2JBAA

Phob response regulator receiver domain constitutively-active double mutant d53a and y102c.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
b'ARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLAWMLPGGSGIQFIKHLRRESMTRDIPVVMLTARGEEEDRVRGLETGADDCITKPFSPKELVARIKAVMRRISPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY PROTEIN PHOB
publication title The X-Ray Crystal Structures of Two Constitutively Active Mutants of the Escherichia Coli Phob Receiver Domain Give Insights Into Activation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jbaA00
5C5CA 4NICA 5E3JA 1YMVA 2ZWMA 4WXMA 5KQMA 3JVIA 1BA2A 1QP4A 5DLEA 1JL3A 1YIOA 2PJUA 3QELA 4Z4FA 1URPA 2L19A 1RPJA 3I09A 4L4UA 4Z4GA 4KRFA 4RY9A 1K68A 3LUDA 1M2EA 1ZITA 1PEYA 2MYNA 4RDCA 4HYEA 4EVSA 3DZDA 3OLZA 4M88A 4ETIA 2MYUA 1SXIA 3MYYA 4LX8A 5IBQA 1FFGA 4IMJB 3BRQA 5BRJA 4Z4IA 1ZH2A 1NXTA 1LJUA 4Z4CA 1NATA 2ID7A 3SQNA 2MSLA 3JS5A 4MRMB 4KPYA 3OQOA 4EVQA 1VKRA 3LMKA 1A2OA 3OO0A 2E4YA 4DADA 5B3JC 4MS3A 1MIHA 5IUJC 5TPZA 1PEAA 2IYNA 1WETA 1XHEA 2PUEA 1EHCA 4RS3A 4KMRA 4NCBA 4ZJPA 1P6UA 2KYRA 3QLVC 1KGSA 3DGEC 1EWKA 3H5TA 4OLAA 3CNBA 5IEBA 3RVSA 1H9CA 2J48A 3HSYA 3KS9A 3QLUA 4OG2A 3F6CA 1JWLA 1DCKA 2M1ZA 3LUCA 2O20A 2V0NA 1QQAA 5HQJA 1JF8A 1FFWA 3TO5A 4W5NA 3MF4A 3R0JA 4LE1A 2H0AA 4JB2A 1KRWA 2GI4A 4Y9TA 3KHTA 3O74A 1MB0A 2FN8A 3P9YA 5JNSA 3OMXA 3T95A 1EWTA 1Y1LA 6CHYA 2XDYA 4WZZA 3GWGA 4KK3A 2PAFA 4XARA 4RK1A 1NXXA 3BRSA 2M98A 4KREA 5JNUA 3NBMA 2HQBA 4RKRA 3UUGA 2PUDA 2NUBA 5DKFA 1LK0A 1DRKA 3E3MA 3F7NA 5TE9A 1MVOA 4XASA 2PE5A 5TPWA 4W5OA 4RXUA 2AYZA 3LKBA 4GNRA 4G0XA 3CLKA 2OENG 3KG2A 3N0RA 4E7PA 5TQ0A 3DBIA 5CNMA 3EODA 2FLWA 4JASB 1E6MA 3JPYA 4YWHA 5GOTA 1ABEA 1ZHHA 2FVYA 3JPWA 1M5UA 2B4AA 1AB6A 1E6LA 1RXIA 1U2PA 4L85A 3E61A 1ABFA 4KV7A 3HM9A 2RDMA 3OM0A 4TMYA 1LBHA 1YTUA 2L2QA 4XFKA 3SAJA 5JNWA 3GV0A 4MQEB 4DQDA 3QLUC 3MIZA 2CHFA 4PZ0A 3CU5A 1VLZA 1U04A 4MS1B 5JNRA 3OM1A 4ZMRA 3HZHA 4F8JA 2FEWB 3TB6A 2Q5CA 2JBAA 2AYXA 2RJOA 5EWLB 5BQ3A 2VK2A 1DCFA 2L18A 3TD9A 3OLVA 1ZVVA 2RGYA 5D2CA 4PYRA 3TMYA 7ABPA 1SD5A 3RVPA 5EWMB 4MR8B 5GQSA 2R25B 1DRJA 2WB4A 3H5VA 3QX8A 1MAVA 3O21A 3HCWA 2JCGA 1QPZA 4Q6BA 3IP5A 4Z0NA 2QZJA 5TPZD 2MYPA 5C5EA 4S04A 3UKJA 1EAYA 2NT4A 1E2BA 5JNVA 3EGCA 2HPHA 3O1JC 4G0YA 5I4CA 1UDRA 1TM2A 2MYTA 2IPLA 2NT3A 4RK0A 3H1FA 3Q7SA 4JB0A 1NXVA 1M5TA 2LUOA 3CKMA 5JS2A 2QW1A 4H3HB 4GPAA 3SG0A 3O2QB 4Q6WA 1OXKB 1Z26A 1TLFA 3RVKA 3NNNA 3MQ4A 2E4UA 2FQXA 2WY2D 4MR9B 4Q7EA 4G86A 1JLKA 2E4XA 2FEKA 2HSGA 1W25A 4G97A 2F8SA 3G1WA 1DZ3A 4F06A 1OXBB 4O5AA 3ROTA 4IMIB 1YK1A 3BBLA 4G0PA 3OQNA 3CZ5A 5CNKA 5KC8A 5KWSA 3HVRA 5IULC 3DLBA 4KNYA 4NCAA 3HO1A 1P8AA 5FWXA 1U8TA 3H6HA 2QSJA 1ZESA 2LP4Y 3EULA 3GBVA 3CS3A 1W9HA 3LUKA 3Q41A 4IF4A 4FE7A 1LJLA 2X7XA 4MQFB 2VUHB 8ABPA 3IPAA 1Z17A 3GT7A 1CHNA 1KMIY 2ZAYA 4O1IA 2QR3A 2TMYA 2GWRA 4RY8A 4N76A 3BILA 4ZPJA 1MB3A 3EAFA 4YCSA 5IUNC 1P6QA 5JNTA 1QNLA 1JYEA 1GUDA 3H5OA 1Z15A 3I45A 2FQWA 3KJXA 3M9WA 4PEVA 3BREA 4D6XA 3C3MA 1ZGZA 2PUAA 4Z99A 4ETNA 4JA2A 3QX9A 3KYIB 3ILHA 3D02A 1DC7A 1VRVA 3EQZA 2QVCA 4IILA 1U2QA 2B1JA 3QEMB 4MLCA 1NXOA 3IP6A 3OLXA 3T6KA 2LPMA 3KCNA 4MR7B 5EWJB 5EWMA 5TQ2A 3VNBA 4JP1A 3NNSA 1GCGA 1E6KA 3F6PA 1CYEA 4KK4A 3IP7A 1LBIA 5DCLA 1USIA 3RVJA 4D74A 4MS4A 5IC5A 3W9SA 1JHZA 1F4VA 4QYMA 2A9PA 4G0OA 2R47A 1IIBA 4PE5B 1Z25A 1NXWA 1Z2EA 4N0PA 4YRZA 3NHMA 4S05A 3JVDA 2P9HA 3S99A 4EYGA 3H5WA 2WWVD 2PL1A 3IPCA 1P2FA 1PNTA 4ETMA 2F8TA 1BDIA 2FTKE 4LE2A 4MLDA 3T8YA 1APBA 1RZRA 1JH9A 2H3HA 1NXPA 5PNTA 2FLKA 2JVKA 5BR1A 3IP9A 5CNIA 2E4VA 3O2JA 3N53A 3HDGA 3QEKA 2NZUG 2VUIB 4MGEA 4EVRA 1QO0D 4O1HA 3H5LA 1TMYA 4W5RA 4H60A 4TN5A 1D2AA 3O2SB 3T38A 3HS3A 3C97A 4RK5A 2FMHA 4P98A 5CHYA 1ISRA 4F12A 1C4WA 3MA0A 3QELB 2FQYA 3H1EA 4ML3A 4MQFA 4YGXB 4Z9BA 5KQPA 3FFWA 3URMA 3LUJA 3N6VA 3O1IC 3KKEA 4MRMA 3LUAA 4XXHA 4B09A 1A04A 4Z4EA 2R48A 4N47A 1FQWA 2R4QA 5HSGA 1U0SY 1USGA 4HNRA 4N0QA 3RH0A 4G0MA 3MM4A 5ED4A 1JFSA 4Z4HA 1QP0A 2CHEA 3RVMA 1NTRA 2BGGA 3K9CA 1PHRA 4IGAA 1FSPA 1BDHA 3OQMA 2PUFA 3H5IA 4MS3B 4G0ZA 2IPNA 4RKQA 3A0RB 2PUBA 2LBPA 3QEMA 2PUGA 4YO7A 4EYKA 4WXEA 1QMPA 1L5YA 3QLTA 3SM9A 1DP4A 1QO0A 1D1QA 1QP7A 3HEBA 3CZCA 3GYBA 5T7BA 3GA5A 4LDAA 4RXMA 5FWYB 3LTEA 3ROFA 5DGCA 2MSWA 3L49A 4H3KB 2JRLA 4TLLB 2FKAA 3IDOA 3HXMA 3QK7A 3Q9SA 2I6FA 3LKVA 3LOPA 4G0QA 4RK6A 4RSMA 4KFCA 1K66A 2A9OA 1DBWA 2IDMA 3FFXA 1TJYA 2W42A 3RQIA 2FMIA 3HV2A 1JX6A 1JFTA 5DTEA 4RK4A 3FMVA 2QU7A 3CTPA 3HUUA 5TPWB 4W5QA 5HM6A 3CFYA 4YV7A 4RU1A 2JB9A 1F51E 4LRQA 1RZRD 1ISSA 3O75A 4OTZA 3OLWA 1JBEA 1BDJA 2NZVG 2A9QA 2DRIA 2JVIA 2QXYA 3OLYA 5TQ0B 4YS6A 3TX6A 4ZMSA 4OLBA 2WJAA 1DG9A 3GL9A 4HNSA 4KZKA 1ZDMA 4MQEA 4F11A 2HQRA 2JVJA 4FE4A 3SNKA 2JK1A 3CG4A 4EUKA 4MS1A 2MSKA 4EGSA 1KRXA 5HKOA 1ZY2A 3FFTA 1DC8A 1DCMA 2PMCA 1GCAA 2OQRA 3A0UA 2P4UA 5EWLA 1Z16A 3NNDA 3A3KA 1L5ZA 2GKGA 3SY8A 4JAVC 3Q7RA 5JS1A 2HJ9A 4QPJC 5FBHA 4LZLA 5KI6A 4YR7A 3KSMA 1D4ZA 5KQGA 2FEPA 3DGFC 3H1GA 5F64A 4UHJA 1JDPA 3MMNA 4YLEA 4CBVA 4MR8A 2JBAB 2E4WA 1PNRA 5FBKA 2WMYA 1EWVA 1RXEA 4NQRA 1XHFA 