ARZA 1R6DA 1HF3A 1Z45A 4ZRMA 3GDOA 3OIFA 4UUNA 3CZMA 5HWSA 2OO5A 5KOIA 1A4IA 4A03A 1B8UA 3WWYA 1MGOA 4B79A 5EQFA 1I10A 2CVOA 2ZJ1A 3WYCA 8ADHA 2ET6A 4PRLA 1PJLA 2D5CA 5HRUA 4IDFA 4RPKA 3P2OA 4W7IA 3Q2KA 2FPPA 5BSEA 2X5KO 2Q45A 1U4SA 3ZN2A 1QYDA 4B3IA 5A05A 2DBRA 4N5LA 4FJ1A 3BTSA 2JCVA 2I3GA 4LK3A 3U0BA 3NV9A 3EDMA 3NUGA 4NU5A 3JQFA 5EN4A 3ROMA 3W4KA 3GNTA 4BO7A 3GN1A 2C54A 1DC6A 2R00A 1GQYA 1ZMOA 4L4XA 4CM8B 1KVQA 2GN8A 4YQYA 4CQLA 4KQWA 2GN9A 4CLOB 5ITWA 3GF4A 1UXGA 1KY4A 4ITUA 4KDFA 1K3TA 3OHSX 3M2PA 3ZWOA 1H6DA 1Z7BA 3JQBC 4J90A 1B7GO 1B26A 2RAFA 1PEDA 3ZWNA 5DN9A 4Z0PA 3PDUA 4UUOA 3DBRB 3F4BA 4JBHA 4JGBA 1H9BA 4XJTA 1V8BA 3GEDA 1P77A 3K9QO 4LMRA 2VRCA 4QTZA 4H3VA 2JHGA 3CMCO 3JQ8A 1EE2A 5F21A 3DZBA 1RM0A 4WPGA 2PKQP 4E32A 2Z1NA 4Z0TA 1BW9B 5CDTA 3DAGA 4OKIA 1A7KA 4BVAA 3R3JA 4NJMB 3DZKA 5A5FA 1DC5A 4XIYA 2EP7A 1K6JA 1IOLA 3R6DA 1W0CA 4Q3DA 1HL3A 3GLQA 1PQUA 4A5OA 3H65A 2DM6A 1Z7EA 4U6SA 3B1KA 1DIBA 4FGWA 4XCVA 4CM9A 1ZFNA 1DFIA 4CMCA 3AU9A 2QRLA 4AJOA 4A26A 1HDZA 3QQPA 1SMKA 4OH1A 2A4KA 3E9NA 4U7WA 2BI8A 3TZHA 2UAGA 2JHFA 1HDGO 1PR3A 1A9YA 2B37A 2OORA 3MTGA 5LCXA 1ZEJA 4PLCA 3TF5A 1NAHA 3OJEA 9LDBA 3WICA 1GY8A 2H5LA 3RI3A 1QR6A 3KBOA 2VHXA 2D5AA 1NQTA 3H9JA 1MG0A 3TZKA 3C7DB 4OL9A 4DBZA 1OOEA 4BNYA 3IDSA 3KEOA 2OGUA 3E5MA 5GMOA 1H2BA 1GPJA 2FPGA 3LT0A 3D64A 4DMMA 2PNFA 4IIUA 1E3WA 1ENYA 4PCVA 4OMUA 2J5RA 4YEDA 5JAQA 1Q7GA 1I2CA 1R15A 4FFPA 3ZWXA 5FWNA 2X1HA 4IXWA 2W8ZA 1R4MA 3WLEA 2YQ5A 3EAGA 3ZDFA 1Y1PA 4MVJA 4KTTE 2HK7A 5TC4A 5G4KA 3DZIA 3AM5A 3HQ4O 2ZB7A 1N1GA 1XU7A 3BMNB 2EP5A 5DCWA 4D3SA 4AL4A 3IL2A 2EIHA 4ILKA 1HYHA 5A9TA 3QVXA 4NPCA 2C20A 4RZHA 2O4UX 4G5HA 3CSDA 3OM9A 1H0KA 1KEUA 4DXHA 2NADA 3WGZA 3AOEC 4R69A 4CM1A 4YTEA 3WS7A 4E31A 4KMSA 2VOEA 5AOVA 4HXYA 4DIBA 4KQXA 5HS4A 3I1JA 1T1RA 3F9IA 4R1TA 4OSPA 3E9MA 1PL8A 1R12A 2IZ0A 2B69A 1AE1A 3B70A 2Q4EA 4ALIA 4OJNA 1K2WA 4K6CA 3MJVA 2JD0A 5KTKA 3LVFO 3ANMA 4Z9XA 1U8XX 1LSSA 1DFGA 1Q0HA 2HAEA 2X5OA 2PD4A 5JBIA 5GZ1A 3VVBA 2UUPA 2YV3A 3HSKA 4PLZA 1YDWA 2CDAA 3C1TA 2C5EA 2EKQA 4WEQA 1YE3A 4FOSA 4O59O 3WX0A 1H6AA 3ON5A 3QE3A 2XAAA 1SEPA 4M1QA 4PLHA 3PHGA 1U1IA 3WBBA 3KZVA 3BHIA 5I9LA 2PTGA 3UCEA 1E3JA 1FDSA 2BELA 3WG9A 2RH4A 2CUKA 2JCXA 1JKIA 5F5LA 3WOHA 4CLRB 5IG2A 1E3EA 5CP8A 1MFPA 3OH8A 4NK4A 1LC3A 3BIOA 3A9WA 1OBFO 2JKVA 1SOWA 1P74A 2C2XA 4YCAA 3W4IA 1I3KA 4TRRA 2AA3A 1RYEA 2X9GA 4PRKA 3SEFA 2ZYDA 1N9GA 1PJ2A 1E7RA 4GX5A 5COQA 1X14A 4D3DA 4MIEA 2A94A 1B16A 3QWFA 1J49A 3VKVA 1U2DA 5JYEA 1LI4A 2X58A 5ENDA 2PZLA 1CYDA 2WD7B 4MVJD 3RJ5A 1NWHA 3QRWA 1BVRA 2YHUA 4F6CA 1RJWA 1W8DA 1B3RA 1S7CA 2OL4A 4WLEA 3JQ9C 1RWBA 2C7GA 5A5EA 1T2DA 2O3SA 3VH4A 2UV8A 2I99A 1B8PA 2X8LA 4GKVA 4Q3NA 3GR6A 2YJZA 3I4FA 3PIIA 3D3WB 2RIRA 4BGUA 3VPGA 4RLSA 3HN2A 5TT0A 4IQ0A 4ZJUA 3WGOA 1B15A 4O6VA 3B6ZA 3AUSA 1YRLA 2EV9A 1P1HA 3BMNA 3GT0A 4J0FA 4J91A 4NFHA 1Y6JA 1UP7A 1DC3A 2GERA 2FR1A 4E2ZA 1N8KA 1QP8A 4J1SA 5KVVA 3F1KA 4P4LA 5G0VA 2G1UA 1Y8RB 3CH6A 5H81A 2GUGA 4XGIA 1GYQA 1EE9A 1DJQA 1U3VA 1P1KA 4CM4B 2YHIB 4WCDA 1A4UA 4NZ9A 4BL5A 3HJAA 3I23A 1UAGA 1ZXBA 4MIYA 3FD8A 4MVJM 1Q7CA 3GFGA 3NT4A 4E2WA 2PH3A 1ULUA 1XSEA 5JCJD 1ZUD1 2B83A 2JD2A 4DVJA 4ZQHA 5KWEA 4AVYA 4E2XA 2VNAA 4ZICA 3KHUA 4GAEA 4Z3DA 4NK5A 3U62A 3MJ4A 2O3JA 2UUOA 3GUYA 4D41A 2CDBA 3AY7A 3KLPX 3RKRA 1I36A 1QV7A 4MVJP 4U8GA 1KS9A 3RKUA 3ETDA 5EQDA 4P38A 1HE2A 4RF5A 3V2UA 1HYEA 1H6BA 4PFJA 3ZGYA 4MVJF 2VUTA 4IY1A 4YJFA 5BQFA 2HSDA 5EIOA 1IULA 2Q1WA 1HYGA 3QWHA 4G81A 2XF8A 4GKBA 4WCFC 1OFGA 2OXIA 2C82A 5JO0A 4YRBA 3MJTA 4J1QA 4II2A 2YZ7A 1LDYA 1U28A 2FP4A 5AXBA 4AICA 1IPFA 3UXYA 1J5PA 1BGVA 4E30A 1J4AA 4D0RA 5JAIA 2PV7A 2Q50A 8LDHA 1EVYA 3WGGA 4CMEA 1NQOA 2YFHA 4TKLA 3OETA 3WLFA 2C07A 1E7SA 1XHLA 2ZATA 1TT7A 9LDTA 5FF9A 2HJSA 3O4RA 4Y6PA 3Q6IA 4YT8A 4BUCA 4MINA 5JNLA 1QYVA 3VC7A 4FC7A 4O5OA 5HTOA 4A7PA 1U5AA 2EKPA 1YS4A 3SVTA 4YJHB 2VWHA 1SEVA 2EF1A 3H6KA 3PXXA 3PWZA 5JE8A 1E3LA 1N5DA 5DT9A 2VZ9A 2V6MA 3VPSA 4WJZA 1IUKA 1HRDA 1VKNA 2WD7A 4TMFA 5IZCC 2Y67A 4TVOA 2ZKLA 1YGYA 4PVDA 1JQBA 3R0IA 1PSDA 3JQDA 1WVGA 3L9XA 4RF3A 3UCXA 3T7EA 1FF9A 4QO7A 5KVQA 1WWKA 4FFMA 4IGEA 2GLXA 1QRRA 4OQZA 5IZ4A 1F17A 3PIDA 1O95A 2FR0A 3QLJA 3ANLA 3ZZNA 1OC2A 3F5QA 3L9WA 2Q2QA 3QWBA 4ZQBA 2PKQO 3V1TC 3FRJA 4P4NA 3L6OO 1I2ZA 4E4YA 2VWGA 3FBGA 1I3LA 2WE7A 3H5RA 3I6QA 1HDXA 5TT1A 4OO3A 3OA0A 1R4NB 4QT0A 3RASA 1XA0A 3RUCA 3ZWYA 5JLAA 1GU7A 3E8XA 3PI7A 2TMDA 1KVSA 3I3OA 2JJYA 2ZK7A 4CMHA 1HXHA 1UP6A 4ZQGA 2EWMA 1EDZA 3OEYA 4GLOA 4R41A 4UUPA 4YRDA 4YQZA 1SB8A 