3MJDA

1.9 angstrom crystal structure of orotate phosphoribosyltransferase (pyre) francisella tularensis.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
209
Chain Sequence
NLYFQSNAMFIEFALKNQVLKFGEFTLKSGRISPYFFNAGLFNTGAQLATLADYYAQLIIKSDVKYDILFGPAYKGIPLVAAISTVLALKYNIDMPYAFDRKEGVFVGADMTNKKVLLIDDVMTAGTAFYESYNKLKIINAKIAGVVLSIDRQEKAKDSDISATKKISQDFNIPVLAVTNFESIFEYVKENLDETMIDKFKQYRQKYGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotate phosphoribosyltransferase
publication title 1.9 Angstrom Crystal Structure of Orotate Phosphoribosyltransferase (pyrE) Francisella tularensis.
rcsb
source organism Francisella tularensis
molecule tags Transferase
total genus 67
structure length 209
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3mjdA00
4RACA 2H07A 4RABA 4X44A 5ESWA 1P19A 4JLSA 5JSQA 1D6NA 2C4KA 1IBSA 1VSTA 1UPUA 1Y0BA 1A96A 1W30A 5EUCA 1UPFA 1MZVA 3HVUA 3OZGA 3DAHA 4WN3A 4P84A 5KAPA 4RV4A 1A95A 2DY0A 1QCDA 1NONA 4P3KA 1A3CA 1ECCA 2JKZA 1DQNA 1NULA 1V9SA 1ZN8A 1O5OA 4RHTA 5BQPA 1XZNA 1ECFA 1J7JA 4LYYA 5BRNA 3MBIA 4X45A 2H08A 3ACBA 1U9ZA 1L1QA 4WMLA 5E38A 1DKUA 3DEZA 1R3UA 1GPH1 3MJDA 5IAOA 1OPRA 1QK3A 4RHYA 4RHUA 1QB8A 4LYGA 5HIAA 2P1ZA 1JLRA 1I14A 4S2UA 2PRZA 1VDMA 1P4AA 5K51A 1P17A 2JI4A 1XZ8A 1ECJA 1HMPA 1XTTA 2PS1A 1I0IA 1G9SA 1STOA 4Z1OA 5HKLA 4RAQA 2GEBA 4LZNA 5KAMA 4IJQA 1ECGA 1FSGA 4M0UA 2WNSA 3G6WA 4QRIA 4RADA 1OROA 3LPNA 4OHCA 1PZMA 3OZFA 3KB8A 1ECBA 4P86A 1I5EA 4RQAA 2JBHA 1QCCA 3DMPA 3EFHA 2XBUA 1QK5A 4LZOA 3GEPA 1BZYA 3QW4B 2AEEA 1QB7A 5IPFA 5BSKA 3ACCA 4RHXA 2PRYA 1LH0A 4TWBA 4JITA 4RANA 3GGJA 4RAOA 3S5JA 1BD3A 4M0KA 2JKYA 1A4XA 3M3HA 3H83A 1TC1A 4P82A 1U9YA 1A97A 4M0PA 4RQBA 1QK4A 1O57A 3OHPA 1HGXA 1DKRA 2HCRA 5ESXA 1DBRA 1JLSA 1XTUA 1TC2A 1P18A 4ZFNA 4P83A 1G2PA 3ACDA 1ZN9A 3N2LA 4MB6A 5BQOA 1WD5A 1XTVA 1AO0A 2H06A 2YZKA 2IGBA 4P80A 1BD4A 4KN6A 1UFRA 2E55A 4P81A 4QYIB 1OREA 4PAWA 3LRTA 4QYIA 1I13A 5JV5A 1DQPA 2VFAA 1G9TA 1VCHA 1L1RA 2FXVA 1GRVA 1G2QA 3O7MA 1A98A 2EHJA 1Z7GA 1I0LA 4F8EA 1CJBA 4FYMA 3NAGA 3GGCA 1YFZA 4PFQA 1ZN7A 4LZAA
