1ST2A

The three-dimensional structure of bacillus amyloliquefaciens subtilisin at 1.8 angstroms and an analysis of the structural consequences of peroxide inactivation
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
275
structure length
272
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNDVINSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SUBTILISIN BPN'
publication title The three-dimensional structure of Bacillus amyloliquefaciens subtilisin at 1.8 A and an analysis of the structural consequences of peroxide inactivation.
pubmed rcsb
source organism Bacillus amyloliquefaciens
total genus 95
structure length 272
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1990-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1st2A00
3AFGA 1LW6E 3DWEX 1GTJ1 1SBNE 1A2QA 3DE3X 5JXHA 3DE4X 2IXTA 2W2PA 3DVQX 1GA4A 2WV7A 1HT3A 5JMOA 4WOCA 1VSBA 1P8JA 2ID4A 2X8JB 1BFKA 3CO0S 2QTWB 1IC6A 5ARDA 5B1DA 3WIVA 1KE1A 4H6XA 1JEAA 1OYOA 1SIBE 1SCJA 2PRKA 5B1EA 3I2YX 2Z2YA 3ZXYA 1TMGE 4K8RB 1SH7A 2W2NA 1T1IA 1UBNA 1WSDA 3GT4A 4DZTA 1WMDA 1EGQA 1TO1E 2HPZA 3LPDA 4YN3A 1AK9A 4J94A 1P7WA 3VYVA 1SCBA 2E1PA 2IY9A 1S02A 1WVMA 1C3LA 2XRMA 5ARBA 1T1EA 5FAXA 2XTJA 1THMA 2W2QA 3WHIA 2Z2XA 4FONA 3PRKE 1KDZA 4KB5A 3WQBA 4DJ5X 4GI3A 4H6VA 3D9QX 3EDYA 1GA1A 3Q5GA 1SBIA 4ZOQI 2PYZA 3EIFA 1YU6A 3QTLA 2Z2ZA 1Y3FE 1PEKE 4CFYA 2ID8A 1Y4DE 1V6CA 3WIUA 2WWTA 1V5IA 3AJ9A 1DUIA 3DE2X 2X8JA 1TK2A 1Y34E 3DDZX 5SICE 3P5BA 5I9SA 1PFGA 1GTG1 1Y3CE 3QMPA 5AQEA 1SIOA 1SUDA 3DVRX 5CW1A 1KE2A 3F7OA 3I30X 2W2OA 3BPSA 1S2NA 3I37X 4NE9A 4OV6B 3A3NA 3TECE 4WOBA 3QFHA 1SIUA 1WMFA 3LPAA 4M1ZA 2WUVA 2ZWOA 1BJRE 4NMXB 2DQKA 1R6VA 1Y48E 1ST2A 1SPBS 2Z58A 1SVNA 3HJRA 1Y1KE 4OMDA 1MEEA 3GCWA 1GNVA 1GCIA 3DE1X 1T1GA 1R0RE 2HD4A 3A3OA 3H42B 1TECE 4OMCA 3DE5X 3A3PA 1TM1E 4Z2AA 1EA7A 1GTL1 1SUCA 2B6NA 1TM3E 3Q40A 4AKTA 1S01A 4ZARA 3TI9A 1CSEE 3BGOS 2DUJA 2ZWPA 1BE8A 1TM5E 1ST3A 2SBTA 3VTAA 1IAVA 1ZVJA 3BX1A 4BWGA 5K7SA 3F49S 2ZRQA 3DE6X 4LVOA 3L1KA 4NE7A 3AJ8A 4HVLA 1SELA 4C3VA 3CNQS 1BFUA 3OSZA 2PKCA 3D43A 3LPCA 1DBIA 2G4VA 1AQNA 2PQ2A 3VSBA 1AVTA 2P4EA 3DE7X 1Y9ZA 3GCXA 3ZXXA 3GT3A 1Q5PA 4KG7A 4LVNA 3DYBA 1P7VA 5ARCA 4MZDA 3DVSX 1C9MA 5JXGA 3VHQA 2Z57A 5AVKA 1GT91 1KDVA 3PTLA 1AU9A 3UNXA 4AKSA 4DWWA 1SBHA 3SQOA 2Z30A 1PTKA 1BH6A 4B5LA 1SUAA 1SUPA 2TECE 3EE6A 3I34X 1AV7A 1BE6A 1MPTA 4CG0A 3DW3X 1Y3BE 3T41A 5JXIA 1YJAA 1XF1A 3F7MA 3VV3A 1SUBA 2PWAA 4C3UA 1WMEA 1C9NA 2DP4E 1NDUA 3DW1X 3SICE 1SCAA 1AH2A 1SUEA 5FBZA 1SCNE 3DE0X 3VV2A 1SCDA 1OT5A 5AVJA 4I0WB 3LXUX 2SICE 2W2MA 1PJ8A 1NDQA 1GNSA 1Y4AE 5AMXA 1YJBA 1CNMA 4HX2A 1TM7E 2SNIE 2PMWB 1Y33E 2GKOA 4CFZA 1TO2E 1KDYA 1SBCA 1ZVKA 2ST1A 1SN7A 5FFNA 1GA6A 2V8BA 1Y3DE 1SBTA 1TM4E 2WUWE 1YJCA 4RYDA 3TI7A 5JXJA 1C9JA 4KPGA 4JP8A 2PWBA 1AF4A 1R64A 1OYVA 4H6WA 2SECE 1NLUA 2Z56A
chains in the Genus database with same CATH superfamily
3Q7TA 3AFGA 3PHLA 4MP8A 2M9MA 4N7BA 1E8NA 1NQXA 1NGSA 1TCVA 4JT8A 1T1RA 1D7AA 2AOWA 1SG0A 4PRZA 4TXLA 3RVJA 4HJRA 3IUBA 1G6Q1 1C4KA 1X9HA 2ZJZA 2XKAA 3PT5A 4YMWA 3A6PC 4V24A 1I9GA 1IM2A 2JFFA 2FPSA 2QN1A 3K1JA 4NC9A 4JHLA 1MDFA 3UJ8A 3V4OA 1PT7A 2QJFA 1T8PA 1M6WA 1E0DA 3AO0B 4KFUA 4LDRA 2EVWX 3MA0A 1IB6A 4LY9A 1JIQA 3UO8B 2ZDHA 3DKRA 2QAJA 2P9CA 5DHPA 1UIRA 4I1OA 2GT1A 2EJTA 1IHXA 3MFYA 5GQSA 3V8NA 4DXHA 1H8EA 4JX8A 3D4IA 4DV7B 4HVCA 2A35A 2V74B 1YHNA 3RVSA 3SYRA 2ZUCA 1U2TA 2AH5A 4GP7A 5HA5A 3PXAA 1NN3A 1A8QA 1AQYA 1PS0A 3OJEA 4YQFA 2I66A 3KE8A 1OIVA 3I2FA 1ZRMA 5ALKA 1XL0A 3X43A 4P4NA 2Y1GA 4EPXA 1D8TA 2QG9A 3WIVA 1UZNA 1UFOA 4Y7CA 3QNUA 1FDWA 1PQWA 1R4MA 4NIMA 3ZXSA 1Y3IA 4KOAA 4FLFA 4LJ9A 4AS1A 3OIUA 1PFVA 2PUTA 2WU3A 3ABOB 3RFTA 4OQLA 3FUTA 1VLZA 3VR0A 1GSOA 4IXDA 2OHOA 3DV0A 3RB8A 4LZWA 4QO7A 5DNAA 2FQYA 1UJ6A 3KJNA 1L7QA 1ZM7A 3FPSA 4CM6A 4BV9A 1PGNA 4O2RA 4C6TA 2K7ZA 4U9HS 1NURA 4MKHA 4NNPA 4AVYA 5E6UB 4UE6A 5K5EA 1EAMA 1WSDA 3WWYA 3DM5A 1OASA 1S2GA 5FJIA 1EFAA 3EEFA 5KQMA 1T9KA 3UJDA 1UP4A 5IDXA 5BO5A 3WLPA 2FMXA 2GTIA 1R0WA 4I3FA 4F9EA 1TO1E 2HIMA 2O8CA 2GM5A 2VHZA 2D3WA 2PU7A 2REQB 4YN3A 5BOVA 3L7YA 4Z9AA 2C9CA 4KUGA 5AWFC 2OQVA 1J90A 5JARA 3PEFA 4XDGA 3D7MA 1FP1D 2NSJA 2Y0CA 3RUIA 2X4IA 4FPXA 2YR0A 4INPA 3Q41A 3M0EA 3WRVA 3HK2A 2HT1A 4EG1A 5BQPA 3VPXA 4MQBA 1L8QA 4CR7A 4RZ3A 4MUYA 2B8TA 1WVMA 1X1BA 2D5BA 3WB9A 1C3LA 1XLVA 2Y1EA 1L1EA 4JNKA 2BP7A 2E37A 3RRYA 4LRTB 4LXQA 2AL7A 1SXJE 5C34B 4JP5A 1XZNA 1T9DA 2WHPA 2Z1MA 3HBLA 4OYYA 4X8OA 4MUJA 1YQ9A 3EARA 3LWDA 2ZUBA 1UC9A 4NZYA 1L5HB 1SZCA 4ON9A 4I36A 3THRA 3MLBA 1WO8A 3E4CA 3IV7A 3DV9A 1J0EA 4RPLA 2YN0A 1QHFA 3E15A 1PV2A 3DXYA 1OJ7A 1UDWA 2QIPA 3K2QA 1GPBA 1PYDA 2QZ9A 1RJ9A 2G83A 3CRQA 1ZRHA 4IGEA 5G4KB 5GJVC 3EGXB 1H9BA 1Q7CA 1YTUA 4FONA 2PLRA 2CUKA 1IEQA 1AM4D 1NMYA 2QEQA 4A8TA 4FEEA 1J8FA 2ZSIA 3C6XA 1KL7A 1T5BA 4CKYA 2QROA 2HEGA 4G56A 5CVJA 2XAUA 3I83A 5EWMB 3VZRA 4DNOA 3A11A 2AN3A 3RIXA 2ZBRA 1QYWA 4I1UA 5LBTA 3RYHA 5DHAA 1A9PA 2YC2C 4C03A 3C6ZA 5EI5A 4PLYA 4Z2YA 1XPJA 4G09A 2W37A 2WINI 1GGJA 4ADSG 5KPJA 4H7EA 4EFMA 4YJ3B 1FQJA 4WCVA 1UWKA 2EBWA 4E4TA 3TZBA 1U8XX 2JDIA 