3F4LA 4IUYA 1MC4A 5TX7A 2AEJA 4EJ6A 1VSVA 3S8MA 3H5AA 3P5SA 4PLWA 3GVPA 4K26A 3I4CA 2D8AA 4M86A 5JDCC 3UW3A 5K6AA 1PIWA 4LISA 3VHRA 3VZRA 4AJHA 3BMCB 3HN7A 3VZPA 4IM7A 2E82A 1PL7A 4YAGA 3D4PA 3OQ1A 3S2GA 4CQMA 5A02A 1IY8A 3TQHA 1EVIA 4IDEA 1ISIA 3WSVA 4D45A 1ENZA 1KBZA 2EJWA 4YDRA 4XR9A 3DHYA 3M1AA 1U2GA 3RUIA 1Z6ZA 4JIGA 1H94A 4BNVA 4BNUA 3RJ9A 4CMEC 5HBRA 2HJRA 2I5PO 2Q2WA 4Z0HO 3WWZA 4CV2A 1NTOA 4YAJA 2C5AA 2P4QA 3PHLA 3DMTA 2NUAA 1F14A 1N9GB 1B2LA 1SOVA 1ADGA 4NHEA 1T26A 2YDXA 4MVJE 4M55A 4DIOA 1CQIA 4CR7A 2FHSA 4RQTA 5G0WA 2EW8A 1YJ8A 1TI7A 2VWPA 1ZKMA 3TPCA 4D0SA 4BO1A 1T2FA 1WXDA 3GVXA 5F3RA 2QQ5A 5JYDA 4Q3CA 1DHTA 3JSAA 2NV6A 5CFZA 4WKGA 5CDGA 1EUZA 1ISFA 3DONA 3H9EO 4IPTA 3WTBA 4WCFB 5CEEA 2B35A 5C5IA 1YBVA 1DEHA 2HRZA 3SJ7A 5IXSA 1HDOA 4FS3A 3SC6A 2Y1DA 4A73A 2HMUA 3VZQA 3S2EA 4ZQFA 1YBAA 3ZHYA 2XPCA 3EC7A 3IQDB 2FOIA 2B4RO 3LDHA 3D4OA 1GYPA 3JTMA 4YJFB 4CODB 6LDHA 5COAA 4NBWA 3N7UA 3DXFA 1E7WA 3EHEA 3IC5A 2BGMA 2PZKA 4HFMA 1KIFA 4UULA 4U0JA 4U6QA 3WYEA 1ISJA 1ISMA 1DHRA 3HDQA 4MVJH 3QWAA 5IJZA 1B0AA 2X0NA 4PLVA 3WMWA 2I9PA 4WNIA 4G2NA 4UVDA 2Q4BA 1BTOA 2VHWA 3QVTA 4XYLA 1Y5RA 2P91A 4LCEA 1B3BA 3NT2A 1AN9A 2A9FA 2QRJA 3ZWWA 1LQTA 5JSFA 2PKRA 3QVOA 4IZIA 3H4VA 4IJWA 2X9VA 1JVBA 4I5EA 5JO9A 3K6JA 3U49A 1EEHA 1DB3A 2PGDA 2VUSA 3EYWA 4ZD6A 3ZWMA 5JPIA 1PTJA 2H6EA 2QX7A 4EUEA 2QW8A 5K9ZA 1PGNA 4ESOA 4IS2A 1R16A 3WJAA 3WFIA 1D1TA 3FWNA 2GN4A 2ZTVA 4BO6A 5A06A 3LK7A 3Q9NA 1ID1A 3WGTA 3WQSB 4P8RA 3H8VA 4OXKA 1LU9A 5K6AC 1SCUA 2ZYGA 1ZSNA 1F8GA 3I9JA 4L0QA 2GYYA 4FSHA 3ZCXA 1KY5A 3DBLA 2GDZA 3VOSA 2OBNA 3ZW9A 1GZ3A 3RIHA 3K31A 2PD3A 4EUFA 2HDHA 1P44A 2WSBA 3R1IA 3V5NA 4YYZA 1LDGA 3DBHB 2E37A 3PFFA 1YL5A 3U9LA 5TIIA 2BH9A 1XQ1A 2UVDA 1LRLA 4J1NA 3JQGB 4OOFA 3MJCA 3KRTA 5ENVA 3WGIA 2Y99A 3KYBA 1IHYA 2Z95A 1DO8A 2IRWA 1N2SA 4Z9YA 3OMLA 3GHHA 4J1TA 3ADPA 1JA9A 4RV9A 5IN5A 2WWRA 3QW2A 4OXNA 2NU6A 4RVUA 1T25A 1GDHA 4RDHA 1PJSA 1EFLA 2ZTLA 3HADA 4INAA 1HE3A 4ND4A 4I9NA 4W9NC 5KKCA 4PLTA 4E13A 1PL6A 4B4VA 1JAXA 3H9GA 4NBUA 3SBOA 1ZK0A 3DO5A 4QX6A 4FD3A 3EVTA 5I7FA 1XCBA 5CG2A 1AUPA 1GUZA 3TL2A 3QWIA 3U4HA 2FMUA 1TXGA 1LRKA 1X7DA 2D1YA 1NPTO 3FTNA 5BSFA 4OQYA 4KTVE 5ER9A 4LMPA 4CV3A 2DUWA 1N7HA 4EYEA 5DOVA 4E33A 2F1KA 3I9KA 4DMLA 4EITA 3LC1O 5F1OA 3ZNNA 3VPXA 4GSKA 3MWEB 3GDFA 1V3VA 4J0EA 5JAZA 1U8FO 4CQLB 4IDBA 2J8ZA 4TSKA 4WE3A 3NEPX 4URFA 1R0KA 3DQPA 4AJ1A 1ZBQA 1NPDA 5L4NA 4I8XA 3TWOA 4L73A 3PVZA 1V9LA 4JNKA 5A03A 4W7HA 3PYMA 1XEAA 2EERA 1Q7BA 2EGHA 4MP6A 4XQEA 1M6WA 3GMSA 5U9CA 3EUWA 2JFFA 1ENPA 1IB6A 1OAAA 2DAPA 3SLGA 4Z3KA 5CDUA 3AUAA 1Y81A 3RUFA 3OF2A 4R68A 1ZVMA 1JWAB 2F00A 3UN1A 1XIVA 1ZJYA 3C8MA 2NU9A 1P9LA 4BNKA 4FB5A 1QSGA 2AMFA 1C0KA 1I5RA 3GN2A 3A14A 5T67A 2O50A 1YO6A 1X15A 1UZLA 1WPQA 3UHAA 4CJXA 3MZ0A 3ONFA 3KTDA 2O7SA 1VLLA 1Y8QB 4IDDA 4B8ZA 4J3FA 2Z1MA 1QYXA 3PJFA 4HFRA 4D3FA 5JFOA 4L76A 3BMOA 1ADFA 2AQHA 1GPDG 3LT2A 5DP2A 2O48X 4Q39A 5B37A 4UEJA 1M76A 3RROA 1IZ0A 1EBFA 2O4CA 5JMWA 4BB6A 1JWBB 1VL6A 3ZI0A 1MX3A 3PHJA 1MA0A 1EBUA 1H2HA 3NRCA 1QMGA 4D42A 3RFVA 1Y9EA 2X22A 2VOJA 4CM3A 3GPIA 4R9RA 4W9NA 2BI7A 1AGNA 3JCZA 3H9UA 3HFSA 1SPXA 5C37A 1PS9A 3H5NA 4CUZA 4BS9A 1P0CA 2Y0EA 5AXCA 3CMMA 2AW5A 3IMFA 3PGXA 4IMPA 3W4JA 5JCXA 3FR7A 4XQCA 4J16A 4XDYA 3GEMA 2X0RA 1F8FA 2GRAA 3JD4A 2HKIA 4R5MA 4BMSA 5G2OA 5A3VA 1GQQA 5ES3A 1CQJA 4PG8A 1UZNA 1E7QA 2LDBA 3D3EA 1GZ6A 2Q99A 4YAIA 1GFSA 1MLDA 2IDZA 4BNLA 3JYQA 3CE6A 3DBLB 3WQQA 4YRAA 1E3SA 3PGJA 2JD1A 5BR7A 4PG7A 4XYBA 3GA0A 4O63O 2OFPA 2PZMA 4MKZA 4N54A 2I6TA 3A28A 1D1SA 1R37A 3PJGA 4RO0A 3FN4A 3W8FA 4MVJI 4NJOA 4CMKA 3ZU3A 2AE2A 1K0UA 3HZZA 5KCZA 1JKFA 1KETA 3PTZA 3PQDA 4FJ2A 1JDJA 2AHRA 3AWDA 2Y68A 4Y6RA 4GL4A 1LTHR 4W82A 3TDKA 1JW9B 3PHHA 3C7AA 2Q3EA 1MUUA 1PR9A 3ENNA 3QSGA 1UXIA 4GWKA 4CLRA 5IN4A 2D2IA 4KOAA 1NHWA 3E03A 3INGA 4Q3EA 4HNHA 1PZFA 4KZPA 4I9HA 4UVIA 3H7AA 3ICPA 1LUAA 3DZGA 4F3YA 3LLSA 3B1FA 3RC9A 3VKUA 2R00C 3NTQA 2OUIA 4IIVA 1JKJA 3JQAB 1EFKA 1VC2A 4ND3A 3PEFA 4Y9DA 4NFYA 3U4CA 2WDZA 3JQEA 3V1UA 5U4QA 4RVFA 4B4WA 4TWRA 2EJVA 4NBVA 2YQ4A 3BHJA 4LVUA 5LDGA 4CM5A 1NP3A 1IYZA 2BD0A 2YHIA 4PLFA 3W8DA 1ZK2A 1E92A 3DB2A 3I9LA 1U3TA 3GVIA 4E6PA 1ONOA 4DPMA 1HDRA 3LLVA 4GGOA 3AU8A 3QVSA 4XRRA 3V2GA 1P1FA 4YB8A 1Z82A 2JAHA 3DWFA 4TQGA 3GRPA 5CEFA 3ASUA 1YJQA 4RDIA 1K6IA 1C0LA 2POQX 5T8KA 4GLLA 3VH2A 2DBZA 1SC6A 3H3JA 4R1SA 4B7XA 4FFOA 1N1EA 5TNXA 4XYMA 3WJ7A 2NVWA 1PGPA 2CVZA 4Q3BA 3ZWAA 3EVNA 4W4TA 1IL0A 3K5PA 3RVDA 3I9MA 4PG5A 2NVBA 2P9EA 2PZJA 4ND5A 3WNVA 