chains in the Genus database with same CATH superfamily
4UUQA 2VJMB 2V45A 1YFJA 2PH7A 3FTNA 1M2WA 1QYIA 1Y81A 2N3ZA 3AGPA 3EXG1 1UC9A 1E1CA 1NVWQ 3DR3A 3GCGA 4H9GA 3GGDA 2ZIUB 1GJRA 4IWYA 4NQZA 2IELA 3D6MA 2PKQP 4UQLA 1B0UA 1Q95A 3BXFA 4XARA 1PK7A 3QI2A 1PEYA 2CFTA 4URUR 4W4TA 3C4QA 1JE0A 2FUG6 2QJTA 4LZJA 5FNVF 1QE0A 3P0HA 3CU5A 2VIIA 1QR6A 1KQ3A 4V03A 1EHIA 4AZSA 1HUQA 3SZ3A 1I3LA 4J03A 2FXIA 1V9SA 4LNUA 4MEJA 5U4QA 3LKZA 1FQJA 1FTQA 4I1UA 4CWAA 3P1JA 4AJ1A 2XVAA 4CZ2A 4DBLC 5KSYA 2ERCA 5L3SB 4P93A 4YYZA 1DX6A 3KKNA 4M1SA 3KEOA 3ADCA 1GADO 3VYWA 3NHZA 4IAOA 3WR5A 3MJDA 1IN8A 2Q7DA 2XA1A 1CVLA 3ZK9A 3WV4A 5GZ1A 2J3KA 1LTKA 1TLLA 1VXOA 1C7QA 4JJEA 1BX3A 4HYQA 1OD6A 4OQYA 2P9CA 1Y48E 4WK6A 3N2YA 4UBIA 1HTWA 2H2GA 4JUCA 3FYUA 4LOLA 3EXHA 3OX3A 1BH2A 2V03A 4D79A 1ZVQA 1ZVKA 4CKBB 5ICCA 3WGIA 1R0KA 1UXKA 4QT4A 1R5NA 1QUFA 2VP4A 4J2TA 4G8BA 3MJTA 4JIMA 4Y2JA 2J3IA 1F14A 4F9FA 1TVKA 2XUAA 3BGDA 1T24A 2VSXA 3I4CA 2ZANA 2BEVA 2P90A 5LVAA 1XMIA 1DJMA 4O1HA 3DEAA 2XQIA 3KV1A 3SC2A 1TQ8A 3ENKA 4ZRMA 3G2QA 2ATVA 4QLAA 1QK5A 4FNMA 2G82A 1KI4A 2X22A 1NVAA 4ZOLB 3UJ3X 3NKFA 2OAGA 4ER5A 4KR7A 3BXGA 5SY9A 2QVLA 4ZOAA 3HN6A 1NT2A 2ODNA 1QQTA 2OFWA 2RFLA 3BB4A 3FHLA 4HO1X 4AXXA 2G0NA 4I8DA 1IEWA 4MAAA 3HU2A 4ZT4A 1BMTA 3T5GA 4ND8B 3U56A 3W90A 1XEAA 2I4NA 1HTTA 2Q62A 3RR2A 1WE2A 3NHRA 1JXQA 1PFGA 3R5SA 4LY9A 4Z4EA 4EAAA 4B2LA 4RKRA 1NFRA 1NVVQ 1IIRA 3JRNA 3JWPA 1VL2A 4HWRA 4WOJA 5DNEA 4Z4CA 4YJ2A 2P2CA 3V4RA 3WQSB 1NI4B 1TFRA 4Z1MA 4C0WA 2FYTA 2FWBA 3WB1A 1JLLB 3CH7A 4TUYB 1E2JA 5J2UA 2IGBA 3AV3A 3FMGA 2LNDA 2W48A 2I7XA 4OATA 4E4TA 1SOWA 1E9BA 4C30A 3SM3A 5F7XA 1CRZA 3D6UA 3EW7A 2QTHA 3OZTA 2KSQA 2DWPA 4ND7A 3NOQA 1QRTA 3W3AH 3WO1A 5DNCA 3IUQA 4CU2A 4F9GA 3R4VA 4NONA 4IV5A 5LU8A 1E3LA 4GBED 3ZNOA 3UAWA 2Y9PB 2HMWA 4LZPA 4JA0A 4XH9B 1E5DA 1NVFA 4U6SA 5HMMA 5TQ0A 4PIVA 1UKZA 1JR3A 2OPHA 5CD1A 3G0DA 1EWQA 2FY8A 2P6PA 3KJIA 3GZTB 4P31A 4RZHA 1NZDA 2ZI7A 4NFLA 4FSXA 5JJCA 2ZP1A 3QBVA 3OZGA 2FX3A 3I6ZA 4P58A 2WM9B 3LU1A 4GICA 4CEHA 2BFFA 5BT9A 2Q07A 2QF7A 4C3VA 4IDNA 2BFMA 3RLFA 1L5QA 