3MJDA

1.9 angstrom crystal structure of orotate phosphoribosyltransferase (pyre) francisella tularensis.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
209
Chain Sequence
b'NLYFQSNAMFIEFALKNQVLKFGEFTLKSGRISPYFFNAGLFNTGAQLATLADYYAQLIIKSDVKYDILFGPAYKGIPLVAAISTVLALKYNIDMPYAFDRKEGVFVGADMTNKKVLLIDDVMTAGTAFYESYNKLKIINAKIAGVVLSIDRQEKAKDSDISATKKISQDFNIPVLAVTNFESIFEYVKENLDETMIDKFKQYRQKYGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotate phosphoribosyltransferase
publication title 1.9 Angstrom Crystal Structure of Orotate Phosphoribosyltransferase (pyrE) Francisella tularensis.
rcsb
source organism Francisella tularensis
molecule tags Transferase
total genus 67
structure length 209
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3mjdA00
3M3HA 5BSKA 4F8EA 1QB7A 4RANA 3G6WA 4P81A 5K51A 1NULA 2VFAA 1UFRA 1L1QA 1YFZA 3DEZA 3GEPA 1GPH1 4RADA 1W30A 1HMPA 4IJQA 4RV4A 5KAMA 4M0UA 5ESXA 1AO0A 2H08A 1R3UA 2JI4A 5EUCA 1TC1A 2P1ZA 4RHYA 1VDMA 5HIAA 1ECFA 1QK4A 5JSQA 4P82A 1Y0BA 4P84A 1CJBA 4RABA 4MB6A 3KB8A 1I14A 3MJDA 1DQPA 1VCHA 1U9YA 3DAHA 4QYIA 2H06A 2HCRA 5ESWA 2XBUA 4RAQA 4PFQA 1QCCA 1XTUA 1XZNA 1ZN7A 1J7JA 1NONA 4LYYA 4OHCA 4RAOA 3NAGA 5JV5A 1OPRA 2JBHA 1U9ZA 4P3KA 2DY0A 1A98A 2H07A 4M0PA 1G9TA 2PRYA 4LZOA 1ECCA 1P19A 3OHPA 4P83A 1STOA 4JITA 3GGCA 4P86A 2GEBA 1QB8A 1DKRA 3MBIA 1I0LA 1QK3A 1Z7GA 1I0IA 2JKYA 5IPFA 5KAPA 4WN3A 3GGJA 3H83A 4ZFNA 1O57A 4RQBA 2AEEA 1I5EA 1IBSA 1BD4A 3OZGA 5BRNA 5IAOA 4PAWA 4KN6A 1A97A 4X45A 1I13A 1ZN9A 4RHTA 3ACCA 2E55A 4WMLA 3LPNA 1A4XA 1FSGA 3LRTA 1O5OA 1DKUA 1UPUA 1V9SA 2YZKA 4P80A 4M0KA 5E38A 1LH0A 3S5JA 4LZAA 4JLSA 4S2UA 1G2PA 2C4KA 1L1RA 1MZVA 2WNSA 3OZFA 3O7MA 1VSTA 1HGXA 1BD3A 3N2LA 1JLRA 4QYIB 2PRZA 1G2QA 1BZYA 1DQNA 1XZ8A 4LZNA 4Z1OA 1OROA 1P17A 2JKZA 3EFHA 4TWBA 4RHXA 1WD5A 2EHJA 1P18A 1QCDA 1JLSA 1A95A 1ECBA 4RHUA 4QRIA 1ECGA 1P4AA 1GRVA 2IGBA 3ACDA 2FXVA 3QW4B 1A96A 1OREA 1A3CA 1XTVA 1TC2A 3ACBA 4FYMA 4RACA 1DBRA 4X44A 2PS1A 4RQAA 3DMPA 5BQPA 1D6NA 3HVUA 5HKLA 5BQOA 4LYGA 1UPFA 1XTTA 1ECJA 1QK5A 1PZMA 1ZN8A 1G9SA
chains in the Genus database with same CATH superfamily
2G28A 3OLYA 1EVLA 2A0UA 2QL7A 1NI4A 3K0AA 4OYYA 4PQYA 4PYQA 5F1PA 2VDWB 3OZIA 5D84A 3T94A 2GSWA 4B9EA 3C70A 3NASA 5DJ5A 1GZHB 3PC2A 3C3DA 1VTKA 4IQGA 3ONDA 5HBRA 4IJQA 2DLDA 4AWBA 1UDAA 3O5AA 1SIUA 4KI0A 1GFZA 2ZRQA 1LZLA 4C89A 2VBIA 2UUBB 2A1TR 1FP7A 4MUHA 3ZV4A 3PPXA 2A84A 4C1BA 2ZIAA 3L8CA 3VQTA 3I5UA 3Q8KA 3ER6A 1FYWA 3IDZA 3TRFA 4MJ3A 1KNQA 1I6LA 1VYVA 4JUIA 5FWXB 5IJZA 3KETA 2JATA 1TVKB 1DPFA 2DBQA 4UVIA 1BFUA 1X6VA 2ORVA 4B3DA 2FEKA 2BM9A 4YGXB 1FF9A 4EHHA 2FWRA 4L8FA 2F43A 3REQA 2Q3BA 4D99A 1MV8A 3UHFA 2HF8A 4FJ0A 1SUAA 5DM2A 4N3GA 1TIBA 4MQLA 3RS7A 1LVHA 4TRMA 3SIPA 3ASYA 5FADA 4MB2A 4OQEA 4F92B 2Y1OA 2B78A 3GEIA 3B3AA 4GVXA 3IAM6 1K8YB 1EDDA 5JWRA 1OFUX 4NOJA 2JIBA 1XMPA 4NCBA 3WLHA 4LK2A 4AS2A 5KJFA 1E1RD 4QBHA 2ZANA 1I30A 3REGA 4KPFC 2EKBA 1VSVA 2X0JA 4RTJA 2GPYA 3JD2A 5BYBA 1MTZA 1ZAKA 3E82A 3SEQA 3D1LA 2WP0A 1VJ1A 4B83A 3ZE9A 3TD6A 1XRLA 1PEKE 3T8YA 3ZPXA 3EZ2A 5ARBA 4RZ2A 2ACVA 3UBTA 3WGVA 4LC9A 3TLMA 4TMYA 2ZG6A 4YONB 1EDOA 1TRKA 3V80A 3UTCA 1L3CA 3B60A 1I4LD 4R2LA 1KYWA 1LDNA 4UVDA 1D2AA 5LSAA 4MJXA 4RMNA 1J1UA 2EJTA 4M83A 3MWYW 4HGRA 3HYRA 1SOMA 1SZJG 3H5LA 1SU6A 4C6RA 4DUZB 3IEKA 4MP3A 4G5QA 3OP4A 3J7TA 1J25A 2D5IA 1HQDA 2ZEJA 4ZAZA 1PDOA 2FCAA 3BCHA 4RD4A 4CHTA 4ZALA 4ZVUA 2DHEA 3WYGA 4MTCA 3U39A 3ML1A 2NPFA 3FN4A 5F23A 2SKDA 2ZULA 3L8EA 2CDNA 4HZUA 3EVZA 3V1TC 4BYMA 5AVWA 2WUVA 3SWWA 1ZIYA 3LS2A 5KHAA 1OYYA 1SUWA 3SNKA 3DXFA 3TSAA 3OX2A 3U9LA 5H3LA 3VYRB 4DUYB 3CJRA 3SK0A 4ROTA 4BCBA 3U44A 3RUCA 3L8HA 3TRDA 3VYUB 1BEEA 4DPKA 4V1CB 4BYGA 2IH4A 3OSUA 3RC8A 4FLMA 2DETA 4TRRA 4BO1A 4CL0A 1SUBA 1TK3A 5CDFE 3NDIA 2J07A 4DA0A 4XJTA 1UC5B 1DHRA 1MKYA 1P7CA 2AN5A 3I28A 3KOYA 4TL9A 5TPWB 2HA2A 2P4UA 3OQVA 4EKDA 2C9YA 1VHTA 4WKNA 1E7QA 1DEHA 1OUMA 3UQZA 4EZEA 1Q0LA 4TVKA 3T7DA 3GAAA 4M9CA 1NL3A 1Z8DA 3PYMA 1JIQA 4O29A 1ZM4A 5HIJA 2NNLD 1VPWA 4Q1DA 4BO7A 3A7EA 1T36B 5L7WA 2AWOA 2XMQA 2V5VA 3EIFA 3DXZA 3I9LA 4CN8A 1J39A 3FTFA 3K6SA 1KY3A 4PLHA 2XRFA 4WFJA 3OQIA 4XWAA 4ZRMA 2DC1A 4C4PA 1JR3A 3L9WA 4G4IA 1YFZA 5H70A 1KETA 4GLLA 4CFZA 2NPIA 1TUEA 2X23A 3OIWA 4M86A 4OKIA 4HNTA 3PFHA 3EPPA 2OFFA 3EVTA 3UWSA 3ANNA 1ISPA 2WFMA 4IDNA 1T5HX 4X8LA 3UH1A 2CLFB 2Q27A 5D5QA 1C9DB 4GX0A 3IALA 2Z58A 3UJ7A 1XB2A 2C3MA 5J2TA 4GDFA 4ZV7A 1WWKA 2QW8A 4FINA 2YV5A 4FVTA 4I4TF 1NX6A 4Q4JA 1E3EA 3BZUA 3DAHA 4PNPA 3HA2A 1RHQA 1SJ9A 3TTVA 4ENPA 3O1JC 4DJAA 1HETA 1MNQA 3KL4A 3RWMB 1AB6A 4R9RA 1ZN7A 2F64A 5M34A 3O8OA 3JZAA 3V32A 2IWRA 2Z6VA 4ZXPA 5A5DA 1YSCA 4G81A 4LNAA 2QRVA 3H9UA 3MPUA 4Y0NA 4L5IA 2RHCA 5F51A 3ZWBA 4DBZA 2OD2A 1E0KA 1OF1A 2P2NA 4DDUA 2BGRA 1IHDA 1I3NA 5AW4A 2Y76A 5K3FB 5K3EA 1LBIA 2N47A 1LWNA 2E4VA 5IAEA 1U0BB 2CV0A 1QGDA 3Q9NA 3ID6C 2NAPA 4RFSA 1ZMRA 1YMUA 1HDGO 3OIFA 1NYQA 4TT8A 4GX5A 4X1KA 4V0KA 1L0BA 1VBKA 5FV7A 4TMZA 3AFIA 1T2EA 4PYKA 4AWAA 2CHGA 3G1TA 3U17A 5KUTA 5AK4A 2X9NA 1G19A 3LSYA 3CG0A 1PQ4A 3AV0B 4DIEA 4K6HA 4B87A 5CB6A 4PGGA 2VNAA 