1YOBA 4WN3A 3WIOA 3U3MA 3PQ6A 4KN9S 1TJYA 3OT5A 4JLOA 4BS9A 2Q99A 3HMQA 4BNLA 3LXMA 4IIVA 1KH1A 4EENA 4UZEA 1N2EA 5HW0A 2NNLD 1W4RA 1GPAA 5DU2A 6ADHA 5IVDA 2P9TA 4WK6A 1TZJA 1QU3A 1FC0A 1K0UA 1A8HA 4H60A 4UULA 3EFHA 3W5CA 2MTBA 2P91A 3MLAA 3LUFA 5DRTA 3A9RA 5AW5A 3ETLA 1TXGA 2NXWA 2J85A 3TQOA 3HO1A 1RXUA 4IXWA 5HIAA 1DUIA 4B3GA 1PG0A 3AUSA 5K4AA 1JEJA 1S3SA 3GGJA 3ICPA 4M9RA 2PJZA 4XX0B 1J8DA 1GYPA 1W2GA 1Y34E 1TPYA 1YL5A 2GPYA 2IGBA 2XD4A 2C4TA 1EBBA 2N0SA 3ENKA 4X90A 3RG8A 3VVBA 1VE9A 5IFLA 3PENA 2YC4C 4PGFA 5IXYA 3WDKA 3GDHA 1E98A 1O3YA 1H6BA 3RSOA 1W29A 2H57A 3ESRA 1JG7A 4L6AA 5A0VA 5TDHA 4LXYA 5EUBA 1MAAA 3MTBA 4PNHA 4QLAA 1Y89A 3O95A 1HMPA 3NLLA 3OJXA 4K46A 5HOQA 7ABPA 1QOPB 3AVOA 5JZVA 2JGFA 4IZHA 3S0JA 3DTVD 1M1NB 1KE2A 1CRPA 1YRHA 1HKHA 4ISCA 2VTBA 4CMGA 4UVEA 3AV0B 3EFOB 2BKUA 1LCIA 1GU7A 1YBHA 1MW8X 1EINA 3IQWA 4X54A 2O7NA 2QX7A 2WZQA 2VHWA 3ZBTA 1J9EA 1VLJA 3RSHA 3WK7A 1WCV1 3B7WA 4OV6B 4TL8A 2WVJA 3FCAA 5JD3A 3OLYA 2XMPA 2PD4A 3D6FA 4ZT4A 2C4MA 5BV2P 2RK4A 4MS3A 5E7IA 4BZQA 1L7MA 4YJHB 2QXTA 3CPHA 2AOVA 3UQZA 5T8KA 1E2HA 3PDHA 4YR7A 2VHVA 1OB2A 4L5JA 3KZVA 3PG5A 1QG0A 1ONSA 1RYEA 3FKQA 2JARA 1OXTA 3HXMA 1JDUA 2JHPA 4FU0A 5AM4A 4AFNA 3DAFA 3G2HA 3BMCB 2HX1A 1NOJA 2ODWA 3OOSA 4LF5B 3P4UA 1KAHA 2WUEA 4MKFA 4TGLA 2EQBA 3UMBA 4P53A 2D62A 3WVNA 2IYLD 2AEEA 4HO1X 4N3BA 5E1OA 3R44A 4EFDA 1A5BB 4LWZA 4NCHA 4XIYA 3R40A 3RLFA 4KN8A 4C9BA 1WSWA 3BKWA 4CLOB 4CI9A 3SYTA 1XFDA 1PTJA 4V3BA 4LF7B 3T06B 3ZX4A 1YJQA 1PVDA 1JDJA 3QLVA 4ZJYA 1Z6AA 3ZG6A 4EHIA 2WEKA 4JXKA 1OIXA 3TSCA 5FD8A 3I04M 3NWJA 2VWHA 4O4IB 1TZBA 5J3JA 4D79A 3U9TA 3U7HB 1BS9A 2RCYA 3GCWA 4LEIA 5JJBA 5C18A 4J1TC 1EFPA 3AB7A 1R6BX 1WB4A 2WBLC 2Z1NA 2IV7A 2XYQA 2OQRA 2QD1A 4GLJA 3WISA 5BNZA 1R0RE 4TRMA 2WM3A 3QFCA 3VXKA 1CUVA 1DC7A 2A1IA 1HORA 2O48X 4OHPA 1HY3A 3QF4A 1J2RA 1U3CA 4RVNA 5JEEA 3ETEA 3AVTA 4OI0A 1YOVB 3STXA 3W8EA 4DUPA 1FMFA 4GNKA 1N6KA 4LW8A 5L7TA 4FHGA 5C80A 3BF7A 3UXMA 2JIQA 4HAZA 5FR1A 2HBYA 3REFA 1I7LA 2OV3A 2ZJFA 3V8MA 1UK7A 4GSLA 3PDCA 3KWJA 1N32B 3HV0A 1P5FA 5AKGA 3VR2A 5EKXA 3VJLA 2C04A 5FI3A 4WLFA 2MOKA 5F12A 3CH7A 5CT4A 3GOQA 2PH3A 2VUHB 3RHTA 3IMFA 4P3KA 4DQVA 1UBJS 4EL0A 1WB9A 2EBFX 4BU1A 4JDPA 2QTBA 2O07A 4GGPA 4HDNB 4DM3A 3JZDA 1CUZA 8GPBA 3H9QA 3TCNA 4QHSA 3NIFB 3S27A 2JCGA 3NU1A 4UDYX 4U7FA 4YYZA 3OTHA 4GLFA 5JD4A 3DZKA 3KWMA 3MTEA 3ILVA 1ZA1A 2JAOA 3DLTA 2P2ZA 1XEWX 3NHPA 3UKJA 2H7VA 1Z68A 4ZCIA 2GN1A 3PIDA 4GPTA 2G8NA 5F7OA 2EV9A 3QWAA 4ZWNA 4F4IA 1YQQA 5IP5A 3K0BA 2XCUA 4C0LA 1UL1X 3WL7A 1BH2A 4PO1A 1X8XA 2I6XA 4MMYB 2ZRQA 2XUQA 4G1MB 3CUYA 4OHXA 3OTWA 1BGWA 4RNCA 4BVLA 4KR2A 1CJVC 3FI9A 5KKAA 2ZOSA 4R81A 3LRXA 5EIHA 1Q50A 4F72A 4CYMA 1RXEA 7GPBA 4A0SA 3RFUA 3LT5A 3HI6A 5B7QA 1TTTA 1N1MA 1A4XA 1IN5A 2YZGA 5K3OA 3BMXA 2WU0A 1GUAA 4RQBA 1JU9A 3QOXA 3AG5A 1UCFA 1K6IA 3PNYA 3ZHYA 1E5LA 5J2TA 3A14A 3KQYA 4R9RA 3NIBA 1YS1X 4TV8B 3FYTA 1GGNA 4D9KA 4LJ7A 3G13A 1J2TA 4DUYB 2YICA 2ZSHA 3B51X 3JATB 4M88A 4QUJA 4E6EA 1UBGA 5K2OA 3PUKA 3UUEA 4A6XA 3D2CA 3MWYW 4WZAB 3HWWA 5K0EA 2FSHA 4ZI2A 3LC7O 4PN3A 2ZRKA 3PPXA 4B4UA 3A26A 4ND2A 5JAOA 5T67A 3RBXA 2CLMB 2VYFA 2XCIA 3PTLA 3VKUA 3UEOA 1P4RA 3LY5A 3SKYA 2LDBA 4K87A 2W2KB 1G20B 2R6CA 1NHGA 3R0VA 4NBWA 1F38A 2WSSA 4QT0A 4A27A 4F2DA 1J99A 1EWTA 1BMTA 3M4YA 2P2GA 2YHAA 4HPXB 4ZXPA 4ENPA 4OFWA 2Y1WA 3AHCA 1IHOA 2YWBA 4II7A 1FU8A 4MW0A 1A3CA 1EX1A 4E5MA 2PIDA 3FYUC 4IMPA 4OYHA 4FZ3A 4KH1A 3T1OA 3R7BA 4F2PA 4FZJA 1U8UA 1WEHA 5AW4A 1M2GA 1B41A 2Z2JA 3GT7A 1SKYE 4FJ0A 1HLGA 3TSOA 2VJAA 2R1TB 3DMPA 4QXQA 4R1OA 3QPBA 3NKFA 1ICEA 2R5NA 2FRDA 4CG3A 1HE1C 3PX2A 2O54A 4KAXA 2AR7A 4BO2A 1KKLA 4Q3BA 2AG0A 2ECKA 5EIAA 5KOJA 1B73A 1XF1A 1XGKA 3QFSA 3JW8A 2FFJA 2O50A 1H1DA 3S81A 2BIFA 1K8YB 1P6QA 3ED5A 3NHRA 3FUXA 3D7SA 3ELWA 4OQMA 3CLUC 3VKWA 2PJUA 4IVQA 3RUEA 1XQYA 2QTTA 2XYPA 1HQCA 1NNEA 1BXGA 2QTRA 2VJBA 5E6RB 2VPWA 5I3ZA 1SCNE 5LP6B 2WTNA 3VV2A 1Y4ZA 3AH8A 4JC0A 2NO6A 1Z8NA 2P8JA 4Z7JA 1DC8A 2VBFA 1O5TA 4TRNA 2O2YA 5EZ5A 1J24A 3PHCA 3B3AA 1DIOB 3ELYA 3AILA 3EAGA 1P2TA 3H5AA 5AVJA 3KZOA 3P2IA 3Q72A 3N2NA 2REXB 4WIAA 1IM8A 1BWPA 5CVEA 5H83A 4IJ5A 1TT7A 1J39A 2R84A 3IUPA 1GKYA 4DA8A 5ALVA 3ZU6A 3LPMA 4EYQA 4CCWA 1UT6A 4KX3A 1OU0A 2W2MA 3PC6A 3HJHA 2AQIA 4MRPA 2C1XA 4RHEA 3TIIA 2FUCA 2PDAA 1KPGA 1YDFA 1HYGA 2CCJA 2CK3D 1H6DA 1ZXXA 3R6GA 4WDQA 1NI3A 1KDTA 1DC4A 4OQQA 1E69A 5DT9A 2GPBA 3M6WA 4RF4A 2EZ9A 4UTOA 2JASA 1JKIA 2ZJ0A 4M0UA 2ASVA 3FVVA 3EG5A 3HDYA 3OO1A 5M7EA 1K86A 5PGMA 2CD9A 3AUYA 3U13A 2PBFA 2D74A 1COWD 1G6KA 1YZKA 2H2GA 5EWJA 1HBJA 3K30A 5AT1A 2BBTA 4JIGA 1QS0A 3RVBA 4QICA 4FMBB 1LS1A 1YS2X 2O7SA 4RA9A 1XC7A 1QIDA 1VHDA 2YRWA 3MQ2A 5COAA 4JBIA 2IOYA 3BE4A 1V7ZA 1Z26A 2GCOA 1IUPA 2CL7X 2INGX 1KJWA 1M83A 1TYAE 3FE2A 3KUXA 1QVRA 1KI4A 2VZLA 2YWFA 5COBA 4TQ9A 1HI9A 1T4BA 1E1RA 2FZ4A 3LL7A 5FL7D 1T6ZA 4NL4H 3R7DA 2GHIA 3A6LA 1DX9A 5AQ1A 5H02A 3N9IA 4FDMA 4FI3F 3KAKA 2ZUSA 5B1YA 3A1VA 2CE2X 4EJMA 2B1RA 2GBLC 1POWA 3HRIA 5TQVA 1H2WA 3B5IA 2HRBA 1E64A 4GO1A 5HGJA 4Z86A 4FJ2A 4KO4S 3K8ZA 5IKXA 3LBIA 1EP3B 1M3SA 4BX8A 1OAOC 3BWVA 3DVAA 3N86A 