4DN6A 1NXSA 1C0EA 4KQ9A 4QYWA 3RVLA 4F3TA 1PUXA 2YHBA 3GBPA 4XAQA 3RVOA 4FB4A 2IPMA 4KVFA 4ZYLA 1TVMA 3RVQA 3LUFA 2FW0A 4RY0A 5IUKC 3EJWA 4EY3A 4YP9A 2PUCA 3I5AA 3DLHA 1D1PA 3N75A 5FWYA 4WT7A 1ZGGA 1Z2DA 3HUTA 3C3KA 3LUHA 1DBQA 3NHZA 2FXIA 2IOYA 1JYFA 2N9UA 1DJMA 1Z13A 3H6GA 4NV3A 1I3CA 4W5TA 4N41A 1J56A 2GBPA 3M9XA 3ILYA 4MR9A 1SXHA 1S8NA 2FSPA 3CG0A 4WUTA 1GUBA 4RZSA 2E4ZA 1DBPA 2IPAB 1GLGA 1R8JA 3KTOA 3N0XA 1AB5A 3HJFA 1HEYA 1Z12A 4XLTA 3A10A 4PICA 1NY5A 4MAAA 2YHAA 2RJNA 4JOQA 3N0WA 1A0OA 3O1HB 3OMWA 4OBBA 4RK7A 4MYRA 3OO1A 1USKA 3FGZA 5KC9A 1BAPA 4HNQA 5FWXB 2PL9A 3LUGA 3Q7TA 3HK2A 3F73A 4QICA 3CHYA 5IX8A 5CNJA 2PKXA 2GX6A 3JTEA 4KQCA 2L17A 3D8UA 1CEYA 2WRZA 1JFVA 4N03A 1FFSA 3EQ2A 3C6QA 3Q15C 2QVGA 1SXGA 3M6MD 3N8IA 4D6YA 3KLOA 3RVRA 5KQLA 1JDNA 3H75A 4IRXA 2CWDA 4RWEA 5IEJA 2FN9A 6ABPA 4UHKA 2WJWA 3KLNA 3KYJB 1B00A 1D5WA 1QKKA 4MR7A 5EWJA 1YS7A 5BRAA 1T34A 4EYOA 1BVHA 1YS6A 1Z18A 5T3YA 1ZAYA 3RVNA 1M2FA 4Z9AA 4WWHA 3G85A 3CRNA 3HDVA 1QQBA 2FMKA 4TLMB 9ABPA 2CD7A 4LE0A 3B2NA 4MPTA 2LIVA 1EFAA 2A9RA 3GRCA 2HQOA 2VYCA 3LFTA 5TQ2B 5B3JA 3C3WA 4LDZA 1SRRA 2PLNA 1ZH4A 2IKSA 1XWWA 3I42A 3JY6A 4EYQA 3QLVA 3FDFA 4MS4B 3UK0A 2QV0A 3K4HA 4RV5A 5TQJA 5ABPA 1YMUA 1RNLA 3EDCA 4RXTA 3L6UA 2ID9A 4OATA 1YVUA 2FMFA 4E7OA 3VNAA 1YK0A 1ZN2A 4P1ZA 1VPWA
chains in the Genus database with same CATH superfamily
1YZVA 3K9LA 1XMIA 1IN6A 2O8EB 4B7ZA 3F2IA 3B82A 4LIPD 2Q4RA 5K09A 1PHPA 2PWAA 1ZWKA 5DLEA 2ZI6A 2ZYWX 1QGOA 3B6JA 4G8JA 1ABBA 4QBKA 3CZMA 1WDKA 2JLZA 2O8BB 1GZDA 4IF6A 1K68A 4KIFA 4X6UA 3ZU6A 2ECFA 5ER9A 1K7SN 2ZBFA 1L8OA 4IJUA 4R7ZA 3OTOB 4IIUA 4BEVA 3DZDA 4ETIA 5JZBA 2WU0A 3I4FA 3KKLA 4JJFA 1PVVA 1BXGB 1U94A 1U3WA 5IBQA 3BRQA 4XQ9A 4IO1A 5ELLA 2DETA 2CVFA 2WJHA 4JXJA 1DLJA 4DYHA 4PTZA 1KEWA 1QTQA 3RIGA 2DYKA 4GAEA 3TR6A 5BN3A 4NS4A 3H2IA 3PA6A 5EZQA 5DYYA 5H8WA 5IJXA 1QONA 1LGYA 1QF9A 5CA1F 1O6ZA 2BY4A 1F38A 1FFHA 1LPAB 4N3AA 1OWOA 4DADA 1AC5A 2XQVA 4MS3A 5F7JA 2WQ6A 3VMFA 1IONA 4HC4A 1P6UA 2WYHA 4BNYA 4ZZIA 1U0GA 3ENNA 4OQLA 4CIXA 3CNBA 3OBIA 5P8WA 4YMTA 1CZUA 4HYYA 3TSWA 4J0GA 3OJLA 3PC2A 1GRRA 1P1RA 4UUOA 1T2UA 3VI3B 1DEXA 1PJLA 2OE2A 3OJ0A 4RETA 5TMEA 4MPRA 2GF9A 3EYWA 4P0TA 5A0TA 4G5OA 4CKXA 1HOTA 3K9QO 4TPKA 3NVDA 1Y1LA 2NACA 5EA2A 6CHYA 3KEGA 2NU6A 1C7FA 1XEWX 3PWKA 1W75A 3C6XA 4PBRA 4PZPA 2AUTA 2ZZNA 1BN7A 4OM8A 4DQKA 1QGED 3IUMA 4XARA 3IDSA 2ZP1A 1RKVA 2ZR0A 3P2MA 2OFWA 2OHGA 2PZGA 2HQBA 2XUKA 3OFVA 5BN4B 1M2OB 1W5FA 2QX4A 2P9GA 2VP9A 2HNBA 2PXAA 5DT2A 4MQ4A 4MW6A 5CVVA 1NUQA 1ISHA 1JDVA 4XASA 1N0HA 1T5DX 1KZHA 1FNCA 4EB3A 1F14A 1VSVA 4AG5A 1ZL2A 5I4KA 2W6JD 4W5OA 2XJ4A 4R0NA 1JJVA 3WKBA 4DHWA 1RD4A 3PD1A 1JQBA 1QZ3A 1U2EA 5AYVA 1D0SA 4G5GA 1VG0B 1AKVA 2EGGA 2VWQA 1K3FA 2YWFA 2AYYA 1P2TA 3FSJX 3D6HA 2D0IA 4R81A 4YREA 2OYRA 3M81A 2QD2A 2WP0A 4B9AA 1Z4NA 3UHOA 1PGOA 1DSSG 1ZJJA 4WCFB 3U4DA 1E2NA 3JPWA 1VL2A 4IH9A 2IE8A 2NXCA 1VKZA 3KHUA 5JU6A 3OQIB 1A4RA 1RXIA 2GB4A 2FOLA 4P32A 5DISB 4OIMA 3E5RA 1F8YA 2JI6A 2R1VA 2Q2VA 5FORA 4AJEA 5ISMA 1XR3A 5A7HA 2F48A 2QM8A 5ALQA 3QLUC 2W22A 2ZIEA 1XVLA 4BMYA 1JAXA 5GADl 1EZ4A 1VLZA 3ZNQA 3JYHA 3N86A 1BKYA 3COWA 4FYPA 5EUMA 3T9FA 4ZMRA 4TMFA 1RM4A 1RPNA 2ZVQX 2C31A 2VRCA 3Q8MA 3K15A 1KO4A 5BQ3A 1VHJA 4A7PA 3ZJ5A 4IXNA 2TECE 3V48A 4DCCA 1N3LA 3AUJB 3R0VA 2X1MA 4LDQA 1W88B 1O96B 1NMEA 1ADBA 4AQDA 1O97D 4V24A 2FE1A 2WB4A 3H7AA 4MLZA 2BAGA 1Z5PA 2X4LA 4IDFA 1XWIA 2ZT8A 3AIOA 2OAGA 3KE8A 2IY7A 3NVMB 4XJXA 1VJCA 2JCGA 1EINA 2HXGA 3HXPA 4KRXA 1O4VA 3GPBA 4D9BA 5KNDD 5L3SB 4B3GA 4D9GA 3UT5B 5JSZB 2RBEA 4EJSC 5L9AA 1DC3A 3P9NA 1IN8A 2DBYA 2LXNA 4CM8B 1Y82A 3F96A 5IZCA 3PGMA 4W9MC 2GM3A 3R3XA 3PCTA 1RI1A 2FAXA 4NRDA 3M6XA 3VKUA 3HLYA 1OJ7A 3O0DA 4HGRA 2DFKB 2HSEA 3F9RA 1J5PA 3IEPA 4YRSA 4LFAB 2HMWA 4WIAA 2X0DA 2EJBA 3LRXA 4RX1A 1M75A 1ZBQA 2OZEA 3I76A 1YAJA 1D7AA 2IEYA 1B6GA 2A59A 1OXKB 1E9AA 3D5QA 3EEYA 4CETA 3ETLA 3F49S 3K71B 3ANMA 3LOQA 4YNBA 3NBKA 1JU3A 4XWGA 5BSEA 4ZOLF 4F5EA 3BPSA 3PDWA 5F33A 4HMPA 1XU9A 1Z0FA 4NNJA 2JLUA 3ILSA 2NVOA 3W9SA 4P34A 2G1KA 4LZZA 1TYDE 2Q29A 4TMXA 4EO4A 2DHCA 5I7VA 3VPXA 2YOGA 4COOA 1SUAA 4YQYA 5IYZB 3TX2A 1Z5ZA 4NDAA 4XD7D 1T24A 3ICVA 5ITSA 3I9FA 4BP1A 4IIDA 4JBHA 2P6MA 5EIBD 5F78A 1P9WA 2QHXA 4YRRA 1Q91A 3LWBA 4DT1B 3OCJA 5EXXA 4J9UE 4Q39A 1Z2OX 1Y34E 3IJ5A 1QBKC 1IHYA 4QTTB 1KAEA 2KJQA 4ZO4A 3FXAA 2VHTA 4E3ZA 5BMVF 1K7YA 4QOHA 4CQLB 3M2PA 1TQDA 1I3OA 2H85A 2OCPA 2QTVA 3H4TA 3VR3A 4EJMA 2BI7A 2BRUC 1KPGA 3H2GA 3N7TA 4ZT7A 3V4ZA 5HW0A 3E27A 1BHSA 1UPUA 3C1AA 4IGEA 4KXFB 1L7EA 3IAS6 1EXVA 3EAGA 4KKVA 2WWFA 2BONA 2OC9A 3ZWWA 4CMEA 2JHGA 3AL3A 2UVPA 4P82A 2JGEA 2VP0A 4JR0A 4JA2A 2AFHA 4OA8A 1D8TA 1MG5A 2FK7A 4TWZA 1MX5A 1P75A 1V3VA 1DC7A 3GT0A 1VRVA 3I9JA 4RE5A 5KVAA 1SKMA 1MJHA 4K9PA 5TMDA 1YCHA 4OQ4A 4MINA 3AG5A 1PJ4A 2WG2A 3EPRA 4MR7B 4PYLA 1SC6A 4YJFA 3CRVA 3DMFA 1E6KA 3ZS8A 1FTSA 3JR3A 4R7GA 3W8EA 5CVJA 4X94A 1K92A 3U48A 4B74A 4DA8A 4HDKA 4JC8A 1IPFA 2WWRA 2JW5A 1M2VB 2WJIA 2X3FA 4TGLA 5FO1A 1HL3A 1JYSA 3HCBA 2XDQA 4N7MA 2QX7A 4J76A 4MVJD 4R3UC 2OBYA 1IMJA 1EFKA 4OJNA 3A14A 