5B4TA 3HCDA 1G8PA 2JIRA 4HNRA 3U49A 4EB6B 3OZTA 1NUTA 3EPKA 3EISA 1V8ZA 4P4GA 3TGLA 2ZTHA 3KT0A 4KWIA 1P1CA 4G07A 4IIGA 1KO8A 1SZPA 3WGHA 4DCMA 1G3QA 1WCIB 2JC3A 4JLOA 5ITVA 2W2QA 3QKWA 4HDAA 4GYKA 4TGLA 1K63A 2VYVA 1O54A 1UFOA 3CEAA 2ODNA 1GP2A 4K6OA 1QGED 2P68A 3CLRD 3CUKA 1MXHA 1ZG3A 2ZE7A 3HBNA 4L4RA 1QOZA 4XX0B 5INTA 5KNBH 1QF6A 4NBUA 1KYVA 4I8IA 5F77A 4MIYA 5IM5A 4HEHA 3RS2A 3AILA 1KAOA 4WEQA 4PINA 1U6JA 2O8DA 2C7GA 1KU0A 1JQ5A 2ZIVB 3IMKA 3NHUA 5DGTA 4DMRA 1W36C 2QN8A 2WYIA 1U0NA 3I9FA 3WO1A 3TQRA 2RC6A 4GLJA 3EODA 1DQNA 2YKGA 5CB8A 3KOXA 3EY9A 4KN5A 3PT5A 2RH9B 2DUMA 5ALGA 1DNPA 4KWHA 3BM5A 3TPZA 1P44A 5GQSA 5EIEA 1CJUC 1M8KA 2I1LA 2Y0CA 3WAGA 5J3JA 2ZM5A 1UIMA 2SECE 2AR9A 3RTCA 1ZW1A 2GA9A 3NTQA 5KNLA 5A3VA 2C8LA 1ZD9A 1K7EB 2OHOA 1IBCA 2NTJA 5CRIA 3LWDA 3KTFA 4YCSA 1ZM9A 3CVWA 3CUVA 3Q3VA 2HCBA 1GHTA 2C96A 1WLYA 2OZLA 2WIBA 5IDWA 5ALOA 1ODTC 1UM9B 2UDPA 3RLIA 4RU1A 1GQ2A 4DBLC 4F5EA 2Q50A 3TCNA 2J3EA 4OQPA 2ZYRA 3P0HA 4WNAB 1EZZA 1FDSA 2QRUA 4CT0A 4ZEWA 4QDKA 3UJ6A 4F5WA 1WZ2A 3LPCA 5E6SA 2IITA 1KQGA 2PJUA 2PX4A 3WKAA 1VMIA 1ABBA 2VKTA 1Y6FA 4IICA 1CQJB 3G0CA 4CM4A 5K0LA 3MTBA 3CRQA 2WUFA 4HGNA 1I7QB 1NVUQ 1R0ZA 3WV4A 4OEHA 3EC2A 2J59A 4LF5B 4KQ2A 3CZAA 3T1OA 4NG5A 1NBIA 1QDLB 4UHKA 3HN7A 4P82A 4YMGA 5K99A 4JI0B 1GNVA 1EHCA 3NHFA 2VZ0A 3TRHA 1RQPA 1ES9A 3JYHA 4UNQA 1OBCA 2ZIFA 3QOYA 4LYJA 3PGVA 4IIXA 4OJTA 3I32A 1N5LA 4BC0A 6YASA 2QTGA 3C16C 4D81A 2FPIA 3HWRA 4N49A 5C5DA 3ZW9A 1ZCZA 4DV1B 2NXNA 5CIWA 3LXUX 2QZ4A 2AWNA 1Z6PA 2D2VA 1YCFA 3P19A 4FMDB 3VV2A 4CKYA 4GR4A 2C1EA 5IM4F 4AJJA 4D9JA 1RRPA 5H82A 3Q0TA 2XGJA 4MQMA 5IEBA 1RYFA 3NJ4A 4B47A 3DFKA 2CVOA 2A9KA 1XZHA 4O4HA 4QULA 5U9CA 4DWWA 2EZ9A 3VR0A 3CZPA 3GRKA 1VJ0A 1SCDA 3GL9A 4I46A 5DRTA 5BNIA 3BWEA 1T5OA 2AX4A 2EGGA 3DTVD 3FJ1A 4BGEA 2NVOA 3ZGNA 5H7XA 5KOHA 2HWXA 1Z0UA 2J31A 3DO5A 3D8HA 1GJRA 3UFXB 1SK9A 1H2XA 4X85A 4G0YA 4DXDA 4JLDA 4G0NA 1LDYA 2QORA 1Y3IA 2V7XA 4GM4A 1ZD5A 1KY5A 2Y1KA 3AHDA 3KQWA 4UXIA 1OI4A 3EVFA 3FZGA 2EHDA 3ITDA 1CUUA 1Y3AA 3ZHOA 1CDEA 2JPDA 1OJ7A 2MINA 2RGCA 1OAAA 3BXOA 4FNOA 1RC0A 1T9ZA 4QU5A 1L5HA 4IGAA 3V6MA 2Y4OA 1NMSA 4OQXA 4I50B 4B7XA 2I4RA 2R8EA 2AFIE 4X6UA 4II7A 3G1WA 4LGMA 4PYNA 3U31A 1ZITA 1KP3A 5BN4B 4ECEA 4KIGA 3ZDCA 1WY7A 2IIPA 1EA5A 1SR8A 1DP4A 1MJNA 1XVIA 2O7SA 3AJDA 5EIOA 4F1JA 1P39A 4ITVA 3I37X 1GDDA 2WG0A 3AERA 1O95A 3A3PA 4JB3A 3ZV6A 1TUIA 4LZAA 4EPVA 1KJ9A 3QVKA 2R47A 4GPD1 2H51A 2XNKA 5I4BA 3DDZX 3SJZA 3UA4A 5CXXA 2OBMA 4IH4A 2Q49A 4QYIB 5L6LB 4BJ5A 4A3SA 2AE2A 2NYRA 1T9GR 2HWYA 1SC3A 4IS2A 4RVDA 4L0DA 4FKZA 1L9XA 3OZDA 5FA8A 4LDZA 1BHO1 2NXEA 1P6XA 2GZ2A 1KVUA 1Y9EA 1R9NA 3OM0A 3EASA 4OQDA 4AROA 2ZKLA 3F6CA 1PZHA 1XEXA 2MWMA 2J85A 5B57C 4K9LA 4FZRA 1Y4AE 3FHCB 1M3SA 1W5AA 2VJYA 4YCAA 4CIBA 5B3LA 2IDJA 5BQOA 3S27A 3AFOA 1I7PA 3IP5A 1TQ2A 3MXTA 3E1GA 5KDOA 1M8PA 3E4DA 1JPVA 3CZ9A 4J0QA 4EJSB 1QC5B 2PLAA 4PQRA 1N2CA 4D82A 2BTEA 5F33A 2Q0QA 2X2EA 2FGKA 4FILA 4JK3A 3A4YA 4RTQA 2BRUA 3HEMA 4MLDA 4AF8A 4B0OA 1H1LB 5EWMB 5KNDA 4AJOA 3DOJA 1DWUA 3H0EA 4HX5A 4UUAA 4YJ3A 4Z4QA 3C8UA 3QXHA 2IBSA 4H3KB 5JJLA 3ZLBA 4DLVA 1QO0A 2E21A 1R5NA 2OBXA 3Q8WA 4JP3A 4M8IA 5FPHA 4AQ7A 1Y42X 1PZEA 2GPWA 2GA8A 3ABIA 2XW6A 4DMLA 4BRUA 3FPGA 5HIMA 3ZR4B 2WICA 3RAJA 1IQUA 3CH6A 3CINA 5IBRA 3NBFA 4L85A 3S7ZA 1DAPA 2PSEA 5DM70 2ZWMA 4IGEA 4CCYA 3GJSA 2EQAA 4AZTA 2AYZA 2WHPA 3KZMA 3MJTA 2WR8A 3OLCX 5EPUA 3CTMA 3SVZA 1ZJZA 2GHRA 4BVFA 1MJFA 1ZDMA 3OOWA 5F7JA 4DLAA 4EG6A 3VHQA 3WGNA 3VVCA 1EFUA 1EPUA 4IINA 3SZMA 4O08A 1KPHA 1P19A 3CZQA 1JHXA 2BR4A 4FOPA 4Q3OA 3UIEA 5LDHA 1Y9AA 4ZJYA 5I01A 3ZD9A 3DZGA 2ET6A 4I6JA 2JEZA 2BDUA 4UCWA 2ROQA 1N0HA 5IC6A 2HXYA 2G63A 3LSTA 3U4DA 4LVCA 2FF7A 5FOVA 3W7BA 1XDGA 1AD2A 2R48A 2QD2A 1HKUA 2DECA 4RORA 2IYLD 5EXTA 5IJXA 2YVUA 4UTZA 1US8B 4KQCA 2VPPA 2B3DA 3GGJA 3L0IB 5G4KA 3I09A 2XVXA 2XTNA 1PDVA 2QPTA 3HVHA 2IDKA 4JBIA 5JPIA 2ODPA 1E8MA 2CCGA 3PX7A 3R8CA 4PRLA 1QGYA 4DIUA 1U0TA 2KBFA 3I2IA 4X45A 2C8KA 5C3MA 1R12A 1X15A 3LTNC 3GPLA 3OZVA 3TK1A 2QTAA 4ALNA 2WFLA 2UYYA 3DZJA 4ZI5A 3VFDA 5BSTA 5B7QA 1PJTA 3HABA 4ACBA 1DT3A 3JXEA 4MKXA 2HA5A 3OCJA 3OQJA 3ROPA 5FYDA 1V5WA 4YROA 4ESVA 1E6MA 2HRBA 2NLOA 2QD5A 3AJAA 3DAGA 3KQTA 3OZXA 3WK9A 1DRWA 3I9JA 3N58A 2CWWA 5T41A 4H4EA 4D7AA 4WZAA 3VR4A 1Z5NA 4ZJPA 3RAPR 1FYXA 2O8EB 1D6JA 3T9DA 4DMCA 4WADA 1G5QA 1AKMA 1V4NA 4UZFA 3EDRA 2TECE 4PAOA 4WQMA 3WMWA 4IHQA 5BY2A 4IVPA 3QH4A 4KRGA 2WU8A 1O96B 3ZVRA 2ODWA 5L95A 3SF8B 3U3DA 3HKBB 5KTOA 2P69A 5JROA 1FSPA 2ABWA 4JJKA 2VSNA 1RYHA 4HGPA 4D8WA 4ZI3A 5JSZA 2GCEA 4ZC1A 1RAIA 2XH8A 2KW5A 2ZBEA 3CLRC 2GEKA 2WF8A 1CG6A 1W29A 1YQEA 1EX7A 3AF3A 3MTGA 4PYMA 1I2CA 4OJQA 5ANRB 5JNVA 4CEIA 1GQQA 3HUEA 1Q1NA 3BB3A 3L8ZA 2VHWA 3DLTA 3LGAA 5CM8B 3UMCA 3C87A 4BQSA 5CFMA 1WSDA 1WHTB 221PA 4KG7A 3PHLA 5CG2A 3PZRA 4O2LA 2UAGA 3MCAA 4LVOA 4EYGA 2P3QA 4N3NA 4PLZA 1FFSA 1B4DA 3VPSA 3GFBA 2VL7A 1NUSA 2W93A 1CEQA 5BPFA 5KDDA 4HADA 3R7FA 4FIZA 2ZU6A 5HFJA 1UMKA 2TSYB 2QRHA 4N5DA 5B37A 4M7WA 4C4OA 2FPGB 3KEMA 4C43A 1JEYB 1AZTA 1RRGA 2X0NA 2ZAGA 2VHTA 3KP1A 5JY6A 1NRIA 5ECWA 4ZO9A 4JYPA 