1WE2A 2P2CA 2XVZA 1EFVA 2XYVA 2YMLA 1Y7PA 4Q4HB 5F3RA 3RU2A 1C7EA 2ZRBA 4F2HA 2NZYA 4AURA 3W1WA 1VSUA 4IMRA 4BMXA 3B1YA 4BO4A 3QPWA 1G5HA 4MQ5A 1Y8CA 2Q1UA 5LCXA 3AY3A 3GC6A 1N0VC 4IMJB 4XIJA 2X76A 1YRYE 2R62A 4FGWA 4PQRA 5CFOA 2QN6A 2BAGA 3IJ5A 2Q0HA 1IFXA 1WP9A 1YS9A 3VUFA 2IBTA 3VU8A 1SURA 4RCYA 2CW5A 1CZKA 2LTAA 4QQNA 4DQ0A 1GM5A 2C4NA 1DEAA 2VG8A 3DO8A 4JY7A 4K6KA 1C3JA 5KDDA 1GA4A 1NBMA 1NW7A 3E82A 1RZ3A 5TARA 4CQMB 1ECFA 2VPZA 1AOXA 2WDPA 3ZY5A 4XGQA 2OUIA 4BEBA 1CUGA 2EKPA 2JI9A 4XWKA 1OZAA 4U2BA 4CDGA 2NYRA 1MX9A 4G63A 4C7XA 1IQ0A 3L18A 3HM9A 1N2HA 4KP7A 2PE5A 4HBZA 3LDAA 4ZREA 4O63O 1KEKA 2JAXA 4MUKA 5SY9A 3IERA 5F5LA 4ZDKA 2P3OA 4E03A 4BLQA 3T7AA 1Q1ZA 2J7PA 1U2GC 1UP6A 2CNLA 3NTVA 4QNMA 5B1DA 3FZYA 4ZALA 5FOWA 1ZA2A 3D8NA 1REQA 4IOMA 2GPWA 1ONNA 4GWGA 5AK0A 3B78A 1QH1A 4Q3KA 4P3OA 4HVTA 1WSAA 4P58A 3ZR4B 4DMHA 5KQGA 3O8OB 2GCNA 3VMMA 1ZIXA 1OFTA 4IJQA 1OBFO 4YAWA 4EJSA 2PXXA 3AP3A 3C85A 3RSCA 2I4MA 5EJ6A 1K7XB 4MV6A 2C5AA 3R4VA 2R9VA 1RZVA 4C5AA 4QUGA 1RRPA 3H86A 4O33A 1GG5A 1RVDA 2OVBA 4CMEA 3IA2A 4E0BA 4FB4A 4G0ZA 3EEQA 4BTVA 5KKCA 1IYZA 2PBZA 5G40A 2JFZA 2B61A 3D5QA 5KYUB 3V1LA 1VBFA 3KR1A 1EI9A 5T6BA 1ZKDA 1RP1A 4AS2A 1Z37A 4D0GA 4Y98A 2J3MA 1CS0B 4RLHA 5E4TA 2OHGA 5G4LA 2AT1A 3GVIA 5SYNA 2D59A 3GZ4A 1Q0QA 4MQ6A 4ARCA 4G81A 1QM5A 2YWGA 4PPNA 1Z9BA 1J21A 3KALA 2KLBA 3VYVA 2QW8A 1IBKB 5BNIA 2ZTVA 4HXYA 4BAZA 5AI9A 5AKKA 1B26A 3OZRA 2ZUDA 5FF9A 4TN1A 3CZRA 2KW5A 4LDNA 1DKRA 5D85A 3SYMA 1GCOA 5TT1A 3UH0A 4GQBA 1ESMA 3PQ8A 4LJRA 4M1QA 2CKDA 3WXMA 1JIUA 2WC1A 1MX5A 3V4PB 1Y8AA 1WCXA 5G41A 4GKBA 4EL5A 1K8XB 3EMVA 2MIIA 3P26A 3A06A 3BL8A 3IRUA 4KLCA 1A71A 3AFMA 2WWGA 4YXWD 3SVLA 1ZU4A 4L78A 5DI3A 4HQ6A 2JJQA 3OAAD 4R9UC 1IIBA 2ZVJA 3CNNA 1R5NA 2C29D 4LNUB 1T3GA 2W2QA 2PH7A 5AW2A 4ZYXA 4BVKA 4MKIA 2ZJBA 5L3ZA 3D6HA 3PYXA 4JXJA 4YLGA 4CM7A 1JR4A 2Z2XA 2F3PA 5DTEA 4OCZA 5FTKA 5C5IA 4REQB 1I32A 1CUSA 1XN1A 3L7DA 1LDGA 3DEIA 3OA2A 1NSFA 1U8YA 1VCMA 3E48A 5HRAA 3HCFA 2MYUA 3Q5DA 2Q27A 5B5SA 4DR4B 1NVMB 5BYBA 1PFUA 4PSUA 4RVHA 4LPKA 3GD7A 4CL3A 5A03A 4S04A 2A3NA 4LXGA 3TOSA 4N41A 5L4NA 4FCTA 4DUGD 3RFCA 4QM6A 2BKXA 4HI0E 5IDWA 1DO0A 2QHXA 4HLUC 3AR3A 3FYDA 3L5OA 3R3YA 5ECGC 2ECPA 4MV5A 3IALA 4ZVUA 1Q1EA 4ZODA 3E3NA 2WAOA 1DHTA 1CY0A 2PO5A 3MYRA 3OQJA 4ESHA 4RPKA 5DISB 3K0SA 1DAIA 4KMRA 1R0LA 3G8DA 4ENQA 1NU8A 1IPFA 3HBAA 2ZB2A 1G8PA 1CZUA 3IPRA 3VOSA 5LQRA 2ZT7A 5IT9A 3K70B 4R98A 2PLWA 4CMIA 1GZ3A 3KYJB 1DAGA 4KVGA 1USIA 3HCWA 1Y4DE 3QEOA 2OGSA 3URKA 1L9XA 2C4WA 3ABIA 3ADOA 3O03A 4DAEA 1G5IA 3DBOB 3R3WA 1PCXA 4A2CA 1KJYA 3PXBA 2F1KA 2XCLA 3EA0A 3FPCA 3HZZA 1IDOA 1V9CA 3NHMA 3M4ZA 1Z7GA 1ODJA 4MEJA 2IPNA 2DKNA 2R7AA 1ABFA 5EUCA 5BR8B 2GAAA 4WOJA 1Y9JA 9LDTA 1TMYA 2OBNA 3DE2X 1XVVA 4GH5A 1GQFA 4F86A 4H08A 5JW6A 1BXKA 3QEAZ 5T8KC 3TS1A 1ES9A 5DX8A 2ZBUA 3P9ZA 4N3CA 5H9WA 1IXSB 1W5TA 2H31A 1Y9AA 3V97A 1E58A 2WQZA 4YRSA 4XSGA 2C3MA 3KU4A 4IRXA 4PLPA 3IIJA 5J2UA 2NQTA 1GTG1 1IBSA 3WJ2A 3U3RA 3OFJA 1Y98A 4CEJA 2WABA 3WLMA 4FDVA 4F8JA 4WVFA 3RPEA 1JAHA 3KSAC 1WF6A 5IZ4A 5AESA 3U7EB 1OC4A 4GAEA 1VQ1A 4GGMX 3U26A 1Y5IA 3LT4A 3LV8A 4MQ4A 2FI1A 4X97A 1Y5LA 4RK4A 5TT0A 2GLTA 3F98A 4QGHA 5JSZA 5HKKD 5LA6B 3HGMA 4QASA 3BPSA 4XA8A 4FI3C 3FVQA 4BLRA 5GJBA 1N5DA 2YV4A 1CE8B 1G7RA 4Z0TA 1GKKA 1WW3A 2HXSA 2H3HA 1LB1B 1NYLA 2Z5VA 3LBAA 1ISIA 1P3JA 2I80A 1V2HE 3NHZA 2DFDA 4WRRA 4J9VA 2I9KA 4YALA 1Z5NA 3OO0A 1PQPA 3THSA 3GH3A 1EBFA 1YI8A 1OBCA 2YXPX 5FLEX 3CKKA 2QV0A 1E8MA 3RT1A 3VKHA 2IODA 3U2QA 2V4MA 4OH1A 4Y6RA 1KI7A 4EHBA 4H3VA 4YHHB 3P2YA 3THWA 2BH9A 2BCGY 4IYJA 4KQ9A 3QP9A 3JAWA 3NYRA 2O1EA 5BNTA 4EH1A 3F6YA 1U9JA 2XGOA 4RQAA 1FFGA 3GN2A 3UAXA 4I5DA 1U2PA 3TRHA 5GJCA 4JU8A 2GLUA 1LGYA 3H1TA 3FMPB 1DV1A 3DF9A 3G5MA 2XNSA 1ZNWA 5CYPA 1A8SA 1N5OX 4FYJA 4RVSA 1NMEA 1MTOA 5KVCA 1RZRA 2IEZA 4FT4A 2VRWA 2NPFA 1GNLA 3E0XA 1D1PA 4YMTA 3O2JA 1J23A 2GHRA 2F1IA 4OP3A 3E9NA 4Q7LA 3ZD9A 4DLVA 5FEMA 3AUAA 2UZ1A 3ZV3A 2Z9DA 4NDNE 5I47A 1KC1A 4KV9A 3DDNA 3KAJA 4HEQA 2O7RA 4Q9JA 3H6GA 1XK7A 3L84A 3IGFA 1ICIA 3KP1A 4GG1A 5AJWA 3IBTA 1VMKA 2HU8A 1FX0B 1PWYE 1XCMA 1GFWA 3KOYA 4DEXA 3NX4A 1STOA 1MXFA 2M32A 3B8HA 3ER6A 2HMWA 4OGKA 4OVKA 1EIZA 1GKUB 3M1AA 3O5AA 4OIFA 4BB6A 4DJDC 4DN6A 5DI9A 4RL6A 1USWA 1T1GA 2QMQA 1NXTA 4JLKA 3R8CA 4GL2A 4UNPA 2WIJA 2OESA 3ETHA 3OFNA 3DTNA 2QXYA 1V45E 1QQ5A 4PS0A 3JPWA 3FAKA 3QNMA 4J07A 1Z3CA 1EXMA 2XNDA 4KQ1A 2GD0A 1KOJA 2CJXA 2BBWA 2BFMA 1I0LA 2I9PA 1RS0A 3K72B 2GJSA 3FZQA 3ZWNA 1PNTA 5HJ2A 3LVBA 2O5VA 1EA7A 3E18A 4YRNA 5FA8A 2OE2A 5JD6A 4KVZA 4FEYA 1EFTA 1GRCA 2C8JA 2J5BA 3K35A 1WB6A 2C88A 5HZMA 5T6MA 1ADJA 2HSWA 5DGDA 5IVKA 1QH8B 4UBLA 1TM3E 1O94A 2HJ9A 5ABPA 5LXTB 2EX1A 5FEUA 4JUAA 4I4NA 5ITZA 4TXNA 1OR8A 4DIMA 2F4VB 2I91A 3QVGA 2VNHA 4BKMA 4BUCA 3MAGA 2PL3A 3KTDA 3GEGA 4IIXA 3K5WA 1W7AA 4J2OA 3FHTA 1PAUA 4MW7A 1UDBA 5TPWB 4FGZA 5JD5A 1L6RA 3PHBE 2CJWB 2DWOA 5GGXA 3GRAA 1MV8A 3LA6A 4DV5B 1WXXA 2F48A 3JYHA 3T9CA 2ZZNA 5DULA 4EO4A 4OAOA 3RJ9A 1M0EA 5I8ZA 1XXHE 2YCBA 2G88A 1JALA 1FDSA 1BEUB 2NV6A 2WIKA 3JYLA 3PVZA 5DB4A 4Q9HA 4C0QC 5JCPA 1ZHOA 1ZVJA 4J7XA 1JG3A 