2JBAA

Phob response regulator receiver domain constitutively-active double mutant d53a and y102c.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
ARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLAWMLPGGSGIQFIKHLRRESMTRDIPVVMLTARGEEEDRVRGLETGADDCITKPFSPKELVARIKAVMRRISPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-Ray Crystal Structures of Two Constitutively Active Mutants of the Escherichia Coli Phob Receiver Domain Give Insights Into Activation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY PROTEIN PHOB
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jbaA00
1YTUA 2IYNA 1DBWA 3G85A 5IULC 3VNAA 3ILHA 1PEAA 5BR1A 5B3JA 5JNVA 3CG0A 4ZMSA 5JNWA 3JPYA 4FE4A 4HYEA 4LE0A 1JYFA 4LE2A 4NICA 2E4WA 1M2FA 3F6CA 1ZITA 1PHRA 1RXEA 4ETIA 3CZ5A 4F8JA 5C5EA 2R47A 3RVKA 3ILYA 5IEJA 5JNSA 2CHEA 5HSGA 2QZJA 4MS1A 1K66A 3H5VA 2LP4Y 4YCSA 3FMVA 3RVNA 3UK0A 1DG9A 4D6XA 5KWSA 2M98A 3LKBA 1BDJA 4MQFA 2MYNA 4KFCA 3LTEA 3I5AA 4N0QA 3KS9A 3OQOA 3DLHA 1DZ3A 2N9UA 3GBVA 4N76A 5E3JA 4YR7A 3HS3A 1JFTA 1CEYA 1W25A 4GNRA 1EWVA 3LUDA 4WZZA 4E7OA 2A9QA 1U04A 4MYRA 1DP4A 3GA5A 1BDIA 2L2QA 1OXKB 1DC7A 5TQJA 5KQLA 4OLAA 2WJAA 1NXTA 4F12A 4MS4A 3F6PA 3MYYA 4FB4A 5B3JC 5TPWB 4ZMRA 6ABPA 3RVOA 1Z2EA 5T7BA 5FWXA 4LRQA 4EYQA 3IPCA 1Y1LA 2NT3A 5CNJA 3E3MA 5CNIA 1NXVA 2PUAA 4OBBA 3OMWA 5HM6A 4YP9A 3LMKA 4IMJB 3H5OA 4CBVA 1A0OA 4D74A 4P98A 3UKJA 2B4AA 4MLDA 4MS4B 3H6HA 3LUGA 1MAVA 2MYUA 4WT7A 3LUKA 1YMUA 3NNNA 1E6LA 1QMPA 1RNLA 1ZN2A 2P4UA 3K4HA 4H3KB 1LJUA 4W5QA 4G0YA 3H5WA 5EWJB 3KTOA 3NNSA 4N0PA 1M2EA 4MR9B 4KQ9A 1ZVVA 3HV2A 5KQGA 2R25B 2PL1A 4H60A 1NTRA 2R4QA 3QLUC 5DTEA 2BGGA 3OO0A 1C0EA 3Q7RA 2MSLA 5DLEA 4W5NA 1R8JA 4EYKA 1PNTA 5ABPA 3OQNA 3MM4A 3O21A 5BQ3A 1JDNA 2RJNA 4HNQA 7ABPA 5I4CA 1W9HA 2FEPA 3TMYA 1ZY2A 2L17A 1JYEA 4KV7A 4JP1A 3O1JC 1APBA 3OQMA 3FFTA 2M1ZA 4TLLB 5BRAA 2IOYA 1Z15A 3H5TA 3I09A 3MQ4A 1RZRA 2MYTA 2O20A 1KRWA 3C6QA 2FEWB 4D6YA 4OTZA 1QPZA 2MSWA 2FMIA 3BRQA 3HEBA 2KYRA 4EVRA 2E4ZA 1FFWA 2R48A 3EULA 3KG2A 4RXTA 2TMYA 3Q9SA 2J48A 4OATA 1U2QA 4YS6A 4Q6WA 2P9HA 2FEKA 2HJ9A 1T34A 5EWLA 3GBPA 1DCKA 4QYWA 1YS6A 2RGYA 5FWYA 4Q6BA 3CZCA 4RU1A 5EWJA 3SG0A 4XASA 4DN6A 4Z4GA 1KMIY 4W5OA 2IKSA 2FKAA 4KK3A 3RVLA 1IIBA 1F51E 3DLBA 2CHFA 3CTPA 4MQEB 4UHJA 2HQOA 2NUBA 4PICA 4G0ZA 4RXMA 5ED4A 2OQRA 2ZAYA 1EFAA 4JOQA 4LDZA 4PEVA 1ZGGA 2PJUA 3RVSA 4RDCA 3QX8A 1WETA 1VPWA 2JK1A 3GYBA 3M9WA 3TO5A 3M9XA 1SRRA 1VKRA 4ETMA 4EYOA 1Z25A 4G0MA 5FWYB 5JS2A 1SXGA 3R0JA 4RK1A 3I45A 3NNDA 3C3WA 3HUTA 3OLZA 4Z4FA 4MR8B 2L18A 1GUDA 4PZ0A 4XAQA 4RSMA 2AYXA 4MS3A 4Z9AA 4Z0NA 4JA2A 3N0RA 4W5TA 1RPJA 3RVJA 2LPMA 1BVHA 3GT7A 2ID9A 2WRZA 4YLEA 5DCLA 4Z99A 1DCMA 4NQRA 2PUGA 3N53A 2FLKA 4XLTA 3O1IC 1LBIA 4QICA 1SD5A 4RKQA 3HM9A 4EY3A 4G97A 4O1IA 1D1PA 2PAFA 4G0XA 2JBAA 2QU7A 5T3YA 1USIA 1GUBA 3GV0A 5TE9A 3QELB 3CFYA 2CD7A 2CWDA 3T8YA 4EVQA 4RXUA 4L85A 3KYIB 1QP4A 4MS1B 1JDPA 3JY6A 2YHBA 3Q15C 4KVFA 4OG2A 3OMXA 1A2OA 2B1JA 1BDHA 1ZESA 2LUOA 1E6MA 1EWTA 1TM2A 4UHKA 2PMCA 4KZKA 3GWGA 3JVDA 4Z4EA 1Z12A 3EJWA 1YMVA 3FDFA 4TN5A 3RQIA 3QEKA 2GI4A 1QQBA 3VNBA 1I3CA 3CHYA 5KI6A 1RXIA 2VUIB 1YK1A 1QKKA 5EWMB 4KNYA 1QO0A 3BREA 3O74A 1M5TA 3FFWA 1JF8A 1NY5A 2WB4A 1UDRA 1Z16A 2FLWA 3TD9A 2PE5A 1YK0A 1TVMA 3N8IA 3IP9A 3O2QB 1L5ZA 5TQ2A 4G0QA 4RZSA 2HQRA 1DRJA 2QSJA 1JX6A 3EAFA 5D2CA 3KHTA 2F8SA 3EDCA 1EAYA 3OM1A 3HSYA 3DGEC 1ABEA 1P6UA 3MF4A 3O2JA 3D8UA 4O5AA 1QNLA 1USGA 3QLUA 1HEYA 1DCFA 1K68A 1LJLA 3CKMA 3JVIA 4LZLA 1YS7A 4NV3A 2WY2D 3IDOA 1QO0D 4Z4IA 2AYZA 1D2AA 3HXMA 5IBQA 1LBHA 5HKOA 4RV5A 4RK5A 3G1WA 4KMRA 1DRKA 3SQNA 3IPAA 1DJMA 3LUHA 5FBHA 5HQJA 3Q41A 3KLNA 1H9CA 2A9RA 2FQWA 3MA0A 2F8TA 4LDAA 1QQAA 4ETNA 3IP6A 1J56A 2W42A 3SM9A 1CHNA 2FN9A 3OM0A 3HVRA 2Q5CA 5IEBA 5IX8A 3NHMA 5DGCA 4KQCA 5TQ0B 2PKXA 2HQBA 4WXMA 9ABPA 2X7XA 1NXSA 3TX6A 3F7NA 3QELA 3GRCA 5KC9A 4O1HA 3IP7A 4F3TA 2JBAB 1GLGA 3JTEA 4WWHA 3BBLA 4FE7A 3QLVC 2QXYA 3TB6A 3UUGA 3HUUA 4HNRA 1Z13A 2H0AA 1MIHA 3O1HB 2MYPA 2VUHB 1A04A 2A9OA 3MIZA 3QEMB 2RJOA 4MR7B 2WWVD 3QK7A 4PE5B 2FTKE 1CYEA 1RZRD 1ZDMA 1AB5A 1FSPA 4MLCA 3RVPA 2FSPA 1XHFA 5GOTA 3KLOA 4XXHA 2JVJA 3I42A 3C3KA 3F73A 2MSKA 3HJFA 1AB6A 2L19A 2FMFA 1JL3A 4MPTA 2YHAA 4ZPJA 3A10A 2FVYA 4G0OA 1JHZA 2HPHA 4L4UA 1ABFA 4S05A 3LUJA 5KQMA 2ID7A 1ZGZA 4MGEA 3N0XA 5JNRA 4RY9A 5JNUA 3JS5A 3OO1A 3N75A 1ZAYA 1FQWA 5TPZD 1BAPA 3T95A 3O75A 4NCAA 2VYCA 3EQ2A 1LK0A 1L5YA 3NBMA 1JFSA 4MQEA 4JASB 4LE1A 4YV7A 1ISSA 1ZHHA 3A0RB 4KRFA 1KGSA 4LX8A 2A9PA 3Q7SA 4N47A 2QV0A 1Z26A 1M5UA 1QP0A 3H6GA 3SNKA 1PNRA 2WMYA 3SAJA 4MR8A 4MR9A 4WUTA 2JVIA 1MVOA 4MAAA 4ZJPA 4NCBA 4ZYLA 3LOPA 5IUJC 1P6QA 2I6FA 1URPA 4XFKA 5FBKA 4QYMA 1JWLA 1P8AA 3SY8A 4JB0A 2QW1A 4N41A 3M6MD 3N0WA 4EGSA 3KCNA 1ZH4A 3RVMA 4YRZA 3H5IA 2FQXA 4B09A 1VLZA 4IRXA 4MQFB 3DZDA 2JB9A 2NZVG 3ROTA 5CHYA 4ML3A 1MB0A 1YVUA 1EWKA 3LUFA 2H3HA 3BRSA 1P2FA 3HDGA 3E61A 4W5RA 3KYJB 2E4UA 2IPNA 4RK6A 2QVCA 3D02A 2IPAB 3FGZA 1FFGA 2LIVA 1OXBB 3DGFC 3H5LA 3H75A 4G86A 1NXPA 2GKGA 3A0UA 1C4WA 3L6UA 1NXWA 2PL9A 3EQZA 5EWLB 2PUDA 3ROFA 1NATA 