3MJDA

1.9 angstrom crystal structure of orotate phosphoribosyltransferase (pyre) francisella tularensis.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
209
Chain Sequence
NLYFQSNAMFIEFALKNQVLKFGEFTLKSGRISPYFFNAGLFNTGAQLATLADYYAQLIIKSDVKYDILFGPAYKGIPLVAAISTVLALKYNIDMPYAFDRKEGVFVGADMTNKKVLLIDDVMTAGTAFYESYNKLKIINAKIAGVVLSIDRQEKAKDSDISATKKISQDFNIPVLAVTNFESIFEYVKENLDETMIDKFKQYRQKYGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Orotate phosphoribosyltransferase
publication title 1.9 Angstrom Crystal Structure of Orotate Phosphoribosyltransferase (pyrE) Francisella tularensis.
rcsb
source organism Francisella tularensis
total genus 67
structure length 209
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3mjdA00
1A98A 1NONA 1O57A 1I5EA 4WN3A 1J7JA 1TC2A 5ESXA 4LZAA 1DBRA 1GRVA 1UPFA 4RANA 2WNSA 1Z7GA 3DMPA 5KAPA 1ECBA 2C4KA 3HVUA 1G9TA 1PZMA 1R3UA 1FSGA 4S2UA 5BQPA 2YZKA 5HIAA 1P19A 4RAQA 3N2LA 3O7MA 1O5OA 1I0LA 2JBHA 1I14A 5HKLA 4P86A 1BZYA 1VSTA 1A97A 4PFQA 4QYIA 3MBIA 2VFAA 4LZNA 1UPUA 2GEBA 4P82A 1XZ8A 1ZN7A 5E38A 1QB8A 4RQBA 3S5JA 4RQAA 4P81A 3OZGA 4P80A 1A96A 1MZVA 1CJBA 2JKZA 1ECJA 1YFZA 2XBUA 1OREA 1P17A 3EFHA 1WD5A 1QCDA 2PRYA 4RABA 2PS1A 3ACDA 4MB6A 3OZFA 4LZOA 3ACCA 1P4AA 4P3KA 1G2PA 1I13A 1STOA 4IJQA 1UFRA 1DQPA 2H08A 4OHCA 1TC1A 1NULA 3G6WA 5JV5A 4RHTA 1OPRA 1QK4A 3GGCA 4KN6A 5BSKA 3DEZA 5BRNA 2H06A 4PAWA 2JKYA 3ACBA 5KAMA 1A3CA 1A4XA 1XTUA 2P1ZA 4X44A 2IGBA 2PRZA 1BD4A 4X45A 1QB7A 2JI4A 4F8EA 1HMPA 1ZN9A 2H07A 4JLSA 4M0UA 5EUCA 4RACA 2FXVA 3QW4B 1U9YA 1XTTA 4LYYA 1JLSA 1QK3A 3DAHA 2DY0A 1L1RA 5BQOA 4RHXA 1ECFA 4RAOA 3GEPA 3KB8A 5JSQA 1JLRA 1ECCA 4QYIB 4JITA 1DQNA 5IPFA 4RV4A 3NAGA 1DKUA 1QCCA 1OROA 1BD3A 1G2QA 4RADA 1LH0A 1I0IA 4M0PA 3OHPA 1Y0BA 3LRTA 5ESWA 4RHYA 2EHJA 1GPH1 1VCHA 1HGXA 1W30A 1QK5A 3GGJA 4LYGA 1AO0A 3MJDA 1VDMA 4RHUA 5K51A 4ZFNA 1ZN8A 1ECGA 4TWBA 2HCRA 1U9ZA 4WMLA 2E55A 1L1QA 3H83A 1XZNA 1XTVA 1G9SA 5IAOA 4P83A 3M3HA 1A95A 3LPNA 4QRIA 4P84A 4FYMA 1IBSA 1P18A 1D6NA 4M0KA 1V9SA 2AEEA 4Z1OA 1DKRA
chains in the Genus database with same CATH superfamily
3ESDA 4TLLB 3CWCA 1RRCA 3ZCSA 4JQOA 3LXRA 1UBHS 4WN3A 1W88B 1Y37A 4PRLA 3GT7A 2ZG6A 4X20B 2PX5A 3R74A 1YJCA 3DKVA 5DHRA 5ALQA 1FFXB 4PG5A 4CL0A 1XZHA 3ZLJA 5JI2E 3PF9A 1FSGA 1G3IA 2Y1KA 1I8TA 4E94A 4KACA 2G0AA 4DT1A 2APJA 3KZNA 4W63A 2Z30A 4GUDA 5COAA 4OYHA 4WPGA 2H92A 3C8DA 4AY5A 1XMPA 4CKWB 1H5NA 1V8PA 3N05A 4HDKA 2RI6A 5C18A 4P4UA 5KYXA 1O96B 2C7OA 2H3EA 3QNUA 1M8PA 2YJZA 1VE7A 2CVOA 1XZ8A 2IVZA 4JZYA 4BDSA 5BV7A 2AX3A 3AF5A 3DMTC 1WMBA 3JWPA 1ZJJA 4ARBA 1ARZA 1AX9A 2B20A 4GM4A 5B7GA 3T1VA 3LYAA 1XQ6A 1UXOA 2X8WA 3KSBC 1THGA 2J3JA 2C2WA 1N2OA 3RW9A 3SYKA 2PNFA 1CDDA 3N0XA 3QEBZ 5LN1A 2P1RA 4IKEA 4NZNA 2C83A 4NCKA 4HTAA 4Q4AB 3WJ7A 4ZYWA 3QITA 4X7BA 5JSKA 3UWOA 3TIXB 3SS9X 3DTVB 3PPXA 2MOKA 3TM4A 4BKUA 4F12A 1DMSA 3NBQA 1A0OA 3GT4A 2FW8A 5J4YA 1EJ6A 1UFRA 3HJRA 5CAEA 4KWIA 5ILGA 2UKDA 3RARA 4QX6A 1U5AA 2G06A 4EEKA 2N0SA 3H2ZA 5HYVA 3QTTA 1SCQA 3NATA 1QLWA 4PLHA 5IK2A 5LZ2A 4YP5A 2A9QA 2QRVA 3PBKA 2ZTHA 4O2BA 3QLUA 1EYZA 2CB9A 2F43A 2WPDA 3TTXA 3UVEA 4HJRA 1J25A 4BFWA 4EO4A 5IVPA 4YRDA 5KS2A 3KJIA 2PRZA 3UT5A 2YJ3A 4DM3A 1BEEA 1T5BA 1PW7A 1TVMA 2VYND 4XIFA 1TW2A 3KQSA 2QQGA 3UYKA 2LD4A 1JQDA 4XLTA 2WOOA 3FBTA 2O7NA 3HYNA 4B7CA 6Q21A 3CZMA 4IJWA 1UMKA 2R48A 2CZCA 3OJFA 3RPEA 3BM5A 5IF9A 2DP4E 1MW9X 1NLZA 5BQ3A 2GM5A 2CNBA 4Z3KA 2VJNA 4IH4A 3E3LA 2P77A 4MI9A 1X1CA 2WWHA 2JIRA 4AYXA 5FWYA 2DWPA 4ZK2A 4TVKA 4WBNF 2Y6VA 3TTSA 2JGDB 2Y2UA 1I3CA 5B53A 3QWFA 2H3HA 3NGMA 2J6HA 3FIUA 1PJZA 1S02A 2F90A 3BVPA 1AZTA 2F67A 4KH0A 1U1IA 4L9AA 2C9YA 2IT1A 2OL4A 1GL9B 5C2JB 1GTSA 2HYIC 1GNTA 1VGVA 2YH2A 4Y9DA 2EQBA 3GVCA 1I6KA 1UJMA 4G5OA 4YRZA 1Z22A 3WLAA 2J07A 2WNHA 3UXYA 1NM5A 2IP2A 4MS4B 1WA5A 1OH8A 3A6LA 3B89A 1JHAA 3L07A 3WJ2A 1UFKA 1MDBA 4MW0A 1F9AA 2B8NA 4AP5A 1VG0B 3AEQA 2RGXA 4LQCA 5U1PA 5JAZA 4LRUA 1H23A 1Z6ZA 2DSTA 3VR1A 4A2QA 5E4YA 4A7PA 2CNDA 4XJVA 1YF3A 5K4HA 3BD7A 3DKKA 3M3HA 3OMXA 1CNEA 3DZBA 2IY8A 3IMFA 3A2KA 5PNTA 3RJTA 2Z04A 3EVEA 1LDEA 4G37A 7GPBA 3CY6A 1DVRA 1JPJA 1X7WA 2E9SA 4KJXA 1CW2B 1TU4A 5SZJA 4EJ2A 1JPUA 3ZCRA 4IUCS 1VE6A 4ZOLF 4LYEA 5EY5B 5CLIA 3SJCA 5AM4A 3P0FA 1JAHA 1AHNA 4MI6A 2QVGA 3LHFA 1G9TA 4V24A 1PU2A 5LFAA 1KZ7B 1OAKA 1J39A 4C87A 4A8TA 1YIDA 1HFEL 2JGAA 4ISCA 1ZCBA 1TTPB 1XDGA 4J0EA 1CFZA 1GN8A 5H02A 3GT0A 1MZPA 3BJMA 1PUXA 3EASA 2RGRA 3MOGA 5BR1A 3K0BA 3T15A 2XOEA 5A2QA 1M5RA 2ZROA 5K1ZA 2W6ZA 1NBHA 1YB7A 1I1HA 3HP1A 2OVFA 4CG0A 2OCLA 4O4LB 5C8ZA 3FSEA 2A1TS 4I8XA 4YDQA 3QYAA 1E1YA 2AMJA 3IQEA 2KLHA 5BT8A 1Y1RA 1NLUA 5A1TA 1J5EB 1TQ6A 1RWPA 5DZSA 1FX0A 3F6CA 5ENDA 4F06A 3A3YA 1SO8A 3S4YA 4UOEA 4BQEA 4WZ6A 1CK4A 3HN7A 1WP9A 2XDQB 2Z08A 3C87A 1YQQA 3L77A 3O73A 1UKVY 4BB0A 1DG1G 2W2PA 4H0CA 4OHCA 4KQ1A 3CNQS 1PJ4A 4JYZA 2C7PA 2PZFA 1LDYA 2ZRPA 3PPVA 1DIBA 1RYMA 2CNOA 2C04A 3PNPA 3SHOA 3TDKA 2H65A 4KMOA 3T7IA 2H5IA 2POCA 1XU4A 1Z28A 2WU8A 3A58B 3JAMA 2H1RA 3HI4A 1JWLA 4CKZA 5ALTA 1F2TA 1ZVJA 1H5UA 4H15A 4WZAE 4YIHA 2QYHA 3H04A 4KW7A 2XRFA 3MT7A 3RAGA 