1JLLB 1FP4B 1AF7A 4XCQA 3F49S 2VIIA 3HCDA 4H1TA 1GSIA 1K7SN 1DG9A 5AHXA 3UWOA 1CLEA 3EVAA 2ZIFA 1WCIB 1G5QA 1M2KA 3KQVA 4XASA 3MWFA 3OICA 4YBRA 4KQKA 1DJQA 2FUG1 2YBEA 1MOSA 3LNCA 5JOQA 2O8FB 1K98A 5EVCA 4JI4B 4QOJA 1SOVA 1VFPA 2BHNA 2IGTA 3CNQS 3H2GA 1ILWA 1W4CA 5ESXA 2PKWA 2HMVA 3BXGA 1QPGA 3MJFA 4OI4A 4PLFA 3WRYA 1KMNA 3BEOA 5KNBA 1T13A 4ZEMA 5KQPA 1L5SA 2BUBA 2GN4A 5E8JA 1F2VA 3VDNB 1KC3A 3GLFB 5A3VA 1DJMA 3C6KA 2QB5A 3ICWA 2WIDA 4RL4A 4ZAFA 4JI2B 1Q0PA 2ZYAA 1E62A 4U0JA 1E77A 4ENUA 1NRWA 4EPYA 4KXYA 1JKFA 2W83A 2P7HA 3IIMA 1MZPA 3IVMA 2A0KA 4BCCA 2UKDA 2XTAA 3A31A 3JQBC 4JI1B 3WSVA 1ML4A 4A73A 2W22A 4YUAA 4PLCA 2H2DA 2WUFA 5FT9A 4Z7OB 2CCGA 5I6DA 5EKSA 3C5HA 1ZD5A 4U3JB 4AO7A 2Y4OA 1GAEO 4FN5A 1P0CA 5EMLA 1E9BA 1XR3A 1T8RA 1WBBA 4OO3A 4PYKA 5AOCA 1JPVA 3GBPA 2YWCA 2JNWA 3QE2A 2DR0A 2JB9A 1FFBA 2FSFA 3H16A 3KHUA 3MLEA 4Y2JA 4E31A 3LHIA 3E9EA 4FP9A 1GTMA 1JWBB 4PZEA 4PLZA 2DWUA 1MO5A 2GDJA 2VBIA 1TA9A 2BWJA 2Y1FA 3JQDA 4RHTA 5JCOC 2V7VA 4BGIA 4DWWA 4E5UA 3SQOA 1Q84A 3LCUA 4MYSA 4B44A 1I9CA 4CHTA 2AC7A 2H16A 3NKVA 2ZAYA 1NVUQ 3A7EA 2YZ2A 2MSWA 2Q8NA 1KEEB 3REOA 2YV5A 2HSZA 3FNBA 3N6VA 4DVGA 4MK4A 2PXCA 3SXPA 3ZEAA 1U28A 2H1WA 3B3FA 3TZ6A 4MRRA 1KBOA 2VAPA 4D43A 1QG2A 1K92A 3O3OB 1BHJA 3U49A 3UATA 3B70A 2G9VA 5A4DA 1F0NA 1MPTA 1WABA 3EOAI 1V7CA 4UBOA 4W5HA 1B0AA 4AMZA 1DQPA 2O3JA 4KR3A 1MT3A 2J0UB 3P45A 4QEKA 4UOZA 3E23A 1FVXA 3MCUA 4Y6SA 4A8JA 1WAMA 2XUHA 3ONWA 3FDZB 2WAXA 4RF2A 4UBIA 4UXHA 5IUKC 4N76A 5TVGA 4RFVA 4EKIA 2XX3A 1TKAA 2IYUA 3FTCA 4JEIA 2XVMA 4NABA 5AICA 1KJNA 4UM9B 1U63A 3EYWA 2AG8A 4TL6A 5SY4A 1C9NA 2C5SA 2EF1A 1BZYA 2V97A 5JALA 1E6EA 2WA2A 1XUOA 3CLSD 1CUXA 2IEAA 1JQLB 2PZ8A 4C1BA 4E46A 4V3CA 1L5KA 3ZH9B 5DN9A 1ZU5A 2E87A 5CMLA 1EK5A 1FP2A 4EHKA 4HTAA 3R9XA 2OGWA 5IH7A 1JPUA 4HAYA 5ALTA 2GEVA 4I4TF 4M2LA 1PTJC 3EA4A 1IN4A 3BIWA 1LU9A 2WTXA 4I0WB 4BPBA 2PUHA 4F85A 3QLVC 1NYQA 4KI7A 1V4BA 5AVQA 1T2FA 5K3SA 3E9YA 5REQA 4LYDA 4RO0A 3EOBI 3R0QA 4GI2A 4YJ3A 3U7IA 2H4ZA 5G53C 4CKCA 2PMEA 4MDEA 5CLLA 1DE0A 3K8YA 4HLNA 2HYDA 3H2ZA 5DNWA 3LZDA 2HAEA 4RIEA 1KMHA 3JQAD 5I9LA 5DFAA 2PZEA 3DG9A 1KSJA 3NBFA 2O3QA 4YUZA 4S1WA 4BMOB 2V6BA 3NGXA 1E3MA 4Y6QA 5B57C 3AP1A 2CLSA 2IV3A 1S1MA 3W05A 3IDAA 3CV3A 3NBUA 1P3Y1 3UT0A 1TADA 1QOQB 1XZBA 3SSMA 1N0IA 5IC5A 4RTSA 1JG2A 1DS6A 4PYJA 1TZMA 1W1WA 1SBCA 2P9JA 1RC0A 4I5EA 1H65A 1RLTA 1UJBA 2XVAA 3FPLA 3QOFA 2GN0A 3BJEA 5HK9A 2P9ZA 2XE8A 3O82A 4FYPA 1D6SA 4JB3A 4DIUA 4C4OA 3RAFC 1OH8A 4B76A 1N3LA 1WB5A 2XXAA 1NR5A 1L2TA 1H4SA 2EKZA 4XI9A 3RU9A 2OLJA 1TM4E 3B3GA 3QGMA 1PI3A 3HY6A 1G3UA 3VR4A 4LXHA 4REMA 1WCWA 4OQNA 2ZIUB 4KFSA 3UJPA 4EG3A 4A8HA 2YJ3A 1SQFA 5FOTA 3WC4A 1L1FA 3GLIE 4INAA 4M9QA 4DQLA 4E4YA 5LKAA 4MVJM 1PBNA 3IJEB 1W1UA 2J9XB 2NSYA 3UMFA 4EY4A 4D2IA 4FNGA 1X70A 2ETVA 2JH3A 1H2RS 1EWVA 2YFQA 5CYFA 2GFHA 3OWOA 1LK7A 2XOKA 1I3MA 2OHXA 3EFOA 4U02A 2I67A 3C45A 4QWWA 2WKPA 1R8XA 2ZT8A 3WICA 5BVGB 3C1UA 3V6LA 4KE9A 5KNDA 3RFFA 4QYMA 1VKNA 3TZLA 1VL1A 2D4AA 4CG1A 4PFKA 2I1LA 3O3CA 3BVPA 3QHPA 3KYCB 3W5UA 4YRRA 3RIGA 3VSAA 1POXA 3L7AA 4LBYA 2WJPA 4TX1A 3TOXA 1I7SB 2YXEA 1IBMB 1JBQA 2XJ9A 3DE4X 1XMVA 1R4ZA 2D2EA 1E4OA 3NYQA 2VXYA 5JAHA 4BJ6A 1ENZA 3LZCA 4M8KA 2BEVA 3WADA 1NN1A 5JWHA 2LE0A 4H7DA 4OB8A 4PTLA 5AKJA 4DC1A 1KK1A 1Z5PA 5LZ4A 4WCFB 1A88A 4D57A 4PONA 3HDQA 4WOCA 1QZUA 3SQDA 4ED9A 4UM7A 2ORED 1EAYA 3PNLA 3UT5B 4B3FX 2H4WA 3SIXA 4EMSA 1QZ3A 3ESBA 5A02A 3TX2A 4CRWB 1EYZA 3IT2A 3E7FA 1OJLA 1JEYA 4FFBB 4UDNA 3QW2A 3T5AA 1XD8A 1P0IA 1LK0A 5J5VA 3WK9A 1I7QB 4LI3X 4KWHA 5EWLA 3RD5A 3EXFA 3TB6A 1IHUA 3GG9A 1Y6GA 1RYHA 3PPWA 3LUHA 3ZGYA 1RE0A 3UHOA 3PD1A 1D03A 1IIRA 4FDLA 4J0JA 3WNBA 4A23A 4BVBA 3PWSA 1M1XB 4D8WA 2RK6A 1ETUA 1L7EA 2P3LA 4FFSA 4DRYA 4FGSA 5LZ9A 2PRKA 3EPPA 3G2QA 10MHA 4E2YA 5AP9A 1VJ5A 4LK2A 2V4ZA 2JLXA 1ISRA 1TTPB 4BLWA 4D92A 4O4IA 3F4BA 4HHEA 2YHBA 1NQTA 2YX1A 1II0A 4IFEA 4WK4B 2BLLA 4D3SA 3GCGA 4ESOA 3V46A 1RAFA 2O0LA 4HB0A 4V0SA 1N6LA 1U7HA 3NB0A 2ONZA 2W2NA 3AI3A 3NEYA 4ES6A 3OZFA 4KREA 4OJNA 1NF2A 4DR1B 3IEVA 2X7XA 3N1UA 3W4IA 2ATIA 3FCSB 2IOQA 4QWMA 2DPGA 2JGLA 2MR5A 3NTQA 2GS9A 4LHSA 4UEJA 3ZWBA 1J0DA 2HIAA 1GUYA 1M2VA 1JX6A 1YOVA 3SKVA 1KZ4A 3I9NA 4LCBA 4OHCA 4BNFA 1AGYA 5JCXA 3BH7A 2K7FA 2H1IA 2W6ZA 4WK0B 4ZT6A 2BGRA 1PT8A 2FRDC 3N0XA 3V7NA 4EABA 3ID6C 4TXJA 3WY9A 1TZKA 4GZ3A 1UAYA 2CNDA 2OZVA 1Y9DA 3BD6A 4N5MA 2VPYA 1RQNA 4QDOA 4U5QA 3OZ7A 3ZGVA 1T6NA 3UN1A 1W36C 4N82A 1QLJA 1YA4A 2GCEA 1IM5A 2VF5X 2HRZA 1NI5A 3AEUB 3PP8A 1U81A 4XLLA 4D0NA 5TV2A 2EFCB 4IH9A 5DK6A 3TXAA 3OZBA 3LT1A 1W0KD 4UHJA 4NZMA 5EHNA 3D4LA 1E1CB 1GN8A 1QIFA 1UM9B 3V4ZA 3V4VB 1IAQA 2C1EA 2R1VA 3O38A 3IURA 4EG4A 4YIHA 3WYGA 4BP1A 2JK1A 4RGVA 4D42A 2B4YA 4GQAA 3ORSA 4Q3EA 1ACLA 2ZPAA 2NYVA 3FHLA 1MNAA 1NYTA 2P11A 1OKKA 1YO6A 2BM1A 4KXLA 5CFPA 1RQ2A 1FX1A 2IVFA 3UF0A 2ZATA 3GJ3A 4G8DA 1GQ2A 4AAYA 5J47A 4JZKA 4DJ5X 4D97A 2CWWA 1Z5WA 4F45A 1K8ZB 3JRXA 5HG0A 4RXMA 4OOFA 3ZCRA 5M5BA 4WZBE 3VNBA 5ES4B 4Q4CA 1F2TB 4BDTA 4DPLA 4P4UA 3GLGE 4D3FA 4EY5A 3HM2A 3ROXA 1U7ZA 2NZXA 2ACEA 3SXUB 3ZHZA 2P2SA 2UVPA 4B75A 5CB4B 5J2UF 