3MJDA

1.9 angstrom crystal structure of orotate phosphoribosyltransferase (pyre) francisella tularensis.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
209
Chain Sequence
NLYFQSNAMFIEFALKNQVLKFGEFTLKSGRISPYFFNAGLFNTGAQLATLADYYAQLIIKSDVKYDILFGPAYKGIPLVAAISTVLALKYNIDMPYAFDRKEGVFVGADMTNKKVLLIDDVMTAGTAFYESYNKLKIINAKIAGVVLSIDRQEKAKDSDISATKKISQDFNIPVLAVTNFESIFEYVKENLDETMIDKFKQYRQKYGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.9 Angstrom Crystal Structure of Orotate Phosphoribosyltransferase (pyrE) Francisella tularensis.
rcsb
source organism Francisella tularensis
molecule tags Transferase
molecule keywords Orotate phosphoribosyltransferase
total genus 67
structure length 209
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3mjdA00
2VFAA 1IBSA 1XZNA 1G2QA 4QYIB 4WMLA 1A4XA 1QK3A 1ZN8A 2PRZA 4PFQA 1UPUA 4RADA 2IGBA 4IJQA 1FSGA 4RQAA 1BD4A 2AEEA 1GPH1 1P17A 2GEBA 2PS1A 1STOA 4RAOA 1G9TA 5KAPA 3LRTA 3NAGA 1ECFA 4JLSA 4P82A 4TWBA 3GGCA 5JSQA 1ECBA 1TC2A 4X44A 1OREA 5IAOA 3MJDA 2E55A 2JI4A 4OHCA 1BZYA 1NONA 1DQNA 1YFZA 1OPRA 4RANA 4RABA 5E38A 1JLSA 3H83A 1V9SA 5HIAA 1DKUA 4Z1OA 2H08A 3KB8A 4P81A 4MB6A 3DMPA 4LYGA 1G9SA 1QB7A 3OHPA 3MBIA 1QK5A 1DKRA 4P86A 3S5JA 5EUCA 3EFHA 1LH0A 3OZFA 1VSTA 1A96A 4RAQA 4F8EA 2EHJA 1D6NA 1Z7GA 4M0UA 2PRYA 1CJBA 1DBRA 2C4KA 3M3HA 4LZAA 1P4AA 1TC1A 3OZGA 4X45A 2DY0A 3QW4B 1BD3A 1J7JA 4M0KA 1A97A 1R3UA 4S2UA 4KN6A 5BQOA 2XBUA 3ACDA 3DAHA 1I5EA 1A95A 1HMPA 1I0LA 1I13A 5ESWA 3DEZA 1I0IA 3GEPA 4RHYA 1XTVA 3HVUA 1OROA 1A98A 1ZN9A 4M0PA 1O57A 1P19A 1WD5A 4RV4A 1P18A 4P84A 1A3CA 1ECGA 4RHUA 5JV5A 4P3KA 1W30A 4FYMA 1VDMA 1XTUA 4RHXA 1O5OA 1JLRA 1QK4A 1ZN7A 3O7MA 1L1RA 2JKZA 3ACBA 3LPNA 4QYIA 1DQPA 1Y0BA 2H06A 2JBHA 4RQBA 3GGJA 2FXVA 5BRNA 3N2LA 1VCHA 1QCCA 1G2PA 2WNSA 1XTTA 4LZNA 5BSKA 4LYYA 5K51A 5ESXA 1QCDA 1UPFA 1HGXA 1GRVA 1ECCA 4ZFNA 2JKYA 4QRIA 1U9YA 1UFRA 1ECJA 4PAWA 5BQPA 3G6WA 4LZOA 1L1QA 4P80A 1I14A 1QB8A 4WN3A 2H07A 4JITA 1U9ZA 4RACA 4P83A 2HCRA 2P1ZA 3ACCA 5HKLA 1MZVA 5IPFA 4RHTA 2YZKA 1XZ8A 5KAMA 1AO0A 1NULA 1PZMA
chains in the Genus database with same CATH superfamily
4MRMB 3W90A 4F7WA 4O4JB 1NMEA 2YWDA 4RKFA 1QK3A 3KO8A 4HX5A 2RGUA 1CV2A 5DHTA 4S3MA 5C5EA 3WOHA 5ALKA 1L7VC 1P17A 3PXCX 1OFUX 1AQNA 3KQTA 3WMXA 3NLLA 1N2CB 3UMFA 2ODBA 3D8RA 4PC7A 3MSXA 1RQ2A 4C0QC 2BBWA 4ZEVA 5AW1A 1EWKA 5IH7A 1W47A 2QVLA 1IN7A 1Q7CA 3WJAA 5M2QA 4KNYA 5JPCA 5GZ3A 5DM0A 2LRHA 3GJXC 3FSRA 4WTOA 3GEMA 1HYEA 4ZIRA 1NN5A 5ITWA 3QPDA 4M46A 5KMGA 2QMYA 4K9QA 4BTLA 3O2QB 2POCA 4RDCA 4HT3B 2AYYA 1BS1A 1RYNA 4C4TA 5HGJA 1RRGA 1QAMA 3FF4A 1QRDA 4KODA 3LP8A 3EHEA 3OJLA 5IS2A 2P4EA 1RCUA 4NCHA 4FZ3A 1C1HA 1SPBS 1WDKA 3U4DA 2WWWA 1JH8A 3M4XA 3UKDA 4H1HA 2H9IA 5LZ7A 5B4UA 2Z6QA 3JALB 4GW3A 4OXQA 2SHKA 3DKRA 4EG4A 4GDMA 3LXXA 1KI1A 2PRYA 2QTVB 3IUPA 4IV5A 4MGHA 4FFOA 1XE3A 2AOTB 4GPZA 5ALJA 2L2QA 3LH5A 1SURA 2Q9UA 4J0QA 1HZZC 1DELA 1T3LA 4ZZ3A 2O9JA 1JQ3A 3TZCA 1N5DA 3WFIA 1IBRA 2P6UA 1RU3A 3PLRA 1VIVA 1SOAA 1KEUA 4J0KA 2B20A 3C3PA 3THWB 1DRKA 1Z34A 3PUHA 4KQMA 2JFZA 1TMOA 1BE1A 3ZK7A 1I3KA 4AO6A 1ZP6A 4HJXA 2RKWA 3V3TA 4PGFA 3UUEA 3SDSA 4A27A 3P97A 2X9LA 3AY6A 3NNNA 3PC2A 5F77A 1R8YA 3C3MA 5J2TF 5BMVB 2DT5A 2TMGA 3FCEA 2P40A 3H9UA 4G26A 1W6RA 4PLFA 4DJJA 5HF5A 3C7CB 1S3FA 1VLVA 2HDWA 2QUBA 4JYPA 3LKDA 4NIMA 1ST3A 1HV8A 3JWPA 4G4SP 2C3UA 3ZH2A 3KETA 1W4CA 3NMUF 1Q1EA 1E79D 3EZ9A 2Y1CA 3ZQJA 2CLIB 1Z39A 1J56A 5DGTA 5DGIA 2VS1A 3P0IA 3NS7A 3ORYA 1AUXA 1GOTA 4KACA 4AWAA 3FHTA 3WO1A 3FYUA 2C9CA 5JXJA 3OPYI 1Z0KA 5A4IS 1EGAA 4EG8A 4MLDA 1YFKA 2F59A 1I30A 1E2KA 1SCUA 2XH8A 4Z0NA 3W9YA 5G1PA 3UGQA 4M2LA 5B3JC 4N8SA 3SLGA 1VG9B 1Z0FA 3TAXA 4YP5A 4D8TA 1V41E 1ZN2A 1P5ZB 4EYOA 1PWEA 1NXOA 3AZQA 4C1NA 5LDHA 5CVEA 2R48A 4Z2AA 2IZ5A 3PFGA 2RH5A 3NJ4A 1Z6XA 2RHRA 1FP1D 3A4LA 4E94A 3P4YA 4JL5A 2HADA 2IE0A 3I9KA 4LJLA 2BHRA 4AKHA 5FXMA 3THSA 3EQ8A 2G1KA 2WT4A 4O0MA 1NV8A 1M8PA 1QHIA 1S7CA 2GYVA 3O8OA 5LP6A 2IPAB 3SI7A 3FR7A 3QOYA 2C2KA 3DOHA 3MJSA 3RTGA 4QJ4A 5C32A 5L9AA 3P45A 2C7GA 5D00A 3SVZA 5BUZA 2O54A 4QYSA 3RUHA 3GRRA 2D7DA 5JU6A 1RYEA 5K3CA 2NVUB 2W2LD 4BLVA 4ER6A 2BP7B 1ZAKA 4MQLA 3JR7A 2XUKA 2G82A 3VA7A 3FVQA 3KZ1E 1QYCA 5EJ9A 1KWKA 2VZ8A 1KSFX 1VG0B 3LX6A 2UZ0A 4H7EA 1N6KA 1MJGA 2I8LA 1E77A 3KLNA 4OGLA 1QP7A 3A7EA 4RPLA 3BRWD 3MS7A 4K81B 4IUYA 1WZEA 4MWCA 5IJXA 3UZUA 4JR2A 3PEEA 2MJLA 3GGCA 1TVKA 1Z0DA 3E8XA 3UT6A 1IDOA 1L4KA 1AKNA 1UAGA 2I2WA 4KWTA 5J43A 3L6RA 3T38A 4U7WA 3X1ZA 1AM4D 4N3GA 2Z5LA 3L1KA 3RTBA 3NX4A 5BOSA 5H9WA 2V7TA 2Q27A 4QQRA 3ZS8A 1PVVA 1IK6A 4ECAA 4EG1A 2IYTA 3T3GA 4UDNA 2XEXA 5ADUS 4MVJG 3FCYA 1ZC4A 3OT1B 3RC7A 2GJAA 1G8YA 1OX4A 1FQOA 1AY0A 4K6GA 5LYJA 3UGKA 2PRJA 4IDQA 3IQGX 5CLIA 1M73E 3OICA 4JSRA 5M7EA 2WU0A 1KPIA 2YWEA 1S3IA 1ISJA 1L4NA 4R5HA 1RKVA 1WZIA 2IOYA 2X2OA 3N2ZB 1CQZA 1G17A 4C3OB 2ZJ7A 5I7VA 1LBTA 2PGXA 2QW0X 3ZBQA 3GC6A 2IEDA 1IOVA 2YYSA 3F90A 1YZNA 2GUGA 1R8JA 1B6SA 2KBEA 1V2GA 1NG9A 1P0MA 1BJTA 1QFMA 2HIAA 4RTRA 2KPOA 4GUAA 1U1CA 2N75A 5AXDA 3EDRA 3A04A 2Z09A 4TKLA 5L53A 4MTLA 5C18A 3GPDG 4R84A 4ZPXA 1NVVR 1U0EA 