2VK2A 2LBPA 3HZHA 1U8TA 1XHEA 3KJXA 3FFXA 5F64A 1E2BA 1VRVA 1B00A 3IP5A 5CNMA 3W9SA 3LKVA 1TLFA 2GBPA 3T38A 3EODA 8ABPA 1PUXA 4PYRA 5BRJA 2JVKA 4S04A 1DBQA 2E4VA 2GWRA 4EYGA 3QLVA 2JCGA 2XDYA 5KQPA 4M88A 1D5WA 3EGCA 4RY0A 1GCGA 2HSGA 4TLMB 3C3MA 5DKFA 4RK4A 2WJWA 2FN8A 2FXIA 2RDMA 4TMYA 1SXHA 1F4VA 5GQSA 5TPWA 4RS3A 4RWEA 3HCWA 4KPYA 4XARA 5IUNC 3DBIA 1ISRA 4JB2A 5KC8A 4P1ZA 1EHCA 1BA2A 5IUKC 3CS3A 1TMYA 1Z17A 4YWHA 3OLVA 4RK7A 3RVQA 3H1EA 5EWMA 1JLKA 5JNTA 3Q7TA 4H3HB 4IMIB 1DC8A 4YGXB 1S8NA 4GPAA 4YO7A 4DADA 3N6VA 3CNBA 4EUKA 2GX6A 3L49A 5PNTA 1GCAA 4F06A 3MMNA 2FQYA 3H1GA 2QVGA 3RVRA 2PUCA 1FFSA 4RKRA 4Z4CA 3URMA 1NXOA 5TQ0A 4KREA 3HK2A 4DQDA 3HDVA 4KK4A 4Z4HA 4RY8A 1NXXA 3CG4A 3K9CA 3LUCA 2PUEA 1U2PA 2E4YA 4MRMA 2PUFA 2PUBA 3OLXA 4EVSA 3H1FA 3JPWA 3RH0A 4WXEA 2IPLA 4Q7EA 4Z9BA 5TPZA 4MS3B 4F11A 1XWWA 3NHZA 1SXIA 1JH9A 3QEMA 3C97A 4MR7A 3QX9A 4G0PA 4N03A 5IC5A 3P9YA 2IDMA 3LFTA 2ZWMA 3QLTA 1KRXA 1D1QA 3O2SB 2V0NA 5TQ2B 3OLWA 2FMHA 1MB3A 2E4XA 2IPMA 4QPJC 6CHYA 2JRLA 2NZUG 1ZH2A 4MRMB 2QR3A 3HO1A 3A3KA 3S99A 1JFVA 1PEYA 4HNSA 4IILA 1YIOA 5JS1A 1QP7A 2FW0A 3CRNA 3CU5A 3B2NA 5CNKA 3LUAA 1E6KA 5C5CA 4IF4A 4Y9TA 1D4ZA 3T6KA 1DBPA 1U0SY 1USKA 2NT4A 2DRIA 5FWXB 4OLBA 2OENG 2PLNA 3KSMA 4IGAA 1Z18A 4RK0A 1TJYA 4JAVC 2FMKA 3BILA 3GL9A 3KKEA 3OLYA 1Z2DA 3CLKA 4E7PA 1JBEA
chains in the Genus database with same CATH superfamily
1ST2A 3L77A 3SD7A 1ND6A 4XM1A 4LFBB 3FPGA 2OO5C 2FWMX 4NK5A 4FB5A 2HGSA 4R1MA 4RY2A 2NO4A 4AP9A 1EHIA 3WGZA 5HG0A 1B93A 3PXXA 4RA9A 3DHYA 1ODLA 3K09A 1EDOA 5FNZA 1CUUA 6Q21A 4B79A 3O4RA 5L4LA 5LL6P 2WVHA 1VPDA 3CRW1 1V4BA 2KLHA 4LN1A 4TMTA 4HUQB 2XCUA 5CFNA 3HXKA 3G2QA 3ND7A 4J4BA 5TV2A 5JH7F 2AOUB 3Q7EA 5IEJA 1XCMA 5U4QA 4QDJA 4GLLA 3H5VA 4IDOA 1HE2A 3A36A 4FS8A 4JGBA 1ZPDA 3FWYA 4RTQA 1KXZA 2OB1A 2G07A 2Q6LA 3R0QA 1PAUA 1JEAA 3H84A 3TG8A 1KI4A 4LRUA 4N47A 2XVXA 2AN1A 4BL5A 3ZLJA 2ALJA 4NCHA 5LP6F 5C35A 3DZHA 4W5HA 2FPGA 2AXQA 3HR4A 3R5FA 4PTYA 2H85A 5BQOA 1EWVA 3N7UA 3SE7A 4BAZA 3FAZA 1QG2A 2BMWA 3UMMA 1XCJA 1U8YA 1J00A 1UFOA 2ZJ4A 3MBOA 4NF2A 1EUCA 5KQLA 1RAHA 2XJ4A 5MGBA 1IXSB 4LKRA 1FE8A 2PLRA 2WJAA 2N75A 2D1SA 3N7AA 3AG6A 4GSYA 1I7PA 1SBHA 2J9XB 4YFYA 4CM1A 1NBOA 1WAMA 3DUWA 3KR1A 1KSGA 5D6OA 3V2UA 5G4KA 3ZWCA 4LRQA 5JC8A 3QTTA 1X7YA 4YJ2B 1Y1LA 4QOIA 2AJ8A 3JV7A 5L53A 2VSNA 3RRYA 2BJVA 5FX2A 1A9SA 4QT4A 4IDDA 4YDRA 4L9WA 5AVUA 4YP9A 3QKUA 4DEYA 5HRCA 4IMJB 4QDOA 3IHWA 5IKMA 1QTQA 1PRYA 4BX3A 2OG1A 4YPFA 3CA8A 2SKCA 5T41A 2H57A 2I7CA 2AVNA 2C5FA 3N07A 4J0CA 4QVKA 1YVRA 1J2YA 2V4UA 3RTBA 2HSEA 3AEZA 1E3JA 1T1JA 1M34B 3E22A 2WW8A 3HXPA 4HWSA 2RIRA 4TYYA 3G1TA 4K87A 2HUPA 4GL4A 4DA0A 3FPBA 2H1WA 4JYMA 1AO0A 2OHXA 2P11A 5JPIA 5JASA 1D03A 3LIIA 5IM4F 1KMNA 2XWSA 4BWVA 3PVSA 5BWOA 1LSJA 2WKRA 3U3RA 1UXHA 4PLGA 3VKFA 2BGGA 2CY0A 2CE2X 2BJHA 1Z9BA 2XGGA 5DZSA 4B85A 1E61A 1N2IA 1E2KA 2Q5LA 2ZIAA 3RIGA 1QDUA 4MWCA 4JR1A 5IDQA 1S8AA 3CR7A 4KV9A 2QTGA 4DR7B 4N5HX 4O63O 3RJ5A 1NN1A 1X1DA 2Q3HA 1UKEA 2H2WA 2WC1A 1ELOA 2JJQA 1T0HB 4C6TA 1IHPA 3ETJA 5FIUA 1V4NA 3VZDA 3DBOB 1G7TA 5G53C 2IIQA 4YJDA 4D46A 1TUBB 3PQEA 4BO2A 4ZEVA 1OYOA 2WEKA 2RI1A 4TLLB 2QLTA 1SHUX 3PC3A 2XSZD 3COYA 4B7XA 4NV0A 2HIMA 1NJSA 3NM4A 4AX4A 5BOSA 3LVQE 5AW6A 4W9MC 3G5MA 3T3DA 4BVAA 3Q4GA 3LT1A 1AS3A 3MJ4A 1NWHA 1F12A 2GZ1A 1NQTA 1Y34E 1IY0A 3HTXA 2YBEA 1M34E 1C5KA 2AJTA 4EFNA 3CR8A 4PINA 1DHRA 4EG0A 1VKNA 2XMSA 4GICA 1ORVA 3ZLVA 4R8KA 1YS6A 3LA6A 4A92A 1LW6E 2VJDA 3SOPA 4I5DA 2R1ZA 2O2YA 4LZWA 3DV0A 4TZ0A 2QA5A 2O8NA 5JEEA 3EY9A 2WU8A 3HPQA 1B41A 4EZEA 3SZ3A 1IOZA 4BS9A 1JG4A 4NENA 2P90A 1L7XA 1F5NA 3EB9A 2IYRA 3FMGA 3ZNNA 4M86A 4GRIA 2J0EA 3EGXA 3DBHB 5KYYB 1XRQA 3DDHA 5BUQA 3CW9A 4GP9A 3TI7A 3ZKAA 2OHJA 3BL5A 5E1MA 3FBGA 2O05A 5M3BA 4G5XA 4JUDX 4ARVA 1WUJS 4ZYYA 1LVUA 3DV0B 1KMQA 3H4TA 4I99A 4TWJA 3LHDA 5FD8A 4AF8A 3D54D 1MAWA 1VM6A 1Z25A 2ZM5A 3FUVA 2CNNA 1SXGA 3SXJA 3ZG6A 3C3WA 3ESCA 1YRLA 2QI9F 4RQUA 3WGLA 4Z5XA 1KSHA 3M8KA 3I9LA 3TOVA 4OFBA 3V4VB 3VSAA 5JPCA 4ER3A 4QUBA 5KJ6A 2I2AA 4ZK2A 1QHFA 1SUSA 1LI4A 2XW6A 3EGVA 4YLEA 5EZYA 4E5KA 3GFPA 4IP0A 3PRHA 4BVBA 3GCDA 2ZPAA 4IIXA 3THWA 5KTOA 1GU7A 3VKWA 1WBJB 2ONJA 1A5AB 2HLNA 4DV1B 2EZ9A 3G8YA 3JAKB 3LSYA 3GRYA 1UBHS 4X8LA 3UV3A 4F96A 2BMJA 4GOND 5T3YA 1SOVA 2XE4A 3D3WA 4X8OA 4AY6A 1DQRA 1M74A 4YCCA 3U5ZB 3INTA 4BPBA 2O1XA 4TKUB 5LJLA 2IH5A 1CUIA 4N5NA 5JBNA 1LZLA 4NONA 4BC0A 4NH4A 2XEXA 3U3DA 5GONA 2Q3BA 3LBIA 4AJEA 2NM0A 4JUCA 3IAFA 4MWGA 4YBZA 1L5VA 5ECDA 5JCPA 1EXMA 2P2GA 3ES9A 3FYDA 4OQEA 3SKXA 3QEKA 1IN6A 3LH5A 4EG6A 2CLFB 2P2SA 1RXIA 1WXIA 3P26A 5T6BA 4IHAA 1GZ3A 3AFOA 4DMCA 5KYKA 2C4TA 1POWA 3K9BA 3H1TA 3G7UA 2FMUA 1NQVA 3IR5A 4OGWA 4PS1A 5REQA 1N3BA 4U7GA 1R10A 4PHHA 3IVRA 1EP3B 4HX5A 4U63A 5B55A 3KFXA 1GJRA 4GOXA 2HQRA 3K0EA 1CR4A 2I03A 3X2EA 4HPJB 4BV8A 1AS0A 1GDTA 1JX6A 3EAFA 1D1SA 4RIFA 1ZOSA 3KHTA 1IMJA 5AI4A 1K5GA 3L40A 5A03A 2GEBA 3EDCA 4TYNA 3ND8A 5I45A 3TD2A 2ZBEA 3BH6A 4XYGA 1NW3A 2HIAA 4BKUA 4F5ZA 4Q4DA 1DAKA 1P6UA 3GFTA 4R81A 4CLOA 1BVHA 3MINB 1ZCAA 2B4QA 3G79A 4BMSA 3LX5A 3NM6B 4IOMA 