5F1OA 3R20A 1TDJA 4M0UA 4R1SA 4D74A 4RLQA 4B32A 3T3PB 1ULBA 2R6R1 3BMCB 3K9FC 3S3TA 4EATA 1PR5A 5JCPA 1JKIA 1NSFA 5ERGB 3G17A 3OP4A 5EXSA 4ENWA 1BH6A 3L5OA 4TQ9A 2EKZA 3HI6A 3NHRA 3Q9SA 1U7OA 3Q10A 5CFZA 1DQNA 5CEJA 4IUBS 5LMUB 3KLPX 1Y98A 2J9XB 3SIPA 3P2MA 4JP3A 3GJTA 2COKA 4KR2A 1U8FO 3GQBB 3O6VA 1RD4A 3AR6A 3ZEAA 5FLXA 1XRQA 3KT6A 4G9GA 5BW5A 2RH4A 4LA4A 1EVYA 4CLOB 4FHEA 1CY6A 3KR2A 2A5FA 1FRNA 3BTSA 4WASA 1QIJA 4CLDA 5A04A 3V8RA 4CMKA 1JHQA 2ETXA 1QZXA 3VR6H 4YMIA 4O8ZA 4FOSA 4U2EA 2PH7A 5E3HA 3CS3A 1GRRA 3NDJA 1R0CA 2Q3FA 1KR2A 1XUOA 2IYZA 2V6GA 3CLVA 4DR7B 3PD7A 3TQSA 3Q6MA 3IBYA 4DARA 4X95A 2XIQA 4D5EA 4G1CA 4EUHA 4TTQA 4LJKA 1E4VA 2BRUC 2HV8A 4LECA 1F9EA 1SOUA 1XD8A 2OO5C 4IFTA 4OHMA 4R2KA 3ZCXA 4G97A 5E0OA 5J2UB 3R2JA 1ODKA 2R87A 4LQDA 1P3Y1 2BGJA 3HV2A 2CXRA 3MILA 4J0DA 4XDHA 1N5RA 2VP9A 5GP1A 2OFXA 4KZKA 4PO3X 4YPOA 1XEXB 1ISMA 1I4LD 1OLSA 3ZBTA 2PQ0A 1SWWA 4MTLA 1K2VN 5K0SA 3IP5A 3F7OA 5IG2A 4OB6A 3BSSA 4GX1A 1U2GA 4R7TA 5E9QA 3U4HA 2BFOA 2HMVA 2QM7A 4RK1A 1TCBA 1M2FA 1GTRA 3ZPXA 4CV2A 2FF7A 4IDBA 1DX4A 2HSZA 1F2UA 4C3UA 3B6ZA 3ESRA 3F96A 3NJ4A 3BXEA 2UZ1A 2R60A 4RELA 2RGAA 4AFNA 1RKBA 1RKUA 2CYAA 3NKFA 3V80A 3BCUA 1H85A 1CZNA 5DNAA 2NVBA 4L15A 4MO2A 4DV7B 3GFPA 1L8XA 4CT4B 2IX3A 1FFYA 1JT2A 4H3SA 2VHUA 2OP1A 3EZLA 4G4GA 4JENA 5D3QA 3TGLA 3IJ5A 1OI4A 2NVUA 4IOKA 2BHTA 4NFLA 3RJMA 1DDOA 1NC3A 2ATIA 5HF9A 4HYTA 4NK5A 4K6MA 1QGOA 2ZXFA 1JEQB 4Y2SA 1U3CA 5B2ZA 4I4TF 1SXJC 2NG1A 3AFIA 3PRHA 2GTHA 5E6RA 4UFNA 1MOSA 5ITZB 4Y2TA 1CHNA 1T9GR 3UM9A 2WB2A 1XIVA 2QRPA 4L50A 2VZ0A 4LZOA 1LSJA 4FT4A 1MV8A 3I4LA 4OAOA 2CNWA 2W6MA 2V3VA 1HL7A 1T9HA 2X7XA 1S4MA 2QLBA 1XYGA 2GN4A 2QXTA 1ZIXA 3GXOA 1QANA 1SAYA 3FUVA 2VBFA 4MWEA 5ALHA 4ZT6A 5SV2A 3ZWXA 1JG1A 4C6HA 3OOEA 1ULAA 3H6GA 3I01A 4H3KB 4M1TA 3VNBA 1ISHA 5CU7A 3WLLA 5K6AA 1BE8A 1RCUA 5IMBA 3TSWA 1P6UA 4NFHA 3LUHA 3V5NA 1JBKA 4Y2GA 5KX5B 5LDGA 1M0WA 1E0AA 1UMCB 3VH2A 4TYYA 3MQ4A 4E4RA 3A6PC 3DDWA 4WY2A 1QQBA 1QO0A 3GIWA 2FPIA 4JLSA 2FPGA 3LDHA 3COZA 2AYYA 1T4CA 3N2NA 1T4MA 1LFAA 2GB4A 1JLSA 2L69A 4HYYA 4BE9A 1BXGA 4F5EA 1GLNA 4NMHA 1N3IA 1M67A 4R8VA 4F4UA 3IEMA 1LV7A 2GRAA 2GFHA 3O95A 4JXJA 4AO8A 1Z39A 1PR9A 1XPOA 2CHGA 3IAUA 2EG5A 1CZHA 2X15A 3CF6R 4OHFA 3S2FA 4CIXA 5BWCA 1QTQA 4M0FA 2WIKA 4ZGWA 6CHYA 1NYRA 3G7SA 2HA2A 1EH5A 3ZIAD 1UBEA 1ZK1A 1GZSA 1K9VF 1G291 1N2SA 3DJFA 4R9SA 3ICQB 4G0VA 1NVFA 1T1GA 4HEA1 4NV0A 1IQPA 4TWAA 3WGZA 4JUIA 1OBCA 2IXTA 2VBGA 2XT9A 3TE7A 4B6JA 1N5DA 3GGDA 3WJ1A 2I6QA 4IIFA 4OA8A 2EJUA 4ZRMA 5EHIA 1N4AA 3ZZMA 3RAEC 5DYYA 3JQFA 3GUVA 2O20A 1KVTA 1ADJA 1SOWA 1VJ5A 1YQDA 3IC5A 1S2DA 1A71A 1ECLA 3NTUA 1X15A 3LG2A 1PR3A 5LQMA 3GCXA 3PCTA 3PZRA 1KDYA 1UUFA 4X8OA 5A5VA 3ASYA 2WE7A 3DAGA 4WK4B 5C8YA 1QH1A 4EI9A 3D4NA 2SNIE 3ZNNA 2PVCA 3E7DA 4ZCMA 1JEOA 5IEBA 4L5IA 4U39A 5LBTA 1RQNA 2DPXA 2GNPA 3HXPA 3A36A 1AUQA 2FP3A 1I4EB 1MG5A 4JH0A 4QUGA 3VMMA 4HLCA 5AOAA 3GRYA 4PZPA 4OXIA 2GN9A 1V16A 4YDRA 2O52A 3HO6A 1NPYA 2YV3A 4AK9A 5BN4A 4WESA 3QE0A 3HDVA 4Q4HB 1CRZA 4WZBE 2JD1A 3LGXA 3DEHA 3BORA 4V3CA 2AGVA 3K9CA 2Q5LA 3SHTA 2RHGB 4B79A 4LF6B 1NMQA 3O8NA 2GETA 3LTEA 2V0GA 3IOEA 1EU1A 5JQGA 1O5OA 1VKNA 1XKLA 2YOHA 3AJAA 2IHKA 2P8SA 4JBXA 1DSSG 4OB7A 4YLYA 1SD1A 3OT4A 4U0JA 4R2LA 3N28A 3VNRA 1MH9A 1PWHA 3QMMA 2HT6A 3IESA 3L4SO 2XW6A 2PKQO 2PSSA 1JJ7A 1QPGA 4WINA 3RDPA 2YWFA 3LSTA 2P4EA 5HQ3A 4X64B 3FH0A 1U7UA 3BHNA 3OQBA 4AN1A 2XJ9A 1ECJA 3DFKA 4JUAA 4BKQA 3MIZA 2ACWA 1CRPA 3IVAA 3UATA 2X4LA 4G67A 4W9NC 2P3SA 3GLIB 3G0OA 1RZ3A 1P73A 1Z0KA 3AY7A 4P3YA 1JKFA 3MAJA 5K03A 2FQYA 2GEUA 1VE5A 2YY6A 2Y92A 2OCGA 4IJQA 3GJ4A 1V1MB 2VYFA 4S24A 2ZJ1A 1DBPA 5KKCA 3OIWA 3ZTYA 3PS9A 3JAKA 4M86A 2YX1A 1KMMA 3W2GA 3E3MA 3GH1A 3E18A 1JFFA 2GYYA 2BH9A 1WCV1 4DCVA 3N1UA 3IIJA 1CQXA 2WUFA 4JT9A 1DCFA 2R6FA 2V7WA 3LPDA 3TQHA 2PAFA 3GDWA 4O6VA 1X7YA 5JXWA 3O90A 2WY2D 5GJBA 4HUTA 3H2GA 3GD5A 2D59A 3SFZA 3V8EA 1ISIA 1ZL0A 2I4TA 3OCWA 2V7TA 1P39A 1S8OA 2HZ7A 2PH5A 3MLBA 1Y1PA 3NYWA 4Q05A 3UEOA 3VDRA 1E0JA 5E7QA 2ZS7A 1AXEA 1CUEA 1FU8A 5YASA 2VHXA 4PZDA 4BWFB 2K7ZA 1V4NA 2SBTA 4D4GA 2BMDA 4MV9A 4RVHA 3ID6C 3ZKWA 4CDRA 5ELXA 4UBOA 4EZEA 3EEBA 4K6GA 1VHJA 1J2EA 4TTIA 5CR9A 1Y6ZA 4J0KA 3PGLA 1E98A 1ZGJA 4YO7A 5CFMA 4EHBA 4KAJA 3ZHTA 4BVJA 1VIVA 2GLTA 3D7MA 3IULA 4PYOA 2QGFA 1FPQA 1ADCA 1N0WA 2BOVA 1ODJA 5DI3B 5BW6B 4MQ5A 3BXHA 3A05A 2AG8A 1PJRA 3TSZA 4ZIRA 1KAGA 2IHZA 4QM7A 4BO8A 4M0CA 3P5BA 2WTUA 1RABA 3BB1A 2G76A 5DHAA 2P8JA 3I37X 3GOQA 1LX6A 1RRMA 2YFKA 2ZIZA 4IDGA 1M8FA 1W6RA 3DBIA 4KZPA 4ROTA 2D0DA 3WGOA 2XYHA 2GM4A 4Y6PA 4IKOA 2IE8A 2GPTA 5C5DA 1DFGA 3N2EA 3ZE8A 5CM9C 2I7VA 1PL0A 2C7RA 1MO4A 2R7KA 4M0KA 2UVPA 4OU4A 1UBOS 2CJFA 2OUKA 3PPYA 2VJDA 4UTXA 2Z43A 4M4SA 1HEIA 2K87A 2PX8A 4ACBA 2ZI3A 1PDWA 2EKDA 2J0UB 2YCLA 3R9KA 2ZYVX 3ESQA 2RHJA 3RYIA 3GZJA 1QVZA 4GECA 3T7CA 4BFUA 4GQAA 2O2HA 4PIMA 4KE9A 4PAOA 3QOFA 3AHCA 3L9WA 4H2DA 2IFTA 4A8PA 1XT6A 3MELA 2NU9B 1PX0A 2XH8A 1MNAA 4ZI7F 1OH6A 3A14A 4OU5A 2HK9A 1NNEA 2J1LA 3I9LA 2VUHB 4QXMA 2RHDA 4EVQA 1YMQA 2RGEA 3FYTA 3AF6A 2B25A 3IUJA 3R3VA 2Q1YA 1YZFA 3O8BA 4K9PA 5C1IA 