1ST2A

The three-dimensional structure of bacillus amyloliquefaciens subtilisin at 1.8 angstroms and an analysis of the structural consequences of peroxide inactivation
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
275
structure length
272
Chain Sequence
b'AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNDVINSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN BPN'
publication title The three-dimensional structure of Bacillus amyloliquefaciens subtilisin at 1.8 A and an analysis of the structural consequences of peroxide inactivation.
pubmed rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 95
structure length 272
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1990-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1st2A00
4AKTA 1SCAA 2Z2ZA 4MZDA 3DE5X 1C9NA 1KDVA 1BE6A 3VV2A 1SCDA 3DE1X 1KDZA 1WMDA 3EDYA 1SN7A 2HPZA 1SIUA 1GNVA 1BE8A 5FFNA 2Z57A 1YU6A 4WOCA 1GTG1 3VV3A 1BFKA 2SNIE 2ZWPA 4DJ5X 3GT4A 1A2QA 4LVOA 1YJBA 2XRMA 1XF1A 4YN3A 3LPDA 3DVRX 3Q5GA 4KPGA 3F49S 5B1DA 1Y3BE 4KB5A 4I0WB 4ZARA 4JP8A 3I30X 1JEAA 1SBTA 1CSEE 2TECE 3CO0S 1AH2A 1TM3E 2XTJA 3QMPA 1R6VA 3AFGA 5FBZA 2W2NA 1TMGE 1LW6E 1R64A 4LVNA 1GA4A 1SBHA 1SBIA 1THMA 1PTKA 3P5BA 2QTWB 1OYOA 4C3UA 1SUDA 1Y4DE 1TK2A 2P4EA 2Z58A 4CFYA 1WMEA 4ZOQI 1WVMA 3DYBA 3VHQA 2PWBA 1P7VA 2X8JB 3H42B 3I37X 1P8JA 3WIUA 2Z2XA 4Z2AA 4BWGA 2WV7A 5AVJA 1Y34E 3D43A 1TM5E 5JMOA 1ZVKA 1CNMA 3VSBA 1Y3DE 2SICE 4RYDA 3L1KA 4OMCA 3BPSA 4C3VA 3VTAA 1Y1KE 3DVQX 4H6WA 5AMXA 4GI3A 3WHIA 1TM7E 2DP4E 3TI9A 3DE2X 5JXJA 3WQBA 3F7OA 1V6CA 3DVSX 2IY9A 3BX1A 1Y9ZA 3CNQS 1C9JA 1OT5A 1SVNA 2HD4A 1NLUA 3WIVA 5JXIA 1KE2A 3DW3X 1AU9A 2WUVA 1GA6A 5JXGA 3GT3A 4CFZA 3DDZX 3DE6X 5AQEA 1S02A 4AKSA 1AK9A 1SIOA 3VYVA 3DE3X 1YJAA 3UNXA 1Y48E 4DWWA 2SECE 1GNSA 1SBCA 1KE1A 1P7WA 1DUIA 2W2OA 4HVLA 4H6XA 3EIFA 4NE7A 2ID4A 1S01A 2PKCA 3OSZA 2GKOA 1UBNA 1HT3A 3GCWA 1WSDA 2PQ2A 3I2YX 3SICE 1Y3FE 1GTJ1 1SCNE 1S2NA 3EE6A 3HJRA 3DE7X 5JXHA 1MEEA 1OYVA 3LXUX 5FAXA 2ZRQA 2WWTA 1SCJA 1GT91 1BH6A 1SCBA 1TO2E 4KG7A 3AJ8A 1AF4A 3F7MA 2WUWE 1IC6A 1GCIA 1Y4AE 4K8RB 1GTL1 2W2QA 3A3OA 1EA7A 2PWAA 3DW1X 3PTLA 4DZTA 1Y33E 2ID8A 3GCXA 4WOBA 2Z2YA 2PRKA 5CW1A 1DBIA 5ARDA 1KDYA 1SUCA 1TM1E 4NE9A 2Z30A 1SUAA 3QTLA 4OV6B 1GA1A 1BJRE 1VSBA 1YJCA 1BFUA 3I34X 2SBTA 3AJ9A 3DE0X 2DUJA 2W2PA 1SUPA 1SPBS 3TECE 2W2MA 5K7SA 3LPAA 3LPCA 2E1PA 1SBNE 3TI7A 1SIBE 1T1IA 3ZXYA 1T1GA 1TM4E 1NDUA 2PYZA 1ZVJA 1AV7A 1C3LA 1V5IA 4M1ZA 3A3NA 3Q40A 5ARCA 1C9MA 3BGOS 1R0RE 4OMDA 4H6VA 5B1EA 1NDQA 2Z56A 3PRKE 2V8BA 1IAVA 1AVTA 2B6NA 2ZWOA 2IXTA 4HX2A 2G4VA 1PJ8A 1T1EA 3QFHA 2DQKA 1WMFA 4NMXB 1Y3CE 1PFGA 2X8JA 3DWEX 4J94A 1AQNA 2PMWB 1SELA 1MPTA 4FONA 1TECE 3ZXXA 4CG0A 5AVKA 3A3PA 1PEKE 3SQOA 3D9QX 4B5LA 3T41A 1SH7A 5ARBA 2ST1A 5I9SA 1EGQA 1ST3A 5SICE 1Q5PA 3DE4X 1SUBA 1TO1E 1SUEA 1ST2A
chains in the Genus database with same CATH superfamily
5ESWA 3I62A 4LPKA 1V48A 2PUHA 2G1KA 2PS0A 1VLMA 5CVJA 3DB2A 1TF5A 3PICA 2P9TA 4QEDA 4R1QA 5LBIA 1HY3A 3L79A 4YJDA 4EJMA 3QOWA 2AWNA 3EHEA 3OQBA 4AJ2A 3LZDA 3DO6A 2A5YB 4YMIA 3IEXA 2QJWA 3BH7A 4FFPA 4BWFB 2Y1CA 4LECA 4BV2A 5B2FA 2H1OA 1YZGA 4LQ4A 5FO1A 3EDYA 4ZQIA 4W6ZA 1ZVVA 4RABA 4Q3KA 2C7RA 5E6UB 1J25A 4CLXA 2IKQA 4P81A 4UMVA 2GPJA 3BMQB 2PGNA 3KQWA 3T5MA 2IU4A 1YQEA 4Y2VA 1WXQA 1W1IA 2ASEA 4BQPA 1U3TA 4TS1A 1CNEA 3RUAA 1UJMA 4RV4A 5E6SB 2Q2VA 1BE8A 2WPDA 4UFOA 2GO7A 4EZBA 4ZU1X 3SHVA 4FCTA 1KYZA 2Z83A 3C4QA 1VG9B 4O2RA 3RJ5A 1H8HD 5L4NA 1L4GA 2WJ3A 2OHFA 2O8FB 1YK1A 3ABOB 2VBFA 2BFWA 2WD9A 2ZJ2A 5LZ5A 1WUJS 3U80A 3RLIA 4UPDA 4YCMA 3N2LA 2EZ8A 1W35A 4BLOA 3IUEA 3FNBA 2W4IA 4CCWA 1KY4A 5KVSA 1SXIA 4CQMA 1NONA 1EIWA 5H4HA 3MC1A 3LL4A 1BH2A 5ALEA 5AH0A 2PXCA 2GYUA 4FEYA 2ZI5A 3KELA 2ZJ6A 3I6YA 4M8KA 4QARA 3D8RA 1KMHA 1QGUB 2O2JA 4Y7CA 2P2LA 3SZOA 2X23A 1DAKA 2JA1A 1ZZEA 1DDIA 2B4KA 4LVUA 1K27A 4BLPA 5I4BA 1Z0SA 3G89A 1TRHA 2XD9A 3UUWA 1NHWA 5ALNA 2YQZA 4L7VA 4X90A 4MGYR 4WD3A 1CZKA 3WNCA 5TARA 3GVCA 4C7OA 1CUDA 1RE1A 4A5SA 3BRQA 3AL0C 1WW8A 1C4OA 5JE8A 4GBJA 5THKA 1FX0B 2QQEA 5EUQB 4N9QA 2EKDA 5BXQC 5CLQA 3TN7A 4BDSA 3Q41A 1E2LA 5EGNA 3KJQA 3WLHA 1H3NA 5KNCA 4BY9E 5T3UA 4BNIA 1LD3A 4CTMA 3RNLA 1LW6E 1PFYA 2IEYA 3NWBA 3L18A 3HYNA 2AS0A 2BBWA 3FIJA 4ICIA 4ML3A 4AROA 3VPDA 3PD0A 1Y9EA 3SC3A 2UDPA 1JKJA 1I5OA 3LSTA 3W8FA 1Z2DA 4K46A 3TXYA 3A10A 1M2KA 2CFSA 4RD6A 3LO5A 3ZV3A 2R87A 1N5JA 1L7EA 3V4SA 4QOIA 3WJ1A 2NU8B 3RS0A 4C3UA 1Y6ZA 5C1OA 5KTOA 2W11A 2WZQA 4AY2A 5C8YF 3M4YA 5KYKA 2G9QA 2IPLA 5FOTA 3S8YA 1DVRA 4KE6A 4J1SA 4YO8A 1QH0A 2EWVA 4ARVA 3OM8A 3L0DA 2ZSHA 4F4IA 5CDTA 1GO2A 4G09A 1O9BA 3I9V1 1GHTA 4ES6A 4S2EA 5E7QA 2IH5A 4J43A 3LRPA 3CLTD 4HATA 5C4IA 3AYXB 5LNK1 3LH5A 2QL7A 1YE8A 5IF3A 5E7JA 2FF5A 1OBVA 4HLQB 4DMUB 3FF1A 2O2IA 3I9NA 1WUYA 2PWBA 4GZLA 4MCAA 1YFJA 2YNMA 2J7KA 4FNOA 2VLIA 3V1KA 1U9IA 2XUAA 1EVYA 3HM2A 4JHLA 4FFBA 1P1FA 4IS2A 4U3JB 5TGDA 1N1DA 3VNSA 4Q9JA 3HA3A 4NG5A 3WKCA 2Q62A 1LRKA 2HA0A 4XQ0A 1B0AA 1HYBA 4IUCS 2DT8A 3DKIA 1L7RA 3ZHYA 1U0RA 4BUJA 1JMYA 5A2GA 2FW7A 3OPMA 1JIJA 4LJ4A 2AOWA 3H6KA 1J2JA 3K1YA 1V45E 