1DFHA 4E21A 1P1RA 1UJMA 1FDVA 2GSDA 4YVFA 4YT5A 7ADHA 3GGPA 4WLUA 2Q1TA 4L75A 4P4GA 1JN0A 4ZVVA 3IP1A 4DUPA 3KUXA 4F45A 4HNGA 3RCBA 4UREA 3ONEA 1TT5B 5LDHA 4HV4A 2R2GA 1PJTA 1WLYA 1GUFA 2I65A 2CF5A 1K5HA 4E0BA 2FZWA 3ZNOA 1CETA 4FIZA 1CEQA 2CY0A 4AFNA 3KSUA 4EW6A 1I32A 4RPJA 4CV1A 1PJ4A 3ROKA 2PY6A 2W90A 3VPFA 4YJHA 1NFFA 2X0IA 1VJTA 1ZK4A 3GG2A 5ITVA 3LSYA 4XDZA 2DU8A 3AUTA 5EMHA 3DBHA 3VTFA 3L4BA 4L74A 3NDRA 4TVBA 4XJSA 5L3ZA 3OJ0A 4A27A 3EK2A 4BNIA 2E4AA 1G1AA 4L4RA 5CHEA 1E5LA 5CDSA 3AJRA 3JQBA 2G82A 3FI9A 5JC1A 3ETGA 4N5NA 4BGEA 4J7UA 1XQ6A 5IDYA 4R16A 5TJ9A 4XYGA 4OIMA 1I01A 2G17A 3RUEA 4LSMA 4ZA2A 2P2SA 1QXSA 1T2EA 4GX2A 5TJHA 3VZSA 1Q0QA 2IODA 1M66A 5A3JA 1XYGA 4RGBA 3WFJA 1Z73A 1BVUA 1FJHA 1PS8A 3ZHZA 3DOCA 1HE5A 2CMDA 1YOVA 3BZUA 2VZ0A 3F47A 3FTPA 3OQ6A 3G49A 1AXGA 1Y7TA 2B0JA 3QY9A 2GASA 1ZCJA 1ZSVA 2VT3A 5EJ2A 3C7CB 3FNGA 4MP8A 3NAQA 1NQAO 2IE0A 3AM3A 5BT9A 5I7VA 3GQVA 1YL6A 4IQGA 4CMIB 1BW9A 3VTZA 5IDQA 5MGBA 5L7YA 4HY3A 1LJ8A 2EG9A 3DFZA 4CLDA 2DQ4A 3DZJA 3ONDA 4JP2A 2O3UA 4R54A 4O0LA 1EDOA 2ZIZA 3DEYX 3SXPA 2VNSA 3RUDA 1YKFA 3AI1A 5JC8A 2PD6A 4R3NA 2AQ8A 3RFTA 3FNHA 3KSZO 1GYRA 1NASA 2IZZA 1GCUA 4R3WA 3RC7A 7MDHA 1ZK1A 4GQAA 3HDJA 1YQDA 3RC1A 3RWBA 2I66A 5T8KC 3PPIA 4FFNA 2WE8A 4MO2A 4IJVA 1MP0A 1U4OA 3CUKA 1VKOA 4QECA 4CMJA 4E5YA 4PZCA 1NVMB 4YAEA 3INTA 3HNPA 3Q2IA 5B12A 3G1UA 2PA3A 1EQ2A 2IZ1A 4GMFA 4GPD1 5DF1A 1FMCA 4A2CA 3QIVA 4CV0A 4XB2A 3IKTA 4FDAA 3KYDB 3LZ6A 4YT2A 4YXFA 3QHAA 3EGOA 5U1PA 3PHIA 3KEQA 4GMGA 1EVJA 3N74A 5L7TA 3UF0A 3DHEA 2VN8A 5H83A 2G0TA 2W4QA 3G3EA 5CEJA 3PWKA 4D44A 3BTOA 3PQEA 2BHLA 3U3XA 4MVJG 5K0ZA 2ZQZA 4JJGA 4AJLA 2J5QA 3ROPA 2JFHA 1Q2XA 4S1VA 4RLHA 4GBJA 1ZO8A 1TB4A 4IBOA 4XGNA 2GN6A 1ENOA 4WLNA 3S2IA 5I9MA 2C7VA 3KM0A 2JL1A 1DXYA 1I8TA 2NQ8A 2SCUA 3OIGA 4J4HA 3GZNB 4LN1A 3UOGA 3JQ7A 4JP3A 1G0NA 1C1XB 1U3UA 1XR3A 3D0OA 4TZTA 5G0TA 1AHIA 4PG6A 2DT5A 4IMRA 4QO8A 1HEUA 1F06A 2W2KA 3K2BA 3S1LA 1E1NA 1R0LA 5FI5A 5BNFA 3EZYA 1C0PA 3FCOA 4B3JA 1EK6A 4EDFA 3B1JA 3K30A 2OHXA 4WOKA 4BNJA 4C7KA 4F46A 1ZXLA 5A9SB 2DUUA 3MTJA 3ROQA 2RHCA 2VUUA 5DZSA 4FW8A 1PGQA 1DRWA 4BKPA 2Y66A 4YA6A 5L7WA 5I7SA 1NR1A 2AEMA 3GGGA 1MXFA 3E48A 3WSWA 3GDGA 4LRSB 1MV8A 3IKVA 5TF4A 5TQVA 3F46A 4HADA 4DPKA 4PLGA 2D3TA 2NWQA 3ZV5A 2E48A 4FGSA 4HUJA 5CPBA 3GEGA 1E1KA 1S6YA 2RCYA 3FWZA 2B4TO 1UZMA 1KVTA 1A9ZA 1NXQA 2GZ3A 5FYDA 2DLDA 4G65A 2W98A 2GD1O 4J7CA 5T5QA 3NT5A 2IXAA 3OECA 1PZEA 2W2KB 4CM6A 2H9IA 2FY8A 3L6EA 3ITKA 3C1OA 5GZ3A 3PP8A 3NJ4A 4LW8A 2NLOA 1HWYA 3DOJA 3N58A 1DAOA 3ZWCA 3AI3A 3UVEA 5TS3A 1HLDA 1N7GA 3CTMA 3U09A 5A1TA 1TT5A 3P7MA 5AVOA 3PFWO 2GO1A 1TEHA 3KVOA 5HM8A 3ORFA 4K6FA 3GK3A 2IXBA 3Q1LA 1KVRA 1SB9A 3ICCA 1P31A 4R1UA 1GQ2A 2HUNA 1GV0A 3DBVO 2PH5A 1GD1O 3GFBA 2J3JA 4UVEA 1LLDA 3E5RA 5FFFA 1FK8A 3P19A 3DMTC 4WLFA 1LC0A 4XWYA 3G79A 1LEHA 1V35A 3DR3A 3NX4A 1HDCA 1WMBA 2UDPA 4BV9A 1P45A 3UH1A 4OM8A 4TZKA 2DFVA 4CR6A 5JDCA 1F12A 3GZNA 2AXQA 3A4VA 3PZRA 2YV2A 1M75A 4NU6A 3IUSA 5A04A 2WTBA 3LF1A 3ST7A 4NR0A 3JD3A 3Q11A 1UH5A 3IJPA 4J6FA 2DFDA 5IDWA 2HLPA 4GVXA 3BTUA 4R51A 3WIDA 5ILOA 3Q0EA 1X1EA 3AM4A 1HETA 4RPLA 2ZB8A 1O5IA 4KDEA 1L1FA 4H15A 3ABIA 1LLUA 1EZ4A 1ULSA 2O2YA 2YUTA 3V8BA 1QLJA 3LU1A 3GZ4A 5L51A 2Y1OA 3RFXA 2WMDA 4LVCA 4M89A 1E0DA 1PWZA 4J2OA 2XXBA 4JBIA 1U5CA 3KO8A 4NJMA 4DYVA 5DBIA 2QHXA 2RBEA 3G0OA 1I30A 1NYTA 1WMAA 2NNLD 3BAZA 1R0SA 4JXKA 3T4EA 4BO3A 1HE4A 1UXJA 4C7JA 3GH3A 3ZWPA 4BNMA 1PZGA 3GGOA 2EKLA 3E1KA 4DRYA 1T4BA 4I1IA 4BOYA 1UP4A 3GVHA 2Q2VA 2CNBA 3TOXA 5C3MA 5IZCA 1LDEA 1HZZA 3D3WA 3QV1A 5A4DA 2AG8A 3FF4A 1I2BA 5JXWA 4B3HA 4RVHA 3AK4A 1VRWA 4R4JA 4UAGA 4RPHA 1C1DB 2A35A 4D46A 2HRBA 4H7PA 4J43A 2BFPA 4FFRA 2WD8A 4JLWA 4ZQEA 1VJ0A 1NVTA 2WM3A 3K2EA 2Q1UA 1D3AA 2QYTA 4BQPA 3R3SA 3GUCA 3VH1A 1NX6A 5THKA 1HSZA 4UEOA 2O3RA 3RD5A 3HB4X 2NTVA 1E6UA 4LSWA 4BNGA 2QZZA 5EINA 1A27A 3MJSA 3WNQA 5FEUA 2NQTA 4CM7A 3O8QA 4WLOA 3GY0A 5GZ6A 2VRBA 4A0SA 4CLEA 5HS6A 1YWGO 2B5VA 3OEWA 4CMGA 2BFAA 2HMVA 3MWDB 4NG5A 3TL3A 2E6UX 4CM4A 5ILGA 4D7AA 4YBZA 1LNQA 4XX0A 4UVGA 3GNQA 2OP1A 5L4SA 4XB1A 1K6XA 4MIOA 1KERA 4EUHA 1D4FA 4BNHA 4HWKA 5EL0A 1KOLA 3ZHBA 2H1SA 1EK5A 3ZU5A 2FRDA 3PYLA 1E7MA 2CFCA 2YDYA 1X0XA 5GY7A 1TA4A 1OC4A 2EW2A 3D5TA 3HUDA 2CF6A 3AY6A 1R4NA 2X23A 4NMHA 5AQ1A 1UUFA 2BKAA 1B14A 3ULKA 1YONA 2O7QA 3RAJA 2EXXA 2BRUA 1MXHA 3BYZA 2FSVA 4GX0A 2RHRA 4I5FA 4PZDA 3U4IA 4FN4A 3GC6A 4J9UE 1XG5A 4DYDA 3OBBA 1T4DA 3DL2A 3ENKA 1CJCA 1CWUA 1VL0A 4NIMA 4CLXA 1V6AA 3GAZA 5ICMA 1YXMA 2DTXA 1N92A 