2XNDA 1BCRB 1NVAA 2H0RA 1DEXA 4M86A 1XCPA 1ILWA 3CURA 4WX2B 1JBQA 1W5SA 1Z7EA 4DSOA 2P6RA 3DF7A 4IIVA 3GNTA 4XGKA 3V8NA 1RE1A 2B30A 4R8LA 3VGPA 3QNMA 4PCAA 1QQBA 4ZKDA 1G7SA 2YUIA 2CFCA 2A59A 1LFAA 1P91A 2GK7A 2JCBA 2ZIAA 4YR9A 5KVQA 1G1MA 1M72A 1A9ZA 1RQGA 1ODKA 3C39A 1CE8A 4MUNA 3GLTA 4RTKA 1ZR4A 2XZLA 1M7GA 1RDFA 3H2YA 3RCBA 5K09A 4OD0A 2RHLA 4IO1A 2IYQA 4KXYA 1L1RA 1T2NA 1HOTA 3THYA 2XBLA 4I9GA 4NEGA 1ZY2A 1KI4A 1RJFA 1C2YA 3ED1A 4OIFA 3T7KA 3DVLA 2WPNA 4RFSA 2GJ4A 1QG2A 2EVWX 1L4GA 3MUEA 5LN1A 5DBIA 2Y1LA 4FIZA 2JCYA 3PQ2A 2H11A 3MYYA 1IZZA 3IOMA 4HVCA 2VXOA 2C03A 5IN5A 3RK1A 2IIVA 2VCYA 1ML3A 2FWJA 3RKUA 4BFSA 3J80A 1K88A 2C59A 1NVKA 1OVMA 4NYMR 1EVZA 4IXDA 3WFZA 1L4YA 3LE8A 4IIJB 1E99A 2N0SA 4D5GA 4KFCA 5AHRA 2WA2A 3E1GA 4M8NE 1TD9A 1EEXB 3JD3A 1WA5A 3NFYA 1T29A 5AW5A 2GPWA 2MCFA 3TM4A 4MS4B 4PLZA 3ROQA 2F48A 3WQQA 3OY2A 1XPOA 2XHEA 2R9VA 2UYYA 3N6VA 4PSUA 3IIMA 1X9HA 5T67A 3GRZA 2BZ1A 1PR3A 1PVDA 2VDOB 2ZWVA 3QGMA 4Y9RA 5CUQA 2ZKIA 4BJ3A 1C9JA 3D6FA 1PZMA 4KUGA 4PVCA 3TX2A 4FBGA 2BISA 1U7UA 2GBIA 3HU5A 5LSAA 5E1OA 4BV2A 4PG6A 3W5HA 4L74A 1DADA 4QPZA 3T7IA 5A9SA 1L5VA 3WGTA 4D0RA 5LQKA 4MDFA 3ENWA 1FLDA 3IRUA 5G3ZA 3UUGA 1DNPA 3D3JA 3V55A 1QRUA 2AS0A 4EY5A 2P6NA 2CC2A 5EIWA 1J8YF 4OKIA 5JRJA 4LJ9A 1WG8A 4QG3A 1W1WA 3T06B 1ZM9A 1JA1A 2DHEA 2ZROA 1N0VC 2AC4A 1JEQB 4FHFA 2XXJA 1FDSA 2A86A 5CNKA 4HDNA 4U2DA 2NU7A 2OORA 4PRKA 2P91A 5JNTA 4OGFA 1YRYE 2QAGB 2JCVA 4CGZA 1YH3A 5G1OA 3WA6A 1W4ZA 5CM9C 5JNLA 1YR3A 4IY1A 3DMRA 1O5IA 1BDMA 1L5MA 4XH9B 1ZH0A 1TEZA 3EGXB 1FYWA 3ES9A 2D3WA 3NTXA 5F4ZA 4MR9B 3C6KA 4ZT7A 1NY5A 1PYGA 3HWX1 3KAPA 3KYDB 3DOUA 2DXIA 2ZB7A 4RLHA 2BFOA 4JJGA 4S2EA 4KDEA 4C5AA 4FM9A 1ZM4A 2D3TA 1M3SA 3FYTA 4BV8A 4ENQA 5B2FA 1D4AA 1MV5A 4J2HA 3SKYA 3JQ9C 4MQEA 4ZVOA 5DK4A 3QW4B 2D8AA 2ZAOA 1PR0A 3FPAA 1BE8A 3NGMA 1U4OA 1AE1A 1Z9BA 5ED0A 3TOZA 3HE3A 5TQJA 1F4PA 5IZCC 4BMYA 3VR6D 5LZ2A 2W2MA 4PQFA 1TGVA 2I6XA 1GGFA 1T1IA 4YDHB 4ZHQB 1VSBA 3GVIA 5EMNA 4JWTA 4KKXB 4V39A 3TNLA 4ZCTA 3HNRA 5DHRA 2CHEA 4GPBA 3KVOA 1JEAA 3D3KA 4HQLA 1QIMA 4AUMA 2BM9A 2NO0A 4EX7A 2P27A 1UDXA 4Q4HA 3KDPA 2AUMA 5G02A 2DT8A 3UOAB 1CUYA 2ONZA 4G0PA 1OI3A 2IBMA 3CZ4A 5LQMA 2BFCB 3HJCA 1E3IA 3FRHA 4U8HA 4YJHA 5KCZA 1P3DA 5CYFA 4INZA 2XMPA 2BDEA 4EI9A 3W8DA 1WM1A 4CKYA 1GNRA 3NTVA 5TPZD 5JCPA 4FP9A 3VHQA 2FZLA 2FG6C 3P0JA 4Y9SA 3L8FA 4RF5A 3MTJA 3S1LA 2I6FA 2IHJA 2PS3A 1KKLA 1IN8A 3ZJVA 1YGPA 2Z98A 4AZTA 4HPWA 3M6XA 2XXAB 4QEKA 4ZU3A 3Q9UA 3RQIA 4J0FA 1WXFA 2LDXA 1M6VB 4FOPA 2C7VA 1IAVA 2EJWA 4PAWA 7GPBA 1GTMA 4RKRA 5HS4A 3EF1A 4QECA 2A30A 4XVQA 3PUZA 1A8UA 3ICVA 4KEAA 1VKJA 1FJXA 1T9ZA 1JFFB 3SMQA 1I4LD 4ARCA 2R7KA 3N8HA 2JLRA 1C5KA 2W8BA 5JZ9A 2GEKA 1OFHA 3N07A 3EXHC 5DOVA 2CZCA 2QS9A 1HA3A 3WNBA 2XX3A 3IAAA 2REQA 4G4SO 2ZIXA 4BNYA 1G8HA 1W4RA 1UKYA 3QSYA 1YA6A 4CHTA 1NVGA 3BE5A 3HN6A 4DXAA 3BL6A 1DXOA 1T13A 1J2JA 1KFKB 2DOKA 2LUOA 4GIBA 1GPH1 4LVNA 1GSAA 4CHGA 2BF7A 3GJYA 5HNKA 4PPYA 2QW1A 5LLSA 1ZVKA 3JQBC 2MWMA 4IYJA 1C4XA 2WAAA 3L7IA 2VT3A 5GOTA 3UFXA 2I7VA 3U37A 3L7AA 1F8YA 4P0TA 3DO6A 4J0DA 3RS4A 4O6VA 1GG2A 3QMPA 3UAVA 2RH9B 2H0AA 1YU9A 1TD1A 1BIFA 2BLLA 2HLDD 5EMMA 1PQ4A 2VDKB 2NXJA 3IV7A 1JMYA 2AZDA 3OX4A 2C07A 4R0VA 3HKDA 3U2QA 4CU5A 4WASA 3QUCA 3A36A 3DT9A 1EXMA 4GZLA 3U9TA 1OBHA 1QKIA 3WQRA 3GP8A 3F5MA 3H9BA 6CHYA 4I99A 2DAPA 3W2IA 2QIOA 1UJMA 4A2QA 1S02A 4WBNB 4NJEA 4AUKA 1GQQA 2VYFA 4QFMA 1XOIA 4YUWA 2GK3A 1YUBA 2A1TR 1E2BA 1WZ2A 2PJRA 4ZVKA 1PJ2A 2A5YB 1CJUC 3PUKA 2AX3A 2WNIA 2Q2QA 3BERA 3SFVA 3LOQA 2WTEA 1X7DA 3L5OA 3ED5A 2A4KA 4Q82A 1K9SA 3RANA 4CEIA 3UMMA 1QOPB 3E81A 3AONB 3FLMA 3OQ6A 3QVGB 4GF5A 5JRZA 4AYWA 2DY0A 4LHYA 2VWHA 4CEHB 1YVRA 4ZZ1A 3Q3HA 4YIHA 5FA5A 1R10A 2VK4A 3CLRC 3TQCA 5DTRA 1NX9A 2CGEA 4DLTA 3GLHA 2G1AA 421PA 5JY1A 5EJ4A 2ECKA 3HEAA 3OJOA 3KSRA 4I5IA 2W4IA 4WKPA 4C6TB 3AOEC 3FJOA 4X64B 1J2YA 2BTQA 1R2QA 2E4AA 3FCSB 1UF9A 2JFGA 4KG7A 4MIYA 1SXJB 5HXAA 1M2VA 4DS3A 3EF0A 3TSAA 3K5WA 3G17A 3I9JA 4OQDA 3NDIA 3L06A 1B0ZA 5KIAA 1VMIA 4ZQIA 1UBCA 2IYOA 5JW6A 4PR0A 1QK4A 1V37A 2V7UA 1YE5A 4LXYA 3R9KA 1GAQA 2XQGA 3W6OA 2BAGA 3RSGA 3TBKA 5EWJB 1BH2A 2VEOA 2IIBA 3KJXA 3REOA 1PT6A 3UJAA 1SD2A 2ZAIA 1XKTA 4BQPA 1J0BA 2GFQA 3KB2A 4ZAYA 4EG0A 3M6IA 2AL7A 4I4TF 2PYDA 2HHJA 1CNMA 4OQXA 4XX0B 4Z0HO 5I01A 1LLQA 2GCNA 3PJFA 4FEEA 4A2PA 5BY2A 4N1AA 1QHEA 3MQ2A 2BFAA 1T8PA 1AV7A 1LQ2A 2DKNA 4YJ3B 2EQ5A 3BHMA 5L4SA 1QFJA 3GLQA 3WNZA 2XNKA 3U17A 5ALSA 1RWKA 2HFKA 2HQRA 3OE1A 1ZSYA 5PNTA 3S3TA 2X8BA 4NMLA 3WICA 4H7DA 1H65A 3WOVA 1H0SA 4OEHA 1DC7A 4BUCA 3WGVA 4F3KA 4UM8B 1M8FA 4Q4JA 4MA5A 4O5OA 4EVSA 4DDUA 2GBLA 4GAEA 4LRWA 3VPSA 4LJ7A 1R66A 2WFLA 4B7CA 3K05A 1PV2A 3P0RA 2IUUA 4JP8A 1AZLA 4M4SA 4JXKA 5FNVA 1ANKA 3UJCA 4B6EA 4TKUB 2HLPA 4BFUA 4TV8F 1CF9A 1HSOA 3I9OA 3N5KA 4RZXA 4F2PA 5JZMA 3H5RA 4KLCA 4BQIA 1JE0A 3D9QX 4IV0A 3EY9A 3SF0A 2ZSFA 3F9IA 3D7SA 2NZ8A 1WBDA 5F23A 3WGHA 1XC7A 5BSUA 1B2LA 4CE6A 3Q9LA 2ZBUA 4M1KA 5KYUB 4DIKA 3UJ3X 2OTCA 2FN8A 5LZ5A 1LLUA 1MB4A 3FIJA 2E3JA 2DQSA 1TVEA 2FHPA 4L5BA 4P32A 1UZLA 4JS0A 5AM0A 5BNTA 1E5DA 1TT7A 1DIBA 3BFKA 3U44B 4DLUA 