2EIXA 5ADUS 4I7EA 2XB2A 4DV4B 5KTRA 3ODPA 3OO0A 5EXPA 3IOMA 3WGZA 5J1SB 5AKZA 2FOXA 1KZ9A 5JNTA 3QQ5A 4HEJA 2R6FA 2NMVA 5L7YA 3FCXA 3PKIA 3IAM1 4A27A 3BPSA 3I5AA 2OWDA 1A72A 4DFDA 1YVEI 4UAGA 2JANA 3F5QA 3LA8A 5SZKB 4J6EA 1C8VB 1UBRS 3VC3A 4UDXX 1P0PA 4E09A 4IJ5A 3UUEA 3ISVA 1RM0A 3ITEA 1QCYA 3KKQA 2D1TA 5LDGA 2IUFA 2PL3A 2WKRA 3SK0A 4E3ZA 3PFNA 3RJMA 1PGQA 3C1AA 1BHJA 4CT5A 2G1UA 1YB5A 1KY2A 1KO7A 3AY6A 3HV2A 1V2GA 3K6KA 3L9WA 1RRGA 3M49A 3RK1A 1WDMA 3SXUB 1RE0A 3ASYA 2FNAA 1BEEA 3A9TA 3EUAA 2ZRHA 5KYGA 2OYRA 1BS2A 1OA0A 1X86B 5E0KB 1E79D 4BLQA 1P5RA 4BZPA 4IRUB 4MVJA 1TEXA 1GGJA 1BCSB 3BGDA 1YCHA 4H77A 1A5ZA 4PC3A 3SFTA 3F7OA 4R1MA 1HKUA 1Y9ZA 5LP1A 3K2BA 2C9ZA 3IP9A 3JQGB 1DS6A 1DDOA 4F46A 2BFAA 4AG3A 1U5BB 3SIXA 2ISSD 3C41J 3WFJA 1TL7C 4GOOD 1FFHA 3ULKA 2ORWA 3AESA 3WK6A 2RGNA 1HDRA 4BVFA 4DUGA 2GD2A 1CQPA 4WFQA 4B33A 3MTGA 1NASA 3FDXA 3IRUA 3FR7A 4FMPA 4LTDA 1M2GA 4N7RA 1IN6A 1NQVA 2A92A 2QRZA 3GEIA 4JMPA 3U2QA 1X77A 2YY7A 2GK3A 2YWRA 1B6GA 4YJ2B 9LDTA 5IAEA 1S8FA 2Q6IA 4YEDA 4ZAZA 3L4BC 3VMFA 3P4XA 1XJ5A 1TU0A 3MN1A 1RHJA 1SXJD 2CWDA 2AOXA 3O3NB 1ISJA 4PHFA 1NRXA 2Y0BA 4RA6A 5A71A 4LOIA 3S1AB 2JFPA 3EPKA 1SKYB 2B20A 2MT9A 1IE3A 2ZBVA 3ZDBA 3KDAA 3JR3A 4QTXA 4PCAA 2P0AA 3EIQA 3PIRA 1LA2A 4BQQA 4DMFA 4AKSA 1Q7GA 4PC6A 5BW6B 2XMQA 2PSSA 3D3KA 4BNZA 2VUHB 3C7CB 4P54A 4G5FA 3MTJA 2EQAA 4DJDC 10MHA 1US8A 3HLKA 2YYZA 3FGNA 4M9QA 3QEAZ 4XX0A 5ALMA 1Y8AA 2G82A 3NT5A 2VFAA 1ETUA 5U4QA 4BS9A 1QS0A 1FRFS 1G20B 2C2OA 4JP2A 4X71A 4YAOA 5IFLA 2AZDA 3V1MA 1WUHS 1XYYA 2FCRA 3V8QA 5I8WA 1ZHOA 2ZSAA 3BXFA 5EMKA 1G8FA 2EJUA 2AKEA 3SX4A 1QYCA 1T8PA 3PDCA 3OE1A 2NO1A 2QUJA 1MOSA 4Z3DA 2Q9BA 4O4JF 4ISCA 4ARIA 5BXYA 1A8UA 4A0SA 1MXHA 4MWGA 4ZCLA 3KUDA 1DJQA 3RODA 2HLDA 2GCPA 1E2EA 4PHHA 2CKDA 2ONCA 1AKEA 1LY1A 2QRJA 3PC8C 4D8XA 1BX3A 1UKAA 2YDXA 4DLSA 4G1CA 4COOA 2DFVA 1S2NA 4Z4FA 3NAZA 1P45A 2B3DA 2IEBA 1G17A 4XB6B 1M2WA 1Z8HA 3L8ZA 4C0BA 4PZZA 5HILA 1Z6QA 4JY7A 1CDDA 5DFAA 4JC5A 3TOVA 4B79A 4K26A 4R1LA 5CGQB 5TR9A 3VUFA 4WINA 5HQJA 5IXYA 1YA6A 1K06A 2IGTA 2PZAA 4ZQEA 4BFCA 1DBQA 2RI0A 5HJ7A 3PXEA 2HYDA 4TKLA 5DLDA 2I4NA 5EJAA 3GZTB 3KXKA 4J4HA 3IIKA 1ZXLA 4NCJA 1H1LA 4QIHA 3SU8A 1I3MA 2MR6A 5B1HA 4EITA 5A62A 4Q34A 5CK5A 1ZESA 2HF7A 4C22A 2IDKA 2WWTA 3FOAA 3AX6A 3VAAA 3DFUA 4BNJA 4MWEA 1QG2A 1DG3A 5B3AA 3AF0A 5JQGB 2IBTA 1HR0B 1GT91 1JS1X 1NXVA 2OXTA 3F6RA 2QW8A 1RWXA 2JFGA 2NPIA 4ZREA 4F5YA 1YMQA 1P2VA 3VH3A 1EJBA 1RNLA 3MOGA 4YB8A 2XHEA 3OOEA 3NGXA 4RUKA 1C7EA 5B1IA 4IIGA 3CVVA 2ZBUA 3KQVA 3OQ1A 2L2QA 1Y8ZA 1CY0A 1XUOA 4PAGA 3UMYA 5B58T 2WF8A 1WB5A 1Z7WA 3VXKA 3PEEA 1Z0ZA 1J21A 4LNHA 4XJVA 3FPBA 3TD6A 2J0SA 1PVVA 3DT6A 4HRAA 1NM5A 2RBGA 2OOKA 2B3TA 3N86A 2B92A 3ZN2A 1AKRA 1TDJA 4DV0B 2F00A 3CKLA 2FLVA 3L49A 1X7HA 4TL7A 4D3ZA 4NXMB 1S1CA 2BWJA 1AUOA 2EYQA 4J91A 3PFHA 1Z5OA 2PL1A 2VO1A 1O94C 3R8FA 3VH4A 1MEJA 4HQOA 2R4QA 4WCFB 4E12A 2HBQA 3NHWA 1H2RS 2RGEA 1OT3A 2JVIA 4PVCA 3G2HA 1J0XO 3ZWXA 4TYWA 2Q5LA 3MJSA 1KP2A 3HRIA 3WAJA 1WVIA 1ZLXA 1OFUA 4NFYA 3M9WA 1T4DA 1ZP6A 2ZVQX 3EIHA 5BUZA 2ZBRA 1RAHA 4H17A 1S9HA 1BQ4A 4NS1A 3HR4A 5TPZD 3ZUGA 3W5VA 3DKPA 2VP4A 2PZFA 2W2MA 2IZ7A 4HFJA 3FKSD 4Y6OA 4OM8A 4BNDA 2BKLA 3BXOA 4IKOA 1X1QA 4ZYUA 1EX6A 3F98A 2I62A 5C3UA 4CCSA 1PR6A 3IX7A 1HL7A 2WSIA 2X42A 3NOVA 4EW6A 3LX8A 4LY0A 2AT1A 1OMOA 5B4TA 1EK0A 2E1PA 3HGQA 4REQB 1SBNE 4ZMBA 1MO4A 2FWMX 2PTGA 4ZU3A 5KX5B 2PUBA 1TAUA 5IBRA 1L4LA 2JH8A 4L07A 3PQ6A 2ZG6A 1NC3A 3OUZA 1LQTA 3PXCX 4M1ZA 4MTCA 5LZ4A 2DY1A 3NH9A 4FYPA 2BZSA 2B5OA 2DCMA 1X7ZB 1J0CA 2FX5A 2VQSA 5AP9A 3ZS9A 4L0QA 4CIDA 2PUAA 1XGKA 3MAGA 3WZ2A 4DMMA 3E9RA 4CR6A 1Y7HA 5BWOA 4I2NA 2YKGA 1L3BA 3DZIA 4JU9A 3W8EA 3N6VA 3O92A 1PAUA 1YRYE 3VDNB 2IELA 5AHXA 3ZVLA 3QH4A 3PXGA 1XMJA 2H2HA 1QHXA 1D7AA 4B34A 2C2ZA 3ELBA 4KQJA 1FNSA 2OG2A 4PO3X 3NM5A 1VKHA 1J20A 1LGYA 3BMNB 4HX5A 5CH5A 1X80B 1KHHA 3TIIA 1QANA 1GEGA 1SUFA 5FOSA 1K2WA 3L7KA 1XA3A 3ZTYA 1QZXA 1M9NA 3V00A 1N9GB 5CW2A 4JYZA 4G8CA 1IM8A 1CE8A 2IXTA 2XOKD 1S7CA 1O6CA 2OCAA 3PK0A 4H1HA 4URHA 2NU9B 3ITDA 3IEPA 5JZSA 1WLYA 4BVBA 4L4YA 3D7SA 1D0SA 1EM8B 3MAJA 1FTGA 4TOIA 4JKIA 4MVJG 3OT1A 2F4NA 1WUTA 3CX6A 4QG7A 2O5EA 2QENA 4B3GA 3UB2A 4EKGA 3LVBA 4ZC8A 1C29B 2J46A 3Q15C 3WWEA 5C4MA 3DWEX 1RLIA 5G4KB 4EUNA 4PPGA 4DLWA 2W6ID 3LT4A 4RXTA 1AKNA 2QR3A 4K6MA 3F97A 4EW1A 3SVZA 3Q7IA 2NQTA 3Q10A 3FOZA 2RJ3A 4JJGA 1OFGA 1I7PA 2DQZA 3FLAA 4FONA 1BC5A 4D92A 4Z6KA 3DEJA 6REQA 4BRWA 5JBQA 2J3LA 2QX6A 1G5IA 4HAWA 5CEJA 5C35A 3FE2A 4ZO6A 1TUEA 4C21A 3KB8A 3DBHA 2GTHA 1B42A 1B1CA 3V4VB 4RS4A 5AW8A 1W6UA 2XMGA 2VTKA 1UADA 1H2AS 2HNBA 1OREA 1E59A 4YRMA 5TQJA 3VC2A 2Z9DA 3SJAA 3CRRA 5EOVA 3G1UA 2V03A 4KK3A 3T41A 1GPYA 2RC5A 3ZU2A 4BFVA 3HN2A 3M5DA 1NVWQ 1RM4A 4JJEA 4PZEA 3URMA 1LK7A 3M4ZA 3PCXA 4CM8B 2DETA 4D45A 4ZZ1A 5T5QA 1A8QA 4F1WA 4BYMA 1Y98A 4YXWD 1PRYA 3E9DA 3CSUA 4MGIR 2F59A 1PZXA 4AJJA 3DE4X 1ID8A 1SUBA 1LQ2A 3SQNA 3ENVA 4FK8A 5KSWB 4YI5A 3FUVA 2Q2WA 2PRYA 221PA 3TK1A 3E48A 4HQ6A 1V8PA 3WSVA 1NSFA 1RYBA 2BT4A 1YHYA 4F6CA 2QD2A 1YTLA 4MZDA 2NSHA 2XAAA 2NZXA 4UAUA 1N32B 5D6NA 2CEAA 3MAAC 3GCGA 