2P5YA 4XA8A 2OMEA 2NVUB 2NU8A 2D0IA 2B4QA 1JU9A 4UUMA 1MC5A 1M67A 1NM5A 2FWMX 1BRMA 1H6CA 1PZHA 1NBOA 5IF3A 3G17A 5AXAA 1LQUA 3JD1A 1Y5MA 4BGIA 4D43A 1O94A 1IHXA 1LSOA 2DTEA 2OOSA 4JN6B 3ZH2A 1E6EA 1WAMA 1IPEA 4I9UA 4DC0A 4DGSA 2FN7A 5B1YA 4BO2A 1IZ9A 1J6UA 2BFOA 1W4ZA 4QFCA 3SC4A 3DTYA 4EEXA 4OXYA 5TSDA 4XIJA 1NPYA 4K9DA 4Y67A 1FDUA 4BNZA 4BNWA 4IS3A 2QZ9A 3JYLA 2ZCVA 2V65A 5C7OO 4U5QA 4J9VA 1WP4A 2PFGA 4ALJA 2WYVA 4FR5A 2HMTA 4RF2A 5G4LA 3V1YA 4IGFA 1VPDA 4RQUA 4B7UA 5IDXA 3ZNPA 4AJEA 3DTTA 1ZIDA 2JAPA 2YV1A 2O3QA 4XZ3A 1VSUA 1V3UA 3B20A 4XRGA 2Q46A 3WXBA 3ZV3A 5JY1A 1U7HA 5H82A 4OAQA 2YW9A 4J4BA 1BXGA 1YQXA 2J5KA 4R5HA 2QRKA 1LSUA 2PR2A 1ONNA 2ZB3A 1EUDA 2NVUA 2X86A 2J6IA 2BGLA 3FR8A 4IDAA 4IJUA 3JV7A 3RBXA 1BXZA 3NTRA 4J7XA 4XKJA 4EEZA 3WGYA 4JX8A 4OOEA 2CDCA 2GPTA 3GOHA 4DLLA 3DZFA 4S3MA 2GCGA 3K92A 4FPXA 4RZIA 3JQ6A 5I8WA 4BO9A 3I83A 2O3TA 4RF4A 1LX6A 2XOXA 3ADOA 2PLAA 4LGVA 2P5UA 4DTIA 2DPGA 1U9JA 2NSDA 4NNJA 2VYNA 6ADHA 2UYYA 1PGOA 1X7GA 2I67A 1PQWA 4Y98A 5ER6A 3IIEA 1Q1NA 2HQ1A 3TJRA 1CIVA 3W8EA 4YAKA 2EGGA 1VJ1A 3HDYA 3TOZA 2J3KA 1X7HA 3OSUA 3RQSA 5MDHA 3NGLA 1QYCA 4FOOA 1WDMA 4BO5A 3FPCA 4WCFA 4YJDA 3TFQA 4IDGA 2HU2A 4H16A 1ZK3A 4UVHA 2NM0A 4BV8A 4DLAA 2C0CA 1QORA 3LT4A 4JK3A 1XELA 1ZMTA 4MPDA 3AFNA 3U4DA 2A92A 2YYYA 3PJEA 1LDNA 4DPLA 4HBGA 4HP8A 5EERA 3NJ8A 2X7HA 1QKIA 2BFMA 4A10A 2GR9A 4BHTA 4DL9A 5JDIC 3CKYA 3D5QA 1YB5A 3KB6A 1OZAA 3INRA 5C7LO 3ZHXA 3KLMX 5DCYA 4XGKA 2YFQA 4RL6A 1D8AA 1A7AA 3TZ6A 3UAGA 4FCCA 1DIAA 5F1KA 4BO0A 3NKLA 3GG9A 3QVWA 1BMDA 3WGQA 4IJKA 3E18A 4NI5A 3ZWVA 3PK0A 4EZBA 2FR8A 5IXYA 1KC1A 1E3IA 1L7EA 4YPOA 4DREA 5DULA 3PLNA 4WGGA 1D7OA 5CDYA 1FDTA 1A71A 2IYOA 3JYOA 5C7IO 4II3A 3PQFA 4GGPA 4MDHA 2VHVA 3UKOA 3KV3O 4DC1A 3C1AA 1NHGA 5KJCA 1CF2O 1M2WA 1PJ3A 5JW6A 1QYWA 4ID9A 4PGFA 2HMSA 4N7RA 4BNFA 1MFZA 3OJOA 3TN7A 2VWQA 3HHPA 4BO4A 2PWZA 4K1LA 4YJGB 1CDOA 2CZCA 2C2YA 3GRKA 2O2SA 4UEKA 2ZYAA 1T24A 1GZ4A 1DRVA 1NNUA 1AXEA 1V0JA 3BMOB 2DBVO 1KEPA 3KYCB 2D4AA 1YVEI 1JVSA 4B7CA 3CEAA 2AQKA 2HMWA 3LT1A 3RUAA 3L0DA 4JROA 4NBTA 5EPOA 3C85A 2Y0DA 3PYXA 2LDXA 1KEVA 1E1LA 4DLBA 4EJMA 4WK6A 1FXSA 1Y8RA 4HFNA 1P3DA 1J0XO 3ITDA 1X0VA 5KJ1A 2OZPA 3AFMA 4E5MA 3LF2A 5IAAA 3W6ZA 2Y1CA 3EMKA 3PDJA 4RJTA 2ZJ0A 2J3IA 4ONEA 2W2LA 4WEOA 4JJFA 1ZJZA 2R6JA 4GVLA 4AJJA 5JS6A 1KVUA 5DNAA 5THQA 2QIOA 4X54A 1NFRA 4PG4A 3ZU4A 3D7LA 4ROSA 5CPFA 1PU2A 3VVCA 3WGHA 5BNTA 5JDIA 3GAFA 1YL7A 1DAPA 2AEFA 2DTDA 5JY6A 4XEHA 3OIDA 5DCUA 2GZ1A 4DQUA 1C0IA 3O26A 1Q0LA 2VYVA 3VDRA 1B8VA 1DOHA 3VH3A 1NQ5A 4CL8A 1HT0A 1PJQA 4WLVA 4I08A 4L9RA 4FFLA 5KJEA 2VTEA 4ZN6A 2NU7A 3BTVA 3TRIA 4OYRA 3GVCA 1H93A 4LRTB 4L8VA 1BXGB 4JJIA 4CPDA 3WDSA 4KWIA 1ZEMA 4CMIA 1UR5A 2V6GA 4Z9FA 3EW7A 4JQCA 3MJEA 3RU9A 3FNEA 4E5NA 3CZRA 4DWVA 1LLCA 1LDBA 4CLHA 3IOYA 2QG4A 2OP0A 5L40A 4P22A 5T57A 4RPGA 3F5SA 4PVCA 3RU7A 2C59A 5BNIA 1Z74A 3KETA 4KP7A 3DFUA 3OFSA 3ANNA 3E6AA 1YQGA 4MKRA 3RBZA 5KVCA 4M8SA 4R1NA 2I76A 4AJ4A 2NACA 4MJLA 4TROA 1PS0A 1L7DA 4MP3A 3O03A 3PWSA 1GUYA 2ZB4A 3C24A 3FBTA 1T1SA 3KXDA 5KIAA 2VCYA 4GH5A 4AJPA 3HE3A 1UXKA 2VT2A 1ISGA 4OSOA 1V3TA 1P1JA 1E6WA 2AG5A 1YH3A 4RVDA 3DAFA 1LSJA 3JD2A 1U7TA 2VHZA 3BMQA 1Y9AA 4J4TA 4DA9A 4LCJA 3WR5A 1GL3A 1DIRA 5B4UA 1GADO 3LC2O 4JCOA 1NR7A 1BHSA 2IYPA 3O9ZA 2P9CA 4YT4A 5T6BA 3BXXA 5FI3A 4ZHSA 2G5CA 3CIFA 4KUGA 3SLKA 1JLLA 2E49A 4BO8A 1M6HA
chains in the Genus database with same CATH superfamily
5CT9A 3UW1A 1TIPA 3U48A 4F0JA 4UOZA 4PSCA 4UNPA 5FBQB 3X1XA 1E0SA 3W5VA 3E9ZA 2Q3JA 1FPMA 4YJKA 4QXOA 3GX1A 3L79A 3MCVA 3DM5A 3UJ9A 5J23A 5IK2A 4LIPD 1MG5A 3MXOA 5BN1A 3T3NA 1C1DA 2X1VA 1ULHA 1RE0A 5F3DA 5A9RA 1CY1A 3C3XA 1N1MA 1VE9A 4JFAA 4TXMA 1X7XB 1YBMA 4OYYA 3HKBB 4KGDA 4UUQA 1JJBA 3RQIA 1QM5A 4ENRA 3TSCA 3CB4A 3LPCA 1HG1A 3K8ZA 4BUZA 1KYIA 2IYVA 2I6GA 2DHDA 2PCJA 4BMDA 3SHQA 3TBHA 4R9NA 3W3AA 3I2FA 4IHJB 2LTAA 4HSGA 2IA5A 5DFAA 4MO9A 4C76A 4QSHA 4OJYA 1NT2A 2YWBA 2CHUA 3OOJA 3PFHA 5TRTA 1O0SA 5ECYA 1EFCA 2I7DA 1N36B 2G1PA 3FPKA 2K87A 2XUPA 1HY3A 4FT4A 3P4UA 4LOKA 1QS0B 1E5XA 3DDNA 1K6MA 1JR3D 2N3ZA 2J0SA 1FS6A 1YCFA 3AOEA 3HB5X 2QLNA 5GJWC 4HH0A 1E79D 2ZU6A 4I36A 4BVLA 1IE3A 4MVCA 1X13A 1BGXT 2PWAA 4JUIA 2J67A 1XQWA 1P3JA 2YWDA 3AP2A 5DMXA 5ILQA 2RONA 5BWMA 1UXHA 5BXQC 2IS4A 1C14A 3MELA 2IEDA 2O1WA 3JATB 4ATNA 1S02A 2YFKA 3H1AA 4BNTA 1J25A 3F6SA 5CAEA 2GF2A 3TMKA 3UICA 1WUTA 5A0TA 3TLKA 2CNNA 4HKTA 3T41A 1HNZB 3D1JA 2ZITA 1SK9A 3VU9A 4EG4A 3GRZA 4RVGA 1Y63A 2D0PB 1X1TA 4MMYB 1FVOA 1YC5A 1YA4A 2ZIEA 4OMCA 