2JCVA 1QGUA 2P4HX 4G07A 2X8AA 3DZHA 3WLKX 1RAEA 3LK6A 4MLDA 3MELA 5JANA 2JAWA 3MVEA 4Y2YA 4BOYA 1O94A 1VLJA 3KQUA 3ZWVA 1DJQA 2YMPA 3IV9A 1NE7A 3MQFA 5AK6A 2DX7A 4K81B 1OVGA 3AR3A 1QR6A 3EXAA 1DOHA 2YWRA 3QVUA 3EMBA 3RODA 2H2WA 1ND5A 2OD7A 4RPIA 5ALDA 2DR2A 3EUEA 2AKAB 1TM5E 4M7RA 5D3QA 5DGXA 5F5XA 2NQ2C 3C97A 3C7TA 1WRBA 2ACKA 4NE9A 3RREA 4D8TA 3LP6A 4RUKA 2PMEA 3DLTA 4F12A 3OE1A 4IIYA 4LHSA 1GUFA 2FQQA 5EIEA 5KX5A 1REQA 3UQYS 4ML3A 4J0HA 4YAOA 3ZR4B 5HVNA 1ST2A 1HUQA 2P2GA 1NFFA 3WL6A 2P7IA 3IUYA 3MT8A 1ECGA 1TJ3A 2OCKA 1XNHA 3H9GA 4Q9DA 3IOEA 2OSBA 1TZMA 5J4YA 4CKZA 3TTXA 3FAZA 1HO3A 1B76A 3SQOA 5L3ZA 2EX4A 1DKNA 3TD2A 4Z49A 3ETCA 1EUCB 4HNRA 1NVXQ 1M6YA 1UMBB 2D62A 3B7PA 4U7PB 2D2VA 3L7BA 1P4RA 4AM8A 4KL8S 2D1QA 4BNWA 5DMXA 4NV1A 4RCZA 3JR7A 2XNDA 4E33A 5E8RA 1C1DA 5U4QA 1F2VA 3FRJA 4D4HA 4EG8A 4JT2A 1ZXBA 3M1YA 4JX9A 3RSCA 2IGBA 3V55A 2EEPA 4RKQA 2BHNA 2J33A 5IJWA 5I8ZA 1OCEA 1E18A 1HV8A 1QMPA 1G8AA 1T5SA 3C7CB 3EVDA 3DMYA 2FWNA 1GAWA 1NQ5A 4X92A 4KPFC 3K0SA 1HURA 2JIRA 2P69A 3IMGA 4MHTA 4QRHA 1SKAA 2AZ4A 1XBTA 2QTTA 3VXKA 1RJEA 4PPYA 1Q5PA 1XXHA 2VSOA 2FYTA 3WWOA 4ACAA 3S5JA 4YLGA 5I48A 1T4BA 2W2NA 4MYTA 1JHYA 5G3ZA 1MB2A 1KE1A 5T6MA 3W6NA 5DO9A 4KV9A 5L3VA 4RK6A 2C7GA 4FHZA 4WKOA 3N2ZB 1OREA 4IVNA 4ZTBA 2KS6A 4D79A 4QLBA 4D0LB 2R6ZA 1H0RA 4AF7A 1J8FA 4F1KA 3ON5A 5SYMA 2IYFA 3M6UA 5JZ9A 1FA9A 1JX6A 5D01A 4XB2A 1I2DA 1YXMA 4TRJA 4RLHA 5L3QA 1UKBA 8LDHA 3V9PA 2DLDA 4HAXA 3KKZA 5A03A 3BAFA 3IP8A 3F4KA 3R20A 1P2VA 4FR5A 1E4EB 5EIFA 1JFRA 2JANA 4IGIA 4X00A 4GXTA 3WIUA 4H7EA 4OSPA 1QZXA 4ZCTA 3LJKA 2FPKA 3V1MA 1NVAA 1XZIA 3SWWA 2F3PA 3P2KA 2XXAA 2QXYA 1W73A 3DG9A 1TZBA 1NKVA 5IM4F 4P83A 2F90A 3NFRA 1JHXA 3ONVA 1JLLB 2VTKA 3LCCA 4HNSA 5AM5A 3NRJA 5LA6B 4G5YA 3TOXA 2OG1A 3OJXA 1MNAA 1TF5A 3U7QB 5BNWA 2QUAA 3CG4A 3LC1O 4HQ6A 2Q0HA 2B7BA 1TUEA 2MSKA 1CVIA 4EGSA 3C41J 4CYMA 4RIHA 2WZQA 4WFJA 2NNLD 2PRKA 3BC1A 4LSWA 5EL0A 5AVRA 3LY7A 4G1EB 2IYYA 5DHSA 2HMYB 3RTGA 4ZJUA 5LBUA 1M3SA 3GLKA 4MVJF 1OWPA 4S1VA 4DA4A 1QRUA 1JDPA 5CIYA 3L0YA 5F7XA 1FUYB 1HPLA 1VRWA 2J4FA 5DPMA 4POOA 5JUWA 5H0IA 1TLTA 1AV6A 3CJTA 1I4LD 1ETHA 3CX8A 4PRLA 1E0JA 4AKGA 3GNTA 4BMSA 2IOQA 4YJGB 4D9NA 4EARA 5F3WB 2P27A 4PZ9A 4D4GA 5KDLA 1HT2E 1R2QA 4F3YA 3ANNA 2VHVA 3MW8A 4JQZA 3NXSA 1G5FA 1AKWA 2CGEA 1KFBB 1JEQB 2I8AA 2ACVA 4HPJB 4IM7A 2UYOA 4XGQA 3IB3A 4QE3A 3WGKA 3PXCX 1SWWA 2HPAA 3V3KA 4D42A 3EMDA 3HUTA 2GEUA 3IHLA 1WXFA 4QOIA 3VDNB 1BRTA 1O5OA 1JYFA 2FUCA 2WNIA 3NUZA 1I3CA 3B6MA 2DLNA 3MINB 3VYUB 1TAUA 3OEED 1GQ2A 5AJYA 1HT3A 2H3EA 2ZB4A 2JD1A 3PEEA 2Q9CA 3MS2A 4LMPA 2PY6A 3KOWA 3EF1A 3DE7X 5JVDA 3K94A 3NDRA 1ZI6A 4RVOA 2EWVA 5TMPA 3LPNA 1D6MA 1LV7A 4XLTA 1Y3DE 1EJ2A 1GPH1 2FCAA 4NOLA 3U4QB 3LBHA 1T29A 1GRCA 1N6OA 4EFDA 5A04A 3IB6A 2O2CA 1N92A 1P80A 1QWOA 3QOXA 4XB1A 2ZDQA 1VKOA 3BRWA 4Y6GB 2I6TA 2J9RA 2XB9A 3I6IA 4EPVA 1HFKA 1KVQA 1Y33E 2XNSA 3DAPA 3HZZA 3LCUA 2PL9A 5AKGA 4EY8A 2N1BA 1YKGA 2DECA 3GN2A 4ZIRB 3AI7A 3PQ3A 1BVYF 4RL4A 1PJZA 3DPIA 4AZTA 4DIBA 1Z56C 5LYJF 2IZ0A 3FPKA 3T1HB 1J42A 5HTKA 1A9YA 4L3WA 4QFMA 3UPTA 3HVUA 2QVGA 2ZJOA 1RJ9B 4LGMA 4PXAA 5IARA 4MXDA 1P7YA 4ZU1X 1LBEA 4M87A 1KEKA 1ESEA 3GAAA 4UDYX 4A9AA 3VU1A 2A6PA 4RCYA 2WTXA 3FMPB 2C29D 1YU9A 3IV6A 4AJKA 1F0YA 2VDLB 4NCKA 4DSTA 3EASA 1X1BA 1UEIA 2UDPA 2OYCA 3IPXA 3UMRA 2FB9A 3G85A 1OXUA 3UUEA 2PMBA 1DVRA 5I7FA 1FRQA 5ESRA 9ABPA 2HO4A 2YJTD 3BG5A 4EKIA 3WNZA 3S1LA 2L42A 2OKGA 2K4MA 3DHWC 1IXSB 1X1RA 4GGOA 4X8HA 5B1SA 3WGOA 5DNCA 3C3WA 4N0DA 1XSEA 5BV0A 1ZH4A 2VOJA 2DWUA 1WTCA 2Z8YA 1W5SA 2GH1A 2I6QA 2P3LA 4AJ9A 4C3OB 3K4HA 2G6BA 2M6KA 4RV5A 4CMCA 1NPTO 5TQJA 4BNIA 1A1VA 1IXYA 4ZCRA 4EA8A 5EAIA 8ADHA 4FE3A 4BXOA 2PHZA 2QB5A 3FPAA 1D2AA 3U3JA 2O2HA 1L8XA 2QJFA 3Q1LA 5H68A 1PX2A 1XQ9A 3MLAA 2GD0A 4IWXA 2PU5A 1RCTE 2DUJA 2PXCA 3O93A 3F5QA 4B2PA 1SCBA 3GA7A 1RZVA 3NOQA 4ZHSA 2PZAA 1R0CA 3X1YA 1E7YA 1ZKMA 3BULA 1UP4A 5EESA 1L4UA 2H2DA 1X3LA 4R83A 4UTVA 4JYAB 4DWWA 5A4DA 3D4NA 4P4SB 3O9VA 4IKEA 3UH1A 1C3JA 1ZU5A 2V7WA 5ALPA 4FZRA 5G40A 5EHZA 2XUQA 5AXCA 4M4SA 3KT8A 5EFZA 1COWD 5AM0A 1JTVA 4P4UA 2QD5A 2HH9A 2VHEA 1ID8A 2VG8A 4YUVA 1MIOA 4ND1A 2RGGA 3VTKA 3B60A 4RM3A 3I2IA 3PFBA 3M9LA 3NI2A 2QWXA 3NWPA 4YCNA 1NDQA 3BA1A 4YJHA 4BQIA 5LP6F 2Y1GA 1VC2A 2BUCA 2EX1A 2WB2A 4UHDA 4MJXA 1B2LA 4TTPA 2O8FB 2E5LB 1ZZGA 2PT9A 4HP8A 2V5VA 4FHDA 1EHCA 4UUMA 5J5CA 4E6EA 2ILTA 2FRXA 3AG6A 3P9KA 3EEFA 1Q17A 1F7UA 3FLAA 4K6HA 1ATIA 1RHKA 2J7PA 5DTQA 5AW6A 2YWEA 4OFWA 1PVOA 5BSTA 3MD9A 5TX7A 2P41A 3GLIA 3GLGA 1VHTA 1OAKA 2BVNA 1ZGHA 1T36A 3K9BA 5EIWA 5ESWA 3SHVA 1JF8A 1FFWA 4BB0A 4LTDA 4OGKA 2Q9AA 2ORED 4TLBA 2GI4A 3D81A 3IYLW 4Y9TA 1FP1D 1CW2B 1Q1BA 3AHIA 4YP1A 2PZFA 4AKIA 3ASZA 3A4IA 1DAMA 2ZWAA 4CIBA 1TJ4A 821PA 4E5VA 4N3CA 4B0PA 1IRXA 4X3PA 2C7VA 3FYUA 4IFIA 1HXHA 2EFCB 2HHCA 2IUFA 4UHCA 1EUZA 5AHKA 4KREA 2QRNA 3C3EA 5HTOA 1TMKA 3DKPA 3MWFA 1T3TA 3PSHA 4EMTA 1RQ2A 2AG8A 1KDTA 2QAGC 3IAS1 2HF7A 3JU3A 3CA8A 2H4HA 4DV4B 3JAKB 1XP8A 3IUBA 1P73A 2MINB 2VJQA 3GVPA 3WHKA 3ROKA 1ZBDA 4NOJA 3TNFA 4CM9A 1CS0B 4MQLA 3E4DA 2EKDA 