4U5XA 4NP6A 5IDWA 2IPXA 3STWA 4DCTA 1UZMA 1J07A 3UAOA 4DBVO 1ZMOA 2DX7A 3QQPA 3NXSA 1FLNA 2RGGA 1L5GB 1Z6AA 3WE7A 1V2HE 3B7GA 2FVYA 2XA9A 3SHFA 4M88A 4ENTA 2HPZA 1N6LA 5DM2A 3AJDA 1O97C 3O3CA 3OPYI 1SAYA 4PFSA 2J9FA 3MT0A 4MYDA 2V4ZA 5DHQA 3OEHA 1KI6B 3CF4A 4ZZ2A 1MORA 3OKFA 2VNHA 3AU8A 3DQQA 4UU1A 3GLTA 3ZU3A 4CG1A 4J49A 1E3LA 1VL8A 2XQKA 1Y1QA 4RGYA 5AKHA 3RT7A 4MMYB 4IMJB 2OYCA 4DSTA 2I6QA 3V1TC 5BWBA 2AE2A 3AUJB 1D7OA 4OKIA 3B9QA 4DG5A 5CB8A 2VYND 4I99A 4NYIQ 1D2AA 4QELA 5HIIA 1M6YA 1XZGA 4XPIB 4XWKA 2Z43A 1J7KA 1XWFA 2GDZA 3ELUA 2OEPA 1T13A 2YHSA 1GOTA 3SBOA 5LIRA 4HH0A 3C74A 1EXMA 2H3HA 4ENPA 2H5JA 4BFWA 1U2TA 1WV1A 4X95A 4IIUA 1SZPA 4QNNA 3GLGB 2AZXA 4U0KA 3AVPA 1DJLA 4MRMA 1X0VA 2IYUA 1A96A 3K9GA 4TTVA 5HUHA 2G36A 1H8ED 2RH9B 3BXXA 4J0JA 2J7PD 2FSUA 3DCYA 1A82A 5EMMA 1ODIA 1IRIA 2E48A 2PZGA 1Z6XA 1ZONA 3IJPA 3V3KA 2I91A 2BFCB 5CK4A 4D9IA 1XZFA 3OG9A 2JFNA 5BSEA 2OZVA 3IT2A 3CMCO 4LISA 4MQEB 4K6GA 2GRAA 2HMTA 4KN9S 3S2UA 2QL5A 4KB5A 3AVWA 3NYQA 2D5BA 3EGEA 1NKTA 2VZLA 3Q4GA 1ZH4A 2AJLI 3PG5A 4NJEA 3EBPA 4WCFC 4F72A 3QVOA 4ZYLA 4NCAA 1AUQA 1G20E 3LCUA 3CVUA 1GGEA 4OGFA 1D04A 1G0NA 3BSYA 4QL3A 4DSAA 1QQTA 1FP6A 2WZBA 3C14C 2LZ0A 3NKLA 1NQUA 1IBMB 2YMMA 1Y6JA 2H4HA 3ZHBA 4MDFA 4P31A 2HGSA 4HB3A 4A1OA 1Z08A 3CS3A 1W19A 2BGNA 3KG2A 3L04A 3TW0A 1EGAA 2HRCA 1TKBA 1RBMA 4R9SA 2GEUA 3DOHA 3CFYA 5IT0A 5C8ZA 3EULA 2GZMA 4R05A 3EA4A 1SKUA 3R5JA 3A1DA 5A5VA 1MVOA 2ZREA 5I7VA 1WXXA 4CT4B 4TLMB 3KOXA 1LTQA 2H16A 2WF7A 4G0QA 3TE6A 4BMZA 2RH4A 5DP2A 2QTAA 1HDXA 3V8NA 1UZAA 2E9SA 2PWZA 3P27A 5KKAA 2HWKA 3B6MA 2JGKA 4S05A 4IFEA 2O2YA 2BVNA 4RF3A 3VNRA 1TMKA 2OHJA 2P4EA 1HRKA 1NSYA 1RZ3A 4FXPA 4XWAA 5LB2A 3STXA 1AO0A 1Z5WA 4NYMR 4M1EA 4KO4S 4NCKA 1F2TA 3T7TA 4O2AA 2FMFA 2PGAA 1FP2A 2C2HA 2C98A 2FHPA 3N2KB 4RFSB 2IIBA 5JZMA 3WJAA 4G0UA 1MFPA 3IERA 3H5LA 1WVGA 4LZZA 4Z0TA 2VF7A 3L7IA 5CB4F 4C2UA 4JLAA 3BBPA 4ODIA 1GPMA 1V26A 2H08A 3RAGA 4G5RA 2PKWA 4KX5A 3DNMA 4ZI3A 1HYHA 1P7VA 3K70D 1O4VA 1KO4A 5EZYF 5AOAA 2BEVB 2DJIA 4IUBS 4R7TA 2OD2A 3V9AA 4TV8F 4EHIA 3ESQA 5FEMA 4A16A 3T94A 4GX0A 4IHAA 5KJ1A 1MVLA 2BMVA 3REQA 3I0MA 4JI5B 4B44A 1YZNA 3A2NA 3AJAA 3D3NA 4H16A 4HDRA 3IUSA 1AS0A 1EP3B 1MIOB 2Q3JA 2ZE8A 4QO8A 3SIWA 1E8NA 4GPTA 4PGGA 1L4NA 1NVDA 1GUDA 4M1WA 4B8YA 2NAFA 1CNMA 3L1VA 2ZJZA 1YVRA 4PW0A 4WCVA 1U3DA 3AL3A 1WZNA 3KZOA 5BR1A 4OHVA 4XZ3A 4KRFA 1Q0RA 4OMCA 3DZFA 4P92A 3GLSA 3BWBA 3FAZA 3F4LA 1Q7TA 1KJIA 3MCZA 1QH8B 3PQFA 3L4BA 3SSAA 4GI2A 3WLEA 4EUSA 4YQFA 1AMUA 1P81A 3FI9A 1BX1A 1GAWA 1JX6A 3IP6A 1ZN9A 2JEYA 4II7A 1FFCA 4P3YA 4IEIA 2M6SA 4XGRA 5E6UA 4UZEA 4XKJA 3EZLA 1IBKB 3ZE0B 3ZBPA 2VN8A 1XQ1A 1TA0A 3OQIB 3WY9A 4B2YA 1MOQA 4UULA 2XWPA 4FN4A 1JGTA 5ES4B 5E6SA 2FRDC 2II6A 3ADBA 2EFEB 4I46A 1EU1A 1Y7IA 2Y67A 3CH7A 1VZ2A 2Q6TA 1CT9A 4JS0A 1PEYA 2I7CA 4QFMA 4AVYA 5LM3A 4Z4GA 4X6LA 5LQMA 3NYIA 2PT6A 3W7VA 4PS1A 5GVRA 3U09A 2G04A 2YHBA 1BE0A 2HXSA 3RJTA 1RYMA 1ISMA 4LPSA 3MWDB 5BW5A 2O8FA 5JJCA 2JGJA 4QX6A 1BMQA 1UBEA 2ECQA 3O73A 1EB8A 4EHFA 1XTIA 2DQ4A 2JAUA 2PH3A 3SC6A 4B1FA 5BWMA 2QYSA 5AW9A 4ENQA 3O83A 3R24A 2AXQA 4CF7A 1L7OA 3M0EA 3QPCA 4DDWA 5DOVA 4F91B 4CLEA 3L93A 5J2UB 5H3LA 3CJTA 2WJIA 3ES9A 3RH0A 5LQDA 1AZWA 1NF8A 4K6FA 1YF3A 2JIDA 3EQ2A 2XD4A 5JLJA 3GJ3A 1AKTA 5MFPA 4HQFA 5AM0A 1AV6A 3BICA 1JEDA 1RKBA 1M2NA 1V3QE 3C45A 4KI0A 3TX2A 4ZYTA 2L82A 1FJ2A 3AHCA 2YVLA 1SOWA 4DGSA 1J6UA 3LHSA 4NPAA 2XE8A 4M9ZA 5LL6P 5EJGA 5JXGA 4PBSA 3ZCSA 5A4FS 4KRGA 5B64A 1U1DA 1YQUA 3RYTC 4DF3A 5U9CA 1NUPA 4DBZA 2C8VA 1QIDA 2YFQA 3CZQA 3VKVA 3C5VA 1FX0A 1L5HB 4QUAA 3OA2A 4QQRA 2J31A 4FE3A 2CCGA 3A0UA 4UNPA 2UYQA 2IV2X 1M1ZA 1VL6A 4YXWA 3H16A 3QXJA 4N5NA 4BZZA 3AKDA 4IJKA 4CKXA 1YJAA 4M9SA 1XXLA 1T4BA 2JGNA 3HV0A 4LCJA 2GF2A 2JJ8A 4AUKA 2I87A 1OXXK 4J0GA 4D8TA 5LKRA 1QYIA 3JWIA 4EK9A 4X41A 1ZR4A 2C1ZA 1F8XA 3LVFO 3CEPB 3LG2A 4MO2A 2XE4A 4QU0A 5NULA 1RU3A 5TNXA 2VJYA 4WEOA 2GXSA 4C87A 5IUJC 3IDSA 1VSQA 4XD7D 4JXXA 2Q6OA 1FW8A 3Q9SA 4JVLA 4MUBA 3AUYA 4BX0A 4RTRA 5IULC 1F0NA 4NKRA 1Z0DA 4JKYA 5F1OA 3ZKWB 2Q1XA 4FMCB 4LV6A 3U44A 2X0IA 1AZLA 2ZYWX 4X7BA 4A2CA 1W59A 2AOTB 2VF5X 4OQQA 3GW8A 2DHCA 3TRKA 5HP4A 5CFQA 3CF4G 1KJWA 2PKCA 3L6DA 4UVDA 2BM8A 5DYYA 3W3AD 4BO6A 4G85A 4BMXA 3E9MA 3VR5D 4FLMA 1SXGA 3I9LA 2WEKA 3OTQA 2PD4A 2ONJA 1E79A 2IA5A 4PLFA 4EYSA 4Z54A 1HC7A 4G9GA 4XQEA 3H8WA 3MS2A 1JHUA 2R4UA 5LBUA 1O94A 2FSFA 4HZGA 1VL1A 3GA5A 1XTQA 1ENOA 1M2HA 2UUAB 3DM9B 2NO0A 2W6QA 5FBKA 1E62A 2FTKE 3ADKA 4U3JA 4DLTA 4A2WA 3L06A 2C2GA 2A5FA 3HYRA 1PVDA 1OYVA 3TZ6A 5BUSA 2OAEA 3RIGA 1EZ1A 3COYA 3VX3A 3R5FA 4XYBA 1HGXA 4HH4A 3C24A 4ZDJA 5JYCA 2QY9A 4RORA 5DM4A 1OTXA 1Z16A 2VT2A 4F21A 1VJ5A 2CXOA 3AQIA 5TQ2B 2NSLA 2B8NA 5KHAA 1BTOA 5JO0A 5LSAA 3IE2A 4EEKA 3T3PB 3ZE1B 1OPXA 2WZDA 1LLCA 3BL8A 1UMKA 2FEAA 5BUQA 2BKEA 5L8VA 1SXJA 2GXQA 2H2GA 2PVCA 2EHDA 3G88A 4YFVA 3UJDA 1RC8A 5DWDA 4ALLA 5EIFA 4D41A 3EASA 2WKSA 7REQA 2QX4A 4GXRA 4YECA 3K6RA 1SOAA 3NR2A 2X5XA 8AT1A 3W9YA 3LTEA 3N87A 3NGLA 1U8AA 4MCIA 2KM1A 2RCYA 1EX1A 3NXKA 1H1DA 2EFGA 2W48A 4FHGA 1KK1A 4RAQA 1V16B 4GOMD 4E31A 1EA7A 3V42A 1ESDA 