2XZOA 1NJ1A 1R8JA 1GWNA 2UVQA 2P6UA 4UMDA 4B8YA 1OA1A 1JYSA 2PJDA 2FLWA 4UQLA 2D1SA 4TMKA 2HA3A 5J5CA 3H9UA 4OX9Y 1N5RA 2ICAA 5K0TA 2V7XA 1ZDMA 1VLMA 1WRBA 2FEPA 1GPH1 2QZPA 5TJ9A 4LYAA 2OYCA 1S0UA 3HI4A 2VNKA 3IT3A 2IHJA 3L8EA 1H22A 3LNTA 1V8PA 3ZXIA 4BQEA 4YX9A 5F9HA 4EGAA 2OMEA 1GYRA 5A3QA 2QUHA 4Y2SA 2A9PA 2Q0SA 4C4AA 3B3QA 1R1DA 4EPWA 3TEMA 5JRDS 4J9UE 4CMCA 1T43A 2F43A 1KKMA 3DF7A 2VSOA 4EDFA 3F78A 4PC3A 5BOSB 1DFGA 5EIOA 1Y5MA 3VHLB 3OZWA 2Y93A 1V1MA 2EL9A 4PG7A 5AKXA 4B7CA 2R7NA 3MM4A 5TS3A 1QONA 1R50A 3U44A 2FNAA 4PG6A 5JZSA 2QR2A 1GT6A 2HSGA 1H6CA 1OAKA 3R4CA 4K6FA 2COEA 3DWGA 2YMMA 3UK6A 3DVRX 5CM9C 2JEYA 4E88A 2AWOA 3LLCA 3U4CA 5D3KA 2G67A 3EPKA 3NXSA 1QTNA 3MRVA 3V4RA 4AZTA 4XYGA 3L93A 4PY2A 4YAUA 3A4TA 1Z2PX 3UMMA 3LP8A 4D9IA 3ZTTA 5BWLA 1OHHD 2NIPA 3O8CA 4H3SA 2PZMA 4AO6A 5IVPA 2RI0A 4GI7A 4W6ZA 5H5JA 4UARA 2XBMA 4C22A 4QLOA 1R6DA 1Z07A 1ZRNA 1P1FA 3CWZA 4AX8A 2PT7A 2ZETA 3G2KA 3DLBA 1T8SA 4R8VA 4YP0A 4QTYA 4GR5A 3NAZA 2ADOA 5F21A 1J9GA 2ZM6B 1HYBA 4MW4A 2YJGA 2FSVA 4HUJA 4D9JA 1PT9A 1KI1A 1XTBA 3LD9A 2PGOA 2B83A 1Z56C 4DCNA 2P2NA 5ITVA 4DDHA 4KUHA 5FI5A 2R6ZA 3R5HA 1PHPA 3VYSB 1DDGA 4EG5A 3HHPA 3IP8A 1NAIA 2RGAA 4UUPA 2FFRA 1EUZA 2Y1OA 3SIWA 2D4HA 1E9FA 3CSDA 3CX4A 4X1YB 3WYNA 1CUJA 4C89A 4EUNA 2JJ1D 1ST2A 1ZL2A 1VPLA 1Y7LA 4EJSC 1B93A 3HFSA 2ZBVA 3ZHOA 3HKEA 1ECGA 2X0JA 1GAXA 3WIDA 4IJ6A 4Q05A 2P1ZA 2H65A 4B7AA 4CM9A 2MSEB 4EG0A 1DAFA 3KJGA 3TXXA 4EJ2A 2HADA 1E2JA 1RYDA 4RPGA 3O4GA 5A3SA 4CLRB 4CMEC 5I9IA 4PWYA 2CNBA 1A72A 5KVVA 1H3EA 2I87A 4W4TA 1D2CA 1EVQA 1KFCB 4YHBA 1HUQA 1BGXT 4Q3LA 1EUYA 2R4UA 4DE5A 3ADDA 1YZLA 3KG2A 3R0ZA 2WJ4A 4TS3A 4LRQA 2DFTA 1UFVA 3OTIA 5DHTA 4QC2A 1VFNA 5EZYB 3CT4A 4OQPA 2VZ8A 4M36A 2GLXA 1ECPA 4KAFA 4L4RA 4NRDA 3RO7A 4AJ4A 4CM8B 1VKJA 4F4CA 4E12A 3B6JA 3U5TA 1KAQA 3DAOA 4BE7B 3PEUA 1G5FA 4UHCA 3IKTA 4NOLA 4HDQB 3H5OA 3ORQA 2J6BA 3IO5A 2WU1A 4CEHA 1CJBA 1HL7A 1NXXA 2YUIA 3CPSA 3KXLA 4NY1A 4MVJP 3P9XA 2LCQA 1R8SA 4G23A 1DAKA 3FPHA 2XT6A 4HL6A 4RTJA 1PDWA 1UKZA 2Y1KA 5EZSA 4YPFA 3SZUA 5CA0F 4YMIA 3RHZA 4EB8A 4KGVA 5ALIA 3L8GA 1ZD9A 3NBQA 2CNWD 4NX2A 3RSFA 4D8UA 1NFFA 4MV7A 4X0EA 3PEEA 4MVJF 4WASA 2IUUA 4FOLA 1Y1PA 4FC6A 2O3TA 4I3GA 1EFCA 1QHIA 1HXHA 4Q7MB 2O8DA 2KHZA 1I3LA 1MABA 4C0AC 2ZBGA 3ZCTA 4B84A 4BFXA 4AKTA 2DXIA 1YIAA 4PVDA 5IJ0A 4MVJI 2EQ5A 1QU2A 3S70A 4OUDB 3NWEA 4YGXB 4AIIA 4Z9YA 1UKEA 3PICA 3BB3A 4FMDF 4DV0B 3BGOS 3OLZA 4R7GA 1XTUA 1KZGB 4HQLA 1E2GA 4A03A 1Z2AA 1PZHA 1Q6YA 4JWKA 1W581 1TAGA 4BNKA 4X66B 1RCUA 2A0UA 2DUWA 3D7LA 4YT4A 4DMLA 1XI2A 4R0NA 2P9QA 3UXHA 3NBYC 5EMNA 3BSWA 2QUZA 1U7PA 4JEUA 2I2AA 4JUFA 3MJVA 1C2TA 1O57A 1M7BA 1TF5A 2XNJA 2YN2A 1G19A 1JEEA 3DTVB 1N7IA 3LKBA 2VF2A 4QG7A 3K9LA 4L73A 2VT7A 3ECAA 1TE2A 3EVGA 3U1BA 1Z0AA 4XAQA 1ZITA 1PKXA 1A04A 1DDIA 4OLFA 4CIWA 5FYQA 1CW2B 1BJTA 4XWOA 2P6NA 4YRFA 3PC2A 3BBPA 2WQ7A 1VYUA 1IY1A 4TYMA 2HK8A 1PEAA 4QBFA 3VHRA 2E4WA 3INGA 1TKBA 3QVJA 2A67A 4PZDA 4KQ2A 5FUWA 3L92A 4DGQA 4MCAA 1ELOA 1V9SA 3PUWA 2FPPA 4NG4A 2ZXUA 2I8AA 2OXEA 4LKOA 4C20A 2X6TA 3SYKA 2GD1O 1FW6A 1LPNA 3E7WA 3GPDG 2XECA 3FFWA 2FRXA 4HS9A 4RM3A 5JAIA 2BMAA 3C6BA 2FZVA 2C83A 1E1QA 4FQ8A 4MB6A 1JR2A 2GK4A 2FVYA 4J1QA 4PQGA 4XPIA 2GPTA 3EDRA 3F4KA 2GTPA 4QJ4A 1SVWA 4FMDB 2RHWA 4H35A 1G2OA 4ARZB 2OAEA 3HRHA 3IEUA 5DM1A 4AZ0A 1C9MA 1YS4A 3VHQA 1CUIA 1MAWA 2VJCA 1JSXA 2CFCA 1PU2A 4DABA 3IP7A 3O92A 1KDVA 2MYTA 5FP0A 3L4KA 2Q3DA 1TRKA 2RHGB 4MW9A 2BE7A 3D3EA 1WXGA 3IUYA 3S6JA 3TBHA 3W3AH 2H17A 2HA7A 2GN6A 3H5WA 3BORA 1PQ4A 4FFWA 3KS9A 5DCWA 2OSVA 4EKDA 4YCAA 5JBQA 2QENA 1D6NA 2YIVX 3ANSA 2Q8PA 1XMQB 5CM2Z 2H54A 1LRKA 3GZNA 3M70A 4YRQA 1KMQA 4QFDA 3V55A 4QBIA 1IMOA 2TECE 3JQ6A 4P3PA 4CTOA 1F6BA 4B82A 3CISA 4CCAA 5HKOA 1PYOA 1ZI6A 4QDKA 1ZOPA 3F0TA 5CPFA 4UU8A 4PG8A 1CUCA 5K01A 3DW3X 3KPVA 4F6CA 2PSDA 2WF8A 3AF0A 2FLKA 5E4FA 1Z12A 5A1TA 4F93B 3TLMA 1GPLA 1A9SA 4JA0A 4G6ZA 5HS6A 3UGQA 3FRIA 3TQFA 5JVDA 2QYOA 1F12A 2I6UA 1F2UB 1AUVA 1SOMA 3DEYX 3TMAA 5FIUA 1RI5A 3D1LA 3D7KA 1KY2A 1R0ZA 2J41A 3SDSA 3BWBA 1Q16A 2OXIA 2EQAA 3W8FA 1FMJA 3OESA 1LZKA 3VX4A 4M54A 3WNQA 1FW8A 3PDWA 3K3PA 2C2MA 4LZAA 4U2CA 1OTYA 1JYEA 1OT5A 4YV2A 4ABTA 4X7BA 3AHIA 2JGAA 4JQCA 1P9OA 3FOBA 4GOJA 5JV5A 2ORIA 5DBFA 2JLCA 2N42A 4EJ0A 2QGNA 2F9MA 2PV0A 4BNMA 1W35A 2XB9A 5THKA 1ZLYA 2FH5B 3HTXA 4MI3A 2QAGA 5IC6A 3LXUX 1WG8A 5ALFA 3SJ7A 1MH1A 2IXGA 4WNYA 2E5LB 1YHYA 2IPAB 4Y2PA 3A1NA 3EIHA 5TE9A 1Q7RA 4RORA 3HNRA 5KQLA 3WGLA 2V45A 3GJ5A 1LPAB 4LQLA 4MJXA 1UKVY 1RSZA 1R4NB 3DMDA 4KH0A 4L51A 3GPCA 1O77A 1D1SA 1CZLA 4H7PA 4JIMA 1VB3A 1YZUA 4PO8A 3MWJA 4CMKA 4MGYR 2Z95A 4M99A 4OHYA 1NZDA 3V2IA 1ZOSA 2OBYA 1A7KA 3REGA 3VFDA 4O3MA 3P9YA 2JFHA 2BBSA 3U4MA 2V4UA 1PBTA 4NBRA 3K6RA 4ZO4A 1IE3A 4R16A 3QQPA 1K66A 4P32A 4DIDA 3U1TA 4URZR 1CQWA 1G8JA 3MOSA 3T3OA 3MB8A 3MGGA 3MWEA 1CUYA 3ENWA 2SHKA 3QYJA 4CG2A 1E4EA 2NO7A 3K6SB 1O94C 2WMNB 5F4BA 5IH3A 4TYNA 1RQLA 3SAJA 3NTRA 1Z5ZA 3BMQA 3QLTA 4N0PA 4UFNA 2FN8A 5HILA 1JTEA 3JQQA 3G59A 3JXEA 3NFYA 4B3BA 1UJ4A 4MVJH 2O4CA 5IW8A 3T7TA 3TE6A 2AFHE 3ZWMA 2BHRA 1NJ6A 1WULS 3UMYA 2Z56A 2XDQA 4QLBA 