2QLNA 5IBCA 3LE8A 4PYNA 5TQ0A 1YRAA 4C0SA 3EODA 3RDPA 2IODA 4CIVA 1LU9A 2QP4A 3PS9A 3NATA 4JKYA 2IZOA 2Y66A 4X90A 2OXEA 3LC2O 2DT5A 3R0QA 1YI0A 2F4NA 3DHYA 2CMKA 3DEAA 5CTJA 5EHQA 2GKSA 3FB1A 4QOEA 1DEAA 2C2OA 3G9XA 1VPEA 4KIGA 3A1EA 3FPLA 3S5UA 3HB4X 1P9NA 2ZR7A 3K1YA 4UFPA 1G6HA 1AU9A 4QKQA 2FZEA 2NSJA 1WU7A 3UF0A 4GZMA 4XFKA 5JNWA 2Z43A 2PKYX 3ETNA 4X6LA 1YDHA 2NV0A 1JDZA 4EG1A 1BX1A 1SH7A 3CLSD 5CRIA 1N32B 4GKAA 3W90A 2HIHA 2VNAA 4BVFA 2ATIA 1ZOSA 1V0JA 2Z4SA 3CXUA 1SGWA 4LOJA 2OBMA 2C2MA 3I5YA 2Z3WA 3A6KA 5AI6A 2VK2A 5L3RA 1N5RA 3NDIA 1NJGA 1T2FA 2IYQA 3JQ8A 3MTBA 1TA4A 3S2UA 3THRA 3EXFA 4LXXA 4B2YA 2OG2A 5DE3A 3AC0A 2BKUA 2D2EA 1S4QA 1Z3CA 1WX1A 5DRTA 1V3UA 1WHSB 1ZJ6A 3E9RA 5JE8A 4GC5A 2PT6A 5DFAA 2WKSA 1G20A 3LY5A 5FBZA 3ELBA 5IM5A 1WDMA 1QPZA 2Z30A 3GLVA 2ZUDA 3H1PA 3HVJA 1IJBA 1ECBA 3UKJA 5BNFA 1W4RA 4B4OA 1H05A 4WK2B 5JAIA 3QVXA 3O8CA 3WHLA 4LRSB 2BEUB 1W0KA 2FZWA 2I6GA 3OZXA 3OEHA 3MJDA 1DGQA 1DX4A 3MD0A 1YB7A 2R6CA 2GBLC 3BFVA 3OFSA 3WGLA 2IA5A 3LPCA 3OFJA 4YGYA 5AHOA 3WGYA 1EP1B 1UM8A 4JB0A 4E5MA 1C81A 1H1DA 1W19A 3FYHA 3W6ZA 5FQNA 1Q14A 3BX1A 4UHEA 2VNIA 2OO7A 2HQ1A 4PRKA 5LOVF 3NYWA 1YA8A 2PM8A 3ZWKA 2X7HA 4G86A 1HA3A 3E9QA 5IVPA 1NUPA 4YCCA 5J4LA 2HSGA 4EY6A 3TQRA 1Z82A 2ODNA 3FNHA 3GUVA 3CEPB 3RT7A 4Z7JA 5B3KA 3ZWMA 2HSDA 2ZWOA 2C1EA 2H9YA 3BBLA 4KE8A 3I30X 3OQNA 2IXFA 2HWWA 5IBRA 4UOZA 4RVNA 3TLKA 4UCFA 2QJRA 5B4VA 2NYVA 4QXPA 2K5UA 4TKLA 4OJKA 2CC2A 4KAFA 3HP1A 4MQFB 2H18A 1E6UA 3R6GA 3MGKA 5IMBA 1AT1A 1M7BA 2YHSA 3IBFA 3LQ4A 2BKLA 2IXTA 4I14A 2PGJA 2O9JA 4FFRA 1W5BA 3BIWA 4YI5A 5KPJA 1A96A 4LXGA 3ZI4A 3L7DA 4DREA 4YXFA 4YRDA 1YQWA 3KT3A 1U98A 1XZ8A 2I3ZA 2ILVA 2YMMA 3DBHB 1TUBB 2VWHA 2JAQA 4I1UA 4PEVA 1JA9A 3CH6A 4D6XA 4UM7A 1UZLA 2HIMA 2XVAA 121PA 1ONPA 4P92A 4PR3A 3NCHA 3RYFB 5K0TA 5KYNA 2C95A 1CZLA 1FB5A 1RC0A 5BQFA 4HWGA 5YASA 3KQLA 2A3RA 3DDNA 2H00A 3K72B 3ASUA 3EY9A 2WUVA 4PNPA 5AVWA 3MMPA 4GBGA 5J2UF 2WIJA 1ZRSA 3T3GA 4RSGA 1XVUA 3GJ3A 4WZBB 3ZGOA 4I9HA 2BPOA 3IA7A 4MKZA 3ZW7A 4XWYA 2O2SA 2Y9PB 4L22A 3KALA 4WXYB 5F77A 3SXUB 3ZBPA 1AK1A 1G5TA 1TMGE 2A9JA 2EKLA 1X0XA 1XFDA 1XELA 2F8LA 2GJ8A 2NO4A 2P2DA 1RFGE 3W1EA 4PANA 3L8CA 4WN9B 3ZGNA 5DCUA 3T3HA 4AJIA 2DG2A 1TAHA 1ORVA 1RRGA 4ZALA 2DMRA 5TSDA 2O8CB 3B1VA 4CKEB 4CI0B 4E88A 1P1CA 1C9JA 1MO5A 1Y9EA 3C0KA 1GZHB 2JVKA 3KDAA 1F1JA 1Z4LA 2BLNA 3DFFA 3VZRA 5BUSA 2OLKA 2CXSA 2QUZA 2W2LD 1W6UA 4YACA 2VUIB 2G5GX 2J3EA 3KYCB 2L69A 2IUYA 1T3ZA 3AFOA 2AJLI 3FETA 4R16A 3KKPA 2FPOA 5C46F 2GM5A 3REOA 5AH0A 5ADVA 1WZIA 1YDEA 4WXRA 3F4LA 5HOQA 1CZRA 1PL7A 3T7KA 3W3ZB 1L8AA 2QTZA 1C4WA 5ULLA 5KYTA 4D46A 1KRHA 4MGIR 3P2OA 4OP2A 3W2TA 5BUQA 3UWPA 1NY6A 1UBSB 2BGRA 2P9QA 3TLZA 1L5FA 4B8WA 1UBGA 4RZQA 4JR1A 3TB4A 3TKYA 2PGAA 3FMGA 3DKKA 3IJPA 3VR0A 1PCXA 1W6RA 1WZNA 1NP3A 1OTHA 2GEBA 2V98A 1WB6A 1S02A 2V4UA 4M9RA 2MSDB 2CL7X 3RIXA 1RU3A 2FRVA 4LGYA 2ZZMA 1HGXA 1FRZA 4GLBA 1S9HA 4HNGA 3LW7A 5HUJA 2J6BA 2WIKA 3G89A 3P5SA 4MMXB 3ELUA 2EX0A 4UUNA 2NO9A 3AVQA 5ED4A 4L2IB 3VRHA 2PZJA 3E1SA 3W0LB 2CHEA 3WICA 1P39A 1QP0A 1ADCA 1BDBA 2QTBA 3EIWA 5LWHA 3KQMA 1LK5A 3OQMA 5T67A 1R6AA 4FZVA 3WLRA 3VTFA 2VHUA 3BOSA 1SQ0A 4Y1RB 3HY3A 3VR3D 3QEMA 3OCVA 4YO7A 1XNQB 4M53A 4IZIA 4NFYA 1I1OA 3IJEB 4ZT4A 2XB2A 1NGSA 2FFRA 4WL0A 3B70A 4Q4JA 1ZSVA 2ZJ2A 1FP7A 1Y7IA 5FYDA 1PR1A 1YZKA 3KZ1E 2R6HA 1Q7BA 1JNXX 5T5QA 1C7JA 2BUBA 2FMUA 3P45A 4RXMA 3TR0A 4OMUA 5G4KA 2WPDD 1JEYA 4URWR 2YHIB 3CO0S 1DIAA 1LDBA 1JHQA 3IDOA 2V54A 1V1RA 3QK7A 1T5LA 2BFCB 5CIWA 1HQKA 4M60A 1K66A 2BGUA 5E1OA 1M1YA 2LDBA 1X7YB 2ISQA 2R6AA 4UNSA 4ZQEA 4ENTA 1ND6A 2Q4OA 4BNNA 4PYKA 5JS7A 3N8KA 4OHKA 3THYA 3TIVA 2IEIA 3IAUA 2WHQA 1D6SA 4R1UA 3AVTA 1E3IA 3HCOA 1OI4A 1U02A 3CBGA 4BP8A 3QG5A 1T3GA 2ZPUA 2OBNA 4JVSB 4PGFA 5F9MA 4DR1B 3TRFA 4LC1A 3HUUA 5IXSA 2W6NA 1X7GA 1V35A 3PUJA 1P6XA 1WHTA 4IHQA 2OORA 3R7WB 4YV7A 1BZYA 4FGJA 3AJ8A 4G4JA 1CDZA 4DDVA 1FLNA 2DY1A 1O94D 4DLKA 2H1FA 3VHQA 4ARUA 4OA5A 1RXUA 2WJAA 1TXGA 4H4DA 1BFKA 4PX5A 3ESZA 4Z4QA 1KJQA 4FK8A 2ZAMA 3ZWNA 1U7XA 1GTZA 1WOMA 1Q16A 2HQRA 1JIJA 2OV3A 4PQEA 3WBJA 4EY4A 1WSBA 1VBNA 2R5NA 3P0HA 3O47A 4NEGA 4QRIA 4GSYA 4C78A 4EUKA 1D4OA 2GHIA 4F2HA 1T1SA 2XYPA 3EZ2A 4V3BA 1SVIA 3PNYA 2HHLA 3A0UA 4JP3A 5K4GA 4C4AA 1CNEA 1LRJA 3LC0A 4ZCSA 3ZGZA 4KPEC 2X77A 1SVUA 2D0PB 4XTRA 3LX8A 5AM4A 4FT2A 1D4ZA 3RK1A 3WYAA 1P91A 1KKMA 3FUCA 2NU9A 3IIIA 2P40A 1AK2A 4PYMA 1Y6RA 5A1TA 2XHEA 4H6WA 1OAAA 1RXCA 4BCBA 4DABA 3BRCA 4S1OA 2WT8A 5M5BA 1X2EA 2A1TS 2V7GA 2W2VA 4NXMB 2A7QA 3SJCA 1KDRA 1TJ5A 1XAIA 4DC1A 1NDHA 3V8PA 2Z5LA 2HMVA 3Q98A 4KQ9A 2FPIA 1NV9A 1TZCA 4B3XA 1AQIA 1RYHA 5CFRA 2J5QA 2YHBA 3PC6A 5D00A 3RVDA 3VBEA 3TQSA 2XNDD 4BO1A 4BFCA 4L50A 4D9MA 1H2BA 1P0IA 3AHFA 1GARA 2XADA 4A2QA 2Q1TA 2VDKB 4HUQA 3HM2A 2O23A 1XX6A 3HLKA 3AB7A 3WZ2A 2HMTA 4P38A 4RSRA 2IVZA 3AV3A 1JG7A 4QASA 5JRDS 3D7KA 4DMRA 1X9IA 2XZTA 3M1AA 2D74A 1BSVA 2Q1UA 4NH4A 4DCTA 1J56A 3CH4B 4PIMA 2XUIA 1Z0ZA 2GDJA 2Y4OA 5CCXA 1ECPA 2ZSHA 5KOHB 5K3DA 2BI4A 3X2FA 3U49A 4D5EA 1OW3B 1GA6A 5MFPA 1MENA 1UJNA 1Z6QA 2FF7A 3VVBA 4YMLA 3F78A 