3WJ7A 4C6HA 2EFDB 1HXHA 4IYJA 1GA6A 4D4GA 1XB2A 3PXUA 4F3YA 2GF9A 4G0UA 1J39A 1U02A 1E3DA 4RSRA 2IWRA 3COJA 2CUTA 1W93A 4FFMA 1XCPA 3DWGA 1JVBA 1TAQA 2Z2JA 3INGA 3PQ7A 3QHQA 4OBWA 2HPVA 1MZPA 2AR7A 4CM4A 2X4IA 5HKOA 4XX0A 1KI6A 5HZKA 2C61A 3QVLA 1N9KA 5EUCA 2HSZA 3IT3A 3KAJA 3SHWA 5CB4A 3PC7A 4LZPA 1P2VA 4OOEA 5AJVB 2V0GA 3HY6A 3TB4A 1M2KA 5HQJA 4ZV4A 5FBVB 5E7MA 1AY0A 1Q7TA 1HFWA 1XZMA 1NASA 4KQGA 4HDSA 2OOSA 3AO0B 2A1TR 2O5RA 3IP3A 2O3RA 2NSLA 2I9KA 5ALWA 5F52A 5I7AA 3MOGA 3QWIA 4BFZA 3TQRA 5IX8A 5KO2A 1M6VB 3BIJA 1FMCA 3S1LA 1HOXA 5D3KA 4LC1A 1YRQA 4U7HA 1A7UA 1P3JA 3AY7A 4H7PA 4S1NA 5EYPA 1TFUA 3WQHA 4L6IA 1NXSA 4NY1A 3HU2A 3AR9A 3IT0A 1DAGA 4INPA 5EIHA 5EZQA 2PL3A 4FE7A 3OPVA 1TKCA 1CU1A 1X3SA 2VOEA 1M0SA 3G0CA 3NORA 3PR1A 3TOZA 3V33A 2VUHB 4QA9A 2A9OA 1Z68A 5EHIA 3VHQA 2E48A 1J99A 4CCYA 1KSJA 4P0TA 4JXXA 1IZZA 1SXJB 4GMFA 1MOPA 1JBQA 2Y68A 4DUPA 2L42A 1K75A 2Y76A 5ALEA 2FSPA 2Y0CA 3ISTA 4KR7A 5KCZA 3E0XA 3R76A 3QEBZ 4AECA 3SM3A 4WRRA 3IE0A 2L19A 2R00C 1SG6A 1BSVA 1NBMA 2NUAB 1VE5A 2PXAA 1KPHA 1BX1A 2AQ8A 3DMPA 4EELA 4BKRA 3K94A 3DWIA 1X9GA 1XAGA 3N7TA 2G70A 5AVQA 1HDCA 5TJHA 5LPNA 4L9AA 2LRHA 2EWVA 3NC4A 1SO8A 3O2NA 3PR2B 4MMZB 5G3ZA 4DNPA 4JJAA 1ESNA 3T7JA 3CX6A 3R7AA 4AWXA 1LK0A 2F43B 1OV6A 3TL6A 1L5OA 2XRYA 2ZJ0A 3NFYA 1ZHHA 3WO1A 3RGGA 2CKDA 3B1JA 1DELA 1YCDA 2JFHA 3EXG2 3U81A 4F1KA 3OKAA 4IHJB 1YACA 4RFSA 2IV7A 1GGMA 4J1SA 4IZOA 3E6AA 1W36B 5I8ZA 3KDSE 3AY3A 3T5GA 3I9FA 1K8XB 2OLKA 3WWDA 1ZM4A 1KI9A 2CFSA 2IZ0A 5EESA 3ZZMA 2WAOA 1KJJA 1OXTA 3HJTA 2DWPA 2GKSA 3I0MA 1VJGA 4E11A 2F3PA 3VZSA 1PVDA 1BIFA 3WXMA 4L3WA 1R0RE 1YRBA 3A1UA 2QMHA 2QAJA 4G6ZA 2I76A 4MGIR 3QV1A 4EGSA 5L7YA 1RADA 2GZMA 3S2GA 2ZM6B 4HYYA 4AYXA 1VE1A 2ISQA 2UZ0A 2M6KA 2PTGA 3H17A 3T9DA 1YSCA 5FBQB 4XCVA 4BGEA 1EIZA 3NTVA 5CJ2A 1YCFA 2ET6A 2HO5A 5ILOA 3J7AC 1BXZA 1PG0A 3A4YA 3SZMA 2Y93A 4QUKA 4EJ0A 4KODA 1VLQA 3X2FA 2HRQA 1YVUA 2X77A 5JO0A 2VRCD 4P0PB 3BRSA 4L5BA 3LE8A 3IVAA 4FFPA 3MMZA 4IRUB 4PLPA 3V4LA 2JIQA 1CVRA 3ZWAA 4C20A 4ALJA 4OUDB 1S4QA 5A4DA 1JEEA 1BS2A 4XWYA 5AM0A 4ZTUB 2ZBPA 3W4JA 2CC2A 3HKDB 3DYBA 1IOVA 3PQ5A 1G8SA 1D6JA 3TLAA 1MD9A 1VSVA 1R18A 4YV1A 1O94D 5JD6A 3PUVA 5JYBA 4C2TA 1NHWA 1TQ2A 4Q4HA 3LT4A 3OKPA 3STUA 1B00A 3FI9A 1Z0KA 2W48A 1R6VA 2WINI 4C3ZA 2XRFA 5JOQA 5C3MA 4BIIA 2EKLA 4P54A 4H17A 4RF3A 1GZUA 2B21A 3GJZA 3BWVA 4BGVA 4BNNA 1I2AA 3GVCA 4MWEA 1IN5A 4N9QA 4EJSB 3WP1B 4DIUA 4EJMA 4S04A 5FP0A 2XMCA 4NK4A 1TEVA 2G9ZA 1D5WA 2VAPA 5CDFA 3U80A 1M2HA 4MIOA 4HEHA 5DHRA 3WQSB 1XDSA 1Z36A 2EBUA 2EF1A 2NAPA 2WJWA 5BQXA 4H6XA 2W4IA 4D9EA 1I2MA 3WGNA 2XA2A 3J81A 4QYIA 1IXKA 4R1PA 1IQ0A 3BXEA 1NE7A 1QIJA 5H3HA 5DXJA 1GXSA 2FYTA 3T9EA 5ICEA 4JR0A 5IUKC 2AI1A 2F67A 1TTTA 2MSDB 2WD9A 3H8SA 1TTQB 2B7BA 3V32A 2GCOB 4MK4A 3WGOA 4BFCA 1ZLXA 1RRCA 1I1OA 2H9AA 3VU3A 3QPAA 1EK6A 1FS4A 4S2UA 1KVSA 3VZRA 3AIKA 4DA7A 1MAAA 4YRSA 2BDUA 3ZK8A 2ZYDA 1XYVA 1YFZA 5AI8A 2H4XA 1VL6A 3LYAA 4GPEA 3U4AA 2QVGA 2XZDA 2GK3A 3RVRA 1BMFA 1F8GA 3PJEA 1FFSA 3OC0A 4YUWA 4HDMB 5T57A 4KREA 3FPKA 1ECFA 3HKEA 4M0UA 2J41A 2V7VA 3HDVA 3HB7A 2YYZA 4MTLA 5EJIA 4EY4A 5C80A 1AO3A 1Q95A 4Y0AA 5FPYA 3FCCA 2DHEA 3I9NA 4L02A 1BXKA 4UUAA 4I3GA 3ZVLA 1RTTA 5FUMA 5JSHA 2XKJE 1M6WA 2QTWB 3JAWB 5JR3A 3GMTA 1TKRA 5ES3A 5TPZA 1XI2A 1B8VA 1MB9A 1QHHB 4E5UA 1JH9A 5EVJA 1U2DA 1FDUA 3F4KA 3PKJA 1ZNYA 3PPWA 1P7VA 3U4HA 3KXIA 1W76A 2EJUA 1OIWA 3MGGA 5DGHA 3DG9A 2ACKA 1TQDA 3CWCA 3OX4A 5AW9A 3ZWNA 2V7QD 2GCNA 1K3UB 1T2DA 2BBTA 2GN8A 1JFVA 3IUJA 3JXEA 2HXGA 2F8LA 2H7CA 1E2IA 1YIOA 1SKQA 1FFDA 2COUA 2GRUA 3DCNA 2FWIA 2D2VA 2WJJA 4YP7A 5J2UF 4AKIA 4Q4AB 1Y1TA 1R5BA 2Q2WA 3KJFA 4WN3A 4TSKA 4RLFA 3U1VA 3R7NA 1REQB 1KZGB 1U2GA 1DOHA 1ZKDA 2HJGA 2NU7A 4QU0A 1KFCB 1XGKA 3EZFA 2OO5A 1F0NA 1JKFA 2XD9A 3VR1A 4PXAA 1WO8A 5FWXB 5H81A 1YA4A 2B82A 2ODBA 1QF9A 3RG2A 1B42A 4HUQA 4KYVA 4YCJA 4DREA 3GXOA 1Z63A 2ZYHA 2Z1MA 4LMBA 3T0FA 1IBMB 2F48A 3M6WA 5DLYA 3OFKA 3GL9A 3N3BC 4XIFA 4AB1A 1SB8A 4MVXA 2YTZA 4K28A 4RPJA 5EMJA 1I6MA 5THXA 2A2ZA 2J32A 1P5HA 5C1DA 5FB3A 3VNAA 3BTUA 3CV3A 2C4HA 2DVMA 3U3XA 3RHTA 1JSCA 4B75A 3WP0A 1MGOA 4HWRA 1JILA 3JPYA 4KGVA 3WHPA 3BRCA 3DEIA 3GP3A 4K3UA 1U0EA 2G76A 3AR7A 4OAQA 4LCEA 4J0QA 3HKBA 3EPHA 1E8DA 1ISJA 1NDHA 3P9QA 3CZ5A 1KERA 2M2IA 4O4IB 5BNFA 3DBHA 1WSWA 1ODSA 3VXKA 2LV8A 3X43A 3EVEA 3O4JA 4OGFA 2A5YB 5CM2Z 1E89A 3DL7A 3DT9A 4ZYZA 2ACVA 3DZKA 4O4HB 2R5NA 4HQ0A 5JWRA 4GKKB 2D3WA 1NOJA 2EBFX 1XU7A 2A4MA 4IXTA 1EEHA 4YMGA 5AQ1A 3GLHB 3H2SA 4FFSA 5EMKA 1P29A 2F3TA 1XJ0A 2D1TA 4WNCA 3GD5A 3QFCA 5EIBD 3R5HA 5C7OO 3AV0B 3I2IA 3TOXA 3SWWA 4WFJA 1H1DA 2DKOA 4JYCA 1IM5A 1TIPA 2VNSA 2ZWVA 1IQRA 1DC7A 4UU7A 1D4FA 2GD6A 1TKBA 3Q8WA 4ZQEA 4ZI5A 4CV1A 3TLCA 4DAEA 1CP3A 4FB4A 1LJ8A 6ABPA 2QZSA 4D82A 2P9JA 3EEQA 4RVFA 3ESZA 3IPCA 2XMDA 2RGUA 2PUJA 4WNYA 2ZRJA 3ZIAA 3L8MA 1PJ3A 3G0IA 4M8IA 4P7BA 3VH2A 2OP0A 3AOEC 4O4IF 4R3WA 5TT1A 4Y2JA 5FFNA 4O0MA 5B1SA 3CSUA 4UVIA 2GZ3A 4L51A 4ZN6A 2QBYA 1P18A 3B9RA 4BJ3A 3JARA 4DCOA 3P0FA 3KR0A 3K5HA 4W5WA 1UF9A 1FYWA 2K87A 2XCOA 4PU0A 4BZZA 5MHTA 2TECE 4MYCA 5EUBA 4H3KB 