1NU8A 3AJEA 5SV2A 3SF0A 3SFVA 4A0QA 1KYTA 4WJLA 1E77A 1UJ2A 2AOXA 1JSCA 1KO8A 2FN8A 2HA7A 2ICAA 3HEMA 3M1IA 1PUXA 3E9QA 3G2QA 4KE6A 4M54A 4BLSA 4DBVO 3IUPA 1DE0A 1IN1A 1WPXA 3H2ZA 4GMHA 3IVAA 2Q2NA 5LU9A 4BEBA 1WVMA 4TMZA 3UEOA 2IP4A 3W1VA 4NYJR 5IM4F 1CQJB 1CY6A 1WSWA 2GMWA 1AUOA 4KQMA 4S1WA 4YDQA 1KGDA 3LBNA 3NHJA 3I0MA 5SY4A 4LRWA 5IFLA 1F9AA 1JA0A 5T3UA 4B5KA 4DV6B 2W6ID 3DXXA 2WIBA 4BAUA 2IPMA 4PZEA 5P21A 3W79A 2F1IA 3CLRD 3CSUA 4JOCA 3TTWA 1ORDA 3F9CA 2QB5A 2Z8YA 4HGNA 5LBIA 1BCSB 3KYDA 3OFND 3R7BA 3CN7A 5ELXA 2ONYA 4KR2A 2C4UA 3MYYA 1SD5A 1TLTA 1XNHA 2LCIA 1FRVA 3N0VA 4QVGA 1Z9BA 3JATA 4XR4A 4YHBA 5AKYA 1FRQA 1XWFA 4JOBA 4GF5A 1T5DX 1T4MA 4GVPA 4JT2A 2HTEA 3S2FA 4MRMB 1R6AA 3UATA 4FMCF 3UGKA 4TSFD 1XA3A 1XL1A 4QJ4A 1V7CA 3CW8X 3VR2D 2AE1A 2WF8A 3FNBA 4FHCA 4Q4JA 1EINA 1EVZA 3B3GA 5IWCA 3BHMA 4Q3AA 5K3AA 2GJSA 1WIWA 4UAUA 3ZWBA 2QX9A 1DP4A 1E1CA 2VJMB 4Y1EA 2AJDA 3ABSB 1JAYA 3UFXA 4BKOA 2GA8A 1HEIA 2D06A 5CXSA 3RVOA 3IS3A 1FDWA 3IBCA 3VJMA 4B7ZA 2F3UA 4OLJA 2MU1A 3SXUB 5HRAA 2RAPA 2QX4A 1X92A 1CZKA 4I55F 3QK7A 4D79A 2ARKA 3MXTA 5B3JA 3DV0B 4X1YB 4HN2A 4PN7A 4JL8A 3I6IA 4IIEA 5FQOA 5CA0A 5J4LA 2X7JA 4BE7B 1E94E 1NV8A 4IH9A 4L5AA 4PIVA 3RAFC 1RCUA 3PICA 2EJUA 4ME6A 4GM0A 2OQRA 5LP6B 1O57A 2ZTUA 3DZHA 4H3SA 4EA6A 1FYWA 2HYIC 4IG4A 1MH1A 4BEVA 2I4OA 1BHO1 2N46A 2N75A 3BE6A 1MOPA 1RKBA 4F2WA 3AFOA 2AEEA 1HDIA 3JQFC 3DCIA 3B8EA 1XTJA 3DAYA 3HDGA 4MV7A 2HEIA 1C3XA 3FETA 1G6KA 4Q34A 2FPUA 4JLSA 1NWCA 3P1JA 5AXDA 3AZQA 1P0FA 1Z4PX 3A4IA 2WWXA 4CMBA 4EPRA 1DIGA 1FRZA 2OHIA 4YRJA 3TR6A 4N5HX 4R1PA 4AY3A 4U63A 1OXKB 2RCNA 5DXJA 1L4UA 1N6NA 1ZGBA 4MW0A 4XPIB 1WDLA 1A2OA 2J6CA 4BKUA 1L5HB 1GAEO 4DCUA 3IP3A 1PD0A 2A86A 1UDBA 1HLGA 4F4FA 2ODPA 2V74B 4NY1A 1JEEA 3AVVA 1YRBA 2J5XA 4MGHA 2WFAA 5KJ6A 1Y34E 1RKVA 2KLBA 3H6GA 3HLTA 4BEJA 13PKA 4F4DA 3DBIA 2JGRA 3PT9A 3V7NA 5A7FA 3SI7A 1EM8A 4D9FA 1A82A 3IXLA 1Q3HA 2HA5A 4X60A 2Q4OA 5FJIA 1JFRA 4D8VA 5AQEA 4Q9JA 3LKZA 4EGFA 2BMWA 3QKTA 1OE0A 1YB4A 5AK6A 5I9NA 2HJVA 1MGPA 3F71A 1G5IA 1TM7E 4Z6KA 2PZFA 1UJNA 3I5YA 3F3SA 4M36A 2X7XA 3IUMA 4JX9A 3LBIA 2ZYIA 4TS3A 1TK3A 3WLAA 1H9AA 5ED0A 4NFSA 3BEOA 3VR4A 2ZBUA 2QLMA 2FMIA 3KYIB 1JB1A 4KFTA 3E9EA 5FBWB 1BWPA 5B7QA 1VPTA 1VI2A 3NFYA 3X1WA 4MQMA 2CLSA 4DA7A 2FDCA 5EPUA 1B4DA 1FMLA 1U63A 2ZT6A 1O8CA 1USWA 4LAFA 1I33A 2KS6A 2YOFA 4QTUB 3W2IA 4GMKA 4X6YA 3G1TA 3SVLA 2JGDB 1RYDA 3C0KA 3OZBA 4NDNE 4W8GA 2C5SA 2BTOA 2J3DA 4YJ3A 3EXHA 1XZMA 2C9YA 5I7FA 4HCJA 2VDVE 4GNKA 2R47A 4RORA 4ZMBA 4W1QA 3T3MB 1I0ZA 1IJFA 3H3FA 4ZYVA 1YDEA 3KZXA 4TKVB 3UNXA 2XMRA 2VPZA 2YYSA 1XVVA 3DCNA 3H9QA 4I5DA 2VQ3A 4RPCA 4YRNA 3CLUC 4HMOA 2VCEA 4HYTA 4WADA 4O8ZA 4DV3B 3H11A 2OZLB 4JY7A 7REQA 2OV6A 3VAZA 3RH0A 1T2AA 3CISA 1Y3FE 2YTZA 4GXQA 4YJGA 1J0BA 4YN3A 1GNQA 2Q8NA 3N8NA 2GDJA 3M82A 4KO3S 1ATZA 4HATA 3I05A 1B23P 3DWEX 2B36A 3OURA 1EA7A 1O9HA 5TEVA 3WY9A 1NKTA 3GCGA 4HNAA 3UAGA 3VAYA 2W5UA 4CL3A 1A72A 1F0YA 2A5FA 5AKJA 3M6IA 3EEIA 1GV1A 1TAGA 1JUDA 2NU9B 3DEZA 3UENA 3WLMA 3NDJA 2FTKE 4NZOA 4Y2QA 5A6SB 4LYHA 2P9GA 4FFDA 3FCXA 2YN0A 4JP1A 4MOWA 1E1DA 1P9WA 3GD5A 3GMDA 4BFVA 5F3WB 2GGSA 1RJEA 5EIHA 4B4KA 4H17A 3D4NA 4TYPA 5CITA 1H9CA 1UXOA 2R4QA 3BJEA 3QUAA 4BVFA 2ZJOA 4EY7A 5CCBA 4YR9A 1FYFA 4Q15A 5DP1A 1M2OB 1TKAA 2EZ9A 3AZPA 3BGSA 3N5CA 4CIBA 5ARBA 1XLVA 2P7IA 3GPDG 3MCUA 5C7OO 1XGKA 2FOXA 2JA2A 4CVNA 5AW0A 2D1SA 5DASA 1OX4B 2RIPA 2H08A 2WWWA 2Q5JA 4FYVA 3VU9B 1TYDE 2V6BA 1ODTC 2D00A 2J9FB 2JJ2A 2BFDB 3OUTA 4IHKA 4NL4H 5M5BA 3AF6A 2V1UA 4EF6A 3WGNA 3MILA 4KRXA 5K03A 1D4OA 4YREA 1GEGA 1D0IA 1NAIA 3BRCA 1Z6QA 3CEPB 1VGVA 3G8AA 3K96A 4PNPA 3WV4A 1G41A 3L5KA 1WZEA 1RPNA 2XCLA 1KEKA 2IYEA 5E7IA 3KQQA 2GOYA 1NX9A 4W99A 4HNAB 1ZQ1A 3I52A 4QUIA 3NO4A 4J49A 2C7RA 4LRUA 3LC7O 4YACA 3V2HA 5KJFA 2MYTA 5COBA 1EWYA 2XB2A 1M34A 2GNAA 3MS7A 4LY3A 1H22A 1FJGB 1IU9A 1G7TA 1YULA 2QRQA 1K3FA 1V26A 3HFRA 3NYQA 3U81A 5HW0A 3CUTA 1ICEA 5HYVA 5KO2A 3W34A 1Y33E 5CVJA 2H7YA 3RT1A 2QN8A 1CRWG 2WUGA 3A0UA 3O2SB 4U3JB 5GJCA 4B35A 2WF6A 2C5FA 5DM4A 1YJ5A 5IJXA 3WB9A 2OYRA 4C08A 2QTGA 3NGXA 4UTVA 3HB1A 3THXB 4CQMD 4ZTBA 1T1JA 2RH8A 2Q5IA 4MVXA 3A9VA 5IMBA 2XHZA 5FOWA 2HXSA 4K9KA 1YGPA 3UAWA 4P3YA 4TYQA 2OFOA 4Q9AA 3CRW1 1JHXA 1T5IA 2DGDA 2J0EA 2YXBA 3EMVA 2WC1A 3SLRA 2HSGA 2JI7A 5FPYA 1JIUA 4OBWA 3L7NA 3O38A 3K35A 3U5TA 4WA7A 2ZYHA 3DEHA 1SHJA 4PLPA 1NG1A 4CEHB 1PWHA 1ULTA 1UANA 3C6KA 3ZVRA 2IU6A 3EE6A 4A8HA 3GJYA 4IDNA 1W0KD 3UIEA 4HDKB 4TLMB 3UV3A 1HZJA 3LRTA 3NU1A 2HJHA 3QKUA 4BC0A 2X77A 3BL8A 4NENB 