4JJ8A 4JYPA 3UT5B 4DQDA 3ZK8A 1J8FA 1KBQA 2FPSA 4WOBA 3SXUA 3WIBA 4JYAB 3JQFC 1Z12A 1Z5VA 4DIBA 5CB0A 3I6IA 1TU4A 2OZPA 5DX1A 1VPVA 2CJPA 3SYKA 1FNBA 1N0HA 2I33A 5J2TB 4UPEA 4CM1A 5BOSA 4F60A 2VDLB 3RF7A 3ROXA 4PS0A 1BCSA 4NYJR 1S2OA 2ZYIA 4W9RA 4CLRB 1NAHA 1VMDA 2BMEA 4H4DA 4DAOA 4MS3A 4JODA 4C9BA 2DOKA 1QCZA 4EJFA 1NBHA 5HVNA 2TS1A 3ONWA 2I71A 3BEDA 1QNFA 1N7GA 2CHGA 3IC5A 4YV2A 5CX1B 3CZAA 5SZIA 3B3FA 2F67A 3UYKA 4D3SA 5JRJA 2EF1A 3GLIB 3GLGE 4UCFA 4AQDA 4X54A 1LBIA 5C5CA 2Q99A 1U2QA 4Z9YA 4QM7A 3L6RA 2RD2A 1TK9A 3LK7A 3VZQA 1A7KA 1YQQA 1BXRB 1JSZA 3OCVA 4EY6A 3C2QA 3G2OA 2PCLA 1YK0A 4GE0A 2H1FA 1QTNA 3HACA 1DLJA 2AW3A 4YVFA 2D74A 2E4YA 3PC3A 4D3YA 1S3IA 2VSOA 3DMNA 3H17A 1FS6A 5KJCA 4HYTA 4LZPA 4KX3A 5H70A 5I01A 4IJ6A 1JEYB 2O6HA 1Z5UA 3GELA 4KP7A 4EY5A 2JCBA 3DBIA 2GJ4A 3PU6A 4XQGA 6YASA 3PIDA 2HRDA 3M6MD 2GD0A 4U6NA 4XGQA 3ORSA 1UJNA 3O8OB 1WB4A 3KD3A 4NF2A 1YBVA 5EUCA 2IWHA 4YMHA 3UN1A 3VOTA 3GT7A 4H27A 1HT0A 1ZL0A 2YXEA 1FSFA 5B3JC 1G9TA 4PIMA 3Q3GE 1N9ZA 2XQFA 5BOVA 4F7DA 2I1VB 3IELA 3MT9A 2DQSA 2Z56A 4WZBE 3EWNA 5E7MA 1I2BA 2OV3A 3OLCX 3SY8A 5CD1A 3ZUPA 5EHIA 4IKEA 1TTTA 4HMOA 4KXMA 4C7JA 3OCXA 2AI2A 3THOA 1RXWA 2J3KA 4HRVA 3VH1A 3C5EA 3NCHA 2NXCA 3BQMB 2QUHA 4O4HF 4ENRA 1N0UA 5GQSA 1VHTA 4LWOA 1M6HA 3C6KA 4WKBA 1XCPA 4GMFA 4JCOA 4PYQA 5ALJA 3U3MA 3FXAA 5D87A 3EAGA 1OAOC 3JQPA 3UAZA 1LBEA 2VBGA 4FHDA 4S1OA 1UBHS 3N05A 4KNYA 3VISA 1Q0SA 3N2EA 3A1EA 3BG5A 1DKUA 1H66A 5T57A 2DHRA 2LIPA 4O2BB 1GADO 2UZ0A 1O0BA 1QIGA 1TX4B 2XB9A 4OJTA 1VKJA 5IW8A 4G1BA 1Y3CE 1IBSA 1XLVA 3I5XA 2E2WA 3B1JA 1E3JA 4LJ9A 4Y6SA 1HDGO 3RW9A 5IN4A 4C0WA 2CDBA 4XR9A 4C3ZA 4AZ3B 4BX3A 1KI7A 4WDQA 3GCZA 3IMFA 4WRRA 3CPEA 4RKRA 3AEQB 5TPZA 4D9BA 4AF7A 3DLBA 4KQWA 5DISB 3MGKA 3B20A 3VR6D 3RUCA 3FKSA 1AKUA 3OZFA 5AVKA 2LCQA 1QP4A 3U7RA 2EGHA 3BZWA 1DI0A 2FYTA 3KXPA 3DPUA 1CJMA 1CVLA 2GEBA 3PUJA 5JANA 2HR1A 1XVTA 4C06A 3GRAA 3T38A 5JQGA 3A3PA 3QU2A 2J1LA 3OIWA 1MAWA 5IYZB 3E84A 3HEBA 1V5EA 4H7DA 3T7SA 5LMCA 2RK3A 1UZLA 5FWXA 2XCUA 3D1LA 2W8BB 1WSBA 2HO5A 2GZRA 2DGDA 1K7FB 2GZSA 4E5PA 4Z0PA 3T3NA 1C41A 4F4UA 1KBZA 2E82A 3FHLA 3FVWA 6GPBA 1TLTA 5JASA 1YACA 2JZNA 3EIWA 2YWCA 3ZQJA 1OZAA 4MKHA 4WE3A 4OHWA 1MHTA 1BGWA 1DCFA 6AT1A 1TYCA 4PG7A 3WQQA 4IRMA 5LKAA 1NI4A 3HFSA 1UXGA 3CH4B 3LLUA 4MXDA 4I50F 4LXXA 4CQLB 3FPEA 2IPAB 1YFLA 3GV0A 4I8XA 3W5HA 1FP4A 4J6FA 5H02A 1QYXA 4WEQA 4DT1B 3QM1A 3RF6A 2PQ6A 1WQ1R 3MSCA 1MH1A 3TLGB 3AINA 3GLHB 1DC3A 4IUDS 4PC1A 4Y2TA 1SCDA 5ITVA 2ODQA 3G5MA 2UYGA 1PGPA 3PUIA 3WP0A 4ETNA 5K3EA 1MVNA 3BD8A 4RF2A 4DCUA 3IE1A 1J5EB 1DRJA 3RJZA 1Q0PA 1WMDA 5DV9A 1IULA 1KF0A 4MVJM 5BO5A 3BERA 3G0OA 3SE0A 5KMGA 3RUEA 4C4RA 2WM8A 1DO2A 3P1JA 3DCNA 1LBHA 3PP8A 1BKYA 3RSFA 5JS8A 1KFBB 3R2JA 3SZMA 1YUBA 1XXHB 2AMJA 2WWRA 3GA7A 4TZKA 3IQWA 4LE1A 4YUXA 2O59A 2IOYA 4LHEA 2Z5FA 1R0YA 5T8KA 5K1ZA 1Y1TA 3WADA 2FV8A 5BWLA 4UQOA 4RHEA 2JGIA 2VCYA 2Z57A 4RM3A 1BQ3A 3I6QA 4MUGA 1YU6A 3EQ8A 1CP3A 1DHTA 1AURA 3H2JA 3P9YA 5IVHA 2H65A 1HE2A 5JHGB 4N7MA 3PWTA 1JLHA 3AFIA 2W6IA 5JADA 1TYEB 2SNIE 3HMQA 1DELA 1C0EA 2WHPB 3AHEA 5KX5A 1UZNA 3NETA 1BWRA 1MLDA 2MYPA 3ROKA 4FUQA 2G40A 4Y6RA 5CCEA 1JHDA 2JD0A 1QK4A 4QOGA 3F4BA 2JI4A 5E2IA 1KIFA 3QU5A 5LIPA 1XN4A 3AVXA 5AUQA 3OY2A 4DOMA 2I22A 2XRMA 1H1TA 5CXSA 1YSCA 3LMKA 4C0HA 4GLJA 4UUAA 5DU2A 4ED9A 5F3WB 2B36A 2DBRA 4MRNA 2GT1A 2XUPA 3LPDA 3RKUA 3W3ZB 1G7RA 2ZM6B 2XLBA 1I3OA 3CEJA 5TY0A 3T34A 4C05A 1N6PA 2BD0A 1KP9A 2JW5A 1UBUS 2XVZA 1Y3BE 3UK1A 4CKCA 4A6PA 3KQLA 3WBBA 2FMHA 1SVMA 1SR8A 2O8DA 1U7DA 3B82A 2NO9A 1HNZB 2RKOA 2B83A 1WD7A 1JEAA 2G5TA 2QM3A 3KLPX 1OXTA 3PNKA 1FMCA 3OPYB 4NICA 4P6VF 5KWEA 3PNYA 1I4DD 4YK7A 1J90A 5FV4A 4FEEA 1HRDA 2XTJA 2EX4A 2Q41A 5F2KA 4BQFA 1LI7A 1LKZA 3TKYA 4ZVVA 1WCWA 2QBYB 3A27A 1GGFA 1NMSA 3L0OA 1SHUX 2G0AA 4OPMA 3DHNA 3MCWA 3H97A 3RTDA 1COZA 5C52B 4QM6A 3IBFA 1TEHA 1VIDA 4GI7A 4HFRA 5DCLA 3RC1A 5AESA 2AOUA 4DA7A 3WI7A 2MIIA 1EM8A 4FTWA 1O6FA 2F64A 3P2EA 3D3QA 3KQMA 3NNNA 5KYNA 3D5EA 1JSXA 3V2HA 3L7BA 4HL6A 3R7AA 1YO6A 3L41A 3DP9A 5LDHA 2QLJA 5JWHA 1Y7LA 2I1QA 3LOUA 3NJ4A 3P5BA 4BLWA 5JZVA 3BXPA 1OYOA 2XA2A 4ROTA 4AO7A 5IK2D 1JPNA 1O96B 5G4KA 4E22A 3CX4A 4NQZA 1VA4A 3H19A 3UHAA 2LUOA 3OZBA 3AERA 1KJ8A 3QVMA 1AQJA 2Z8YA 1K6EA 3G7NA 4IHJB 1K3UB 3LL7A 2VYNA 4E15A 5LZ2A 2FRDA 4DV3B 5B7PA 1TI7A 2Q1SA 1GTRA 1G6OA 2JJ2D 1J8DA 3JQDA 4Q1AA 4L0MA 4WTOA 3G8BA 3NDIA 3DYBA 3F6BX 3PTZA 4XM1A 5H82A 1MQ8B 1N4AA 3RUDA 4BKRA 4UU0A 2XB6A 3R3JA 4IX1A 4LQLA 1AY0A 1U0JA 4DV1B 5KYVA 1QCDA 4I9NA 1L5WA 4HADA 3HFGA 2V98A 2BKAA 4OXKA 1ZUD1 4QDXA 3S1SA 1G63A 3OCWA 4CM8A 1C8BA 4JSTA 1IDN1 4NBWA 4V2IA 3G2KA 1E9RA 2RFLA 1H8EA 2R60A 1JHAA 3ASUA 1EHYA 2J7PA 3F6SA 1T4MA 1GGNA 2HJWA 1W5EA 4HEHA 5KYXA 2Z1NA 3QNUA 5DHPA 3ZCVA 1T2VA 3SG0A 1UC5B 2X14A 1OI3A 3LYAA 2D2IA 2X6QA 4JQOA 4KAFA 4OSPA 2ZRGA 5J5CA 3M2TA 2CZCA 3KKMA 4OHRA 2VDUE 4LHYA 2ZZMA 4P35A 4NJOA 1Q7CA 2XQVA 4UKDA 3KSZO 1KZHA 3DPSA 1NV9A 2YL2A 3OBIA 3FLMA 4M55A 4GD3Q 5KIAA 2VOEA 1Z83A 4Q82A 1CJKC 2HADA 3C1TA 3VGPA 2GJSA 3LUDA 4ETIA 1DRKA 3O1IC 2W2KB 1BXZA 3LD9A 3V4OA 3OIUA 1MMFB 1Y3HA 4BFYA 