1ST2A

The three-dimensional structure of bacillus amyloliquefaciens subtilisin at 1.8 angstroms and an analysis of the structural consequences of peroxide inactivation
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
275
structure length
272
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNDVINSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN BPN'
publication title The three-dimensional structure of Bacillus amyloliquefaciens subtilisin at 1.8 A and an analysis of the structural consequences of peroxide inactivation.
pubmed rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 95
structure length 272
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1990-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1st2A00
3ZXXA 1NDUA 5I9SA 4MZDA 1ZVKA 3I30X 3DVQX 4WOCA 1SUCA 2Z2ZA 1AF4A 1GA4A 1T1EA 4B5LA 1SBCA 2PQ2A 3UNXA 1TO2E 4C3VA 2V8BA 4YN3A 1YJBA 4HVLA 2XTJA 1R6VA 3DW3X 1KDYA 1SCDA 1KE2A 2Z2XA 1A2QA 1SUEA 1SUBA 3DVSX 1Y4AE 3BX1A 1S02A 5SICE 1SBNE 4BWGA 4M1ZA 5AVJA 5FFNA 3PRKE 5JMOA 5ARDA 4CFZA 3DE2X 2TECE 2X8JB 3D9QX 5AMXA 1UBNA 2W2QA 3VV3A 2W2MA 3L1KA 3I37X 1Y3BE 1TK2A 1SPBS 1BH6A 2PWBA 3BPSA 3I34X 3Q5GA 4OV6B 3PTLA 1SCAA 1NDQA 1WSDA 4FONA 2P4EA 3DE3X 1Y9ZA 4KPGA 2ZRQA 1LW6E 1ST2A 2PWAA 1WMEA 3DDZX 4HX2A 1P7VA 2ID4A 1Y3DE 1ST3A 3WHIA 1R0RE 3LPAA 1SUAA 1ZVJA 4KG7A 1Y1KE 1SIBE 1TMGE 3F7OA 1P7WA 1EGQA 3VTAA 1TO1E 4K8RB 3OSZA 4JP8A 1IAVA 2SNIE 4OMCA 5FBZA 3DVRX 3A3PA 3VHQA 2XRMA 5ARBA 1V5IA 1DUIA 4H6WA 5AQEA 3TECE 1DBIA 1PTKA 3BGOS 3A3NA 1YJCA 2WUWE 2IY9A 1THMA 4LVNA 3WIUA 1HT3A 1TM5E 4J94A 1TECE 4NE9A 1XF1A 1BJRE 3VV2A 3DE0X 2Z57A 1TM7E 4C3UA 5K7SA 1SBIA 1JEAA 2SECE 3LPCA 2W2NA 3QTLA 3VYVA 3WQBA 2WV7A 3QFHA 1S2NA 1WMDA 1GT91 1Y33E 3F49S 4H6XA 2Z30A 1AV7A 4DJ5X 1OT5A 2DP4E 1PJ8A 3DYBA 5AVKA 3EE6A 4NE7A 1SCNE 1VSBA 1MEEA 1SH7A 4H6VA 3AJ9A 2SBTA 3F7MA 1KDVA 3DE4X 1SUDA 1OYVA 1MPTA 3GCXA 5JXIA 1GTL1 4KB5A 2ZWPA 1WMFA 1T1GA 1BFKA 5B1EA 1V6CA 3DWEX 1Y3CE 2PRKA 4LVOA 4Z2AA 3DE1X 3EDYA 2HPZA 3WIVA 3TI7A 1SCBA 1OYOA 3CO0S 3EIFA 1CSEE 1IC6A 4DZTA 1EA7A 3P5BA 2QTWB 1PEKE 3VSBA 1SCJA 1AH2A 1SUPA 3D43A 4ZARA 3T41A 3QMPA 3DE6X 3SQOA 5JXHA 2W2OA 2W2PA 3DW1X 2E1PA 2GKOA 2Z58A 1TM3E 3AJ8A 3HJRA 1SIUA 2IXTA 2PMWB 3ZXYA 1PFGA 1SBHA 3GCWA 2PKCA 3CNQS 3H42B 2WWTA 3SICE 1SN7A 1SVNA 4AKTA 1TM1E 4GI3A 1GTG1 2ZWOA 4ZOQI 3AFGA 2G4VA 3DE5X 4RYDA 1R64A 5CW1A 4CFYA 3I2YX 4WOBA 3Q40A 1AK9A 1YU6A 2WUVA 1BFUA 1GCIA 1Y4DE 4CG0A 2Z2YA 3A3OA 3DE7X 1C3LA 4OMDA 1NLUA 1Q5PA 5JXGA 2Z56A 2B6NA 2ST1A 1AQNA 5JXJA 1BE6A 2SICE 1GNSA 1T1IA 4I0WB 3LXUX 1SIOA 2DUJA 1KDZA 4DWWA 1TM4E 1AVTA 1Y48E 1S01A 1Y3FE 1KE1A 3TI9A 1Y34E 1P8JA 5B1DA 1GNVA 3LPDA 1CNMA 4NMXB 1AU9A 1GA6A 2DQKA 2HD4A 1GTJ1 2PYZA 1C9JA 1SBTA 1BE8A 3GT3A 1GA1A 1WVMA 5FAXA 1C9NA 2X8JA 2ID8A 1C9MA 1YJAA 3GT4A 1SELA 5ARCA 4AKSA
chains in the Genus database with same CATH superfamily
1SXJB 3UG7A 3T61A 1K68A 4I1RA 1UFOA 2N3ZA 1WZ2A 2I4RA 5G0TA 2A84A 4I6JA 4NCHA 1GG2A 3WRVA 1E9RA 2HK8A 2H4WA 3DVQX 4MV1A 1D0IA 3CKKA 4XQ0A 1RDFA 1JLKA 1SUFA 1T8YA 1XHFA 1CZHA 2ZUVA 3YASA 1Y5LA 4IVNA 4YBZA 3HRHA 4JELA 3GGDA 3HP7A 4TRJA 1MB3A 3V7YA 1S2IA 4G97A 2KBFA 1W1IA 1TFRA 5DT9A 3H7IA 2OG1A 4AO8A 1C1HA 2Y9PB 4PLCA 3ND6A 1Y1LA 5ECYA 3GOHA 5GZ6A 3R5FA 2HMAA 3LYAA 4YUZA 1ILWA 1XVAA 2R86A 4IICA 3L18A 4C2AA 3AIMA 1C0PA 3LDHA 3USCS 3ELUA 3KBOA 4H35A 5F5XA 3SC6A 1CB7A 1B8VA 3EZLA 2WJYA 2B1IA 2UUOA 7ABPA 3MJ4A 4FIZA 3AG5A 1J21A 2BTQA 3C14C 4GOLD 2JIDA 4ZTZB 1NNSA 1ECBA 2Q3CA 2DUWA 3ISVA 3TW6A 4MLZA 2V59A 4ND5A 3WMGA 2NTYC 1YZKA 3DFUA 2CDAA 1IVSA 2CGEA 4C7XA 2ZS9A 2HCRA 4QA9A 2IYXA 3KYCA 4YLGA 1N5LA 1Z4MA 1F2TB 1XA4A 2O7NA 2RC6A 4FFDA 4FNOA 5CJ2A 3VU8A 2P30A 4S1OA 1L5LA 4LBVA 1JG1A 2ZRGA 4RVFA 1R15A 2EC5A 5SICE 4LXQA 4B7UA 4MHTA 3BL5A 1IHXA 1O58A 3D3KA 4WKPA 4ZI7B 5IJWA 4ID3A 4ZO4A 4C2TA 4F84A 4B46A 1PJRA 2UZ1B 1H0RA 1HEUA 4NIMA 5K0ZA 1CC1S 1K8XB 3QE3A 4HFRA 1Z4PX 4E6PA 4ZHSA 3RDPA 4Q9KA 4ZZ0A 2BGJA 3H5OA 1KR2A 5C80A 3TN7A 3E3MA 4QECA 1T9HA 2JK0A 2PSFA 3HQ4O 3LKVA 4FMPA 3H11A 5FNVA 5DM4A 2VXCA 4LJRA 1TUGA 4Y30A 4O1MA 5BQOA 3D4LA 3I73A 2X7HA 1NV8A 1UQRA 3OZBA 4V0OA 1X1BA 2ZJOA 2VTBB 5JPIA 4NV0A 1Z2OX 5BN5B 4ENTA 3LCRA 2ZSUA 3H5IA 1I30A 3MSXA 4ZANA 3T7RA 4ETWA 1QYCA 4Y2RA 4PZPA 2IITA 3BF7A 4OFWA 1HDCA 1PJSA 5IYZA 4Q1BA 5ICFA 2JIBA 3MAGA 4XDZA 2Z04A 3IB3A 2LIPA 3K9CA 1VXOA 5HS6A 1ZN8A 2PS1A 4Q34A 2PWBA 3A4YA 3F1LA 5CU7A 4RE5A 4A6XA 5C46F 1RWVA 1ZK3A 3AM5A 2XAUA 4QJ3A 3H9UA 1P8AA 1C3OA 1DV1A 1GEGA 1YVDA 4IQFA 4J1TC 5I7AA 5KDOA 2BP7A 4Q3NA 1E1MA 3HN6A 3FCCA 3HSSA 3MOGA 4HWRA 1AGNA 3QJ5A 4RY8A 5DRYA 1NNEA 1O4VA 1NU6A 2P2GA 3ENKA 3DBRB 1LJUA 3UCFA 1KI6B 4CU2A 4CLXA 5JJCA 5JCOC 4LHYA 1SCAA 1M74A 4A6DA 3VGPA 3R3UA 2CLMB 3ET5A 4IRUB 4WX2B 1VC2A 5KWEA 3LLMA 4BECA 3UKDA 4AG3A 2PVCA 1TUIA 1RJWA 3WGHA 1N32B 1L4GA 1YIAA 2I1QA 1JEOA 1Q1GA 2BN4A 2BGUA 2KBEA 2O3UA 4WASA 3V3KA 4XVUA 2A1IA 4UNRA 4DV3B 3HY3A 1HH4A 2H4HA 2JLXA 5EN4A 3WK7A 2XPCA 1L5HA 3RJMA 3L7LA 4DKXA 4W9RA 3UGTA 2VH2A 2C7QA 2SHKA 3KUXA 2OHGA 3DV9A 4GECA 3UXMA 4GZMA 3ZU4A 5BSTA 3EVTA 4NCNA 2BISA 1QAOA 2LZ0A 