3SSNA 4DCVA 3FOWA 4MB6A 3P9ZA 4Z9XA 2W37A 1AUPA 5ALQA 2CWWA 3N8KA 2R6DA 3EFBA 2HCJB 2F1OA 4FQ8A 3W77A 2RHWA 3CEAA 3JPWA 4RELA 2YXBA 4NDZA 4Q0MA 1E6KA 5A0FA 1CYDA 3Q5EA 5ILQA 4AS3A 4TSKA 4TTTS 1Y9EA 2C96A 3IIEA 3TO5A 3PT9A 1LV7A 3SM3A 1EUCA 3M6LA 4QXQA 4I4TA 1AO3A 5CLLA 1RLTA 3CX7A 4EPTA 2VUIB 5C8DA 2WYHA 4CQLB 2FN4A 4OI1A 1U2ZA 2C8LA 2DG2A 4Z2YA 2FCRA 3EPRA 3P94A 1R3UA 4PNZA 3TSCA 2Z2ZA 4H6WA 2OAQ1 1DVRA 4RKWA 1GDTA 1K6XA 1YVEI 3HKCB 1XZFA 4QDTA 4R31A 3LVFO 4EMSA 3C8UA 4Q3LA 3K0HA 5IEBA 4NC9A 2QBYA 1Z3CA 2NSLA 2G83A 4ZC8A 2AYXA 5EOVA 5F98A 4A6XA 5K0ZA 5F3WB 2X0JA 3NBKA 3GJRA 3LYAA 4D9KA 3FZQA 3NHFA 2ACEA 1SUDA 2BHLA 1DAMA 4HH3C 4R7TA 1QO9A 1LA2A 2PUJA 3CR8A 4PWYA 3BSFA 3LFHA 4JIGA 3D8SA 3L92A 3X2EA 3AHGA 4FZRA 4RTSA 2J9ZB 2OHIA 5KOYA 4P4SB 2W90A 3SEAA 3WKCA 1D2EA 5KDDA 4O2AA 4R01A 4TV8B 4UTVA 3VZSA 4MUHA 1J06A 2SCUB 3NASA 5FORA 2YZMA 5C8XA 4TVOA 2AOVA 2Y1FA 4RIGA 4E33A 1KJQA 1RYFA 2RHCA 4EKNB 5DHUA 1SUBA 1TMYA 5DLEA 1KZ7B 4F4IA 2A9PA 3K09A 4FD3A 4RENA 4BEJA 2W00A 4QBIA 3V4VB 4PZDA 5K3FA 1OD6A 4HWKA 5LJLA 1QGYA 4FGWA 1J5EB 5ITVA 5C7IO 3FMFA 2EYUA 4RM2A 3JTMA 4RS3A 4YRDA 4RSRA 1A2OA 4TUYF 3I9V6 3PEWA 2FVXA 1F8XA 1K3UB 3A6EA 4FNOA 3UJHA 4QXAA 1KZHA 4A8TA 1CKEA 1U9ZA 1K27A 2QM3A 2XYRA 3GFTA 4DV2B 1NSFA 4OMFG 1KDZA 2O5CA 1SR8A 3VAAA 2WICA 1KMHB 3WBKA 2ZWPA 3OM0A 2PKYX 2J07A 1S1CA 3HJBA 3JTEA 2XSZD 3UMBA 1P9NA 4A8JA 2CXHA 4HSEA 2J4CA 3BS4A 3WKDA 1DSSG 5EMHA 3IILA 4YRSA 4PLPA 2UUOA 2XNHA 1VHTA 5AOBA 4U2FA 4YRMA 3E03A 5HRAA 2D6FA 4EY8A 3WK7A 4N5NA 5BVHA 1U9IA 5HKKA 2FMTA 4JOSA 2HQBA 2GI4A 3NHLA 5JD3A 4PLHA 5H83A 1MO2A 2WW8A 4NESA 3AXTA 3CSDA 3I4FA 1U7WA 2ZU0C 4GXRA 2AUTA 1Z5OA 2Q0XA 2Q5CA 2OBYA 3HGTA 2J67A 1I8TA 3G2MA 1GCGA 3LQKA 1QE0A 1X87A 2D06A 4EJSC 3ESQA 4DMHA 2WJGA 5DM2A 4ZA2A 2WIKA 3VNVA 3FETA 4RJIA 3F4BA 4GM4A 4BPBA 4P35A 1V6CA 3H83A 3KPYA 2AN5A 1AZTA 3H04A 1UBRS 4NK4A 4G36A 3EDMA 3GRPA 4WHMA 4BMOB 4DQUA 4OX9Y 2FR1A 3BMOB 3C6XA 3WRYC 3WNDA 2IDJA 4G2TA 1QGAA 4R7ZA 5KNDA 4IDNA 1NDQA 4O25A 5CT4A 4ER3A 4Q47A 1CUIA 2OFFA 1R8QA 4YMVA 1TVCA 3B6ZA 3GQBB 4QFDA 2FW6A 1NBME 1GN9A 3NYRA 1M2OA 1YCFA 3C0KA 4PCVA 3T12A 3NBAA 1AUVA 3IULA 1X39A 3ZDFA 3G5LA 1ZLYA 3LZCA 5ERXA 3VDQA 3K6JA 4LDNA 3VM6A 3SLKA 4DQ0A 2FEPA 2QD3A 1WDWB 1YJQA 3NJRA 3H87A 4KDRA 1UC4B 3ILVA 1KQ3A 1I2MA 1RTKA 3L7CA 4REOA 1TM7E 3CISA 3K9WA 4KAFA 2HW8A 2C9MA 4BE4A 4AS1A 2FUNB 4IHJB 3DM9B 4A0GA 1Q1QA 2O52A 1WW8A 5DM60 2P79A 4GLFA 2C3PA 1DDIA 4DA7A 2IV2X 5FFNA 3M1IA 5A9RA 5K8TA 2R00A 5A0TA 5JXWA 1PJ4A 3QPAA 1CY7A 2FPGA 3TZQA 1EHIA 3G1UA 5JEDA 3GLHE 2WF7A 1K4YA 1LPBB 4C2UA 2QRMA 2ZI3A 1T2CA 3DBLB 3I0ZA 3LRXA 4RO0A 1U8YA 4KGXA 2IPNA 1MC4A 2C4HA 1P7CA 3GYGA 2EW2A 4NMXB 4U9HS 1XTUA 3ZGYA 2OMEA 2VP5A 4RH1A 4WEQA 5AHWA 3D8HA 1RT9A 2QU8A 4UD2A 2HHLA 4YMSA 4DLLA 3N2NA 3NKLA 5C51B 2YNMC 4Z7NB 4U5QA 5ALFA 1QIIA 4B3DA 4EDHA 2QNBA 4BVHA 4CMAA 2JIZD 3X1JA 3LVQE 5CG2A 4QU9A 4X20A 3F97A 1UPFA 5ARDA 4DJAA 3TLJA 3LQ1A 3MJEA 4DQXA 3PUYA 1TQ8A 4CGYA 4XWTA 4CXMA 2BV3A 2BGWA 2J0VA 1JXOA 4JLPA 4HV4A 4QRIA 2CXPA 2PVCA 2WM8A 1V96A 5CFZA 2DQZA 1DJOA 3PQ7A 2O7RA 1P45A 1KWGA 1FJHA 2MSLA 3CRZA 4X7PA 5E6SB 1N2SA 2VSOA 1EK1A 1GP2A 1OLXB 2CUNA 2OV4A 3MRVA 4JD5A 2DBYA 1CFJA 2J85A 4I6EA 4JKOA 5HM8A 3BCUA 2ZBVA 4IF4A 4IW3B 3WK4A 4BO7A 1T1RA 4BUZA 1NJSA 3A6PC 3PFNA 3RS2A 1E5VA 4FWIB 2JGDB 3BSWA 1JQLB 1BTOA 2ISQA 3RUDA 4PV7A 3IEMA 4HGRA 1NDUA 2R8BA 4QHYA 3I6YA 2AT1A 1BQ4A 4TMYA 4M0EA 1QOZA 4BVEA 2QP9X 1AD2A 1DAKA 4JHXA 5K2OA 2D2XA 1ZCFA 4NPAA 2HPVA 2ZE5A 1G9TA 3N0VA 4L8YA 3CRMA 1OIVA 1X9GA 2OO7A 3FTQA 2PT6A 4NULA 1G7TA 4BKRA 3DQZA 1QGUA 1E9EA 4B4UA 1I36A 1N2ZA 3GJ5A 1ORWA 4TQUS 4IIXA 2RGYA 2MINA 1TC2A 3DKVA 3GLKA 3IAS6 1FMFA 3JZDA 1Z5VA 1ZVQA 2AOUB 2C97A 1U3DA 3KQOA 3QXHA 1BRTA 4ND4A 5DRTA 5JYEA 4P5DA 5FYQA 3B2EA 5DI9A 1QOQB 2G8NA 3CNNA 4OYLA 3TG8A 4NBKA 5MN6A 3ZLBA 1KXJA 2O07A 3V7FA 1R1DA 2IHNA 1JQJC 4W9NC 5C5DA 1VXOA 2DSNA 3WLMA 2FJPA 3TL3A 2BWJA 4HK4A 3L0ZA 4NWIA 3BHJA 2BKEA 4L4RA 3MBIA 1Z8DA 2QR5A 2Z8ZA 3T4XA 5KU7A 1DJNA 2ABWA 1Y7LA 3BILA 3GV0A 3JVEA 3CH5A 1N7JA 5FD8A 5KB3A 1N8TA 1SVIA 1ZIOA 5M04A 2IYXA 4OI2A 5E0KB 2G5TA 4EB3A 5IMSA 2AJDA 1SKQA 4JGIA 1N4AA 3TZBA 5BR1A 4OX9B 2AD5A 1PZGA 2DECA 5KI6A 2X0NA 3H75A 3I2FA 1N2EA 4HCJA 5KHLB 4CFSA 1TQHA 4X45A 5D5PA 2FPIA 3RFTA 4EH1A 1ZMBA 1J7JA 4ALIA 3CH6A 1Z17A 2PL3A 4NVRA 4OOFA 5JS2A 1DC6A 4NG5A 2F1RA 2NNWB 3D8BA 3N2EA 1L2TA 3O84A 4MQBA 1OFTA 1FNSA 1Q84A 4AG3A 1YJ5A 1D1SA 4V02A 3D54D 3HFSA 3OPYA 1B8NA 3A1UA 3FJYA 3TLGA 4GL2A 1EK2A 3GUHA 2OHXA 5EUMA 3G9XA 3L18A 2Q3HA 3O9VA 1VB3A 2GGSA 2BGMA 3CH7A 4TTVA 2WJIA 3CKKA 5F1KA 4OU5A 4XUGB 1CZLA 5JV5A 3MC1A 3ONNA 4E4YA 3UYLA 1DJQA 1FVXA 4QQFA 1OSNA 2DWUA 1QH9A 2IPOA 2PMWB 3AR7A 1Q11A 3KT8A 3LCUA 3QWIA 2AW5A 4HAXA 1U1IA 3E9NA 4NYMQ 4RJTA 1AKMA 1XVAA 5CURA 2F1IA 1US8A 2Z5VA 5FBKA 3U9SA 3LYLA 2VTVA 4DDMA 4EY6A 2D1QA 3FTNA 4CN9A 3IQWA 5BYJA 2J1LA 5BSKA 5MGNA 4TLDA 1UBHS 3M8KA 4ISCA 1MEJA 3QQ5A 3VU8A 1OLSA 2PUHA 1LTQA 1XTBA 2EX4A 5EYPB 3V80A 2PUAA 1QP4A 3UEOA 2CFRA 3AI7A 4LNHA 3PCRB 2AJBA 4G5XA 3WHKA 2E4ZA 4NF2A 2REXB 4MEBA 4AJLA 1SQFA 5CEJA 3DAGA 3W2HA 