1AZWA 1SUSA 5H80A 3S6JA 2GPBA 1NTRA 3DLBA 1C1XA 3CW8X 5LQKA 3UAVA 1VM6A 3D0RA 4YLEA 2VDMB 4XIYA 1QM5A 3P9PA 3RV4A 3S2SA 2J9ZB 1N1EA 1JSRA 2W6IA 3ZBPA 3Q8WA 2AFVA 3PEUA 1XZKA 3IDZA 4PHHA 3SHTA 5C5CA 2CDRA 3PJFA 1POWA 2X9VA 3Q7TA 4HNUA 3Q5EA 2HXYA 3R0JA 1Q91A 3H0CA 1T5HX 4Y18A 3RTAA 1CPYA 2C5AA 2FOXA 4IFIA 1BXGA 1FMCA 1G7RA 1TM4E 3MERA 2VZLA 1KDRA 1DEKA 4LE2A 3GRVA 1GCOA 4D3XA 5JXHA 4NBNA 2AZTA 2R8YA 4OQLA 4B81A 3H9JA 3A27A 3ZE9A 4TMXA 2J7KA 1MC4A 3WNVA 1RHMA 1YIAA 1TEZA 1JQ5A 2RH9B 2D5CA 2VDQB 3IDOA 1AUQA 4QXQA 4PN3A 2X5XA 4Z4GA 2OHIA 1Z9BA 5HKLA 3BXPA 4OQZA 1PGNA 5AJHA 3W5JA 1RWBA 2GZ2A 1DUSA 2IVFA 3CUTA 4NCNA 4N0MA 4OAOA 2I3AA 4YECA 2B4QA 1NNEA 3GEIA 2DUMA 4IILA 3OESA 5C8YB 1P7VA 1E3WA 1QOQB 4C2TA 1TZMA 1N3YA 4CR7A 3RS7A 2V6BA 3A4IA 3HYCA 2AX3A 3NBKA 4H7EA 3UYLA 2DH6A 1KI9A 2Y92A 1W34A 3FDXA 2NU9B 1SWWA 3H4TA 4NNPA 5L6LB 5G0UA 2GBFA 4PXAA 4JQOA 3T1TA 3TF5A 2BDUA 1G3RA 2QAGA 4I55B 3TLGB 3EY4A 3LE8A 3GLIA 1G8AA 4TWBA 5HOEA 2A59A 3B51X 2O0LA 3ES9A 3SX4A 4MYHA 3DVRX 1EXNA 2WWWA 3AUUA 2ZUFA 3TRJA 3OVMA 1SUAA 4J16A 3V3TA 2AC4A 1Y6ZA 1T3TA 1K7YA 1MIHA 4D9GA 1H5UA 1XWWA 3FVVA 5BUSA 1KZ6A 4Y9RA 1GPNA 1ZI9A 2AN5A 3NVDA 3DFFA 1RYNA 4KREA 5BOVA 3T5DA 4A8JA 4DCGA 3WBBA 4RDIA 2ZBFA 3LW8A 2OWDA 1MT3A 4H1UA 4P9NA 1DRUA 1KMHA 1M0TA 4B7XA 4YWJA 3K5IA 1FRNA 2PX4A 5D3MB 3ND5A 5B6PA 1Y5RA 4YV1A 1EGMB 4G23A 2I6UA 4EFNA 4MR7B 1A1SA 3PNKA 4S04A 1T0PA 1VE1A 4UDOA 3M5WA 1KYVA 1MNAA 2ZJ8A 2JD1A 2O2EA 4KMMA 5DBEX 5E7QA 4IFEA 2C4HA 3KYDB 3JX9A 4F0JA 1V8PA 2QTCA 2X3UA 3QWAA 4IHJA 4ZJZA 4AT1A 2IZZA 3V7UA 5AHRA 4DLXA 5KQRA 3JPWA 3BC1A 4MV3A 4R1NA 5J4LA 3SEZA 1X86B 2FOIA 3L8FA 3THOA 5CVUA 1UPUA 3BRWD 2FWIA 3JQ7A 8AT1A 3MQ4A 2QTMA 1FY2A 4K9KA 4LJ9A 2WSBA 4V0LA 4WGFA 4XWYA 2VJDA 2ONYA 5DCWA 1UPFA 2IP4A 4RY9A 5AI9A 5J5VA 1K27A 1BHJA 3G13A 2IYAA 2JAXA 2XCIA 1X80A 1NXQA 2ZIXB 1F2DA 1JI0A 4L5AA 2GFHA 1UOQA 4OXKA 1W9MA 1H23A 4QYSA 1ZXXA 1UT6A 1IHOA 2GF9A 3MN1A 1VFNA 4V0MA 4DQXA 1RAEA 1PR6A 2HRDA 4W5WA 3BF8A 2R8EA 3U3XA 2IDMA 2NSDA 4FFLA 4DKJA 2ALJA 3P2OA 1MJ5A 1JG1A 3P5BA 1CQJA 2Q5LA 4JT4A 1I36A 