3X3HA 5CXQA 5I9LA 3KJIA 3RFUA 5LU8A 2ROQA 2O2CA 4PTZA 4IO0A 1I2DA 5FH9A 3BMCA 1ATZA 4MHTA 3ICEA 2FRDC 1ZVVA 1U1IA 2R25B 1CWUA 4CV3A 4BX8A 1Z7YA 3GUVA 4MTCA 4AMZA 2QUIA 1GUZA 2IX3A 4D7AA 2AK3A 1N6OA 2FEAA 3TZQA 4CCSA 4NE9A 4ZVRA 3WSVA 3GFRA 4PZDA 4WZAE 2H4YA 1Q0ZA 4Q48A 4JOCA 5A9TA 4YRKA 1I6WA 4JP3A 1XA4A 4EWLA 2VK8A 3K1ZA 2AN3A 1E4YA 3BWYA 3N3AC 1E62A 4H4DA 4QZVA 2VT6A 4UM9D 4PBSA 4V1CB 2YV4A 2XHEA 3TLGA 3G49A 4JP1A 2ZUFA 3OQMA 2BKUA 3K6SA 1WUIS 3LOUA 3LF1A 4J0FA 1JP7A 1T6NA 3R0ZA 4ZP1A 4YC7A 4P7FA 4RD2A 4WCVA 2OBMA 3CZ9A 1UAYA 4CL3A 3ZHQA 3VFDA 4D6YA 3BL6A 3E7WA 4MPDA 5GGYA 1JG6A 4AULA 4NMWA 1DIGA 4AMUA 4KR9A 2IFTA 4DZZA 1G5QA 3ER6A 1UBNA 1DTEA 2AFIA 2J5XA 3LD9A 2VDNB 3OH8A 4OATA 4QPPA 1NBEA 3S8YA 3OZBA 1KK2A 5HF8A 3RAPR 1Y3IA 3HL0A 2HBYA 4ND7A 3HZZA 3NWPA 2FDRA 1WSBA 2FFRA 1UR5A 2Q4EA 4Q6BA 3SG0A 8ATCA 2ONZA 4DN6A 1KMIY 2ZPUA 1RE0A 1TO6A 3FD8A 4FU0A 2BFFA 4YJ2F 4X1IB 3U61B 4ARSA 4MVWA 2WB2A 3IVMA 4UHJA 4FMDF 5CDSA 2DZDA 4UUOA 1NLMA 2BGNA 4DLUA 5TJ9A 3B60A 4RXMA 1CNFA 1HT0A 3D4BA 1I33A 3NALA 4PFJA 4UUBA 2H06A 4DV0B 4TZTA 3ZLUA 1XLVA 4AUNA 2Y77A 1E1YA 3RUDA 1F0KA 3IEMA 3EGWA 2QD4A 2WQ7A 2FF5A 1N2HA 4ETMA 1D2MA 2FPXA 4G0MA 4EHKA 1LKZA 3OBBA 5GP1A 3U19A 3I45A 3O4FA 4U0KA 3FYUC 2Z1DA 2A4KA 2O19A 1R3DA 3VJLA 3MZ0A 1JQLB 1GGFA 2QJFA 1YS4A 1Y9DA 2WRZA 3NPMA 3HWSA 2X42A 3NOOA 1O6FA 2WSMA 2NX2A 2H6EA 2XVZA 4RLQA 4E94A 3NZEA 3N53A 4CHGA 1T4MA 4ZVPA 3SJAA 1R4NA 2VYQA 4CKCB 2ORYA 3MRVA 3MTGA 3WGHA 4BGUA 3WOHA 3TTUA 4RIEA 4G97A 1DADA 2Q46A 2QNRA 3GAFA 1D1PA 3T61A 1VHDA 3LRXA 2QYHA 1Q22A 2VDMB 4L72A 4ZDJA 4M7WA 3I05A 1CEXA 3FRIA 3ZE8A 4PN7A 1GKUB 3FWZA 3MTBA 5F1PA 2QRKA 4CEIA 1JDPA 3RODA 4L5AA 1LNQA 2ZJ7A 4Q5IA 1NUHA 4JLNA 2BE7A 1G1AA 1U8XX 4A0GA 4YT8A 3OJXA 4AUEA 4UTNA 3KDPA 1ZESA 3LGSA 4P58A 1IBSA 2ASEA 3GLFB 1XELA 3ORQA 2WSYB 1GTRA 1DFHA 1YMVA 3DEZA 4YASA 4YP6A 5M04A 1LS1A 1SKYE 2O7VA 4GF5A 5KI6A 4YAIA 3KB8A 4HPXB 1M2OB 1QO0A 1C0IA 1SIOA 2JZOA 2BL4A 2CNDA 1U0FA 4OQNA 1Y8RB 2A0XA 2X5JO 3FFWA 4HQOA 3GLFA 1G63A 3RYIA 3N8IA 4B4OA 1BMTA 2WUFA 5KTTA 1J06A 1HZJA 3E7FA 1NSYA 4FDTA 3R6TA 4Z2YA 4EZBA 5B2EA 1CJSA 1VIAA 1I4WA 1NY6A 3E58A 1L1EA 1VMEA 2O7NA 5ALUA 1VSUA 3EVDA 3GHHA 4ISCA 1BXGA 2JDID 3MTQA 5DNDA 1V16B 3EEFA 4RGYA 3AEXA 1EP2B 1UBGA 2VSFA 4HNHA 4WBSA 1DKNA 4N5IX 3ND9A 4KUGA 3WLAA 1N7IA 2II6A 3DE7X 3O9VA 5CPFA 3ZGVA 4E5VA 5CURA 4XOIA 3G82C 1P2GA 4PM4A 4BMXA 4F4JA 3ZGZA 3QXJA 5EXPA 2P1ZA 3EVTA 3ZWBA 4C7KA 5JJLA 2XDQB 4CR8A 1P7WA 1Z29A 3IR7A 3OECA 4PZYA 1QYXA 2FSSA 5B6PA 3WK5A 3B7WA 3W2TA 4PLHA 3CH7A 1Y3CE 1PS0A 1Q1ZA 3Q7QA 4A5OA 1VCHA 3HL4A 3W3AA 1G3RA 2B20A 2WTNA 2C03A 4GR4A 4UAJA 2ZI7A 3K2IA 1CHNA 5F77A 4MRAA 5AW3A 1X39A 3WMXA 5AHRA 1OQAA 3GEIA 5TLSA 5ALIA 3DR3A 1L4KA 4RPCA 1FNDA 4EJ2A 5CXSA 2V8OA 3KTDA 4YCBA 4BP3A 1M1YB 2KJQA 1KZ9A 5CYOA 5DK6A 2HYDA 2X7XA 4YXWA 3NQ41 3MUFA 1CUCA 1MX1A 1T2FA 2EL9A 3FZYA 3LU1A 4LSWA 5KVQA 1ONNA 4ASUA 1FP2A 3F78A 5BW6B 2VJBA 5DP1A 3VR4H 3STTA 4KE6A 1JHAA 2JLZA 1PZGA 2J4FA 3IO5A 3EQ8A 4N8SA 3VUEA 4PNPA 5KSOA 1ENYA 1YCGA 4XM0A 3TLJA 4CM5A 2HT1A 2NVBA 2ZI3A 3NM5A 2J30A 3QK7A 3BB1A 2GA8A 3PTAA 1GZHB 1R6UA 3CEMA 4LZNA 2AXNA 5NULA 1OX4B 1OBHA 1P2DA 5DM70 5JZVA 2VSOA 1OTHA 4JL6A 4LJ7A 3DE3X 3ZXYA 1YB1A 3DC7A 3GGGA 5EJ7A 2VK4A 4C3UA 1B26A 4PHGA 4HDQB 3TRFA 4L0QA 4EI2A 3VYWA 2FVYA 1LSSA 3LWNA 1P9RA 2YVQA 3GJ4A 2ZQ5A 5COAA 5K3FA 1AU9A 2ES4A 2QRGA 1MO5A 2AE2A 3C1OA 3EAQA 2EEPA 1FLAA 3BXZA 3NGMA 4JLPA 3EHDA 4WNIA 3CKKA 5AP9A 4CQMD 2R44A 4QDTA 3O5AA 3RBVA 1DDGA 4HI0E 4H59A 3LLVA 3P0IA 3KU1A 5E9AA 5E9QA 1DO8A 3KKQA 4HTFB 4HXGA 1CCWA 1GNTA 4BNIA 1JR3A 2PT9A 1GPMA 1FP4B 4KO4S 4YJ3B 1RBZA 2OZKA 2DUWA 1ZLYA 2XUJA 3D1LA 3Q7SA 2EJTA 2LKCA 2XY4A 2ONYA 3TLKA 4PX3A 4PPNA 4BRWA 3LC0A 1S3GA 2GCOA 2GEDA 1E9DA 4PY2A 5G40A 3LLCA 4BNVA 2ZTLA 2I3BA 2D06A 5KJFA 1PFYA 5KVSA 4DNOA 3WMGA 1OLOA 3QE3A 1QX3A 5E6RB 1YZYA 3VU0A 4AMGA 4M8LA 4AROA 1IN7A 1EZ4A 1URPA 2QDXA 1L5FA 1WEKA 3D9QX 3EIOA 4RM2A 4X41A 1QK4A 2C07A 4ITVA 4Q9AA 4M38A 4Q39A 5AT1A 2DTEA 3EZLA 4N5MA 4K2HA 4BJ1A 1SWVA 4FFDA 2GDJA 4JS0A 4G89A 3R41A 4JB0A 4JQYA 1NU6A 4I1VA 5ER9A 1R4ZA 4C29A 1BE1A 1ISPA 4IGEA 4D97A 1V7ZA 1RWNA 2QAGB 4L5CA 4YJGB 4Z7QB 1GOTA 3HVUA 5D84A 5ALVA 3TXAA 5A6SA 3PJGA 4KJXA 2X8AA 4ER0A 4POOA 1HYQA 4MW4A 1PR3A 1QRAA 4LWOA 2H4ZA 3WKAA 4EG8A 4ZI7A 1US8A 1XU9A 2ONCA 2AZTA 4IUDS 3UPTA 5JAPA 3L84A 1JEQB 4HBGA 4BX0A 3VOTA 3M4XA 1UBUS 3PNBA 5E3IA 1JIXA 1V1MB 1T3HA 3KUUA 3A2NA 3KYJB 1VE3A 2P8SA 2QVCA 3TLXA 4E4RA 2ZSFA 3L0ZA 2PKCA 4X90A 2HCBA 1G5RA 2QY9A 2ZSDA 3BA1A 3BJMA 3B1ZA 4DIMA 2JAPA 4KXNA 5ES4B 3U13A 1EGMB 5FEMA 1UM9B 2B2CA 1B3RA 2BMVA 4BFLA 2J87A 1BX3A 2RGAA 2YOGA 4OHRA 4W7HA 1LS6A 5A62A 5BWMA 1ZHOA 4QC2A 4K88A 3E4CA 3AR8A 3OP4A 2WYVA 4ZOLF 4B3RB 4EHIA 1TKAA 3V55A 4PONA 1LK7A 2JFPA 3Q2IA 3RREA 3SZRA 4BMCA 3RS5A 3EGEA 1A5TA 2Y05A 2Y1LA 3O3MB 3OZRA 4TL7A 3TRDA 2BEWA 1KY5A 4UNQA 3OA0A 2XRMA 3AVOA 5EPUA 3UV7A 1Q0HA 1ULHA 4CIAA 5EL0A 3RYCB 1EUZA 1KETA 5KQPA 5IF9A 3HHEA 1E59A 2I1QA 4U4AA 1B0ZA 4JBHA 2QRNA 2I80A 1WJGA 2Y1GA 1KK3A 4A8TA 7MHTA 3G5AA 3FGNA 2GXQA 4HZUB 2FXIA 3RDPA 