2ZYSA 1PIWA 4ND8A 4KLRA 4EG3A 2NTYC 4Q1BA 3TLCA 3U1VA 3JALB 2C4MA 4IIYA 4RQBA 3ETDA 3M3DA 2QD5A 4DAOA 2PR2A 2DR3A 2QJRA 3FLAA 4B8YA 5BR4A 3RSSA 4XWAA 1CJUC 1W85B 1X1BA 3EDQA 1P5HA 3FUUA 3WK4A 2FLVA 1NF3A 3ICWA 4WNAA 1E2KA 4I5FA 4MA0A 4MEBA 3DNPA 1F06A 3JR3A 3M6FA 1L5HA 4P3KA 1ZH6A 3EXHB 2FI1A 2PUBA 3PDUA 3W04A 2BW0A 4ZMRA 3LQ4A 3ZQ6A 1NBWB 1R9NA 2P75A 4JLVA 4RD3A 5KNCH 1RTKA 2GK7A 4M0EA 3ZY3A 1V8OA 2C5HA 3IP7A 4FZJA 4MGEA 5CVCA 5IYZB 2HHHB 4C20A 2PUEA 2ZBDA 3DEZA 4KIUA 1UJCA 2A9VA 4EKNB 1NG9A 3WSTA 1HYHA 5A7HA 4MVJM 4PAWA 3DP7A 1GQYA 1TA9A 2WJGA 1K4MA 2IWHA 2OV2A 4EYEA 4I50F 1XQVA 3O4JA 1AK1A 1DBSA 2W6NA 5LXTB 1Y1TA 1IN7A 4IIVA 1V2HE 4UTPA 4MWZA 1AO3A 2FOLA 3W4KA 2PO5A 3GFFA 4JC5A 3PYMA 4RO0A 4GOMD 4KVFA 1N7GA 2FFBA 2Q5IA 3D8HA 4V39A 4Y6LA 3I2JA 3ORFA 4ZV9A 5BVGB 4INZA 1ZR2A 3IP1A 3L7DA 3EOBI 4F38A 2EJBA 3KSUA 5TQ0B 3QI7A 3TVDA 1KRWA 3L6UA 1YU6A 1UXIA 3O0DA 1E3DA 4I1IA 3A37A 3ML1A 4L5CA 1OI3A 1Z4LA 4BTVA 1N9GB 4N8SA 1AH2A 2OP0A 5G3YA 2VT3A 1O54A 2VHQA 5EKTA 1PSZA 2XXJA 1J23A 3H1TA 4FHCA 2OD2A 5I47A 3HGTA 3IVGA 1CY0A 5KTRA 5KTKA 4ZOBA 1XZMA 3PLAE 3S1SA 5C4MA 3BDVA 3JZMA 2EG9A 2ZWMA 2ZYGA 2YKGA 2B61A 4FHDA 3UV6A 4CT5A 2ZJAA 3OLCX 2BE7A 2C5GA 2X1HA 3SXUA 4DREA 4ILEA 1TO1E 1U8CB 2EBWA 3K53A 3WGGA 3U61B 2WLTA 2M6SA 2XOKD 3AL2A 2JI8A 3R3JA 1ENZA 2DVMA 3A1CA 4PFJA 4XGQA 4GRDA 1FP6A 3RQSA 4EG8A 4OQZA 4MINA 1E2GA 4M1MA 2ZUSA 5LB2A 3RC2A 5DEIA 5HFAA 1BE1A 5THXA 2GUGA 4A0RA 3VC2A 3WGUA 1DIGA 1QTRA 3KJXA 1Q1AA 2ZWAA 5EHGA 4D8YA 3CR3C 4AP9A 4EX6A 4RVOA 5M04A 1W34A 2PVPA 2YJNA 3U60B 1KRHA 2BGWA 1W0KA 1L5NA 4ER3A 2X76A 2JAQA 4F60A 3NIWA 2L18A 3BXZA 4IQ8A 4OXYA 4ESVA 2C4KA 3OY7A 1V3UA 4MKHA 5I7HA 4DWVA 2Y8EA 3JQPA 4PY2A 4BP8A 3BWXA 1E2NA 1TM4E 1HFWA 4XH9B 3QVLA 4WCVA 2AOUA 3EG5A 1BRMA 3I42A 3UWSA 3TJRA 4GWLA 4NICA 3Q3CA 3ZY6A 3CIFA 4CU5A 1VHQA 3N75A 1ZUIA 2OV8A 4NFYA 3E1KA 5CXUA 2FG6C 2QT9A 2FSHA 3A1NA 4NBRA 1M1YA 2GBFA 5TMEA 4ZYVA 1USUA 1L4BA 2YR0A 2YZ2A 4RZUA 2RE8A 1NXWA 2FUEA 2IYTA 3OZCA 3G79A 4HAWA 5B5SA 4YCDA 4KR0A 1VECA 1M6WA 1PJ8A 2H7VA 3ET5A 2Q7XA 3SN6A 4F6RB 2O05A 2EOAA 3DZDA 3IUBA 4E3WA 1RHMA 1Z07A 4JDPA 1J07A 2V6BA 5KCZA 1MQ8B 4AF8A 5FXMA 4BFCA 2ZJBA 3FHJA 4L5YA 1NFFA 1BU8A 1RYDA 3MF4A 2A78A 3P71T 3ZGXA 2XVYA 1PT6A 3ENQA 4I81A 4PO9A 4F93B 3HACA 1CB7A 1KSHA 1N2EA 2OM2A 1DAOA 4K8RB 2PA0A 4GI5A 1W4ZA 1MOPA 4PAGA 3CZ5A 1N1EA 3VPGA 1RKQA 4V3BA 1E9RA 1UZNA 4R2HA 1BROA 3VTKA 1U65A 4EMSA 4N39A 5JMOA 4DV2B 4MICA 3O74A 2CKDA 1ZNQO 1SQGA 4ANFA 2BN4A 4JUFA 2WFMA 5G41A 1XHEA 1RZRD 5CT5A 2QRNA 4DT1B 3WLQA 3HNOA 2IYRA 1Q3HA 1YQWA 1Z25A 2M32A 3A4NA 3EXEA 1PGQA 3KT0A 3VGPA 4XVUA 3PX2A 3RFFA 3L6OO 4D45A 5IKPA 4P1ZA 4EFKA 3ZU4A 1VBNA 2X13A 1BA3A 1J0XO 1JQLB 4HDKB 4NZZA 3EPLA 1HRKA 4TYQA 5ISMA 1KDVA 3VZPA 1NBOA 1U04A 4Q9NA 3FM9A 4YRGA 1G2QA 3OTGA 4F9EA 4KSBA 2R85A 1U3FA 2WZCA 2A9PA 4E21A 3KQWA 1ONSA 2DC1A 1MB0A 3FDXA 3NJRA 3LIPA 4K03A 4LJSA 4EHKA 1WEKA 2JGNA 3KTAA 2JVIA 3BIFA 3EVGA 5HMMA 1NW9B 5TT0A 2VPIA 2IUFA 3NTVA 2MSCB 3W6OA 1HGXA 1PNQA 1SC1A 3PUVA 3QF4A 4J4TA 3GRRA 4AT1A 3SE7A 4GI3A 1YHYA 1OWNA 2UUBB 4MYHA 5KREA 3KQMA 1AU9A 1KVRA 1ONPA 2FFRA 2H0QA 2RAPA 4H17A 4PLCA 5CPBA 3WQBA 1Q50A 4L3WA 3GUHA 2X77A 1S0UA 5CAEB 4ZZ2A 2QZPA 1P0MA 3IV6A 3C48A 2ODNA 4Y1FA 3PNSA 5JFGA 5A4IS 1E1RA 3C5CA 2YV5A 3NV9A 2REXB 4LDRA 1UOEA 1UZLA 1ODTC 1LDMA 2QRVB 4Q1EA 1AKVA 3LPNA 2V7VA 2F43B 4TKVA 5GIPE 1LZKA 1SIUA 4PO1A 3VOSA 3VVCA 2VNAA 1PHRA 1VOTA 1C7IA 2A5YB 3RV3A 1KFEB 1CUCA 3FFWA 3KV1A 3UT5B 4BTEA 3VNSA 1NONA 1WRBA 2GD0A 2NADA 3HR8A 4HAXA 3N3AC 1VJTA 1XQ9A 2NVWA 4XCQA 4ESEA 1VI5A 2IGTA 5ALYA 2Q3MA 3L0IB 4TKUA 3VYVA 3NDBB 5E4TA 1X42A 3IR5A 4LY0A 4DSZA 2BGMA 5J5AA 1W5AA 1P19A 3OKFA 1GZHB 2XZLA 4Q3BA 2P35A 5FWYB 4ZQBA 5IJWA 1MXHA 2LDXA 4RMGA 1EK0A 2JBHA 3GRCA 1L6IA 3S2UA 1RZVA 3CNOA 1X3SA 3KVOA 1O0CA 1MJGM 1U80A 4MUBA 1RYZA 5JLJA 4EYKA 1UK8A 2D4AA 3LX8A 4AO7A 3NBZC 5HJEA 1KOJA 1IQUA 2W8ZA 2PIAA 4N4AA 1BMFD 5DTEA 5CIWA 1HO3A 4JKYA 2AQHA 1Z18A 1E32A 3GFBA 1NIPA 5LYJA 2NU6A 2XQJA 3FPAA 3TGWA 3TS1A 3WSVA 2VA9A 3NPAA 2EX4A 3HYRA 3OLXA 4PN7A 5BN5B 1NVEA 4JB8A 5CCEA 2E5LB 1CZUA 1H8ED 1E9DA 3GQVA 5LPNA 1E1MA 1WHTA 2DR0A 2VNSA 3AEQB 1CF9A 3OZEA 4Z9BA 5DM70 3PI7A 1T5DX 4DNFA 4X91A 5DB4A 1YRAA 5KHAA 1J8QA 3QSYA 2Y66A 2O19A 3MWJA 1WHSA 3HUUA 4KQCA 4NG5A 3BZUA 4I66A 3BH7A 3ED1A 5BSMA 3HUEA 1PTJA 3TPZA 1POXA 2OV4A 1X7WB 4HQNA 3UAOA 3ZXXA 4KLAA 3WMEA 2PJRA 3O1JC 1W48A 3CKKA 1KI8A 4BMXA 1L3BA 4ZO8A 1MQSA 2Q8NA 4ZEVA 2C9MA 1V8DA 3OC0A 4NENA 3OI7A 5AO9A 2RH8A 1AUVA 3L6DA 3V33A 1V7QA 3RLFA 4QOHA 5CYOA 5DM60 4E5PA 4HKTA 3WLMA 2CLOB 4C29A 1OXKB 4HEA6 3UOWA 4C5CA 1UMBA 2WTBA 2Y0PA 3AG5A 4X94A 4C5AA 3PGKA 5G4LA 5JOQA 3SR4A 4ISBA 2XA9A 1Q3KA 2E2WA 2YDYA 4JLDA 4Z8XA 5CEEA 4UEKA 3FWHA 3IUQA 4RTRA 2W4IA 3FMPB 2D2IA 1RXCA 1DS6A 5FF9A 4AS3A 5SYNA 4CE6A 2ZUEA 5AQ1A 1NVGA 2PZLA 1Y7IA 4TXNA 2TSYB 4D97A 4ZMBA 1TJYA 3ZZ0A 8ABPA 4ZOAA 5K4AA 2WTNA 3R76A 3ZE0B 3OTIA 4AQYB 3AU8A 3L18A 4O4IF 4ZVLA 4OK6A 4G1UC 4LXQA 1FX0B 1QYIA 1YU9A 2XRYA 2VDNB 1Z8DA 1TZJA 1QJ4A 2Q1WA 3UB3A 4PCAA 3RHTA 3TXYA 3JYOA 4PX2A 3AWIA 1N2HA 1ULHA 2D0OB 