3KFVA 3AX6A 3R41A 4BJ6A 1DXQA 2JW5A 1R0RE 2ZLBA 4Q3KA 4KSCA 4WXHA 5HEKA 1UP6A 3E81A 4D9KA 1GPLA 1RC0A 5CAEB 3A9WA 5FBWB 5IUJC 4Z7NB 1XAIA 1J2UA 2EDCA 2GHRA 3ZV5A 3F4KA 3ZHBA 2WDZA 9ATCA 1H22A 2BSQA 4EB6B 3QEAZ 5IWCA 4E46A 4KOEC 1P7WA 4X9XA 3BF8A 4GX5A 3DMTA 2R48A 2FN7A 2X5NA 1LFAA 4GUAA 3PENA 4YP5A 4NCBA 3IDQA 4H60A 3E8SA 3SBEA 4A03A 5FTLA 2Q2OA 1WBBA 4A26A 2HRRA 3SF8B 3E0QA 3LM8A 3A9TA 1TF2A 3BM5A 3ICVA 4NECA 5DLEA 3TUIC 4A5OA 5CFZA 3KSUA 4L5IA 2FR1A 2B4RO 4XKJA 2QA5A 5HOEA 3PD0A 2QJWA 4K6CA 4AF8A 4DRXA 1XUOA 1TD1A 1PHPA 1T8WA 4OK6A 3C8DA 1B6TA 2BFFA 4BQEA 1KSGA 1DO2A 1KO4A 1VYHA 1Q15A 1PJ4A 2R66A 5ARBA 3U44A 2HHHB 3PNBA 2JHFA 3B9PA 2VXBA 3BC1A 1T3SA 3JWEA 2QEQA 4QYIB 4MYSA 4XRRA 1RFGE 1MA0A 2GBGA 1A98A 4OAOA 1VKJA 2VHEA 3L43A 4IPTA 1DUIA 3UYKA 1E4EA 3MIZA 1BKYA 1N2ZA 3VPGA 2I4OA 5KMGB 2ZUFA 1NVDA 3ACCA 1HDOA 5AUOB 3DNFA 3WBJA 3ZJVA 2K6GA 4QGFA 3RYHA 1PAUA 4RKRA 1B93A 2AZTA 4YRNA 1D6NA 1RQNA 3GLGA 1USKA 5ALSA 1KVQA 2YQZA 4G1BA 4WXPA 3EZFA 3UK1A 3W5DA 4N8SA 2QQFA 1OHHA 1W6RA 4F4JA 1EK6A 2D74A 1WL8A 2E6KA 4LOAA 3VHXA 2WWFA 1U3FA 3QX9A 4K6GA 2IX3A 1OR8A 3B6JA 1ZW1A 4G0PA 4MI3A 1N0IA 1G38A 3KLPX 1QGAA 1E9DA 5LPNA 3ANMA 1XJWA 2OQ2A 2IIQA 2Q9UA 2FWPA 1DFGA 3P9YA 2VAXA 2VJAA 2LPMA 3WYCA 2HCJB 4RCVA 4PSAA 4J94A 4X20B 2Z98A 1SR8A 4LRWA 5ALMA 1IHDA 1TECE 4JVLA 5JZVA 3U4QB 1C7EA 1JVNA 2HX1A 2OO7A 4Q3BA 3TTTA 4MV4A 1RQGA 3ZE1B 3AUKA 1T91A 4P31A 3U48A 5EMHA 3VH4A 1S8OA 1QQBA 1QH9A 5FX2A 2FMTA 3H9CA 5CFRA 2ZAOA 4B9AA 2VDVE 5B58T 1ZONA 5J1TB 3U4DA 3EBOA 3QYAA 3SOZA 3TOCA 3IEMA 2REQB 4XM2A 1H8ED 2ZIXB 3R4CA 4B6QA 3GLHA 3WNCA 4ZVNA 1ZESA 2H4ZA 2Q4DA 1IN5A 1AE1A 1YRLA 2WP0A 3F7TA 4ZYVA 2HSJA 2D00A 2LCFA 2GKGA 1DRJA 2QAIA 3RWBA 5JAHA 4JDPA 1YQEA 3FUVA 3LV8A 5B1SA 4OJYA 1Y7TA 3SJBA 4FD3A 4IMIB 1WX1A 4YCCA 1U11A 1FXWA 1KSFX 2FI1A 2WR8A 4QJBA 2WA1A 4DLZA 4CLDA 4KREA 4C5BA 3MBOA 2RKOA 1XWFA 1F1JA 3ONVA 1XLVA 2ORWA 3ITKA 3L4KA 3O73A 3CZ5A 1E69A 3I52A 1SOMA 5AVKA 4EELA 2WVHA 4MCJA 4CKCA 1K86A 1PG2A 1R0XA 4ZCIA 3N2EA 1GQYA 4KDEA 4BV8A 4E7PA 2XUOA 4L5CA 2PUFA 3QU9A 3VOAA 4F5EA 3HCFA 2AUNA 1FDVA 2JH8A 2OXIA 2VHYA 4WJZA 4XUDA 3SI7A 2D1YA 3WL7A 3EQ9A 3C97A 4M87A 3TK1A 4I8XA 4MVCA 2CE7A 3D6MA 4E5SA 2Z1MA 3SM3A 4RFSB 1NE2A 1KFEB 4N65A 5EWJB 5A9SB 3TIVA 3W4KA 4I6EA 3PNSA 2QN8A 4REOA 5IASA 1I6KA 2IA5A 2NIPA 2G72A 3DXXA 4ZMSA 1THTA 2HI0A 3JXEA 3HXOA 4DW8A 1REQA 2A57A 3WC4A 3KP1A 1J9EA 3NDBB 2R6AA 5LP6B 5FA6A 2QX8A 3BSFA 4JI7B 1KZGB 5C7OO 2HQ1A 4CTOA 1BTOA 2VRBA 2NTEA 2CB0A 2V9PA 3PICA 1KQOA 5LXTA 3OURA 1POXA 1JDVA 2AEMA 4RPIA 3QTTA 1ORWA 1XTVA 3W9SA 4B9EA 1R8YA 1IPEA 1NBME 3LT2A 4M7PA 2VP4A 5BUQA 5JZBA 4ZRNA 4XI9A 3VNAA 1I51A 1PT5A 1R16A 1J2EA 3E9RA 5HK9A 4HADA 3HO8A 3TEJA 1AKEA 1SG0A 1H0SA 4G4SO 1H9CA 4MVWA 3EH2A 2WKSA 1JQKA 1N6OA 2W4MA 3OJLA 4LZZA 3GXBA 5B3AA 4MA0A 2QU7A 5ES4B 2JVKA 5IKMA 1F38A 3MGKA 3BSWA 5BYJA 1RBQA 4V38A 2JD2A 4K9KA 2YXDA 3KRTA 2JF0A 5AKEA 2CV1A 2ZM6B 1T9GR 1YJ5A 3MYRA 4ZA2A 2XZTA 3K7EA 4NSNA 4FYVA 2WT4A 3E3OA 5DYIA 5SV2A 2A4KA 3RTGA 3ULKA 2GRUA 2BW0A 1LB1B 3HCDA 3OEEA 5E1DA 1AA9A 2CZQA 2OCAA 1MZPA 4X97A 4AO7A 3PDIB 4BC0A 3L05A 4JXZA 4RK4A 3QM1A 5FBKA 2NU8B 1NXTA 2YHUA 2JCYA 2ACVA 1KI3A 2PKCA 3CWZA 1CY4A 4C5AA 4J7CA 4KSYA 1BMQA 2G88A 1TRKA 4RIFA 3URMA 4NV3A 1ETHA 3EQZA 3O92A 3OQ6A 3U4QA 4B6RA 3JQGB 3JZDA 1P45A 4UDYX 2LV8A 4JVNA 1DT5A 3H2HA 1FCJA 4L1KA 1ZPDA 1M73E 1NKVA 2D5CA 2DBVO 4JJ7A 3N8DA 1MJ5A 1O77A 4G26A 1GTG1 4NOLA 4R68A 2DULA 1U2GC 3S0JA 1NZJA 1PL8A 1QJCA 3QNUA 1Y3HA 1BWSA 2IF2A 3UENA 4ENVA 1S8NA 2NO9A 1VJCA 1E7WA 2EKLA 3D31A 1R4NB 3Q7IA 4OG2A 2QVCA 4GYYA 5CBPB 4RKEA 3L7CA 4HF7A 3OPNA 1LF5A 1MC5A 2Q4RA 4Q4JB 5KZMB 4PRZA 3SOPA 4M76B 1W46A 2ZSDA 4X7BA 3PI6A 4BN4A 1XAHA 2FMHA 4CIYA 1WHTA 3VUFA 3F6EX 1QV6A 2J85A 2R4QA 5C31A 4YV0A 4DMLA 4O2AF 1FS5A 2O2SA 5B5SA 1T2AA 2HNBA 3C8UA 4JASB 2ZRMA 3U13A 3WKDA 3V4VB 1A3CA 4CETA 4KXYA 1BFUA 1QRRA 2Z5LA 2QTBA 2VZLA 3MS7A 4NBUA 3G8BA 2WU0A 2ALJA 1JQLB 1VTKA 2A59A 4MZXA 4P3YA 1MTOA 3GRYA 4L72A 2Q7XA 4LYDA 4UDOA 4F11A 5EE0A 5IANA 3F2IA 2QRHA 2QX7A 3WVNA 4OTZA 2RE8A 2WM2A 4GXRA 3LCCA 4P5DA 4HNHA 4LXYA 3O8OA 3RNOA 1GU7A 5CT8A 5HJ7A 3L1HA 1P2SA 2C8VA 4A9AA 1USVA 3B38A 3LC7O 4K1LA 5H9VA 2SICE 3IESA 2WE7A 4XWYA 1LJ8A 6PFKA 2VT3A 2XZLA 1EYZA 2E5FA 2JK1A 2HSGA 4OJNA 1T4DA 4OQYA 2P6NA 1CP2A 1QAMA 2ZU6A 4I1IA 4RVNA 4UU7A 4EEXA 5EJ4A 2GX6A 4F8JA 1OV6A 2X9GA 2Y8EA 3Q12A 2ZYAA 1W5FA 3U1BA 3OKCA 3BJEA 3HKEB 1G21B 3IAS1 3M3HA 1QFJA 4PPYA 3D7RA 2V65A 1VKRA 3PD7A 1AA6A 3GGCA 5LZ2A 5C0OE 5JISA 1SZDA 3LLVA 2VPWA 3PI7A 3ST7A 5AVVA 4MYUA 2JAXA 5BMVF 1NUPA 1XEXB 4BOYA 3ZY4A 5G53C 4TL6A 3GBPA 2RH9B 3VTKA 2HW8A 5A06A 3G1WA 2HUNA 2QE7D 1E79D 1DNPA 1XKXA 4WY5A 3NAQA 1CZRA 3WNBA 1ZOPA 7MDHA 4DCVA 2R62A 2AZ4A 1CNFA 3TRJA 3P9NA 3V2UA 3CLTD 3EUWA 2XDWA 3O4GA 4EVIA 4DR5B 1FNNA 5EGNA 3P2JA 1ZU5A 4F2GA 3SHOA 3W4IA 2XX3A 2AA3A 2FUCA 1HFKA 1C9JA 4LYFA 1O0SA 2OC4A 1Z33A 4OLJA 4HDNA 3IUNA 1T8UA 1JSXA 3OZGA 4ZD6A 1KY4A 2R7LA 2XQFA 4G8DA 1ZAKA 3CJRA 1YJAA 4YUAA 4J2OA 2ZB3A 3WLSA 1DOZA 5CTAA 2Q1UA 1B6RA 1VLVA 4ZXFA 2ZXEA 2P9ZA 1KMCA 1Y7IA 2PH5A 1ZXLA 4Q9HA 3GUHA 