3WA7A 1G59A 3MW8A 1A9QA 2X3FA 1F6WA 2FZCA 1ZW6A 1CUXA 1OBFO 3MWFA 4MEAA 1H2XA 4GP6A 4D5EA 5HUQA 3E22B 3LWNA 3G2IA 1KI6A 2NTYC 3E03A 3HWSA 4OJNA 4DVGA 2B35A 2I6GA 3AU9A 1DCKA 2XXJA 3SQMA 1YL7A 3F9IA 5EQDA 4R8MA 5KJ6A 2CNWD 2VHYA 3KAKA 1UM8A 1EGMB 4QULA 1VJ0A 2BW0A 2GLUA 2GX6A 4WGGA 3MTDA 4Y2PA 2C3PA 2PIDA 4YDHB 5JAIA 5BNWA 2IJGX 3BHMA 3FMFA 2FN3A 4K86A 4XPIA 3JZFA 3NLLA 4U63A 1OILA 2WV9A 3NP7A 1H94A 2PXXA 4POAA 3NHKA 4B31A 4ZCIA 3DVSX 2HEGA 2IHZA 3HB1A 2O3JA 4TVKA 5LCXA 2XJ9A 3F3SA 1KZ1A 1R5JA 3KR0A 2XGMA 1E61A 4C5BA 1KMCA 4A26A 5AJUA 1EWRA 2P62A 1BCRA 2X22A 3LRXA 4TZ6A 1S6YA 1C30A 2NO6A 4U1RA 2OAQ1 3WIVA 1H6DA 4LBWA 4KN6A 3N6RA 4CLOA 3L5KA 4DIMA 1SKBA 1XA4A 4KLRA 3YASA 4X45A 3EXIB 4KACA 5EWLB 6PFKA 1GL7A 1R00A 1RC1A 4MUAA 1O0CA 2ZCUA 3QPVA 3BT7A 1Q20A 1XZEA 2QM0A 3AUAA 4DV5B 2IWRA 2G63A 4U2DA 3FZEA 4Q3NA 4Z99A 4BU1A 4R8KA 1J70A 3LDFA 1V7CA 3MUEA 4W6QA 3RSSA 5BVHA 3FCAA 3JQAB 2YJ3A 3AR7A 3P0JA 1X7DA 4GT1A 4YRLA 3C70A 3SM3A 4DHWA 4TYQA 5E1DA 1SB9A 1Q3KA 1TMOA 2H1LA 4OL9A 3KUXA 4UHBA 4JIGA 2QMQA 3W79A 5AJTA 3B12A 3MMXA 4NU5A 1X8KA 5K05A 1EZ4A 2BHRA 2ONZA 1PQWA 3QVUA 4RMHA 5KTNA 5JAHA 1CG6A 4YO7A 3TR0A 5JSYA 3E9ZA 1ESCA 1ND5A 2ZCVA 3EMBA 2QG9A 1IM5A 1CIVA 3BIXA 3UICA 5IX8A 2GVDC 5JJBA 4GVXA 3H0CA 4E70A 5CEFA 4DLVA 1HDEA 4M0FA 3PEWA 1FTQA 3UJNA 2R0QC 1NTRA 3KQHA 1SFRA 4TTTS 1VJDA 5H8WA 4YS6A 2AE1A 3PUVA 4I3GA 2MSWA 1C7QA 3GPCA 4XFDA 3IJRA 1A0OA 1TMYA 4FX2A 1S01A 5JEDA 2I5PO 4RIHA 3FPGA 3WJ2A 1NNSA 4DR7B 3FTDA 3I23A 2C5GA 3F6CA 1UP7A 3N2KA 2GR9A 5DNWA 3WWZA 1N3BA 1OLXB 1Z37A 3EVGA 3JQFA 4IWNA 1NG9A 4D82A 4QWMA 1SCNE 5K6AC 4P83A 3AVUA 2FP4B 4P4LA 1L1QA 5B6JA 1CWUA 1E2IA 2WWVD 3AOGA 2V55B 1N57A 2UAGA 2W98A 2H57A 3KETA 3QVKA 5DN9A 4BGDA 1GT6A 1JR4A 1NVVR 4UNNA 5LQRA 4XCXA 2C1EA 4MYUA 3ZCUA 1UBGA 1X7GA 3P9QA 1FFXA 2YWFA 4ND4A 4US2R 2BEUB 1YL5A 3I42A 2GCOA 5EMJA 3KFXA 1X8LA 2E6KA 3VOAA 2AB0A 2H54A 3EYWA 1ML4A 4XA8A 1JR6A 4DAEA 4OYHA 4F2PA 3PX3A 2FSVA 1D0VA 1HFEL 4Z8XA 4DEVA 1ADCA 2EP5A 1DKPA 4GX2A 3I0NA 3QLUC 1H4TA 5B53A 1Q84A 3PQ3A 4XYGA 1XZMA 1AHNA 2DM6A 1WQ3A 1GDHA 1RQ2A 2DU8A 3I5MA 3KR2A 3KX2A 1GCOA 3P2IA 1CR6A 3KHTA 4L6IA 3FDJA 4B75A 4XM2A 4EIWA 2AYYA 2QD3A 1EFPB 1L5RA 4B6FA 1I51A 1L7DA 2WE7A 2PEZA 1CB0A 5ECWA 3NHZA 1XNJA 4A2QA 1K7YA 1F5NA 4AULA 4CM6A 1NN0A 1FDSA 1R74A 3LY5A 4CTNA 2Z8XA 2JATA 2POCA 5TPWB 5KSYA 3GFGA 2WU0A 3R0QA 3BJMA 5TMDA 4W7HA 1BEUB 3CIFA 4GYWA 3ESDA 3VO9A 5EL0A 3OQIA 4ESEA 1TVCA 2VT7A 2A30A 3NBYC 2CVQA 1QFXA 2ID8A 2R9VA 4OOEA 3TLAA 1E98A 2Y6UA 5B3JA 4HDAA 1HZJA 2D6FA 3ZNPA 3OQJA 1A50B 5KWIA 3N58A 4B3DA 2AGVA 1G18A 1SQFA 1FVFA 5FI0B 3GPDG 1ZGGA 3FTEA 1D8TA 1CUFA 4HWKA 5KBYA 1WNTA 1NC1A 3ROTA 1KDYA 2R97A 1SUCA 3ZQUA 4C04A 1SVIA 2N3ZA 5JVDF 4KQMA 4BAUA 1XKTA 4OHFA 3D4OA 3X2SA 2WDPA 4N76A 1I1NA 3V7WA 3M70A 2Q2NA 4ZRNA 1DX6A 3ICPA 3G2LA 3C3PA 3W3AA 1DXYA 4KU4A 4UPVA 3GYGA 4YYZA 1QAQA 3FJOA 2PIAA 3VR5A 1ETHA 1YFZA 2DUJA 4K9KA 2HFJA 2BGGA 1LDGA 4GM1A 3OLVA 4O59O 5KVVA 2FOIA 3ZC3A 5J2UA 1OAOA 2G1JA 3E9NA 3GJ7A 4S1WA 4XSGA 4ESOA 3LXRA 2JI9A 5C81A 1DARA 3F7TA 2YJGA 3H4VA 3CONA 2Q8NA 1ZCFA 5BNFA 9ABPA 4OATA 2BHTA 4PTLA 2OAGA 4MVJP 5DHTA 4OQYA 1T6XA 3HCBA 5LYYA 5E4JA 1GARA 2IRWA 3ICWA 5JNLA 1CR1A 4M9RA 3WWYA 1NR1A 4RD0A 4TMKA 5JNVA 4PR3A 1X7WB 1GCAA 5C1IA 3HCAA 1KTVA 3E2PA 4QUJA 2GOYA 4KWCA 1THGA 5TT1A 1S8OA 4E46A 5CG1A 4BTLA 4ZEWA 1TB4A 1ZSNA 2ATEA 2B1JA 4CTOA 4LY9A 4ZO8A 2RJOA 3TFWA 3TL6A 3ZEIA 3EFBA 1REQA 5IUKC 1F12A 2A6PA 1XMQB 3PXUA 4D98A 3JYLA 2ZT7A 3RKRA 5DLPA 3KXDA 4CUKA 4DNFA 5CBPB 3I52A 3L7MA 1Z35A 1BOFA 1KXZA 5B7QA 3TPFA 2B6HA 5FH9A 2OCGA 2H0RA 3EBLA 4GX5A 4M22A 1PT8A 3WMFA 3BK1A 4GQIA 5FBHA 1R6AA 2G1AA 1FYVA 1WQ4A 1AJEA 2BI4A 2EW2A 2W5UA 3ZKWA 2EFCB 3ZLTA 2D1FA 4ZKEA 4Z7NB 3FNIA 5BNTA 2RGXA 2AOTA 4OTZA 2QTTA 2X76A 4QPDA 3EFEA 2MHCA 5K2OA 3ZHZA 2O1XA 1YMVA 2HDHA 1YI8A 4HX2A 1D2MA 1IZ9A 4BE7B 1NUHA 4RQAA 1LSUA 4U7TB 5EE1A 2HUPA 3OCYA 4KQKA 4UHDA 2E1RA 5BR4A 4JB3A 1QKJA 1ZL2A 2B0JA 1ZRMA 1R4NB 3V4RA 1TZCA 4TYNA 1FVXA 5HMMA 1L4EA 1FE8A 5A3JA 1CERA 1JR3E 1VE5A 3FUWA 1DV2A 5CVUA 3UOWA 2I6SA 1K8XB 1PDVA 5LBTA 1OFIA 4BEWA 1QPBA 1RI5A 2IUUA 4PZAA 1IOLA 4NR0A 1XLTA 2G6TA 1P0CA 1J2YA 2YJ6A 2BFBB 2DFKB 3MF4A 1Q21A 1BEZA 3NHYA 1NPYA 3ODGA 5AHRA 3UMJA 4B82A 1N2HA 4RA9B 4IQFA 3D3JA 1NXTA 3WDMA 2QLNA 2FJ0A 4KDFA 3A3YA 4IBOA 4FFDA 2V3CC 4MV7A 5TQ2A 1BDMA 2C95A 4JOBA 1I80A 1K8ZB 3A1CA 4EMBA 5ITWA 2Q3HA 4DPKA 2Y3IA 2C4HA 1HE8B 3SF0A 3D3EA 5JG7A 1DPFA 3G7UA 2BH9A 2D5CA 1NJFA 1L5NA 2VAMA 3CVXA 1I2AA 2PMFA 4BVAA 3KJXA 1KS9A 2OCYC 4N01A 4OHMA 2ZTLA 3CCFA 5EESA 4W5RA 4RSGA 3G2PA 2K2QB 4H1TA 4N5MA 4RF5A 2HXGA 3C7AA 3EPLA 2G72A 4KVFA 4G0MA 2H1RA 4WASA 1L5OA 3SYLA 4AO8A 1QIFA 3OFVA 1QRRA 1G21B 3VKWA 3L7OA 2AUTA 1V16A 1ST2A 3EEYA 1JFFB 1DXQA 2XDAA 3NVAA 3QF7A 3FTQA 1LNZA 2H85A 3AF1A 1SCAA 3H1PA 5EZSA 3UT5A 2OHXA 3A6PC 4ZCPA 2DFTA 1ZSYA 2R6ZA 2GEFA 2QVLA 2TRSB 4JVOA 4QDOA 1UMCB 5CM9C 5J2TA 3FH0A 4ERXA 1EBFA 1CDOA 3O4IA 4HEA1 4BO7A 4P3OA 5JZ9A 1JB9A 3V4FA 2AUMA 2UZIR 4M0LA 2F8MA 2REBA 1XQYA 2A7QA 1LLDA 3GH3A 4GOJA 4PSUA 1EUZA 4JFAA 1ZUIA 1RRFA 1SWVA 1U94A 2O2CA 2VAPA 2X4IA 