2VTVA 3AUXA 2VHEA 1TEZA 4P3NA 4AY2A 2B0JA 1W5FA 3IUMA 3TNFA 1W47A 5C4IA 3LC0A 1UC8A 2NZJA 4FYMA 4H7IA 4DR3B 2V6JA 4OL0A 3OICA 1V3VA 4OFZA 4O4LF 3UOAB 1F2TB 1QHXA 2QG9A 1O57A 3A1DA 3L7OA 1S2IA 3ORQA 3IAEA 2JRLA 3HBNA 5KOHB 1PFWA 2CSUA 3FUTA 3T4XA 5HGJA 3Q8KA 3SP1A 4DXHA 1OXXK 2G77B 1T3HA 2QWXA 3HADA 3C41J 4JFAA 3OPNA 4A0FA 1N0UA 3VR4D 4UKDA 4UHCA 3EH2A 4DY4A 1P9NA 5BSRA 1U0JA 1PWEA 4X1OA 2H8GA 1N75A 2TMKA 1CUDA 3UHFA 4US1R 5I4BA 1HORA 3MWEA 3K0AA 5FUMA 4KYUA 1R6AA 3NS7A 4G09A 1YA6A 2QN7A 3UQZA 1HA3A 4R3NA 4MGHA 3ROMA 1ONOA 2ODAA 2PUHA 4RDCA 3ASZA 1RHUA 3L7AA 1ETHA 4DLUA 4ILKA 4MW6A 3RUPA 2VNHA 4PX5A 4QU5A 4MIEA 2GEJA 3MXOA 5FNVF 4YMVA 5L53A 1IUPA 3G5MA 1GUZA 3DXYA 2YJ6A 4ND1A 5ILOA 1QKIA 3ELDA 1NJSA 2WC1A 5BRAA 2CMHA 4B3DA 2G4CA 3MJSA 1YB2A 3BFXA 1U9JA 1IDOA 1P2VA 2JZNA 3QPWA 3WLHA 4OQPA 1KNXA 5JCOC 1CYEA 4LRXA 4OH7A 221PA 3FHCB 1G5PA 1UXKA 3IPLA 4YAJA 4F8EA 1AHHA 1FB5A 4DSTA 2GERA 1SKAA 1ADFA 5GJVC 4BO9A 2J5XA 3U49A 1B15A 2I7TA 5JH7B 4KGZA 4KUEA 1JKMA 3GFVA 1E7SA 1CEXA 2C4UA 4N1AA 5L3SA 4QQNA 5J3JA 2RK4A 3RRZA 1IJEA 1EBUA 1SUBA 3LY7A 4YAFA 3VU0A 1CERA 1RBZA 5SZKB 3RYFA 3BE8A 3BWMA 3JQBC 1P7VA 2GCOA 1F2UB 2FXVA 4LF5B 1QRTA 2UZ1B 3IO5A 4Z0NA 1DAEA 1B16A 3L92A 1I1OA 4NEGA 4YRFA 1PG5A 1XYVA 4Q03A 5F98A 4BMSA 2HK8A 1DUVG 1RWBA 3PR2B 1WV1A 3T5PA 5KWVA 2G07A 2NZXA 2P4SA 4FEGA 4IH1A 2WIDA 2R6ZA 4J0QA 1CUFA 4W82A 2NVUB 1TUBA 1R7RA 4B82A 2ZVQX 3WQQA 5J2UF 1MX1A 1XZAA 3NQ41 1ML4A 1Q7RA 3QBDA 3W06A 4BS9A 2JIDA 3GVPA 4GVXA 3BL8A 2DWUA 2OWDA 3GAZA 3KKZA 5LZ8A 4HFNA 2Z6AA 3Q5EA 4P0PB 1QK5A 4IVPA 1FLDA 1GADO 3W7BA 3MUFA 4C0XA 2V9ZA 2WI8A 2XNDD 3R8XA 2VAPA 3H5AA 3I45A 1FLVA 3V2UA 3VSAA 1Z3IX 6AT1A 1HI9A 3I0MA 2IOYA 2O23A 3D43A 3E81A 4OJQA 2GN8A 4N0DA 1N3BA 3L4BA 3M49A 5JWHA 3DYBA 5BMOA 4IIUA 3L3BA 1R64A 5KNCA 2BBOA 3QEMB 3JWIA 3JASB 4P7FA 1BN6A 3R3ZA 3IURA 2HC9A 2BM9A 1JLHA 2KI5A 3L6EA 3SLKA 1FXWF 2C2XA 5G4KA 3TQRA 3HTXA 5KBYA 3LLMA 1XPUA 4OHOA 2XCRB 4GOND 1N3LA 1PGJA 2LCIA 4B09A 1W36C 2GPBA 2FPIB 2O7SA 1DWUA 2FPGB 3NP7A 4EG1A 1T4CB 4ALJA 2WAAA 1E2HA 1GSAA 4IM7A 4HPWA 4MLDA 1GPKA 1BXGB 4EJSC 4OJKA 2WYIA 3U5ZB 4MWDA 5AWFC 2ZQYA 4A10A 1WP4A 4TSFD 2OZVA 3GF4A 2XTAA 5JDCA 5KWIA 2DBZA 1II9A 1L4MA 2O14A 5C1DA 3OU2A 3AHIA 1BYUA 3PE3A 4KQ6A 4MV6A 5FHRA 1HT1E 3HJTA 2WZDA 5MN4A 1DXQA 4V1CI 1CUAA 3VUEA 3ZQKA 4Z6KA 3JQ8A 3L8ZA 2XTZA 1S01A 1AKNA 3HZOA 4K2HA 2FMUA 2Z4TA 5KX5F 2FWJA 2VKTA 4IV0A 3WYBA 3VO2A 3Q11A 1YZQA 1LK5A 3IA2A 4PO8A 3Q5DA 1K75A 1OAOC 4XVCA 2CF5A 1UJ4A 2YIMA 3JYPA 1PGOA 4C7KA 1T0JB 3M34A 5DX1A 4EGQA 2REOA 2AFIE 2P9JA 3GMDA 2VDLB 5C8YB 3LCVB 3LCJA 2EDAA 3TJMA 4JI2B 1VTKA 4U7JA 5F4ZA 3CPEA 3T7SA 2EFEB 4KXFB 2IEAA 2FR8A 4H7PA 5LC1A 3IGFA 1OJ7A 4OEHA 2WD9A 3QUCA 1K5PA 1JIJA 2LXNA 1BVUA 4MUKA 4FGZA 4UNIA 3KJEA 3HB1A 3OX4A 4U02A 2W6CX 3C4JA 4HDNA 3UNXA 2PXXA 4KDRA 4Q7MB 3DKPA 1XZIA 4CDGA 3D3EA 1SQFA 1V16B 1RJFA 2V1XA 1FUIA 1SVIA 2E87A 4L1KA 3TQOA 4C2TA 3HJFA 1YZNA 3AERA 5IAGA 3IQDB 3N0WA 5CK4A 2WD7A 4WESB 5DBOA 2ANCA 4JT8A 1TIKA 3QE9Y 4E07A 5K09A 3IE1A 1W4LA 5H4HA 5JQGB 2DPHA 2NZ2A 1UKZA 1MUUA 1WXHA 1HURA 4QEKA 3C8HA 4Y30A 3DMYA 3UAXA 3GYBA 4B1FA 1MAUA 3KZCA 5JZBA 3CWZA 3OA2A 1GA1A 4ZGBA 5DM4A 3I72A 4GZ3A 1J0BA 3CLSD 4RIHA 2ZTUA 3S29A 4UUNA 1JR2A 2I65A 3WIUA 1LH0A 1N2XA 1PZEA 3AR9A 3E7WA 1KMQA 1PEDA 5HQ3B 1OZHA 2G8NA 2R6CA 3EC2A 4N7RA 5ITWA 2YNMC 4ND3A 3S8EA 4DRYA 3BD9A 1YE8A 2H9IA 3B3FA 2O1XA 3QY9A 4PG8A 1RXEA 1XRPA 2W70A 1TZMA 4AKSA 4BGIA 2OO3A 2DRIA 3P0JA 4B4WA 3RJ5A 2DE0X 3HA2A 3FVWA 1VE1A 3A3OA 3WJAA 4YR9A 1J00A 1HDEA 3U4DA 4LZJA 3GGOA 1RM4A 4O4JA 1YNSA 1FQKA 2J41A 2QYTA 4BFXA 4DC9A 4YXFA 1EXMA 1NW4A 2RJOA 4FONA 2R25B 1BE0A 2OR3A 1Y9ZA 2AFHE 1OFVA 2FPMA 3JAKB 5CVJA 4K3VA 3TNLA 4IMPA 1OGIA 2NM0A 3ESYA 3H2HA 1JFFB 2I4NA 3QG5A 1ZJWA 2VK2A 1TFUA 4R8KA 4B35A 1OC2A 2ZIGA 1N1MA 2X2OA 4HSEA 4TXJA 4PLWA 5CTJA 2CVFA 2LTAA 4FGKA 1DG9A 2HTEA 1H4TA 2BL4A 4G01B 1X7YB 1SVSA 1TFRA 1NBIA 1IZYA 3O3OB 3UJ3X 3HWRA 2EL9A 4HYQA 3K15A 1J2YA 5LBUA 3AF2A 3TUZC 4GX2A 4J0IA 2R5FA 4HCJA 3WLJA 1G8JA 2BZSA 2E6KA 3NNSA 2PYIA 4J3JA 4M9UA 4P31A 4PPFA 4Z0TA 1IRIA 3WGNA 1G3RA 1R3UA 2GSWA 3G2KA 5HIAA 1TTHA 3ZKWB 3BXGA 1ZGGA 4QLOA 3ZD8A 5C8VA 3F5MA 2KB0A 3GGPA 1NNUA 3GRZA 4OUDB 2VSOA 1OWPA 3C5WP 3D59A 1G98A 3NIGB 1NBMD 5EMHA 3OWHA 2JBWA 2XGGA 2Y0CA 2VYVD 4DJ5X 4PNZA 4XWWA 4P81A 3S70A 2R1ZA 4TS1A 2PH1A 2VT7A 4J1SA 2LKDA 1ZG3A 3H9JA 3D2CA 4ZIRB 1NG1A 2YWCA 3KOXA 2N47A 3ZLTA 4PRKA 3OZWA 4X00A 2W6OA 4YRBA 4NE2A 1L7AA 4YCBA 1ZONA 3K2BA 2ZRMA 1PUIA 4W8OA 1PWZA 2ZJ5A 3NHMA 3B51X 4BNUA 4FR2A 1CDEA 1LC3A 3TNJA 2R8BA 4TMVA 1G66A 5COQA 3C14C 4YHBA 2CUKA 3RWOA 3DOCA 3W7AA 3BRWD 4UTRA 3I61A 1FFCA 2UYCA 1UK9A 3M83A 4UASA 3TPFA 2UVPB 3H42B 5B12A 2NYVA 3L1UA 1KJNA 3I8SA 4DMRA 5AVVA 4CCSA 1PEAA 5HDBB 5A5GA 2HREA 1IHOA 4FJ1A 1BRTA 1J9ZA 2AZMA 5DRTA 2YHSA 3I9NA 4GHWA 2O48X 1H65A 3CKLA 3GRPA 4KAFA 1Z8NA 1SUAA 1JWAB 1DQRA 2FWBA 2GHTA 2IOFA 3KKMA 2RIPA 4M8IA 5E6UA 1QE3A 3H4MA 5EUCA 3ZWPA 3F6PA 2MSKA 1FRQA 1MENA 3TFQA 5FUWA 3SR3A 5H9WA 1VPEA 1QFYA 1M8KA 2ZUUA 3MGAA 4TMWA 5HJ5A 5L7TA 1WVIA 1A9YA 2B4KA 4PRZA 1A4IA 4UM9D 3GEPA 