3I1IA 5ADVA 3VTZA 1WCYA 2A5FA 4O8ZA 3RF6A 1A2QA 4KBYA 2XTMA 1RWVA 5BR1A 2JI8A 2HKIA 3EZGA 4ALJA 1A8UA 1VMDA 5L95A 1T91A 3U09A 4WBSA 1WU8A 4GICA 2VPQA 3TUJC 4C4XA 3NDBB 1GG8A 2IZOA 1JUDA 1WS6A 5HQ3A 4FZRA 4IIJA 1ZM3A 2OHVA 4U4AA 4ZN6A 2Z6UA 5EQJB 1N8NA 3QUQA 2CD7A 3DVQX 2AOTA 3MVEA 3R3VA 4KKVA 1QOZA 2BL4A 4GOOD 4BX3A 4ESVA 1WEKA 4M8LA 4HNUA 5F7JA 1VLVA 2J09A 3KPUA 4JKYA 3STWA 5JMOA 4Z4QA 4OH7A 3N58A 3WRYC 2QTVA 3NOQA 2GSWA 1L6IA 3RARA 3CE9A 1VC2A 3G1TA 1A1VA 2C4VA 2Z0MA 4S1PA 2GI4A 4NONA 3S8MA 2XUZA 3JARB 1T0JB 2YNMD 2X8JB 1IXKA 3PFFA 5JSQA 3QE4A 3NUGA 1QF9A 4C0BA 3ZQ4A 4GM0A 5F7XA 1XQVA 4C7VA 1ZK2A 1A9ZA 3I1JA 5L45A 4V0ME 3KFVA 1BYIA 1KXJA 3BGSA 4X8MA 2X0DA 1HNXB 1C14A 3F2IA 1J8QA 3HJFA 1ZGJA 3BF8A 5ED4A 4MQFB 3EHDA 4X7MA 3VJMA 3GW8A 2IF0A 2DVMA 1U0JA 4BLUA 4MHOA 5EXTA 1T8TA 1MF7A 4URWR 3W04A 3TEFA 1T4CA 1SCUB 4OKIA 2NU9A 1GVHA 1RJDA 2QS9A 2ZIGA 2PGNA 1SGWA 2OCIA 3FIUA 2B78A 1RMYA 2AN5A 5ADWA 1T34A 1W85B 1GXSB 2PSEA 3L1HA 3NHLA 3V7UA 2GM3A 3K2BA 4AECA 3T0IA 1I3OA 1DJLA 1E3TA 1IK6A 2Y9MB 2VATA 1WBJB 2ZWAA 1WMDA 4IV5A 2NO1A 3CLTC 1W1IA 1GOTA 1XQ6A 2HLHA 1OXMA 1DFHA 4F2WA 1U28C 1Z15A 2HF8A 2AMJA 5BXYA 1YJXA 4Z3OA 3FSGD 4XD7D 2C0PA 5LQUA 1HE3A 3CLRC 1CNEA 1Y4UA 3L7NA 4KWCA 1QYCA 5D8DA 1C9KA 1WY5A 3OJWA 4BV3A 4G3XA 4LDQA 4X41A 4WQMA 2OEPA 1TDJA 3OPYA 1E0AA 1PZGA 3X1DA 2BZ0A 4A8JC 4IDBA 5JJ5A 1ZXBA 1U3DA 1Z8DA 4JROA 4HFNA 1K4MA 1EX9A 2Q3BA 2R2GA 2QMOA 3DUWA 1QGUB 3EG9B 3OJOA 4ILEA 4QARA 5LXTA 5LMCA 4F46A 2IPMA 1IBRA 5TXGA 1VHJA 2TMYA 4CIDA 1XHLA 3OQMA 3NHJA 2DTDA 4QQKA 4D4LA 4E3ZA 3L4JA 3QSYA 1JJAA 3AOEA 3O8QA 4MV3A 3QY9A 4JFAA 4UCQA 1E2LA 3PL1A 2M6LA 5A4AA 1Y63A 4OYLA 1M7HA 4IDDA 5FHQA 5TGTA 4G5HA 5DHRA 4GXTA 1JR3E 2QZSA 3PWKA 3QFRA 3TD2A 5JS1A 2VLBA 3L8ZA 4EVRA 5A6VA 4NWIA 4YJFA 3ETJA 4UFOA 5FA5A 5C8VA 1LQ2A 4Y9RA 1JLLA 4NFSA 1ORDA 4L76A 3RS8A 2O2HA 2J9YB 4JB0A 1F6WA 4UC0A 1T29A 5AJXA 1ECJA 5EP1A 4DREA 2PD6A 1WCIA 1BDJA 2EARA 1M72A 4CQLB 5DX1A 1A5AB 1UQUA 2BMWA 3GJRA 3IILA 2OCAA 3PE4A 2CHUA 3ONVA 3RS5A 2BMVA 3DNMA 5D7NA 3FOZA 2BZGA 4BEWA 1V8OA 4K26A 3B89A 4BVHA 5BN3A 1E9RA 3EIFA 1AQLA 1P0QA 4IQGA 1WXIA 3A1CA 1KSFX 4N4AA 2JI6A 4OI2A 2PUEA 3B3JA 1FNBA 2H9YA 4V1CA 4RMGA 3G0OA 4D45A 1BDIA 3QEMB 3C7AA 4LXXA 1QO0D 4NBVA 4HV4A 1RU3A 4NJMB 3L0IB 1XMPA 2V58A 3MC1A 4EI2A 2FZGA 3D8RA 3DL2A 3QA9A 2G04A 3BRWD 3U4GA 5EGNA 3REQA 1B6GA 2J1LA 2WWTA 4CZ2A 1KQ3A 3I2GA 4ZRNA 3PQ4A 4RZ2A 5A4IS 2PGDA 3CZ4A 1JU3A 2FPGB 4MGEA 3R74A 1XYYA 5AVTA 3H04A 2DPHA 4ZGBA 2P69A 2UXCB 2DULA 4ZO9A 2DBQA 2XCRB 3UB3A 1UMDA 3IP3A 3KD3A 1R0XA 5DNEA 4A0RA 4ZEVA 5KWEA 4S24A 5BY2A 2QU7A 4N8DA 1C1XB 3VTFA 1P18A 3P2KA 4WLOA 5CNIA 5HDBB 1JJIA 3ND5A 3U48A 1CIJA 3F46A 2QN9A 4LYJA 1EUCA 1O0SA 1WNTA 3WIEA 4EMBA 3K71B 1AKYA 1FFWA 1JVBA 3HB0A 3QVUA 2OB1A 5EPEA 1RXYA 3I2IA 1D2HA 2R11A 1ISSA 3T4XA 1X2BA 1J7JA 3OPVA 4RTLA 2FN9A 3KBOA 3C1TA 2ZFUA 2GYYA 1USKA 2FZCA 2A57A 1P72A 1Z2OX 1LVUA 1R7RA 5F7ZA 2W2OA 1DBRA 3U9LA 5LD2B 1RYYA 3NR2A 1Q1NA 3KHTA 2W6JA 3HWSA 4GOLD 5B6IA 2FUKA 3FDZA 3T7IA 2B36A 4PFQA 5FPPA 5TQ2B 4AJ2A 2DT5A 4YRPA 2QTMA 4ZC8A 4ZQIA 1SIWA 1FYDA 2JIZD 4LYFA 2FOIA 1YR6A 1PJTA 2DPMA 1SPXA 1YS6A 4YRAA 4ZI3A 2WM9B 3K15A 4HQOA 1ILEA 3HP7A 4A4DA 2R5WA 2O3UA 1HLFA 3C4JA 1JZTA 1NVVR 2AA3A 4DV2B 2A1UB 2CLDX 2GEFA 1Z35A 3BRSA 3DKIA 4YK7A 1FSFA 3RRJA 3SI7A 1IQUA 5A5GA 5IK2D 3W34A 1GHTA 1M6HA 3FOCA 3DEJA 2GK7A 4R2JA 4W99A 1BU8A 4D8XA 5B36A 4XUGB 1I4EB 5CVCA 1OBHA 1WXDA 2QMZA 4JJIA 2VTEA 4MPPA 4FYHA 5DXFA 1OA0A 2AKEA 3HNOA 2VNJA 2CVZA 5CP8A 3HR4A 4DA7A 1ZMBA 2QD3A 4ZZ1A 1U0HC 1T25A 4BBPA 1PNRA 2ZI3A 4IFIA 1QFYA 2PKEA 1IATA 1EH5A 5CB0A 1ZGGA 1YRLA 1N0HA 1Z5OA 4QRDA 5CNMA 4W5NA 4NAVA 3OBBA 5FPHA 1DJOA 4INJA 3ZTWA 4MOWA 3QBTA 2O1XA 2WKWA 1I2AA 4Y1RB 2XA1A 3NM4A 4R5MA 2EZ4A 1XMIA 4PM4A 1K5DA 3E6AA 4DGSA 4EEXA 3GVCA 4DTCA 1BMQA 4RH0A 1RRFA 1NKVA 1IVYA 1SHKA 4LBWA 1YCFA 2C95A 3PSHA 3K32A 4X6LA 5T4FA 2X0IA 3RJ5A 3EAQA 1IZYA 1JXQA 2EU8A 1H9CA 3SNKA 3VYRB 3S1AB 2VBCA 4ZQEA 1TYDE 1ZK1A 4CKEB 2QY6A 4RFLA 1LTHR 3SZGA 1NFRA 3U4IA 4B4VA 1NVVQ 1EGAA 1X7XB 1XTRA 2ZQZA 3NTUA 5FWAA 5K4GA 4BAUA 5LIRA 2UYCA 1G41A 1FUKA 1XYGA 1Z6TA 1JQEA 1KZ1A 2E6KA 2PUBA 5LPNA 1VHTA 4EX6A 2AFIE 3P52A 5K0JA 3BGIA 1B4DA 1UKCA 1FQOA 1W88B 3OQHA 4MWCA 2O4UX 2WMYA 2HU5A 2FEKA 4ZVVA 2C5LA 3PVCA 4C43A 1LJLA 4KSBA 1OH5A 4AG3A 1XZCA 2B4RO 2Q3JA 4JLVA 1FDIA 1FU7A 1M6VA 1YC5A 4I9NA 4NDAA 3RVPA 4UD6A 2GWHA 3L02A 4G65A 4KQWA 3KJXA 1CV2A 4IG4A 5E3IA 4AQYB 1G2QA 3UB4A 4BN0A 1Y5RA 4URXR 3QXSA 4D9BA 2FPOA 3JQ7A 3V8BA 2V03A 3VHXA 3WGMA 5ICGA 5CEJA 1MB0A 2BR5A 3CBGA 4XQEA 3RVKA 3WLOA 1P81A 3LQKA 2XZDA 3I9FA 2FX2A 2ZKIA 3FZEA 1BXRB 3PF8A 1D4ZA 3LXRA 5DV9A 4DYVA 1LDMA 3TOZA 1BEZA 1ZEMA 2YN4A 4Y9TA 3VTAA 1HE4A 4XB2A 1ZOOA 1NXOA 1QCDA 2EJWA 2EYUA 4MI6A 4WN9B 2LR0A 4XR4A 4UM8B 1UBOS 4DQKA 6ABPA 1QVZA 3DE6X 4RTKA 1PJBA 2VI5A 3AERB 3RJMA 3RKUA 4BZWA 2MSCB 3ZKWA 1YKGA 5AOVA 3SHOA 2IY7A 3DZBA 4FW9A 5TSDA 3EZ7A 2QN2A 4EW3A 4JV5B 1OXSC 2MYPA 3A6DA 1C7ZA 3CF0A 3H8VA 1TTHA 4Y8VA 5JI3E 4AY6A 3V2HA 4XQ9A 1DKUA 4DLSA 3I5MA 3CY6A 4H3KB 4S0XA 2VSYA 4Z0HO 5BV1A 3QLUC 3U4QB 5CFRA 4FINA 4P33A 