1L5HA 3KYCA 1R0CA 2PRIA 1XMPA 2B2XA 3BPSA 5M3BA 1PBNA 3FUXA 4BQRA 1DX9A 2HBQA 1G38A 3D31A 3D8SA 1XQVA 1LLQA 1KKMA 5TVKA 3ILXA 1OGJA 2QD2A 4WXMA 2JGFA 3WIEA 3EZLA 5DM60 3D6UA 1OILA 2NSJA 4NPAA 4D3ZA 1R6DA 3GMTA 4PZ9A 1ESMA 5KOIA 1ODSA 3DE3X 3USES 1TCAA 1YS7A 2P3OA 2PRYA 5EVCA 1SUSA 1CNMA 1KFKB 5LB4A 5HQ3B 3S8EA 3WL8A 4Z4QA 1Y37A 1F2UB 2PG3A 2ZG6A 2CVOA 1UZUA 3IPCA 5G53C 1PJLA 5B2ZA 5HRUA 4KMMA 5LZ9A 2V9ZA 3LHDA 1H65A 2PMKA 4W7IA 1NC3A 4G63A 5BUZA 2GVNA 2Y9MB 2WU4A 4AZVA 5J47A 3VSDA 2VHTA 1G5TA 4FJ1A 2JCVA 4GLBA 3SEAA 4QUBA 3QFCA 5JOQA 1NJFA 3TLXA 5P8WA 1Y42X 3U0BA 3NUGA 5EN4A 4Z0NA 3E58A 3EAFA 4PONA 3UFBA 3GNTA 4B3BA 1DJMA 3M4ZA 3CX6A 1IJBA 2BDUA 5G3YA 4MR8B 2G04A 1DC6A 2I87A 2GZRA 4Q4HB 1MPTA 3TIIA 1KVQA 3G6WA 4YCBA 1U1FA 3WRXC 1HR0B 4TS4A 2I2AA 3QEAZ 1QVZA 3DMNA 1RXUA 3K1TA 4K6HA 4LV6A 3AFIA 3AP1A 4CLOB 3SX4A 1UXGA 4GLJA 3O8BA 2IOQA 3OHSX 4KDFA 6NULA 5I7HA 2M1XA 2WDPA 4NYMQ 4YECA 1F2TB 3WLTA 5HOEA 5B1SA 1BWRA 1B7GO 1RWMA 1YQWA 1TPZA 3ZWNA 3H4IA 5E6RA 5AUQA 1CUAA 1OXSC 1UBOS 1F3OA 2CNOA 1P5HA 1V8BA 1EVLA 4MPPA 2UVPB 1TF7A 2JS7A 4Q7LA 1TKCA 3GQBA 3OZWA 4LMRA 1HG0A 5DLPA 1L8AA 2VRCA 3N2GA 4JYAB 1JE0A 2I1VB 4H3VA 3CMCO 4JVSB 5F21A 3RIXA 3WLJA 4BLVA 4Y2XA 4WPGA 4ZOLB 4BX8A 4UQPA 4Z0TA 1R18A 2OLKA 4QUHA 1NOKA 1UK8A 4EI8A 4MZXA 2WWFA 1SBIA 4OKIA 3S70A 4BVAA 3NZEA 4WCVA 4INZA 4F3TA 5A5FA 1WXGA 1FFEA 4IYRA 4XIYA 2P75A 3IEPA 1W0CA 2NZ8A 2QTZA 3ICOA 4Q3DA 4RFLA 2Z6VA 3G89A 3DGFC 3LQ4A 1Z7EA 4LECA 2DXIA 3IEMA 5HF9A 3CUVA 1W0KA 3GRRA 4O8CA 4MQFB 3IE1A 1YFKA 4BLWA 1G64A 3T7KA 4XCVA 2ZRFA 5AKZA 4LHSA 1DFIA 4CMCA 1NY5A 2J07A 2QRLA 3NWPA 4AJOA 2BKVA 3SQXA 3IGFA 2ZEJA 1O77A 1XKXA 1UMKA 2A4KA 4U7WA 2BI8A 1CQWA 3FPEA 4UNSA 3E7FA 1OFIA 2H9AA 2IZ6A 1A9YA 4HGPA 3TE6A 3UBMA 3PRKE 5LCXA 4R2JA 3WGMA 1BS1A 5LOVB 2XE6A 4B6FA 3OJEA 3IERA 3LPMA 4TLLB 2G40A 2VYFA 2ZJ4A 1ZUHA 3NRBA 4G4JA 1EP2B 3A4MA 4BZZA 3C7KA 4EATA 5AVWA 4KMOA 3WSTA 1HTTA 3HU5A 1QHFA 4DJAA 3H9JA 4G26A 2C96A 3BJMA 3KKNA 1JEDA 3N76A 3SNKA 3PQ2A 4QUJA 4BFSA 2KSQA 4DBZA 3Q15C 1MV5A 2AYYA 2OGUA 3V1MA 3LT0A 2IU0A 4MYTA 2H51A 1LX7A 1ENYA 5EIBC 3MYRA 4YEDA 4F7DA 5IC4A 1UZAA 1K6EA 4ITVA 4YXWD 1TECE 4KO1S 1R4MA 3ZDFA 2VJDA 1GCGA 3O6VA 4MVJA 2HK7A 2PLWA 1SCNE 4DIMA 2BP7B 2F8SA 3AHIA 3V4FA 3AM5A 4OBXA 4P4TA 2ZB7A 1N1GA 1IQUA 3ZHOA 1P6QA 2EP5A 2WKSA 2AFIA 5BWBA 4ETMA 5EWJA 1Z26A 3GLGA 2FG6C 1O95D 4AL4A 2JFUA 1NNEA 4NE9A 1RHRA 5DMHA 5ALUA 5E7MA 3QZUA 2C20A 1JBEA 3UXHA 2J30A 4RZHA 2GD2A 4YYEA 4POAA 4NEGA 4IJ5A 4KHZA 1L7PA 4OH7A 1KEUA 2QPLA 2RB5A 3STWA 5CJJA 3T9AA 3P9ZA 5IJ0B 3K0BA 4MJ7A 2FQWA 3COPA 3LPDA 4NX2A 1XCGB 1O1YA 4YTEA 3KUKA 3HS3A 5AOVA 3VJRA 4ZK6A 3W06A 2QN2A 1T3GA 4KXMA 4DIBA 1EFPB 1D2CA 5B64A 1QIFA 4K9SA 5HK9A 1U7WA 2PUHA 3CW9A 3E9MA 2IZ0A 1S89A 2B69A 5FP0A 4K05A 4OJNA 2C2BA 4RY0A 1J2UA 3MJVA 4EYSA 5KTKA 1HI9A 3ANMA 4Z9XA 2HNAA 1D9XA 2BFEA 1Q0HA 1UKBA 2HAEA 2I22A 2I8AA 2JCSA 2X6RA 3HBMA 1MJGM 4M9UA 4FMBB 4PPYA 4Q4LA 2HPAA 2LPMA 5JBIA 1ITZA 2EJTA 2YV3A 3HSKA 4ND6A 3GLIA 3QUBA 4ZO7A 2H4YA 3C48A 1Q0PA 2OCGA 3NLLA 3B89A 5ALEA 5LZ2A 5JVDA 1ORHA 1OW3B 2D5LA 4HLCA 5BWOA 2XAAA 3LQQA 2AG0A 1MJGA 1IIRA 3C3YA 2J31A 3PHGA 1U1IA 3IHWA 4PLHA 3BHIA 3WBBA 5I9LA 3GLGB 4AKIA 4RFSB 2E18A 1SHUX 4EHNA 1LZKA 1EXWA 2H85A 2QY9A 3O94A 1ZM7A 3DW1X 3GEEA 1QIMA 3KJNA 5BYJA 2VF2A 1E2PA 4LKOA 5AK3A 2CUKA 3IH5A 5AJWA 5F5LA 5FLYA 3ZKWA 3ZIAD 5IG2A 1EG7A 1BE8A 4IVPA 4JYMA 3VKGA 4EHHA 1NKSA 4NK4A 2CXHA 1I51A 1Q77A 3BIOA 3A9WA 3A11A 4OQLA 2JKVA 1AJEA 3K9LA 3D3KA 2ZUEA 1YAJA 1XRMA 4TT8A 4PAGA 1I3KA 4YRFA 4TRRA 3ZXIA 4WK4B 1P9RA 2DOKA 1E3MA 1R2QA 4XEUA 3DKVA 2LZ0A 1I7NA 1NN0A 5COQA 2NXJA 4P32A 4X90A 3PUYA 4Z7QB 5LKRA 1M1NB 2DFLA 3TGLA 1BOFA 3IVCA 3IJ5A 1BU8A 1WA5A 3LECA 5JUWA 5IK2D 2PKXA 5JYEA 2CNWA 2ZE5A 2AWOA 2NO4A 5ENDA 4C03A 4KN9S 4HGRA 4N39A 1PRYA 5AW2A 5ERGB 2XD4A 4NQRA 1OH5A 3V3KA 4F6CA 3MUNA 2J9YB 4O3MA 1S7CA 4IW3B 4PQYA 2UZ4A 1QFYA 3CLKA 2OL4A 4RULA 4WLEA 2Q6KA 3Q9LA 1RWBA 3FSEA 4R8MA 4H7FA 3G23A 3JASB 3GLFB 1GQRA 2UV8A 4OKSA 3O1HB 4QARA 2EVWX 2A9KA 2X8LA 1QOQB 2JKYA 3O3NB 4Q3NA 4AWBA 1NF3A 4EF4A 1LK5A 2Q0SA 3Q0IA 1M83A 5EE3A 3PIIA 4MGYR 2LWIA 5AI9A 2QPAA 1VGQA 3VPGA 1SU7A 4HLUA 3VKHA 3HVJA 4IQ0A 4MA5A 1DARA 4O25A 2W0SA 3HYSA 1O0BA 1CEXA 4E07A 4F8JA 4QOGA 5E8JA 5KQSA 5JHHB 3BMNA 3GT0A 3HBFA 4J91A 1RAEA 1Y6JA 3EC1A 1UMDA 2QRPA 3Q5DA 4Q3OA 5ALHA 3EB9A 4J1SA 2REOA 4D6YA 4DDMA 3F1KA 5G0VA 1Q92A 1J24A 2O6LA 3D6TB 5T3YA 5KPJA 2ONCA 5J59A 1OFUX 3LA8A 1U3VA 1IN8A 3GA7A 3FUVA 1GSOA 2YHIB 1A4UA 1UBJS 4H0CA 4BL5A 2CUTA 