4KB5A 2ZRHA 3VJMA 3UAWA 4DMMA 1HH4A 4F6RB 1DBVO 2CDAA 5JAHA 1XHEA 3QMVA 4QTXA 4TRNA 3PC4A 4HAOA 2LCFA 2PFGA 3NX4A 4JP2A 1MH1A 2AQKA 2LWIA 3HJBA 3IVAA 3L4EA 3UB4A 3ZS9A 1GR1A 1M10A 2CNDA 3MS4A 2R66A 1ZS9A 2GHIA 4UMVA 1TW3A 2JIQA 2YWFA 4IV5A 4QYMA 621PA 1Q5PA 1QIMA 1MPTA 3RABA 1G9TA 2FMUA 1CW2B 3O9MA 3FDXA 4GPEA 1G6OA 4JUFA 4OYHA 3UKOA 4H1WA 3ZTTA 2H5LA 1BRTA 3FR7A 4OXYA 5HQJA 2OCLA 3GA0A 5LMNB 1QF7A 2IIBA 1CUGA 3WJAA 1XTQA 1CIVA 1DKLA 2ZFUA 3CGWA 3ZLJA 4L8VA 5AW7A 3QUQA 2YR0A 4ES6A 3DUFB 4XCVA 3W6ZA 3IEUA 1AY0A 2WILA 4XIJA 2NGRA 4WN9A 3P9RA 2CDRA 3ES9A 2RC5A 3MYRA 3LQYA 4EY4A 3MK31 1UKBA 4HDKA 1F0KA 1P1IA 2DBVO 2R96A 3A6JA 3RVJA 3T7TA 4EOGA 4H0NA 4BEVA 2NT3A 1DXQA 1G7SA 3VHXA 4ARBA 3NH9A 1W581 1VJRA 3SZ3A 1SEPA 4ZC8A 2NZUG 2JAPA 2GASA 2JJ1A 2QTHA 4PZUA 2GX6A 3AK4A 3JWEA 4J0JA 1PVDA 1X7WB 3JARA 1UWVA 1ZVQA 1C7FA 1THZA 4GZ5A 4QJ4A 2NTEA 4MW5A 1TQ4A 4Y2YA 2QVGA 5DI3A 1AKQA 4LHSA 4O4JA 1O5OA 1PLJA 3STXA 3SHFA 1EXNA 1KR2A 2X14A 3GJYA 4CMGA 2F8SA 1KDRA 2Y93A 3D5TA 3I6QA 3U3OA 5FPSA 2Z3VA 4U3JA 1CZNA 1WL8A 2PLFA 2WNSA 3L3BA 3TAUA 1FU8A 1N77A 3AONB 1XQ9A 4V2IA 5T4HA 1E7RA 4S1OA 1YGYA 1OLSB 4PS0A 4B7ZA 2WF9A 4H15A 3AFHA 4IKPA 5IAKA 3UENA 3WX0A 2VKQA 1E2DA 3AJRA 3FNIA 2BM0A 1PAUA 3S6JA 1JKJB 3ZCXA 3CNOA 4Q4DA 2Q3HA 1XPUA 3KJNA 4R40A 1IWPB 2XUPA 3H9BA 4BE7B 3TZQA 2JASA 4DAEA 2DPMA 3NIFB 3GC6A 1NXWA 4IFEA 1JMKC 4I9UA 4KJZA 5FBQB 3IEIA 1TO2E 1NM5C 2FR0A 3OEYA 3PC3A 1LRLA 4HLCA 4ABTA 2JI6A 1P61B 4XI9A 2HLHA 3B6MA 2C9DA 1RXYA 1XOIA 4TL8A 4ARZA 2NUBA 2RGUA 5DTJA 2GAJA 1IJKA 1QVWA 1JQLB 2FOXA 5AXDA 2BR3A 1WG8A 4I1UA 3L40A 5ALZA 4RC9A 3PC8C 5HZHA 1MHTA 2G40A 2Q9AA 1M1UA 4MMZB 2P6PA 4EK9A 2H2AA 3S8MA 4S24A 5BO5A 3GLGB 5REQB 3T7CA 1EE1A 3D3EA 5FD8A 2EV9A 5JNRA 4TYQA 4BP9A 5JMTA 3DO6A 1MT3A 3OFND 1O7JA 5LDDC 2H1CA 2YN4A 3DDOA 4EQ6B 3N7AA 2O7NA 1E5XA 3U4AA 5HIAA 4BZWA 5TARA 5IZCC 3Q10A 2C9ZA 1NQOA 1R0CA 2WT4A 3QWBA 4LSZA 4O4HF 1ZX1A 4RJIA 5AOAA 3ZDXB 1HL7A 5G4LA 2GMWA 1WHSA 2FUG6 3C3EA 5I4KA 3ZDEA 4YDQA 3VNUA 3QLUC 1U9YA 2HI0A 1XCPA 1NYRA 4CLDA 4UTOA 2VHVA 5HHTA 3D6MA 5TSDA 1L2TA 3JTMA 5AI5A 4B17A 5K3BA 3K6JA 4RTLA 1BS2A 4U6QA 4Y0VA 5IKOA 1GYRA 4Q3EA 1XHLA 3WIBA 1CQIB 1P4HA 1FLVA 1UKYA 1G6HA 3KKOA 3PR2B 2QX7A 3MJSA 4OJNA 4UU0A 2FJPA 1XO1A 5LP6C 2VQDA 4R68A 1V48A 3P4XA 3M3PA 2JF0A 2HA0A 2BEWB 3RRNA 1SM4A 3LNTA 3MLBA 4MDHA 5DLYA 3LHKA 2VHUA 1YAHA 1TIPA 1X77A 3NT4A 4C6SA 1UJBA 1USWA 4OMUA 7GPBA 2IS4A 3QVLA 2Q45A 1OLXA 1SVMA 2AXEA 3PDWA 4P4SA 4R98A 2OV3A 1Y34E 1P31A 2WHEA 5ERGB 3FPLA 4XSHA 4DARA 3TDKA 1JP7A 2AFIA 4U7PB 4DLXA 1SIOA 1XCJA 3K9HA 3NXSA 4NBVA 3F5SA 4XDYA 1UJNA 2HEIA 4HYYA 1AGPA 2ONYA 4MYCA 4C7OA 3KJHA 3KQUA 2CYBA 4JSYA 4ND7A 4JWKA 4KXLA 4BMPB 3R3UA 3CW8X 2M6KA 1Y82A 1PFQA 3PC6A 4ZT7A 1B41A 2ZI5A 1WQ3A 1LJUA 1OJLA 1W88B 1FJ2A 3RTEA 4EY3A 3VKGA 1ESMA 1FFAA 2PCLA 4WXYB 2QMYA 4GI2A 4MR9A 2WT8A 3BGOS 4QAQA 1CEYA 3RG8A 2IW1A 4GVLA 1PEAA 4TTAA 1EFRA 3NEAA 3KQQA 4YJ2B 4CQLA 3DV2A 4UFNA 4M1QA 4PC3A 2PL5A 4R8SA 1KSGA 1S7CA 2R7KA 4L57A 1FSSA 3L8GA 3GG9A 1AA9A 3VR5D 2H57A 4XD2A 4GXRA 1Z63A 3ELUA 4I4CA 3KQVA 1E7WA 5DN9A 2WEKA 4LGYA 4I14A 1I1HA 3L82B 1YB7A 4TL6A 4QDTA 3N07A 3U80A 4KUGA 2H63A 1TECE 1KEWA 2CJPA 1EJBA 1PSZA 3UPDA 2QL9A 2A4MA 5LA6B 3L92A 1ST2A 4LXYA 2VCHA 1UBNA 3FG9A 2CK3D 2C0PA 4MROA 2DGDA 5IN4A 1Y1QA 4OX9Y 4M49A 4O3MA 2X15A 3JALA 2ZSHA 3FF4A 2O19A 2GRJA 4KRXA 2HGSA 3T5BA 2I33A 2IYEA 4FSDA 4Q16A 1ZOLA 2PJRA 4DC0A 1SHTX 4XYBA 3RI3A 4YJ3F 3HLYA 2TYSB 3JQAB 3PFFA 2O4CA 2J3LA 4ANFA 5AVYA 3JWHA 2G08A 2Z1MA 4DW8A 3SHVA 1E2FA 2PGDA 1S4MA 1QOQB 1ACLA 3S2IA 4D57A 2BWJA 4G0UA 3L6RA 5FOUA 3N2GA 1NZDA 4IQ0A 4LHZA 1QK5A 4TXLA 4N18A 1G9SA 5GV7A 3U0VA 5DBIA 4KAAA 3I5YA 1VFNA 1H65A 3E81A 1Q22A 1S9HA 1CF9A 2P9CA 2IA5A 3G6WA 3GRUA 1JTVA 1FLDA 2C61A 1MGOA 2PR2A 3HRIA 2J6IA 3LBAA 1JFVA 3R4CA 1FBNA 2CJWA 2FP3A 4O3FA 3TSZA 4QWWA 1E4YA 3FRIA 3IUSA 2VTBA 1NKVA 1E1LA 5B7NA 1GPWB 5AUQA 4EX7A 1Q1GA 3DMHA 3KYJB 4L74A 1NNUA 4HYTA 1HE3A 1LLUA 4NQZA 4WY8A 4LJ4A 1UKAA 2IPOA 4X94A 5ALIA 2J9GA 1KXZA 2CNLA 5BVHB 3F3YA 1F14A 2DF8A 2F2TA 3FVQA 4ME6A 5L7TA 3G5MA 5LP1A 3G7UA 2DCUA 4IJWA 3QMWA 5DMHA 2QP9X 4OX9B 3ESDA 3TCKA 5IASA 2CD9A 4AYWA 1YHYA 3NUZA 4XGRA 4DM4A 4EEKA 1QGUB 3U3MA 1N1DA 4IZHA 4N7JA 1DRJA 521PA 3BD7A 1X80B 4LPKA 4R7TA 3B9RA 1M34A 1TD1A 1V6CA 1AB5A 2HQRA 1ECCA 1GILA 1ZHHA 4HV4A 2ZIEA 5TEVA 4XVRA 2CY0A 4R4JA 4JITA 3C5HA 1N78A 2F67A 1U90A 5CM2Z 2B1QA 2RARA 3P2IA 2ID9A 5JQGB 1V1MB 3OTIA 1L4KA 4TKVA 4YQZA 3NHWA 4M89A 4CEHA 1G21B 1ZD4A 4F96A 3ZYCA 1ZZGA 2H7XA 4U39A 4RENA 4DG5A 4AJPA 1V1RA 4F3RA 1MO3A 3C45A 1RAHA 3O91A 2D3TA 4KFTA 5AW9A 1GCAA 1BCSB 3FRJA 4PBSA 1JIKA 3M89A 4Z7NB 3QWHA 3SE0A 2QJFA 2JAOA 3B52X 1C8LA 4BHTA 4L75A 4ZT2A 4PZLA 4B81A 3BQNB 3MTDA 1I3LA 4L6CA 1CXZA 2CD7A 4AY3A 2VLBA 4D42A 4KQIA 2Q62A 3KEOA 3B6EA 4N4AA 3F0TA 3M9XA 4TQGA 3CT6A 3HL0A 2KJQA 5D6NA 1WM1A 2J5XA 3ENZA 1KZ9A 3NM4A 4NP6A 4QOHA 1XVTA 3H0CA 3JYOA 5D8DA 5TS3A 1LC0A 2BJHA 2C2MA 4ALKA 1GRNA 1U7PA 4AY4A 4HEA1 4ZIRA 3I01M 1N6OA 5DVZA 1A1SA 3EGCA 3GT7A 4F45A 3C15C 3R5TA 4IMPA 5CD1A 1H6DA 1Y5MA 5EAIA 1C30B 5EINA 2J3QA 1U9IA 4RZXA 