1CUJA 3KPYA 4BNZA 1F4VA 1SUWA 4PNHA 3I6QA 2V54A 1Q1AA 4N8DA 3DBIA 1GPBA 1W2GA 4LMRA 2NYAA 2OCYC 2IF2A 4DE5A 3CVYA 4NJOA 1G1MA 1TL7C 3B2QA 2J46A 1WY5A 1GPNA 3GY0A 3OLVA 4XYMA 3OFNA 4Y6PA 4FEAA 2ZETA 3ASZA 3VYTB 4JUFA 1XQVA 1CE8B 1NUSA 4KW7A 1GT6A 1UDBA 4PAMA 4TYWA 3CNBA 4KMMA 2I6QA 5AOBA 1CS4C 4D3YA 5FWYA 4Q01A 2Q0XA 3T54A 3VTFA 5FV4A 3R8CA 1V7CA 2EWWA 1HM5A 2ZRIA 4BO6A 4C0JA 4JU8A 4Y6GB 1QHEA 4ID3A 2QAGA 2VPIA 2RGNA 4R51A 1CZUA 2CN1A 1ICEA 4ITUA 1TJ3A 3GJ5A 1ML3A 5T67A 3S27A 3WRVA 3W7VA 1HA3A 1Z6QA 2ZJ5A 1ZNXA 3M6FA 3PWZA 3UFXA 5JXHA 1ULAA 4R8MA 1U7DA 3IEKA 1PZXA 3KL2A 4OKIA 1XG5A 4QREA 3SZOA 4X3CA 1SXIA 3IEPA 4WK6A 1XA3A 2RIPA 2ZE6A 2CVFA 1DB3A 4PR0A 3TNLA 1KQPA 1NN0A 1RW4A 2YXNA 3RBXA 4FSXA 4S35A 1IULA 4PAGA 1OTYA 5TQ2B 5DI9A 2E4XA 1J8DA 1ZH2A 1K06A 4Q9HA 4KR2A 4IHJF 1MO4A 1N0WA 1Z6ZA 2E5FA 4X61A 1WBDA 3BHMA 2DECA 2D5CA 1EUYA 1QS0A 4M0DA 4D43A 1T1IA 3T3GA 4JIGA 3CONA 4YALA 3IS3A 4UUPA 4HB4A 1DAMA 4XQGA 5JMPA 2QQ5A 2FY8A 1VBMA 4WZAA 3D4OA 2ATXA 2YZ2A 3F90A 4D98A 2VEDA 1DQSA 3KXDA 3QXGA 4LBZA 4CLOB 5HZMA 4LF4B 5KQRA 4R31A 4O4JA 1D4ZA 1ZUNA 4CF7A 2NT4A 4MQLA 1T13A 4LDJA 4WIAA 2E7ZA 1CUFA 3AWDA 2IA5A 3W8NA 3A6EA 4KN9S 5CLFA 1OLUB 2K2WA 1Q3KA 1E2UA 1GAJA 2EG5A 3OUTA 5L3QA 2FDCA 1ZU5A 3EPJA 2RGNC 2WWFA 5DO9A 2HIHA 3DBVO 2WVGA 4OM8A 1IJEA 2Q41A 1TZBA 3C2QA 1C8BA 3KQMA 4KFRA 5ALRA 2BYTA 4RVGA 1XA0A 1R6TA 4ZV7A 3G02A 1UAGA 3OY7A 3G7NA 4DEXA 2EFGA 1L7NA 3S1AA 1SIBE 4U2KA 1PEAA 1SK9A 3RYTC 3WLHA 1SAYA 4EG7A 4IFIA 4UHDA 1EI9A 3C7KA 5JCOA 1QIMA 1EE1A 1SHTX 5CAEB 2VCHA 3D81A 3H9JA 5ITZA 1GNRA 3DLAA 3SJZA 1YUBA 1OD6A 3P2IA 3U3MA 2QTVB 4AJ4A 1RXEA 5EKTA 1EWQA 3WGIA 1OXXK 3E35A 4RV9A 3IPXA 5TQVA 2XB9A 2PG3A 2EEZA 3NBYC 3NFRA 3W90A 1K66A 4KXUA 5AKXA 3V9PA 4MWBA 5CH3A 1PWEA 5KWSA 4GGMX 3RYHA 3WLMA 1IZ7A 4UHHA 1CIPA 3I83A 2IUTA 2PVCA 3FSGA 3LTEA 4WOBA 3NTLA 4PLWA 4WZAB 5ARCA 3RRMA 2N9UA 4WTOA 1GQYA 4YR7A 3U31A 2F1HA 1RC0A 3CB2A 1CEYA 5DWVA 3DWFA 4WZZA 2H2IA 1W0JD 2JDIA 3T9BA 3HH8A 3HU1A 3UK2A 1HH4A 2I2BA 3AZQA 2UXCB 4NPHA 3NHLA 4O2AB 4DR1B 4HFMA 2VBFA 2JCSA 5EP1A 3L3BA 4IH4A 2RONA 4KFTA 3O91A 4Y3UA 1NNUA 1V6CA 2NXEA 3M4NA 1HL3A 4KXYA 5ESXA 4AG3A 4EKYA 3M6IA 2IBSA 5L9AA 3PE3A 4I6GA 1VJCA 4R3NA 4EO9A 2FZKA 5EJ2A 5AW2A 1GWNA 1UKCA 2DC1A 1WB6A 2PX4A 4TQ9A 3SSNA 4FI3C 2FWRA 1JDBB 3C3JA 3WL5A 4KPUB 2CJWA 4JENA 2NIPA 3F9RA 3E4DA 1W0KD 1RNLA 2DLCX 1CRLA 2ADOA 4M0MA 1RU3A 2P4UA 3T1HB 2R8RA 1B8PA 3AFNA 4ND6A 4PC1A 1V0JA 1N3IA 1J5PA 3HM2A 3EX7C 4GLJA 4K9SA 3K70B 1EG7A 5AVYA 4XE5A 5I7HA 3K05A 3B1WA 3KSUA 3UMSA 2OHVA 3WYFA 1UZNA 3BUSA 5AOCA 4LHYA 4DC0A 2JJYA 3H2ZA 3PEVA 3FJ1A 4MDEA 1E6UA 1I3OA 5DTEA 1Q20A 5CVCA 4DMGA 1R8JA 1T25A 4W5NA 3C6YA 5FTNA 1WCIB 4YMLA 5PGMA 2I4IA 3E9RA 4TV9B 2WHEA 1OBVA 2YVAA 3CUSA 4QE3A 5TS2A 4KGZA 4DR2B 5E6SA 4WNAA 1XRRA 1C14A 3FPLA 4I8DA 5E38A 4FZVA 5KHOC 1GUFA 2O8FA 2FCRA 2WA1A 3ST7A 3TMYA 1W49A 3WAJA 2O8EB 2W8ZA 1MAHA 3J81k 4IG4A 5D3MB 3VKUA 1CF9A 2C82A 1MW9X 3LBFA 3IDQA 1GFIA 1Z6PA 4QSHA 3TTWA 4P8RA 4TV9A 3OPNA 1M0WA 3HXLA 1FRFS 1JH8A 1RHUA 2RMKA 1QHIA 1Q91A 1ZA2A 1FNCA 1Z2OX 3UCEA 3UQYS 4EHDA 4AQ7A 4UPEA 4UBKA 5EFZA 4FI3F 4EVRA 2HSWA 3I01M 2GZRA 5ILGA 4CPDA 5JUWA 2H1IA 4MI6A 1WF3A 4E5YA 4YAKA 5CFLA 1DSSG 3VV3A 1L8QA 3BG5A 3CZPA 5ELLA 1CIJA 1VHQA 4CVNA 2FEKA 3RC1A 3TTVA 1XQXA 1N2CE 1TVKB 3NTUA 1XC7A 1M66A 4YRDA 3PC8A 2O8DA 2GD1O 2OZEA 4MV8A 4M8KA 4YX9A 3A7DA 3SFVA 2FKAA 3F5QA 5AK4A 5CEFA 1IAQA 2A1UB 5DDIP 4EG4A 1G6HA 5JAZA 3RC9A 5AKHA 4CM7A 4PICA 5KCMA 1KH3A 3TQSA 4D8XA 5CEEA 1D09A 1E3IA 2ZAYA 2GHTA 5T4EA 1UWVA 5FFFA 4UXHA 3TWOA 3VNUA 3GYBA 3H8VA 3M4YA 4TVKA 3B9QA 1K4YA 1L5HB 2D2FA 2KSQA 3IAM1 3DAYA 3IBFA 3NDRA 4FLFA 4N7RA 3HA3A 4NOMA 4YDSA 3ZK7A 1J4AA 3H8WA 4IDAA 4QO7A 4BB5A 3U5TA 3NVMB 4Y2XA 4D8WA 4QEDA 2Y1WA 4E6PA 1Q15A 2GD0A 1RM0A 2NSJA 1X1QA 2E89A 1UANA 2P75A 2WZBA 3K0CA 4MS3A 5K1ZA 3W2IA 3ZHCA 3DDOA 4BTLA 3WKCA 3DNMA 4DDUA 3DMYA 2GM3A 2W2KB 1IB6A 2F3RA 3E23A 3EZGA 4XJSA 4YDQA 5KNCH 3HDQA 4RDIA 3CTMA 1GZ5A 5A71A 1DKPA 1JQBA 3VR6H 5CPBA 2CXNA 5FL7D 1SOMA 5B1IA 4D9BA 3BYZA 5AD1A 1A8UA 3UOGA 4IGIA 3WGGA 4MINA 3TR5A 4AKHA 4C0BA 2ATIA 2WTEA 2ZT5A 3GEEA 4JLBA 3BOSA 4ARAA 1TLTA 2NTVA 4OQQA 1JIVA 3W7AA 2C0QA 2HY7A 1QXSA 2C4KA 4MUFA 2X41A 4RA6A 3FSEA 4J6EA 4DGSA 1GPH1 2YHBA 3LP8A 2RBKA 1QZTA 2DHRA 5DISB 1NLFA 2ZUSA 2FX5A 5B1YA 4GVLA 5JCJA 3AUFA 5F98A 4IVRA 1EWTA 4F97A 4AJJA 1NNEA 1YV9A 2EU8A 1CNMA 2HNKA 5CIQA 5HK9A 2IITA 3THXA 3EJWA 3FDFA 5IANA 3IR6A 5ALNA 2GI4A 3AB7A 3YASA 2BKLA 3PDCA 1HGXA 4HQLA 5AXDA 2H5LA 2I33A 4EHHA 1SU7A 4BO0A 1QGDA 3JQ8B 4KSCA 3ZIDA 5JI2E 1E0SA 9LDBA 2PE5A 2FLWA 5EEGA 3UJ9A 3WKDA 1L5ZA 2JD0A 4JBIA 2FSVC 2H4HA 4OI1A 2QOEA 1FL9A 1T1RA 3O83A 3R0IA 3H4VA 2DQKA 2QN8A 5HDQA 3G9XA 3T41A 1FOEB 3X2SA 3SHQA 5U9CA 3NANA 5IFLA 1CFJA 3D6VA 2P2NA 3FYTA 1J9ZA 4DDTA 5FL7A 1U3DA 2FWNA 3ZY2A 4CFZA 3TKYA 4R2MA 1SQ5A 2YHIA 2O2XA 2BM0A 3G68A 3HCEA 1BEZA 5FRDA 2QTAA 2QN2A 4RJKA 3DQZA 4H4CA 4YGYA 5BSFA 2ZJ6A 1V1JA 1XOIA 2QX9A 4AQYB 1RJWA 3PUJA 3JWGA 2GTPA 5E4FA 2ZRCA 1EFCA 1VE9A 2OVBA 4MB0A 2WU3A 4Y9SA 2JGAA 3T0IA 1KZYC 2ORIA 4XLLA 1HKHA 