3BRQA 1RAFA 5EFZA 3PLNA 2VP9A 4EHDA 5AW4A 1KEEB 4KYVA 1Q57A 2I22A 4BEBA 2XCRB 4JOBA 5BVGB 2HJ9A 2B9EA 2CHGA 1OZHA 1YNOA 1EX1A 4GC9A 1J33A 1UBOS 1FS4A 3V8PA 3WZMA 3TR6A 4PHCA 3D6HA 3K8QA 1HG0A 5L3QA 4MQ6A 4QULA 2C88A 4W9NC 2BF7A 2QTLA 1T26A 4ND3A 1EGHA 2ZSKA 2BHLA 2Q1TA 1RI2A 3U7IA 5KU7A 2V8BA 4ACAA 3DOFA 4IJ6A 3THRA 3E7FA 5C7IO 2VNJA 5DGIA 5I7SA 1ZL2A 3ELWA 2BVNA 2G0AA 3EF1A 3JD2A 4WZBA 3R7SA 1PWYE 5DEOA 1L5SA 2NZUG 1SVSA 4PLTA 2FH5B 5DBHX 4DV2B 1R3UA 1SCDA 3VR4D 4AX8A 2IBMA 3BEOA 4C4AA 1JQEA 1YR8A 1VIAA 1ZNZA 1BD4A 1FNBA 2AOVA 3MLEA 2O2YA 1Y9EA 2JGJA 3QWBA 4KPFC 1OZ0A 2FDRA 1IBCA 3NYIA 3K1YA 2Y1CA 2NT3A 1AUXA 4GZLA 4YHBA 2W4IA 4U7GA 1OLUA 4DCGA 4GPZA 3VAAA 1GPUA 4NZ9A 3WB1A 3N8NA 2AFRA 3O4RA 4HAWA 5JW6A 2CCJA 3JQFC 1QNLA 1XCPA 4MP6A 1JFFB 5EJ8A 4FGSA 5TJHA 1JKMA 1PZFA 5DHAA 4MQFA 1DQYA 3AZQA 3RSZA 1PFUA 2DHCA 2WUGA 3I12A 4OFBA 1IHUA 3UJ9A 3QXXA 4A8JC 1SVWA 1ULAA 3I9V1 4BJ1A 1UFVA 3ENWA 4D0SA 1E7YA 4NYIQ 3NVMB 4CR6A 4ENWA 5CB4F 3CYFA 3OTGA 4W7SA 5INTA 3P2YA 3H4MA 1VKNA 3DMRA 5IXSA 1T4MA 3I2IA 1XTTA 4GIBA 3PRKE 3FIUA 4EENA 4K40A 3DE2X 5JO0A 4G5QA 2ANCA 2VWPA 2JLBA 3C3JA 4LJ9A 1ZCFA 3FI0A 1RADA 5EJIA 2D4AA 4G85A 2C0PA 3OEYA 5ESWA 2P9QA 4Z7JA 5IG2A 5CX1A 1HE3A 5JNWA 3OPVA 4X3CA 4WXEA 1E0KA 3FZNA 5HKAA 2YMPA 3OIFA 3TH5A 3ZCUA 1RQLA 1SPBS 1J5XA 4B0OA 2OKCA 5AICA 2R60A 2C59A 2DFDA 2J59A 3VPFA 1COWD 3L0DA 1QSGA 1DBWA 2FOLA 1ZGGA 4HXFB 3H5LA 5CB6A 1K66A 2YFQA 1SC3A 3ZCXA 2GBLC 2JDIA 5DK6A 3OM0A 5I9LA 4YRPA 5GZ1A 4O2BA 5H16A 3FDXA 3K9HA 3PC8C 2VDOB 1CIJA 3UJ8A 2C00A 2CW5A 3K0BA 1Q2XA 1IWOA 4O4IB 1CZNA 3HV0A 1NATA 1VL2A 1Y8CA 2ZI9A 3K1JA 5KYXA 4B76A 2G08A 1D1QA 2AMLA 5DTQA 2V6FA 1QRAA 4C01A 1R66A 3K8ZA 4I9GA 2RIRA 2W00A 3U2QA 3NTQA 1JR3A 4YJHA 2AFHA 2CUKA 3ZOKA 1HR0B 3ZI0A 4PYMA 3MCVA 2MINA 3B5JA 1KYTA 2ONKA 1DJPA 1T0PA 3ADPA 3NO4A 3FXAA 2WYHA 4IGIA 2F4NA 3H5WA 4JYMA 4FFNA 3VA7A 2O19A 3H2YA 3TLMA 4WBNA 2PCJA 1FY2A 2JA2A 2VK1A 1XZHA 1DEKA 4KTTE 2ZIEA 1RHMA 4CLRA 1E2HA 5AW0A 5DLYA 1SUAA 4UFNA 1QHSA 1VCOA 5DGCA 4KC0A 3VR5H 3WGLA 1P1RA 4FMDB 3DTVA 3T9CA 3THOA 8AT1A 3BVPA 3QV1A 1TMGE 1TVKB 2P75A 3F7OA 4FINA 4MPPA 1T9ZA 3K70C 1R0KA 1KAOA 2O5EA 4B09A 1KVTA 2AXPA 2GFQA 3OM9A 1ECJA 4NBNA 1ZVVA 1ZHFA 2PJDA 3OQNA 1OY1A 1DG1G 1PQYA 3VZCA 4AI6A 3IE2A 2FQWA 3I1YA 4LYGA 2Q62A 3R6WA 3NPMA 1D07A 4EYGA 4YPVA 1VPWA 2BOVA 1E6WA 2ORVA 4AZ0A 1N5OX 2WJ4A 1TZJA 4KN5A 1O1YA 2W83A 5HJEA 1UANA 1MQ9A 4AJHA 4BVLA 1LTQA 1KDTA 2HWUA 3LI2A 4IGFA 1QU3A 2JHPA 2Q0HA 2ODAA 4CT4B 3UT5B 1CWUA 3HDYA 2R9VA 1KMHA 3IQIX 4KO4S 1FNSA 2QLNA 1PO7A 3DBVO 3NLLA 3PQ4A 2GUGA 3JAKB 4YROA 3SJCA 5HRCA 1Z2EA 2BEUB 4C6HA 1GZSA 1LPMA 4G81A 4TKVB 2R2GA 3C74A 3DFZA 3BFXA 3LG2A 4NCXA 2WM8A 3VKUA 1G3MA 3GFQA 2HU2A 4B31A 2XKKA 1GUFA 4X41A 1BE0A 1IONA 1WULS 2R6FA 4N54A 5I4IA 1H4SA 4G8CA 1O96B 3L6CA 1I4DD 3AW8A 3VPBA 3VNQA 3ZHCA 3GNSA 1O9BA 2OV2A 4ISBA 5F76A 1YONA 2Y93A 1JDTA 2PL5A 3MJDA 2ZI5A 4HDOB 4FWIB 5DBIA 1Z22A 3P9IA 4JBYA 1R6TA 1YHNA 2EFHB 3QQ5A 4QEDA 3RIMA 1ZNQO 1GKUB 1SEPA 1W88A 4D9GA 4EMBA 2C96A 2WIBA 5GY7A 1A7UA 5T6BA 2BFPA 1UMDB 5JLAA 2CUNA 1DIBA 5B7PA 4OGLA 1PT7A 2J3MA 4RIEA 3U49A 4M0EA 4RM3A 3QLUC 4E5PA 1Q0RA 5LOVB 2C5EA 1N3BA 4A1OA 4MKIA 2YFYA 4HSGA 2H5JA 3NOXA 4RSRA 2HZBA 3HKBB 4XWKA 4YDRA 4DR3B 4QOIA 1VSTA 5D5HA 3WIUA 4ZT5A 3N39C 1V2HE 3T1VA 3BORA 4EYQA 5TMEA 4MO9A 4IFBA 5EWLA 4FFSA 3KJXA 3TIXB 3MCTA 2LBPA 4P4TA 1KVUA 2J9XB 3DDSA 1L5ZA 1HL3A 1R5OA 4JEMA 4LECA 5P21A 4M53A 2Q3JA 3Q7SA 1N36B 3WWCA 3S8MA 5FDFA 1U1GA 4GI1A 3VV2A 4WJKB 1YACA 2QPAA 3T52A 5AJTA 2YWRA 2I29A 2VFAA 3MMPA 4D8XA 2CXPA 5J43A 3N9IA 2FLVA 4DA8A 4IXDA 2XGJA 5CA1F 4RS3A 4E07A 3TLJA 4YV7A 2H0RA 5EQDA 1VL8A 1Y5RA 3ES9A 3EA4A 1QIFA 3LHDA 4JYCA 1OGJA 1ZP6A 3ZY5A 4ZT7A 1RMYA 1JIXA 4YH1A 1MOSA 1NRWA 1M1YA 3F49S 1SHKA 2QE7A 1E79A 3EBLA 1HMYA 1KAHA 3HUFA 1TQ6A 4OP3A 4LYYA 4I4TB 3SHFA 821PA 2RGGA 2X5OA 4MOWA 4PY2A 4PLZA 1M6VA 3B7WA 5ADUS 2GBFA 3TEFA 1UBFA 1O95A 2PK3A 3SZRA 4ZAWA 2FW8A 1JTEA 3FVRA 3W6ZA 5KQRA 2C7VA 4AP9A 5FBHA 4YCAA 1T9CA 2ERXA 4NHOA 4HZGA 4KQHA 2PGLA 1F48A 4NE7A 2PKWA 5FA5A 3QOXA 4RZ3A 1FTNA 1ZICA 2XUIA 3UH0A 3TF5A 1YFLA 1HNNA 2D06A 1TYEB 3M1IA 2PZAA 1D1PA 3B1YA 1WIWA 5EFOA 3CE6A 3I04A 2ECFA 3ODGA 4YCDA 4CDGA 7REQA 5JSZA 1WB9A 1XCBA 4JBLA 1EAYA 4DEYA 3WMXA 4GMGA 2P6MA 3QPDA 3TKAA 1INLA 3U1VA 1WF3A 3FCUB 5JECA 1IAQA 2Y1DA 1GTL1 3FHOA 4KB5A 4MRMB 4LSMA 3WHKA 2QB5A 1P0MA 5HW0A 3IQWA 1PR0A 2OAQ1 1IUKA 1BS9A 2AUTA 2H5LA 2VEDA 3QPVA 5CCXA 1TKAA 3U3DA 4PLPA 1RMQA 1WSBA 2AMYA 2G4LA 1I4TD 3LLUA 4MH0R 2LVBA 2BR5A 3GRFA 5IJXA 3IO5A 5LLDA 3OJCA 1VBMA 4X00A 1VGVA 1G17A 2APJA 2OGSA 3UW3A 4YAEA 4AWXA 4LI0A 1DG9A 1S2DA 1XQ6A 4ERXA 3EX7C 2H1HA 4G37A 2G0NA 4LVOA 4MULA 3EDYA 2ZBQA 4E2YA 1UPFA 4B3XA 4WBXC 3KZCA 2HPZA 5TPZA 2QE6A 3GJQA 3RJZA 1IQUA 3TI7A 3TQQA 2BDEA 3AB7A 3GA5A 3UMFA 4B32A 3U7RA 3I5YA 3C5WP 3EJWA 1T0UA 2WC1A 4PXSA 3UIEA 5TF0A 3NDRA 4X24A 2QR3A 3F6SA 1XRJA 1S7CA 2DKNA 2PZJA 1XZBA 3JQEA 4FOOA 5EXDA 2IJGX 5HKLA 3BULA 1C5KA 3T7CA 3VPXA 4DZTA 1MAHA 3VR4A 2PLWA 1KJZA 3FUCA 4HEA1 1NN5A 3ZUGA 2YICA 5DM60 2BMAA 2PT5A 4R3WA 5F51A 3LWNA 3VSBA 3W1VA 