3KB8A 1NQ5A 4FFRA 3V42A 5DYNA 3UJDA 4UMDA 4BUJA 4C3ZA 3NB0A 1WB5A 2J9ZB 4H7JA 4U2DA 1R50A 1SPXA 1KI6A 1P1RA 4ND8B 3RS0A 3KUDA 5K3OA 4C2UA 3WA7A 2DFVA 1UFVA 1U7ZA 2R2AA 1E5TA 4GSLA 1OF1A 3NBYC 4PQEA 3HCFA 3QVGA 4J07A 2ZDGA 4RSMA 4B4OA 4FCWA 4G84A 3TG2A 3LRTA 3P4YA 3VDQA 1QOQB 3E8SA 4BATA 2H2GA 1FSPA 1QOPB 2I2AA 3RVPA 3GV0A 4OAPA 3GGJA 4BNVA 3RE1A 1AO0A 1L5HB 4DYVA 2BCEA 4O1HA 1RAGA 1PGNA 2CBZA 2GKOA 5DN6A 1MKYA 3IIMA 5JAMA 3EIOA 4N0QA 2W2TA 3FZEA 4F3KA 5I7VA 4I5DA 4Q15A 3D6NB 3VR3D 4YRPA 5HZHA 1C0KA 4IQGA 1PKEA 4TMZA 2OHHA 3D7NA 3SVLA 2VHZA 1N6LA 4QRIA 3IV7A 2LP4Y 1GGKA 3W5VA 5KYYA 4I9GA 5CFRA 2CT8A 4BVGA 4KU4A 1E6KA 3O26A 1RM5A 2NTVA 2ZYDA 1O97D 1EAMA 3LLSA 1O94C 1B00A 2QMQA 3QWAA 4KLNA 2G70A 3FDJA 4HGOA 3K6KA 5EIBD 5CDHA 3B1WA 1RLJA 1BJTA 4DG5A 1WX1A 1YNOA 4FUQA 2J4FA 2IY9A 1QIEA 2JC3A 3ODPA 4RK4A 1XLTA 3RHFA 4B4DA 4EVSA 2FQWA 2A3RA 3PITA 5LM3A 2X40A 3PCXA 2FSPA 3DBRA 5KOYA 1Q19A 4WFIA 1ORTA 2D13A 4Q9DA 1RC1A 2Z2KA 1YDEA 1VJGA 4WFQA 1M73E 2HF7A 4DS3A 3BE6A 5E0KB 2C84A 4XB2A 1RJEA 1VXRA 3KCNA 1CS4C 3O8DA 4JP2A 5C3MA 1QH0A 1RAIA 1AE1A 4E0BA 1EVIA 2VWGA 3X44A 5E7JA 2UUAB 1LS1A 3I64A 4Y0NA 4OFWA 2EGHA 4N76A 3OC6A 5LXTF 1FK8A 4NYIR 1XF9A 1GGEA 2ZULA 2O0KA 2VL7A 4D0LB 1HLPA 3TTTA 4H1UA 3RUAA 3M5CA 1QCDA 1FS6A 4ZKEA 3SXUB 3WP0A 4EY8A 1FDTA 3MD0A 1P6QA 2ZI6A 5KPDA 1U7DA 2ONKA 4NU6A 1WSWA 3IP9A 1VJRA 5I9TA 1IOLA 4HAOA 1QRRA 4XR9A 1GQ2A 2H1VA 2JFHA 2HJRA 1VPDA 1W5SA 3ECAA 1U8YA 1SELA 1BCSA 1GFWA 1Z4OA 3CRVA 3Q1LA 4FDVA 4QHTA 2ID7A 2Z4SA 3F5DA 1WW2A 3IAM1 3MTDA 4LTNA 4W8HA 2X3FA 1F2VA 3GA5A 3R7FA 4QODA 4CV0A 2XF2A 3DW3X 1IXRC 3Q3JB 4L74A 4YMGA 1WKBA 1GUFA 4G5YA 2OXCA 3STXA 2I4RA 3BJRA 4YASA 1QHFA 1OBOA 2BV3A 5E3IA 3VDXA 3PG5A 3WIDA 2DU8A 3CX4A 3FGPA 3INTA 3ZDYB 3DMRA 3KPYA 4YQYA 4C6SA 1YKGA 4EFDA 4DV3B 1UM9A 1M6HA 3CMMA 4J43A 5IAKA 2K5UA 1M2EA 1Q95A 2B7CA 3Q8WA 5LA6A 3WTCA 3GJYA 5JEDA 5FUVA 1LDNA 4K81B 3LOUA 3EISA 3DF9A 5EIEA 2ODTX 1Q57A 2AOUB 2Q1SA 4X8MA 1IUNA 1JHRA 5A3JA 1FUUA 1OLXA 3ZWYA 1RWVA 1M2GA 1ULTA 4X24A 1FTYA 4YWJA 5K3CA 5T3UA 2QSZA 4I6GA 4NQRA 1KE1A 1SQ5A 5A7FA 4CMBA 1G8HA 1GYRA 3C3KA 1N78A 3ADKA 4TVBA 1K3FA 1M1YB 2CDAA 4MHSA 5AKIA 4DJJA 1LPNA 5AQEA 2BZ0A 5FPQA 1Y89A 4TT3A 5NLLA 5LQJA 1JR3A 3GRKA 4YREA 2Z8XA 1NJ1A 5AIBA 4FZ3A 3QPBA 2WFLA 1DIRA 1NU8A 3ZW8A 5F7XA 1ZW6A 3N9IA 2GGSA 4QICA 4QUDA 3PNLA 1NRWA 1X74A 1Z7WA 4YYEA 3Q41A 2OZLA 5H70A 4OHUA 2FW9A 4N6OA 4CQJA 1RWNA 2G4VA 7MDHA 1GCUA 4GEGA 3AJ9A 3T0GA 3WWCA 3TRHA 3HL4A 5DWQA 2PKCA 1CR6A 1SHLA 1AB6A 2YS7A 3C6XA 2IQIA 3I6MA 1SULA 3KAPA 3RT7A 4FILA 2GAFA 1XD9A 4CMHA 5BMVF 2PRKA 3B53X 3R5XA 1ZK3A 5DMHA 1GNSA 1RADA 1W8IA 3EIHA 4O3MA 5ER6A 1QIIA 4JP8A 3CN7A 2YV1A 3NYRA 4TYPA 4N47A 1BEZA 3EXEB 2ODBA 5KQGA 4P0TA 3QU4A 3WICA 2FXIA 2CV0A 1EDDA 1XEWX 5ALOA 1GSOA 5DP2A 4BO5A 2J3MA 2WVJA 1R6DA 3OE7A 3SBXA 5A6VA 4Q7EA 4WJZA 3AETB 1YQUA 4HBGA 4U6NA 2NXCA 3ZV6A 4ZHQA 2BEUA 1U2DA 5E8JA 1AGXA 4WA7A 1F12A 3BH0A 3Q0EA 3LS2A 2A94A 1Q84A 4IHQA 4L0QA 2J87A 3KTAB 1L7EA 3KPJA 1IWOA 5CMLA 1THTA 1N9KA 3VAZA 1SCAA 1SZCA 1N57A 7ABPA 1LF0A 3NTLA 3QF4B 1RXIA 2BKXA 4X7MA 3D6MA 1T1IA 2XBUA 1RBYA 2OT3B 3ENNA 2NUTA 4DLNA 4BNIA 2HU2A 2ZAMA 2RGYA 4N54A 1SVOA 5F1YA 1NT2A 2C31A 4DMCA 2BJVA 2HBYA 3I92A 3B82A 1DFIA 4L7QA 3IXMA 3AG6A 4MCHA 5AI4A 2E1PA 2ZRKA 4FD3A 2DFNA 3IEIA 3LVFO 4M46A 4C4TA 2ZSJA 3LI2A 3ER6A 2FR1A 4NARA 1DAGA 1WMDA 1PT8A 3F6RA 3ORYA 1OWOA 3KZKA 4TKVB 2Y1XA 1YJQA 3VU9B 1J33A 3FTNA 5ALDA 2DPMA 1UMDA 3TBKA 4Z7QB 1AV6A 3QEOA 2XGMA 1RI4A 1ZHFA 3RVNA 4ML3A 3CRW1 4GE0A 4DLLA 2XYRA 1AGYA 2AL7A 2FFQA 4B6EA 3X2FA 5IUJC 1GZUA 1RACA 2P2YA 2IOFK 3CH5A 3NGXA 4YV0A 621PA 1QB7A 4TKUB 4C0KA 4D0RA 2PD6A 4TX1A 3U7HB 3CX3A 1K3UB 3TINA 1R27A 3VVMA 2W22A 5FAXA 3Q7IA 1X7DA 4B4KA 1K66A 4CMGA 4FBMA 1FDIA 5JT1A 1S7CA 4UCXA 2NWQA 3FROA 1FS4A 2FW1A 1CUUA 3RO7A 3OVMA 3EJ6A 2DLDA 3CPSA 1QRSA 1CJSA 1JAYA 1E2MA 2FZKA 3H3JA 4IL5A 1KI7A 5FQOA 5GWXA 3W3ZB 1I94B 4Z53A 4GC9A 4O2BF 3IBTA 3KOYA 5DGDA 1G0NA 3B2EA 4PFSA 4TL8A 1EI9A 2VH5R 5LYJB 1KVQA 2AN9A 4UBJA 4L72A 4AS1A 4TTPA 1F3LA 3P96A 3IAXA 1Q7GA 1WHTB 4IOMA 5AT1A 2OYCA 3VPAA 1EP9A 2PPLA 1IXKA 3WI7A 5I7FA 2WIJA 3S7ZA 3VBCA 3I30X 1JDBC 1WHSB 5DTMA 3SDSA 1F0KA 3U13A 1GPLA 4HP8A 1U31A 1ZWKA 2H2WA 5CXSA 3RFCA 2PL1A 3I23A 4KE7A 3BILA 3M1LA 5P21A 4TVOA 5C0OE 2W2OA 3VZCA 6NULA 1GL7A 2JFFA 1NIJA 1Z4NA 2Z98A 2ZSEA 3EA4A 2HIGA 2FKAA 4U2GA 5JFTA 3PUKA 1IU9A 2W2LA 2CFCA 3UPTA 2PTHA 2QX9A 1GRVA 2OFOA 1LLUA 3WWPA 4AZ3B 1U28A 2I6XA 4DLWA 1UMBB 4AMBA 4LBZA 1R0XA 3AV3A 4M0LA 4Q1AA 1EFPA 3I8OA 3UANA 4YI5A 3MS7A 2AD1A 1P9LA 3NBFA 4K6FA 4MKIA 3WRVA 2RHLA 3NTXA 2O2SA 2ZREA 1T25A 2HI0A 1IZ0A 3R5HA 4NBVA 3H5OA 1FX1A 3T7TA 4DTCA 2ATCA 1KA9H 2P67A 5EIXA 3GO4A 4QUEA 3CPJB 3KR0A 5EP3A 2VTDA 1SG9A 1P0QA 1NT4A 1GQRA 3P45A 1RYHA 1Q22A 4PU0A 1YVUA 4MP8A 4D9FA 4YRCA 3NDRA 4ADSG 3NHLA 3PKZA 4P4SA 3KSAC 3MJRA 5EMMA 2XCTB 2I66A 5ECGC 5FBLB 3AJEA 5B1DA 4X85A 1LZLA 4A91A 4IQFA 2VWQA 4J1QA 4JBLA 3ZUPA 5J47A 1P4GA 3FPEA 3ILYA 1K86A 4PTYA 5EESA 4BVFA 4QDJA 1Y1LA 3G0IA 5TY0A 3BZBA 2IUUA 1KEVA 3ADPA 3BDIA 3GDOA 4BRUA 4BZZA 1H66A 1W8DA 2WIBA 1NXVA 