2UXCB 1DJQA 1RJGA 4FQ8A 4XRRA 4E08A 1P1JA 1RE0A 4RF3A 2NQ2C 5HIIA 1P17A 3JQGA 4IOKA 3UFBA 4U2FA 1YF3A 3PXXA 4X64B 3VAYA 5LZ7A 4Z4IA 1XQVA 1UC8A 3NEJA 1JHAA 4RA9B 2V74B 2ZT6A 3HZOA 1GOTA 4LRUA 2O07A 2C7VA 3AG5A 3L7CA 5AXAA 4H31A 2XMBA 2IYTA 5COQA 1EP3B 2PNJA 5DN6D 1Z07A 2QWXA 3F1LA 2VC2B 1Q44A 3H04A 5AUNB 1U2RA 2EZ4A 1WKCA 1WTCA 2NUAA 3HCFA 4O25A 4AT1A 4GE3A 5C1DA 4JI5B 4IJ5A 3WLEA 2J0UB 3ZZMA 4DL9A 1NA5A 2Q3CA 3H4IA 3MMSA 2ZB7A 3IS3A 3HO8A 4KN8A 1YR2A 1T43A 2CLKB 1ODJA 3A1TA 2D1FA 4MUYA 5DW0A 2GJ4A 3F7MA 4I6EA 1PJLA 1VA5A 3OF2A 3UVEA 4YRGA 2W2XA 4LDAA 1I7DA 2DKNA 3HCNA 4NYIQ 2Y66A 4P22A 4HUQA 2D1QA 3JQEA 3UK0A 3SIWA 3P2JA 3WIEA 4JI4B 1N32B 1ZFNA 1I51A 3ENQA 4Z86A 5TQJA 4D96A 1TLFA 3C3XA 421PA 1GVHA 3SQOA 3S1AA 5ABPA 4LW8A 2VSFA 4TTIA 4IZ6A 4RVGA 3WBBA 1RADA 4KU4A 4GGMX 1NLZA 1VMAA 4KQWA 3RLFA 2QUIA 1D1SA 1RYDA 2OESA 3BFKA 4KO3S 4QUBA 3GP3A 1JA9A 5J47A 1WCXA 1I2ZA 5CAEB 3RAFC 4BX9A 3A1UA 2K6GA 1SU4A 2V55B 2YJ4A 2Z3ZA 2GPSA 4V3BA 1RXCA 4ILKA 1SWWA 3GWGA 5CJPA 1ISHA 4M9RA 4X3PA 3HWX1 4RCVA 4P3KA 4GR5A 2HF2A 1RPNA 3OZWA 1A98A 2Q7DA 4B85A 2B1RA 4YAOA 3SIXA 2C78A 4ICIA 2OA0A 2Z5LA 4B4WA 3I0ZA 1XMSA 2I76A 3COYA 3TTTA 5DTQA 3G5AA 3U1TA 3IA7A 5EZ5A 4MR8A 4KITB 2GXAA 4C05A 1RWWA 3LDAA 2CLMB 4CM8A 2JFOA 3LVBA 4NS4A 1O5TA 4AUKA 5AKKA 3N2KA 1NQAO 4QNMA 1OX4B 3SG0A 4ZCPA 4PAGA 3K5HA 1MAWA 3P0JA 5MHTA 2VDWA 4ZZIA 2AGVA 1AH2A 5A4FS 2HLDA 2ZJBA 4QPNA 4X90A 1XALA 1RM0A 2O52A 3AR2A 3K1JA 2LVBA 3QKIA 4QNRA 5JY1A 5KWIA 1W4BA 3AVWA 4LV8B 2HTFA 2CLEB 1GGFA 1BVHA 1KI1A 4Z3KA 1X39A 3CNQS 2P4QA 4Q24A 5F7XA 3RS8A 4W5RA 3PX3A 1XA4A 1QTNA 5L7YA 1KMQA 3BTOA 3C4QA 3PXUA 2WZCA 2AS0A 5FWXA 1FDRA 2J41A 3RE1A 1TVKA 4A5SA 2F8TA 4UKDA 4P80A 5EE9A 3W5CA 1CJVC 2JIZA 1E59A 2B4AA 4EECA 3EDMA 4GAEA 1JHOA 5C1OA 1QQTA 1Q0ZA 2FPMA 1M74A 3ANXA 3AL0C 2FN9A 2FSGA 3G89A 3W6UA 1WW8A 1A72A 1JS1X 3EVNA 2EC5A 3LAWA 4F6CA 3C3JA 4OQFA 1WXQA 3RSZA 5KJ1A 4XDGA 1MOPA 3JQFC 3TO5A 3HHEA 4OJKA 4AFNA 1E1QA 2WPDA 3U40A 3QLVA 4HUTA 2OFPA 3KVVA 3QNUA 3U19A 4CLRB 1IUNA 5HG0A 4URFA 1OXBB 2IUTA 4NYMQ 3I5XA 3Q8XB 1ACMA 1WAMA 3DA8A 3GLTA 4ITUA 1MN6A 1XMIA 1X0XA 3DEHA 3SYRA 2EKLA 1FXUA 1IUPA 1U7UA 1A9ZA 2QYTA 4MV7A 4PQFA 4RH3A 2ZAOA 3R5JA 2GO7A 2HCRA 3ZJVA 1OAOA 2J3DA 1FFCA 5IH3A 4YJFB 4M1MA 4BPBA 1ZGCA 5CDHA 3OJEA 3RIEA 4W8GA 4BWGA 4G6ZA 2RI6A 3D7MA 2Q1SA 2XYRA 4DCOA 3AIOA 3HCEA 7REQB 5JDCA 13PKA 1QZZA 4NSNA 1Y5RA 4JCCA 1Z37A 2WU3A 4B8WA 4C08A 2FJUA 2F17A 1Y0BA 4US0R 2Q9BA 4XIIA 5KB3A 3FIUA 1NNLA 1UP6A 2W11A 4Q3KA 5E1OA 4CJXA 3GAFA 3QUBA 2HMAA 1ITZA 3OX1A 4V1CA 4TSKA 1IFXA 1Y7HA 2ZXEA 1K4MA 2OM6A 2ZU0C 5H83A 5JS1A 3N5KA 5EPEA 3K09A 3SCZA 3UW1A 1AMOA 4N54A 4YBZA 3Q9UA 2JFVA 2G1KA 2F6RA 1E8DA 1YI0A 2P7HA 2G9VA 3QU5A 1X7YB 5TPWA 5A4JA 5JTTA 3NAMA 3QUAA 3LF2A 4RZQA 4AICA 1RJFA 1GGEA 2EX1A 1QTQA 4FI3C 5J1SB 3OPNA 1WB6A 3RRBA 4MA5A 5AD1A 1D2HA 5ALLA 1P9LA 1T36A 3RTDA 2X4IA 1LXCA 3L49A 4Q3AA 2ORIA 1E4VA 3P0EA 1HLGA 1VG9B 5DGDA 2GNPA 5HQ3B 4OV6B 1QYWA 1KJZA 4K9QA 1CR4A 3K92A 1OE0A 4TV8B 4IL5A 2B8JA 4JLPA 4DUGD 1CF4A 1CSEE 1NP7A 2BCEA 4IPTA 4B40A 3EGOA 1J0CA 1UBMS 1GCIA 2NV0A 3OFJA 4OU5A 2ZATA 4BZQA 2B98A 4FYKA 5FUWA 2YWCA 2WBLC 2EJBA 5HJ7A 1ORIA 1OXMA 3TQOA 1Z0DA 2WMOB 4QEZA 4QGSA 5HQTA 2LBPA 4MWTA 3NOXA 1GUYA 4LISA 5LYJF 4RQUA 2R00C 3O03A 3E9NA 2NP6A 1VYHA 3PTAA 1TA4A 1W87A 1WEHA 3A6LA 4GG1A 4WOPA 2A0XA 3G2LA 1SH7A 5K3SA 5SZJA 3W04A 4PHFA 1JJIA 4JQOA 4FGZA 1RYZA 2FGJA 3IMGA 1H85A 5BN3B 4JYBA 1ODKA 2JGFA 4DDWA 4OG2A 2X8AA 1YB1A 2X0IA 3DL7A 4Y7CA 4GBED 3RUDA 5ITZA 5EVCA 5DNYB 4LOKA 4ZWNA 2X1MA 3VR2D 3VYTB 1HE5A 4XZ3A 4ID3A 3X3HA 2GYVA 2Q3JA 2HFKA 5AVVA 4REOA 1BMFD 2RK6A 5K3FA 5K0GA 2BZGA 5ICFA 4QM7A 1O6BA 5CCEA 3DOOA 2C1ZA 1HDOA 2IHTA 1R8QA 3DE7X 3DHVA 2NQTA 3NWBA 3Q5DA 1WVGA 4WLVA 4BQIA 3ORHA 2JD2A 4E3WA 2WIAA 1UK7A 1HLPA 1M6WA 2CBZA 3BK2A 3WYAA 2O8CB 4ZI7F 2J9FB 3DD1A 1S9DA 3JZMA 2I67A 1NBOA 2IHZA 4WNCA 2QE7A 1VMEA 3EZ9A 3I01A 2P6NA 3P4UA 4RLFA 2DB3A 2Q1WA 3O4HA 4U8GA 4EB6A 4X8HA 1JWAB 2X8WA 4RLSA 1Q77A 1VIAA 2A9OA 3P4YA 5EHNA 5G3ZA 4K3UA 5B4VA 1XZGA 5LNK1 1YBVA 3PQ4A 2R87A 4Q9DA 3W5DA 1O0BA 1FTGA 3EUFA 4QHYA 3QPCA 4K5QA 3VR1A 1WCIA 2DJIA 2CUZA 1YBAA 2QQ5A 4GC9A 4PLGA 2JVIA 3ONEA 4XYEA 3C3WA 5PGMA 3NOQA 3T1TA 3OQNA 2C4NA 4CMCA 4WWHA 3K2EA 5A6VA 1CJKC 1CZOA 4B6EA 1BHSA 3ELYA 4EI8A 4BLQA 1C4XA 1VZ3A 4CQMB 3HL4A 2D0DA 4XX0A 4BFYA 2B5VA 4KZKA 4TLCA 3F4LA 4ZVKA 1XZEA 1IY2A 1V47A 2I1VB 5EIFA 3HA5A 4DNQA 1WDTA 4E32A 4IDGA 3MTEA 5FCDA 1ZKDA 1ZW6A 3DB2A 5IBQA 4LVUA 1DBWA 2WKRA 1FDVA 3ESBA 3OJCA 4DZRA 3WGOA 4E21A 1ZWLA 2A9QA 1ZGJA 4MK4A 1GPDG 5TLSA 3STTA 2PD6A 3VKVA 4HR7A 2FFRA 1REQB 3OWOA 3E48A 4W1PA 3G02A 4DXHA 5EJ9A 3KV1A 1L7RA 2I87A 3PUVA 2G07A 4X95A 6CHYA 2Q0SA 1CUIA 2QBYB 3TLYA 5JW6A 2I4IA 1F5SA 3NHMA 4TWJA 2YV1A 1QYCA 2A33A 3E5NA 3EZ7A 5M5BA 4MQ6A 3EY4A 1XMXA 2OZVA 3VC3A 1AG9A 2AD5A 1I36A 1Z2NX 3AHEA 4KMMA 4YRDA 1MRZA 1ODLA 1T0UA 1U1GA 2DY1A 3WYBA 3CH5A 4R8VA 3N6VA 4YUWA 3KDPA 5DNCA 4EKEA 1TFUA 2OILA 2VZEA 3IP9A 3OA2A 3QX9A 3WKDA 2BMWA 5KTYA 3GFGA 1N5JA 2HTEA 1CQJA 1CRPA 3UJAA 3JZDA 2J3JA 2BKAA 2VAMA 3BK1A 4M7OA 4EY8A 3FDJA 3LOUA 