2JVKA 1JG2A 4ATNA 1FSPA 2OGSA 1NF8A 2LZ0A 1EWQA 4M8IA 1NW5A 3ET4A 2AYZA 3AY7A 1GXSA 3FTCA 3IHWA 3T3DA 4HBZA 3SHFA 1EX9A 2O2JA 4W7SA 1LI4A 4AVYA 3R8CA 1SCIA 3RS3A 2I62A 1DDOA 2CNLA 2IXTA 2ZWMA 4ZZ0A 4MUFA 1O9HA 4JUBA 1IBSA 2HV9A 2J6BA 3MXOA 3AG5A 1O0BA 1A4XA 5C7OO 2VBGA 4EG3A 3HI4A 5IVIA 2NG1A 4LTMA 4C2BA 1FYFA 3O8BA 3S28A 5FTMA 2SBTA 3QKUA 3RFFA 5B3AA 2HO5A 4BN5A 4BX0A 5JOQA 1P0PA 5CA0B 3KOZA 5L8VA 4LXHA 3ZIUA 2KYRA 4MYRA 3KBBA 4JQCA 1Z6TA 5LKRA 1C3LA 3IAM1 3ORHA 1RJGA 3UBTA 4DUPA 1AGPA 3ZU5A 1SXIA 3VHXA 2PWZA 2E55A 1TB4A 2ODTX 3LQFA 2AE1A 3L1VA 3OLYA 4JI4B 1KFJB 4DTCA 3V42A 3REFA 1WUIS 1ZONA 1RXSA 3ZDDA 1QJ4A 3VR0A 3W3ZB 3U48A 1T5SA 3RBZA 5HUHA 4F56A 2QXYA 5T6MA 1FDTA 1MMFB 1P2UA 3MTDA 4EVIA 1XNQB 1YWGO 4EABA 4M9UA 3W0LB 3RU9A 2IE8A 3U19A 4LE0A 3D0QA 1ESZA 2P62A 4W63A 1HQYE 1MXHA 1Z08A 5ALUA 1CF4A 4JROA 4U2CA 2FMXA 2EKDA 1VPWA 1YULA 2ZI7A 2O8CB 2ECOA 1PX2A 1AB6A 4UZFA 1WBJB 2AV6A 3QIVA 1K0UA 4OB7A 2JIZA 3ZGOA 2RBEA 1A7JA 4DWJA 2ZS8A 4A3SA 2W2PA 2YHAA 3RIXA 3GROA 4FI3C 1OI4A 1WXHA 3I01M 4R68A 3ZU4A 4AZWA 5JBIA 4H3SA 2CXXA 4YH1A 3BA6A 2UYOA 2HN9A 2VJKA 1XJWA 1L8LA 2SKDA 3MJHA 5KOHB 5LWQA 4HXFB 3K0CA 4EGQA 3ZS9A 5IDVA 5ERGB 3JXEA 3T1HB 4OYHA 5IXSA 3PUVA 5AVKA 5BW4A 2QN7A 4JLJA 3BIWA 2IDZA 1P18A 4ARUA 1THTA 5DHFA 4B3CA 1A72A 3C3AA 3CLKA 3IDQA 1NLMA 2GLTA 1XMVA 2FUKA 1GPNA 3GJZA 3IERA 3KCQA 1UWVA 4UXHA 5B64A 3GIWA 3R09A 2ZTVA 3AETB 4F71A 2JHFA 3L6CA 5F52A 1TKRA 1I1HA 3DXFA 4N7MA 2HY7A 3A06A 1CUZA 3VGJA 3ZE7A 5COQA 1Q77A 1E89A 1IOWA 1XZDA 2BGLA 1G2PA 5I8WA 4IJVA 5FRDA 4E4TA 1DHRA 3BEDA 3K0EA 1RPNA 3R2JA 1IOZA 2PBFA 2XMSA 4GVXA 4P2BA 1GPKA 3ZKWA 1Q57A 1VRCA 4WACA 3WL7A 3KTOA 1A7KA 4ER7A 1G42A 4HNGA 4OBEA 3IUSA 1A8QA 2XNCA 4YACA 1QF6A 2ZSAA 2W6IA 4ARSA 1YK1A 4GSYA 1TKCA 4WKGA 4YXWD 2P1ZA 4S1TA 2F7SA 1VHWA 2Y0BA 5L51A 4Q39A 4O1HA 4ZOLA 5THXA 4DLNA 2C94A 1B43A 1XTZA 1FFWA 2ORIA 3K0KA 3VHLB 4CKCB 3ZVLA 4TWJA 3EXIB 1NOKA 3AUAA 2PXAA 4N12A 4V38A 3R20A 4DQVA 2VPIA 5GINE 2XRZA 3H6GA 1RHQA 4JV5B 4PCUA 2JLXA 2VNIA 3VOAA 1YVPA 2WSMA 4ZTBA 3D8UA 2F3PA 3IPYA 1ZNYA 3RDPA 3VAZA 1OIXA 5K0LA 1N25A 3A1WA 4INJA 4GBED 4OKSA 4WFQA 3IQXA 4XGIA 4XWOA 3R8XA 2NU6A 3HFGA 2FGJA 3REGA 1YS9A 1INLA 2AR9A 3T5TA 2ACVA 1LJLA 2WUEA 3ZBPA 3ZXXA 1UBEA 1XF9A 3EYWA 4OO3A 1GNSA 2FE1A 2C57A 4YJDA 4Q9LA 1K0FA 1FK8A 1GGKA 1J2TA 2Y93A 3E2MA 1DKUA 2QWXA 4G0YA 1THGA 2BMVA 3DMPA 3TW8A 3AVPA 1EU1A 3BGOS 2ONYA 4EM6A 3AESB 4LTNA 4IZIA 3OZBA 1FYDA 2G80A 3HCBA 1XD9A 2XQKA 4X1OA 5FL7A 3ZV3A 3BWVA 2PNFA 6Q21A 4OFBA 3CTMA 1C7IA 1ULUA 4PAMA 3AHJA 4U2BA 5FUWA 2OXIA 3SIXA 3S99A 4K2AA 4FCTA 5F9HA 4KE7A 2JW5A 2P9ZA 1QO0A 2QSYA 1NZDA 3I9LA 3BEOA 2YN4A 1WCIB 3NZEA 4MS1A 2WKQA 4KHPB 2A6PA 1E2IA 3GR6A 3TK1A 3V2IA 2Q8PA 4H60A 2JJ8A 5JNUA 1PT7A 1YZYA 1FTGA 2J4FA 1DTSA 2D1TA 2XBUA 3QVLA 5BT9A 2BMWA 3I76A 3T9CA 3FR8A 1BGXT 4BBZA 5HIKA 1GSOA 1IN4A 2RAUA 2XZPA 5ESWA 1PZEA 2FW0A 1IEXA 4DMCA 2IF2A 4RMHA 1ODIA 3L79A 1ID1A 3MINB 1YJBA 4ZVSA 4AF7A 4HUTA 2PUDA 3QKIA 4L9RA 4AJPA 5EIFA 3AZOA 4P84A 4B5LA 5HJ5A 2ID9A 1O4VA 3PDWA 4LPKA 4ZZIA 1N34B 2B8TA 4TXMA 2J5XA 2J6IA 2NSHA 1H8HA 3VO9A 4Y6PA 3N70A 3ZCRA 4BL5A 3FM9A 1E4EB 2JI6A 4OXNA 1Y0BA 4X61A 4ENWA 2JIRA 3P2YA 3PC8C 4XEUA 5AD1A 4OF4A 3JQEA 4RD3A 1BN7A 3OQ1A 4G0NA 5MGBA 3S44A 3DW1X 5K9ZA 3H2ZA 1HETA 3K72B 2F90A 1JDBB 1ZGZA 2LTAA 1ZH6A 2CLKB 1JI3A 3GEEA 4ZVMA 3DR5A 4Z9BA 5DMHA 3OEHA 1O0CA 4LZPA 1E6WA 1U8ZA 3WSVA 4JL6A 3QUSA 4YJFB 1J90A 2B1GA 4IVPA 5LUAA 3I8SA 4JI2B 2LBPA 1CQIB 4KQJA 4IGIA 4L9SA 3NDBB 4JX9A 1M34B 3KKEA 4H35A 3SEFA 4RULA 3ZXSA 1RJEA 4LW8A 3SSAA 3FA2A 3PYXA 4JVLA 4CIDA 2B36A 4ME6A 2QW8A 2WSYB 4PY2A 4R1MA 4ZZ2A 4LIPD 3HZHA 5AUQA 5HSGA 3R9XB 4TTQA 1P33A 1G5RA 4UNQA 4RWEA 3ANLA 3A3OA 1P6QA 3O26A 3WIUA 2XDYA 1Z0UA 1B7GO 4J0GA 1D1PA 2Y4OA 4OHMA 2AC2A 3ZV4A 1IULA 1IN5A 3LLSA 2I4OA 2NXCA 4L73A 4PZLA 4ZC1A 4UNPA 3ZE9A 3G0HA 1ZBDA 1S9DA 4YUAA 3NQ41 2V65A 2AMFA 3MB5A 3PFHA 3HCRA 3ZHUA 3DMDA 4DIFA 2P9FA 2FK7A 4OJMX 5DIFA 3RSZA 4LY3A 2VSXA 4ZQGA 2H4HA 4N5LA 5BN3A 1XA3A 2RMKA 2RE8A 4MIEA 1TTHA 2CCGA 1FS4A 1SKYE 1U8XX 2IEZA 5DHPA 5A2QA 2YCLA 2Q4RA 3EGIA 4LGCA 4Y6RA 5AH0A 4BTEA 1WCYA 1YF3A 4O2BA 1NVUQ 2XA2A 2Z43A 3LF2A 4MMZB 2FCAA 3FI0A 1HXHA 4YLGA 1ZO8A 4CMKA 1W75A 1JUDA 5D6NA 1IZYA 2ZI9A 1J9EA 2I3ZA 4FMDB 5BR7A 3ADBA 4Q1CA 1ZUD1 2J5RA 1N4DA 1JFSA 1JEYB 1L8AA 1G5QA 1Q3HA 1X2EA 3C85A 3EF3A 4O4LA 5ANRB 4I5FA 2XW6A 4M88A 2W4MA 3W5VA 2V7QA 1E2DA 3AUFA 5FA6A 5FPYA 4ID9A 2QAGC 4LRTB 1VJCA 1RLMA 3GPIA 1FFAA 5CLHA 4W5OA 2R8EA 5TQVA 5A71A 4CN8A 4NPCA 1AUOA 2X5NA 3DOIA 5GONA 5CLGA 4MEAA 5E1MA 3QXXA 4HEHA 3ZK8A 2EIHA 1B0UA 4B3JA 4CF5A 3O2NA 1FLAA 2O19A 1WXXA 1XB2A 2KI5A 4ZRNA 4AWBA 1K8YB 2ZR9A 16PKA 3PYMA 3N7UA 3RJTA 2ACKA 2BCGY 3ESRA 4NJOA 1P1IA 1MIOA 1NRXA 4F46A 3GW8A 3WQBA 5CK4A 3HVIA 3TQHA 3AVQA 1JR3D 1RWOA 2G7ZA 3G5TA 4XFDA 3AB8A 2G1PA 1C30B 1QF7A 3D4BA 5DYIA 5ES4B 3OEWA 2O8NA 2R79A 4F97A 4RORA 4AFNA 4IFEA 1W19A 4DWVA 3FMGA 1Y98A 3DNPA 2WZBA 3JV7A 4IJUA 5HIJA 3EGCA 1II9A 2A0KA 1WPXA 1EE9A 3CKYA 3TMKA 4XAQA 1JHXA 2A0WA 1DJPA 4NJMB 1DAPA 1OXXK 2B1JA 4LNUB 3G0CA 4GPIB 1IM8A 2A9KA 1MF7A 4W5HA 5BWBA 