1KEWA 2P79A 4LHWA 4UPDA 4IVQA 5REQA 1ULUA 2C58A 4LE1A 4UJ5A 2H17A 4AMUA 4DTIA 3RRXA 3PFKA 4FX2A 5CNIA 3RTDA 3MRVA 3GYGA 4RSGA 1L5KA 3EX7C 3BMXA 1K7YA 2FRDA 4QOJA 5E1DA 4C0QC 4BNZA 4MYRA 2Z5FA 4EKYA 1JIVA 1YUNA 3PD0A 3DNFA 1R4ZA 4GLFA 4PTZA 1AV7A 1ID8A 4RHXA 1NMZA 1CD5A 4M1SA 3ZDXB 2WABA 4DQXA 3MWEB 1FDUA 3K0AB 3TOZA 2O0LA 2QD2A 4CMCA 2WTMA 3K09A 3PSHA 4CIVA 4L7VA 3L05A 1OV4A 4HGQA 1ZRSA 4RVCA 5JTUA 3R9WA 3W78A 4IV8A 2YWBA 2XITA 2QZZA 3VX3A 1RQXA 1XCBA 2ZIXA 3CH7A 4LMBA 4TPKA 2KYRA 3ZE9A 4XQ0A 5LYYA 3QYJA 5L8VA 3I5XA 2G82A 1WZIA 3CVJA 1LV8A 4DANA 2C9DA 2IC5A 4XX1A 1E94E 3WGJA 1E2FA 1U7HA 2N46A 3SEZA 4EMTA 4URUR 4ZO4A 3ZZ1A 5KJEA 5A0VA 3OQOA 4OX9B 2I8LA 4WMLA 4Q9JA 1JU9A 3FAKA 3LT1A 1JP7A 2P6RA 4XB6B 4W9RA 2Z2YA 3WKEA 2JCXA 4XSHA 2ATEA 4RZHA 4H4DA 3SMQA 2WUDA 4UBLA 5DW0A 3VPSA 1RU3A 1G60A 3IIIA 2BFDA 1KIAA 2MSEB 4EYSA 5L3SB 1TIPA 1Y5MA 1W4BA 3V8BA 2REQA 5KQPA 5HZMA 3LHDA 1H4SA 3MEQA 1NMEA 3PQ7A 4EB6A 2G0NA 4J0CA 4PS1A 1K5DA 3A3PA 4R8LA 1MR3F 4MW4A 5JEEA 4I0WB 4RTPA 1XPRA 3RYFB 1MDFA 2ZWOA 2ZRFA 2GCOB 3JVIA 4XA8A 3RTBA 1K8XB 4WT7A 4E12A 2C1EA 1V43A 2ECPA 4TYNA 3AFGA 1KO1A 3ADOA 1D1SA 2HNAA 2PUTA 3KX2A 4II7A 4ZDIA 1QGUA 3DWIA 3C3YA 1U8UA 3OJ0A 4P92A 1WNTA 4L5BA 1VPLA 2AMLA 1M74A 3VXKA 4DNPA 4ENQA 2X23A 1DI0A 1FW6A 1TUBB 1BZYA 5M34A 2B4QA 4URWR 2XMDA 2AK2A 4KN8A 2I4MA 1NPDA 3CXRA 3FN4A 3MPUA 2IPMA 2RARA 3OIVA 1GYPA 3SZLA 1QH9A 3VR2D 5BPHA 4DV4B 5BYAA 1XCPA 3PXBA 3CCCA 1KGSA 4G9EA 5I9MA 2CVQA 3OUUA 2C99A 3G7UA 3ANXA 3TXXA 5L3ZA 2Y1FA 4RHCA 1L8AA 3DDHA 4U3JA 1VKOA 2WWFA 4FDAA 1QMGA 3KSZO 3SSAA 1HQDA 2HRDA 4MB6A 1TZBA 3G9XA 4UUBA 4GO1A 4ER0A 1T2VA 3MC1A 2BFFA 2Y0BA 3ACCA 4DCPA 2IYWA 5G0WA 3OOWA 3C3EA 3ZX5A 3HABA 4QUJA 3TBHA 2ZUTA 3GUUA 4FFSA 1SR8A 3N2GA 3AR8A 4PICA 3D3KA 4UULA 1JA0A 1UXGA 1ATZA 1NA5A 1UJBA 5G4KB 3DNMA 2IF2A 4QGFA 1LB1B 4JJ6A 4Z4CA 1PL8A 1YASA 4BKPA 2WQZA 2EJVA 1MX5A 4M9QA 1E5LA 2HCTA 3STYA 3V4SA 3E70C 4DR4B 3B1KA 4C4RA 1MB9A 3N58A 2H7XA 3OJWA 3DVRX 4IFIA 4WH0A 3C6KA 1RSZA 4UBMA 3W9YA 3KQYA 3HKBA 3X1ZA 3GLGE 1LK0A 1Z37A 4CIAA 4MVJG 2DEUA 2QY9A 5ALSA 3DXXA 2OAP1 3WYDA 1D2MA 1BXRA 1SGWA 1ZIPA 4FYHA 1GUYA 4Q9AA 5ALJA 3VH1A 1PJAA 1GP2A 2JGKA 3K8OE 3W05A 2HRBA 4IO1A 1PK8A 5BSGA 2VYQA 4A6XA 3NHYA 1XVVA 5IFLA 1SOAA 2IXAA 2ZB8A 4HFJA 2VSQA 3TZQA 5FTMA 4HZGA 2Q3JA 3U9TA 1KH1A 3CNBA 5G1NA 1YK0A 3R3UA 1QU3A 3VSDA 1E60A 4W6ZA 4HNHA 3MT9A 3QEKA 2B1GA 4WCFB 3VHXA 1SCUB 1VYHA 4P4TA 4AJNA 1LPAB 4D4JA 1DX6A 4M89A 2IH2A 3K9HA 3FDIA 1ZITA 3JSAA 1ZA2A 4LTDA 2ZQZA 2F8SA 3VJRA 4WE3A 1ZU4A 1K8YB 2CXXA 5K0ZA 3G89A 1Z0SA 2B4RO 3V4VB 2DB3A 5EI5A 3REQA 4WQMA 1XR3A 3NBMA 2V97A 4UD6A 3LCMA 5IDVA 5FR2A 2R62A 2ZDQA 2C7QA 1VSBA 5AW3A 2E55A 3H83A 4IRMA 2FB9A 3NVKI 1NOJA 1D5WA 3B78A 4JVSB 4MQMA 3PKIA 3OEED 1ZUWA 1E3EA 1UF9A 4IJUA 2VDVE 1URPA 4TS3A 1IM8A 2HRQA 2FQ1A 2W8BA 3PFWO 1FDOA 4HDNB 2C59A 4I1PA 4HLUC 2VAMA 2PQ2A 2BMFA 1BDMA 3D64A 4CUKA 1KS2A 1JW9B 2FMIA 5JAIA 1JDSA 3AERB 3KPUA 4JZKA 2AC2A 4IG9A 1HTBA 4IIHA 2D3WA 2WD7B 3RKSA 4PHHA 2Q27A 5TS3A 3JVDA 2AFIA 1QR2A 5TARA 3DLBA 1RIFA 2F3SA 3E9ZA 1A77A 1X3LA 1N0HA 4GYWA 1H3EA 5C8YF 5C7IO 4OQQA 3VR0A 3K70B 2A86A 2EZUA 3ROKA 1S8AA 3RVKA 1UBMS 5EE3A 4KKVA 3R0JA 4NR0A 5IP5A 4RV5A 3OPYA 1XLWA 2J30A 4HH3C 4KWTA 1ZN7A 2DHCA 3U44B 4Z99A 2I67A 4KWEA 4C0HA 4IDQA 3JATB 3IKMB 1FMCA 5D1NA 1XC7A 5F64A 3EGEA 2NO5A 1EWQA 4FN4A 4PR0A 4Y0AA 4U7PB 2GKSA 1YZYA 4X90A 5IC4A 5HJ7A 3KQTA 5B1YA 1N8KA 1J49A 4O4JB 3VU1A 1XTZA 2WAXA 2QPOA 3E4CA 2Q6IA 2R1UA 3HA7A 4CM1A 3Q7TA 2G63A 2B82A 1J7KA 1FUYB 3RTCA 2LRHA 2AXEA 2N75A 4JC8A 4EW3A 5KB3A 1FYXA 1J8DA 3G02A 2V0CA 4LJ7A 1D0SA 1LBHA 1FNDA 2RGGA 5CFQA 2ASVA 4YJFA 4R1OA 5AKKA 1PVVA 2FUKA 4WW0A 1GAEO 2GAAA 4X7PA 3H1FA 2V1UA 2GJAA 1E20A 4TSKA 3UW1A 1HT0A 3VV2A 5BXYA 4DOMA 2AVDA 5EQTA 5IFKA 3SOZA 3WLTA 3IMCA 4F8JA 4YHHB 4N49A 2WVHA 4JA2A 3NNDA 2J9RA 3I9FA 5IBPA 6GPBA 1UZAA 2ORVA 2HJVA 4PSAA 3KE9A 3RCBA 3THSA 2GD2A 5DU2A 4BNJA 1CEEA 1C1DA 2GILA 2LV8A 1WXGA 2AFHA 2VN8A 3BFKA 4P34A 1W35A 4GMHA 3Q2KA 3TZEA 1NMYA 2HWYA 4R05A 1Z68A 1DXYA 1V6AA 3M7IA 1UQRA 3PKJA 3WB1A 3GIDA 1NJGA 3F6EX 1VMEA 3R0ZA 3UIEA 3ONWA 2V8BA 4CDNA 2OCPA 1D03A 1R1DA 1W2GA 2D7CA 4PCVA 1CS0A 1HNNA 1H93A 2OG1A 3EIWA 3GI1A 3QNWA 1KZ9A 4X1IA 4LK2A 3HXKA 2A14A 3H2IA 4GYYA 2ILTA 1AKQA 3MQ2A 1C1XB 1JKJA 1Q44A 4C9BA 2XHEA 1UDCA 3K5IA 1PT7A 1ABFA 3AH8A 1E4OA 4JLKA 4PRYA 5DOZA 3WKCA 3OOHA 3ZWCA 3W5CA 2O2CA 2H29A 2JL1A 3TLZA 5HM8A 1YR3A 4FYPA 2YWRA 1I7QB 2F1JA 2C54A 3AF3A 1AD2A 4IYJA 2PSJA 4LYGA 5IM4A 3OX1A 3KT8A 3GEHA 1AKWA 2FJPA 2ENUA 1WQ1R 2XB8A 2BGGA 4QYMA 3OLQA 1ZRMA 4LVNA 4HDRA 4IINA 4M2LA 3L49A 2IUYA 1L1QA 4IDPA 2JGIA 1QPBA 1SY7A 1KHTA 1Q1GA 2IK8A 3C1AA 1Z5WA 3ICPA 4MUJA 4AG3A 5JQWA 5F9HA 1ZM7A 2ORWA 2WNIA 3O21A 4F5ZA 4F4IA 2ARKA 3HUTA 3O2QB 3OMLA 4KK3A 3OTQA 4A36A 2GKGA 2AN4A 1D2NA 2WWTA 5D3MB 3UK1A 5HIIA 2EYQA 4E6EA 5BXQC 1LNZA 2NOAA 2Q9UA 5H9VA 4U00A 5DSTA 4BCCA 3JQCA 3M5DA 3WKAA 2BKLA 1MT0A 2G9VA 2I80A 3ZLVA 4U9HS 3H87A 2IVFA 4J4HA 3I01M 1S8FA 5CPFA 5DGXA 1VB5A 4BZQA 2IX9A 1YB4A 5M5BA 2JJ1D 3FSGA 3SQNA 4N5MA 5AJZA 2NZUG 4TQUS 4MVJH 2O59A 1MD9A 4HYEA 