4BRUA 3GIDA 1RLOA 3H1TA 4MYRA 3TBKA 2JFVA 1G2IA 3DTNA 4HAIA 2WQ6A 4EG1A 4IWXA 3MGGA 4XYLA 2IPLA 2M6LA 3RU7A 4EKEA 3B1WA 4Q1EA 4F97A 3K0CC 1VDMA 4EI8A 4PZYA 3SGLA 1E6LA 1E1YA 1MC8A 2VPQA 5L8VA 2I91A 2FQXA 1YS4A 1FPQA 3LF1A 3NI2A 2H2HA 3HSYA 3RSGA 1SB8A 1KA9H 2RGNC 3QRWA 4FMBB 1MGPA 4PHFA 3VH1A 3WLMA 2EW2A 1V4BA 3G2HA 1OROA 3O8DA 2WV9A 3U62A 1TA9A 5D8DA 4B3FX 2QRVA 5CIWA 4HH0A 1WUIS 3CG0A 2CJFA 3NBFA 3CCBA 2OVBA 2P69A 3ONEA 1R9MA 2HWWA 2BI4A 5EZ6B 2GD6A 3VRHA 3I01A 5CYGA 3CNHA 3ADKA 4L5AA 1E4OA 4X63A 3B3AA 4M9XA 721PA 5HWSA 4UTPA 1NUAA 3ZLVA 5E1MA 1UBMS 3A4IA 2C9CA 2C1ZA 1NJ5A 5LB4A 4F85A 1D04A 4DABA 3T3OA 2I4LA 1WNTA 2RSLA 4AY2A 3KV3O 2YC4C 5EGSA 2VO1A 1P33A 3ZK7A 4LA4A 3SYLA 1N9GB 4L3WA 3ESQA 4MYCA 1A8IA 2C7PA 3QFCA 1J0DA 1SG6A 1EXVA 1W85B 3AVTA 5I7EA 4EA9A 3UK7A 2FHSA 1XF9A 2DKFA 2P4QA 1CY1A 2QZJA 2VDUE 3DZFA 4KFUA 4PLGA 1VI5A 4BP1A 4BPBA 2AKEA 3RHSA 2I67A 3QKRA 2PEZA 3I2YX 1T9BA 1YB7A 2VHJA 3QVOA 4MV0A 5TMDA 1AK9A 1ACLA 2MSLA 5I9NA 1XZKA 4HBGA 4P5EA 1P9OA 3DFIA 1X1CA 4ZMBA 4WKNA 5DW0A 5AQ1A 1IEQA 4JL8A 3U7QB 1GCIA 4TWZA 3V7WA 4UXJA 1Y4DE 3O47A 4LCBA 4B84A 4BBZA 1WY7A 3L92A 5JFTA 3KQQA 4BATA 1RQXA 4NR0A 4HLUC 4OMDA 1VIYA 1NMSA 3KU1A 2ZIZA 3CVUA 2MJLA 3ZD8A 3EF3A 1D7OA 1VYVA 2PU5A 2HAEA 3ED5A 3FFWA 3IGFA 5FFFA 4OH7A 4B0PA 3A6PC 3I58A 2GT1A 1FRFS 3MTGA 4QWWA 1HX7A 3A8TA 3L8YA 2YJ6A 1ZM7A 1KNQA 5JXJA 4KLRA 1UR5A 4B4KA 4GPTA 1FRNA 1WW2A 2I2CA 3C6QA 2BZ1A 3CMMA 4IIJF 2AWNA 1GG5A 3O93A 2AEJA 2R1VB 4AZ3B 1EWVA 3CLRC 4RAOA 2GPTA 3E4DA 1Y4SA 2ZE7A 1BC5A 5CJJA 3DT6A 4UEOA 4UULA 4MEJA 4BRSA 5JRZA 4R1TA 1TM4E 3L0IB 3L0PA 3CURA 4KCGA 2A88A 4KMMA 4DQLA 1M6YA 5K3AA 3MLBA 1YB2A 4F92B 1YI8A 4UNSA 3SC2B 5JQGF 4XGKA 5JCJA 1VOTA 3GUYA 5DNCA 4Y7CA 1DCFA 2HXYA 5H3HA 1M1XB 2IIBA 3CLUC 4I8DA 1YA4A 4QODA 4XLLA 2XE6A 4YMIA 5KCZA 4EM6A 3DEKA 4P8RA 1W30A 4NS1A 2OLJA 2FMXA 4IZHA 1GP2A 1AQJA 2NUPB 1SQ6A 4HLDA 1PJ2A 4H7JA 4O08A 4RE6A 3SYMA 1U1IA 1C7RA 1X7ZB 4XX0B 5JAUA 1XZQA 5CLQA 2GD1O 5TE9A 3C1TA 2WSBA 4PZLA 3DUFA 4M54A 3TRKA 9LDBA 4AXBA 5BXYA 5BQXA 5M04A 1QHXA 2ZDQA 4F2WA 2IYFA 1YVEI 2QRLA 2ZTUA 4GM1A 1SBTA 1SNYA 4DG5A 2GJ9A 1RLUA 2DG2A 4MDYA 4C7MA 2FZWA 2VJLA 4TV8A 4DIKA 1X7XB 4BGDA 4ZP1A 3TCXB 2YVLA 3L93A 4FGLA 2UXBB 3AU8A 1EJ0A 1F6DA 3Q7RA 3KETA 4IEIA 5DXAA 4B2YA 2Q9BA 3E2MA 4X44A 4D5GA 3ZY3A 1LVHA 1QK3A 5EERA 4N0EA 2W6JD 2N42A 3Q11A 4HV4A 2GEJA 2XGMA 4R7GA 3AFNA 2JPDA 5TB5A 1I7PA 2JGFA 2WZBA 3AXTA 3KJFA 3PQ5A 4UZFA 2XE4A 3ZDYB 1FFAA 2VYCA 2WIJA 3L0CA 4EBFA 2WJJA 1R6UA 5DP1A 2J9RA 4EKNB 2NSJA 5HFNA 1P39A 3OQIB 4LE2A 3GEMA 5CR9A 5GIPE 4IQ0A 1P5ZB 4QOGA 2ZFUA 1I3NA 2MYUA 1KOFA 3V1YA 7AT1A 5IAJA 4W63A 1T1EA 2OBFA 1L7PA 4TS4A 3NIFB 4P4GA 5EZYA 1ZK0A 3STUA 3V6MA 4LHEA 2XEDA 1CKEA 1Q12A 1ODJA 1TO2E 1OLXB 5C5IA 3K5WA 1ISPA 1RAEA 1OZGA 3NWBA 2DBZA 3KALA 3HABA 1CR2A 2FPXA 2W48A 3CW8X 4QVGA 4TKLA 1ZN2A 1QOQB 2H4XA 3PR2B 1P3DA 4HAVA 5K09A 1MENA 2O48X 1IJBA 2PBLA 1R6VA 1OIXA 2B83A 5IK2A 4ZT4A 5FRDA 4DARA 5C37A 3CPEA 4KBFA 2JVIA 4Z4HA 1Q3HA 4BV3A 3ET4A 2OD2A 4R1SA 3FHLA 5T8KA 2IOYA 1V3VA 3EAFA 3G7SA 3BHMA 4CKYA 1C29B 3WAJA 5C81A 2DJ5A 2P35A 4RHYA 4WN9B 2DYKA 3PQFA 3BFKA 4MJXA 4WCFA 1JIQA 3NS7A 1Z08A 3BJRA 3U4GA 3WV4A 3Q41A 3DQQA 3AY7A 3CVXA 2X40A 4BXOA 1D0SA 3BA6A 2R3SA 1IYZA 3QVXA 2CMGA 4L27A 2HA4A 2C9BA 4KVZA 4QL3A 2CJWA 4LJ6A 2FR8C 4H7DA 4BUZA 4BWGA 1GCGA 1T34A 3ISJA 2JCXA 3DOUA 4URUR 3A1UA 4D4MA 1JPJA 3O84A 4HWGA 5E7QA 5ESRA 1EJ2A 2C5SA 1LX7A 3CEPB 1Z6AA 3HKDA 4MGYR 2UUBB 1JLHA 4PR3A 2ZIFA 3VPHA 2QZ4A 2VDQB 1BNCA 1BXGB 5BORA 3H19A 1OFUA 3DDUA 3U81A 1RCTE 1UBNA 4EGJA 1E9SA 2PMKA 2CDCA 5CDFE 3RYCA 1KWKA 3JWHA 4JLJA 2WNHA 1MO6A 5LLTA 2YH2A 1JLLB 4GDMA 3EXHA 5I7OA 2RG1A 5KVVA 1UAYA 1U4SA 1KZ9A 2ZP1A 1P9LA 4J9UE 1A4IA 2R8XA 5KTMA 1UWKA 1YMQA 2TMKA 3IULA 5BN4B 1XMQB 2A35A 3K70B 1YR7A 4PVCA 4RYLA 1AKNA 2QQGA 4RY2A 1ZZEA 4DDVA 3I34X 1FK8A 4JODA 7YASA 3BRCA 4N8EA 1MDFA 4RK6A 3HO6A 2IWRA 1PT8A 2ODTX 4KAAA 1OBFO 4TS3A 5F64A 9GPBA 2QD1A 1F7VA 2BKEA 1K27A 3II6X 5ILGA 2V7XA 3KTFA 5L7WA 5GONF 3K6KA 2C20A 3H99A 4FONA 3DE3X 4L16A 2LTAA 1X7WA 5JWHA 3N7UA 1VHQA 2QORA 4EGSA 1VIMA 1OAAA 1VL0A 4JROA 4YRLA 3UBTA 4XYEA 3THXB 3LD9A 1P2UA 4OHWA 2AN9A 5GINE 5EQFA 3UGJA 4M4SA 3Q88A 2FUKA 3M6VA 2R5FA 3ZKWB 2XCUA 5JCZA 5HHTA 2RAUA 3LHSA 1S4MA 4AS1A 5A2GA 5GVSA 3AETA 2GTIA 4FIDA 5HQ3B 4NEHB 3H3XA 1ELOA 4LPSA 2F59A 1NWHA 1QIGA 3JYNA 1M0TA 2J32A 3D7MA 2H59A 4EY6A 1I9CA 1BN7A 4NZYA 4JBGA 2H2GA 1C1XA 2VCEA 4MUAA 4LOKA 5DCWA 121PA 1B43A 3HJCA 1ZVJA 2OM2A 2C84A 1JDBB 3CIOA 3QI2A 4GAEA 4IH4A 3C39A 3KKEA 2NZWA 5ALNA 1ZJYA 3ISTA 1YDMA 1ITZA 2YHAA 1QFMA 3I53A 3N0RA 2XD9A 4RPCA 1M7HA 1TO1E 3EMBA 3L4BA 4NYJR 4L6CA 5KU1A 1T4CA 1ZQ1A 1IUOA 1RYZA 2CJPA 4Q3EA 3GLHE 3VYWA 3ZE2B 4UD6A 4I5GA 3ACDA 1R4AA 1MAVA 3TSZA 5ERXA 2QM3A 4AKHA 3GJ7A 1XN1A 1Y63A 2AL7A 3UICA 3H1BA 5HG0A 5CVDA 5F4BA 3HVUA 1C4OA 1N6PA 2E1RA 2QRPA 2WJ6A 5AVYA 1D4AA 3MUEA 2G06A 1DDGA 2DUUA 4HWPA 4BMXA 2A94A 3KKQA 3ZIAA 4YCSA 4LDQA 4YQZA 3HO1A 3U19A 1R0SA 3NOOA 3AEKB 5DCUA 4B45A 2RH8A 1PNQA 2BCGY 3BK1A 3X1DA 1D2HA 5HA5A 4D9JA 9LDTA 1V96A 3KQUA 5CH8A 3WRXC 1NP7A 2ISCA 3EXFA 