4LCEA 4M87A 4DIOA 1RI1A 3T15A 1K5HA 1U8TA 1TQDA 3FNRA 4DDKA 2Y68A 4DF3A 4EJ6A 1PL7A 4OLJA 1JDUA 4X62B 2IEYA 2MYUA 2LR0A 5J4HA 1A77A 5HZGA 2CFSA 2YYAA 2HQ1A 3NT5A 3IAFA 4MWSA 5KNBD 3AVOA 3C4VA 3PS9A 4YS6A 5LD2B 1HT3A 1LPNA 2HHAA 1ACLA 1AZSC 3DV0B 3O4FA 3BGDA 3BXHA 1ZR2A 1XEXA 1FTYA 1IZ7A 1SG0A 2AGVA 2DJ5A 4BFTA 5HK9A 2OZLB 1F3OA 2PLAA 4O2LA 1EA5A 5KTTA 1IH8A 1FX1A 5BSRA 1QANA 1Z6YA 4MKFA 4RKEA 1GZDA 1MQ8B 2W98A 4RXMA 4XVHA 1S8FA 4F11A 3PLAE 4OMUA 1W59A 1OBFO 3GAMA 3FMPB 3IKLA 3KZXA 2BM8A 3KQLA 1VYVA 4HEA1 3OECA 3K9NA 4POAA 4ZN6A 5A1TA 5LQUA 4I1PA 3GCWA 1T0IA 3OG9A 4D4GA 3I9MA 4KQKA 4FYPA 1H85A 2A57A 1R9NA 4MR7B 4N65A 5JT1A 1UMDA 1OE0A 4ALNA 1HTWA 4L15A 2CFOA 2F9FA 2FU5C 2PL1A 2BEVB 3WGJA 2ZJ6A 3EC1A 3HDQA 5CYGA 4IQFA 2LKDA 2J3JA 1G3MA 4UBKA 1T2EA 1P62B 4LQLA 1IUKA 4ZO8A 2QRNA 1SPXA 2J87A 3A70A 4XEHA 3GAZA 2BKUA 1GUAA 3VR4A 1JH9A 3AF5A 4K9PA 2LCFA 5KVAA 1Z5NA 4Q3EA 2G9NA 5D01A 4DCUA 2I2DA 4DM7A 3GFVA 3SHWA 1NSYA 5JVDA 1HM5A 3B12A 2QTHA 3TGWA 3ETLA 3VU9A 3IRVA 3B1WA 3ZXUB 2BGKA 3M83A 3D5TA 4QSMA 5EPOA 1PS9A 1W88B 4PYNA 4XVRA 1VG8A 1Y8RB 1LRKA 4IDAA 4I1YA 3L49A 2VSYA 3OZGA 3C6QA 2GD1O 4JJ7A 1D5CA 4IXNA 4TTRA 1NG1A 5CT9A 2XEDA 3IJRA 4EB6B 2H59A 2C4UA 4DMFA 4XPIA 4R40A 4AJ9A 5A4KA 3GRCA 2B4RO 2AJ8A 4OHOA 3UK2A 4Z4EA 3KQPA 3ACDA 4NHOA 1XCMA 5SY6A 1DXHA 1GT91 3NTUA 3SZRA 1F2VA 3ZTWA 1OA1A 2YY7A 1GQ2A 3V97A 4CJXA 3ZWCA 3MUFA 1CD5A 3AHHA 3BOSA 2HDHA 4WZZA 5FO1A 5AVOA 4QOIA 4WY5A 3X44A 2CVPA 5INTA 4PHGA 3DWGA 1B8VA 2OGWA 3E8SA 3LDUA 4PPFA 5L45A 4KE9A 1GVNB 2JFXA 1A9QA 2ZWOA 3LZ6A 2C20A 1KI9A 3G2HA 3OPNA 3LXUX 4QO7A 2W2NA 1LS6A 3DZCA 2H16A 2GS9A 4D92A 1G60A 1VBFA 2FRXA 2Q6VA 3WK9A 2F8TA 4ZO7A 5FPHA 2G77B 4HR7A 3KALA 4PC1A 3ZVMA 4OAOA 3VKGA 1K06A 1QGZA 5FBWB 1DG3A 1ZD4A 1P1FA 1DKPA 3MS2A 1K97A 3FWPA 1CQXA 4W9RA 1ZDMA 3K1YA 2H00A 3IQIX 3KJIA 3FSJX 2J45A 3MWEB 1QCDA 4E1VA 4WZAE 2APJA 3EFOA 4AUEA 3CNOA 5K5EA 1Z37A 1X1BA 2Z58A 1EX7A 2CL5A 3SYMA 2XCUA 3H4VA 3LK7A 2O14A 4JA2A 5HE9A 3WLHA 1Q14A 1W5FA 4L1KA 1UXGA 1RC8A 3CUUA 4S04A 2OO3A 1YCGA 2RKOA 4OVKA 3C3WA 5AVJA 4XRGA 2HPZA 5C8YF 5IYZB 1M2FA 3MWDA 4M0DA 3C5EA 4OBXA 4Q4LA 5DNEA 5AESA 1PJ8A 3K5HA 5IZ4A 3KQHA 2ATXA 4EYEA 2WMOB 3UO8B 1N57A 3IVRA 1KZ1A 1IHYA 1WB4A 1DUVG 2DFNA 3A9TA 3KQWA 4DEXA 3PWZA 4C2TA 1GRRA 3W5JA 1HFEL 4WWHA 2YWRA 1ELOA 3E9QA 1ABFA 1Z62A 2J9GA 1MU0A 2G9ZA 4HWOA 4PE5B 3ISVA 5ALYA 4BAGA 4EHJA 1BU8A 1NVDA 3N2KA 5CBKA 3GJQA 4G0WA 4ZCIA 4B82A 1X15A 3ENVA 1KAOA 1STOA 2R1VB 3IYLW 3NHPA 1GKIA 2XT9A 4V1CI 4Z4IA 4F38A 2HLHA 3NRJA 5KAPA 2H4WA 4GI1A 2KE5A 1SHZA 1SG6A 2YW2A 1BEEA 3ZYCA 1L7PA 2ZRNA 1U4SA 2DHQA 1LPMA 4P82A 4R71A 2HMYB 3D5QA 1ZVMA 4AK9A 3V6MA 5A4MS 2WI8A 1Z38A 1DC8A 2GTPA 4W6QA 121PA 2WYIA 4KPYA 3JS5A 5JAPA 3N8IA 4G4GA 3CLTC 3DDZX 3UW1A 2Z1NA 5ALMA 3WZ2A 4KREA 4QGFA 2F9MA 2WV9A 4M9CA 2VP0A 3VFDA 5JAZA 1KHHA 4P8RA 4NXNB 1JG3A 1Z2AA 1PWHA 3MT0A 3N59A 2RGEA 1GPJA 2H1WA 1S2LA 4Y2JA 2OXEA 3EE6A 3ZVNA 1R0KA 2GZ2A 3GAAA 4WJZA 1PSZA 1FFXB 3A31A 5YASA 5KYWB 5EQDA 4EJ2A 4KBFA 5ALNA 1L5NA 4F8EA 1XPUA 1LBHA 2R8XA 3H4MA 1VCNA 5JMTA 3E9RA 2Y77A 2RHDA 1V7CA 2PR2A 1E3MA 1QDEA 5KTKA 2FRVA 2PN1A 1J0CA 4CUZA 3TIIA 3IJ5A 1E63A 4OMDA 2GH1A 3O83A 2C9ZA 4DT1A 3U80A 1XQXA 4ENRA 1RYDA 2I4LA 2YXPX 5BQOA 2ENWA 1OV4A 2MSWA 1JPNA 1I5EA 3KS9A 3I4LA 3AXSA 1JZTA 4UE2A 1B8PA 4A73A 4QATA 4BDSA 2WDZA 5CVUA 2VYVD 4R1OA 4I66A 2VXBA 1K8RA 3EW7A 4M36A 3ZW7A 2RHBA 4F4DA 4Q19A 1KJNA 4Z4HA 2I2FA 4XTCS 3VYUB 1COWD 3N8DA 1FP4B 1P2DA 3SF8B 2IDKA 1E4OA 3AERB 3TL6A 4WVFA 3HI6A 1SOVA 4FILA 5AJUA 3MF4A 3WL3A 2HBZA 1Z4IA 4HN9A 3ZY5A 3OF3A 1M1NB 1YI0A 5H3HA 1KSHA 3MGBA 3V32A 2CLFB 1W2HA 3IP6A 1MEEA 1ODSA 3H9EO 3PRYA 4FOOA 3EEIA 5CAEB 4R2XA 5IH3A 4BO5A 2IH4A 4K6CA 2OQRA 2Q5FA 4LVUA 1PD0A 3I6ZA 2V7XA 2H52A 1MLDA 3KLPX 4Q9NA 3ENNA 1I24A 4J3NA 5CIYA 3UJ8A 3UMCA 3H1BA 1DO2A 4MB0A 1K86A 1P4GA 4WZ6A 3VI3B 3RSLA 5IT5A 1SRQA 1E7SA 2CSUA 1NL3A 3C6MA 1NW9B 4LOIA 4Y30A 5M34A 4UFNA 2C95A 3IAM6 3UANA 1VXRA 1EFRA 3HDTA 3E4CA 4PF1A 4DG5A 3AM1A 1EVYA 5EY5B 1EUDB 1WR8A 1J6UA 4PG4A 1XZBA 2EKLA 4URFA 2C0PA 4E3ZA 3KQYA 1GR1A 1C0IA 3IDZA 3MMZA 5CP8A 2FG7C 1ZD1A 4EEXA 1YRLA 1I2ZA 4P58A 1YHZA 3W5BA 3HN2A 2YICA 4UVHA 3ZHRA 4JI6B 4N5IX 1T5DX 1KO7A 4AJNA 2PD3A 4X9XA 1I4DD 3QENA 2R1UA 3DWFA 2J7PD 5JRDS 5JSYA 1UOQA 5FOTA 2ESRA 1B6RA 3DOJA 2GNAA 2QI9F 2VUUA 4P98A 1RLJA 5AMXA 4G85A 4E5UA 5LL6P 5SV2A 5FLEX 3VO8A 5AVXA 1AKWA 1BE0A 2VUHB 3ZZMA 1H5QA 1OILA 3STYA 4FFMA 1S2NA 4Y1EA 3LRTA 1ZGGA 3D2CA 2Z2KA 4UHKA 3LDAA 2EJUA 2WFZA 3U9LA 2GM3A 2QHXA 1A71A 3U7FB 2CEKA 2YFHA 1VFPA 2BFEB 3JD2A 4TTPA 4WK2B 5EESA 3RG8A 1BWSA 4V2IA 4B7XA 2HHHB 4QASA 1S4MA 4X7BA 4B81A 5T4BA 4EJSA 3MPOA 4Z54A 3VC2A 2QTLA 4X7RA 2DUJA 4P7KA 4D6YA 1HDIA 4MI6A 2FPSA 5CDFE 3ILYA 1TKAA 2I87A 1YL5A 1R6TA 1XLTC 3KPWA 4R1TA 5AT1A 2OCLA 3BIOA 1JHPA 3GJ3A 4EPWA 1DUIA 2EWVA 4IDEA 4C0LA 1AKTA 1X70A 3L07A 1I7QB 1BVHA 3ANXA 5LC1A 3A4VA 3Q3GE 1PRYA 2XYQA 1RS0A 1XCGB 1ZL0A 3VTKA 3FF1A 4RESA 3RC3A 3REQB 4GNKA 3EG9B 3HCOA 4CIVA 1PL6A 1LSOA 1C3XA 2YHIB 4TYWA 2RI6A 1CBUA 1JLHA 1V4BA 1TLTA 4UULA 3ZGZA 3ZWDA 1HDOA 2ZFUA 1DOHA 1EPUA 5BV1A 