1N8TA 3JARA 3QBTA 4WE3A 4C20A 3QEBZ 1HORA 2HF2A 3PDJA 1U2ZA 3ZY6A 2VAWA 5FH9A 3GXBA 2XCOA 2YOHA 2DLCX 4IUCS 3PQEA 4M2LA 5TF4A 4CMIB 4QGHA 2V7XA 3HCCA 3SIXA 1NVEA 2VLIA 2UZAA 3HKBA 3S3TA 2WMOB 1FOEB 1KQOA 1QJ4A 3ZWPA 2AZMA 2CHVA 2VP3A 4QGAA 1WY7A 5CB6A 5ES4B 1F2UB 1OY1A 1YCDA 4C0KA 4R9VA 2GX6A 4D45A 4ESOA 2O2EA 3CURA 3RC1A 4RZHA 3V1LA 2INGX 1PW5A 3O4RA 4IHAA 4YAEA 4K0RA 3ZVNA 3AY3A 2XE6A 3TR5A 2FZCA 2XT9A 1L9XA 3KU4A 3QA9A 1YVDA 3RVRA 3H75A 2CVQA 3G2HA 1UPFA 3GNSA 1IQUA 2O2XA 3LVBA 2PZLA 1D2NA 1MVNA 1V8OA 4UBLA 4XOUA 2JDID 1C3VA 2ES4A 4XDYA 1E7QA 3EY4A 3T41A 5ANRB 2JGFA 4AJLA 4PHGA 3R74A 3GO4A 2HYDA 4BMDA 3ASYA 4CCYA 3V8VA 1MX1A 1MEEA 2FMKA 1I6MA 2GOYA 1YFZA 1WUJS 3QVMA 3T7JA 3TLEA 3UKOA 4DEYA 3GRCA 1DAKA 2O7SA 3ET5A 1V7PC 1E2HA 5AVJA 3WXBA 4R68A 1NSTA 2JGNA 4LDZA 4US1R 4CMKA 5M04A 3BTSA 4W9RA 1VL8A 4C6SA 2DKOA 2HNKA 3GH3A 3LBIA 3ORHA 3THOA 5ECDA 4PG7A 3SP1A 5EKXA 3D7RA 5BSGA 3M83A 1KYXA 3GX1A 2I3GA 1X8LA 4GPZA 3ZX4A 1E1MA 1NA5A 4IDHA 1A7UA 2BFEA 3H9CA 1L5QA 3L6UA 4Q7QA 2YBDA 2WBLC 3KEMA 4U6NA 3LUBA 3DXYA 4W63A 2JG3A 4MP8A 5CLQA 3S68A 4P0PB 1YNOA 4XX1A 1X7ZB 1KC3A 1T5OA 2OV1A 3CVXA 4U7HA 4OD0A 1YMVA 2BE9A 1W85A 1LK7A 1Q92A 4ZQIA 4F97A 3DWIA 5KX5F 4DXDA 4RPHA 4HDMA 4XR9A 2PPLA 4UOQA 2XCTB 2I1QA 3CLHA 4KUHA 4NCXA 2VHCA 4LXHA 2VSFA 5CX1B 1YR1A 2JGMA 5EE0A 3WY9A 1U8UA 3EIQA 5L53A 4D9JA 5AICA 1ACMA 3L5KA 2AN5A 3PPVA 1IZZA 4R2MA 4RGYA 2PD6A 3QQPA 5CLHA 4TYPA 4UM9B 2BCEA 4EVSA 4H59A 2LRHA 3KOUA 4M88A 2MYUA 2Q6VA 3R5TA 3D7LA 3BTOA 4PLWA 5K8TA 5LL6P 1E3SA 3U17A 5ALUA 2OPHA 1K7XB 1SXJB 3PR2B 5WRFA 2FJPA 4HL6A 2H8GA 1H2AS 1DDIA 3TGPA 3NXKA 1D09A 1DPFA 3LQ2A 2UUPA 3G68A 3NTRA 4H1WA 5KDOA 2BM9A 1QRAA 2QZSA 3SQNA 4GDMA 4FOPA 1UFRA 5L45A 2MR5A 2B83A 3BRWD 3AR8A 3KPUA 4YV0A 4GX0A 4KWHA 2NU7B 2QMHA 3ILVA 4IBOA 5CT4A 3DVQX 5AK0A 2WIDA 3FPEA 3OE7A 1ZUNB 2DBVO 5TPZA 1WETA 1EFDN 3B53X 4IHJF 3TDMA 3QPWA 1A7KA 2B6NA 1V5GA 2VWPA 2O06A 2XGSA 3ZKWA 5IEBA 1EZZA 1V25A 2QE6A 1U0FA 3BM5A 1C9DB 2AW5A 2ZYHA 3PEUA 3IH5A 2D0DA 1FYVA 2DAPA 3RSFA 3VGPA 2CXPA 2V0NA 3OQ6A 2EG9A 5H3CA 3ED1A 1ULSA 4PVDA 8ATCA 4YC7A 5JNLA 1QRTA 1Z36A 3JQAB 3DDHA 1N2EA 3ZQUA 2WV9A 3OIYA 3P9YA 1E3LA 1K5GA 4RVHA 3CNQS 2BJHA 1PUIA 1EFUA 2FWAA 2QF7A 4NAUA 1OU0A 2HXSA 4WZZA 3UJ8A 1I32A 1TD9A 2CEAA 4DJDC 2AI2A 3A06A 4M9QA 5I4IA 5AKEA 4GM0A 4CUKA 5JH7A 5NLLA 2IYTA 2VH5R 3F6EX 3MAJA 4GBJA 4IVRA 4KZPA 1YUMA 1SZDA 2H8KA 1DRKA 3F9IA 3VDMA 2FV8A 1XEFA 4KQEA 5BQPA 1RMYA 4DDWA 3QVVA 3RC8A 2CYAA 2BGIA 4IHKA 3QE2A 1V1MA 1X38A 5KHLB 5I9NA 1VMAA 2BZSA 3W05A 3K8QA 4DPKA 4R9UC 2B3TA 3BIFA 4E7PA 5FTNA 4X60A 1SG0A 2I87A 3OSUA 3UOAB 2AE1A 4IH4A 3TYXA 4UTPA 3BIJA 2QEQA 2NSYA 1PSZA 4P3NA 3KDSE 4X91A 4JK3A 1JG4A 1ESCA 1L8LA 3VVMA 4CLOB 2BM0A 3OY2A 1T0IA 2EFGA 1BS2A 4CDMA 1YVPA 5K0BA 1JI0A 3D0RA 4CRWB 1NN3A 3V1YA 3VH1A 1DG3A 2B92A 3O82A 3ZNNA 3V32A 1S01A 1JEDA 4TV9F 4JL5A 1H2EA 1U7UA 3OZVA 1QYWA 4YB8A 4PHFA 1W4ZA 3D2CA 1WQ4A 2NAPA 3GV0A 5A5GA 4MH0R 3O8QB 1QNFA 2AC4A 2QVZX 1SD2A 4NFSA 1XKQA 4PZ0A 4NE7A 3VM6A 4ER3A 3A4TA 3RRMA 3GMDA 5D6OA 1YULA 1WBDA 1DAPA 2PLRA 4K2HA 5EUBA 2Y71A 3THXA 3ACDA 4K05A 4WK0B 4AYTA 3HCPA 2E5FA 1GAQA 3OLVA 5GWXA 2O3TA 5TRTA 3DP9A 3LCMA 3IDAA 5LMZA 3QJ5A 1YASA 4GVLA 5KINB 4D9FA 4KOAA 1FW8A 4E5NA 2HFKA 4OK5A 1XYGA 1XA4A 5J1SB 4DR6B 4CNQA 2R00A 2Q45A 4QXRA 4MDYA 1NRIA 1VZ3A 2R25B 2YJ4A 3BL6A 4ND7A 2NXJA 3F1KA 3LT4A 4I19A 4IUBS 3GUCA 4YFYA 5J43A 4PG8A 4GMKA 2PSDA 4WASA 4Z0NA 4BS9A 1WVIA 4AUMA 4AI6A 1E92A 4ZEWA 5B2FA 1ZO8A 2ZRNA 2VJKA 4MA5A 1QFJA 4WMLA 1U8FO 4JC4A 4WOCA 1KL7A 2C5GA 3L0ZA 1T9KA 3TUJC 4FHFA 3T5AA 2J7PD 3I5UA 2ZUCA 2I2BA 2NUPA 4EX7A 4PIPA 1U3TA 3AM5A 2IIPA 3VKWA 3KOOA 4CUZA 5JS6A 1W76A 1DT3A 1FDUA 1MJGA 1TUGA 1UANA 2X4DA 1MG0A 1EFVA 1E1NA 1NBME 1JR3E 3T7EA 3ZWQA 1GPWB 2RGXA 2Z2YA 4JUAA 4M9ZA 1KY5A 2C88A 2BR3A 4GZ3A 4S35A 4YIKA 5EIOA 4YMHA 2CHQA 5J4KA 1Z26A 2Y1XA 4E5UA 2GCOA 4YCMA 1BROA 2P1RA 3M3DA 3LFUA 5LQUA 3PLRA 2ZS8A 3PU6A 2R65A 3SDBA 4G97A 1L3CA 2YL2A 5AJWA 4RV4A 4O5AA 1KR5A 3QU5A 1X7DA 2JJ2D 2ZJ1A 1SZJG 3IXQA 4GZ5A 3IAEA 4WZAB 4RJ2A 5ARCA 5CNKA 3QEAZ 2GLXA 3HEMA 1AOXA 1T9ZA 3PNBA 4A5OA 3ZK9A 5BWMA 3GJ0A 3GN1A 1FFXA 3EULA 1ZGJA 4C6TB 3R24A 13PKA 2VUHB 3T5MA 2ZQ5A 3I9KA 4C7OA 3CRMA 4CM9D 4O0LA 2ZS7A 4ERNA 1E2MA 1OI2A 4RY8A 2O5RA 3ZBQA 1FTWA 2V3CC 5F21A 4BHTA 4BU0A 1KJ9A 2ZPTX 3L8FA 2WJGA 3CQ9A 1A88A 1EFLA 3B48A 5JRZA 4C7MA 3FOEC 2ZITA 3WWZA 1VG8A 2OXCA 2YASA 4R0MA 2CL0X 4FN5A 5DU2A 5TB5A 2O59A 1TW2A 3B6ZA 1ULUA 3BCSA 4EEXA 2C8JA 2P9FA 3FNIA 4J91A 2HCFA 5L7YA 1FY2A 1P4GA 1GYRA 2PYDA 2PT5A 1ZVKA 5SICE 1KI9A 4H4CA 4OGFA 1KXJA 4YAFA 3KCNA 2OV6A 4NQZA 3RBAA 3O3CA 1CT9A 1NW8A 2I8LA 2QVLA 2UXCB 1YJ5A 4QFDA 2PSSA 3KHKA 2SCUB 1W1IA 3IP7A 4RA6B 4RKFA 5FF9A 3T0GA 1XV5A 2QTWB 2WEKA 4GX5A 4KJXA 4UW9A 1R0SA 4MS4A 5CDTA 4FFBB 4AECA 2F1RA 1LW6E 3IFSA 1DWPA 5IC5A 5C8YB 3DLCA 1F4VA 3D6UA 3UV3A 2Q1YA 1P4JA 3IMEA 3KKKA 4G0OA 1BW9A 2J30A 1HYQA 3DAOA 4K40A 5E4TA 4PE5B 3BVPA 2V7BA 4N0PA 5KSPA 5TY0A 2CNBA 1N2CA 3BSFA 1ATZA 1L5KA 2X7JA 3QE0A 2NTJA 3L1JA 3RD5A 2O0HA 3EMVA 1CRPA 3T61A 3S8EA 1NMSA 1M34E 4CW7A 