5KPJA 1PVOA 1MFPA 2WFAA 5KJCA 3Q85A 3ZKWB 4O02B 5IVIA 3S70A 4DQ0A 1XJCA 2XTJA 5DHUA 1LUAA 4TXNA 4KW7A 3FWNA 1JSCA 3L7OA 4WMLA 5SZIA 1BVRA 4I19A 4UEWA 1R5BA 2QLNA 5D3KA 3CH4B 2NVBA 1U2SA 4IBOA 4LYAA 4Y9TA 1P4JA 4XUCA 5ESDA 5F7ZA 1RHJA 1YZGA 2GNOA 2ZJ7A 4HXFB 3TUZC 1IMJA 1SO8A 1VXRA 3QEMA 3KR1A 1MRNA 3CC8A 3HM2A 2ANBA 1D4ZA 1Y5NA 3N7UA 1OV6A 3GLIE 2Q5FA 3I3SR 2HK6A 2FF5A 5IVKA 1CHDA 4A0QA 3MGBA 4E5VA 2I7VA 1U5AA 2VP3A 3GIWA 3R40A 2AN4A 5DH9A 2W2TA 1PGNA 3D5QA 3LY9A 1L7QA 4LXQA 3FNBA 3ETHA 3PUIA 1JXAA 3LRPA 4K1LA 3O1IC 1KE2A 1ECPA 3ZUPA 4AO7A 5I8ZA 4EPWA 5JR3A 3K9GA 4ACAA 2VPWA 3EQ6A 4B3XA 4ER6A 3UICA 1EVQA 3CLTD 4BNNA 1BDHA 3MRVA 3UFXA 2HSGA 5JRZA 1DRUA 5AVQA 1UL1X 1ZK4A 2RFLA 3IKMB 4UCQA 4W99A 1YT5A 5TMBA 3B53X 2D8AA 2KB0A 4GWGA 3D6UA 4A82A 5D1NA 5TF4A 3SMVA 4B7AA 1R74A 3RWBA 4IDCA 4IDOA 3TIXB 2B37A 2J9ZB 3PENA 2L18A 3QVJA 1O03A 4KVGA 4XXHA 2WE8A 3RRXA 1XNRB 4IIHA 4MKGA 3TRKA 1EGMB 3BH0A 1SC9A 1UKVY 2H1VA 1FMTA 3C7AA 4AXBA 3DWGA 4S12A 4E4RA 2WMNB 5GY7A 3BJIC 1XTRA 2X6RA 2ODBA 3GCDA 4RKFA 4D97A 2CUKA 4WVFA 1WXXA 4JJ4A 1SXJC 4GLOA 4LJ6A 2VUHB 3ND9A 4MGHA 5KYUB 4DLUA 1YA6A 2EZ8A 2OLKA 4WH0A 2YN2A 3OECA 5BN4A 5CFNA 3EA5A 4A15A 6ADHA 2EF1A 3A6EA 3B1FA 2E49A 4L0CA 4JXZA 4YRNA 3FYSA 4UAVA 3SX0A 4TM7A 2H9AA 3E5RA 4NXNB 3HLTA 2CN1A 4WFKA 4CCWA 2YFQA 3EB9A 1CJBA 3F9CA 4Y7DA 3DTTA 5F76A 3ZH2A 2GRUA 5KSOA 1J07A 1T4MA 1SB8A 3I9V1 4QYIA 4DLSA 5EJ5A 3ZU4A 1XXHB 2G04A 3HFRA 3B1KA 1QNLA 3L93A 1GV1A 1W36B 1XKTA 4EI2A 4MUBA 2OTCA 2CVPA 2IV3A 3VPGA 4PTLA 1ZN2A 2W2PA 1N5IA 2L19A 5E2BA 3VJKA 2GWRA 5LMZA 1FZQA 2Q6VA 4EYKA 1O94A 5DRYA 2QG9A 1AU9A 4HY3A 5H0IA 4DPMA 4AY2A 3KAPA 4WLEA 5G0TA 4YC7A 5JMWA 3KSUA 4NPAA 4R3UC 5AOCA 3TGWA 2DPXA 3WHKA 3PQFA 3VH4A 2G25A 1F06A 5IC5A 3KWMA 2WWYA 3FHTA 2B7LA 3HVRA 1GZSA 2PQ6A 2ZRCA 1IUKA 3JQ9C 2P9FA 3BOSA 1X1BA 1KI2A 5DISB 3ETEA 3K9BA 2V8OA 2E48A 1EFTA 1I4DD 2QPOA 2H4FA 3AY0A 2I2BA 4EJSA 2CJFA 1IC6A 3W5SA 1QC5A 3W8FA 3HTXA 3FSJX 1DCKA 1OFUA 2VNIA 4X1IB 1LEHA 1U28C 4QUHA 2C0QA 4ZFNA 4D45A 4MKIA 2AJLI 1IAQA 1H1LA 5EWMA 3TNLA 4D2IA 4K26A 1ZP6A 3FNQA 1GZVA 1BRMA 1ENYA 4DNOA 4I5FA 4R8RA 1T0BA 5HUQA 1K9VF 1YOVB 1W75A 4KPGA 3RS0A 3SJCA 3TUIC 1PFKA 2Q8PA 2CMKA 2EG9A 5GONB 1YJ8A 4QPPA 3VYWA 4LC1A 3G2PA 5E38A 3BZWA 3W7AA 2DEUA 1J5PA 3GZNB 5HVNA 3FDZB 4KDEA 4OXIA 1R10A 1RJWA 1C0IA 1YJQA 2XYPA 2XXBA 3REOA 2IH5A 1JYFA 3CLSD 3Q88A 2GN1A 3ZHYA 1U3UA 3VR5H 2QSJA 1QV9A 3T0IA 3MELA 1B7GO 5EMJA 5AW5A 5JMPA 1N6PA 1SBHA 4V0OA 4ER0A 1LS6A 2GD6A 4NNJA 5KWVA 1WQ4A 1X87A 2V4UA 3SQXA 2Z4RA 1A95A 1QHYA 4I3GA 4ZEVA 5A4KA 4WI1A 1N5KA 2JGLA 1YVUA 2A2ZA 1D2GA 5I7HA 3PQDA 1UEJA 1FXSA 3DP7A 1FP6A 3VNVA 1QPBA 1NQTA 1RWKA 3OQ6A 2Y2VA 1VCOA 4ETIA 2GEJA 3QY0A 4H59A 3WLNA 3X1WA 4XIYA 1US8A 5JS7A 3G8CA 2BSQA 4JBLA 1W0JD 2PL3A 2WV7A 4U5QA 1H9AA 4RTNA 2HV8A 3EDCA 3F1KA 4LEIA 4A36A 1P1FA 3F8WA 2WF6A 4J7UA 3JCZA 3LX4A 2FW8A 4LS3A 4ZVNA 4E94A 9GPBA 2BL4A 1X8XA 4Q00A 2IU3A 1ORRA 2XB9A 4H7FA 1LF0A 3GPIA 2QL6A 2EW8A 5E2IA 3TEJA 4Q4CA 1NVEA 1G21E 4BLTA 3EVBA 3MS7A 4BIMA 4D1YA 5KNBA 4DR3B 5A5GA 2YWRA 5DIZA 3WA6A 3QG1A 1VE3A 2A0FA 3DBIA 3HXTA 4H27A 1T8SA 2CCKA 2O4UX 4BFXA 3HRHA 1NOKA 3NW9A 3EW9A 1KI7A 4FFRA 3DXXA 4AY5A 2XLBA 1EQUA 1YE8A 2HRRA 4U7TB 2BBOA 2OO5C 1I6KA 3N8NA 5FHRA 1H1TA 1B2RA 2O8EA 4PRZA 5C8YB 1SVKA 2C77A 2HQOA 2YQ5A 2ZREA 2EJUA 1YIOA 3B1XA 4U0JA 5H59A 1CDOA 4LRXA 1SHKA 5G02A 5CA0B 2B1JA 1ZISA 4YK7A 4I66A 5JECA 3TTYA 3VH3A 1O96A 6AT1A 3C3CA 4TUYB 1DL5A 4JUAA 3SF8A 3AZOA 3HKBA 4UHFA 4ZXFA 3WGGA 4NYMR 3WY9A 1KI9A 3VAZA 4BQEA 1NZFA 4QBGB 1GARA 4DBLE 3LPAA 2C7OA 4U02A 1L5OA 1QH1B 4N6OA 4Z0PA 2QN3A 3EIEA 4MQEB 5SY9A 3T9FA 4Q21A 3FMFA 5DNWA 1N3YA 3DYIA 1YA8A 4XCQA 1HNZB 3L0PA 3UT6A 1X8LA 3OIUA 5EJ8A 3QE3A 3PFCA 1JHMA 2QX4A 4KPYA 3PEEA 1TIKA 2PT5A 1WHTA 3D31A 2A5LA 1ZWKA 3FWKA 4ETWA 2FW1A 4TV9B 1EWQA 5J1TB 4W5WA 2A7QA 2D06A 5H5JA 4F71A 3DCJA 3HXOA 3RM3A 1KOGA 2O3RA 2B5OA 1EFHA 4KXQA 1UKEA 3M6FA 3WYDA 3W8DA 2KHZA 4ZDJA 1MW8X 3AL3A 1XF1A 2VRNA 2VPTA 2OZEA 4YP6A 2AXPA 2ZI9A 4COOA 2FPGA 4RZ3A 4A9AA 1KJQA 2JJMA 1JEYA 1H22A 3UCXA 1M33A 2IUSA 2GYYA 4RIEA 2Q46A 3A26A 1I9GA 3EEQA 3GLVA 3KKMA 1CY2A 2VHXA 4FFNA 1MF7A 2PQ2A 4D3FA 4F6RA 1XTBA 5CNJA 1QFJA 4KTTE 4NZZA 4R84A 1RABA 2WD7A 1DC8A 2I80A 3D02A 2VQ3A 3L1HA 4TYWA 1KI8A 3SLGA 2NV2B 4UJ3A 1XCMA 4UMFA 3ZCUA 3RFTA 3QVWA 2IT1A 4JASB 1IZ8A 1QDUA 2W71A 3ZVLA 3THXB 1HT1E 1IYZA 3DZCA 1YIAA 5CB0A 4KXFB 5AIAA 5CX1A 1TKRA 1WSWA 2W2LA 5K3DA 3B2EA 4P54A 3OM9A 3ZOZA 3ZWNA 2NUPB 1JHPA 5AW6A 5ICGA 1SBIA 2ZS8A 1ZMXA 5F5NA 1JMYA 4Q7KA 3PJDA 4AAYA 1ZIXA 4IP0A 3OZSA 4BRWA 5NULA 3UXHA 5IDXA 3MQFA 2AYYA 1RRMA 3IIKA 3SXUB 5BW4A 3AKYA 3B3GA 4PLWA 4MLZA 3BTVA 5FP0A 3PQ3A 1BJTA 1A9OA 1NW6A 3RVDA 2K7ZA 4IF6A 3LGSA 2F59A 3SP1A 3SNHA 4D56A 2ZSUA 1NOIA 4M53A 2B82A 4RESA 2IU6A 4QLOA 3W9UA 1V71A 3CUYA 3KU1A 3MXOA 2QN6A 4BRZA 1UBTS 1T34A 1QYXA 3PWZA 1X7WA 1J1IA 1U6IA 1WW2A 3EPRA 4GPTA 4LHEA 2CNWD 4X00A 3WSTA 4BLPA 2R6CA 4Z5XA 1MGPA 4O4IB 3AW8A 4JNKA 3KDSE 3LOQA 4V3CA 4Y98A 1JDZA 2FPOA 3S81A 3PX2A 1BE1A 1U0HC 2ZVPX 5H4HA 3WMEA 2NO4A 5LQNA 5B6JA 2PT9A 1YL7A 4X41A 4TYMA 5LDGA 4EMUA 