2FWIA 1MJGM 1Q0SA 3DFKA 1KBOA 3TOVA 1RWWA 1VL8A 1T24A 1XZIA 1GQFA 2VKQA 3DHNA 3F3MA 1B41A 1G2IA 1Y4UA 3GP5A 5JCJD 1A69A 2GO7A 5AOVA 2R6FA 4UUAA 2OC4A 2Q49A 1R6AA 4KXXA 5CTJA 3WAJA 4LK3A 5AJYA 4EBBA 4Y18A 4A8JC 1C3OA 1B1AA 2PK3A 4IF6A 3CVXA 1XL0A 1X2BA 2E37A 2ZBFA 1PNOA 4AF8A 1H2AS 2JCXA 5LZ8A 4PN3A 1A98A 1JTVA 1MO5A 2V6IA 4E21A 1FIUA 3DLBA 1R9MA 3IO5A 4RY0A 5DYNA 3X43A 3MVEA 4QPNA 2XB9A 4LWQA 1TGYA 4H18A 4BMPB 2N3ZA 3V4PB 3IESA 1FX0A 1YC5A 2PKRA 1R0XA 5CX4A 2FE4A 2CW5A 1V26A 3PWKA 4WNAA 1GAJA 5K03A 4QQNA 1N3LA 3S2FA 4EQ6A 5K0FA 3ACBA 3P5SA 4J7CA 4EF6A 5CVCA 3U61B 3K32A 1ENPA 3FXAA 4XCVA 2J31A 2P41A 3A2NA 3R75A 4YFYA 2Q4EA 4R3NA 1E2JA 3RSHA 4E09A 2IOQA 1OXBB 4EW1A 1I2BA 4RPGA 4F3TA 5BW5A 4GR4A 3RADC 1JG6A 3RVMA 2IHBA 2GLUA 5C1BA 1Y5MA 1E0JA 3KR2A 4YCMA 1LDEA 3FLBA 1ZA2A 4HWPA 3MTEA 3WMEA 4HD8A 1KYYA 5B1HA 3H7AA 3WIBA 3DZ8A 3CLUC 3Q3EA 3OMLA 2OBLA 4B6JA 4JVOA 1EFAA 2EDCA 4TVBA 1TK3A 2YJNA 5IJAA 4YRBA 3MCZA 1N6OA 3ZU6A 2NAFA 2J41A 4J16C 5FWDA 3RVPA 1T9DA 1MX3A 3IAUA 1CZNA 1FQJA 3KSMA 5HKLA 2ZI6A 2O3TA 3R44A 4MQ5A 3HB1A 1X19A 5ILGA 1WNFA 2C5HA 3BA1A 4JJEA 1VCIA 3RT1A 2WU1A 1RPJA 3NVDA 2ZIZA 1CY0A 4GUDA 3PXBA 3TPFA 2Q6KA 4P7JA 1Q5PA 3QSGA 1FSZA 1WKVA 1SCJA 2DUNA 4DMGA 1SIOA 2KB0A 4MV7A 3VNSA 1W36D 3RAFC 2X23A 1FJ2A 2B92A 2DWPA 4PGGA 4AJOA 4EMUA 3UUFA 2QPAA 2HK7A 3B89A 5BV0A 4C7OB 3PHLA 3I1YA 2IELA 1PD1A 2ZREA 3RUPA 3BK2A 2CT8A 1P9RA 5IAOA 1A5BB 2W83A 4FFLA 3IEUA 2XJ9A 5U4QA 4FMBB 2Z4SA 2NYVA 3ADCA 3SC3A 3PB3A 3H11B 4W8HA 2V4UA 3BD6A 5EJGA 2PH5A 4O33A 5KKCA 1IPHA 1VZ3A 1ZMRA 4M0MA 1HEUA 1E6UA 1KI7A 3Q88A 3RKRA 4A1FA 5B6JA 3S5UA 3I45A 4N7RA 4D5EA 4PBRA 1OYYA 3QELB 1X80A 4C30A 1IQPA 2RGAA 5JTUA 2CXSA 3BJRA 4WKBA 2H48A 1WHTA 2X5KO 1K2WA 1V1RB 1Z7GA 4PQGA 4V03A 3ENQA 3DCYA 2OWDA 2VNJA 1ZM3A 3PYLA 3V1YA 3ESZA 1VL2A 3WADA 2Y6UA 3DT6A 3O95A 1YZHA 3GGGA 2BEUA 2CLHB 1H2BA 2J3DA 3B3QA 4HGNA 3A9CA 2NUAA 2WUVA 4HLDA 5CHEA 5DP2A 5CCBA 1HE3A 4TWIA 3R7WB 2YINC 2O50A 2IXBA 2Q4TA 2GVNA 2WAYA 2ZYGA 3ABQB 3DMTC 3KQUA 5J4LA 3USES 4UVEA 1L5KA 2PZKA 4U2KA 4L02A 5K6TA 4TRJA 2OENG 2ZIEA 1SC3A 4B6SA 1JR6A 1KAMA 4ZVLA 2O1XA 1ESEA 1JBKA 3LRPA 3MCWA 4ENVA 1RZ3A 4N3CA 1ONBA 1SCAA 2E5WA 4LDAA 3PJGA 3OO1A 1SUFA 5ECDA 1PSWA 3GYBA 5TPWB 3EEQA 2RC5A 2G04A 3EIEA 1QHSA 4PTLA 1GTZA 2BFFA 2I67A 3PC6A 3GLIB 4M22A 2ZT7A 1R9JA 5BSVA 4TS3A 1SMKA 1X7XB 4AX4A 4LI0A 1VCMA 1ENYA 3OLXA 4ZHQF 3Q72A 3TLEA 3SQXA 3VR6A 5DULA 4PZYA 3ROPA 2XB4A 3TOSA 1D4OA 2P35A 1NZFA 4D8WA 3O7WA 1PDOA 3FZYA 1FUEA 4MWTA 1C3JA 2FPRA 1YUNA 3RGWS 3B52X 4E3WA 3AVVA 2CJFA 4DPMA 1ULTA 2HJGA 2W43A 4QGGA 2JZOA 2PPLA 1QLJA 5ED4A 4Y7DA 3HR4A 4CKZA 1F8GA 3ZW8A 1N6PA 3HSKA 4MAMA 4LC0A 3G6KA 2H2HA 1BH6A 1PFQA 1U0GA 1N2OA 2GA9A 3MWGA 4MRAA 2A1TS 1T3HA 4WFJA 1YJAA 3TS1A 4ZJYA 1VRWA 4OQPA 4KXVA 1OTYA 3GLRA 1VPVA 2Q2VA 1I6MA 5HP4A 2XHZA 2ZTHA 5CFNA 4B3RB 2EWMA 5EG5A 1W49A 1G0OA 4PGMA 4IIYA 1ECFA 3PQ4A 2GVDC 2IF0A 1G21A 1JALA 2PJDA 3GZNA 1QH8B 3K6RA 3QKRB 3S2UA 3WLIA 4J7XA 4W5TA 3JZAA 4J3JA 4EW6A 3LC2O 3OX2A 5IT0A 4HYEA 1XO1A 2OV2A 2V96A 3GEIA 4RVNA 2P2NA 4AX8A 3NRCA 5DBFA 4NAUA 3CEMA 1PT8A 3JASB 3L8CA 4B7ZA 1T4GA 4B7AA 4FGJA 5T57A 4PSDA 2XGSA 4UEOA 1G0NA 4G81A 4HEQA 1KMCA 1VCOA 4KN5A 1PFYA 4ND8B 2H1HA 3FUTA 4LC1A 5FUMA 2MTBA 2VPTA 4PX3A 3JD0A 1YASA 4YJGB 4XUEA 3ZCUA 4YCSA 4Y1GA 4DV4B 1IUOA 1UBNA 3DA8A 3M3DA 1I5OA 4LF9B 4LECA 2FW9A 1W0KA 2BJWA 2HQOA 1JAZA 1GT6A 3BRCA 3BXFA 3HJHA 1M1YA 2XQFA 1ZJ4A 3T95A 4BNFA 4Z3DA 5CX1A 3QXCA 5A4FS 1Z25A 1CDEA 3AEUB 3P71T 1ZMXA 2CJWB 1E66A 4HUQA 4ND2A 5AKKA 4H3KB 3VZRA 2YMQA 1RC0A 2BEKA 1QZXA 2Y3IA 3NTQA 1F6WA 1W0CA 4Q7EA 4UBIA 3FZNA 4FUQA 1REQA 4DIMA 4TVSA 3QHAA 4TZ6A 3BMCA 5HGXA 4IS2A 4HQ0A 4ARIA 4YQEA 5JNVA 1YQDA 5D6OA 4WOPA 1IYZA 1AZWA 4LKRA 5G4KA 3IIKA 1KE2A 3USZA 5JQGB 3H13A 4LWZA 2UZ1B 3QTBA 1IJKA 4R41A 4C9BA 4FYJA 1X8JA 3LMKA 2CVQA 1QR6A 4OGWA 1XK6A 1C1YA 2W22A 1NTOA 3A0RB 2IU0A 1LK7A 3TR0A 5BN1A 1L7AA 2Q5OA 3H9GA 3IP8A 4GI7A 3U49A 5JYCA 4V24A 3RYIB 1IY8A 1E7WA 2W2KB 1FRNA 1KC3A 3ROEA 1FDRA 2FUG6 4AZ0A 2A1UA 1Y1LA 4UDYX 1OLUA 1QIDA 3CE6A 1GTL1 2Q1TA 1E96A 1ITZA 1UKVY 2LV8A 4NS1A 3IKVA 1K8XB 4M9ZA 5TT1A 4G8CA 5DYWA 3JQ7B 1XZJA 3PEVA 2II6A 5TQ0A 2VDPB 4AO7A 4W7IA 4M1MA 2IU4A 3R76A 3O4JA 3FSGD 3G9UA 2GN0A 3RRXA 3F2IA 2IH5A 3V33A 1YOVA 4HXEB 3K0SA 1VYUA 3P0HA 3B1YA 5IKXA 4R1SA 4HS9A 4WL0A 5H4HA 4B3GA 1D5WA 4HQFA 3LF1A 5IP5A 4F9EA 3QVXA 4PYQA 1X8XA 5DU2A 2IX3A 1AKRA 1Q0PA 2OEPA 4ALMA 4YLEA 5FAKA 3U40A 1ESCA 5CT6A 4F3RA 2R84A 4FR2A 1EUYA 3IP7A 3C48A 2A2ZA 2JDID 2QP4A 1GRCA 1JDVA 2O1EA 2XECA 5CB4A 1ZN8A 1JG1A 1LTHR 4CF3A 1KF0A 4EL0A 5K0TA 5EZSA 1HDCA 1XFAA 1E9SA 2O8VA 5I51A 1CXZA 1Z4NA 1E3WA 1YNOA 1C2TA 1QX3A 3M6AA 4JH0A 4JC8A 3UHJA 8ADHA 4QAJA 2QQ0A 1KTVA 4B8YA 2WJZB 3K0FB 1CIJA 4KLNA 3TLCA 1HDZA 3PR1A 1XXHA 1H5NA 3KHUA 3BFVA 1TCUA 5IASA 2YWHA 1AHNA 5IVPA 1P44A 3CS3A 4RNCA 5CU7A 3DBHB 1HH4A 1SRRA 2EKPA 5HEKA 4H1UA 4KWCA 3DGFC 1V9SA 1BHO1 3HZOA 2H18A 2PJUA 4QGHA 2YWGA 2WIAA 1A8IA 3DEAA 3RIGA 1GZ6A 1XR3A 2B34A 3S5JA 1T34A 4FC6A 1ODLA 2R5FA 1DEAA 2X4IA 3WYEA 5KSOA 1RQ7A 1YZVA 1N3YA 4R9UC 3VH1A 3QHQA 1D4FA 3OIUA 3SN6A 