3MVEA 2HSGA 2BGJA 4TXNA 4TZTA 5CX1A 1SIUA 2GAIA 1MAVA 2ZT6A 3DDOA 3RHFA 3KLOA 2O14A 4PQFA 1N0VC 4WA8A 3GLIA 2O2DA 5BR8B 1F2UB 3Q8MA 5E9WA 4LC0A 3KQSA 1B7GO 4TTAA 2L17A 1H9BA 3LPLA 1BXRA 4DARA 2OP0A 1Q3TA 1XAGA 3DAHA 2LDBA 3ET4A 1O95D 3KWLA 1SNYA 5C8YB 1F60A 2Z95A 1T2NA 3GNTA 5FUQA 1BFKA 1XEWY 1JEYA 1GXSB 1HT2E 4URZR 3RU7A 1FSSA 3E7PA 4AZVA 5CXQA 3VR6A 4X65B 1WP4A 2C8JA 2UUOA 2ZR9A 3LQ2A 3O8OA 1ZM7A 4LHZA 3RHZA 2OPHA 5CFRA 1CZRA 1RRCA 1JHRA 1Q3HA 3B2NA 3KQQA 3C85A 3IKJA 3O26A 4P4SB 4PZPA 1RI4A 5L45A 2MYTA 1MRZA 4X97A 5AI5A 4YRPA 2VJKA 3DVRX 4IQ0A 5EP3A 1TTPB 1TQHA 5BSVA 1CUEA 3DMTA 2PO5A 3LC7O 5C5EA 2F8TA 1OWOA 4L22A 3IAM6 2IBSA 4LYEA 1K9VF 2CMHA 5IJZA 1UFQA 2CCKA 2A3NA 3NAGA 2C0QA 1J23A 1Q7EA 4MUNA 4AG5A 2PUGA 3EPPA 3S0JA 1VFNA 4F97A 2FPRA 2J67A 2PKYX 4W5TA 4KIWA 1LNSA 3HZHA 3DEYX 1D3AA 4DDHA 4I1OA 3S2EA 4AI6A 3KO8A 1NPDA 5GOTA 3E81A 2N1BA 2BR5A 2O3SA 4JLUA 3RIXA 4LDNA 1R64A 1Z2AA 3OZIA 3IBSA 1XVIA 4LVNA 1QOQB 1M34B 1XDUA 4MQ4A 4P4UA 2QEQA 4PHCA 4GS5A 1HLDA 2BH2A 4YT5A 1JQDA 4JLDA 3TRDA 5JT1A 2OP1A 4O2BA 4QXMA 2OO7A 3ER6A 2GNAA 3HCFA 5BR7A 4OO3A 3UWSA 1ZM4A 3EG5A 3FPCA 1Y82A 5EIBD 3G9TA 1RPNA 5COQA 3OFJA 2AZTA 1R6TA 2YWXA 4Y1EA 3VDRA 3VPBA 4AF6A 1AGYA 5K3BA 1W88B 3M6XA 3Q7PA 5ERXA 3DUWA 1P80A 3A8TA 2HJVA 5JSKA 2FEXA 2PS3A 1QFMA 2PM8A 3V80A 4DMGA 2J4DA 3U7QB 3VDQA 4ZWNA 3TB6A 3BE6A 4UOQA 1WO8A 4ITRC 1OZGA 3GK3A 2QJRA 3U5ZB 1IEXA 1QUFA 1SMKA 4AQ7A 1BO6A 1WVMA 4R2IA 1JAIA 1NN5A 4C14A 1H5NA 1FIUA 2XQGA 4CCYB 1Q7RA 4DPLA 3IT3A 2CL7X 3LUFA 3IMKA 4LNUB 4ZZ0A 3KEFA 4QOJA 1NN1A 5ED0A 2FWAA 1FOEB 2W8BA 4Q19A 6CHYA 3HPRA 3UQZA 4N6GA 2PMEA 1QIKA 3CNOA 3T5GA 3W6OA 2V3WA 4MA4A 2C77A 2FWPA 2C7PA 1KH2A 2OYSA 1TVEA 2EFJA 3N8NA 1OU4A 4HXGA 4BQEA 4EBBA 4EX6A 3DO5A 3NU1A 4B4UA 1TCBA 3WL5A 4HDKA 4XYLA 5K6RA 3A7DA 4KYTA 1ZIPA 1XLUA 2B2XA 3LQQA 3V34A 3O8NA 5FPSA 3LA6A 4IIFA 4RFVA 2C20A 1ZXBA 2V97A 2AWOA 1F1JA 1UT5A 2ZTHA 4RHYA 5ALXA 2PMCA 4FW8A 4HBZA 3GJ8A 4F11A 3AY7A 5LUBA 4Z8YA 2ETVA 3D2BA 3VPCA 3K71B 5JS1A 1TW3A 2XB4A 2JHFA 3GLHA 2GASA 4L4ZA 3NALA 4XIJA 3FA2A 4M8LA 4BCBA 2JVKA 2Q9AA 1C0KA 3NOXA 2BCJQ 5IG2A 2FQ1A 3SHQA 1GITA 2VIIA 3HN6A 4NONA 3SZLA 1IVNA 4HYYA 1AE1A 3PUHA 4W9NC 3OO1A 3STVA 5JFGA 5JSZB 4YJGB 3CJQA 1MZPA 2OVFA 2R25B 1T36B 3ROGA 3INYA 1VIMA 2H2DA 4FNMA 1XXHA 4MVYA 2C94A 3U7EB 3ZI4A 4Y1GA 4B40A 4N18A 3CLRD 1W9HA 4UAJA 3WLOA 3MGGA 1Q0LA 2WTEA 2O5VA 5HJEA 1RBQA 3DLIA 2GDJA 1N5LA 1P5JA 4LSZA 1HA3A 4OI4A 5IJ9B 4WXRA 2WTMA 1JYEA 4O4JB 5IK2A 4A36A 3B6JA 1LU9A 3K9WA 1DC7A 2NOAA 3MMPA 4MUHA 4WVLA 5DM60 4GNRA 5I9LA 3NIGB 3U17A 3ZV7A 1RWVA 2DWCA 3LLSA 1U9JA 4QU9A 5AO9A 4KGZA 4C07A 1MJNA 4PTYA 1LVHA 4P34A 1T8YA 3BGSA 4F2WA 4QSHA 3CTPA 3OJXA 2JJ2A 4HUJA 3ZHTA 4X62B 4LF4B 1XJCA 1FU8A 2YFKA 4LQCA 5F2EA 3IBYA 3VVMA 3UV3A 1UMDB 2JFUA 4ND1A 3EVDA 1VYHA 5JNUA 3JQCA 2HDOA 3PQCA 3GGPA 2FG7C 4H7JA 4Q1BA 3BXGA 4QHYA 3TZCA 1VP3A 5K6AA 1BFDA 2ZUWA 5EMHA 2FI1A 5LQUA 3IP3A 5E3JA 5KHLB 3NC1C 2I2FA 4RNCA 4A8PA 4RL6A 4DZZA 4CPDA 3WGMA 4P08A 4PAMA 5EZQA 5I7WA 2FZVA 5KOJA 1VYUA 3N75A 2E5LB 2NZ2A 2CMGA 4TMWA 3H1BA 3QBVA 1GUYA 4RZ2A 1KAMA 1I7SB 1XALA 1PFVA 5I7HA 1XMVA 5U4XA 1ZITA 1QCCA 2XVXA 3UNXA 2SCUB 4V0NA 1CU1A 1KKUA 3QLUA 4KYUA 4D81A 5AW6A 4FR5A 1IMJA 2VZ9A 3WGLA 4QPCA 5EIBC 2P91A 1EXVA 1FNCA 1E6EA 2WYUA 4R7ZA 3GUZA 3PJFA 1YR7A 1GNSA 2BGLA 4LWQA 4ASUD 4MRRA 4IDBA 3UPDA 3AEUB 3OUUA 1KEPA 3QX9A 4ZQGA 1O96A 3RRZA 4EJ2A 5JYEA 3KYBA 3ZGNA 1QM5A 4KQGA 2OK7A 1KIMA 4X7MA 4CHTA 3NBQA 2QVCA 3AEKA 4TUYA 2VR1A 4A8JB 5L3QB 4L51A 2CNWA 2YHIA 1C0PA 3ILXA 2P1DA 2DLDA 3ICCA 1R8XA 2X8BA 4KVAA 1ZNXA 2FP3A 1P31A 1ENZA 2FETA 4XAQA 4QGFA 3REGA 4IVNA 3NDRA 2B9EA 3LDAA 4Q1DA 1OX4B 2AFIB 4YYEA 1KDPA 5JJIA 1ADBA 2H2IA 1JVSA 4FOTA 1J2TA 1TTHA 4FC7A 5DGDA 4EGSA 3PHLA 4UQPA 1PKXA 2Z4RA 4AD8A 4ZCQA 1UKEA 4OAQA 3LQFA 1TTQB 2PMKA 1ZNYA 4ND2A 4ZKDA 1E5XA 1JLKA 1BU5A 1I0LA 4OQEA 4Q4DA 1YQXA 2Q1UA 4N8EA 1LZKA 4TWAA 3TQCA 2ZI3A 2O1EA 5JALA 5ALUA 3IIEA 4HDOB 3NWOA 1DIOB 5KQRA 1E3TA 2FMIA 4LOHA 1F17A 1P91A 3NBKA 5BWCA 1PT7A 1VPEA 3EEBA 5DNDA 1A8HA 2IV3A 1L1FA 1SKAA 2ZRJA 2HIAA 4KFUA 2C2WA 5EXXA 5A5DA 3AR5A 1RCUA 2G7MC 1T15A 3N70A 3T1QA 1J22A 5BY2A 5B4UA 1KQNA 3G8DA 3M6UA 5DB4A 2FXVA 1TVKB 1WHTA 2J6CA 1GPJA 3WDLA 3ZBTA 2XUHA 4IMRA 5FBVB 2JGFA 4AY6A 2H0AA 4YP1A 2Y1XA 1GSAA 1EVIA 2CN1A 2JHGA 2NO7A 1MX9A 3NTXA 4DLRA 2W2KA 3X1MA 1QV6A 2YXDA 3E0XA 3ROFA 2VDOB 1GKIA 3DYVA 4GBED 4WZAB 3A6EA 4YGXB 5I7UA 2XKKA 1QFYA 5F3RA 4EOGA 5KINB 3KJGA 3SVTA 2JLZA 2OC9A 2DCUA 4CV3A 3NDPA 4DQ0A 3OJOA 2WOOA 2BR3A 4FLFA 4RPHA 4ZYWA 4WNCA 3W5SA 3EUEA 2FFHA 2PSEA 1E60A 1X8JA 1RXCA 5ICSA 4X92A 1VIVA 1F8GA 3NP9A 4V39A 2F9MA 3G8AA 1BRTA 5EXDA 4DMKA 4YV7A 4ND6A 1YJXA 1ZD5A 3IPAA 3ROQA 3WLQA 2Q1YA 2HCBA 3NEPX 1HFKA 2QDXA 4GO1A 1WETA 4DWVA 2O8CB 2QZ4A 4J0EA 3RUHA 4O2LA 1XTRA 3ADPA 4GGMX 2P2ZA 3P0IA 2C8KA 3IPLA 2NPFA 3P5SA 4LI0A 4Y2YA 1MRSA 3FUXA 4ZAGA 1BZYA 3TG8A 4NAUA 4P4GA 1WPRA 5A4JA 1C7RA 1QDUA 3K9NA 5JWRA 1KAQA 5HBRA 1NIPA 1ARZA 2JG3A 2J6HA 1EK6A 1S8AA 4II3A 4M49A 4ZMRA 1S1MA 2HMSA 1KXJA 2YQ4A 4JXJA 5JUWA 1XCLA 3CE6A 1SVLA 1BIFA 3ZKAA 5EWLA 1WTAA 4O2AF 