4MW0A 4MV8A 3WOHA 3W2TA 1OLSA 1C7JA 4NU5A 1GYQA 5DNAA 5DASA 4KE6A 1Z3IX 2JLWA 2C2XA 1ONOA 1M2GA 2OUIA 1JKJA 3L7DA 1FVXA 2AC2A 4MV9A 4TS1A 1W94A 3QKSA 2C4WA 4MA0A 1N2JA 4MRMB 2J9YB 3UG6A 2P62A 4YRLA 3USES 1LF5A 1EZ1A 2XMZA 2Y92A 1I2AA 4YLYA 2GTHA 4GQIA 1DG9A 1OXKB 3W1VA 2HF9A 4Z8XA 4EHIA 2GILA 1OOEA 2NTNA 2Y05A 4LPSA 4NENB 4KMOA 4BCDA 1LJ8A 1ZJ4A 3FVWA 3TW8B 4KXXA 3R09A 4Q66C 4BX3A 4S35A 1YS9A 2DWQA 4IX1A 2XB4A 4CM6A 3IEPA 5DBOA 3GLGA 3FLEA 3H83A 4W1RA 5REQA 3KHTA 4KAXA 3TJZA 3ZHBA 4BN0A 5IKEA 2XVAA 4H08A 3RIGA 1NJ1A 2HM7A 2KQUA 3H8SA 3LXXA 4UHJA 5GJWC 3KB6A 1X1SA 5HKKA 4EQ6A 2QS9A 3G1UA 4EHBA 3BBPA 4MYHA 3P5SA 2JFQA 5GZ1A 2VN8A 1B8PA 3B7GA 3M83A 3II6X 4Q15A 4DM7A 4LRWA 1R9MA 3KZXA 5SZKB 2FFHA 1DKUA 4RGYA 4BN4A 4W5TA 4XEUA 4P4UA 1LH0A 4KO2S 3R6GA 3V46A 5E9QA 2R6DA 5IANA 1CQIA 1WCWA 1Y6JA 4PG7A 3WLRA 4EHLA 5L3RA 3PIRA 1GGHA 2M6SA 3VPHA 2NO0A 2ZKIA 3IR6A 2WNIA 1M6EX 3NM6B 2BEWA 3KG2A 3M34A 1PTKA 1NI5A 4LZPA 4LC0A 3IDOA 3FPAA 2KLHA 3E3MA 3Q3CA 4OYRA 4RDIA 2H1LA 1G66A 2IDMA 4GRDA 1MORA 3HZZA 1YBHA 4FEAA 4OMCA 2SICE 5IMBA 4B73A 3NC0C 1QHHB 1DBRA 2ZPAA 4JQZA 2A57A 1RPAA 1SQFA 2H17A 2PEZA 1ETHA 4EP1A 3ZD6A 3N8IA 4JDPA 4UU7A 2DLCX 3I2KA 2BKEA 5B1EA 2HW8A 3KLBA 1E9AA 1MBZA 4JGBA 3PPWA 1W88A 1GY8A 1MX3A 4FFLA 4PC7A 1XMQB 2PQMA 5A9TA 3COSA 2VK2A 3TZKA 2RKBA 4NCJA 1I7SB 3FYUB 1NSTA 1SUIA 1MX5A 2HIMA 3ODPA 1SQGA 3CLSC 4XSVA 3C5VA 3DEZA 3UYKA 1JSLA 2AHRA 2OGSA 4YJ2A 1ZSNA 2DQ4A 4XJSA 1RP7A 4TX1A 4DPLA 2JLZA 1UXKA 1UEIA 2DHDA 1ENPA 3DJYA 2YIMA 4RPJA 1WX1A 4BGVA 5LZ9A 1ZGBA 1KF0A 2BDTA 4YV7A 2IZ5A 4B80A 1MAVA 2FE4A 1LTKA 4JNCA 2WOOA 1G3UA 1VCHA 2PLNA 2QXYA 3E03A 5DIFA 5IDVA 3OA0A 5K9ZA 1OXVA 4DR6B 5BV7A 5F9HA 1QVZA 5LA6A 3BXPA 3KOZA 4KOEC 3E9EA 1JR3D 3GXBA 3G2KA 4I1VA 1ML4A 3EBOA 1GADO 1N2IA 1P5JA 5F78A 1O77A 3R9KA 5G1PA 5K0BA 1VI2A 1JZTA 4LY0A 3IMFA 3U0BA 1KNXA 3D3JA 4ZCIA 1OWMA 3BXEA 3G0DA 2P4SA 4M0PA 2H07A 4B4DA 1R8JA 1H2ZA 2ZDQA 3A1CA 3QXGA 1T9BA 2HWKA 4LZOA 5FLKA 3REFA 1QO9A 1GG8A 5J43A 3RGWS 1N25A 2QNIA 2IW3A 5F12A 3ZQ4A 3JQAA 5EE5B 1UBEA 5FF9A 3RVOA 4A8HA 2IYUA 2QVBA 5JAIA 1YFLA 4Z7QB 5GZ6A 2VH5R 3A4NA 4HEQA 4U2CA 1ZHOA 1QIFA 4LY9A 1JAHA 3IHTA 1SKAA 5JAPA 1FTQA 5AJVB 4D9NA 3JR3A 1FU7A 5EXDA 3Q7PA 4GSLA 1Q1BA 1X1EA 3FMPB 2NO6A 1KEKA 2GTPA 1H9CA 2Q2NA 4UBLA 1Q7BA 1KFCB 2EP8A 2NACA 3AUJB 3M4NA 4XM1A 4B74A 2WJAA 3B85A 1PWHA 3FMIA 4NV3A 4JX9A 3T1NA 3R9XB 1FY2A 1NR1A 2ZSFA 4JKOA 5BNTA 4MKZA 4IDDA 4CKCB 1G5PA 3KPJA 1V35A 1YZKA 1U0RA 1AS2A 3V4SA 5AM2A 1ZVVA 1D04A 4R05A 2XMCA 3NBYC 1B15A 2QJTA 5BVHA 2O6LA 1KK1A 1QV6A 2NNWB 3EA4A 1IXSB 4NCKA 2PBLA 1G3RA 1JZSA 2OFWA 3FPHA 3SC2B 5JADA 1ONPA 4JBWA 3C6KA 2B0CA 1PGQA 1QGUA 1T8RA 2W0MA 2P79A 4WACA 5DYYA 1KAGA 1YS2X 1X80A 5JCXA 2Y67A 4L9WA 3SC3A 3GBPA 1R6BX 1T5IA 4QQFA 3WL7A 3DPSA 1LC3A 4N0EA 1KO7A 2VTVA 1IB6A 2VYVD 3LW7A 1NUAA 5HJ2A 1DRKA 3RNLA 1HDZA 1P18A 1AUVA 2WVGA 3LW8A 3PQEA 2VHZA 3PTZA 3R7SA 5B36A 4DAOA 1DOZA 4JYMA 5A05A 4HYQA 3THRA 5JQGA 1V1MA 1RKQA 1YB4A 5E1MA 4OXKA 2WKSA 1NN3A 2A8YA 1G21A 4Y8VA 3ZX4A 2PS1A 4G2TA 2PGIA 4Q7LA 5D7NA 1WUHS 3UB2A 3VTZA 1NVAA 1FDIA 5LIPA 4QQKA 1II9A 2XUQA 3T06B 1UBGA 3PUWA 3I52A 1QHFA 3EOAI 1DKMA 2XYHA 4HP8A 4DC9A 3UEOA 2AX3A 1ZYUA 3KSMA 3DFUA 5TMDA 3WA7A 2C5GA 3ESYA 1FX1A 2QGFA 2F1RA 1G7TA 1XZLA 3OE5A 4G8DA 5CDUA 3IE2A 4G85A 3EEIA 3UKJA 3TGPA 3RGGA 1FNBA 1VM6A 1IZZA 2DFLA 1UFRA 2QY6A 2F90A 2WWIA 3CUEF 1N8KA 3I6ZA 3QLTA 1FSFA 2RGBA 1P3Y1 3H6KA 5KYGA 3ECCA 4PNEA 2QRKA 4QPCA 4IWXA 4BFWA 2OBNA 3GMSA 2C8JA 1Z34A 5MGBA 4DCUA 1AKYA 3IAXA 1W6RA 3JQBC 1UZNA 4WERA 3AR4A 5A62A 1VL1A 1VHWA 1JH8A 1VIYA 3FZEA 1NP6A 5AIBA 3QXSA 1MENA 1ZHFA 2E37A 1C30A 4DZTA 4RVCA 3SSOA 1PJQA 2OG1A 1IHUA 1NXTA 3K1TA 3OURA 1I6MA 1VGQA 2BGJA 1HFKA 5AXCA 5B4UA 1HDIA 3ABRB 4OSEA 1P4SA 3AUTA 1K97A 2O2JA 4RPKA 1T5LA 4IS3A 1OXUA 1NOJA 2WWWA 3P9XA 3S2FA 3HYNA 4UUOA 2DY0A 2JDID 2QR5A 2YUIA 4AJ4A 3PE3A 2ZZKA 2Z98A 3FETA 4JU8A 3JRNA 1FFDA 4IFIA 2G06A 3CR3C 1R0WA 3F7OA 2P5UA 3ICCA 3D7SA 5I7AA 5C8XA 1ND5A 2CFCA 1DIRA 2XCUA 4I2VA 3NIWA 4YEDA 1Z39A 1RWQA 2ZWVA 2OECA 4QSHA 4DSNA 4H1UA 3TMKA 1OKKA 4DQVA 4Z54A 2JJ2D 1QMPA 4CG2A 2BFDB 4PW0A 3DAYA 4EKYA 4M55A 2J0UA 2W6NA 1PZXA 4L5BA 4GGOA 2JGJA 1G60A 3BGVA 3DCNA 4NG4A 5I47A 1DXYA 1YR7A 2FG7C 5F64A 2QV7A 2G1PA 2J67A 1Y63A 4GWLA 4AP9A 5EHQA 3B8HA 4QDOA 4MV1A 4D74A 2C9MA 1HSOA 1S8NA 1CUFA 4F72A 2ZAIA 3KEFA 5IAOA 1SG0A 2GK7A 3RRJA 5C81A 2GARA 2QN9A 3OESA 1J5EB 3C7DB 2WW8A 1G20B 3D8RA 2VZ9A 3U7QB 5COAA 3DLCA 3JQQA 3AUAA 2OUKA 3TRIA 2UUOA 3AV3A 1Q0TA 4KSCA 1OC4A 2I66A 5BRJA 4G0OA 1WLSA 4W6QA 4J0IA 1GLNA 4ENQA 2A6PA 1CX9B 3TFOA 1NVGA 2PMCA 4DC1A 4EG5A 2HBRA 1GTMA 2AEFA 3N39C 1K7SN 1ADJA 4YASA 3OU2A 3B36A 4CE6A 4D92A 2O1WA 1SXQA 1XNHA 3RYFB 5JYBA 2WSIA 4K1XA 4B43A 1RCFA 1SCNE 1IPFA 1U2GA 2A9PA 3FB1A 3RTAA 2ALJA 1JDJA 2V0NA 1CUCA 3G9ZA 2IELA 3R3SA 2WU0A 1SXJB 3ROQA 4QHSA 4LSGA 2XE4A 1A9PA 1WO8A 4ZOBA 2EARA 5AQEA 3U16A 1KOJA 1NYTA 1EYZA 3Q12A 4BKQA 1A04A 1WB4A 3TL2A 2WSLA 1XXHE 1O95D 4U00A 3H4TA 2XWBF 3AI7A 3C7CB 4MEJA 1SXIA 1OX4A 2EFCB 3GB9A 3JSAA 4C7VA 2OQRA 2Y77A 3IODA 4GKBA 1YRAA 3E7XA 5DLQC 3DDUA 