5CD9A 2FTKE 1JH9A 1APBA 5K3CA 2O8EA 4KWIA 3PDCA 4B71A 3W3AH 1ZA2A 3RRNA 1Z8DA 3E53A 3CUYA 5JQGF 3I83A 2AMVA 3DSRA 3KKNA 3O2JA 4MV7A 3OEHD 3ZHBA 1PLKA 2YV1A 3EGOA 1F3LA 4LNUB 4QTZA 3IMKA 2O8BA 3GJ8A 3TFWA 1UXJA 2VZ9A 3OTIA 1PJRA 2G5CA 4L02A 1TYBE 3AEZA 1SC4A 2R7KA 1ZRHA 4QXOA 4ZO6A 5HCUA 1IDOA 5CHYA 4ON9A 3IV7A 1N2ZA 5EJ8A 3MA0A 1BXGA 4IQ8A 4UPVA 2NP7A 1PWHA 4HDCA 4A91A 4CWAA 2IHJA 2VBFA 3CGGA 4WBNA 4OFZA 1U9ZA 3ICPA 2DQ4A 3QOWA 3URMA 5ICGA 4FYVA 2AVDA 4FGUA 2JLRA 4O02B 2O1XA 1YRWA 3LHDA 4TSKA 3OPYI 1NRWA 3FTQA 3QBJA 1TU0A 4AY4A 4FLEA 5GJWC 1KIAA 1PFUA 2C59A 1KQGA 1MH1A 1YR6A 4D43A 2H1LA 1YZHA 1NQTA 3CR7A 4I5FA 1C9YA 3VFDA 1WZ2A 1DADA 1J25A 2JJ1A 3NG1A 1P77A 2OLJA 4F3RA 4DEVA 3A37A 2VPWA 3BDVA 1NJ2A 2QRZA 4Q1VA 1TCUA 3WRVA 1NE2A 3FHTA 1H6DA 4CL3A 1E3QA 5IF3A 2EHJA 1WMBA 3UC5A 2X9NA 1A4IA 4LXTA 2QT9A 2W6CX 1XEXB 4KLZA 3UJ6A 5AVUA 5JZSA 3NTQA 4MVJG 2A9FA 1TTTA 2FFAA 1TF2A 3F97A 4N1AA 1NVUQ 2WT9A 2FSSA 2VDPB 4L6CA 2P78A 4D92A 2GBIA 2QLLA 3L1IA 4LMRA 1QP7A 3F3MA 3B1FA 3F67A 4ZCLA 1Z5WA 3E03A 4E5PA 4BJ1A 1WJGA 5BN4A 1PYGA 3G88A 2WUGA 4L5JA 1SRQA 1M2OA 2JZCA 1KEVA 2PVPA 2OK7A 3K3PA 5FQOA 5HF5A 4MA0A 2N47A 1U6KA 1KZGB 1XRMA 4IQFA 4FFVA 1L5MA 2O57A 2EW8A 5DBHX 2WUWE 3VZQA 3LLUA 2GEJA 3U3RA 2J87A 3WB9A 1DBWA 2DXIA 1E5QA 2ZYRA 4WI1A 2CLOB 3RJTA 5C8XA 2W42A 1U1DA 3PTLA 1JU4A 5LYYA 2IXEA 2IYSA 4RQAA 5EE5B 1MJ5A 3QXGA 5EXEA 3QMVA 4M6WA 1ORDA 1FTYA 2NZJA 1DNPA 3HKCB 4TL8A 3VYWA 4WCFA 5F2EA 5K0ZA 4X66B 4FYMA 2NZ2A 4GEKA 4RD4A 4RU1A 1S96A 1USUA 3LNCA 1QVAA 1SVWA 4LRTB 4JV5B 1TPZA 4BMPB 3PFNA 2WWHA 1GL3A 3I2YX 3O75A 3W5BA 5E38A 2QSYA 3OWHA 3Q5EA 3FM9A 4HX2A 3A6PC 2A9QA 4PZLA 2NWQA 4TMZA 1M6WA 3QU9A 4HT3B 3DZBA 1TIKA 5CBKA 2E48A 5KOHA 4Y9UA 1G7TA 1U7OA 3C3XA 5LD2C 4RHTA 1TT7A 1MV8A 2X4IA 1N5KA 1FXWF 3Q10A 4FE4A 5TT1A 3LQQA 2VDMB 3EXEB 3P0IA 3IIKA 1C5KA 2GNAA 5D87A 5I7HA 5DGTA 4DQUA 4MI9A 1JSLA 1V11B 4Q37A 2OQRA 3K0EA 5CDYA 3R3UA 3R5FA 4PAWA 3UTCA 1UH5A 2P4UA 3WJ2A 3OZEA 1AIPA 3C2QA 1L5ZA 2H1RA 3L01A 4ESEA 1JIKA 2QL6A 1J09A 5IZCC 2DCMA 1G8MA 3BK2A 4HS4A 1A9QA 3KSMA 3TCNA 1W88A 2QLBA 1O96A 2C07A 1E4YA 3L8DA 1G2IA 3L93A 4CBVA 2OA0A 1RWVA 3MCTA 1RVDA 2FR8A 2O5CA 1E1CB 3GVCA 3Q87B 1ZNZA 4PVCA 1G3IA 3RRJA 1P3Y1 3RNLA 4BRSA 1M2HA 3HXKA 1RXEA 5CYGA 5HK9A 2V7UA 2QRMA 3B1JA 3LHKA 4FGLA 4GT1A 5L3SA 1H8EA 4F9GA 3ZK7A 1NXSA 1C0LA 1CR0A 2FHSA 1CUJA 3PWSA 4O25A 2ORWA 3UT5A 1GZ7A 5JSZA 5KTSA 3MJEA 4CM8A 4MV6A 4QUKA 4F3TA 3DZ8A 3L1KA 3RVOA 3CVWA 1WUKS 3WK5A 1CUUA 4EL5A 5M7EA 2FH5B 3M5CA 4OF4A 3ZHZA 5FBLB 1YB6A 2E49A 3N75A 5A0VA 3L8EA 1IUOA 3E82A 3UB2A 1EA5A 1OTXA 3E22B 5CITA 2N9UA 3K8YA 2PANA 3B3FA 5BSKA 2VHQA 3U0VA 4FYXA 4DKJA 1IUPA 3BS4A 3EZNA 4PAMA 4GMFA 1SIUA 4UHHA 3DL2A 3FTCA 4I0WB 3DYBA 4MVJE 4RZSA 1IOVA 4B75A 4EW3A 2E4ZA 4NBVA 3DEZA 3UXYA 1IEXA 2AXQA 4YR9A 3V42A 5IJ0B 4IZOA 4QHTA 3LQKA 1EK5A 2OGTA 5IYZA 1TQ4A 4OJQA 5GGYA 1Z6AA 4CMEC 1JMYA 3IKLA 2IQIA 5E4YA 3AUTA 4H7PA 1LTQA 2A9KA 4AJ1A 4EQZA 4ADSG 4DT1A 1DJPA 1NSYA 1X1DA 1A5AB 1MKYA 3COZA 4CHTA 5KC9A 2IK8A 3P20A 4PBTA 4Q7KA 2O14A 3USZA 2PUHA 4DQXA 5I9LA 4YMIA 4CQLA 1UBTS 1L4KA 1GNRA 1SM4A 2TMDA 4YI3A 2OXFA 3PUWA 5AIAA 3RVBA 3ER8A 3AVWA 3JTEA 3IUJA 5IVDA 3CN7A 2CNWA 1UBOS 3T94A 4GBED 3MRSA 5CB4A 2IOFK 3HTXA 3VO1A 3HQ4O 1J9ZA 1PWXA 5C4IA 1NL3A 4FYYA 1FTNA 4HAWA 3ITEA 5EJ2A 2XYRA 2FN9A 2GN0A 1Y63A 2XF8A 3BZWA 2D5LA 3VO8A 3WLQA 4HVAA 3LT1A 4MR7A 4CV3A 3BMOB 4R2HA 3WISA 1Z18A 3MJRA 4PGGA 5EE3A 4KFTA 2I33A 3SX0A 3OQPA 3TZKA 2VZ0A 4MRNA 4R6WA 4LCEA 3UW1A 1M2VA 3C3PA 2Q5FA 2XNJA 4MPTA 3ET4A 1FDRA 4UBJA 2FWBA 5TVKA 4DSOA 1XJ5A 3C7KA 2ZJ0A 1WF6A 4IR7A 4A15A 3FFBA 1DUSA 3GDWA 3ID6C 2LKCA 4OREX 4AZWA 4EG4A 4B3CA 5C7OO 1JPUA 4Y2GA 1PRYA 3D7NA 4O2AB 1SBTA 2EKQA 3I2KA 4HNTA 1KMHB 3C14C 2IF0A 3WLTA 1P74A 2EF1A 4UBNA 4X7PA 1YOVB 4KR7A 1ZD5A 1DQRA 1P19A 1BQ4A 4XX0B 5ADUS 3BBPA 3CCBA 3VR4A 2R87A 4L73A 4Q3CA 3U19A 3GCZA 3GFTA 3LLVA 3CMCO 1UK6A 4D4IA 5JPIA 1PJAA 3HABA 4OQFA 3W9BA 4F1JA 1JMVA 2WA2A 3L06A 1QQTA 1DMSA 1VJGA 2ST1A 1TFRA 5H3HA 2CJPA 3K5HA 4YMGA 2Z2ZA 3EA0A 4UCXA 2Q46A 2VF8A 2OZVA 4KQ2A 3LUDA 3F5FA 5IXJA 2FY8A 2F6RA 2OMKA 5CGZA 3VR5A 1O87A 3FPHA 1STOA 1USWA 3Q85A 2YWDA 1XZLA 2QTLA 4TMKA 4M0PA 3RFCA 1QPGA 3S2ZA 3GMSA 5I7UA 2CDRA 5EPEA 1NJ8A 1T9CA 3RI3A 4NMXB 3WJ7A 5L7WA 1UMBA 4RAOA 4UQOA 5FI5A 1LKZA 1GFWA 1KIMA 2GTIA 3Q3HA 3UAYA 3VMMA 2UU9B 5FA8A 1Y8RB 1E2PA 1OJLA 1OQAA 2PGOA 5IT4A 4RTOA 3UMMA 2WYVA 2H63A 1NP6A 5FEUA 4RA9B 2WVGA 4KI7A 2C78A 3M6LA 4BX3A 4NULA 2BWJA 1NZJA 4KMRA 1IBSA 4GX2A 3ZEIA 1Q7EA 4CG2A 1H9CA 4HXFB 4GGPA 4Q34A 5CB4B 3F6CA 5TF0A 5EI5A 4FNOA 4CM7A 3OIWA 4PC6A 2WFLB 1AXEA 3C70A 1P5ZB 1Y1PA 2WE7A 4RKEA 3SBDA 3RU7A 2QBYB 3AHJA 3RAGA 2UZ4A 1B43A 2YWXA 1JNYA 3V7YA 3L6DA 1Z37A 1GXSB 3ZU2A 3FWYA 4RK1A 4NAVA 3RC9A 1IY9A 2XY4A 4L3OA 5C7IO 4K6FA 2V6FA 3MAGA 1RI2A 4JWKA 2PMWB 2Q6OA 1H8HA 3AJEA 1PLLA 3ESQA 1L4GA 1Z74A 5JR3A 1MVOA 3P2EA 1VB3A 2AB0A 1EUDB 3FAKA 4TZKA 3A9RA 3GVXA 1IIRA 1NBEA 1E4EA 2OENG 2D1FA 1NLUA 1Y4SA 2NLOA 1NMZA 5HRAA 5DNUA 3IPLA 4DCGA 4RH3A 2IIBA 1E5VA 1M74A 1DO0A 4X8MA 5HMLA 2WE8A 5B3LA 1YA6A 1UXKA 