1ZZGA 3G2MA 1EDBA 3EXIA 3K16A 4U6SA 3AIKA 2X3YA 3RGWS 4F5WA 1SB8A 2FHSA 1KI6B 3QKWA 1HDIA 1RFGE 1Y82A 2IDJA 4MIYA 5DFAA 3KL4A 1GITA 5HFJA 2F55A 2XUPA 3MWDA 4LISA 4YCAA 3RUDA 5T4BA 2HLDA 4UUAA 3QVGB 3WK5A 2KSQA 1INLA 3AVTA 1QHGA 1V45E 2HXYA 1IOVA 2GBPA 2OD9A 1CRQA 2W71A 1NVVR 3BSWA 5EHQA 5GPBA 4BPRA 1TADA 1PZNA 1ZI8A 3ANMA 2YN4A 4OKSA 4BEBA 1XNRB 4Q66C 4W8GA 3FE2A 2Q0SA 2WM2A 3L04A 2OB2A 1KHHA 4IO0A 4MWCA 2G71A 1XROA 5U4QA 1GUDA 4K9NA 1IEVA 3LNTA 3HYLA 4ARIA 1R0WA 4P93A 1YZUA 4ZO7A 1FLAA 5EJ8A 5AKZA 3SS8A 4G8CA 5KYYB 4CLEA 3BF8A 3N8HA 4ZQEA 2YYYA 3SZ3A 4Q4LA 5TSDA 4BLVA 1Y9DA 1C3EA 2Z3VA 2ZR9A 2ZBQA 3DFZA 4J0JA 1YULA 4UHJA 2IKSA 4CEIA 2QTVB 3LKZA 2CUTA 1NN0A 2H7YA 3FCCA 5TVGA 1L5RA 4MRSA 4JX9A 3L6RA 5JS1A 3HYCA 1WUIS 2Z8ZA 4A15A 4J6FA 1T2CA 1ZSYA 3LLUA 1CR2A 1H9AA 1EX7A 1E6EA 1JGTA 3DBRB 2KBEA 3L7CA 1A76A 1JQ3A 4M87A 1EZ1A 4OXNA 4YBZA 1DPFA 4YRJA 1FJXA 4JITA 2H85A 3PJEA 2E4VA 1M6VA 3AEYA 1DKUA 3IS3A 4UVHA 1O9BA 2J5RA 2QXYA 1RYNA 4Z1MD 3ZVKA 2FEMA 1Z5NA 2ICAA 3I12A 4AP6A 1SC9A 5BYKA 3KQHA 2FWRA 3UN1A 4U7DA 3ROPA 1KKMA 2B0CA 3LHKA 1PG2A 2CXPA 3LKDA 2QE7A 1VLLA 1MOQA 1KTVA 5EQDA 3EWIA 4IILA 3ONDA 2IZ1A 4QXPA 4KPYA 1EDEA 3EUFA 1HZZC 4KAXA 1Z6GA 3WQSB 3L82B 2BMWA 4DCTA 5G2OA 3V97A 4DIBA 3BTUA 4NZYA 5M7EA 1VA5A 4Q39A 3AESA 4RTOA 1T3ZA 3MGKA 4IY1A 2A8YA 1SHKA 2GA8A 3GZNA 1CIJA 4J7XA 2XAUA 3R75A 1BCSB 4DJFC 2EFCB 1EIWA 1BW9B 1I01A 1YS4A 2YXNA 3Q3VA 4GX0A 3HCPA 3QU9A 1FFEA 1QGDA 1O6ZA 4LIPD 5AVQA 1MOZA 2BFCA 1J90A 2OOSA 3LRXA 1PJSA 3ZY2A 2I33A 4OQMA 4D81A 1QH8A 4EY4A 2NMVA 4BJ5A 3PXXA 1P2DA 1OKKD 1G18A 3U44A 1JEEA 3CGWA 1CY8A 1HE1C 1KY4A 4Z4IA 4TZ6A 2FKNA 1K88A 2NUAA 4EG7A 1TOAA 3QLVC 3LT4A 1XRMA 4RPCA 3THOA 5LZ9A 3RYCB 2IQ5A 3WE7A 4MDHA 2QA5A 1UM9B 4LZAA 4BFTA 3FYCA 3P0IA 2JGFA 2QG4A 4GPAA 3WLSA 2Y9MB 5CDSA 2HX1A 3IILA 2EP7A 1DAMA 2WJWA 4S2UA 3N2IA 5EZYA 4TTRA 4RZQA 1UJ6A 1WPRA 3HC7A 4OATA 2JAHA 3NTOA 1HZJA 4RBNA 3CEHA 1VFNA 1MORA 4C0WA 4IKPA 1XFAA 2FN4A 2QQ0A 4L2IA 2WSMA 4KQIA 3ESAA 4QYSA 4YAGA 3BSYA 1PVOA 1XTQA 3FYHA 3KDSE 1IYZA 5I5GA 3QWBA 3HXTA 1Y8AA 2FFAA 3CR8A 3F9IA 4PW0A 4JI5B 2AS0A 4RJTA 2FRXA 2IHYA 2KLBA 1VFPA 1GPDG 3IJEB 5DT2A 2XRZA 4KQJA 1TQ8A 4GKVA 2AG6A 4CIWA 4R84A 4RLSA 2WFLB 3ZHQA 1KO4A 2BZ1A 2QW0X 2OLKA 3K71B 1YCGA 5F2NA 2ZU0C 2ZPAA 1D9XA 2OZLB 4MULA 3IO3A 4OQLA 2FWMX 1D3AA 1YHNA 2XTMA 3DO6A 3KU4A 4YJ3A 2EQAA 4D80A 1GKKA 2B1JA 2LDBA 2WJZB 3HB0A 3KXDA 4TT8A 4XUDA 4EYOA 1OPRA 1L4EA 1ZOOA 3PFBA 1TYAE 2ZBFA 3KZOA 3M5WA 2W98A 3R7WA 1Z6QA 3L4EA 4ZT2A 2H06A 4URYR 3JVVA 4ASUA 3E0QA 2Q45A 2Z58A 1COWA 1LLQA 4OLAA 3Q6IA 1PYDA 2BTEA 1JYFA 2IUTA 1BG6A 4U7HA 4KBFA 1PAUA 2BGNA 4CI9A 4GP9A 2JI4A 2QROA 2YHUA 3KYJB 2W6IA 1I2DA 3EOZA 4MV0A 4XSGA 2M6KA 4RJ2A 3KALA 1U4OA 8GPBA 3R09A 1U9IA 1DFHA 1KAMA 1RI2A 2RONA 3I3SR 2GFIA 4GT1A 4REMA 4WLUA 3URMA 3V8NA 5FPKA 4FDUA 3VZBA 3UPUA 1E2PA 4MLCA 4DUGA 3G7NA 4CW7A 4K0RA 3S2YA 3C7AA 4IPTA 2Y77A 3LDFA 3OIUA 4L9SA 3E5RA 3UJ8A 4ZHQB 5CYFA 4R6XA 2BEUB 3QMWA 1RBMA 2E4UA 2HCFA 2O3TA 3H8WA 4N3CA 5CXXA 3SZRA 3OLYA 3ZVLA 4EELA 1JFRA 3W90A 5IAJA 1XCLA 4K1LA 4WUTA 3ZNQA 4GP6A 4LGCA 2IDKA 5TJHA 4JI8B 1KSGA 1ZL2A 4BLPA 3AKZA 1FMFA 4YAWA 1IZ8A 2PZKA 3LUFA 3LIIA 1K1EA 1WZEA 2XA1A 2PR7A 4X6XA 4YRRA 5TGDA 3U48A 1QG6A 3AX6A 4I5GA 1BOOA 4CUZA 3OZSA 1DJNA 4J1NA 4J7CA 3IFSA 3TUJC 4K9DA 4F9TA 3UJNA 4OBXA 1EWVA 5DASA 1ISFA 1AMUA 2NPFA 1KU6A 2PS3A 1BS9A 2AI1A 1DBWA 3B60A 4M22A 1HE5A 1QUEA 2PNJA 2VOEA 1JAIA 1ZGAA 2F4NA 3C6ZA 5AXCA 3DLHA 3CVOA 1NU6A 2CL6X 3A6KA 1GJRA 1ZKDA 2RJNA 4Q9LA 3ABSB 3MXTA 2X5XA 3A4MA 3FZNA 2RB4A 2WKRA 3H5IA 3NOOA 3RS9A 3B5JA 3KEOA 1F38A 1EFAA 4GZ5A 1L4UA 2NVOA 3LOPA 2LGJA 4Y3UA 4ZCQA 4E2FA 1PR4A 1Z4MA 2CXTA 3DCIA 3NM5A 3SYTA 4ZREA 2C2GA 5BYJA 3KYCA 3ZDDA 1P5RA 1G6Q1 1E0KA 1J09A 1V5EA 2GAJA 4YS6A 2ZE6A 3OEWA 4RIIA 3PHIA 3ZHOA 1QHIA 3DMFA 1FFDA 4GEKA 1W19A 1O87A 4LOHA 1GXSB 3QRWA 3T3IA 5CT8A 1I7SB 4E2WA 4EKDA 2AG0A 4LMAA 4H7DA 4AAYA 2EF1A 5FV4A 5U9CA 4FYWA 3J81k 4CKBA 1DINA 4YUVA 1RMTA 2GEBA 2HNKA 2ZJ7A 4EENA 2RGUA 3NHJA 4Q01A 2A58A 3SQDA 2L2QA 4Y2RA 1OXMA 1QE5A 4G0WA 2OCDA 3EDOA 3K0CA 5AUOB 2A67A 4IXMA 4UTNA 4XIJA 1VPWA 1J6UA 3IQZA 5CUQA 1MX3A 2AZTA 5TEVA 3FZGA 1FL9A 2BI8A 1V7ZA 3A4VA 1VHLA 4NDNE 3OQIA 5IHXA 3FYDA 1D7OA 2C97A 3GNQA 1H8HA 1CR1A 3BX1A 4FGUA 4FLEA 2RBGA 5F78A 4CM8A 2FPKA 4A92A 2Q5OA 4GLBA 4E31A 2W7TA 3KBBA 5DCLA 3NC4A 4YQFA 1CQJA 4DADA 4RVFA 3MUEA 3OPVA 4BVKA 1GQOA 5FHQA 4DNXA 1TCAA 2VSYA 4FT2A 2WJ3A 4B75A 1B1CA 5T5QA 2CD7A 1KVSA 1X1EA 2H2HA 2FPOA 4MKZA 5KYWA 3BGVA 1XXHA 1OU4A 1RAFA 2AI3A 2PSHA 1W5TA 1UZMA 5LYJF 3P52A 4PYMA 1D2EA 2AN1A 4BFVA 1PZHA 5JPDA 1KJQA 1UDBA 2I03A 4GLJA 3KPWA 3L8EA 1OZFA 2AQIA 3D7SA 1HKUA 1XRRA 4IICA 1BFKA 1OHHD 1OUMA 2DECA 1EFPB 3HCCA 1CUGA 4CQLA 5IVIA 5KNDD 4LZZA 4Q3OA 4AKHA 4CCYA 3CISA 2P69A 2XXAA 1WZNA 2IXDA 1TA0A 2WWXA 4CPDA 5BWBA 5L40A 2XBLA 1MU0A 1N2CE 1Z2EA 4LOAA 3L1IA 2I2BA 4B6FA 3SY8A 1YZVA 3NM4A 2C9BA 4BXOA 1JIUA 3ZJUA 2HFJA 1XMOB 2WG0A 3BE5A 3V55A 1KH2A 4M9RA 3QTLA 1HUQA 2A88A 4JJFA 4MEJA 1OAAA 3HZRA 3ZLUA 5LKRA 3IL2A 3W5AA 1SUCA 4Z7OB 1N2BA 3C3BA 3PNKA 2Y3IA 1H2XA 1V8ZA 1M2VB 