3G0CA 4BJ3A 1E3DA 3R8CA 2D1SA 3EULA 4I3HA 3VU0A 1FRVA 5T57A 5A4JA 3JQ7A 3JZIA 2W98A 2IV2X 1EX6A 4YPOA 1JAHA 2BKUA 3GLTA 4L50A 2EF1A 2PVPA 2OBNA 4RVGA 3IP9A 5E6SB 1NTRA 2ODBA 4YRMA 2KI5A 1AZTA 3JSAA 3MRVA 1HM5A 4RCZA 5BW6B 3PWTA 4MR8A 4IW3B 1YBHA 3QMVA 3LUJA 1VJ1A 5HUJA 4B87A 3DZHA 1D2NA 5L3SB 1FSSA 4FWTA 3DR3A 1E1QD 2JBAB 3JX9A 1IOLA 1GXSA 1XV5A 3CNNA 3QA3E 4L8FA 4PGFA 5FI1B 5B2ZA 1OV4A 3A4LA 3CZAA 4ABYA 1XI2A 3LNCA 4N5LA 1QGED 4R16A 4EO4A 2YIJA 3S68A 5LDHA 2XEXA 1PSZA 2D4HA 4Y98A 3SFTA 1SKYE 3W5VA 1K98A 3ZWQA 3CMCO 3BWEA 4LF5B 3PTZA 2F9LA 1UL1X 1C80A 1DAOA 4HWSA 3TSAA 3V80A 1NG1A 4WDRA 1YRAA 3OZVA 3IEIA 1IEWA 1YQXA 1D9XA 1K6XA 2VJCA 3UKOA 4L85A 3BGDA 3ADCA 1XZMA 3REFA 3PX3A 3OX2A 5JH7B 3R44A 5AO9A 3VUEA 3IBCA 2AG1A 2VWQA 4Q1CA 5G0SA 3KOYA 4TGLA 6ABPA 2NPFA 2B25A 3C3BA 5L3VA 3KSZO 3AL2A 3DTTA 1L3BA 1SWVA 3QUQA 4E0BA 4AQ7A 3C6YA 3D0OA 3GGGA 3HZOA 3QLVC 4IGKA 4JSTA 3GLRA 4D3XA 1F7UA 1JEAA 1RKVA 4P4NA 4DSOA 4BMVA 4N0PA 4BEVA 1W75A 2IUTA 4UASA 3IAXA 2IRWA 1Y82A 2QYTA 4XGRA 4V1CI 2QUJA 4EKDA 1A97A 3ABSB 1U9CA 5BSGA 1LXCA 2AOWA 2NU7B 3D81A 2VF7A 4ALKA 2Z30A 4CM6A 2QTRA 2GZ3A 4MUNA 3TYXA 1RAHA 4Q3LA 4LWOA 1QZUA 1YDGA 2Q5QA 1LH0A 5AKKA 2OXTA 4HH1A 3EODA 4LRTB 1A5TA 1E59A 1V8OA 2JARA 3DYBA 3QEKA 4HDKB 4OD0A 5J58A 5ENVA 2Q5EA 5LD2C 3WNZA 2C4KA 5BNZA 2O8EA 1JQJC 2GEBA 2C5HA 4FNGA 4UAVA 5IF9A 4ETNA 2TRSB 3K0SA 1M1UA 3AESB 2IQIA 1R12A 2C2OA 2H7CA 2JJYA 1QGZA 4WVFA 5C8DA 3B1XA 3IAAA 2AHRA 1VCHA 1MPTA 4Y2HA 5G1OA 3SX2A 5JXIA 4GE3A 4D97A 1CUHA 1T0BA 4G0XA 4J3FA 4PZ0A 3LFUA 1MX3A 3JAMA 2HK7A 3M34A 4DR1B 4IZ6A 2Z0MA 4MUFA 2ZBRA 3DLPX 3IUBA 5AKLA 3WOHA 3LC2O 2XY4A 4ZVVA 2L42A 4P92A 1MB0A 1W5SA 1WMFA 3M81A 4YUYA 1BFKA 3QUSA 2CDNA 5B1EA 2JRCA 3PYMA 3A3KA 4I46A 2Y68A 1LI5A 2JFWA 3NTOA 1XZPA 4R2HA 3IV6A 3R7BA 3W3AD 1JT2A 3ZVLA 4WJLA 1BDJA 4KE8A 1Y80A 2CYAA 4ZEMA 2FWJA 2QQ0A 2ON6A 3MCUA 2GPYA 1RXEA 2QW0X 4LWZA 1B2RA 4NFYA 4R3UC 5C52B 1FZQA 2AD1A 2ASEA 1CUIA 1F5SA 4BBPA 2FFRA 5T4BA 2A0KA 3HFRA 1PG0A 3DBHB 3HZHA 4JXJA 2NZ8A 1QZXA 4RIHA 4XLTA 3FTQA 4ZU6X 1HLDA 5T3UA 4NMMA 1J70A 1P4JA 4YFVA 5DNAA 2EARA 4H1HA 5K3FA 2AOTA 2X0DA 3AF6A 1P9NA 2OZEA 1QE5A 1P1HA 2XF8A 5TQ0B 1GGKA 2JAQA 2YZ2A 4XIGS 3V42A 1D2GA 3V00A 2BGNA 3K05A 4B48A 1T5SA 4AJJA 2X3FA 4NFLA 5FADA 4BVEA 1ACJA 1V1RB 2XH8A 3TL6A 3WFIA 2YASA 4M2LA 4X64B 3HEMA 1ZD3A 4FFRA 4ZYYA 2FAXA 2PD3A 5FYQA 2OO3A 4I50B 4OH1A 2UXDB 2JJ2D 2LGJA 4YAWA 3GJ3A 3EXIA 2W2OA 2XNHA 3FZEA 5EA2A 4B81A 5I4KA 1QXSA 2VHCA 1YGYA 4FC6A 1TM3E 1R18A 2CMDA 3KFLA 2H18A 3OTHA 4ZHQA 1LU9A 1LI7A 1ODKA 5LJLA 1GDHA 1QH1A 1H2ZA 5A0VA 4RKWA 3AQ4A 4TMXA 2QL7A 3CNQS 3ESXA 4DUGD 4FEGA 4WV3A 3PKJA 3WGGA 4ARUA 4QM6A 1DIOB 2VYVD 2WG2A 4O2AB 4WQMA 1I2MA 1Y8QA 4BX3A 4E88A 1BXKA 1LDNA 1UMBB 2EWVA 4LVCA 4X1IA 1UKBA 2BY4A 2FV8A 5AOVA 4RH0A 3M70A 4XJXA 5TY0A 1WSWA 3ASZA 1NI4B 2PGNA 5DNUA 2ETXA 2ZQZA 3G79A 3SWWA 3RSOA 1AUPA 2IYQA 4RABA 3N0TA 1UDWA 3O8CA 5EXPA 2FOXA 3PNYA 2PKEA 4DLLA 1GRVA 3ADBA 3IA7A 3MW8A 5FTKA 2DY1A 4UPEA 3OESA 4G8BA 2FPKA 2C92A 3BIFA 4KDRA 4N49A 3HB7A 4WCVA 4KUGA 4AS3A 3LW8A 3OWHA 3RSHA 1ADFA 4DDMA 2ZUBA 4A5SA 4WUVA 4BLPA 5LKAA 3L01A 4CEHA 4AZTA 3LC0A 5CM8B 4RZIA 2R6DA 2CJYA 4CFYA 4WOBA 1JQBA 3L7DA 3VHLB 5F7JA 1P29A 2Z6VA 1C2YA 2NPOA 2OBMA 3JQBC 3IR6A 2NV0A 2H7XA 1RJEA 3ESYA 2BSAA 3LX5A 4RD6A 2NWQA 2ZITA 2Z9BA 4G09A 4LNUA 4CG0A 1GDDA 5KPDA 1IUNA 1TZCA 3UXEA 2ZIAA 1NDHA 4RAQA 4H08A 3ZWCA 1OBVA 4CRWB 3TG2A 3JPWA 1NLUA 1J8MF 5BMVB 4QDZA 5CK5A 3ZGLA 3TAHA 5HPYB 2CXOA 3PE4A 1BKDR 3F97A 4NDZA 4A8PA 4CEIB 2D2FA 2FK7A 4NU8X 1ODFA 2DWUA 2IHZA 3ETDA 4EA8A 3KE9A 5DI3A 3G1TA 3FFAA 5EIFA 2IV7A 1N9ZA 1J06A 1DIGA 4J7AA 4OATA 1T3ZA 2G0TA 1RI1A 2WQZA 3OAAD 1LV7A 3CRMA 2BJWA 2B8JA 4MQLA 4EX7A 1FFEA 2O3QA 1TLFA 2GCIA 2V55B 1JG6A 2JHAA 1YS6A 5GP1A 1UZMA 2QQEA 3OZUA 4B3BA 2GFHA 3Q0EA 2PSHA 1MO3A 4CKWB 3HXQA 3FNHA 3GROA 3IKTA 4J4BA 1PV2A 4PAOA 3AM3A 4EA6A 3DZIA 2P9CA 5JSQA 3AJAA 4G86A 4DDTA 1AURA 4OHXA 3A2NA 4C30A 1SEVA 5LDDC 2QL6A 1T8PA 2Q07A 2XYRA 4G41A 3U40A 3WRYA 4Z5XA 2M98A 3EZYA 2Q2VA 4MAFA 1R5BA 4NDAA 4ZI5A 4C0QC 5AI8A 2OPHA 4CI0B 1CEXA 2QPTA 2X19A 4D02A 3T7JA 5HTKA 1OI3A 3RU3A 3TLYA 5K0JA 1OTXA 2H2DA 2ZRJA 3LGAA 4JKIA 1B1AA 1T2NA 3IXQA 4BQPA 4ER7A 3IL2A 3B60A 3NWEA 2QNBA 4RKQA 5JNLA 1YZFA 1RE1A 1JDUA 4YYZA 1UMCA 4G8JA 1GNQA 1RLIA 3AF1A 2X6RA 3TB4A 2QK4A 2GM5A 5A0FA 1E2LA 1UBUS 3BWBA 3KL2A 1NF2A 2WSYB 2NUAA 1AB6A 4QUBA 4EO7A 4IVQA 5B2FA 1U31A 1NY5A 1YB6A 3IDOA 4L95C 5F5LA 4YAGA 4Z9YA 2BEWB 3QOFA 3KZXA 4HR7A 2VAPA 2ZUDA 1EXMA 2O50A 5EMKA 5IFLA 1XZEA 3PP8A 2ID8A 2WLTA 5FB3A 1XL0A 4LV6A 2X6QA 1G8AA 2AWOA 4GOND 3GT4A 1HYHA 4ZOLF 4F3NA 1VRWA 4US1R 1XMJA 2F1JA 5LLSA 3ZXXA 1FIUA 3A28A 2G9QA 4G01B 4YAJA 2C2WA 2FPIB 2VHWA 4IIEA 3C7CB 2L18A 4N7BA 3W5HA 4DBZA 2AJ8A 3WXMA 4MZDA 2XITA 3JQDA 3LX4A 4LK2A 5JJKA 4YASA 2QP3A 1Q7EA 2GMWA 1RM3A 1M34A 4TOIA 1PS8A 3V9PA 4YS6A 5KPJA 2DFTA 4KRGA 5KAPA 3DB1A 4X66B 2Q5OA 3KZVA 3NXSA 2NSHA 2H1IA 4JJ6A 5FPTA 2EKZA 2D1FA 4JT4A 5KTNA 4LDZA 2H06A 4R2WA 5AKGA 1IN7A 4ND8B 3VJLA 4DBLC 5MGNA 2OV4A 2PQ2A 2YY6A 3N2GB 3UNXA 4W5QA 3ZXUB 3G5MA 3TR0A 3WO1A 2XA2A 