7YASA 3B9QA 1SC1A 4RJKA 5CMLA 3PHHA 1BE8A 1GSHA 1MOSA 1RHKA 1B42A 2JD1A 3A1VA 4IW3B 5CVVA 1IMOA 1X14A 2Z1DA 1A9QA 3OPYB 3RIYA 2C5LA 4S3MA 1P4RA 3FE2A 3IP7A 1C9MA 2WOJA 4S0ZA 1JHUA 5HS6A 3UT0A 3ZI7A 1P0PA 4AN4A 2CE2X 4AZWA 3FVRA 1JH9A 1BMDA 2BFOA 1Q20A 1Z6AA 2ADMA 3A1SA 3GY0A 1F4PA 2H0RA 3QPBA 3IUNA 5DHAA 4M76B 3KQLA 1N1GA 1KAQA 1GR0A 4N7RA 3CCBA 3F4KA 4O4LB 5M29A 1TLTA 1LRJA 3RC3A 3G2JA 1V3TA 3NBKA 3ZZTA 3L7NA 3WICA 3V1NA 1TRHA 2HJRA 2Y0DA 4JLVA 4KDRA 4Y6OA 5F2NA 2JHAA 3L6DA 5I5GA 5HZMA 1SZCA 4AD8A 1ZK3A 4CR8A 2IEIA 4RTSA 2FPKA 3VGJA 4G9EA 1VE7A 4EEZA 4FHZA 2WSBA 3KEQA 4WLUA 3ET4A 3THSA 4BQNA 4D98A 3M1IA 1O97C 2Q3MA 4QEDA 1FNMA 3RADC 3O1LA 1P2SA 2TMDA 2YS7A 3DHNA 3MW8A 5KNDD 2W00A 4OHVA 2NZVG 3GXOA 2AMFA 1W4LA 3I4LA 2X8LA 1XQ6A 4E7OA 2IS1A 3LQFA 1QO0D 1AUPA 3AFNA 4MHOA 5FI5A 1X9HA 5KTNA 4H1TA 4MARA 1MJGM 4TWAA 4LJ9A 3DD5A 1ULZA 5DGXA 2HJHA 1W73A 1XN1A 1C4OA 1Q1QA 4OIMA 3K32A 3NJ8A 3O47A 4NBNA 1KS9A 3E15A 3UW3A 1BJRE 2DH5A 1RWPA 3EQZA 5EEGA 2O8FB 2D3WA 4I9GA 2DBRA 1FOEB 2QI9C 4FFPA 1WF3A 4JC0A 3SZUA 3L4BC 3RTGA 3X1XA 4BJ6A 3IQEA 2YMQA 2RHRA 3PIDA 4OHPA 4S1TA 4YJFA 3JV7A 2NTYC 4LSWA 4X61A 4BVHA 2OBLA 5C80A 5AVZA 3JD3A 1E5TA 3ZHUA 4YP5A 4CUZA 8AT1A 3WSVA 1U8YA 2PE5A 3U4QB 7REQA 5JZ9A 3A4IA 1VPTA 5AHKA 2G6BA 3GBVA 2XUJA 1P72A 3R6TA 2A88A 4MPTA 1I13A 2AOWA 3KSRA 1TMYA 4KO4S 4MUEA 1IM2A 3GZJA 1TDJA 1M67A 3AF5A 5KIAA 3U4GA 4JI7B 2Y27A 3K8QA 4YRBA 1NLYA 3IUMA 3MN1A 4MUJA 4E2WA 4EPYA 2HMVA 4KDFA 5GVRA 1NW9B 2YZNA 3QHQA 4ZCQA 3PXCX 2QAGB 2X5XA 4G4JA 4BVBA 3WKEA 1A8HA 4TROA 2ZJ2A 4FXPA 4F86A 5ITZB 1NTOA 1LS1A 1RIFA 4NDZA 1CE8B 2CCJA 3U9SA 2CF6A 3C1TA 1TPZA 1X38A 4ZO8A 1AO3A 1X7YA 3GLFB 1TJ5A 1JHYA 2Q5JA 3D4LA 1DELA 4UD2A 4ZEXA 1PJ3A 5G0SA 4B3RB 4R6WA 2I3DA 2DCMA 4R2HA 2FSUA 2NZ2A 1MHPA 4PM4A 3ACDA 5JJ5A 2EIHA 2LKCA 4LRTB 2CMFA 3U2QA 2PUGA 3PEWA 1HNNA 4ND3A 5FRDA 1F7VA 1DLJA 3CY6A 3UH0A 3WLMA 4II3A 4P7FA 5HQ3A 3R3YA 3OMXA 4ZJZA 3OQMA 1N92A 1ND6A 4GPIB 1Z06A 2XZDA 4HO1X 4FJ2A 4NJMB 3C8HA 2K2WA 4TV8A 3SLKA 4AMYA 3O8QA 4QOIA 3VR4D 5EIHA 2W2KB 5ER6A 4NV0A 5HF6A 5F3DA 2JLUA 4G4SP 2BKXA 4FMCB 1MUUA 1XTSA 1RM3A 2XDWA 4PZ9A 4TRJA 2DTXA 2DT8A 2YWEA 2D2XA 3H6GA 3IP6A 3BL8A 4RXTA 1E6KA 2ZBDA 4QVKA 1KAHA 2QAJA 5LA6F 4U7FA 4F2DA 2P67A 4HQRA 5ALNA 4EW6A 2CXRA 1YV9A 2IEYA 5H4GA 5DTEA 2QSZA 4LJRA 4AX4A 1ZVJA 2RGWA 5KYKA 3ISVA 3S0JA 3CBQA 5JPDA 3U7FB 3N5CA 4ZQGA 2YMPA 3W5IA 3T3MB 1AQUA 4HH4A 4DV0B 4IJUA 2ZLBA 3IPCA 2QDXA 5BN3A 1G2IA 3E22B 5LD2C 4JI2B 2UVQA 2GLTA 4BMSA 4OBXA 2ZRIA 5A3RA 3SYLA 1F6WA 3KR2A 1MO4A 4JR0A 1WNFA 4LWOA 5IK2D 5KYYB 1CHNA 1SHLA 3CE6A 5JE8A 4LCBA 3H5OA 2Q7XA 4M88A 2GCNA 3L7KA 3FPFA 3VH2A 5JV5A 3GWZA 4FKMA 2V6FA 1SIBE 3PV0A 5FI3A 1XZDA 3K0FB 1PD1A 2A94A 3L84A 1PR0A 4GH5A 4KQXA 1SRQA 2V0GA 2B2CA 2WZBA 3HMKA 1ZRMA 4F8JA 3IAS6 2GM9A 3I72A 2J7KA 2V4ZA 1O9BA 2I9KA 2O8CA 2J9FA 2Y99A 3IMCA 3LY5A 2GLUA 4F5ZA 1TKAA 2JI7A 1R4MB 2IEDA 2I8LA 1DFIA 2ZJZA 3OD1A 2OHFA 2Y2UA 1C7RA 1XKXA 5TB5A 3SFTA 2KSQA 4F93B 5CIYA 1VXOA 4U63A 5DZSA 3PUHA 2PSJA 1LBTA 2G7ZA 1G1AA 2VUSA 3BIFA 3QWFA 4JLAA 4RSHA 3VUFA 2C5AA 4IDPA 1BX3A 2ATIA 1NUPA 1F4VA 1CC1S 1YHNA 5BORA 4N8DA 1JR6A 2UUAB 4E6EA 2P0EA 4KIJA 3U3RA 3GP5A 2QZPA 4IO0A 2A9FA 4ZCSA 5BNFA 1RCTE 4CDGA 1YQTA 1DG3A 1N6RA 4CQMA 2Z9DA 3KRTA 4BMNA 4NFYA 2O48X 3O8DA 3KQNA 4N0DA 2WJ4A 2LNDA 2VCEA 3LX8A 4XB6B 4JQCA 1CWUA 5JBNA 3DKKA 1QR6A 1UANA 2F1IA 3ETDA 3PXDA 3OMLA 1S89A 2PMFA 2AOXA 1SUEA 1Y9ZA 1A9YA 5E8RA 5AOBA 4JLKA 5ENVA 5EI5A 4P0QB 4FFWA 1REQA 3TSCA 4UTXA 2OYCA 4BBJA 5T4EA 1E77A 4U8HA 2FQXA 1YB6A 3ABZA 3HDQA 2WFZA 4K9PA 3QBVA 5A7GA 1A7UA 4MQBA 1WPQA 2V3VA 2N9UA 3GJ8A 3PGJA 1SC6A 4H60A 4XAQA 5EZSA 2QBYA 2RGRA 5JRDS 1JEJA 1TQHA 4IGKA 2P40A 3NRBA 4EL5A 1ZD1A 2JJ1D 4IG9A 4WOKA 3MJCA 1OB5A 3GK3A 1YNSA 3AJ8A 4GQAA 4R1TA 2Q4RA 4RH0A 1V8BA 4MCJA 3GUHA 2PVCA 3JYPA 3KQPA 4MKRA 1YE3A 4UZEA 4A7PA 1K5PA 2IGBA 4DIBA 4G0VA 3EJWA 4IMIB 1RCUA 2PZKA 1U0GA 1UQRA 2GO1A 2WWGA 3EAQA 1C3LA 3KPYA 3VNSA 4DG8A 1NIPA 3L0ZA 4E70A 1IXZA 1TM5E 2WVJA 5AKGA 3DTVA 4UW9A 4Q18A 2O59A 4J0DA 4AZSA 3H65A 2FSVA 1WKVA 1M2FA 4XD7D 2W6PA 5IKPA 4OFBA 3AR6A 1ECJA 4CF5A 4URZR 2Y71A 3AHJA 3UANA 1NF8A 2J3MA 3D0RA 5BW6B 1OVMA 4V0ME 1RMQA 4CF3A 3U09A 3CURA 2O7VA 1LPNA 1Z5VA 3HJRA 3OM8A 5DWVA 5EP4A 1XV5A 1SCKA 3ROZA 1SBQA 3W3ZB 4A8JC 3UN1A 1DKNA 1NM5A 2KS6A 1H8HA 2XADA 5G3YA 4A0HA 1HE4A 2B3TA 1GZDA 3BE5A 1DOAA 1UOOA 1RQ2A 1W47A 2XCQA 3HVKA 3LM8A 2ZB3A 3N74A 3ILVA 3RF6A 3RYHB 4IKOA 3VBCA 4PFKA 1QWSA 3IDQA 3PUXA 3ORSA 4EA6A 3WGLA 2GR9A 3DEKA 2OXFA 5FI1B 4IYJA 4JLMA 3QPWA 4ZI2A 2IYFA 3KPVA 4AYTA 1R8SA 2ZYWX 1Z36A 3H1PA 1KDYA 2Q7OE 3D43A 2CFIA 3FTEA 5H3HA 4LZWA 1F3LA 1U3FA 2FOIA 3A9WA 3EHDA 3NYRA 5IXYA 3KLOA 1LDBA 3NVKI 5AVSA 2PRYA 2UZ0A 3W7VA 4MS3B 3UMMA 3WQBA 3MTIA 5L4LA 3LHFA 2RGGA 4CTMA 1L4FA 4CDMA 3OG9A 5IZCA 1HBJA 1GCOA 5TVGA 1L7XA 4GXQA 3N6XA 2XRZA 4EFNA 5KTMA 1PZFA 2VDKB 4TLBA 3U4IA 4KBFA 4YUZA 1FP4B 3HP1A 2I4LA 1S96A 2JKYA 1DKOA 3HP4A 1V7QA 4PZPA 3T7EA 5BYKA 2MSEB 1K98A 2WJYA 4X9XA 1J49A 4FONA 5KAPA 3CNNA 3RWOA 3ZHTA 5KYUA 5FOXA 1Y1LA 4B3CA 2EKQA 5BOSB 1E20A 5D01A 2VK8A 4W6ZA 2CHQA 