1T4BA 1E3TA 2EF0A 4MZDA 5DCWA 5EPUA 3V8PA 3ETJA 1F3OA 2H4WA 2IW1A 2VJKA 1NVTA 2WFZA 3A4LA 3IRVA 5LP6C 4ENPA 1G59A 4B9AA 3G5UA 4REQA 2GBLA 3I1JA 4S3MA 4XVHA 2PWPA 5F77A 5BVHA 2AIRA 5M3BA 4JCCA 5BW8A 5B36A 3AUSA 1FQJA 2PWZA 1U1FA 1QKKA 3KKOA 4KH1A 3B1VA 1A9OA 3P9XA 4M1OA 4KO2S 4LGYA 5REQB 1YZKA 1F8GA 2Q5QA 4X3CA 4JMPA 4ASUD 5JY6A 2X0IA 2VQFB 3T52A 1COWD 5FTLA 1KZGB 2QL9A 3R3YA 2QB5A 2RGNA 1Q0QA 4O29A 5BQ5A 3TVYA 3FVVA 5JNVA 4JI7B 2H2AA 4PBRA 3EFOB 2Y1OA 2H1IA 3LVQE 3RSGA 3HR4A 1HOTA 1Q1BA 3GN1A 4RZIA 2ZB3A 2O2IA 3OCCA 4WEOA 3L84A 5B6JA 2QAIA 5BQPA 5T41A 2Z5GA 4GWGA 2P2LA 4PHTA 4DF3A 5AM2A 5FP0A 1SC3A 1ZESA 1HWYA 1B4DA 4G5XA 1I0LA 3KKPA 3MCWA 3B9RA 4KC0A 2UXDB 3OZVA 3F4LA 1QQTA 4QPZA 3PWSA 4X1KA 2Z0MA 4BVHA 2YQ5A 4ZXPA 3W5DA 1BDHA 2VFAA 1ZQ9A 2ZIXB 3Q0TA 4KMSA 4TS9A 4F71A 1QZTA 1FP4A 3W1VA 2EIHA 3CU5A 3OCXA 3DC2A 4OQNA 3GPLA 3AR3A 3DF7A 4HDMA 3WNBA 3HCOA 4AMYA 3R6LA 3R1IA 1UJ5A 4PIPA 2NU8A 3QX3A 1EK2A 2FUG1 3IEVA 4YP1A 1ZGZA 3MUOA 3CNLA 4RVNA 3QVTA 4D96A 2GD1O 5HP4A 4WOJA 2PS1A 5CDTA 2QP3A 2AQ8A 2NV0A 1X39A 3QVKA 2JJ2D 5DX0A 1H4QA 1JSXA 1U0EA 3CURA 4AJ1A 1V9LA 4XM1A 821PA 1EP2B 3K2IA 3BCRA 5AOVA 1KXZA 1SXJE 1EGAA 4QU9A 4C2BA 4NAVA 1TVEA 4C7MA 4F1JA 1QP8A 2NXJA 3QPUA 2BFDB 2HZBA 1JA1A 3O8QB 1U94A 2REQB 1THZA 3RRBA 1QYVA 3CC8A 3VKUA 4Z51A 4UHKA 4RULA 4IR7A 3CB2A 4EB6B 3PRKE 4IBOA 1UEXC 4OY3A 2EFHB 4AC9A 3CZPA 4ZDWA 3F97A 3DE5X 2C2MA 4G1MB 5U4XA 5TIIA 1NUSA 1TK9A 1TPZA 4KXUA 1GNQA 3NC1C 2PL5A 4AF7A 1Z63A 3GJZA 2MDTA 1P2FA 2V7QA 2JLQA 2B35A 1CLUA 3LHIA 3D5QA 2DHDA 1AK2A 4TYMA 3CLKA 2EAUA 2P65A 1QGUB 2JVJA 3OZUA 4MVJA 3F74A 4FYVA 4P5DA 3G8YA 3T6KA 3L1KA 1BX1A 3SLGA 3ZS8A 2ACKA 4HFMA 1WB4A 4X61A 3O2NA 4KGXA 4TLCA 2VPQA 2FK7A 1JMVA 1UQUA 4RK0A 1D4FA 3SSMA 2X9NA 5DBEX 4FQ7A 2JCSA 4CYMA 1L7DA 1E9EA 1KZ6A 1SD2A 2BFEA 2GTPA 3C5HA 4BL5A 2D3TA 4N41A 1GD1O 3EQZA 3EVFA 1FDWA 1IEXA 3FOWA 4GSKA 1WS6A 4F5DA 2FFJA 4AJIA 2OMEA 1ILWA 3WB9A 1WU7A 3SXJA 3MTAA 2BR3A 2Q3HA 2YVAA 3I2GA 4NXNB 1PFGA 3N53A 4TMXA 4GR4A 1DCTA 5AKJA 3ILHA 1VIAA 1QUFA 4TN1A 4QG3A 5JVDA 1JG4A 1Y1QA 1F14A 2J85A 3LQFA 4BQPA 3DAOA 3OPXA 5A3RA 1PV1A 3FJOA 1U9ZA 1H1DA 4NZ9A 3D3WA 1DEKA 2E48A 2ET6A 2VXBA 3CPHA 3N2GB 4FXPA 4RJJA 4B81A 1X1QA 3L0ZA 4MZXA 3IAAA 4EG0A 2R1TA 3ELWA 2O06A 3FFAA 3UXHA 5ALZA 5GGXA 3HP7A 3HVIA 5DNWA 2XHZA 4INOA 2JCGA 1D2GA 2KWIA 2J31A 3M3PA 4NZPA 2HU8A 4MJXA 5LD2C 1NJ8A 2AEEA 2ZATA 3O3NB 2DPGA 3ONNA 4FFWA 3G9QA 2M2IA 3HJAA 2W2QA 3FKSD 2BFNA 4CM4A 2EERA 4NCNA 3AI3A 3LK7A 3D4LA 4UDXX 3ANNA 3P9KA 1BXRB 4JBNA 4J2OA 1P44A 1GR1A 4IIDA 1W29A 3UUWA 1VZ2A 3ZQJA 3WDSA 1PP4A 4XLLA 4KFCA 3I76A 3BSFA 4XR4A 4QZVA 1KYYA 3HYSA 4LJ4A 3ECCA 3FHLA 4QQ8A 1JHPA 3RJZA 4RD2A 4YRIA 3SQWA 4L78A 3PI6A 3GJQA 3K8ZA 3LBNA 2EFDB 4FR0A 4PZAA 3A2LA 4QTTB 4DDWA 1H1TA 2WINI 1Y3FE 1A9XA 5SY6A 3I6ZA 1CIPA 1JI3A 2ROQA 3JQGB 4OGWA 3VKWA 1RQ2A 1RW4A 1WMAA 2E21A 3DOOA 4CV3A 1SG0A 3NOQA 1TYDE 5AUNB 4M0MA 2KBFA 3S27A 1C30A 3GLGA 3SZMA 2A1UB 4CR6A 2QTNA 1AG9A 1RC0A 1W4AA 1QO7A 2PT5A 2GR9A 1F7UA 3THYB 3REQB 2GF9A 3QXXA 2FSVC 3P0EA 3Q0IA 3CUEF 4H77A 5IUKC 4RGQA 5A3QA 1NVVQ 1E62A 5K0NA 2Y1LA 1FFWA 3IKLA 3TNYA 1I13A 4WY8A 4ZRNA 3DFMA 3QTBA 2Y0EA 4V1CA 3RS5A 3W8RA 2BEWA 3P20A 3DL0A 3V4LA 2HEIA 4UARA 5B4UA 5GAJA 2W8BB 4ZJZA 5DIZA 4UFPA 1XAIA 5LCXA 4QQFA 3F3YA 1BN7A 4LEIA 5SZHB 1NSYA 3T9CA 4YT5A 4CM9D 5IASA 5LZ4A 2JD0A 3ZIUA 1F6DA 1ZVKA 3OTHA 4OGGA 4X44A 4EFMA 1VJ1A 3H3XA 3FX2A 4ZC8A 4JSYA 4R0VA 1GU7A 2AFIB 3P9SA 1DG3A 2ORIA 4R8SA 1VL1A 3U62A 4N0EA 3FI0A 3V3TA 1AQNA 2VAWA 4H3HB 4C0AC 3I4CA 3QZUA 4YRTA 4E32A 3WV4A 16PKA 2VEOA 3HU5A 1CU1A 1UKCA 4TM8A 2YFQA 1CDOA 4LCEA 4B3SB 3CO0S 3MB8A 3UC9A 1DT3A 1GWNA 1C0LA 1UWVA 2A2ZA 1N6PA 3BL6A 3OPYB 4U1RA 5AI8A 3OO1A 4D9MA 3J81A 4CEJA 2PU7A 1XGKA 3R9IA 3W2IA 1OROA 5IJ9A 3GJ0A 3IALA 5DJ5A 1TUEA 4KKXB 2A35A 1YIOA 2HA4A 3AF1A 4GLLA 4N3AA 4R3UC 4JI3B 2LIPA 3ZK7A 1S1MA 2L0XA 1P8AA 4FNMA 4G0MA 3CUYA 4OMDA 3WIOA 3KWLA 4PWZA 1U8TA 1E9CA 2IPLA 3OQJA 3VRHA 3V8QA 5IUNC 1JLMA 3FPCA 3H1AA 4WKGA 5J5CA 3ND8A 3TZLA 2HA3A 3SE0A 4RPIA 3X1WA 1XJ0A 4C6TA 4TV9B 3NUQA 3DKRA 4QTUB 1I3KA 3WAJA 5AM0A 4Z9XA 4NU8X 5H16A 3O8RA 2ZJ2A 3CQ9A 1HK7A 4O3FA 1E2LA 4IV5A 2OXRA 2AZ4A 1DL5A 2G5GX 2CXQA 3BIXA 5AW5A 5FX2A 5CX1A 4UVDA 1ABBA 3LCCA 4Y2PA 1J9EA 4AL4A 5CFNA 4GW3A 3RU2A 1ANKA 1R8QA 1T5IA 2B1IA 4QJ4A 4MRAA 2CFTA 2V96A 4LQ4A 1B3RA 1UQTA 4A27A 2VSXA 3AI1A 4QDOA 2JAWA 2WNSA 1H22A 2JFGA 3OCVA 4HC4A 4CHGA 4ZKDA 4EABA 1KYQA 1EE9A 1C1DB 4OCZA 4WXMA 2AFHB 3H5TA 4AX4A 3I53A 1M34E 1KDTA 4FCCA 4JC0A 2BSAA 2IYLD 4N8EA 1IHYA 3WLEA 4BQFA 4YJGB 4X63A 1N6KA 4XM0A 3T8YA 4UDOA 2NSHA 2PXAA 3REGA 3FSRA 1S9DA 1CS0B 1TM3E 1MLDA 4HMOA 4X1IB 4WKCA 4DHWA 2C9ZA 3THRA 4BNTA 1GAWA 2MSDB 3OZXA 1LBEA 4JEIA 4N5DA 1JKJB 3TH5A 1K92A 1IIBA 1V5FA 2I7CA 3IXLA 1R4MB 2P5UA 3IT0A 3DZJA 1U0LA 4YMHA 7AT1A 2H4ZA 3PUIA 3GLFE 3J7AC 3VAAA 2IHJA 4PZYA 2J3IA 4QBFA 4O2AA 2R00A 4AY3A 4XTRA 4DABA 5GM1A 1HH4A 5K01A 1SZPA 4J94A 5SICE 5DBIA 4XRRA 4HDRB 4RETA 4FFBA 3E6AA 3GJRA 5LQUA 3F5SA 2CCGA 3DWEX 2Z2ZA 1TQDA 2D2FA 2RGDA 1XMVA 4QOFA 1I5OA 2CMKA 1UBLS 4QVKA 3I9OA 2FH5B 1D2RA 2VTEA