5DLPA 4JBHA 1U7DA 2QZZA 1RPZA 3LRXA 1IQRA 5BSEA 2P79A 1EXWA 1YKSA 3DOOA 3T8YA 2EL7A 2HGZA 2ZSBA 3FPAA 4RIIA 1MNQA 3GXOA 1DRKA 2PV0A 3ENZA 5B58C 1WJGA 1Y8RB 1PJQA 4O3MA 1Z8DA 1G6HA 1MV5A 2OC9A 1S9DA 3UG6A 5EKUA 3QUAA 4RV9A 2FG7C 3WIBA 3HI6A 4XM1A 5K5EA 3IV7A 1NI5A 2GXUA 2PMDA 3AYXB 2H51A 3SIRA 1WUYA 5JIBA 4G0YA 4ZQBA 3RT7A 1GPJA 2NQ2C 3IOEA 3Q1KA 5DTRA 4BB9A 2JRLA 3IUYA 4XARA 5BQ3A 1TB4A 2VPIA 1KI2A 3UT6A 1P5RA 1U5AA 2JGAA 4J6EA 3HDVA 1YCFA 2QX6A 4OHFA 1LQTA 1E7QA 1D1SA 2DCMA 1JHMA 2ERCA 5C4GB 4MWOA 2XOKD 3DFMA 1YTLA 3WK8A 1GTMA 2DWPA 3C3EA 5EHNA 2E89A 3BHJA 1SC6A 1QRSA 5FWAA 1SBNE 4AUMA 4M1ZA 1L7NA 4WFIA 3VX3A 3DHVA 4URWR 2IS4A 4Z1OA 5JNTA 4QPDA 1TU3A 2P4SA 3IIEA 3ZZNA 4CFSA 4B3IA 5E7JA 3KNZA 4D4KA 4CQLB 3G5LA 2GGSA 5JUWA 2F1RA 1M2OA 1SKYB 4B2IA 1EJBA 3TRDA 1OTYA 1CQWA 2TECE 1O95C 4IRMA 5AMXA 2WMYA 2TMGA 1NVTA 1X9GA 3X2FA 4P7BA 4FI3C 4TX1A 1V7CA 3Q9SA 4AJLA 1SPXA 2G9UA 2LXNA 1GL6A 3B2NA 3WWYA 2UUAB 4LMAA 3QLJA 4ZAZA 2BSXA 1CY7A 2IOFA 1E5DA 2V3WA 3IUMA 4LTDA 2ZT8A 1JSRA 2P3LA 3DDOA 3HYLA 3KYDA 3L8ZA 4FDVA 4KFSA 2PSEA 1RI3A 2HF9A 2ZSFA 3KFXA 4YMGA 1VLMA 1N8KA 1JDJA 1K3FA 1R8SA 2HBRA 1U3DA 2PGDA 2VDKB 2XUJA 4PFKA 3SQLA 4EGAA 2M1ZA 4ER6A 3ITDA 1VPLA 5CDGA 2P6PA 1XMOB 1N6LA 4Y0VA 1R0BA 2R8EA 1WPXA 5J5VA 2QMUA 3KR1A 5ITVA 1LDBA 2PWYA 3D54D 4WWHA 4U2EA 2I5PO 3O2SB 4DBLE 1LEHA 3MNFA 2QPOA 2ONCA 3U61B 1GO2A 1YI1A 1PWHA 1JIIA 2JS7A 2PIAA 4C1BA 2DR0A 4UREA 1EUCA 4TSFA 4I3FA 3W3AA 2ATVA 3DTYA 3ETGA 1VG9B 3A05A 4GI2A 4DLWA 1FTGA 1QKKA 4C0JA 1LSJA 1NVXQ 2GBCA 3GVHA 2OAGA 1ULHA 1QWSA 4IQGA 5CLIA 2FE1A 3AYZB 4C7JA 4E6EA 4DB4A 3ZYCA 3I62A 4KXXA 1BH2A 2MYTA 2P65A 4LZOA 2BCJQ 4JLUA 5HRAA 4NFHA 4REQB 1UAGA 5D3QA 4KNVA 4LCJA 4Q39A 1DXOA 1RZRA 2C2KA 2QGFA 2X7JA 4MS4B 2C5FA 5FP0A 3WTBA 2C42A 1A88A 3FKJA 2W11A 1PUXA 2XWQA 2CVQA 3AMVA 3TWOA 3MINA 4DRYA 5KDDA 2F55A 3GJTA 2O54A 4J0FA 5IVDA 1KU0A 2FPSA 3RD5A 4Z3OA 2BBSA 3QU7A 4D43A 3FPKA 4C20A 4ZTBA 2C3OA 2OFXA 1X87A 3FFTA 3VZQA 4Q16A 4AMBA 1Y1KE 1TU0A 1XD8A 3NASA 2X22A 3OP4A 1Z26A 4IH9A 2JJ2A 5CLHA 5TGZA 3RBAA 4BLRA 3X1JA 4YR7A 5A4FS 4DR2B 1EGQA 1U5BA 1VCNA 2NVUA 4INZA 4BQSA 2XCTB 2PKRA 3W6PA 1XRRA 3O21A 1C1DB 4BZXA 4H4EA 4L7QA 3LK6A 3GN1A 4IMJB 3ZI7A 4D44A 4IDBA 3TFOA 1KC3A 2ZBDA 1OWPA 2ZI6A 1M1YE 4MK4A 1DOHA 3DVAB 4LUCA 4DUGA 5HP4A 1CDZA 5AK3A 3WE7A 4DIOA 1JA1A 4AKEA 2VYVA 1NTOA 2DPYA 2O06A 3A3YA 3FJ1A 3SPXA 1TF7A 5JO9A 3ZHZA 1JWBB 3ZIDA 4OQNA 3CUWA 2R8BA 5LYJF 1Q1NA 1G0OA 4R8KA 4E11A 4BWFB 5K3CA 4CXMA 5KKNB 4CCYB 3E84A 3OQPA 2II6A 5BR7A 3IVMA 4HLQB 3VR3D 4Z99A 2VP3A 1T6YA 1CQJB 3ZTWA 1XTJA 2FMKA 2ZI3A 4I3GA 3K1ZA 4NENB 3STVA 1JKIA 4PQYA 3SXUA 1XMPA 3HFJA 1VHDA 2XTMA 2H6EA 4MAAA 3MHTA 2A9KA 2ROQA 4DMRA 4W1SA 2Y77A 3KZ1E 1US8B 2V0CA 5KQSA 1DQZA 1QHYA 2C5AA 4BS9A 1I7DA 1V45E 5FA8A 3BKWA 1L5NA 3MRTA 1IL0A 3KB6A 4G0WA 4LJAA 3O9VA 4NATA 2VJYA 1O6CA 4TTVA 5TQ2B 3B89A 1NYLA 5TGTA 3TAUA 3JR7A 4KIJA 1QOZA 5F7ZA 4BAZA 4DMMA 1T25A 1PR6A 1X38A 4Q24A 2QI9F 3JRWA 5AKZA 3VJKA 3ZK9A 3SZOA 5ILQA 1P73A 1OA1A 2FA9A 3SVLA 4OHKA 2UVDA 3UAOA 3FN4A 3P7MA 3CE9A 3RS0A 3DD5A 5IDXA 3O2JA 2JI8A 2ZR0A 3ICPA 4DMCA 3NBAA 1ZRSA 1XWWA 5CA1B 2ZJ6A 1ZD4A 4P1ZA 2R85A 1H93A 4RK0A 4CKZA 5KOJB 5LD2B 1LBQA 5BR1A 2CNKA 4MTLA 3WGJA 2DM6A 4RD1A 3U80A 3K8OE 4ZOCA 1E1KA 4Z3KA 1UP4A 2EZ8A 4HLNA 1DELA 4OYLA 1AX9A 3NNSA 4M8NE 4MYDA 4PF1A 4YWJA 3OAAA 4DUPA 5JANA 4KZKA 2GN4A 1T5DX 2G28A 2ZXFA 2V7GA 4PC6A 3F8WA 3PJFA 3ZN2A 4BU0A 3PQ3A 2R87A 5C1IA 2H29A 2FVYA 1E3LA 1F8XA 1PGJA 3IOMA 3CXRA 5CW2A 5DB4A 5AUNB 5CX4A 4Q9IA 2AR0A 3T15A 3NONA 4ZCRA 3CR3C 1I5OA 5G1NA 3ZBQA 4HDRB 1C3EA 3NV7A 4Z0TA 2CUZA 3B3GA 3OO1A 5FWXB 3QTLA 5K45A 1HFWA 5MFPA 4DPLA 4YRDA 3DGEC 2XVXA 2ZAGA 1CUYA 2PLFA 3EFOA 3PPXA 1GR0A 1OJ7A 1YK1A 4PR0A 1YA8A 4F60A 2YXEA 4UU1A 4MS3A 4EFLA 2J31A 3RC7A 1RWNA 4RHFA 5BNIA 1QLHA 5T3YA 1XEFA 2YZKA 4ODIA 5FTWA 2J6IA 1L9KA 3T7KA 5EE3A 1MTZA 1CUCA 2ZIUB 4FMCB 5ADHA 1OT5A 3P2IA 4P53A 4EPWA 5EUMA 1A9XA 1UBSB 1ZBDA 2RK3A 2WILA 4NPHA 1H2AS 2HA3A 1OILA 4NZNA 4DV5B 3TKYA 1EUDB 1SCNE 3QU2A 2ATCA 2XOEA 2X8AA 2RARA 1OI7A 1XEWY 4JAVC 3R7WA 2QTFA 4X0EA 2PZMA 3V46A 3WGVA 1OWNA 3WMEA 2P9FA 4GM0A 1V11B 4EB0A 3FZYA 3GEEA 3L1UA 3O1HB 3EEOA 3LLSA 1EWYA 2FN3A 3ONWA 4Y1EA 5DDIP 3ZV6A 3BTOA 4DIMA 2PO7A 1EP2B 4G84A 5CVEA 5HZKA 2RGDA 1SD2A 4Z0NA 2EX0A 1JBEA 3SP1A 3TZBA 2WIKA 3ZCPA 3VAZA 4WZAA 2X9NA 3BBPA 4RF2A 4F8YA 1W7AA 1YCGA 3TVYA 5GQSA 1MGOA 1M2VB 3L7AA 3RRFA 1GU0A 3SY8A 4QM7A 4FFBA 4ZCQA 2VUIB 2Q1SA 1EPUA 3OBBA 3R0VA 4ZAFA 1L1FA 4DCPA 4C7OB 4X91A 1U7ZA 3MUFA 3EJ6A 5FL7D 1N3YA 2ILTA 3EVDA 3PQDA 1GL9B 1U7PA 3I9LA 5D85A 5J1SB 3ZVNA 1Z4JA 3PHBE 5KYUA 1SC1A 5EOVA 2PUCA 2EOAA 1EK5A 1XJ0A 4O4HA 3UWMA 1NZDA 2OR3A 3OIVA 3PS9A 4DWOA 1PR9A 2F8SA 1OCEA 3GR6A 4D7AA 3GX1A 1ZD9A 2CXTA 2YZNA 2EAUA 1ZBQA 5TPWB 1ZCZA 4D8UA 1RKXA 1ZMTA 4OGGA 1IWBB 3MD9A 1Z16A 4MVJM 5GOTA 3L8CA 2G83A 5IC4A 4DIBA 3NEAA 3DAHA 2AC7A 2NVWA 2ZJBA 4FYYA 1AN9A 3T5CA 2MWMA 1RTKA 1SUPA 2W2XA 3T4PA 5A5EA 2Q1XA 3M7IA 4FXOA 3E3LA 3HCWA 3Q87B 2PZ8A 4HI0E 5ERGB 4UTOA 4E4RA 2H3EA 5A6SB 4MDEA 3P26A 5BSFA 1P19A 3AB3A 1M2WA 3F3YA 4RTMA 1E2GA 3KKOA 