3A9TA 3FXAA 3V5NA 1DRKA 1X80B 2P79A 2Z5LA 3DMHA 3AEYA 1GZ6A 3FWNA 3MUEA 4MVJE 4Z0HO 2VSQA 4I0WB 3TBFA 1OFGA 2FGKA 2XYRA 1TMOA 3C6BA 1R16A 3NIFB 4OCZA 4DVJA 1A4XA 2MU1A 1A9TA 2RH9B 1FFAA 4HAZA 1XXHB 4JP8A 4O8CA 4TWAA 4EI8A 3ZZ1A 2ZW9A 3T5MA 2A94A 2W42A 3AHEA 3JQ7A 5SYNA 1LPPA 4Z49A 4YCAA 2FN9A 3BCSA 2DFTA 5TDHA 5JWOA 2G4CA 3ZCVA 1EVYA 1A95A 4S0ZA 4UAVA 3LX8A 1CF2O 1R6XA 1PT8A 2GF2A 2FW7A 2A14A 2AH5A 3CZAA 1WOYA 5I9SA 5J63A 1E2HA 3Q1LA 2C00A 1G60A 1GG9A 3HU3A 5AVKA 4A7PA 5EGNA 5JMOA 2CCJA 4QULA 4WPGA 3MPUA 2VZ8A 4BVJA 2IH4A 1P73A 2H7VA 4RVSA 3V46A 2FDXA 5ETJA 4YUZA 5ALDA 2RAVA 3HUUA 4JL5A 2O8BA 4KO2S 1MIHA 2V97A 4GU5A 4PO3X 1LTQA 2I4RA 5AWFC 5E2IA 1DUIA 4X6UA 4ZVOA 3O26A 4KHZA 5K3OA 3BT7A 5K7SA 2W2NA 2QX7A 5DNCA 3BAFA 5I3ZA 4MLCA 3K5WA 2PUWA 1IJFA 4ESHA 4F6LA 1T26A 1XCOA 2PGDA 3DDUA 3NDJA 4Q1FA 1OROA 2SCUB 3WK4A 5IKEA 4XFJA 4KE9A 1RD4A 2O8BB 1JL3A 3DDWA 1HG1A 2VQ3A 5DCWA 2JCVA 4CF4A 2VBIA 4DCTA 5DNUA 4WL0A 1KOFA 1N25A 3BQMB 3MCWA 4M89A 1KF0A 4AY2A 1LU9A 3UQZA 1XL1A 5CM8B 3N0XA 3UJDA 3VTZA 1X19A 4WJZA 4E0BA 4FNMA 1JDZA 4RY9A 1A9PA 1UC4B 3OO1A 5F9HA 2J0UB 2XX3A 3K31A 3R3XA 5C3UA 4KE7A 3SHVA 5CG1A 4UW9A 4WKGA 5FKJA 1E77A 4D9GA 1RWMA 2BN4A 1A76A 1H4TA 1LX6A 5MFPA 2V0CA 1G41A 3O8DA 1ISSA 3ITEA 4HH0A 4A6PA 5ALPA 3HA5A 1VGVA 1QIGA 1UZAA 5LBTA 4CN8A 4BN5A 4U7JA 2F3QA 2Z0MA 1M5UA 3GK3A 4FZ5A 2B8NA 1QP0A 1RYYA 2VNIA 2X2PA 3GLKA 1GPUA 2XYPA 3HJNA 3NO4A 4LY0A 1SVLA 1R9JA 5CT6A 4I2NA 1V4VA 1WHSB 4ZYLA 4DB4A 4ZALA 5KYWA 4D9IA 3H2HA 1AKWA 2B2NA 2G6BA 2JJ2D 3CUUA 2O4CA 3C4JA 5IVHA 1JS1X 1H4VB 3RT9A 2WHPA 1W59A 3GN1A 1A9ZA 3L5OA 1TT7A 3PLAE 3KB2A 4AVYA 3OZIA 4OM7A 5DNEA 1FDSA 3D3EA 3WNCA 4QUDA 1IIRA 1QKJA 2PS3A 5DNAA 5A4KA 3H18A 1BOOA 1UKAA 2CD9A 3L2OB 3MJVA 4TL9A 2ZIVB 4ZJUA 1VKHA 3ESXA 3LX6A 3QPDA 5HILA 2QI9C 3KYDA 4PO1A 3OESA 4LFCB 4DLNA 1E66A 4KMSA 3BQ9A 1DBRA 2NV0A 4ZANA 4X9XA 1MB0A 2DSNA 2WMOB 3P9IA 3LLMA 2H3HA 1RI5A 3KSZO 3NWEA 3RSOA 1ORHA 3EXHA 2BCJQ 1DUSA 2GAOA 2IPNA 3LAWA 1KA9H 4RK6A 2W6PA 2ODTX 3SI7A 1C7JA 3COSA 2IPAB 3C0KA 3JQGA 1G21E 1UPFA 3GC6A 4M3NA 4HLQB 2A33A 3A3YA 5D8DA 5A5GA 2EX4A 3L8CA 3N8KA 4ZC1A 5KU1A 1KMHB 4YHBA 2EJCA 3IKLA 4MJLA 3V1KA 3LT5A 4J76A 3T34A 4YRMA 2YHUA 2VJMB 4GLFA 4NL4H 3PDHA 4EHNA 2PX8A 2LDBA 2FP3A 1N57A 4UMFA 1AZTA 1XHEA 3WLPA 2VTKA 1SUPA 1W1IA 3FFXA 3B12A 3PE4A 1V8FA 4QNRA 3IAEA 3LCVB 1KTIA 1MOZA 5K0JA 2GEJA 4B3JA 1H94A 1E9SA 4MPJA 3KU4A 2W71A 1W4CA 3L05A 1R15A 2ATEA 3BA6A 7REQB 8ABPA 1PUXA 2VR1A 3LTNC 2QTHA 3QW2A 1N2GA 2WOJA 1A5SB 3UAZA 3MINA 4EL0A 2GBCA 3BWCA 4UU0A 1DX9A 4W82A 4JA0A 1ONBA 3IFSA 4G09A 4K9QA 2A1TS 3IOEA 5EP2A 3W5VA 4Q3OA 3EMBA 2JKYA 1J8MF 3DKIA 3G0DA 5AM3A 3M4ZA 1QX4A 3C16C 4HGYA 2G1JA 2GAIA 5KOYA 3NC1C 4WOKA 4ZARA 2QTVA 3VTKA 2J67A 2BSQA 4M9QA 1KYIA 2G1AA 3FLEA 2GLXA 2ZJFA 1P1RA 4PANA 3EQ7A 3KUDA 4JXJA 1IMOA 4UTXA 5DGTA 3V1YA 2PWZA 1JLKA 2QMOA 2HCTA 5KHLB 3WHLA 3TM5A 3FLBA 3QSGA 3ABSB 3BMNA 2R1TB 4KXQA 1K86A 4Z3KA 1CNEA 1WZNA 1QVAA 2R79A 2R97A 1MF7A 3L49A 3H1PA 4F06A 1QUEA 5B1EA 2DWOA 3NRBA 2A86A 4F85A 5P21A 2PKEA 2YUTA 3MTDA 4UBIA 2QUKA 2QLLA 4B6OA 1KFEB 4DQDA 5IZ4A 4KK4A 2QQ0A 4KKXB 5FJJA 3PP8A 3OD5A 3BN3A 3CG4A 2HRCA 4Q4HB 5SY9A 1JEYB 2I91A 3AQIA 5J2TA 1SC1A 1ZN7A 1I0ZA 2IXGA 4Y8VA 3VPSA 4BV9A 2A1IA 4LF6B 1CQPA 1O97C 4FKBA 4P7GA 1J0DA 3RUHA 3UIEA 3GFBA 4N03A 3TBHA 2H7YA 2QG6A 4V0RA 4ZCSA 2VJCA 1L5MA 2PJZA 4CT5A 4H16A 3EUFA 3ZS9A 3SN6A 1BVRA 4GKVA 3WNVA 2P6OA 2BTOA 4MRMB 5AYVA 3ZNOA 5A2QA 4LJ4A 4BO3A 2QPLA 5IMSA 2WQ6A 3DZIA 3A1EA 2GFHA 1V6SA 4ALLA 5HNKA 3IQEA 3A37A 5J43A 4WBNF 4KE8A 3TL3A 2AZMA 1T29A 2C2MA 2ZI4A 2BP7A 4LVOA 1TVCA 1R00A 4I9HA 1IXZA 1PDWA 1TUBA 3VSEA 1C1DA 4DSNA 3H2GA 3L79A 3O82A 1I3MA 2QUAA 1U0SY 3CISA 1YR3A 3DNFA 2R1TA 4DCVA 1U7ZA 4FW9A 1IRIA 2JLXA 3ED1A 1S2LA 4BLSA 4Z53A 1SOAA 4WFKA 4OLBA 4DLBA 2XR1A 4GI7A 1NVDA 1ZZGA 3NDPA 4I3HA 4DV6B 3FVQA 4QGAA 5EGSA 2KW5A 1YL6A 4EHBA 2IHNA 2VPQA 2AIRA 1GQRA 1ONSA 2H5EA 4FT4A 2C9CA 2W90A 4L75A 4RZQA 2PWPA 3CXRA 2J9FB 3Q3JB 4AN1A 5HKKA 5LZ4A 2XWQA 3AF2A 3ITDA 2YWXA 2WYUA 1X2BA 1CRQA 4JZKA 1ZM3A 1WWKA 1LBTA 2WJGA 4GQIA 2OFXA 3CKLA 4K9MA 4U6QA 3L6DA 3W5SA 4UCXA 5K8LA 4JI7B 4I4TB 1D6MA 2HLPA 4NS4A 3UMJA 4KGXA 1I7NA 2GNAA 2P9TA 1JYFA 3ZTWA 4GYWA 4FOTA 3CPEA 4MRNA 4FQ8A 5ADWA 1M6YA 3KQTA 3F6CA 3M89A 3B3FA 2H0QA 4ETIA 4D02A 3GLQA 4LY6A 3W8FA 2ZYIA 3L8EA 2NWQA 4RD3A 5LBIA 5SZJA 2VHWA 3VMFA 5G0UA 1EHYA 4UFNA 1CJVC 1PZNA 1XTKA 4MHSA 5DGDA 4C30A 3WFIA 5IN4A 5DNVA 1HG0A 3WYBA 3EMDA 3UC9A 5EXXA 2MYNA 3DQQA 4LEIA 2CUNA 3I5AA 4KQMA 1NW4A 3OQOA 2OHOA 1AHHA 1ZNWA 4DA6A 4XUGB 5JBIA 5GJBA 2ZYRA 3HEMA 1H2RS 4N5LA 1JFTA 3REGA 4XJXA 1UDAA 1ZWKA 3WB9A 1FRZA 2J3HA 3KKNA 4QYXA 1FVHA 1Y33E 2L2QA 3IMKA 3A1FA 1OXKB 1KH1A 3AUUA 4MVJA 4R2HA 5BV0A 3KV3O 3NOQA 1NXTA 2BKVA 2I62A 1JHUA 2QD2A 4KI0A 1A9XB 3VPAA 4BDSA 4LJ5A 4M1MA 4WFQA 3ZJTA 1T4DA 2YCLA 1RWWA 3V42A 1P4SA 3BB4A 3LY5A 4IW3B 3UWKA 5JAUA 2HADA 2OLJA 3DUFB 3RHSA 3SZUA 4BU0A 5FTLA 1T5IA 4BBZA 5DRTA 4CMIB 5JSYA 1WXWA 2VPXA 1RZVA 1MQ8B 4II2A 3UATA 1K5DA 3HY4A 4ZVVA 4H08A 2FGJA 1NW6A 3AL3A 4ALNA 4GKJB 3AY0A 3KJEA 3OE7A 3WLSA 