4MITA 3NTRA 2ZTUA 3K8ZA 1RVDA 4RF4A 9MHTA 2BRUC 4KOAA 2NXJA 4IJKA 2G17A 1MJGA 3LQ4A 3V1UA 5ULLA 1O5IA 3MTQA 3FAZA 4FU0A 3IEVA 1OZ0A 3O2QB 1F38A 1WDKA 2H52A 3FWZA 4FDUA 5FL3A 5BXQC 4X65B 2O3JA 3IBGA 2I6QA 2QVYX 2XDQB 3NORA 1EWRA 2PSHA 1A5TA 1BH2A 2YJTD 3IVRA 4X6LA 5LQJA 2AJTA 1LGYA 4KVAA 1XXHA 2WK1A 2P2ZA 5F1KA 1IAVA 3DCYA 2OK7A 4C5AA 3Q5GA 5DF1A 2FR8A 3CVOA 1XMVA 3ONWA 3PNKA 3AEQA 1EFRD 2P11A 2QU8A 4AKTA 4Z1OA 1Z68A 1SKYB 2OLEA 3GIDA 4TXJA 2EHJA 3S7TA 3HS3A 4IIYA 1JXOA 5AQ1A 1NJFA 1I33A 1ZSYA 2X8BA 4NCIA 2I2AA 4O0LA 1HQKA 1OZFA 1P0FA 4ZYLA 1A7AA 2OBYA 3FOBA 4EGAA 1MABB 3ANLA 4FJ1A 4NE9A 5GJBA 1JEQB 3DMPA 1JLLB 3ONVA 4EBFA 4HN9A 4HX9A 1JQDA 3NP9A 3VC2A 4Z6KA 1NASA 3VJLA 4X1IA 3ZDFA 4MYUA 1NKTA 4R0MA 3B13B 3ICOA 2JFBA 4QUJA 4A73A 1F2UB 3RBXA 3HNRA 5FUQA 4BTEA 2E7ZA 2O2XA 2QRNA 2PKXA 2Q29A 2R6R1 3JTEA 4YT8A 1A9TA 1TJNA 4QFMA 5H9VA 3ZDDA 1WSAA 1PL6A 3BL5A 4JC8A 1TGYA 1YOVA 3IPXA 5C7OO 3ZU3A 2WB4A 4C4TA 4OHUA 1HL3A 2E4WA 3VOAA 3QOWA 3KWJA 5IKMA 1NXOA 3JD4A 5GONA 4BX0A 5CEEA 1E4OA 2JRLA 3I2FA 3A9UA 2CLSA 3FDZA 4OH7A 3T95A 5FPPA 4IAOA 1RFGE 3NTVA 4E88A 5KINB 1OFGA 1Z7BA 3NTOA 1AC5A 4LV6A 5L4SA 1IZYA 4EO4A 4A23A 4EJ0A 3BE4A 1EFLA 3HJCA 4K9DA 1J2EA 2PRJA 2XAUA 5ALQA 3A6KA 1AGYA 3ZNOA 4OHCA 3H3JA 4R7ZA 1KGDA 2AUTA 3HUTA 5LQAA 2P2SA 3PNVA 2BGMA 3MAAC 4IWYA 4Q1VA 1F7UA 4JR2A 1QZUA 1PQUA 2YIDA 3A58B 4G8CA 4NECA 4TTPA 3RREA 5AVUA 5DYIA 1PWEA 5HM8A 4HWTA 2C2KA 1IU9A 3I83A 1NQ5A 2DZDA 4BO0A 3C7KA 4M9XA 4EZIA 1K0FA 4XQCA 4N3CA 4WZ6A 1Z2OX 2KM1A 3ZCRA 1J9ZA 2P1DA 1LVUA 3P7MA 4UNPA 5LQDA 2ZWIA 4REQB 4ZCTA 3AI1A 5K0CA 2IS2A 1U2DA 3NTUA 3TDMA 4ADSG 3EXFB 4EF6A 2WA1A 4JXXA 1M83A 5K0SA 4HRXA 3FY4A 1J24A 2QSUA 1JJVA 2O06A 3N8DA 1Q0HA 3EGXA 3SGLA 2E5LB 3FFTA 5FR2A 1KO5A 2Z8XA 1NXVA 4CTKA 3CKMA 4HQOA 4KR9A 3VVLA 3CF6R 1NY6A 3ZBUA 3QV1A 1R8YA 2H65A 4X24A 2ZI7A 3H8VA 4XX1A 4EBBA 1I4OA 3ED1A 4GO1A 2PQ0A 4W5OA 3SR4A 2HCFA 5I4CA 5LMUB 1F48A 2ZBQA 2OQ2A 3MGGA 3DL0A 3ZYZA 4D0RA 1N6KA 4B6FA 3T7IA 4UNIA 3C4VA 4JP1A 4J3FA 3KPWA 4Y2QA 1Y1RA 5FPTA 2Z30A 3F78A 5THQA 2PUWA 4F5DA 2C4KA 2F3PA 1XN4A 4GXTA 3IAEA 4CV2A 2YW9A 2CZCA 3CUUA 4DY4A 4GL2A 2GPAA 1PBNA 1CQPA 2PH1A 2HU5A 3FCYA 2JCSA 3J81A 4J9VA 4POAA 4DV4B 3DMTC 9ATCA 5CA0A 5IJWA 3HB9A 1SNYA 2YZ2A 5E1DA 3I0NA 3MWJA 1NFFA 2HZBA 3ECAA 3MM4A 3MPOA 2AEMA 4TUYA 3VU0A 3QZUA 2GBPA 1Y3FE 2AUNA 2VH2A 3ONNA 2EDCA 3RVQA 2H0AA 2FOLA 1J2UA 1QH1A 4L3OA 2PCJA 1JQJC 1L7EA 3WFJA 4P4TA 4AO8A 1NF9A 1RXUA 1A96A 1BO6A 4J0CA 4HXGA 4MQEA 4TLAA 1FMLA 1QG0A 5AM4A 3IQIX 1U8FO 2VPXA 3F7TA 4M3NA 2ERXA 2X0DA 5IUJC 1GG2A 3OJOA 1M7HA 2WTAA 4RSRA 5KYVA 4TV9A 1OC2A 1JZQA 4D4HA 3OTWA 3HN2A 3WNCA 2YOFA 2VAWA 2HJ9A 2ODTX 2Q9UA 2B0JA 4IHJB 4ZT6A 3OOEA 3W0LB 2XD9A 4RANA 5K01A 1VJDA 5KREA 1VC2A 1C3OB 1XTJA 4WLNA 2GYWA 3C48A 4HWKA 4LMBA 5JNWA 3H0KA 1F1BA 3JS5A 4MSUA 3ENWA 4JU9A 4PR0A 2PUJA 5A2QA 1Z0ZA 1H2RS 2J6HA 5FWDA 4EGQA 3W5BA 5ESXA 1KDPA 5ENDA 1G4UR 1TZMA 2GZDA 2D1TA 5K3CA 3A6GA 1G4AE 1SXHA 4LNUB 4DIOA 4UFOA 1GFWA 4UDOA 3D8SA 4R9SA 3NIDB 3AF6A 1M6HA 1RQGA 2WE7A 2XE8A 4RABA 4UBOA 4HMOA 1VRWA 4DEVA 4ENTA 5TT0A 1Q17A 2JCGA 1KSJA 5FJJA 2WIGA 1G20E 3DVQX 3R3HA 1GCUA 2I99A 3BFPA 3QENA 4GKAA 2XKKA 3QFRA 4HQFA 1P74A 4CDNA 2XD4A 1T2NA 1KI6B 2XZOA 2R751 1R15A 1TOAA 5KQGA 2YYAA 1HWYA 2HSZA 2NUPA 4YX9A 4JP5A 1TU0A 1VSBA 2BT4A 2PJZA 3WMFA 3PEVA 4NFLA 1QIGA 5F2EA 1BFDA 4S1NA 4WE3A 2G82A 1OH8A 4N5NA 4O1HA 3K2QA 3WRYC 2HLNA 3OY2A 4I7EA 4UREA 4MNTA 1HFJA 2ZPTX 1AT1A 3MBIA 4RF2A 3CWQA 2BFEB 1TLLA 4NEHB 1SXJE 4EH1A 4K9NA 5FBWB 2GZ3A 1ZJWA 2HB6A 3DVAB 4N3BA 4P98A 4JOQA 3T5MA 2JGEA 2Y8EA 4PVCA 5AJTA 3AB3A 2HSWA 3AQ4A 1CD5A 4UEKA 3SR3A 3SY8A 4BP1A 4ZYWA 4KREA 2OCGA 3D4PA 3G5TA 3P52A 5B53A 4B75A 4CM9D 5HX7A 2HO4A 4R5HA 4ZVVA 4TYPA 1XDSA 4LVNA 4C2UA 3RYCA 2GN0A 2YMLA 3CX3A 4ZAWA 4O2RA 3MWFA 1A5SB 1K66A 1A97A 3DV0A 3KZKA 4O4IA 1KEVA 2XYVA 4LX0A 3OCXA 5J4VA 3KC2A 1YCDA 3TLGB 4F1WA 4HPJB 2H4YA 2CFRA 1A50B 3M82A 2FMXA 3OFNA 3RKRA 5HTKA 1A4XA 3IKJA 1VG0B 2C1XA 3Q98A 3LPDA 2DP4E 1NSFA 4WGFA 2C0CA 3W79A 4C1NA 3CUTA 2I7TA 1C5KA 2HLDD 4V0SA 1QFZA 3BSFA 2AEJA 2I5PO 3E5HA 2G0NA 4MS1B 1O87A 1J5XA 2WWHA 1Q91A 5LIRA 1G2QA 1SQ6A 3AQIA 3AEUB 3B89A 4RXUA 4MRMA 4NWIA 4CMAA 1XZ8A 3LDHA 3QFFA 2NYAA 5IJ0B 2YJNA 2X4LA 3JPYA 1P75A 3W4KA 1N3LA 3ZJ4A 1BMTA 5EUBA 3S2GA 5KVCA 3WMXA 5HE9A 3R0QA 3DMRA 5IAGA 5T8KA 2J45A 4V0MA 5C3UA 1ECGA 1E9DA 4N9QA 3ECSA 2EFGA 2ODEA 4MMXB 3F2IA 3E27A 3OD5A 4MUGA 4Q9JA 5AI8A 4NENA 3T35A 1F6BA 3D3NA 2C4MA 2DMRA 2JIZD 2Z5VA 3LUBA 3NATA 1N2HA 2XKAA 3O4IA 1KJIA 4DWOA 1XZAA 3A9RA 5GADl 2H9IA 2GK6A 2ZAYA 4YS6A 3VKUA 5JBQA 4MP8A 2EP5A 2IL1A 2QVXX 4F2GA 1IZ0A 3GEEA 2JGAA 3GO4A 2BFCA 4X84A 4PZ0A 2V7PA 3B1ZA 4DNPA 2GJKA 5FLYA 3BXXA 5FAXA 1YB2A 5BSKA 2J5BA 1UIRA 1ZPDA 3IVMA 2W6MA 4RA6B 1OT5A 5KX5B 1P7PA 3QTLA 5EJ6A 4BJ1A 1E1QD 2WPDD 3JQFA 4N5MA 4DJFC 4WXRA 5TQVA 4D4IA 1TQDA 2OHJA 3DKPA 4PNHA 3CISA 5KVAA 1A9XB 1PF7E 5ALMA 1SKBA 2P78A 5EC8A 1UBOS 5TF0A 5J2UB 1V9LA 4RKEA 1N1EA 3H16A 4DB2A 1KPGA 2MCFA 5LQCA 2VATA 3KLMX 4MV3A 1S1CA 4MULA 3L1JA 4ZAGA 3TZEA 1BWPA 1X92A 1FYEA 3EWSA 2XJ9A 3R3VA 4FOSA 4MAMA 1M75A 1M8GA