1UAGA 3DF7A 2ZI4A 5DRYA 2PZBA 1UT8A 2ZRJA 4TWBA 1RMQA 2HY7A 3LUGA 4Q1FA 4O2BA 3TZEA 4ID3A 3Q8WA 2PH3A 1ULUA 1XZJA 5JCJD 2JD2A 1NN3A 1YBFA 4LXTA 2PKYX 4AVYA 4E2XA 2VNAA 5JAUA 2QNBA 4ZIRA 2BRUC 5FO0A 3ZQ4A 1OTXA 2OMKA 4NK5A 5IKXA 1KZ4A 1UBKS 5KYNA 2CDBA 2V58A 1I36A 1G3RA 1FXUA 3ID6C 4NCAA 4DLTA 3RKUA 4ECAA 5EQDA 2VPXA 5A7HA 3DFMA 1HE2A 2N47A 2QN1A 4RF5A 4Q1AA 5AHWA 4LHEA 1T0BA 3G8BA 1DQSA 3V2UA 3ZDZB 4BX3A 4YPVA 1X7ZA 2QTLA 3H2JA 4PFJA 3ZGYA 4DEYA 2OE2A 2XQJA 1O9GA 1N2CB 3BWCA 5CM9C 4ZRDA 4Q7QA 1CG6A 1DAEA 5ITZB 1B76A 1GPAA 5HVNA 4EW3A 2ODWA 1IULA 5LZ4A 1HYGA 1JDBC 2XF8A 1UJBA 2FZ4A 2WSLA 1QNFA 2IXGA 3F2VA 4GKBA 4RANA 2OXIA 3VR4H 3WLQA 1A8PA 3X1YA 1JXAA 1G60A 5JO0A 2ZWAA 5JATA 3VR6D 1NSFA 3SHWA 2CHFA 3L2OB 5HF8A 5K09A 1J5PA 3DSRA 3AYZB 4D0RA 3ONWA 4FZRA 1M2JA 4RAOA 4TUYA 2O1SA 4O08A 2V59A 2I8CA 5FI0B 3WGGA 8LDHA 1ZXXA 2PWBA 3HJHA 4GPTA 3ICEA 3NQ41 5T4EA 2C07A 4DDTA 1XTRA 1E7SA 1XHLA 3CT6A 3D2CA 4MW4A 3I6ZA 2HJSA 5FF9A 1E6LA 1R88A 3O4RA 4KX3A 5JASA 4MW7A 2XMSA 4W8OA 4BUCA 3SS9X 4YRMA 4Q5IA 1QYVA 4RD2A 2I78A 2BFBB 1EM8B 2CV1A 2R6DA 3VV2A 1NRXA 1U5AA 2EKPA 2N1BA 4TGLA 1BIFA 3PXXA 1F2UA 4Q21A 1SG9A 1FTSA 5JXGA 3VOBA 2VZ9A 4H7KA 2BE7A 1R74A 4KJZA 4PQRA 3H18A 2P40A 4QREA 2WD7A 4HVTA 4RGQA 1AB6A 2Y67A 3BM5A 1ZD4A 1YGYA 2DKOA 4A92A 2FPSA 2INGX 3R0IA 4RF3A 1K5GA 1DV1A 2W6QA 1FF9A 5KVQA 4KR3A 4IGEA 2V3CC 5LMCA 3MMXA 2F9FA 2DX7A 4L0DA 4Q24A 1Y3CE 3LW8A 4V0QA 1QRRA 2ZROA 4OQZA 1PDVA 2IIPA 5IKOA 2OC9A 4URYR 2LNDA 1OC2A 3D2BA 4Y9UA 1OXTA 3AL2A 4DZTA 1IXKA 2PKQO 4QEZA 4Q1VA 3ZD7A 4KO2S 3AQIA 1WE2A 5K99A 4Y1RB 1RPTA 1I2ZA 3O4JA 1NLMA 3OU6A 5TVGA 3T15A 4E4YA 2H7CA 3PXUA 1A96A 1IEVA 4IOLA 3STYA 2VWGA 5J4VA 1I3LA 2WE7A 2A0YA 3H5RA 3VYVA 3LX4A 2ADFA 2ZSDA 1QRSA 4QT0A 1L7XA 4HOYA 5HRCA 5HZMA 1GU7A 1N8TA 2JJYA 4HJXA 2XKBA 5B58T 5IT5A 2HQOA 2PO7A 1E9VA 2YMMA 3GLHE 3RAPR 2JBAA 3GB9A 4JU8A 4CMHA 1EDZA 1KJYA 4R41A 4YMTA 4YRDA 4RKWA 1YKGA 1L5SA 1MC4A 2AEJA 3JPWA 4KHPB 2GD0A 1GA1A 3EJWA 1Z6XA 1T8TA 1VSVA 2PEZA 1G3UA 1Z2OX 1TCUA 2GRJA 3P5SA 4PLWA 5E6UB 2E55A 4XI9A 1NUAA 3BS4A 2R7LA 2HDOA 3FHJA 3I4CA 5FBHA 5CDFA 2YIDA 5JDCC 1BKSB 1C9KA 1QGUB 2V6IA 3BB3A 2L42A 2KX7A 1OY1A 4R81A 3SC2B 3VZPA 1E59A 2WV9A 1QNLA 3OPQA 4DQ0A 2IYYA 3X3HA 4DA9A 3HB9A 4HZGA 2PZ8A 4YAGA 1PR0A 3OQ1A 4MQFA 2M6LA 3KJQA 1G5QA 3P9SA 4P36A 1JMVA 2V8OA 2IELA 4CQMA 3WK4A 3PC6A 3IKMB 1EVIA 2BPOA 1ISIA 4D45A 2WMOB 2FWJA 1ENZA 1KBZA 2EJWA 4RL4A 4XR9A 4A2WA 1W2GA 3UKJA 3RUIA 1S2MA 4KQ9A 5G41A 4MYHA 2MMGA 3MT9A 3W2EA 4AO6A 4JIGA 4N0QA 4RK6A 2C1EA 4HDQB 5PGMA 3G5TA 3PKIA 4B31A 4BNUA 4CMEC 2I5PO 1HORA 1NTOA 3IE2A 4P6VF 4P7JA 2CLEB 5BW4A 3PHLA 3UO8B 1F14A 5DX0A 3KHTA 1IXYA 1ZOLA 3E0QA 1VE7A 2QAIA 4NHEA 3W9SA 1GG5A 4TQAA 1UKYA 4O4HB 1CQIA 1WZUA 2HA6A 4XCQA 2GAJA 1XVAA 1REQA 2MR6A 2AZMA 1RQRA 3CE9A 3GAAA 3MWLA 2FGKA 4P7FA 1TI7A 5JVDB 2WB2A 1VBKA 2A1UB 2VWPA 4U02A 2DFTA 4UDXX 2MINA 4NXMB 3PPYA 1RP7A 1JDNA 3MFYA 2WT4A 1SN7A 2YH2A 1Q2UA 3UPDA 4JITA 1PJ8A 5CFZA 1AKWA 2G4CA 4CTOA 2H4JA 2QTAA 4DQDA 5CDGA 1U0NA 1KYXA 5E9QA 3FYUA 2XY4A 4IPTA 3DC7A 4F72A 1RFLA 2B35A 2PT7A 5C5IA 1YBVA 4BRUA 1DEHA 1NUQA 2HRZA 2I3BA 3AFGA 4ZT5A 4QYXA 4KFUA 1QIKA 4WOBA 2QM7A 3QJGA 4KPUA 4NRDA 1DKUA 2P3QA 4S1TA 4AS3A 1NVVQ 5DHUA 1ZVJA 2W7TA 3Q85A 3VZQA 1MNAA 1YBAA 4TN5A 4S24A 1J2EA 2YXLA 3K09C 4HZIA 4BZWA 5CLFA 2JLVA 3NANA 3GA5A 3LDHA 3WKDA 1FYEA 2CVPA 2G0AA 3GL9A 3QE0A 5FTNA 3UJBA 4ISCA 1E8MA 4D9NA 3I28A 3BCUA 2FGJA 3GJ8A 1SM4A 1XPOA 2SICE 1E7WA 1T0JB 3CO0S 3CURA 1DCMA 5BNZA 3DA8A 2PZKA 5H9WA 4OLBA 1CQIB 1KIFA 1ADYA 4Q4HA 4U0JA 4JLNA 5BURA 3Q41A 2GHIA 1B0AA 1GNRA 1SCBA 4R2LA 2ZJ3A 3WMWA 2EZ8A 4G2NA 1F7UA 3A1CA 2Q4BA 3GPLA 2VHUA 2V4MA 3G59A 4IGIA 5F2OA 2WINI 3A3KA 1B3BA 3MCZA 3R7WA 1AN9A 4D4KA 5EMMA 3F8WA 3KPWA 3TAXA 3TIFA 1LQTA 1I4TD 5BSMA 3ZWWA 2REBA 2CJXA 1DDIA 3QVOA 4PC7A 4IZIA 4EO7A 3DCYA 4QLOA 1A9QA 3UMRA 1GA6A 3ZWMA 1DB3A 1CBUA 1DG9A 2VUSA 3FTDA 1GAXA 2DR0A 3SE7A 2H6EA 2QX7A 4NMWA 4TQ9A 5K9ZA 3CRVA 1FDOA 2X8BA 2ZAOA 1L3CA 2OFXA 1BX0A 4ESOA 1R16A 3MJHA 4I4TB 5FWDA 1AZSC 4TWZA 1U2PA 3EVBA 4Q4CA 3EGVA 4PR0A 4LS3A 3R7DA 1KY2A 2RB4A 4H6PA 3VO2A 4OX9Y 1OQAA 2BUAA 5EUQB 3U7QB 2R5WA 2P3SA 4M7PA 2W2NA 5K6AC 1SCUA 2ZKIA 1ZSNA 2ZYGA 1G21E 3PU6A 1CP3A 2M6RA 3I9JA 4KQFA 4AN1A 1VCMA 3IFSA 4BTEA 2DLNA 1MAHA 1Y4AE 2DULA 2H9YA 3DBLA 2GDZA 3VOSA 7ABPA 3ZW9A 2FMXA 2HF8A 1I2DA 3K31A 3L1KA 4UJ5A 2ZBEA 2ZS7A 4GOXA 1IEQA 1QU3A 3EEOA 2A58A 2QLFA 2WF7A 3WNBA 2WM8A 3V00A 1XQ1A 3ETLA 4LTMA 4DB2A 3OT4A 1J2JA 4NDAA 3RU2A 3SQDA 1BA3A 2CBGA 3OPYA 