2JARA 2CHVA 3A26A 5CT8A 5L40A 4L74A 2B6HA 4QUGA 4L5YA 3EXG1 3WGQA 1E1QA 3MUOA 3N76A 3WMFA 5HKLA 4OYYA 2NSYA 3VVMA 1IOLA 5JAQA 4YJHB 2D0OB 2VDOB 4W5QA 2HKIA 4CEHA 1P1KA 2WAAA 3OPMA 3GEPA 3PZBA 4G4JA 1XJCA 3QWBA 1MB4A 5BN4B 1BHJA 3DL0A 4XPZA 5LWHA 3CLTD 2C29D 3WR5A 3F5SA 4P3XA 5AFSA 4CKWA 3NU1A 3NVDA 1RYMA 4R6XA 4L6AA 3V2HA 1BFDA 3NCHA 3D5TA 4UXIA 1K08A 3ADBA 3AG5A 1XZBA 4B32A 3PI6A 4YUVA 3ETEA 2V5AA 1DPGA 1G19A 5HKKD 3ZXXA 2OXEA 3B53X 1HNWB 3CIFA 5KSWB 2NVUA 5KYVA 4QBIA 2Y9PB 1ADFA 1W2HA 2XUZA 2ZRGA 3OOHA 4AKTA 2FEPA 4EQ6B 3PGLA 4MO9A 1P2UA 3M1LA 3PPYA 3WISA 4DIKA 4UPDA 2G36A 1PR5A 1GGVA 4ENTA 2PLAA 3ZI4A 3SP1A 1MH9A 1S2MA 4XJTA 1XCGB 4QRIA 2GN1A 3H3XA 2MYTA 4Q4JB 4WX2B 4NWIA 2OV1A 1PN3A 1YRHA 2FWJA 4Y0NA 5T64A 3DVAA 3JD3A 4KIGA 2KYRA 3QVMA 1X77A 1X70A 2R48A 3OOJA 4RXTA 3MSXA 1VYTA 5ESWA 1NXQA 2UZ3A 4UJ5A 4NTZA 4ZQBA 2DFPA 2Y99A 3GAZA 3CZ4A 4P92A 4B3HA 5BORA 3W3ZB 2PEZA 2TMKA 1FYVA 3GZJA 3NOVA 1SU6A 4TWIA 4LQLA 2OXIA 1S7CA 1VJRA 5AJXA 1W4RA 2R65A 2YZGA 2ZUWA 4AC9A 4MQ6A 1CC1S 1L3BA 2R3SA 4YP5A 3RVLA 5J3JA 2VYVD 1YQUA 3DFMA 1CVIA 3FJYA 3OUZA 3OZXA 1JFLA 4CIVA 4E08A 4F8YA 1II8A 5CT4A 1R9NA 1COZA 4X45A 4ZT3A 2QB5A 4L73A 5ED4A 1EFAA 4LDZA 3RVSA 1OFUA 3IIMA 3TO5A 4G1VA 2QIPA 3IOMA 3OCCA 4R41A 2ZTSA 1SZPA 1GGEA 4GOKA 1KKUA 1UFQA 3EG9B 3LKDA 4LTNA 3W9BA 4M83A 3EBOA 1L4NA 1TXGA 2B3TA 3ETNA 3NNDA 3EUEA 4TXLA 4ZI3A 5J2UA 2EX0A 2G9RA 4PVCA 3A9SA 3EW9A 2X6RA 1D1TA 5AJTA 1JEOA 3TOSA 1N2CA 5HA5A 1RBMA 2AFHE 4RSHA 4CM6A 3ILVA 3FLMA 4LVUA 3B1VA 3I9V6 5BN1A 2B69A 3W2FA 4MA4A 1QJCA 4BMZA 2B4TO 1GAQA 3U0BA 3TNFA 3D6MA 1MEJA 3O0DA 4MV7A 4LK3A 2CMFA 4YT2A 5K5EA 4LOJA 1H9BA 3ERCA 1XRNA 5LYJA 3L1IA 2ONKA 4Y67A 3UJ3X 4FD2A 5KUTA 4CL0A 5KEIA 3PUZA 3PNYA 3C8ZA 4J2HA 3QELB 3IHKA 2CHQA 2D13A 2WFLB 3T8YA 1YNOA 3ZI0A 1M76A 3OX3A 1WS6A 5LZ8A 3EEIA 1JKMA 4MV6A 1EJ2A 4J8PA 5CW1A 5TF0A 4P2GA 1N2OA 2GR9A 2P9ZA 3Q15C 2G1KA 3PC2A 3BFKA 1M67A 1VE7A 4CLXA 4S1VA 4HO1X 3C43A 2ZYVX 4PTLA 4HMPA 3UK1A 3OQIB 2Y1FA 3NATA 5JDCC 4N7JA 1VA5A 4JEHA 4B81A 2ZPTX 3DTVA 1RR6A 2FUG6 3F3YA 4RWZA 2WLSA 5IAEA 3WMWA 4AF7A 1OLXA 2ZIXB 2R6R1 5EOVA 1UC9A 2FPRA 4J1QA 4A2CA 3AR3A 2YZ7A 1XMQB 4ALMA 2C95A 2VRCA 2E82A 2PIAA 2IVZA 3R8XA 3DFZA 4OREX 3ZV5A 3SR3A 3RPEA 1UC8A 3OFSA 5JS8A 1VL8A 1SB9A 1I3LA 2XTJA 3E7XA 2J5BA 4BV3A 5A5DA 3K0HA 1T5TA 3OTHA 2WSBA 4LI3X 4J16A 4BKQA 1QRSA 4U2EA 2F8SA 1ETHA 1XZQA 2XKAA 4BDTA 4BWFB 1EMDA 1NBMD 2Q62A 3BGVA 3QG5A 5C8ZA 5JU6A 1OYVA 3QI2A 2X1HA 1Y42X 1I2BA 1T5OA 1Z8FA 1OTXA 2BBOA 5LMUB 3FR7A 4EGFA 3QKSB 5EZSA 4ZO6A 3W5IA 5J58A 1EK5A 4II3A 4Y0VA 4L4YA 4DXHA 5HZGA 2PGLA 1OE0A 2CGEA 1N5RA 4J2OA 3NHAA 3OY2A 4BKOA 1QO0D 5CG2A 2ANBA 3H2IA 2J7PA 2UXDB 2C3YA 4EW2A 1RMYA 2JIPA 5MDHA 2BFAA 5C34B 2C8LA 4TM7A 3L7AA 1N8NA 2G9VA 3HJUA 4DCUA 4DRZA 2ODPA 2NVOA 3ELUA 3NI2A 3O0TA 3DD1A 4UNNA 5H83A 4WJLA 3PD0A 2F8TA 1KP3A 4XX1A 4RJJA 5A02A 4TKMA 3KSDO 3GJ0A 4Z1MA 2GVZC 3RVDA 4MARA 3UGKA 4RHEA 1ZG3A 2HA7A 5C7LO 1Z5WA 1F2VA 2YY5A 3FCYA 1TFRA 7MDHA 3ADCA 3GXBA 1D0SA 3T5BA 1E1CB 5FWNA 3VR4D 4AS2A 1EX9A 5SYMA 4KQCA 3R7WB 3SICE 4M9CA 5JHHB 3R5TA 1H2AS 1XROA 5JH7A 5A7FA 2C4NA 2O2HA 4F71A 3SDBA 1Y81A 1RQXA 5FLEX 1Q0UA 2XGOA 4CQNA 1IM8A 1DT3A 1H2WA 3O3NB 3WMRA 3HEAA 4KVAA 4G8JA 4C03A 1NSTA 1Y9ZA 3FZEA 3EXFB 2O59A 3K2QA 1CJKC 1JRLA 3FPFA 3QEMB 1NIPA 2FG7C 3O9ZA 5IJ9A 1U5BB 4BNLA 4EFDA 1CYEA 2XCLA 2YYAA 2Q9AA 4OXIA 2QMEA 3OQIA 5KTNA 5LNK1 3EVAA 1ZDMA 4XVRA 4G5YA 4Z0TA 2YMLA 5CB6A 5CFRA 4ZK6A 2XE8A 1RI2A 2DY0A 2QN9A 3EC2A 1QU2A 1KS2A 3KD3A 1PGQA 2RI6A 5BN4A 2YVUA 1EUQA 1LI7A 2BM1A 2Q5EA 2XUDA 2PS0A 4GP6A 5CDUA 1RPZA 2PH3A 4M99A 3RSFA 3TCXB 2XRZA 1FIUA 2FPUA 3RM3A 3SKYA 4KEAA 1IDN1 1SQ6A 1TI7A 4AUMA 1DPFA 1JA1A 1YIAA 4NSNA 3WWCA 4UFPA 4IKOA 3JAKA 3EXHB 1Q21A 3RFTA 3BE4A 5IAGA 2CT8A 1SBYA 4G37A 1BCSB 2VYCA 3EQ2A 3P2JA 3SR0A 5MN4A 1JFSA 5CYPA 2KHZA 2R6CA 3PDUA 1D4AA 2PK3A 4LE1A 5FYQA 1BW9A 2BHTA 1EM8A 5FQOA 2PGOA 5L6LB 3ZGOA 5FOTA 4KHPB 3Q8XB 3QVVA 4JD5A 3U7JA 1GPWB 2PL5A 4XDYA 3H6GA 5AI0A 5G0TA 2DWCA 1E60A 2IY8A 3LLUA 4NHOA 4EGCB 2LCIA 2FZLA 2G67A 3OZEA 2YXBA 3OIWA 4NCBA 2UVDA 3K2EA 3PBKA 4NJMA 4CE6A 1YUMA 2NAFA 2XXJA 4F6CA 5GZ1A 4BNHA 1QYVA 2ZE7A 1C1YA 2ZROA 1XTSA 3AR2A 4XR4A 4ZAZA 3QZUA 5CDTA 1DU4A 4RCYA 3UM9A 1DG1G 2E18A 2Y1DA 5HJ2A 4BUZA 5EVCA 1JHOA 4KLZA 1O6GA 1U1CA 3M6MD 1I36A 3OE1A 3PGKA 4HZUA 3HXOA 2Z5FA 4D0RA 2AR0A 4F9GA 1LBSA 2DE0X 1K0FA 1L6IA 3H5IA 3G17A 2QGFA 1AG9A 1QSGA 1T9KA 3U26A 5IJXA 4GI1A 4TL8A 4MQFB 1XXLA 1BCRB 3AXTA 3DZDA 3F5DA 1H0HA 4I4CA 4OJMX 1EP1B 4R7GA 3O8LA 5BURA 3OETA 3R2JA 4K26A 1PE0A 1W4LA 2HDHA 3CH6A 3MS7A 4I66A 4TS3A 3PCXA 3AY6A 3AZPA 4NBKA 3WTBA 5DI3A 3WDKA 3Q3IA 5BNIA 1QHNA 5BOVA 3Q2OA 4W5RA 2P62A 1LRJA 2YIVX 1T2NA 4N3GA 4I1RA 4B6SA 5KOIA 3QU5A 1F4PA 4ZDWA 2E3JA 3O95A 5LR6A 3CF2A 4JL8A 4NNJA 1CY0A 4XGKA 2Z95A 4B7CA 1B0UA 1C3LA 4RFSB 1IZ8A 1E9BA 5ERXA 3UT5B 1YU9A 1Q1NA 3DPIA 1T9ZA 1E2BA 1YD7A 2FKNA 4Q1VA 4LV6A 4TSFA 2YQ5A 3RYHB 1WDWB 1FNNA 2ZUEA 1H65A 2AG0A 3H0KA 1GHTA 1SC4A 3PG5A 2X7HA 1K6XA 2O8CB 2F3SA 4IO1A 1RWPA 4L5JA 4BZQA 4WACA 1JR3D 2PHZA 3MAAC 1AKNA 4RF4A 4YMIA 