5LOVB 3W2FA 3ILSA 4TYPA 4WCFB 1C9MA 3TINA 4FW8A 4Q9HA 1AXGA 3GLFE 1X7ZA 2Q7XA 1P8AA 2G5PA 2V8OA 1ADCA 2RGCA 1I3MA 3RSQA 2I54A 3TLAA 1WCXA 1JVBA 3DXYA 1I0LA 3DBIA 3EN0A 4OYYA 4V0SA 1OC2A 2PD4A 2A9RA 3R5HA 4XIJA 2X0FA 1GPYA 3GEPA 3AR5A 1U0JA 3GA0A 1Z22A 3EG5A 1EM8A 2VJDA 3Q5GA 4D9GA 1VSUA 4Z6KA 2FFJA 3U5TA 3EPLA 3FPFA 1QX4A 1P74A 1KJJA 2IXAA 2ZVQX 3F3SA 1FNDA 1I2DA 1D8AA 1POXA 2I4IA 4FDLA 4Q1BA 2EGUA 3E27A 4X1YB 4C0WA 3DEKA 1GSHA 2RK6A 1EGHA 4J1NA 5E1BA 2CL6X 4UMDA 4HN4B 4KMMA 2P9YA 1NE2A 2FEWB 1S2DA 2ORED 1XCJA 1IWBB 1Y7TA 2IUTA 5D5HA 3SDZA 3U3XA 1BWQA 4S35A 3IE1A 4O3MA 4NBVA 1J8DA 4D45A 5C4MA 1T43A 4MV4A 4LYHA 3BSSA 3A9WA 4KLZA 1S5PA 3ELDA 3TMYA 3HBMA 3U3RA 2X4GA 1NYRA 1YMQA 1ZSVA 4MWZA 5A6SB 3VSEA 2WNSA 3HR7A 4Q34A 1T5LA 1RQLA 4NP6A 5H1YA 1J49A 2HXYA 2C8VA 3IBTA 3BM5A 4GC9A 3RLFA 3E23A 5ELMA 2UV8A 4YI5A 3LO5A 1LB1B 3DTVD 2IW1A 2BGNA 2MSCB 2YXDA 5KYTA 2F9LA 2N9UA 2XCSB 4ONEA 5BWLA 4IZHA 4YAWA 4WOJA 2X1HA 3EBLA 1XMOB 2HRCA 3RVJA 1UQRA 4PZ0A 3GLGA 1P4HA 2RBKA 1UL1X 4DSUA 4TTIA 4WINA 1KSJA 2G0NA 4RACA 2AXPA 3ZWQA 3KZVA 5A5DA 3OQJA 4OSEA 4EG7A 2WJHA 2XGOA 1S7GA 2ZRFA 2EG9A 4EO9A 2H4YA 4QBHA 1YXMA 2QSZA 5HCNA 1U2GA 2YV5A 3GZ4A 1HNZB 1C8BA 3DMTA 1LK0A 1UJCA 4M37A 3DSRA 5E3HA 1U94A 2PWPA 2FWPA 4PZ9A 2NGRA 1B74A 2AJLI 5FI0B 3PC4A 3RBVA 5B6IA 2UXBB 1H6BA 2AMVA 3BWBA 5CPBA 1A8SA 3D5EA 3LU1A 4TWRA 4NXMB 1XCOA 2QMQA 4EOGA 2MHCA 4NEQA 4I1OA 2GD6A 5JSKA 3W3AD 4HX9A 4OHCA 2EHDA 3X2FA 3T5CA 2BT4A 1PG5A 5BNIA 1ESMA 5CTAA 4YPFA 1G21E 4OM7A 4BC0A 3N3BC 4QSHA 1EESA 3OCUA 4CPDA 1ZCBA 4ZI7A 3TRJA 4BO2A 3S2SA 5B57C 4HP8A 2HA3A 3SR0A 1Q0LA 2OMKA 3P26A 1OJLA 4QICA 3A4NA 1RZRA 5IKOA 1LDBA 2HXSA 1ZUIA 4F3YA 2ES4A 1XRLA 3PDIA 4JI0B 4B79A 1KK0A 3PZRA 2X7XA 3KPVA 4JXJA 3S2GA 3G0IA 1TRKA 2Z8XA 3S1AA 2VRBA 2YY6A 2GO1A 4LKOA 1XDSA 4YTEA 3KOYA 2Y92A 4Y1RB 5FWAA 4FYHA 1QG0A 3UKJA 1UIRA 2QE7D 1HQKA 3CZPA 4H7PA 2A33A 5LP6C 5DSTA 1QC5B 5CVJA 4LVOA 4N3BA 1KI6A 1XA4A 1VP3A 4UPDA 3X1DA 3G2KA 3KKQA 3GOQA 3GJTA 3HSSA 4GOOD 3F3YA 1Y33E 4JASB 3GG2A 2PQ2A 3K4HA 2JIMA 2WHPB 4BN0A 1XTVA 2B5VA 3SOPA 4EL5A 2Y6VA 4NYJQ 4BJ6A 5KJCA 2QX9A 5BVGB 1IEQA 1VE6A 2JAOA 4TV9F 3ZEIA 1ZCJA 2DWOA 4ZOQI 1ECGA 1P1KA 2OR3A 5F7OA 1N7GA 4XJXA 3EGDB 1G4AE 5JI3E 4B45A 4ZANA 3KDSE 3JR3A 2PWAA 1JDTA 1OXSC 1UEJA 1NNLA 2RHGB 4TYYA 1BXGA 2REOA 5LLTA 4EHNA 2VK2A 1T2VA 1EDOA 1ZU5A 4NE2A 3AEZA 3WSWA 3IMKA 3ABSB 1WJGA 1R5BA 2PMFA 2QAJA 3FIUA 2IP4A 2IW3A 2GJSA 1E1MA 3EXEB 3PICA 4V0OA 4ZAGA 5LA6B 4DCMA 2H1OA 2BBTA 3MJVA 4BXOB 1UK8A 3GJ7A 2J6HA 4ESHA 2NIPA 1RYHA 3HFRA 1AMOA 4GOXA 4D1YA 2BLNA 1VC2A 3BAFA 2AZTA 2PO5A 2XVAA 4JUCA 2BEWA 2YRWA 4OY3A 4CG0A 1M1UA 2JS7A 1ESNA 3A2KA 1K2VN 3D8TA 1G6Q1 1YKFA 2C00A 2Q3EA 3G59A 1C4OA 4L4ZA 3I2JA 3UOGA 3WMWA 4ARBA 4EATA 4PHHA 4PYIA 5D8DA 3KSDO 2GCIA 4GZ6A 1PFGA 4Z1MD 4I55B 1KO5A 4KOAA 1E61A 2GBPA 3FPJA 2O2XA 1U6IA 2VDWB 3G7SA 1QPGA 3GEBA 2UYCA 3ICOA 5KAMA 3RUFA 2CVOA 3GGOA 4F1KA 4GMGA 2PT9A 5CHYA 1X94A 3MYRA 4OK5A 5EWLB 3UWOA 4BRUA 4D9FA 4EMBA 5IJ0A 3Q7QA 1BFUA 4ZQBA 1WB6A 3QE2A 1HEYA 3UWPA 1T1GA 2HA2A 2VJMB 5EE0A 5F21A 2IGBA 1UBTS 3HCDA 4R8KA 4I4CA 4EITA 1DKNA 1RMTA 3FCOA 5TGZA 1E1QA 1XSEA 1MCZA 1M5TA 5JDIC 1ZGAA 5T6BA 1U0SY 4TLLB 1T3TA 2GZMA 5J5CA 1NGSA 2H5JA 2HV8A 2RKBA 3Q5DA 3QQPA 1IC6A 4ZXFA 2Q6LA 3P2KA 2ORVA 1CR4A 1QYRA 3IXLA 4YP0A 1E3QA 2ODQA 5FI1B 1KH2A 4X1KB 4X97A 2E0IA 2QMOA 1V8DA 3FFWA 4RV9A 4IMIB 4JT2A 2CLDX 3N0TA 4OHXA 2JLSA 2IEAA 2M6KA 3CLUD 3K4PA 2WR8A 4MW9A 1RYZA 3K9GA 3QF4A 1YI1A 4Q9KA 2R44A 4R8SA 1BYUA 3MA0A 1EK0A 2C5EA 3DS8A 5L3QB 3E9EA 5H4GA 4U0KA 5DCUA 3U4CA 3RKSA 3V4FA 5TARA 3WMFA 4RDXA 1YMVA 2GF0A 2MT9A 3C3JA 3A2LA 5FI5A 1D6NA 3QX7A 5DCLA 1GU0A 4B75A 3UCXA 2ASVA 1J99A 3PD0A 5JCOC 4PO9A 4XR9A 4BYMA 1JSLA 3JQAD 2I7TA 3UB2A 4V1CA 1I4OA 4F5YA 3BT7A 4ZQHA 3OCXA 3VR5H 1N7IA 2VWPA 2XITA 4HEJA 3QKSB 2WVGA 1U0BB 2B7BA 1VE5A 1RQRA 2CYAA 4JEIA 4RA6A 1XXLA 5JALA 3OQOA 3A27A 2VHQA 1ZRSA 1EDDA 1DBSA 4QAQA 1ZOLA 2QZ4A 2PZBA 4MV1A 1L4FA 4RTLA 5JD4A 3GLFA 1PUXA 2G4LA 2OHGA 3V1NA 4ZHSA 1SUIA 3ZYZA 1WVGA 5LWHA 2Q3JA 4ZKEA 3ZTYA 2JZCA 1Q19A 2PG3A 3ROMA 2I6TA 1MB2A 2R25B 3DL0A 3BQ9A 2C5SA 4NENB 1FY2A 4ZK6A 2AE2A 3QY9A 4Q48A 1SN7A 2ZATA 2AMJA 3K53A 1NP6A 4FYMA 4C5CA 3WLPA 2Q9BA 2IEBA 3SX4A 1MTOA 1TAUA 2XTJA 4GXNA 4N18A 2JD1A 3SC2B 1NURA 4U00A 4RETA 4C0KA 5K8IA 1V8OA 2OO5C 1AA9A 1JMVA 5EIEA 4HDSB 1JAHA 2FEKA 2OUKA 1AS3A 2G9UA 2WT8A 2XTAA 2ZB4A 2IODA 1BGVA 4FMCF 1QVZA 2D2EA 4HDOB 3KYJB 1ZCZA 4GR5A 5DB4A 4O4IB 4YDSA 1EB8A 1KDPA 2IHUA 1GRVA 2A5GA 3ETHA 1IHPA 1IB0A 1XEAA 2UVPA 3RD5A 3D6NB 4KO3S 4Q03A 4DR2B 3DC7A 5FDFA 2OC9A 3FZGA 4MB2A 2DCMA 4C5BA 1FU4A 4HNRA 4U7PB 4PG7A 1AG9A 1HX7A 4HTFB 1ZESA 3PSAA 1XDZA 4LYEA 1CJVC 1IY1A 2MYNA 3NEYA 5KX5F 4JLOA 1NW4A 4BNKA 1JG7A 4BQSA 4HAYA 1XZ8A 3WY9A 3QEJA 2V55B 3Q3VA 3LT5A 4UEKA 1JFVA 2AOWA 4RK1A 2VJCA 3CVJA 3I1FA 4J6FA 1SUSA 2NSYA 4DCOA 4EKIA 1DUSA 2ONCA 3L41A 2PUVA 3GN2A 2QX6A 1SBTA 5FPQA 1Y5RA 2SICE 2ADMA 1ISHA 4J0CA 1RAFA 4PGHA 4ZIRB 1WQ4A 3CPSA 4LISA 2PSSA 3W1EA 2ATCA 2Z8YM 3CRRA 3AVXA 3B13B 1VPEA 2ATEA 2CDNA 3BCSA 3TDKA 1GU1A 1XPRA 3FKJA 2HM7A 4JLSA 1T2UA 