1WMSA 4GYKA 1V7QA 1U1IA 5CH3A 1JLLA 3F7OA 5JD3A 5LA6A 1G0NA 3HC7A 5CG1A 3O4FA 1FUUA 3U7QA 4MDFA 3B1WA 3C8HA 3VNUA 2B30A 1A9PA 3Q3EA 4KH1A 2KM1A 5FUYA 1J2RA 4BQSA 2H5IA 3MK31 1R3DA 2C94A 1O8BA 1PZHA 1R4MB 5DEOA 3T5DA 3HM9A 4DV6B 1FUIA 4FDTA 4NU8X 3W5JA 1JJIA 1IJFA 2H5EA 1OYOA 3EW9A 3QQ5A 4KODA 5P21A 1CSEE 5FPTA 3T7DA 4QPZA 3I1JA 2GETA 4LYDA 1QHYA 1X15A 1WCV1 4AUEA 5JSFA 1XKTA 2OAEA 2XWBF 5EQJB 2X58A 3T34A 2H2AA 4NH0A 5TIIA 3AI2A 4MKRA 1D9ZA 1T2NA 4D6PA 1ZL0A 3WGJA 1FUKA 3SS9X 4BLUA 4GVPA 1I30A 3MS4A 1O57A 1KYQA 1KP2A 4CG0A 4YIHA 1PK8A 2RAUA 2VPPA 1CTQA 3UB3A 3WYEA 1QG0A 4U7JA 3K9FC 1K6EA 7ABPA 4IV5A 5CAEB 3ORSA 5EWMB 1XROA 2NTYC 2ZATA 1K6IA 1QOQB 1DRJA 1Z34A 2FFQA 1AHIA 3IHWA 3KL2A 4QD3A 2CLMB 1MD9A 1JEQA 4HN2A 1MAVA 1L1QA 1GEEA 3O21A 3UG6A 4D26A 1QGDA 1LDEA 2C99A 3OE7D 4IOKA 5TPZD 3WAKA 5LU8A 3P52A 3ZUGA 1LB1B 1QHNA 1FEZA 2W11A 4DXAA 1NOJA 4WLEA 2GR9A 2VRWA 1TEXA 4PGAA 4U39A 2HGZA 2Q7XA 2I2FA 3EIUA 1EQ2A 1VIYA 3MINA 3WKAA 2O2GA 1ZMXA 1ZNXA 3CLRD 4LNAA 5C8VA 2RIRA 3D0KA 2JHPA 2XAAA 3DZGA 4W99A 3IUEA 4D3YA 1O95C 3R76A 1NT2A 1P1BA 3BXZA 3I6YA 1RABA 2M6RA 1D2RA 1JG1A 4IJ6A 1RM3A 2J3KA 4NBKA 4BVLA 3X1KA 1KVRA 4RJTA 3U4QA 4L5AA 1KI4A 1V4NA 1MHTA 4JI7B 3HJRA 4B44A 2AWNA 3AJRA 2DOKA 4KGZA 3DV2A 4IMIB 4MPJA 3VUFA 1JP7A 1RI5A 2ASEA 3A27A 4JYBA 4CF7A 3H1BA 1Q77A 3H16A 4HY3A 4YRIA 5FUMA 4HUTA 3VC1A 3TLAA 2IXBA 3W5HA 1J21A 3KUKA 1K5DA 4TKUB 1MQ8B 1FSZA 1X9GA 1ZHOA 2EIHA 3UKDA 1QLWA 2QR3A 1OWMA 2TMYA 6Q21A 5B58C 3TUZC 1RLIA 3FWKA 2CFOA 3GP8A 1E2LA 4BB5A 1G42A 2K2QB 3BILA 1IC6A 2MR6A 2P6OA 3NP9A 2J45A 4L28A 1LLQA 1P6QA 2PWZA 1RJ9A 2YXDA 3MCWA 4GWLA 3RYTC 4YAGA 3HNOA 3K0CC 3E9EA 2ONKA 3Q9NA 3U7JA 3HFGA 4RZUA 1H4TA 4FEGA 4JQCA 4LI0A 3AIMA 2LTAA 4KEAA 4B3RB 4LYFA 1KAMA 1G9SA 3CF0A 4PPFA 4A23A 2PGXA 3ESRA 5F1KA 4KP7A 3WA6A 4FMCB 1NM5A 4JQOA 4GXNA 1A9ZA 1B6SA 3CKLA 2DBQA 4YRGA 5IAOA 3D3JA 2NO7A 4TLDA 1G2QA 4Z5XA 1UPTA 5B1IA 1X70A 3G13A 5A06A 2Y3IA 3KOXA 3RS2A 3KX2A 4ND3A 1LS6A 2E1PA 3F1LA 3DE1X 1USIA 4D74A 1YR9A 5FBWB 3S40A 4A0GA 1A8UA 2QJOA 2RSLA 1WVGA 4AYWA 3A4YA 2AR7A 3E15A 5BR7A 2H1CA 2A9PA 3D6VA 1D2GA 1NJFA 4C7BA 3ZQ4A 4K9MA 2VR1A 3PE4A 1UPCA 3WRWA 1ML4A 4BE4A 1IHOA 4GWGA 4JBGA 3OP1A 3AT1A 4UNPA 2PQ2A 3LKZA 1O6CA 1U11A 4GLFA 4JI1B 3W5IA 4D44A 4Z7NB 1VSBA 1TM7E 4DVJA 1YUNA 1Y0BA 4JLDA 4BO5A 4CG3A 1K7FB 4EVRA 4I3FA 4ZVVA 5FRDA 1IZ0A 3KQSA 3QUSA 4V0NA 1XO1A 3LH5A 3RFXA 3ZGLA 3D6TB 4FYIA 3LWDA 4WNIA 1ACLA 4P4SA 2DQYA 3T4EA 3T54A 2IOHA 2HJWA 3FOCA 2AF3C 3LLSA 2Z6QA 4Q1DA 4IEFB 4IIHA 3Q2OA 3IBSA 1N25A 3N70A 4FOSA 2VKQA 4PSCA 4FYWA 1JV2B 2PS3A 1CF9A 2IUTA 4Z9BA 2X22A 2QSZA 3NS7A 4NPHA 1AXRA 1D6JA 2FZVA 3DFMA 2OCGA 1OFIA 3GEMA 3DUFB 3MNFA 2Q3BA 5GGXA 2R1UA 1OA1A 4XXHA 2C2BA 4JY7A 3Q5GA 1DFHA 3IAHA 4P4GA 2D3WA 3TLJA 1H1LB 3PP8A 1FQWA 1KOGA 2O8FA 1H0HA 2HQSA 3B6KA 4R2KA 4PLZA 1HTBA 3TVDA 2AKYA 4FXPA 1BX3A 5FI3A 5IN4A 4X20B 4ZCPA 3FHOA 1MBZA 4BUZA 2ZIGA 4O2RA 1P61B 4MGHA 2VSXA 3OAAA 4B4UA 4J3FA 2GAAA 2RGDA 1PHRA 1SU4A 2Q3FA 3L0BA 5F2KA 5CA0B 4ATNA 3WLMA 1B1AA 5EE9A 1NUSA 2GCPA 1HYGA 1R4NB 1U65A 4CDRA 1H93A 2PUWA 4HN9A 2PUGA 1ZG3A 1Q1EA 4M83A 3DE3X 2J85A 2CBZA 3TINA 4TYQA 5U4XA 1YRBA 1SNYA 4H27A 2X76A 4MICA 4LWQA 4G3XA 4JLOA 1CWUA 5JH7F 3LHFA 5KWEA 1SKBA 4X7RA 4ZYWA 2FSHA 3W7AA 4D4MA 3PNSA 2A4MA 2XKJE 2B3DA 1UDBA 2AN9A 1JS1X 3DR3A 3ZDXB 1LI7A 4U0JA 5C3MA 3AFNA 4ZO9A 4QEKA 1Z33A 5JISA 3KQTA 3WDSA 1T0BA 2OFXA 4W6ZA 3S1AB 1XZPA 4G0QA 4J90A 3JAKA 1FLDA 4XVHA 4H15A 1FIUA 4JP2A 2MINA 3LWNA 3UMFA 3FWZA 4P7JA 1E9CA 2YFKA 1CS4C 1CS0A 1W0JA 1WOYA 1ZICA 5F1PA 1JI3A 1UBHS 1HLPA 2VF2A 3CWCA 3M3HA 4LCJA 3RAJA 3BFPA 5AJHA 3HV2A 1A2KC 1XYYA 1FS4A 3UK6A 3ZDQA 3AEYA 5DTEA 3WV4A 4LF4B 1KJJA 3CTPA 3R6WA 4HF7A 2ICAA 4HWOA 4EF5A 1A98A 2DERA 3MCUA 4JENA 4XI9A 5CCBA 2CK3D 4E1AA 2AH5A 5ILQA 3RTCA 2NZVG 3EGDB 1BMQA 3G2IA 2J3QA 1T26A 4YS6A 5KNBA 4OLBA 3SFZA 3R5JA 1IQRA 5LJLA 5I6DA 4L9AA 4LVCA 4YYZA 2BLLA 5L40A 3AKEA 3G5UA 1R6TA 1TZKA 1V7CA 4EJ0A 2F67A 2OM2A 2BOVA 2F3SA 1E79A 2QMZA 3R0ZA 2ZYUX 5CXQA 1SC9A 3Q5DA 5G0TA 3K70B 4XJSA 3SY8A 1AD2A 4D3ZA 4NBTA 5B4TA 2J9FB 2Y1DA 4F3KA 2OM6A 4YP6A 1ZR4A 4RSHA 4Y6OA 1E4VA 3IBYA 4BRZA 3A1UA 2WU3A 1WHSA 3L2OB 1I1QB 1WE2A 3E3AA 1NIPA 2H17A 3JVVA 1EWVA 3SPXA 3U0BA 2AC2A 2P4SA 2UZ1B 2I9PA 1UBMS 3GLTA 1YGPA 2SHKA 3BL8A 3IBTA 4I08A 3L8MA 5JMPA 4DN6A 3H0CA 2Q0SA 2XHZA 3KWJA 1MEOA 3JYNA 3Q88A 5JSYA 2AQHA 2OKCA 3KWLA 4TVOA 1GD1O 1VIVA 2Q49A 3A28A 4DNQA 2WYWA 2X40A 3AUFA 2QPOA 3IR6A 2JJ1D 3LPMA 2BEUA 4KO4S 4QUHA 3P4UA 4RESA 2LZ0A 3IDFA 3JTMA 1A8PA 1H65A 4XYLA 3A31A 2R8XA 1RYYA 2XE8A 4MWDA 1QZUA 3UMSA 3TG8A 2AZXA 5FWYA 3HR4A 3PWZA 3J80A 1AGNA 2VNKA 3NHZA 1GDDA 2FXIA 2WINI 3K9WA 3CNHA 4FDUA 5HCIA 3KAJA 2A94A 4RYDA 2R8BA 3UV7A 3DOFA 1YJAA 3SSAA 3ZE2B 3ABSB 4NFLA 2ODBA 1XQXA 2C4KA 3BK1A 2C4VA 2G63A 3KTOA 3L0OA 1L4EA 4L0CA 3VKFA 1M73E 1VSTA 1ZP6A 2IUSA 3VC3A 3PJRA 3IJRA 1DELA 4WD3A 3KSUA 3VZDA 2QORA 3NIWA 1KEEB 4RK7A 4UDOA 1A4XA 4Y67A 5K9ZA 1U2DA 2UV8A 3LRPA 1EVKA 5DX8A 3FUXA 2CJXA 5DBIA 5BQ5A 2BHSA 1LPMA 5DK6A 4HEA6 1K89A 2Z4TA 4ZGBA 2AWOA 2BH9A 2W43A 4O4IF 1CF2O 