2XOKA 3WKEA 4F3YA 3RIXA 4F5ZA 1N33B 2R8ZA 4H0FA 4DXDA 5EZQA 3D59A 3W77A 5F52A 3NOQA 1VMDA 5L45A 4IIUA 4NKRA 3UT0A 1NJGA 2HV8A 2XKBA 4LF8B 1TADA 1XG5A 2YWCA 3D1VA 3L5KA 3MEQA 5IT0A 3AR7A 4KFCA 3OT4A 2WWTA 4YNBA 2PWPA 1Z6XA 2YHBA 2CXRA 1WBDA 3HB5X 2BFOA 3V1LA 3ETNA 3W8RA 3ZE9A 2XA9A 3GJ0A 3KTOA 4JP1A 1U7XA 3LQ1A 2A0YA 3WBFA 1ZVQA 3T3NA 1A7AA 5JVDA 4RNCA 3K71B 1ZY2A 2YXLA 3GFBA 5IAOA 3AERA 3O2NA 4U2KA 3RANA 1MDBA 5BWBA 1V2GA 1QX4A 3PHLA 4JT8A 4LFCB 4DFDA 4YR9A 2PU7A 4Q02A 1O54A 2VDJA 2H48A 4I2NA 5FHRA 2RHTA 4BLQA 3FBGA 3DOCA 3PIIA 1WB6A 3ECAA 4NH0A 5K20A 4Y2PA 1MO2A 4J0IA 2P68A 2OORC 4OA8A 1UDRA 2I2AA 3IAEA 5J4LA 4LZNA 3C3DA 1OREA 4BCDA 2W6CX 1AQYA 2QZ9A 2F00A 2WWHA 5HFJA 1XQYA 4RXTA 4LMRA 3WV5A 3DE7X 3B1KA 4FB4A 5BNTA 1B23P 1DHTA 2WF6A 4PSKA 4DQDA 3NIGB 1Q5PA 1LSSA 1IY0A 1AKRA 1WZNA 2OCXA 1Q0PA 1HWYA 2CNBA 1YMUA 5JXGA 2YMLA 3D4IA 3LC1O 1FVHA 4XUEA 1QUFA 1H8HD 5BUSA 1Q0LA 1LV8A 3AI1A 3V1TC 3RRNA 3RGWS 3TM5A 4FNAA 4CR8A 1V7ZA 3CLSC 4EHNA 1I0IA 3DA8A 4N41A 1O7JA 3PT9A 4MVJP 3OG9A 2JZNA 3QLTA 4J7XA 1LZLA 1TOAA 1LDEA 4BB0A 4EYSA 3BXEA 3INGA 1MOPA 2ZRDA 3B9QA 3FHTA 3DV0B 5BNWA 4HX5A 3F7NA 3NAGA 2ZEJA 4W9MC 1U7WA 2O20A 2Q3EA 4U9UA 1PNVA 2DQSA 2GBPA 3KT8A 3QJYA 5ALRA 1U2PA 4GS5A 4Q00A 3T54A 1JBKA 1Z6YA 1ZMRA 5KSOA 4WEOA 3HBFA 5FL3A 3PK0A 3IBYA 3D6UA 2AX4A 4HRYA 2O8NA 4MROA 4P0TA 1RJDA 1EFDN 5EXTA 2J5KA 3I4CA 2XW6A 1UODA 4V24A 3TTVA 2C4TA 3L77A 4IIJA 1YUNA 4M1QA 1DJMA 4R2MA 2CSXA 1JHOA 1JE0A 1T0HB 3KL4A 2L0XA 3JS5A 3R6GA 4RQAA 1Z5ZA 3OIDA 4FX5A 5IMBA 5A5VA 4RTQA 5JSUA 3SQXA 5AVWA 4C3ZA 3RRJA 1A7KA 2B1GA 2HCTA 2PYZA 3O74A 3QF4B 2UVQA 4HFNA 2XDAA 2ZAIA 4D4HA 2VHQA 3GG9A 4OBWA 3A6KA 4Q9AA 4BNNA 5JQGA 3UV3A 3LVFO 3U09A 1GUAA 1P4AA 3FCAA 3ZBTA 4F9EA 5FAXA 1I4WA 1CFJA 3FSEA 2XBMA 2BKLA 5FH9A 2G9ZA 2JKYA 3CRZA 3OC0A 2H07A 5ARCA 3Q6MA 4BNLA 1TQ8A 1E2PA 4JC8A 4RHXA 3CJTA 3Q3GE 1G8HA 2FVXA 2E55A 2VPPA 2QTAA 1T6BY 2WG0A 3BXGA 4JJFA 3M4YA 4Z8YA 1N7GA 4GPD1 3S2FA 1G42A 4B3MB 2ZYHA 4UOEA 1KBZA 1E2MA 5KEIA 3C5EA 4RDCA 2VHVA 5E0OA 4HNSA 4P3PA 4D3FA 4EHBA 2PR2A 2R7AA 1HT0A 1U0LA 1NHWA 1GSOA 1OLSA 3WTCA 2GHTA 1R7RA 3ZQJA 4YRCA 5IUNC 3GRVA 3V8VA 1HDGO 4Y6OA 4G1MB 3HVKA 4QYMA 1E3WB 4F6CA 1SBCA 1SIWA 4NU0A 4NRDA 4ZAYA 3K9QO 1PU2A 5JBNA 1NVVR 2HK6A 2ZRAA 2R7MA 5A3SA 1GUZA 1QCCA 4QJ5A 2I34A 4UVDA 1Z37A 1RJ9A 1DRWA 4ZOBA 5HJ5A 3NDPA 1KYZA 2XTJA 1NP3A 1Y6ZA 1W25A 5G41A 5JS8A 4TVOA 1CS0B 1QS0B 1F6BA 3IT3A 3PZBA 4OB7A 1BDHA 3ESCA 1PX0A 3T5GA 1DBSA 5JG7A 5HRUA 2QN6A 2OKGA 3MOIA 2RGYA 3RAJA 1JHXA 1H2HA 1WPGA 2FFHA 2VF5X 1SCUB 2VTVA 3P2KA 4G5GA 4O29A 5DM70 4C4TA 4RTOA 5DHPA 3MWDB 5TRTA 2FX2A 2RGWA 4NL4H 3T0IA 5KYWA 1SHTX 4IWNA 4RZSA 1KFCB 4HWKA 2FLKA 1TPZA 1NQUA 3JVEA 4OFZA 3KQWA 4BYMA 1ZR4A 3P71T 1C7JA 2NO1A 1XDBA 3HP4A 2QHXA 2GEKA 3LHFA 2Q2QA 4MW9A 3H5VA 1C14A 2EXXA 3DCIA 4JLVA 1EEHA 4MWEA 1WXIA 4ND6A 1JDPA 3AGPA 1HE5A 3IPCA 4A2PA 2E87A 4C21A 3I2FA 2IK8A 5HX7A 5HIIA 2HJWA 4EZEA 2HBZA 3LDAA 3IQXA 2P0AA 3LMKA 3UW1A 1B76A 1DSSG 4MW0A 5IVKA 4WESB 5ARDA 5KTYA 5TX7A 1DKMA 3B13B 3EPRA 1BO6A 3FYUA 5GONB 4ZPJA 4W6QA 5DBEX 4NDNE 4ZVOA 1LDYA 1TRHA 1USGA 3X1MA 1RC8A 4OQQA 1U80A 4TMVA 3ZE7A 1XNHA 3TB6A 3UJCA 3VNBA 4QUEA 2ZB7A 3JWIA 5IBRA 3UWKA 3I37X 4EAAA 2HIGA 4K87A 2IUSA 1AKQA 2JLAA 3UMYA 1CQXA 3TSWA 4TKUB 1V4VA 2HMVA 2P4UA 3N59A 3KYJB 3BOSA 4UJ3A 1PD0A 1G9SA 4B43A 5DMXA 4FJ2A 4IV0A 1KL7A 4KAFA 4KHPB 4BCCA 4N01A 1T15A 4UM9D 3N2KA 1DAEA 2HK9A 3K4HA 4EDHA 4N3GA 3ZHRA 2JLRA 5F2KA 1TAHA 2WKRA 1QLJA 2J3DA 3AUJB 1Z0KA 1VI2A 1XC7A 2GJKA 1AZLA 1NM5A 3L07A 3ABZA 3FOAA 1CUBA 3M5CA 1UFRA 1TDJA 4MWSA 2PY6A 4O4JF 4KACA 3PR3A 3ZNPA 4E1BA 2GK3A 1AUOA 3OZRA 4FDAA 5AKXA 3SXJA 3PRYA 3LQKA 4QHSA 3RKSA 1U1EA 5FL7A 2CHEA 2ZJYA 3FAKA 1SA0A 2WJGA 4MDHA 4KDCA 5AP9A 5DLQC 3UAZA 4KPUA 2AF3C 2I2WA 1LW6E 3BMNB 1ST2A 2OENG 2RI0A 3N0VA 1TEHA 2ZRFA 3DDZX 3PJEA 3G9UA 1TEXA 5M3BA 2EATA 2OECA 3EUFA 4JT9A 2O8FA 4NESA 3EW7A 3W78A 5JNUA 1ZCAA 3ZGXA 1PFYA 2TSYB 5HXAA 3QTBA 4GHWA 4II2A 1AS3A 3FYTA 3NC1C 3E22B 1J5PA 1K88A 1D2EA 1WEKA 2R1TB 2C5LA 1VXRA 4TXLA 4Y9DA 4NJEB 5B3LA 1J0AA 1GAJA 1YZLA 3OZIA 4JGGA 4D74A 2J9FB 1WW3A 1N2XA 3GPCA 4ZT2A 4P0PB 2RB4A 4AB1A 4Z7OB 4HEHA 3ZQ6A 4EG8A 3JQAD 1TKBA 1O6GA 1CYDA 3Q7QA 2CCKA 4QUHA 4MMXB 3HWRA 2VTDA 2NO7A 1O6ZA 1MIOA 2XADA 4I9UA 3ABQB 4BLUA 3G2IA 2P3QA 5A5DA 3IURA 4KPEC 4D45A 1EDDA 2R6ZA 4I5EA 1U0RA 2QD4A 1YJ8A 2JGNA 3HYRA 4QG7A 2XNDA 3FMOB 5F23A 2BFAA 4P7GA 2JL1A 1PW5A 4HQFA 2DH6A 4AY4A 4R9RA 1Z8HA 5AT1A 3LA8A 5D3MA 5IF3A 1P18A 2EZUA 3GFSA 3R5TA 4OAQA 3DVRX 1M8KA 3QPUA 4RZXA 4GBED 2QYOA 4MV9A 5J2TA 1OXMA 2GAFA 1PCXA 1EX7A 1Z5OA 3A3PA 3FY4A 5JAIA 3KSMA 4TXNA 1T6XA 1YE8A 4N5DA 5ANRB 1U0OC 2N47A 1NIJA 1UIRA 2ZYVX 1EBBA 2R97A 4G24A 4Q4AB 2XXJA 3GNLA 3MJFA 4H3SA 1HC7A 1YQGA 2R751 2WTMA 1TCCA 2XMDA 5KVSA 1N6IA 1CJCA 1AT1A 1I1OA 4J29A 4X90A 1IHYA 4CIDA 3HMKA 3TUZC 1BX1A 3KHTA 3OPYI 3THWB 1QFYA 4F0JA 3W9UA 1QRTA 1RXIA 1KJNA 4JJEA 1TEVA 1W2HA 1SCQA 4L5YA 4QGSA 1DBRA 4Q66C 2HHLA 4RD0A 4D81A 2B4YA 4TLBA 1FP4A 4OQEA 5LDGA 3SQMA 2P8JA 4Z1MD 1DEOA 2EP8A 1DBIA 4I5FA 1SUIA 2VYND 4I5DA 6REQA 2XTNA 2WZDA 3K0AB 1PTKA 3BMOB 