4TMTA 5AXAA 1H6AA 1WB6A 5ITZB 5J5VA 3LHFA 4Y2HA 4ZODA 1N8KA 1SCUB 3W78A 4P0PB 1DOZA 1FQKA 1UBSB 4S2UA 2R6CA 4TV9A 4AICA 2QLTA 1XEAA 2IY7A 2RHHA 3GMSA 3KOYA 3PC7A 4P3XA 3AF5A 4YGYA 4DLAA 4YMGA 2FZWA 3WRYC 2ZIZA 3TEMA 4PY2A 2QTCA 1ZCAA 5CA1A 1J09A 2FW9A 2GXAA 4OQMA 4NBTA 1JFRA 4H0CA 2YZ2A 2P3QA 3DEFA 3HDGA 4QYSA 5ARCA 1E4OA 1OXKB 3BGOS 1R0RE 3PUWA 2E4UA 1EDEA 3RNOA 2QROA 2C9BA 3K0KA 4INZA 3VPHA 4RC9A 4MHSA 1NDQA 1O0SA 1PLKA 3X43A 1FSPA 3DZJA 3LUJA 1WKBA 4YY3B 2CJWB 2WD7A 3SN6A 4KRXA 4BJ1A 2EJVA 1JQKA 3DAOA 1W0KD 3U7GA 3CT6A 3NX4A 3L1HA 3BM5A 5EAIA 1R18A 2AH5A 3F7NA 3IT0A 3DKRA 3QPUA 1QMPA 3ZWMA 1XJQA 3FKJA 1KYXA 4D5GA 1KARA 1ZINA 2X1MA 3SEZA 3TBHA 3WLIA 2BR4A 5J4YA 2IK8A 3BK2A 2B82A 4WLUA 2EF0A 2IGBA 2XMSA 4D0RA 1JAXA 1SA0B 1B8OA 3SC2B 1K8RA 2FPWA 1BMTA 2ZUUA 3HCNA 3KE8A 3LT2A 4U7WA 4J4TA 4B7AA 5JLAA 5CMLA 3HU1A 5CPFA 4CL3A 2F43B 1Y4ZA 4LG1A 3QUQA 4A15A 3G5UA 2ZTSA 3HADA 2XRZA 3TLXA 2CL5A 1LQUA 1ZIOA 3T5PA 4UTXA 1E8MA 1GRNA 2JDID 2Z8YM 4EENA 2JZCA 2PA0A 4JBXA 3HYTA 3VYTB 3U3OA 1RRKA 2FP4A 1DBWA 3NIFB 3INRA 2ALJA 3K20A 3X2EA 5KCZA 3DBOB 1IY8A 4HNAB 3IV7A 4D25A 4LK3A 4RBNA 3S2YA 3LOPA 3O3MB 3ZE6A 5EIXA 2QMHA 1ULBA 2RHGB 4IXMA 2VDNB 2R751 1Y5NA 3E23A 2XB8A 5F64A 3RBZA 2QB5A 3K5PA 4FBGA 3EEOA 1MPTA 1SUWA 2AD5A 4FYIA 5CAEB 4C2BA 4C89A 2FFAA 3ORRA 3OAAD 4JLSA 1BA3A 4JQSA 3H2ZA 4KQCA 2WF6A 3AVQA 5EPEA 2RC6A 2B7CA 2OCPA 4IHQA 4JBNA 1FTNA 4DKXA 5F2NA 4PFJA 1XQVA 4E32A 2J5KA 2V7QD 4OH1A 4DDVA 1E1MA 1XQ9A 5L7WA 5CLFA 4J1NA 4E03A 3ZJVA 4YRCA 1H0SA 5B7NA 3NHRA 1K86A 3EAQA 4MOWA 2JJQA 1EFPA 2QT9A 2DR3A 3ABSB 1N8NA 4OH7A 1J1ZA 4O4IA 3P8ZA 1QWOA 3O31A 1RJDA 4MDEA 1PJAA 4UHFA 5IEBA 2DWOA 4OYYA 1E5LA 4BO2A 2OA0A 4B3SB 5IDQA 1TAHA 2OFFA 3TAHA 5TPWA 1ZCZA 4EPVA 4CV2A 2C78A 1YFKA 4A8JC 4R2XA 4L72A 1Y4UA 5K0GA 1E6CA 1IJBA 2IYSA 1QG6A 2XTAA 3K3PA 4DXHA 4P33A 1AXRA 1AGPA 3HH8A 3H83A 5I4KA 1KVQA 1YS9A 4F6RA 1YAHA 4MUMA 4Q3DA 4YONB 1XAJA 4RVNA 2OB2A 4HNRA 3QTBA 4AZWA 1ECPA 1KAHA 1RJ9B 3GNQA 4K6OA 4RACA 4XYMA 3S29A 4DQXA 1S7GA 8ABPA 2QU7A 1G38A 1ZD2P 4E33A 3HXQA 3IHLA 4MQBA 2ZFUA 1U7WA 3BK7A 3Q7SA 4JI1B 1B43A 4H59A 2P6PA 4RM2A 4TLCA 5A6SA 1QU2A 1XKQA 1MO3A 4DMRA 3S27A 3L2OB 4D9EA 3CZPA 3DL4A 3E9YA 1QHEA 1NQXA 4JROA 4B8ZA 4L8WB 4HUTA 2VAXA 1O3YA 5FBRB 5AVWA 1U8YA 4FZJA 1YE3A 2VDWB 1H0HA 4EZIA 2DJ5A 1D9XA 2A33A 1L4KA 3EN0A 3RVOA 2BMJA 4YAGA 1FUEA 3ONDA 2P9BA 4MV6A 4C1NA 3L6CA 3WICA 1H42A 5C46F 3AKZA 3JALA 1ESMA 1Q22A 4DMCA 3Q3EA 3QMVA 1SB8A 3H3JA 3W0LB 4D43A 3JAWB 2V7PA 1PR2A 2ZSFA 2G88A 2WTNA 1I6KA 5BV8A 2VUUA 4OYRA 3QKUA 2IZZA 2I8AA 1WCIA 3CVOA 2JPDA 1Z0UA 1N33B 3DWIA 4XDHA 4KO2S 1JA1A 1CK4A 2NG1A 4M0MA 4BFTA 2EG9A 4WY2A 4AMZA 5CB4B 2VYQA 4QTTB 3EUWA 2X2OA 4LVOA 4LDPA 3Q8XB 4BBPA 1KVTA 2CZQA 3B7WA 1JR2A 3OU7A 4TN5A 4BNKA 4G9EA 1NRIA 2WY2D 1XF1A 3V8VA 4IQ8A 4E5DA 3GB9A 5EZYB 1AD2A 3LC2O 4JWKA 4GZ6A 3LCVB 3ZWVA 4F8YA 4TV8B 1CS0B 1E3IA 3BIOA 1ADFA 1JIVA 4B5KA 2ZAGA 5CBPA 5DBHX 1H2ZA 4NZMA 4BKPA 4ENVA 5JV5A 4GKAA 4YAUA 3HXKA 1U7UA 5HG0A 4QBIA 1ODSA 3V48A 1ZMRA 1QQAA 5FB3A 2A1TS 4J0IA 5KU7A 1VHQA 5GJCA 1K9SA 2ZRMA 5T4EA 1FVOA 2HWXA 1DEXA 3F90A 1CSEE 2YBDA 3WZMA 1DAHA 3E8MA 4MUXA 3DDSA 4FVTA 1A88A 3TOXA 4NYJQ 4WNAA 2FK8A 1R16A 3GBVA 3A25A 3C48A 4RXMA 1POXA 4G81A 1KL7A 4LSMA 4JI4B 2IZ0A 3IS3A 1K92A 1FRNA 3MM4A 1OBCA 3PSAA 4G0NA 4N40A 3W5BA 2IX9A 4MJXA 3HJCA 3GEPA 4HGYA 2WKWA 1OWLA 4DZRA 2AMVA 3E3LA 3EMVA 2CYAA 3LU1A 1UEXC 3MQ2A 4QFBA 1HBJA 2H4ZA 5DYIA 5E4TA 1ECCA 4GUAA 2O19A 2DWUA 2IXGA 2HTFA 1R4NA 2P0YA 1YGYA 4U2KA 4XH9B 4OLAA 3LIIA 4K03A 3X2FA 1KGSA 5DHRA 5F51A 1ZI9A 3I76A 1RJGA 3COVA 5EY5B 4M1KA 3LLCA 3HLYA 2FFBA 3R76A 5JBNA 2WILA 4H7EA 1KYIA 4I1VA 2HK9A 4PO8A 1CF4A 4TT8A 5GGXA 5KVAA 4JVSB 3BAZA 4RA9A 3AB7A 2Z58A 1PL8A 4PC7A 3IVAA 2XDWA 2IU0A 3LX4A 4CR7A 1WBBA 3W4JA 1AOXA 1LEHA 1O95A 4N3NA 3N8IA 1XEWX 4JC4A 1NXQA 4MYTA 4P58A 1LB1B 1AHHA 2EJBA 2O4UX 3RSOA 3UGKA 1CIPA 1AIPA 1XKLA 2V7XA 1RM3A 5EHZA 3C0KA 1A9SA 1DFIA 1Y3IA 3E2IA 1IY1A 1PJSA 1WZIA 1JIQA 1JQEA 3QXSA 1T3ZA 2GKSA 1O7JA 3BJIC 1DEAA 1UK7A 3BE8A 4RGVA 2OILA 1KOJA 4GLFA 1WULS 3MT8A 3T12A 5HXAA 1ZU4A 4WMLA 1CJBA 4X6YA 4YAWA 2GYWA 2XT9A 4NAVA 2A2ZA 3IT1A 2C7GA 1G21A 4TKUB 1YB1A 2PUWA 4QATA 2QUKA 5K3FB 4HJXA 4EO4A 4RD4A 1JZTA 4AY5A 5KNBH 4Z4IA 2YV3A 3CNLA 3AI7A 2CXSA 4QGHA 2OORC 4MAFA 3KBBA 3KU1A 5J1TB 2AJDA 2WABA 2WKPA 2XX3A 1XVVA 1NT2A 3LSYA 5TGTA 3TTWA 3M34A 3GJZA 4JR2A 1QC5A 3TX6A 4F1KA 3U0BA 5JS2A 2DC1A 4U2BA 1VLVA 3ICOA 2H92A 3S2FA 3F2IA 1RDFA 3BL6A 1S2LA 2I2CA 3G0CA 3LUKA 4LDJA 2DKOA 3GD7A 3UANA 5SYMA 3DLHA 1XL0A 4LUCA 5DM1A 2AOVA 2ERYA 2RHBA 4JKOA 2D0PB 4YWJA 3ZY4A 4WJZA 4MB6A 3BMCB 1W75A 1ZKDA 4QC2A 4TKZA 3FSJX 1H4QA 4K2AA 3A6GA 3EVFA 4MEJA 3ZDDA 2N42A 2ISCA 5ERYA 2FQXA 1IBRA 3DLTA 1MV5A 4IF6A 1FDOA 2BGWA 2X7JA 2DBYA 3E9EA 4R2MA 3O8DA 2DFNA 5D01A 5A4MS 1HM5A 4GL2A 5COBA 3JQ6A 3H2HA 4UBNA 5C8YA 4XI9A 3W2TA 1D1SA 1II8A 2FPGA 5DYTA 5GJBA 1HL3A 4FWTA 2ZB3A 3N0RA 5HQ3B 3ILVA 4HD8A 2XZTA 5A7GA 1JU3A 3OCJA 5B1YA 1R7RA 3DAPA 2YVQA 1F0KA 1LSSA 3T9BA 5HKLA 1ODKA 3BD7A 1R0LA 3M4JA 3WB2A 3O93A 3E7WA 3LAWA 3P9SA 1SKQA 2IITA 3DW3X 3HBMA 4O33A 