3EXFA 1MNAA 4FS3A 5C5IA 2PGAA 2V6GA 4MP8A 4YAOA 4B3BA 1MFZA 4XW2A 4ZI2A 4LA4A 1PW5A 1XTJA 1SCBA 4G5SA 2JFNA 3V4ZA 5C7YA 2H5EA 1USWA 4I6JA 2XPCA 1XQWA 4QYTA 2AWOA 2QTVA 2QV0A 4X00A 1QWSA 2EBUA 5JD6A 4RIEA 1DPGA 2ZSEA 4MHOA 4ZCLA 4DV7B 1KR2A 2MYTA 3DT8A 1CZUA 3DHWC 2LCQA 4B83A 5A3JA 3DEHA 3SQOA 2VF2A 4QREA 4LY0A 4YQZA 5IFLA 1C7JA 2BIFA 2NU9B 1VGQA 3BREA 4Z9FA 1ZYUA 3CVOA 4AMVA 2FXIA 2DM6A 4YRIA 3CBGA 1DBRA 1JE1A 4RLFA 3UICA 2I80A 5IARA 3FY4A 2DJIA 5HZHA 1HY3A 1FRZA 1OKKD 3AM4A 2V3VA 3DFMA 1R0ZA 5BMVA 5HWSA 3ZKAA 1V8FA 3C1TA 4ZI5A 3B9QA 3G0DA 1RNLA 2JFOA 3OPMA 1EDBA 3DL7A 3PXAA 5AICA 4UTXA 3FYCA 2OBFA 1F7UA 1MDBA 3G3EA 3F6BX 5C31A 3V9PA 2EWWA 1JHUA 1XHFA 3CTPA 5ERYA 3WWOA 4BLSA 1DWQA 3B53X 2Q0HA 4N54A 5K7SA 2FPKA 3MFQA 2QL6A 2X15A 3EGWA 3FYUB 2W6JD 2J48A 4FGLA 4BGIA 5BRAA 3S8YA 2HMUA 1BCSA 4GSLA 5DYGA 3LHIA 4KPEC 2AMYA 1HURA 1UM8A 2ZJ1A 3AY3A 5I7AA 5A5VA 4RHUA 3TPCA 3P4XA 1IPFA 3GH3A 2IUYA 4L28A 2R97A 4DJ5X 2HK8A 3O31A 4KFRA 2I29A 2WMNB 2DWCA 4Q18A 3EISA 1DQPA 3LCRA 3CLSC 4GICA 2Y71A 1IUNA 4UHFA 4BP9A 2QTWB 4I3FA 5F9MA 1T35A 3CLVA 4PYMA 1C9EA 2PZ8A 3DE7X 1MP0A 5AKJA 3E05A 2CBGA 4WUTA 2I4TA 2JJ1D 2PH3A 3PVZA 4RPCA 4RIHA 4ZDWA 2GD0A 5CA1A 3EK2A 3IT2A 2G72A 3KT6A 1MJNA 1L6IA 4E5SA 1DL5A 3FOCA 2ATIA 2VTKA 4OA5A 4QDXA 5JECA 2QLLA 1KOLA 5C1DA 1TAGA 3UJNA 2P9QA 3BZUA 2X77A 1E3JA 2IP2A 2YJZA 2FUCA 3GDWA 3L9XA 3OLVA 3OWOA 3Q3JB 4TRMA 4XX1A 4EAAA 1L7RA 1QB8A 4GH5A 3GVXA 2BFDB 3NW9A 4J1SA 1JWLA 1P7PA 3WE7A 2FR8A 3MZ0A 2CYBA 4BX9A 4URVR 2WTUA 1FJGB 4LC9A 4QUIA 2R7AA 1DS6A 1PNQA 4AP5A 4F9TA 5KJ1A 2Z6UA 1LJ8A 2A7XA 2OHVA 3E9DA 4HDRB 4MV6A 2PX5A 4IILA 3VPFA 2ZANA 2KLBA 2H7XA 1JILA 3MAJA 4KZPA 4RMJA 4DNOA 5DO9A 5BQPA 4MK4A 1F2TB 1KVQA 2V5VA 3AKCA 4IS3A 4DRXA 3QFTA 2R85A 4MULA 2XNDD 1BEZA 3L4BA 4CM8A 2JI8A 4RPIA 3X0DA 2JLUA 4CF7A 2PX0A 4HEA6 4OQMA 5L40A 3D1LA 2WE7A 5G0SA 5JH7B 5TVGA 2B99A 2GFIA 2EZ8A 3KYBA 3O4VA 5L7WA 2VATA 1DRVA 1A1VA 2HC9A 3VDXA 4MR8B 4TS1A 1E6CA 2C9OA 5AI6A 1A2KC 3E53A 1Z5PA 3MRXA 4K9RA 1X7YA 3HDGA 4RQTA 1KRWA 2AVDA 4PYLA 5J63A 1JV2B 4EA9A 5KTYA 4QUAA 5FULA 2VK8A 3N0XA 1XMIA 4FXPA 3AL2A 4PSKA 3RHSA 3MWYW 1EFKA 4Z4GA 1TK9A 3RRJA 2JLZA 4PANA 4KGVA 1FFDA 2Z2JA 4DB2A 3MGGA 5AKLA 5FPSA 1AOXA 2ZIFA 4E5KA 1RM3A 3GG9A 2VYCA 3SBOA 5C1OA 5HQ3B 4ZVRA 2ZCJA 4R1UA 5BR8B 4LZLA 1PWXA 2GKGA 1A88A 1KYVA 1EVLA 1RR6A 1UADA 2DTXA 2ZYVX 3T0IA 4DYHA 4EG6A 2N1MA 5IHPA 3U4QB 5DLQC 1E2EA 3RI3A 4A82A 4PNHA 1O87A 4NECA 5IKPA 4QDJA 1T91A 5JLAA 3R9IA 5J1TB 2W11A 4B40A 1XV5A 4KYUA 2QVGA 3HLKA 1GITA 1ZC3A 4G07A 4UTZA 1F38A 1X74A 3SEQA 4LJAA 3AIIA 1L5HA 3WTBA 2XV1A 4AU1A 1KETA 2IBTA 3K2BA 4R3WA 2HIMA 1N2XA 3LXMA 1XUOA 3KSBC 4M21A 4A5SA 1ULSA 2PQ0A 5KDLA 1TU0A 1Y6FA 2Q07A 3NC4A 4JC5A 3VYRB 5AVSA 3TUZC 3O73A 3BRQA 4KIGA 4QZVA 1H3EA 1OB2A 3IAXA 1T2DA 5HILA 5AOCA 4O08A 4H2DA 1DT3A 1H05A 8AT1A 1JKFA 3DL4A 1ORVA 5GM1A 4A8HA 1DIGA 4PX9A 4AMBA 1LVUA 1OWMA 3E2PA 4Y2SA 4BO3A 5K20A 4DBVO 2QD5A 1NHGA 4IIJA 3DE6X 3HNOA 3ECSA 2YXNA 1QCCA 2OCYC 2O06A 4C4SA 3WGYA 1G5TA 2MU1A 2FOXA 1F1BA 2QN3A 3FUXA 4KGDA 4LQCA 5K51A 4FDTA 4IOMA 1QPBA 4AJKA 1JPVA 1NVTA 3RV3A 3SVTA 2B94A 3LFTA 3OLWA 4II7A 3P4UA 1RFGE 1DBPA 2QYOA 4IPTA 4M7WA 5CBPA 3HPRA 1KHTA 2QVCA 5A3SA 3OE7A 2PVSA 2H4ZA 2OESA 4NV3A 3ABRB 4Y6SA 5AK4A 1T9GS 3LX8A 2VVTA 5SY9A 3S7TA 3LDHA 1OCEA 2E4WA 1QNFA 2C99A 1D09A 2JL1A 3AEKA 3E4DA 4KO4S 4R6XA 5AM5A 1R7RA 5GIOE 2GT1A 2G9RA 1UBKS 2H6EA 3AG6A 3ND7A 2PIAA 2VJOA 1B93A 2PX2A 4LOLA 1MA0A 4UE3S 1AT1A 5C9ZA 4G0VA 4DIEA 2VFAA 3GEGA 1SBIA 4GEKA 4HDAA 2ZE6A 1U2EA 4MGEA 2OYRA 3F4LA 5HA5A 2BGTA 4CLRA 1NQWA 5CD9A 4HDNB 2NU7B 2XTMA 3JQRA 5LB4A 1JHYA 4GGPA 4L9WA 1BW9A 2WNHA 3E15A 2WG2A 2BCJQ 3OTQA 2O23A 3IVMA 1KK2A 1CQWA 1QRRA 3I42A 1N6NA 4RK0A 1GU7A 1W4AA 3DBOB 1D0IA 4R9VA 4E2YA 4JP3A 1KH3A 3BPSA 4M3NA 3MJTA 2QAIA 3OKPA 1DAFA 1U1FA 4HTAA 4XRRA 1SOUA 5MN5A 1UBLS 2O57A 2QI9C 4QXPA 4Q9AA 1SKAA 2WJWA 5KNCA 4DHWA 5EJ8A 1JFTA 4AKSA 2NUPB 1JDPA 2ZUBA 3G0OA 4DGSA 1UZAA 4P4UA 2XUGA 4G2NA 4F72A 1MRNA 1Q21A 1L5LA 3HZRA 4LDZA 1IWOA 1W34A 2XUHA 4MUXA 1OHHA 2V7WA 4JLNA 3O6VA 3TQOA 3UGTA 3HCCA 4MI1A 4XWKA 1H6DA 1XDWA 1Y3DE 1GPMA 4ZHQA 4CBVA 3CXRA 1OU0A 4JVMA 4BGVA 3CCBA 1VFNA 4QPPA 4TM8A 5EVJA 4QHTA 4RA9B 1L5OA 4AMGA 2WOOA 3AO0B 4L08A 2EJTA 2Y1XA 1G7RA 1W25A 2QYSA 1G7CA 2GPTA 2CMFA 3OCJA 5EMJA 4Q4HB 2ZU6A 4OUDB 3SU8A 1XI2A 5AQEA 2H2WA 2MSDB 1QIJA 3V6LA 3FNEA 4RYDA 3AJRA 3BGVA 4NBNA 4A0FA 3F4KA 3CCFA 3HVUA 5DCYA 3R23A 4YJHB 1I7SB 3LUFA 4MW0A 2PAAA 4FKBA 3UMGA 3EJWA 4BUJA 1ZAYA 4D56A 5IKEA 1T3GA 5EGNA 3KLMX 3SXJA 1L7NA 3H2SA 4U6QA 1ZQ9A 2IA5A 2X19A 4ZAFA 4DR1B 3INRA 4ZP1A 2YMLA 2OYSA 4MKRA 5DYTA 3UHOA 1HQCA 1JZQA 3BRWA 1ICIA 5B1IA 5BR4A 4K5QA 3LLCA 1HBJA 1VPLA 3GLSA 2RGNC 4W1QA 4AG5A 4BATA 1XYGA 1GO2A 1J5XA 3SVLA 1IATA 1M5UA 2HF9A 2JJ2D 1LJUA 1Y3FE 4IGKA 5G41A 1QZ3A 2QTBA 3EEFA 4MZDA 1JFFA 2JPDA 2QY9A 2FZKA 4JGBA 5ALXA 3K6KA 1E9VA 1SHJA 1WL8A 2C58A 3PC8A 1Y8AA 2OILA 5SZHB 4ACAA 1GGEA 5SYAA 4DN6A 3VBEA 4KR2A 5HTOA 4QULA 4QWWA 4KK4A 2ZIXB 1SFRA 2DPMA 2YV3A 4N82A 4GM0A 3BJZA 4CLOA 3GEHA 4H4CA 3QG5A 1Z4QA 4RCZA 3ETJA 1Z0JA 2YH2A 3A4YA 3K96