3DBLA 1WV0A 4UBOA 5SYMA 4RMGA 1EGAA 2BF4A 2O4UX 4JBIA 2FSVA 4XJTA 3C8MA 2QJRA 3VJMA 2QI9C 2ADMA 1GR1A 1TTHA 1EFPA 1TJYA 2XBUA 3E5NA 3EH1A 2YDXA 1H8HA 3QVKA 4TTSA 3RHFA 3V1NA 2I0FA 4KYTA 4RY9A 4TUYA 3EFBA 4IAOA 3DO5A 3VMFA 3T38A 1Q77A 3OP1A 3Q98A 4H18A 4R1LA 1N1MA 3SHTA 2UZIR 3L8GA 3R7DA 1QG0A 3U39A 4JLMA 5KNCD 2YCLA 1VECA 2WU4A 2YNMD 4I19A 5AK6A 2B2CA 4QU8A 2WSMA 4R6WA 1WZUA 1L8XA 3C87A 4AP5A 4F1JA 4CQNA 4FT4A 4YRRA 1AHHA 1RC1A 1T5TA 2CJXA 2CFOA 3NR2A 4BTVA 4DA9A 3IPXA 4XFJA 1J22A 1UT5A 2RB5A 5E9AA 5A3RA 4N0MA 1L5QA 3P32A 3K94A 3WSVA 2B4AA 3HA2A 4IIXA 2JEOA 3AKYA 2RONA 1VLLA 4GXNA 3QFHA 4H59A 4LNAA 4OXIA 2OHOA 4V0LA 3USZA 3UATA 1EH5A 3CCFA 1D4FA 1I6WA 3NGLA 4H6XA 3OKPA 4Q4HA 1JEYB 4P0QB 2AK3A 2MCFA 2XMGA 1HZJA 1L4MA 2I2FA 2OTCA 1N2CE 3BS4A 3O95A 5U4XA 3RVSA 3VDMA 4ZVQA 4AY6A 3FSJX 3TOSA 5KYXB 3PXAA 2AVDA 2VJDA 2AB0A 1EM8A 1ISGA 2FEXA 3ELDA 4IX9A 1N77A 3LCVB 1XZLA 5T4EA 3EE6A 3QENA 4CHTA 4YJGB 3V33A 4L4XA 3AT1A 1S1CA 4H6VA 4NQRA 2D5AA 1HTBA 5CB4A 3L49A 3PUZA 1GDTA 2SBTA 2GM4A 3DEAA 1B8PA 2K4MA 4Y8VA 5B36A 4RORA 1S3SA 3WICA 2CB9A 2GDZA 1X0XA 2XE7A 2TYSB 2XXBA 3GFRA 1BWPA 4RV4A 5F21A 3ZPXA 3C2QA 4QJ4A 4MQEA 1EUYA 4MUYA 5K6AA 5FTMA 2E4ZA 1R9JA 2I7DA 2RHGB 2BUBA 4HNGA 4PHTA 5KTTA 4NFSA 4DEXA 4L8LA 4O4LF 3JR3A 4Q9NA 5A62A 3FLEA 3NHLA 2VR1A 1IQPA 3HB0A 3OJWA 3OUUA 4HXEB 4J2TA 1GFZA 5H3LA 3TGPA 2WQ7A 2BMJA 1DJOA 4F4DA 2CMFA 2JLQA 1XMIA 3EUAA 1XMSA 2ARKA 4LX0A 5F12A 3ZBPA 5FUQA 4M83A 1N0UA 5ALGA 3LQQA 3KSBC 2CLCX 1DTWA 1NUHA 3A1CA 3I0MA 5CVUA 3HBJA 1C81A 1B74A 3AR9A 3T3DA 4OI1A 5C35A 1O57A 4I1YA 4RJIA 3E9YA 3SIPA 5DGHA 5IT9A 2JZCA 4NBSA 4W8GA 3UB2A 2HKIA 5T7BA 3WNQA 3A4NA 4EL5A 3FOBA 4FOTA 1C8KA 1HOXA 3IUJA 4BQRA 4LEIA 4AECA 1JG7A 3KSRA 3LOUA 3MTBA 3FSGD 4P86A 4DADA 5BYAA 4KBYA 2W8BA 4U7PB 2POCA 2PZFA 4K6OA 3UMRA 3S7TA 2E21A 3OD1A 2OSVA 1WB5A 1SGWA 1RRGA 1XD2B 3KQVA 4G56A 4BFUA 4BEJA 4DDWA 3O1JC 2PX4A 3R0ZA 1U2EA 2J07A 3FGZA 4FZJA 3PA6A 4QDKA 2GA9A 4K0RA 1ZH4A 4YJ2F 1XCMA 3CXUA 3LIIA 4B17A 4OKSA 1PTJA 1GFIA 3OWOA 3PNOA 3AHGA 3CUUA 3OE1A 1OFVA 1ZIXA 2NVBA 1F06A 1U9ZA 1CE8A 4KR2A 2IYYA 5DHFA 3FLMA 2W2PA 3REQB 3WK9A 2YWBA 1E32A 1KEWA 2JLZA 3A4VA 4ARZA 1IQ0A 1IUPA 4H2DA 3EDCA 3ETHA 5GGYA 2EU8A 1SBHA 2UVPB 1JA9A 1MJFA 3NPAA 4HMPA 1JEQA 4OK3A 4C0KA 1A8PA 4RH3A 3UA4A 5HF9A 1N6KA 1H5UA 2IP1A 1JH8A 2UUPA 2XT6A 3IPRA 4G89A 4QG3A 3DPSA 3Q3CA 3ONFA 3VR5A 2Y4OA 1UIMA 2IDMA 1T36A 3UV7A 8MHTA 4ZN6A 1P7YA 2G6BA 2O57A 2EKPA 1Z06A 4WKCA 3CZCA 2ZWAA 5T6MA 1UXKA 3N8GA 1OH8A 1PGQA 2E85A 3WQHA 1WZIA 4MVJE 2ZWOA 2XHZA 4QDJA 3VYSB 1ZMOA 1EVIA 2OZPA 3KDSE 4M22A 4DANA 3PVCA 1W5EA 3QVGA 5EPUA 1L4YA 3IIJA 3O8BA 4NJMB 3KJQA 2I7VA 1BZYA 2X86A 3DE5X 3MFYA 3NM5A 2C04A 1CTQA 5E6UA 4ZC8A 1U4OA 1F2UA 1LQUA 1TI7A 5DO9A 1V4NA 2QSUA 2ZSJA 1R64A 3LQYA 4MV7A 4CCSA 5I9IA 5EPEA 4XUGB 4LX8A 3Q40A 4L4UA 3SZUA 1NN3A 1Z39A 4BVBA 1ECFA 2AK2A 3FGPA 3KQMA 3JASB 4HEQA 3VI3B 4EG0A 1H23A 1K6JA 3GP5A 5AM5A 4JYAB 6CHYA 3JYHA 3U16A 4C05A 4RJKA 2NU9A 2WAOA 2R00C 1Z4NA 1MPXA 2AMJA 3HYTA 3UAWA 1LY1A 4GX2A 4JUDX 5DH9A 3O1LA 2PUTA 1HDZA 4KV9A 1UZAA 3VISA 4CT0A 1NJFA 5TDHA 2PD6A 4ARVA 1UK9A 2FZEA 5HQTA 1E9CA 3DF7A 4O02B 4XYBA 3VR1A 4C5CA 5LN1A 3D64A 4RPJA 2D5LA 2Z8YA 1PV1A 4IFTA 3CVWA 1NJ1A 1WCWA 1Q7BA 2B0CA 4TTIA 4ZI7F 5JV5A 4F86A 5JZOA 3HBAA 2X9VA 5BV2P 4EI2A 4RELA 2VBIA 2XUHA 1Z7WA 3HCPA 1KDZA 1N2OA 1WMBA 2DPLA 3K9GA 4QUJA 5JWOA 2J67A 4BWYA 3TGLA 2IT1A 2OXFA 3E27A 1U0BB 5LQCA 3M0EA 2ETVA 1OE0A 4JLWA 4RD2A 4OHBA 4ZOLB 2EQ5A 2HXGA 2F67A 3JQAA 3VO8A 3VR4H 3DMGA 4Y2TA 1JEJA 4JUAA 2HHAA 4V02A 2J9YB 4KRXA 5DOVA 4NQZA 1CNMA 4TROA 2VRWA 4GXTA 4P58A 4IVPA 1V1MA 1H2YA 1QVZA 1Z18A 2RDMA 4PZ9A 4PLVA 2D1RA 2DGDA 1VMAA 1I2ZA 1UDXA 5HDBB 1EB8A 2B99A 3ELBA 3JALB 1UT8A 3IAM6 2HLHA 4JLNA 3MZ0A 3OU6A 2O1WA 2OHXA 4OHCA 4X1YA 4XPIA 2DX7A 5B6JA 2ECPA 4JK3A 1YCHA 1ONPA 1YBFA 1DI0A 2JFHA 1T1SA 2Q3LA 3FLBA 4MR9A 5I47A 1BJTA 3QKIA 3AVXA 2J30A 3RTBA 2Z3ZA 4MJLA 1VB5A 1ZJ4A 3OIUA 2N75A 4KQGA 4DC0A 4JJ4A 2ATIA 1C9NA 1A7JA 3KK0A 1C9MA 2J0SA 5A1JA 3GA0A 4TTJA 5REQA 5JFGA 3PDJA 5HCUA 1QGUA 3FDIA 4L0CA 2QVZX 4DIDA 1RP1A 5D3KA 3EXEB 1V0JA 3PL1A 4BQOA 4QDUA 1C2TA 1D7AA 2XI4A 3GQBA 2A9PA 3H8VA 3OPXA 3OZSA 5I9SA 2JLVA 3EA0A 4CLOA 1M1NA 1AMNA 4XD7D 3VZRA 2DF8A 1OA0A 3NFRA 1SUSA 4HP8A 1UJBA 4JLAA 4GQIA 3ZGYA 4AIIA 2IYLD 5K9ZA 1Y1TA 2YVAA 4Y3UA 1A8UA 4YCLA 3V6LA 2Q8QA 4I1PA 1DADA 3GZJA 1E64A 1XTUA 1YQDA 8ATCA 4N03A 5LNK6 4EP1A 1HNWB 1KI4A 2OD9A 2H1VA 1IJEA 5K2MA 4A0GA 1P7CA 2VYNA 2ZUSA 1XNRB 1CDOA 2D0IA 3DAFA 1DX4A 4QNRA 1KPGA 1Q6ZA 1X8LA 2BMVA 2JFFA 3HR8A 5G1PA 3VR2D 4PX5A 4C76A 2OCDA 3O03A 1PVVA 2F64A 2ZB2A 4I1OA 1LPNA 2RFLA 5FTJA 1G8MA 1GQRA 1V8FA 3S2IA 4B8ZA 4HVLA 1E2BA 4HDMA 4PZCA 1JJVA 1GILA 2PHZA 2HSWA 2A8YA 4RVUA 4ASUD 1Q1ZA 1JF8A 3C1AA 1X80B 4LHSA 4RA9A 1J7JA 1NNLA 4U6QA 1EDZA 5DM1A 1OFTA 2H92A 3HN2A 5JHGB 4XGIA 3W0LB 3VU1A 4LDAA 2X8WA 2XHEA 3EEBA 3TO5A 5FWYA 3PFFA 3OZ7A 2IEYA 3KUKA 3OTWA 4LJKA 3T3GA 5KNCA 2YNMA 4Q4LA 2W0MA 4M37A 2WAAA 2ODPA 3DXZA 3OPQA 4PS1A 4X92A 1G8KA 3S2UA 4BVGA 1VPTA 3FR7A 3DKIA 4JOQA 5IZCA 5SYAA 4NXMB 1OXVA 2IXDA 3X44A 4TWAA