4P4SA 3RYFB 1V5GA 3DOUA 2Y05A 4CE6A 5EUBA 3G79A 3N6XA 1CYDA 1R15A 5FWYA 3UJ6A 2H5EA 1P5FA 2GYYA 3HABA 2ECKA 3KAJA 4OFBA 2ZRDA 1PJTA 2XOXA 2Y2UA 2EX0A 3MUNA 3OPVA 3WISA 3WGHA 4NESA 4UJ3A 3VM6A 4PSKA 1NQAO 1B93A 3A05A 3NJ8A 4F12A 4AKIA 2QQ0A 3RBVA 5FF9A 2UKDA 2G0TA 1JH8A 3G85A 3MINB 1JFTA 2JLCA 3DDZX 3DHEA 4MGZR 1HG1A 1VLHA 5I4CA 3B6IA 2G3YA 4Z4CA 4C03A 5LA6F 1U2GC 1FXWF 1HE4A 4Y2QA 1XDGA 2HWWA 1ZWKA 2ZRLA 3FIUA 1BDHA 4LF7B 1DTWB 1HTTA 2G09A 2J3DA 2IOQA 1JYSA 3JATB 1NVBA 2JBHA 1Y48E 3C98A 1J4AA 3D8UA 5CA0B 2FFJA 4MV4A 1SUIA 2WT8A 1VXOA 1USVA 2HF9A 1XNRB 3BIJA 1USGA 3IURA 3QMMA 4ID9A 4XUEA 5DGHA 2W2VA 4G89A 2DMRA 3BFPA 5I7FA 4HOYA 2LKCA 4NULA 4JT9A 1CQJA 4XSVA 1RKVA 1IK6A 1YMUA 4LBVA 2CCJA 4GW3A 3STTA 3W2IA 4LYDA 4CL2A 4H6XA 1W88A 3D2CA 1E3WB 2WA1A 1D2CA 4FCCA 4FD2A 4PC2A 2AJCA 3GLVA 1RYNA 1T9ZA 1BHQ1 4PVDA 4PSVA 1Z18A 2GKOA 3WXMA 3L4KA 3ZGLA 2ZANA 1SK9A 1VRCA 1ZD4A 3D3WB 1X70A 3DMGA 5DI3B 1ZK0A 2DUWA 2NM0A 3DXFA 4CL8A 3DD5A 3G5AA 4YQYA 5BSMA 1T8UA 1XFAA 3MHTA 2ORED 3RSHA 1RLTA 3OJ0A 1EXNA 4QD3A 2P3LA 3TG2A 3K2QA 1SQGA 2CBZA 1RHMA 3G0HA 4NCHA 2VJBA 2GRJA 2WJYA 1MC8A 5DXAA 5HF6A 5C4GB 4CM4A 3DCIA 2A3RA 1TW2A 1B0PA 3Q72A 4L57A 2JNWA 2C0PA 3IVMA 2XKJE 1C7JA 2FMXA 2PYDA 3UC9A 2EEPA 1GNRA 1F06A 1L7XA 3B2QA 3CM0A 5JATA 4J76A 3T95A 5K8CA 2YWGA 3KFLA 1RQLA 1OLOA 3BOSA 3QJYA 4B76A 1EBUA 3NBAA 1ZHFA 1SU8A 2GFQA 3KIPA 3RK4A 1JLSA 4D42A 2GAJA 2JCXA 1EFVB 1M8FA 2M98A 1FUYB 2V96A 3O4HA 3TLCA 3AXTA 3N2YA 4I1SA 4RPJA 2JLVA 2BTQA 3ACDA 2O4CA 2VHJA 1JHQA 4L9WA 2PKQO 5CTAA 4CEHB 2XUJA 1B16A 5CT5A 3WX0A 4K0RA 1ZNWA 1PSWA 1XHLA 4MYCA 4PYOA 1UXIA 4XE5A 3X1DA 1KWKA 2MINA 2ZTMA 1L8XA 4DUYB 1I13A 5KYYA 3WRYA 2PRSA 2QRPA 1O9HA 3OEED 3P2KA 3FYUA 4G56A 3SR0A 4YJGA 3E3MA 2JI7A 4QDKA 2OUKA 3GARA 521PA 1MXFA 1TZMA 1T36A 2W2QA 2PWAA 3GP5A 1GKYA 2A1IA 3HGMA 3R5SA 4G4SO 1A7AA 1RACA 2M32A 2ZBFA 4H6PA 4S1TA 4TVBA 3P9XA 3NEJA 4U7HA 3WNDA 2BFPA 4IOJA 5HSGA 5EJIA 3ZDYB 2XKAA 4MHTA 1I94B 5EVCA 3RAPR 4IYJA 5AM3A 1MG5A 3ESZA 1W4BA 3KKLA 2OECA 4ZQFA 3V4LA 5ARDA 4L7QA 3R40A 3SCZA 1V39A 2D06A 3ANLA 4ER6A 3E8SA 4NE9A 2VP6A 2VHWA 3U31A 4BNFA 5AW4A 3WBKA 2AK2A 2MYUA 2XWSA 4MP3A 3QKIA 2X15A 4ZVQA 3TBKA 2IS1A 3TW8A 4KBYA 3MTQA 3FG9A 4IWYA 4WK4B 4ENUA 2XLCA 4REOA 1ODTC 1I6WA 1HYGA 4FD3A 5FQOA 1QE0A 4JJIA 1CUHA 3CE9A 3EPJA 4EKDA 2I03A 3BMXA 1I01A 3NTRA 4L6AA 3RUPA 4UCWA 4DTCA 1X0XA 4ZV4A 2A9OA 1UMDA 3H4MA 3GR6A 4EW3A 3VU9A 4KBGA 4MULA 4Q3OA 4QUIA 2YC4C 3T7DA 2XDQB 1X1EA 1I0IA 4CTKA 1GCUA 1Y1PA 2WIKA 1JTEA 1NVXQ 4R8VA 4CUZA 4M1YA 3ZWNA 1G8YA 3COJA 1QH1B 3ZDFA 2Y1OA 3TNLA 4IM7A 1PR4A 1W46A 2PYZA 2WFAA 4WOPA 5GM2A 1ATZA 3N8GA 1G2OA 1MT0A 2VDJA 3TGLA 4UZFA 5EHNA 3NRCA 5EKSA 4R2HA 1L8AA 1SRQA 2YV2A 1YC5A 1WRBA 2VJAA 1QDLB 2WF9A 2HC9A 1XEFA 3BWVA 5EIEA 5IAOA 4YUYA 4DLZA 3LY7A 4QKQA 4FGLA 1T9BA 2Q45A 2HF8A 3HKEB 4EG5A 3U56A 2ZZNA 1R12A 5FTWA 5KSPA 3PL5A 4RWEA 4TMXA 4WJKB 5HA5A 3PX7A 1BYUA 1G2QA 2V0CA 2OGUA 5G1OA 2V8BA 1IQ0A 2WWIA 4AN0A 1FNMA 3TNJA 2M1ZA 2WVHA 1JA0A 4I50B 4NZOA 2JL1A 1ZUNA 1B26A 4C6HA 1E9FA 1O9GA 4R2WA 3AEUA 1P73A 5BQPA 4IKPA 1C1DB 1M8GA 5HKKD 4ARBA 1BW9B 3L0ZA 4BC1A 2R65A 5DBFA 1U9ZA 2EDAA 1NVAA 2V9CA 2ZM5A 1KZGB 4A8JA 1XRMA 3RFTA 5L3QA 2DHEA 2E55A 1WSAA 4EUKA 1J1IA 1H2FA 3AR4A 1BVUA 5JD6A 3WGIA 1DOAA 4M9CA 1XCJA 5H3CA 3K0FB 1ZGJA 1NVEA 2NQ2C 3P9ZA 3NIWA 3OZ7A 4HQLA 8ADHA 3C3YA 3ZK9A 5JPCA 2FR8C 4W7SA 1E9BA 3ELDA 2JFXA 4RDXA 1MEOA 1DAOA 4M0PA 2B99A 2YXNA 1UBCA 4FKZA 4J7AA 4UU8A 4YAIA 1R0KA 3QVJA 4J94A 5FR2A 4LZWA 3PR1A 2Y0CA 1T5DX 5K09A 2Z2JA 2J9XB 1J0AA 3DC2A 5BWNA 1XDWA 4IDHA 1E7QA 4PAOA 5LWQA 1SELA 1HSOA 5A3RA 4WV3A 5JD4A 2B8EA 2RI6A 5FJJA 4MZXA 4L3VA 4LEIA 2O1SA 2HH9A 4AL4A 4P0QB 4NZPA 2PMBA 3U4AA 5THXA 2IS4A 3D5TA 1GRCA 2AF4C 2VYCA 3GDGA 3KP1A 3O5AA 4GG1A 4QAJA 2QKYA 1U9CA 3PLAE 2GPTA 2QX7A 3GHHA 2CEKA 3QVXA 3ZY5A 4EHBA 2H11A 3L8DA 2DPMA 4J1QA 1ORVA 2IW1A 3C43A 4R3UC 5CPBA 4BJ5A 1EAMA 2OENG 2AEJA 3COWA 4LGMA 5KTPA 2K87A 2ZRIA 3L92A 3M83A 2Y99A 1JAZA 3CG0A 2QTHA 1EPUA 2CY0A 1GRVA 1L7PA 2OO5A 4MX8A 1R0XA 1ST3A 3HKCA 4JK3A 4LAFA 4WZAA 5SICE 4BPBA 1Q5PA 3FHOA 2B1IA 4B7CA 2O0JA 4FYKA 2PKEA 3NBZC 1T6YA 3FOEC 4OQNA 5K4GA 3WGOA 4B3RB 3L0CA 1W93A 1KY3A 1DWPA 4IG4A 5AQ1A 5ALTA 4D9GA 2ERXA 4FFOA 5KC8A 5EIHA 1W0KA 4L0CA 1T34A 2IYPA 3GGCA 3OIFA 1AX9A 3IDFA 2BP7B 3TTTA 3VHLB 3FFWA 4WWHA 2GUWA 3TVTA 3QVSA 3ZDEA 4A3SA 2L0XA 4Q1FA 1XPUA 4Q7KA 3FMIA 4JLWA 4V38A 2DERA 1JP7A 2VHZA 3BCUA 1JR3D 2O8CA 3ME5A 5ELXA 2AJTA 1SGWA 3MYRA 1AUXA 1RKUA 3UWDA 3I32A 2OCBA 1B74A 3QE4A 5DXFA 1NVVQ 1JJAA 2WP8J 3UHOA 4BNGA 3NM6B 5I9MA 3EXG2 1Z2NX 2R7AA 1ZK2A 1X15A 1BXKA 1D6SA 2CXHA 1KO1A 1W85A 2EIHA 2H8KA 2JLSA 5HF8A 5UKDA 2JDIA 4BLVA 5AKEA 1VM6A 5M3BA 1M2JA 4MV3A 1YV9A 1GAEO 2CYBA 4EI2A 1NJ2A 1KETA 3HE3A 4QNMA 1AUPA 4MDYA 5FJIA 4B3MB 1JDBB 2WM2A 3ER9A 5DBIA 1GL6A 3T6KA 1IZ0A 4D3FA 5LYJB 4JXZA 1NNLA 1SCUA 3U1TA 5B6PA 4L3OA 1AN9A 3BHNA 3UATA 1PNOA 4AN1A 1C50A 5EMNA 1OU0A 3EDRA 4MW4A 1QH9A 2N0SA 3BVPA 3SFVA 3N0WA 4PLZA 1FEZA 2NVWA 1USKA 3OAAA 5AJHA 5AK6A 3A70A 4JL8A 2HPHA 2V45A 3GP3A 3QE0A 3OT4A 4BVGA 3N7AA 3Q3CA 3U13A 5B36A 2V7QA 3ZU4A