1GTSA 2IW3A 4L6CA 3TQQA 5DTJA 3BG5A 5JS6A 4J3NA 2FA9A 2J3JA 4RTOA 4U2GA 1YFJA 4AP9A 1MVNA 4Y2TA 2ZCVA 5EPOA 3W2HA 1JQJC 2I1QA 2VDJA 4MVWA 4NG5A 1N1EA 3UPTA 1KOLA 1ZY2A 4IDGA 1N5KA 5IYZB 3QVKA 2IDMA 2KX7A 1NJGA 3VPGA 4BCDA 4UAUA 3DYBA 1QX3A 5EZ6B 1NF3A 1CQIA 5L3VA 3HL4A 3F5MA 2NM0A 2NTNA 3BC1A 2A0XA 3P27A 3HO8A 1L8LA 3UK7A 2RGWA 3RS4A 3BMOB 4WUVA 4JI7B 4LHEA 1XJWA 9ABPA 1R9GA 1X94A 5BQ3A 1CEEA 3EQ7A 2A59A 1DQSA 3OCVA 2JFBA 4W5QA 2RIRA 5ITSA 4MWOA 1I3NA 4L7QA 4Y9UA 2IZ0A 1ADBA 2ZQYA 721PA 4IKPA 1T36A 3DLCA 3OQNA 2OZEA 3CSSA 1BH6A 3ORFA 4X00A 2WWWA 3VAZA 4EFLA 4HXFB 2KYRA 5ALYA 4EP1A 1WA5A 4YAGA 3D64A 1QQBA 1GN9A 3OZEA 2BELA 2JK0A 2DBRA 1BE6A 2R44A 1XNGA 2VF7A 1JKJA 1MRZA 1GPUA 4WH0A 3TQIA 4U9UA 4NMMA 1N6PA 4LE0A 1XROA 3FA2A 1KA9H 4J7AA 3ZI4A 2Z2IA 2RI1A 3T41A 4Z1MA 2DB3A 5KAPA 2BBOA 3N76A 4DIBA 2P41A 2FSVC 4TMFA 4DG9A 3VV3A 5JJIA 4C7KA 1FFXB 1DX6A 1P44A 1RHKA 4QEZA 4ITUA 3T1NA 4XTRA 1YFLA 3VNVA 2VTDA 1WMEA 2J45A 4BP9A 2PX0A 3EVBA 3F3KA 4U2EA 4Z8XA 1UBCA 1Y81A 4ZQBA 3AUJB 1QIIA 1A4UA 1S2DA 1AH2A 4AG6A 1Z38A 3RAEC 3E9RA 4NP6A 5F4ZA 3T9FA 4E5NA 5I3CA 3OF3A 5I48A 1ZQ1A 2G5PA 3X1JA 2HA5A 2V54A 4D56A 2AI3A 1T2CA 4UMEA 2CHEA 2RBKA 3PGXA 4RSMA 5AI8A 3ADBA 3QE9Y 4GKKB 3NW9A 1JXMA 4NVRA 4DMCA 3LQQA 1CRLA 3O21A 4Q4AB 3W9SA 3NHYA 4JC4A 3DMNA 4EHDA 5C37A 4QUIA 3T4EA 4IQ0A 1G59A 5F5NA 4F5WA 3SXUA 2CXHA 5EJGA 3BREA 2QSUA 5A6SB 4A6DA 5KEIA 1TL7C 2ZIWB 1NU6A 1Z8HA 2NYUA 2PGJA 3HCPA 3NASA 1BFDA 1YFZA 2V7UA 3F71A 1Y9EA 2O2JA 2WF9A 1U0RA 2CLIB 1A7AA 2YZKA 3CG4A 3Q98A 4PHHA 1X77A 5B1SA 1F8XA 3G9XA 3AESA 2C99A 4D3XA 1YZYA 2QZJA 4EO9A 4QJIA 2JHCA 3T9BA 3RUPA 5CDSA 1FNSA 2W6PA 4G5SA 2HRQA 4HG2A 2PMKA 4X60A 1XN4A 3UW3A 4ZCRA 1UFKA 3KUCA 5CVVA 1OIWA 1U98A 5KVQA 5JH7B 1QRTA 1TO2E 3O2NA 1F60A 4XFJA 1FLNA 5FB3A 1KDYA 4P98A 1SXJB 5I7RA 4D81A 5F2KA 5ALMA 1SN7A 4K0KB 5FFNA 2UZIR 3QEJA 3SZOA 2DBZA 1A97A 2ZYWX 4K9OA 5JCJA 1Z4KA 4QM7A 3LBFA 4FHFA 3GIDA 4W5RA 1J6UA 1QSGA 2AXPA 2WUWE 3VVCA 4HLCA 1TZCA 1JNYA 1PF7E 4XIGS 3AXSA 4JQOA 3CIFA 2PV7A 1X87A 3NBMA 4HYEA 2QWXA 1C9JA 5TB5A 5BWNA 3A0UA 4QAJA 2ZVDA 2O2GA 3OTGA 1DTWA 1UZUA 2FSIA 5CRIA 4M37A 2WNIA 2IUEA 4BVEA 1AT1A 1YZTA 1C80A 4N7MA 1AN9A 3HCNA 1A9QA 4P5DA 1VGVA 4F4HA 3TF5A 5L3SA 3FWYA 3UAVA 1T5TA 2QL6A 3VPSA 4B3CA 3KZMA 1ZVVA 3R23A 1VIAA 3MMXA 5KWSA 1E3EA 2HMUA 3B13B 4LPSA 3WGVA 1BAPA 3HXPA 5TMDA 2GOYA 2V7TA 3JWPA 5FWDA 2GJAA 1I10A 1EXDA 1C5KA 4BFWA 3K9QO 1II8A 2O5RA 2XF8A 1KZ9A 1QAMA 3CN9A 2J59A 3HKCA 1TAHA 1FBNA 1L8XA 2MINB 3KQSA 4XJXA 1G21A 2PA3A 4PYRA 3LWZA 5AI6A 2QUKA 1ULAA 2X5JO 4KX5A 5JUWA 1DIRA 4LGMA 2W2LA 3WNDA 5CJ2A 5GMOA 1HEYA 1YTLA 5B2EA 3TRDA 3K0HA 2XWPA 2RGBA 1D9ZA 1PL7A 2RH5A 4NZOA 4OUKX 1ORWA 2DOKA 5G1PA 3NM5A 1SA0A 2GFQA 4LRSB 3FLMA 4MI1A 3T3IA 3GQBA 4B3HA 1EG7A 3B48A 4OGFA 1NBWB 1IC6A 2ONKA 4ML3A 3EF0A 1NQUA 1ZR4A 2ACKA 1KE1A 4CMJA 5IJWA 5J63A 2ZVQX 1OZHA 4QIHA 1TUBA 1XVTA 1U7UA 2FPKA 4KXMA 3I5UA 4FHZA 2I4RA 3NAMA 1K97A 1TK3A 2NUTA 2ZKLA 3GGPA 2EERA 3OPYI 3PA6A 3QY0A 5B1EA 1RRKA 1XP5A 3EXG1 3ZDCA 1F0KA 2QV7A 1LFAA 4FSDA 2VAMA 1RYNA 3L4EA 1HC7A 2A9QA 2VQDA 4HJXA 4LJ8A 1HA3A 2XMSA 1HM5A 2I2XB 1DC6A 1D4FA 1XTIA 3CHYA 3FWKA 3MGAA 2Q1SA 5JIBA 1XDDA 3AHEA 2C0QA 3KLNA 4K9MA 3TLKA 4RWEA 3KB8A 4RQUA 5C4IA 3JR3A 3N7AA 1UPTA 1QCZA 1SVSA 4NFLA 3VPHA 3ZDFA 2IFTA 4HNVA 2XF2A 1KJ8A 5EKDA 5J1SB 2WVHA 2FG7C 1DIHA 1YQXA 1P2SA 2YDYA 2WJVA 3A1DA 1OZ0A 4LZOA 1EK1A 3FROA 3OEHD 4QPJC 3SJUA 4RJ2A 4US0R 5ALLA 1NUSA 3PGKA 4YP9A 3S2UA 7ADHA 4I14A 2K2WA 2GR9A 1P7WA 3ILSA 3IOCA 1Y7TA 3IUNA 3LJKA 4GECA 4RLFA 1M5UA 5TMPA 1QAQA 3R20A 2XQGA 1KI2A 4YI5A 2JZOA 1P9WA 1M6EX 2QTNA 4TSKA 5EMHA 1RLJA 2IX9A 2VJQA 1VE7A 2XXBA 5G3YA 2QKYA 4GDMA 1VLQA 4K1LA 1N92A 3TG2A 2DC1A 3PHHA 3V1NA 4HNTA 1UFQA 5TR9A 3DDSA 4YCBA 3QPCA 1A2KC 4RV9A 1S1CA 1HV8A 3AV3A 4Q7QA 2XUGA 3HSKA 4R1QA 4C7JA 4ECEA 1HDXA 4IL5A 5HVNA 5DDIP 1U0GA 2H0RA 2HLNA 5LJIA 2F3UA 5EMMA 2HJSA 4KHZA 4DNXA 3I6YA 2BSQA 2JFYA 3W90A 2W48A 4V1CI 2CVQA 2CFSA 2HUNA 3OCYA 3SC6A 4ZYZA 4ZTUB 2PVCA 2ZR0A 2IS1A 1VBKA 3LGAA 1ZJ4A 1MC5A 1V71A 2QAGC 2AKYA 2QE7D 3DTVA 1HFWA 1KTVA 1VKZA 2D2XA 4MQMA 4L15A 1E5XA 1QP0A 4F60A 1AK2A 4CN8A 4QVGA 4DR6B 3UK2A 1GV0A 3E7XA 1K7FB 2HA0A 5EE1A 1U1CA 3B6EA 4A8PA 3R6DA 2DHRA 5K0LA 2C9MA 5EXPA 2XSZD 2YWXA 5HUQA 2GSDA 4IFTA 2PMDA 3IDOA 4F38A 1YAJA 2H5IA 1Q0RA 2IYSA 3DUFA 1H69A 3QTBA 2I34A 4FK8A 4GD3Q 4BC1A 5JFOA 3U19A 3ZGLA 3EGOA 1YU6A 1KQNA 4BO8A 3N75A 1GRRA 1IZ7A 1UR5A 1SC6A 3DDCA 2QN8A 5M29A 3VNUA 1I13A 4LQCA 3OLQA 1QV7A 3OIYA 2IS2A 4PRLA 8ADHA 1E7MA 1RW4A 1Z7YA 2AZMA 4HLDA 1DQNA 5KKNB 1XTZA 3DQZA 4MIYA 3E22B 1YZQA 2HBRA 3RIHA 1QBGA 1XNRB 2A9FA 4Z4HA 1NMZA 4MQUA 3VDRA 2VRCD 1WLSA 2ZB4A 3AJ9A 3PLNA 4L2IA 4LAFA 3SP1A 2NXNA 5L3QB 5CBPA 1TJNA 2VYCA 2EX4A 2NO9A 3E53A 4S05A 1I5OA 4MS1B 4OM8A 4YUYA 3NBKA 1U1IA 3BQ9A 1DKLA 3AL2A 3EYAA 3OC0A 5JZMA 1KTIA 1HRDA 2JBAB 4R4JA 4PZCA 3T3GA 1MAUA 2QBYB 4XE5A 2AB0A 3QMPA 1DBWA 3CGGA 1KIAA 1SCKA 1M1UA 1PZNA 1T3ZA 1ORRA 1YQDA 3H4IA 4MRNA 2MSDB 1EWRA 3FPGA 4PG4A 2GD2A 3NEPX 4S3MA 3SX4A 3WWPA 4CF6A 3HJCA 5HXAA 4DS3A 1OWNA 3LG2A 3MT0A 1KI8A 4Q6WA 4DT1B 3RVDA 