4Q4CA 5TIIA 3WA7A 4GXRA 3A8TA 3KEMA 1G4AE 3F8TA 1ZD4A 1IHYA 3IO3A 4KVGA 5DHQA 3TR6A 4BQIA 1EP9A 1FFXB 4M1OA 3IESA 3BMNB 2FXVA 2X0FA 2EP7A 4EB6A 2C9YA 3R9KA 1EDZA 1JA0A 2CLHB 2VQ6A 1RAIA 4G23A 4X94A 1TU4A 4GDMA 4J3FA 1DKRA 1JU9A 1A8HA 1XCBA 4LQDA 4RHCA 3UXMA 2ZCVA 5ALOA 3U17A 4JWKA 2VP4A 1J24A 5CA1F 2WUWE 1MT3A 1L1QA 3QMWA 2CNWA 5FUQA 3DW1X 2WYHA 2XSZA 4YBRA 1JG3A 4YJ3A 5CGZA 4MWSA 1LRLA 1AVTA 3JQ8A 3OURA 4OH1A 4S1PA 3NBZC 3L0YA 1RRGA 1UXGA 4MJ7A 4CWAA 5FA6A 1CQIA 1CZLA 2BR5A 2JK0A 2IHJA 3AHJA 3AIMA 3WIDA 1FDRA 3HA7A 4IS3A 1MTOA 2C5HA 1SCUB 3GUCA 5A5VA 3WRXC 4UPVA 2G77B 3KWMA 3KYCB 5BVGA 4V0MA 2G3YA 1PJ2A 1BGVA 2FQYA 2MDTA 3ZWDA 4B48A 1T36B 5IBRA 1ODJA 1M2WA 1PF7E 4FONA 4ADSG 4MP3A 3MJFA 1V41E 1YONA 4V0ME 3URMA 3CVWA 4QRHA 2Y92A 3C8HA 2AEEA 4HNAA 1X92A 4Q82A 5EP4A 3ZBTA 1KP2A 2PUEA 4O3FA 4W6QA 3ZDFA 4K9LA 3TGLA 2GQ0A 1E1RA 1IFXA 3H1FA 4Q7EA 3DONA 1CLUA 3F1LA 2IX9A 3OM9A 2AC2A 3OE4A 2WU1A 4FTWA 3PWSA 3P9YA 4L1KA 1M6NA 4EW1A 5HCNA 4CL2A 4EENA 4N49A 5HBGA 1FFXA 3FCSB 1XZLA 3FUWA 1LY1A 1AKMA 1E2EA 2C5EA 2JRCA 2NZUG 4GMGA 3GJYA 4LYDA 4OYHA 1KAQA 2NQ2C 2XITA 4JX9A 4HLUC 5FBLB 2V7EA 2ECKA 3OCWA 1BD3A 4QYIB 3H8JA 3SHOA 1GV1A 2BMEA 2YYSA 3VNQA 4LJKA 2ATCA 4CN9A 2Q5OA 4LWPA 2DU8A 1RLTA 5LA6F 3SE0A 2C8JA 5JD5A 3NIDB 3FZQA 2OILA 3EYAA 1WCV1 4LMPA 4O2BB 4HD8A 1WA5A 5IH3A 5JSKA 5I01A 2V7QA 3VC3A 421PA 4OX9Y 2RAUA 3PXBA 1N78A 2HU2A 3PFKA 5DX0A 2R5WA 4O29A 1TRHA 4XVCA 3BVPA 2Z8XA 1TJYA 3CM0A 2WNSA 3BILA 4WKCA 1J7KA 2FB9A 2P2YA 3OLYA 1NVEA 4GXNA 1Z4KA 4JLKA 1RFLA 3RG8A 4U39A 3SX2A 4F91B 2Q3CA 1IB0A 4LAFA 4FFRA 5DBFA 1QWSA 1XLTA 3G8BA 4IQFA 2HCRA 2XZTA 5JNVA 1KIMA 5LQUA 1MGPA 3N8DA 4LV5B 4HYEA 4PXSA 4LE0A 1H6AA 3ZWQA 1O95C 2C5LA 2EAUA 4DIEA 3CLRC 3VZBA 1DZIA 2HREA 3AKZA 4IIDA 1RTKA 3KIPA 5FO0A 3AUSA 1WZCA 4RDXA 3K30A 1VKZA 2P9FA 5EMLA 3OBIA 4C7JA 3SMQA 3EBLA 1F8FA 1V6AA 1MPTA 2LP4Y 5IW8A 2BF4A 1E2MA 1FUKA 2FRXA 2NPOA 1RRFA 5EMMA 1OZFA 5FPKA 1Y8AA 2M98A 1T9AA 2V6GA 5AVOA 1BVUA 3FHCB 3B8HA 2UYYA 1AQJA 1V3UA 1WW3A 1DNPA 1ZX1A 3GLGA 3EOBI 2QUJA 1AZSC 3W8EA 5GVSA 3MAGA 1XEAA 1X80A 2NU9A 4G65A 3S8MA 5BR8B 4HB0A 4E7OA 1KC1A 4C7OB 4JI2B 4PWZA 2H0RA 3LYLA 1M8GA 2AEMA 1P1IA 2H16A 1E1KA 1O89A 1RYBA 1IYZA 1ODCA 2XMZA 4K3VA 1P9WA 2ZBDA 3F6PA 5HTKA 2HMUA 5A05A 4YIHA 2G0TA 4IIGA 4B4UA 1S1CA 3D8TA 3HLKA 3UUFA 4MHOA 4BV2A 4PNZA 1JDVA 3CCFA 1GPLA 4AK9A 3OMWA 2DQ4A 2ZWOA 1BX0A 4DF3A 5KNCA 3DBRB 4F4DA 1I24A 2W2QA 1I4LD 4FHCA 5ALKA 3TLYA 4F9EA 1K8ZB 3AEQA 1H23A 1E5TA 5AM4A 3D3QA 4IQ8A 2JIMA 1PFUA 2Q5FA 2YC4C 4Q0MA 4AJOA 2JCYA 5B4UA 1T0BA 2YW9A 3BXGA 4MS4B 5B53A 3SU8A 2AC4A 3EFOA 3P8ZA 1MAVA 5AI6A 1EVIA 1CR0A 1OZGA 1YMUA 4M4SA 4UFOA 2NU8B 2HU5A 1EFLA 1ZK4A 5I3CA 1OOEA 2VWPA 1BC5A 3K96A 5G41A 4FGZA 1A1SA 1PW7A 4ER7A 4YPOA 3INYA 2O5EA 2PL1A 3K09C 4KXVA 4V38A 1QHHA 2O4UX 4R2JA 1U80A 1PT6A 4JKYA 4FN4A 1U7PA 3DBLB 4X7RA 4WHMA 1OZAA 3ADOA 1C0EA 3E22B 3QXXA 3ZUPA 4AJLA 5DLEA 4B83A 4QJ4A 4I4TF 4C78A 2VF7A 4R2KA 2HHLA 2D2XA 1R0BA 1TC1A 1I01A 4L27A 3GUZA 3AGQA 2WUVA 3G23A 1UBSB 2YR0A 1RM3A 2ZEJA 4HS9A 3TUIC 2J6BA 3ZQ4A 2F1OA 1G8KA 1HKUA 1XALA 2ZQZA 4UJ3A 3WK8A 1V5EA 2J08A 1NP6A 3KOZA 3W5AA 4QELA 3G2HA 1BW9B 2CL6X 4GX0A 3R5KA 3OKCA 2XF2A 1BMDA 5BSTA 3BSYA 1AQNA 1Y8CA 1P1BA 1HDGO 2O20A 2Q1UA 4CMKA 2X5XA 2I4LA 4AJIA 3PJRA 3WIBA 4EATA 3WV5A 1QPZA 2EFHB 2UXBB 1XTVA 5I7SA 4BNFA 2IU4A 2XWBF 4NYJR 2ZRMA 3GI1A 4WK4B 2QYOA 4HV4A 3NMUF 2XA1A 3CVXA 3A6PC 1U2QA 1S5PA 2R6GA 3G2IA 3HI4A 2X5KO 5I47A 3PUKA 2JHGA 2AFRA 1CY1A 4L3OA 5E2BA 2RHGB 5JSUA 2P2CA 2HHCA 3HLTA 3UJ7A 2RGYA 1N6RA 4TTAA 2VSYA 1VHLA 3C6KA 1VYUA 5DYGA 1TYCA 3D0QA 3RCBA 4FGUA 4KK3A 4NYMQ 3V8QA 1GZ4A 1VLJA 3KPVA 3IQHX 4LF9B 2JD1A 3QQPA 3ND5A 1EFVA 1SUDA 2ERYA 4RH3A 4DLKA 3RAFC 3GVHA 1U98A 4BN4A 4ZHQB 3L7DA 4A91A 1HOTA 1FTQA 3EIFA 4X1OA 1ZGGA 3D2CA 4K5QA 4TKZA 1ZUWA 5BVGB 3ZEIA 3GMDA 4YAWA 3OSUA 5T4HA 4KWTA 3T0GA 2P3OA 1RJ9A 1SRRA 2R0QC 3JWEA 4XIIA 3E3NA 3I8XA 3GW8A 1UPBA 3A4MA 3DOCA 2G5CA 3ET5A 3EZ9A 1F0YA 5KNCD 3QPWA 1U8EA 4IVQA 2HM7A 3A9CA 3W6UA 1BWQA 4J1NA 2Q07A 4YVFA 3U7HB 1G6OA 4PLYA 3DT8A 3A1NA 5AJYA 4IDNA 3QNUA 5CA0A 3K7EA 5FAKA 4W5TA 1YR2A 2VZLA 1XVAA 3GT7A 2X0EA 1AKVA 1AV6A 5IT9A 4Z99A 3DV9A 3AYXB 4OVKA 1S2DA 4YAFA 1OT5A 1SCAA 4PC3A 5BNZA 5JDIA 5JEDA 1GTJ1 4FUTA 4PZZA 4EA7A 5FOVA 5A4FS 1WXXA 5GM2A 1V26A 2HIGA 5C8YB 4QOJA 5CA1B 5CEJA 2XTZA 2I4MA 1FUYB 3I92A 2ZRNA 2NUTB 3E5HA 4QPDA 2VJAA 4E5SA 3ZWWA 1BRMA 2IKQA 3OCZA 3PC8C 4DARA 2W37A 1IRXA 5T8KC 2ZUTA 5LN1A 1LD3A 2A8YA 1NQOA 1X1SA 4EG1A 4G07A 3EXAA 2C5GA 2ZT7A 5B37A 1BDHA 2WFAA 3L04A 1CFZA 3ICOA 1XSEA 2BR4A 2VS1A 4JBXA 3QBJA 3F0TA 3UPUA 4LHZA 2V98A 4NKRA 4RTNA 2GCPA 1VHWA 1KZ4A 1K8YB 5FPPA 3TQCA 4QGSA 2DUUA 3FMFA 1A88A 2D0DA 3A27A 4O02B 5BWNA 4A2QA 4TQAA 2Z2ZA 2J7PD 2AFHA 1FFEA 5FR2A 3UAOA 4BGDA 3O74A 3N74A 1T0JB 4GPIB 3A2LA 2DTDA 4U2GA 5H80A 2J5QA 2BE9A 4REQB 1OLSB 1Z16A 4HYQA 2NNLD 3I2FA 3JVUA 4I14A 3WMEA 4N48A 2XV1A 5J1SB 3LQYA 4NCNA 3QTLA 4AN0A 5HVNA 2O3JA 3DFFA 1JLMA 1YQQA 2OPBA 3N2KB 4G24A 3P9PA 3L18A 4LV8B 4E5MA 2ZVJA 1OFHA 4M76B 2X76A 3N2IA 2AI3A 2B9VA 1S2NA 2HF9A 2Q9BA 3KSRA