1I6WA 4Y2TA 5KSOA 5IS2A 1QOZA 2P2SA 5IX8A 1PJSA 3C4QA 1FP4B 3H2YA 4DG5A 3KELA 3HJNA 1LTHR 5I7WA 5MN5A 3UBMA 3DBHA 1EFRD 1RKUA 2DFDA 1TUBA 1Z0SA 4YRBA 1VG9B 4Z54A 1B8VA 2B8NA 5E6UB 2C2XA 4ZT6A 3H86A 1NFRA 1PFGA 2H0RA 1MQ9A 3UA4A 1KYIA 4QU0A 1BH2A 3RYFA 5C34B 3DW1X 3E7WA 4PG5A 3RT9A 4D6YA 2GKOA 4RWEA 1JSXA 1AZLA 4Z1MA 5IEJA 3ZHYA 2WWYA 4BNMA 4UHKA 1BVUA 2CNNA 1JJBA 2B2CA 3GCWA 5AI5A 3GLQA 3MUNA 5E2BA 3LCJA 4UDXX 4OHBA 2EKBA 3FNRA 4YRPA 3TMAA 2IZZA 3L6BA 3PSAA 2R0QC 8MHTA 2IHYA 4WZBA 3HU1A 3RBVA 3C8MA 4HDNB 3V8RA 1ZS9A 1ZGBA 1V4BA 3SXUA 2QMOA 2B4TO 4XB6B 2EFJA 3MQ2A 4P3PA 2ZJ5A 1UDCA 2CD7A 5ALSA 3UMYA 2BEVB 4WN9A 4WLFA 4HXGA 4ITRC 4LY0A 4XWWA 3LI2A 3LF2A 4ODIA 2DVMA 2KW5A 1V9SA 4UU0A 5AHRA 3GVHA 1L5GB 5AW3A 5KU1A 3WGIA 1B0ZA 4J1TA 4MW0A 2O8CA 1BXZA 2OHVA 3PQ6A 4CKEA 3THWA 4W7HA 3M3PA 3WSVA 2G77B 3H05A 4QGSA 3GJQA 4WTOA 3N07A 2V96A 1KI1A 2P4EA 5JBNA 1OYVA 2QMYA 2X86A 1ZK3A 3PF9A 3HVKA 3PQ5A 4QGFA 2AEFA 3UXEA 3KYCA 2RAVA 3LSTA 2C4TA 1LSUA 4P1ZA 4B3JA 4E14A 1LWOA 3JD3A 4NBUA 4MWBA 1OFTA 4P33A 1UC5B 5E3JA 4LJ8A 4ZQCB 1ZJWA 3FTNA 1OX5A 3DOEA 3BFXA 3KV3O 5TARA 4WBNF 3TQTA 1JT2A 1BCRB 1QO7A 1UAAA 3EEOA 3D64A 1RPJA 4B6FA 2ZRLA 3OKAA 1IN1A 2QYOA 1Z8NA 4Y2XA 1SBHA 3S27A 3VVCA 4TX1A 1O3YA 3IEKA 4H6PA 2ZBUA 2CHGA 1IHPA 3DXFA 4OK6A 3F3KA 2C42A 1YZGA 4TM7A 5BW6B 1S8AA 5LMCA 4R98A 2ZXEA 3G0GA 4ZOAA 3H97A 1U3VA 3HBLA 4I8DA 3SKYA 1FFGA 1PFKA 5TNXA 2KLBA 3PR3A 5IP5A 3NHWA 3D2AA 4OXXA 2ZANA 3DOCA 2R751 3A9CA 4QPPA 2IZ1A 3PUZA 4L2IA 1DLIA 4I1VA 4NJOA 4UFNA 1L3BA 4KPYA 3QVLA 3LT0A 1A2OA 2A5LA 3MS7A 1YQTA 4KAAA 2GVNA 5BV7A 3ND6A 1W93A 4LDNA 1NUTA 1RADA 1PR2A 2CLSA 5I9BA 4CF4A 4PQRA 5G4KB 5JBIA 4RJLA 5CM9C 1M0EA 2KYRA 1AUOA 1CQPA 2CNWD 2I7TA 4Q93A 4LEIA 1DO8A 4BLPA 4HXEB 1JWLA 2H2FA 3GNQA 4PG4A 4JLJA 3TO5A 3E81A 3IEVA 4QREA 3L92A 4ILEA 1Q3HA 1KYTA 5FUVA 2YHIA 3U80A 1Z9BA 4Q9AA 3U3OA 4J0QA 2HGSA 5JNSA 1BHO1 1Z63A 4G89A 2DGDA 2BFCA 4GZ6A 2JFNA 4Y7DA 2O8DB 3JQFC 5LC1A 3EX7C 3SZMA 1X7YA 3AGPA 2QRJA 4KPUB 5EFOA 5LUBA 4D4LA 1ZK2A 4MUIA 4I55B 5BORA 4GP6A 1BC5A 3BXEA 4F56A 1G16A 3ABIA 2VC2B 4N5HX 1PJCA 4KX5A 2D5CA 4C21A 2YCLA 3HBAA 5KJFA 2WMNB 5I9SA 3R7WA 3LKBA 4FC6A 4H18A 2WP8J 3UJ7A 4KR0A 2ANCA 4DDUA 4XDHA 4WOKA 4DTIA 3HCFA 2QG9A 3VHLB 4UFOA 5HDBB 1AF7A 3SJUA 3L7AA 2PUTA 3RAPR 4G4GA 3SFVA 2O1EA 3OD1A 4KH0A 3VR4D 1XXHE 1EVEA 2YZMA 2YRWA 1TCBA 3H11B 3L7NA 4JL6A 5CLIA 4MUNA 5EXTA 1M5UA 1MF7A 1G3QA 5AI4A 1W29A 3SIWA 1ZD9A 5K6TA 2YZ7A 3DMTC 1Y48E 4KQMA 3L3BA 1EXWA 2XUGA 4J94A 3D6MA 5B6PA 3T1YB 2V9ZA 1TW3A 3TFQA 2FR0A 4MQEB 1E61A 4IOLA 1E1KA 1MPXA 3OZGA 2RE8A 1RTKA 4HO1X 4BECA 2F3UA 3G2OA 5EP3A 3X1WA 1EKXA 3TFOA 3VR5D 2FEWB 1TCCA 2RC6A 3U7RA 1SC1A 3R09A 3WNVA 2DP4E 1N2OA 2YIDA 5JDCA 3GFRA 5ALVA 1ZW6A 1AKNA 2RB5A 2ZAGA 4A8JC 3QW4B 1KFEB 2BGTA 3R5XA 4UOEA 1YONA 5E7JA 2RGYA 1U9CA 2DULA 2JFXA 2ZSEA 1F0KA 1TK2A 4IIJB 1ESMA 5L4LA 5GQSA 1F5SA 3FN4A 3PUKA 2RHCA 5CFQA 3A4NA 3BICA 3HCWA 4Q4DA 4DHEA 2LKDA 3M82A 4FMBB 3WZLA 1XG5A 1JA1A 3NBUA 1C7IA 1RWWA 3AL2A 4QFCA 2Z4RA 3PVSA 1UBJS 3PFKA 4AS1A 1FNBA 3CPHA 4XJVA 1QV7A 3TZCA 5ENVA 5EIHA 3TSOA 3ZV3A 4INZA 1UDRA 5G0WA 5M3BA 1G18A 1S8OA 2GAFA 2MYTA 2Q0QA 3CZQA 3CEMA 4XIIA 4ZA2A 1MA0A 4AKSA 2GMWA 3TPFA 3L07A 4KSBA 4QUJA 1WB9A 1DAIA 1M76A 2NQ8A 1II9A 4N0MA 4H3HB 4ND2A 5IYZF 1MP0A 2Y68A 3U1TA 1T4CB 2X4GA 1BVRA 1QFYA 3PDIB 3L82B 4QOSA 3UTDA 2E4XA 4D0RA 5ALHA 1I7SB 4CMIA 4YUAA 4B3IA 4LBZA 3L6CA 1IN4A 3KAPA 3T3PB 4E1VA 5AW5A 3SZOA 4I1RA 4RMJA 4Y8VA 4XEHA 1ZOOA 3QKSB 4O63O 4YT2A 5JYDA 5KWSA 1H6AA 4JKOA 5DYTA 3H13A 4BO8A 1UWLA 3KB8A 3DQPA 3JCZA 2BZ1A 1AUXA 1F2UA 1LC0A 1L4BA 1QV9A 2BEWB 4HQOA 5ALLA 5DZSA 4ARZB 5EERA 5EQDA 5H9VA 1PK9A 3TM5A 2PKQO 3D31A 1S7CA 5IMSA 2WD7B 3RC3A 2H65A 5AKXA 1I4OA 1L5LA 4MHSA 4YCBA 2J9XB 2JLYA 4LF9B 1AGXA 1J2JA 2DPLA 2PX5A 1VJRA 2ORIA 4X61A 5IUNC 1EGHA 2EQ5A 4U02A 1AGYA 4MRVA 1Q0TA 2IHNA 3U3DA 1M1XB 1ZCBA 5C81A 5J63A 1FS6A 4UTZA 1Z62A 4TTAA 1H4SA 5EHGA 1LLFA 2MHCA 4EFLA 1WPXA 3LZCA 1N6KA 4QNRA 3BREA 1NVVR 3NT2A 4JN6B 2OCDA 5CR9A 4FJ0A 2QRLA 4LV5B 5CXUA 1UZNA 2Q21A 3ZDYB 3V4VB 1NI3A 3GH1A 4BB9A 4IILA 2NGRA 1XTBA 2CJFA 4CEJB 5D3KA 1RAHA 3LQ1A 3IP6A 4ZU3A 1XZQA 2GGSA 1UFKA 2FPLA 2FETA 4Y9SA 3VNBA 2Q3HA 5D3MB 1WDWB 3F6PA 4IZ6A 2QRHA 5KSZA 1CYEA 2JI4A 5A5FA 3HCDA 1DQYA 1G9TA 3EC2A 2ON6A 1JWBB 2VHWA 1QAQA 3R5HA 1ARZA 1HE2A 5DTJA 2Z5VA 1XEAA 1RHMA 3CCCA 3RS3A 4ZAZA 4LHVA 2OGUA 4Y1EA 4ARBA 1LX6A 1VTKA 3DE2X 3E7FA 2HHHB 4IJWA 4L4SA 4RTPA 5AI0A 5AJTA 2G4CA 1VMDA 1PT6A 4MIKA 4C9BA 2HK7A 4OMCA 1VLMA 1X7ZA 1ENPA 1KA9H 2EP7A 1W4AA 5EIXA 3U16A 2W6IA 3ETGA 1NNSA 1ZINA 1Z4OA 1RLUA 1GGJA 1E69A 2XYHA 5DLQC 3UATA 2RK4A 1G98A 2GPSA 3C87A 3LHSA 1T8RA 2ZULA 3CX4A 3KVNA 1UQUA 1FYFA 2BSXA 5CX1A 3ZD9A 1E9EA 3H8VA 3ZJTA 2JIOA 2FE4A 4W5RA 1VPTA 1P0QA 2BDUA 3NDJA 3QVGB 4OQEA 3A9SA 3LC7O 2H4XA 2A14A 4A2WA 3ZD7A 4DY6A 4IKOA 4I1SA 2Z2JA 2PMKA 4HB0A 1GNQA 3F46A 4RZIA 1U7ZA 4F3NA 5JATA 4HK4A 3SVLA 4WJZA 3CRZA 1Y1KE 4I9FA 4C88A 1TQ8A 1SXJA 1KI7A 4GMXA 3NIGB 3WWYA 2Z6UA 4FD3A 3VAZA 2ORYA 4D1YA 3O8LA 1UDXA 3CLRC 4DBZA 2RHBA 1OHHA 2AKEA 1VFPA 3D4BA 2AJDA