2PTHA 3K9HA 5AW7A 3ZGXA 4YP7A 3T7DA 4HGZA 3PR1A 4WY2A 1FYEA 1GZ5A 1RAGA 4JITA 4CM1A 4OOEA 3KEOA 1G0NA 3P9KA 2LV8A 1YNOA 2NAPA 3HEMA 4Q7EA 3W0LB 2YJZA 4EUEA 1KQFA 2JLWA 3CUSA 2RHMA 3IMEA 3HFJA 3ZDZB 2VCEA 3I62A 3IB6A 3HZOA 5E2IA 3M3HA 4PC1A 5FYDA 4BNXA 2P3SA 2VWGA 4C04A 1OI3A 1XZMA 5DIZA 3MMNA 2HPVA 3LIPA 4D6XA 4GPBA 2BZ1A 3PRHA 3C15C 5D5HA 1UWCA 1E7RA 2IE0A 4YJKA 3ACBA 3VKVA 2Y6UA 2NV2B 3MJDA 3OD1A 1USVA 4HX5A 4REOA 3IEPA 4H4EA 1Q15A 3CKMA 4B7ZA 5BR7A 4BRUA 4KLNA 1QHYA 3ROKA 3K0KA 5FHRA 1HRKA 3UGJA 3DR5A 5ALWA 2ATXA 2OAGA 4ZEXA 2DQKA 4OJTA 3KT8A 5HE8A 5B7GA 1CUFA 1YD7A 4GP9A 1FSPA 1YRQA 1UC5B 3AVWA 1PJAA 1L4LA 3DKKA 4RS3A 4ZPJA 3T38A 1S89A 1KIFA 4BIIA 2JVKA 4DA0A 2L18A 1Q0ZA 2I76A 5H9VA 3CVVA 3A32A 4GR4A 2QVYX 5FX2A 2F2TA 1YHZA 1FDRA 3ZCSA 2FW9A 1IJFA 3OCXA 4YRIA 1K7YA 1ODFA 2G6TA 2YBDA 2GJKA 5T5QA 2I7TA 2JC3A 1HT2E 5A06A 4RY0A 3TGLA 1TF7A 1ZSNA 5L7YA 5T41A 1G8MA 3BOSA 4PRKA 3WLLA 2O8BA 4YC7A 1SC1A 2JEZA 5IG2A 3EJWA 4FWTA 4G26A 2LP4Y 2PCJA 4F4JA 5FQNA 1I7NA 3U56A 3AR5A 1SKYB 2W5UA 4RD0A 1WOYA 2Q9CA 3KL4A 4YVFA 4ETMA 4FOOA 1AKTA 1QVWA 5AJTA 5IJ9A 4KNVA 2ZCJA 8AT1A 1MOZA 1D9XA 2WG1A 3BEDA 3T54A 3I12A 3KCQA 4I5IA 1EG2A 4IIFA 4IKEA 3EGCA 4ZZ2A 3ZHBA 4E1BA 5HM6A 5KJ6A 1X1CA 1ZD4A 1I2DA 1XEXA 2IBMA 3FJ1A 1PUIA 4JVNA 1LBEA 2E2WA 3CPJB 4RKEA 1M8KA 1XA4A 2BEWB 3NNDA 2FEWB 4WVLA 1TECE 2MYNA 3I42A 5IU6A 4GC5A 4YTEA 2VQEB 4RMHA 5DPMA 5H1YA 4JI8B 1J0XO 4CJXA 3FBTA 3RS2A 1TM1E 4Z2AA 3MUOA 1I1OA 2NVWA 2ZS7A 3SVZA 3AOEC 4J2HA 5JY1A 4D4HA 4HXGA 5F2OA 1JDBB 1KETA 3HMKA 4NATA 3VZPA 1GTL1 3BIFA 4YRCA 1JV2B 3LLUA 3K5IA 1K6XA 3HO6A 4G2TA 2BDTA 4ID9A 5I9TA 3NOOA 5IAOA 5E6SB 2W8BB 1N6IA 1Z45A 4WUTA 4Y9DA 4RF5A 4EB3A 1RXVA 1QFXA 1WHTB 2G09A 4MUIA 4KGZA 4YP1A 3VR5H 2R6FA 3CB4A 1P60A 4TMTA 3OX4A 4L72A 4UTNA 4B2LA 1I3KA 2NADA 3LL4A 1CF9A 2BOVA 4LSGA 1HTBA 2CXSA 2WUGA 4S1TA 1ZH0A 3RHSA 5IC4A 4PAMA 1XKXA 1EA5A 4ZU6X 2P0EA 2VFAA 3GJ6A 4K1XA 2Z4RA 1JA1A 2HWYA 4GXRA 2FQ1A 3W5SA 5F76A 2GZMA 3LKZA 4NENB 1GZVA 4RC9A 4RJJA 3R7SA 1W75A 1DC5A 2IEBA 3FNHA 5H16A 4BWGA 5JZOA 1PK9A 3RRXA 3VC1A 3FN4A 1WUKS 2R6AA 3L0PA 4BKUA 1N5LA 2AYYA 3PVSA 2P9FA 3L1KA 3OZXA 2XE6A 1F0PA 3WYFA 4MP3A 3GLIA 3ZJUA 1LPOA 4MR9B 4B6FA 2HPAA 3ND7A 3KQOA 3SD7A 4OGLA 2VDWA 4B0PA 5KHOC 2WPDD 1X8JA 2VH1A 3TINA 2PPLA 3WR5A 2ZRHA 5CIWA 3RVMA 2G0AA 4TKVA 1RPJA 2X1MA 4EI8A 1FNCA 4JELA 5JMPA 1B8UA 3ZGOA 4UTVA 1KARA 3FAZA 2P4EA 3DE7X 3E7DA 3I0MA 4RMJA 4R8KA 1H5NA 3NUZA 4LBZA 2J0EA 4UBKA 4HOYA 4BFUA 2H5JA 1U3FA 3HWRA 2FWRA 1RKXA 3D2LA 2ZI5A 2FE1A 2JCBA 5LJLA 2EXXA 3KPJA 3ZCUA 2O0MA 1NR1A 1UJ5A 2DT8A 1KU0A 2EWWA 3CLHA 3QBDA 4LTNA 1Q19A 5MHTA 1GZSA 1UANA 2ZIAA 2YVKA 1ZYUA 4RADA 1IUNA 1MB2A 4BZXA 2XGJA 3RS7A 2D13A 2YJ4A 1S9HA 4TL9A 1O5IA 1TU4A 4OXYA 1ECBA 3CVJA 4OQZA 1AY0A 2GZSA 1MMFB 1P2FA 4LZNA 1XEFA 3TCKA 4CL2A 2G0NA 1AU9A 2ZU0C 1YRWA 2NXEA 1W4AA 5F3DA 5BN1A 1UXHA 3L0ZA 4UW9A 4X6YA 3W5BA 5CVDA 2PHZA 5EG5A 4HGYA 4GRDA 4MCIA 2CSUA 1ZPDA 2RIPA 4B48A 4F12A 2IU3A 3KZ1E 2ES4A 5EMKA 5GP1A 3EK2A 1KEPA 2BHTA 4QXRA 1N8TA 1UK6A 1YSCA 2Q3MA 1NJ2A 3F6PA 4B5LA 1Y5NA 1KVQA 2QOEA 2BYTA 2V6GA 2A0WA 1UBTS 3AEQA 3BSSA 4W5TA 1COWA 3G7UA 4X92A 1MAHA 3RT7A 1ZUD1 5EEHA 1U2EA 4UCFA 4J75A 1UXOA 4ZYUA 3SVTA 1WX1A 3BRQA 3QWFA 3L2OB 4K05A 1LBQA 3W06A 3X2SA 1KVTA 3ZE8A 3QOWA 5FL7A 4OAQA 5SYAA 1GL3A 3KQQA 2YS6A 5C8YA 4YAIA 3AG6A 4YREA 1UZLA 3VGJA 2HWUA 2FWBA 1QQAA 1JQDA 1Y1QA 3IUQA 1C7QA 1Z2EA 1WXFA 2SKDA 1QB7A 5HJ5A 3CINA 4C7OA 4BXOA 4DV6B 3B36A 2HRDA 4BRWA 3HN2A 1K3FA 3PJEA 1M6NA 2FW1A 2P6MA 2QI9F 1NVWQ 1U31A 2EL7A 2CGEA 5A9SB 3UTCA 4MP6A 2Q9AA 1I1HA 2Q4TA 3R9KA 2ACVA 1WXEA 4XOUA 4XH9B 4ALLA 1SKBA 5CJJA 4HAWA 2KB0A 3OZGA 5ALQA 3VH3A 1T10A 1NI4A 2YKGA 1PGJA 3V5NA 4E08A 5BSVA 4RZSA 1UPAA 1S8NA 1GG9A 1ZS9A 2MHCA 3E2MA 3FYCA 1XVAA 2F8SA 4IV0A 3UAWA 4GZ5A 4A7PA 2XZPA 3SIPA 3GA0A 3QKRA 1RWKA 1KMCA 3OPXA 4RV5A 1DB3A 1KMMA 4LNAA 4PHCA 1I3CA 2QRQA 4KL8S 1ZGZA 4O29A 4DWVA 1RKVA 2I3BA 3EIOA 4KACA 1V0JA 1H66A 1YJBA 1BQ3A 2PWPA 4I6EA 3A3KA 1I8TA 2G07A 4I1RA 5I7EA 1GY8A 2LRHA 3EB9A 3F8WA 3DJFA 4TM7A 1U4OA 4XD2A 3VBEA 4A0HA 4RAQA 4F21A 1M2EA 3ZK8A 1HGXA 1QP4A 4RUKA 5I5GA 4YUVA 3DBLA 3HKBB 4MV1A 4L85A 3HVKA 4LGCA 4HRXA 2SKCA 4CFZA 2F8MA 2HJHA 3MTAA 3S2ZA 3R7WA 3Q9SA 1ZWKA 2J4CA 4CBVA 1CYEA 2ORWA 5LUAA 1EB9A 3Q8KA 5FBRB 3BXXA 3KJQA 2IPXA 3VJKA 4QUKA 3TPZA 5BSHA 4QJ3A 3MJSA 1C8KA 4JQYA 2NO4A 2ZYGA 3C4QA 3PQ2A 5GONB 5D3MB 5KIAA 2OBXA 2BFWA 4N3NA 4DDWA 1Z16A 4RH1A 4ETWA 4YCCA 3QELA 5IUNC 3UWDA 3UBTA 1HKUA 2REBA 4K2HA 4L9WA 1MB9A 3TLCA 3F2VA 3JS5A 1QO7A 4IH1A 3F90A 4II3A 4MWGA 1FK8A 2M6KA 3GLGA 1WVIA 4TUYF 4N1AA 4Y0VA 1FNDA 3QVOA 4DFDA 2PWBA 4CIXA 4PGAA 5J4HA 2GEJA 4B4OA 1MQ8B 4R8RA 2Z9CA 1NLUA 2WDZA 1P75A 4OHRA 4OLJA 5CHYA 1LRLA 5EP3A 2OA0A 3UJBA 2BH2A 1HYEA 13PKA 2FZKA 1VL0A 2PSJA 3KSMA 3SBOA 5EE0A 4AJEA 5DN6A 3W2FA 3U60B 1JEDA 1TTQB 2GO1A 4G5RA 1PUXA 4NSNA 4PQEA 5B3JA 5LBIA 1X8LA 3KTFA 3LW7A 4WKOA 4LVUA 3TRKA 1P2DA 1UMBA 2J3KA 3GUZA 3ILYA 4F92B 3WGIA 2TRSB 1D2RA 1TT5B 4E33A 2NO0A 4J1SA 5J4LA 1DO8A 1GPMA 2GH1A 5IARA 2KBFA 5IFKA 1SU8A 1X7WA 2E49A 2QPOA 2WG0A 4B2PA 5IXJA 2HJWA 1SVOA