4FN5A 2A4MA 2CXOA 2IRWA 3AV0B 4QAJA 4E7PA 3T1HB 4PX2A 1N2SA 4MI6A 2HI0A 5FUVA 4P7BA 3WL7A 5AI0A 5ENZA 5IN5A 3GGSA 2P79A 3GT7A 4OXNA 3AERA 3JARA 3AVXA 3OZUA 5EWLA 2HDNB 5DNYB 1GDHA 3QE9Y 4RDHA 3FMGA 4TYNA 1P6XA 1HE3A 2JJ8A 2Q4TA 4CKZA 3M6LA 3CUEF 3GLRA 3LUCA 3A1FA 3P0HA 4NBUA 2WU3A 4FNOA 3SBOA 1MAAA 2AMVA 1SXIA 1QB7A 1ZK0A 2AMLA 3C6YA 3EVTA 2BN4A 3QOXA 4INOA 1AUPA 1GUZA 1K68A 2D1RA 1RU3A 1X19A 1VBNA 3DHWC 4IV5A 3RUPA 3U4HA 3RSQA 1LRKA 1TXGA 3KKPA 4RXMA 3ABRB 1RWKA 2QUJA 3EFOA 2DUWA 4HG2A 1N7HA 1GILA 4X85A 3PUHA 5JBQA 1WL8A 4JSTA 1TC2A 4D4MA 4EB8A 4MV0A 1ZH6A 5FXMA 1NBEA 1K86A 3GRVA 3H5TA 4I1OA 3PNKA 4JEHA 5H9VA 4TSKA 4ACBA 3H99A 5BUSA 4YMSA 4WE3A 4K9LA 4GWLA 4URFA 4OHPA 1J70A 1R0KA 1VECA 2VDUE 3P9CA 4NHOA 1OX4A 3HKEB 2Z8YM 5E2BA 1BMFA 4JSYA 4A8TA 4BDSA 5L4NA 4L78A 4F1KA 3KTFA 3ZHSA 4GPIB 1Z12A 5A03A 3G2OA 4W7HA 1L7NA 4LOLA 1XEAA 4L5IA 1R8YA 2EGHA 3LHIA 4MP6A 3U19A 4C3ZA 1LPAB 1TU3A 2AN4A 4M8NE 3E22A 2A14A 3I1IA 5AIBA 1ENPA 1OAAA 2C7BA 2DAPA 2R44A 1NI5A 3JR7A 4TL9A 2EOAA 3RHSA 1N9KA 1JLHA 4LTDA 3SIXA 3ZGOA 5CDUA 4IIJA 5IVKA 3RUFA 5KC8A 4R68A 5DTMA 1OXVA 1JWAB 4WINA 1EFRD 3QA3E 5AW7A 2GB4A 3TG8A 2PJUA 1XIVA 2A9PA 4C06A 1QFXA 2I7XA 1AKNA 2NU9A 2I7VA 2V1XA 1P9LA 2XWSA 3L6RA 5EZSA 4BNKA 4FB5A 4YMGA 1XEXA 3GN2A 4CN8A 1PWYE 3IT3A 3R3HA 2E4WA 4MRMA 4PIMA 5T67A 1XRRA 2P2DA 3HNRA 1NMYA 4V03A 1YO6A 4CCAA 4HI0E 4HMPA 3HFJA 2H2FA 3ONFA 3KTDA 1OPRA 2O7SA 1VLLA 4LF6B 3DVQX 1T4GA 4IDDA 3KR2A 4LYDA 5DNWA 4YCDA 3ACCA 3BMOA 4L76A 1ADFA 2LP4Y 3A3YA 4RCYA 2IYLD 3RVLA 1S8AA 3M5DA 1GPDG 1K27A 1W94A 1X94A 2N9UA 4FBLA 3FWYA 1W75A 2WPDA 4UEJA 2R9VA 3QEBZ 1YFJA 1A8UA 2O4CA 5I47A 1HDEA 3B48A 2LCFA 1D0SA 5ALRA 5A02A 5C1BA 3C87A 4QVKA 5KWSA 1MX3A 3J81A 2WAMA 5AWFC 2IHUA 3E61A 4J0HA 5U4XA 1P2UA 3RG8A 3GFOA 4WX2B 1H2HA 2YVQA 1QTNA 3LXMA 3NRCA 4XB6B 4BV2A 5ALVA 5ALKA 3GLTA 4X9XA 3C15C 2DPXA 3ZLVA 2P2YA 3WGLA 4DCJA 3M9XA 3HFSA 1SPXA 5C37A 4JVMA 1FDIA 5IANA 2BMVA 4RBNA 1BKDR 3SC2A 2WT8A 5EIEA 1LFDB 3ZGLA 1P0CA 2A5YB 1EK0A 4QAQA 1E9FA 3G1WA 4X3OA 3CEJA 3CMMA 3I58A 3IMFA 4IMPA 1SRRA 1E1QD 1XD8A 1BJTA 4XQCA 1RAFA 3G7SA 4XDYA 1P8JA 2JZCA 3LP6A 5I7AA 2X0RA 3SQNA 1F7VA 2OCXA 1F8FA 4F11A 4Y2HA 2MSKA 1SXJA 4R5MA 1SJ9A 4BMSA 4DCSA 4NV0A 4HLQB 2E5LB 3HKCA 2I7TA 1ZCFA 4LF9B 2C3UA 1CR6A 1BVYF 1WEKA 1CR0A 3AUYA 4QWMA 2C3OA 4IGAA 2IYWA 3LHSA 3AZOA 4ZU6X 1OZGA 2QLLA 4PG8A 1KPHA 3UWOA 3TBFA 2GI4A 5JROA 3U40A 3BD7A 2JIRA 1E9CA 1O4WA 1UC5B 1R64A 1AD2A 5SYNA 1E1QA 4BNLA 621PA 1QFSA 3KWFA 4X1IA 1A4XA 3DBLB 1M1NA 3NCHA 1LD3A 2JD1A 2OA0A 5HIKA 5BR7A 2PT6A 3FCUB 4XYBA 4NSNA 1R27A 1VCIA 2JB9A 3E2MA 4PYKA 3IHLA 2OFPA 4UU8A 3EGCA 1IXRC 4GO1A 4OK5A 3UANA 2CNKA 1D1SA 3A28A 4RO0A 1BFDA 4ASUD 5AESA 2C58A 5K8TA 5KSYA 3QMPA 6ABPA 6PFKA 1JQ5A 4ZT3A 1IRXA 3HZZA 2GA9A 3PTZA 1FNMA 5FUQA 3ZDXB 4XOIA 4RA6B 3LCMA 3EGEA 4TLEA 3UAOA 5EMNA 4LQLA 4WXYB 3VR5D 3F98A 5IN4A 1FQJA 1PR9A 1OHHA 2ID9A 3A32A 1VSQA 3ENNA 4MKIA 4OL0A 4PYQA 4EKYA 1ST3A 3FMOB 1ZRNA 4RZQA 4Y18A 4MYDA 5BVHA 5FBRB 3E03A 3S0JA 3ND9A 2PXXA 1X8XA 3LW7A 2W8BB 4WZBA 1UBEA 1NW9B 2D7JA 3RC9A 1EPUA 2Q6TA 3B1FA 4B48A 5KNDA 1WXXA 4X1KA 2I4RA 2V4ZA 4KAXA 5EXDA 3W3AD 2DWOA 1GPBA 1JKJA 3JQAB 1EFKA 3JWHA 4IL5A 4FDMA 4P0PB 1SOUA 4DMRA 1V37A 1T8SA 4Y9DA 5EHIA 2CXTA 1R9GA 4NFYA 4D26A 4PHTA 5ALYA 3JQEA 5JS7A 2WUDA 3GFQA 3V1UA 5U4QA 4RVFA 3S5UA 1YDMA 1EWKA 4UFOA 1M2GA 4TWRA 5KQGA 2EJVA 3VSCA 5EIXA 1II0A 2H5EA 2YQ4A 3MTDA 4GI5A 5KI6A 4ZZ0A 5JXHA 4CM5A 2LE0A 4G86A 1UBGA 4GOMD 5FKJA 3OEHA 2XT9A 1EWTA 2BD0A 2YHIA 2VH1A 3FYSA 4K2HA 3LKVA 3UUGA 1XWWA 2A0FA 1P4HA 4QUAA 2DT8A 1JEAA 3NCTA 4MAMA 1FSFA 4Z9AA 1U3TA 4TMVA 3GVIA 1A0OA 3EVAA 2WJWA 2YJ4A 4QPPA 4DPMA 3E23A 4HDRA 2NUTA 2A5GA 1XROA 1DEOA 3KKMA 4G1FA 3T9CA 1GGEA 3QVSA 4XRRA 3V2GA 4YB8A 2PJDA 2X5NA 4B3SB 3PXAA 2GKOA 1UWLA 5JPDA 3PBKA 4RDIA 3ZDCA 1K7FB 1KSFX 1K6IA 3MS4A 4F5WA 4I8IA 4EG7A 5T8KA 4ARAA 2OGSA 2GBLC 1X70A 3OM0A 3QH4A 4R1SA 1OX6A 4UE2A 4TMKA 1K7YA 3K1ZA 3ZDEA 4DMUB 1N1EA 5TNXA 4DVGA 5KNBH 2J09A 4ZOLF 3ABZA 2ZT7A 3ZWAA 2FMHA 2C2HA 4EPTA 2BUBA 1G4AE 4W4TA 4Z1MD 1KRHA 4IXMA 2JEYA 4C3UA 2WHRA 2CNWD 3I9MA 4ND5A 3WNVA 4E21A 5MFPA 1P1RA 5AJXA 3ZJVA 3L7LA 7ADHA 3GGPA 4JLPA 4YRIA 3FIUA 4IIBA 1G6OA 2FYTA 3WP1B 3ZWKA 4DJTA 1JSRA 3CQ9A 1MX5A 4ZVVA 3UV6A 4F5YA 2GM4A 4MWGA 5FEMA 2VNHA 2DP4E 3CX4A 4WZZA 4R71A 3B6JA 1BMTA 4L0CA 3IA7A 2PYIA 1F38A 4HNGA 3D8BA 1ECCA 2PR7A 4UREA 3PNOA 1BXRA 3RRXA 4C4ZA 1M5TA 1XQYA 5ALNA 3OEEA 2FN3A 4Q66C 2UYGA 3PFGA 5GTDA 2CF5A 4MS4B 1K5HA 2G72A 3QBEA 3DEKA 3VNVA 4WERA 5HQTA 3HM2A