3TBFA 1PJSA 1VLJA 1C7JA 4J7UA 4MW0A 4ZJYA 5LUBA 4BO6A 2R85A 2ZS9A 4BCBA 4NFHA 4DIEA 5KBYA 1LDNA 1EUDB 2EDCA 3F7MA 5FI0B 3DE5X 2OL4A 4I50B 2D13A 2R7NA 4FHDA 4AZ0A 1SXJD 3T0GA 4DZTA 1BTOA 3IRUA 2P65A 2OHXA 1OI7A 1EXVA 1W7AA 1J21A 2F8SA 1II9A 4XKJA 3V1MA 2D0IA 5FPKA 2XZLA 3WGMA 4EJSA 4X5OA 4LX0A 1CIJA 3ONEA 4EO7A 2HMTA 4XYGA 1JHXA 1HE3A 4XWAA 5TPZD 4IRUB 5G4LA 1QNFA 1FRVA 2P3SA 3NEYA 4TMWA 3LUJA 2O8BA 1W1IA 2RGDA 3O1JC 2FG6C 2XDQB 3ABOB 3B9RA 2BE7A 3K9LA 3R3HA 1D0IA 4ZI7F 2HF8A 3QFHA 3NQ41 3QF7A 4UTXA 2QVYX 3RKSA 4DR1B 4B09A 3UHJA 2JBAB 4DR3B 1UQRA 4IR7A 4CIBA 2NZYA 5FI3A 4JA2A 4F8YA 3GLQA 3KXIA 4I5EA 3S0JA 3FBWA 4KAAA 5G1NA 3IVGA 4DCPA 4UHKA 1KWGA 5IT9A 1M8FA 3QMWA 5UKDA 3NT4A 3DMDA 4GPBA 3T1HB 4ABTA 4N5IX 4ENQA 1SC4A 4IXMA 2Y6UA 1VRWA 4NBSA 1NUAA 3Q5DA 2GEFA 3HDTA 3VBEA 3TLXA 1L4KA 1Q19A 4TV9A 4C14A 2JIOA 1DWUA 2HSGA 2G9VA 4IMRA 2PXHA 1GZVA 2ZB7A 1RI4A 1MUUA 2VCEA 4KPUA 4TTTS 3JV7A 3R3WA 4E03A 2VHCA 3QVUA 4XM1A 2P3LA 1G8GA 1A8PA 4OHWA 4H31A 2WNIA 1HT3A 2PAAA 3ICVA 2WJYA 2QP9X 3QOWA 2OE2A 2Q6TA 2LCFA 1TLFA 1BD4A 1ONOA 2ZYDA 1NE7A 5JNLA 3JQPA 3VH1A 2F48A 1YH3A 4UZFA 2EFCB 2IU3A 4MQ4A 5H68A 2DB3A 2ZSIA 1GKLA 4UXHA 4C5BA 2O8EA 5C5IA 1NBHA 3FJ1A 1XZCA 3ZDBA 4B7ZA 3CEAA 2BT4A 1MAUA 2FXVA 3PDUA 4E31A 3LA6A 5IKEA 1L6RA 2YV3A 4G9GA 3K92A 1ZOOA 2EFHB 3JYHA 4R8RA 2UZ4A 4DLNA 2IZ5A 3F4KA 1PWZA 1QBKC 3QYPA 5GAJA 1E5QA 3D59A 2BFBA 2UVQA 3N2GB 1RBMA 4N6NA 4G24A 1E63A 4OHPA 3VGJA 4KODA 2SCUA 2MJLA 4C0SA 4EZIA 1AUPA 2Z9BA 1XTZA 5JQWA 5A0VA 4JWKA 2A1UB 2X42A 3KQUA 4AAYA 2ODAA 2OG1A 3PF8A 4XYBA 2JPDA 3JARA 4XD7A 2X0DA 1JDUA 1LW7A 3DAHA 4CQMD 4UHJA 4P08A 1KNXA 5FWYB 3ZDFA 2QI9F 4KVAA 4LKRA 3OURA 3CRNA 1I2AA 4N40A 2ABWA 2EBHX 2DY0A 4N5NA 1QNLA 1GUZA 1KIAA 5H83A 4EGSA 3HJUA 2W90A 4HRAA 1J56A 4ZTZB 2ZRDA 2FP4A 4RK7A 4KUHA 5I7SA 3AM4A 1EJ0A 1Z25A 2TS1A 4E15A 1JG2A 1U0EA 1UP7A 3BQMB 3COVA 3MNFA 2NUAB 5BV7A 3DBRA 2AUTA 4JCCA 1H6BA 4JYMA 4AJEA 4CE6A 4E4RA 3TIXB 4D8YA 4HK4A 1KEUA 4QFBA 1NJ1A 2H7YA 2G07A 2QGFA 1OI3A 1QG4A 5CIQA 4UPEA 4DS3A 2VRCD 4KGXA 4PTZA 3I9KA 2VBGA 3WHLA 4I8XA 1J2UA 3LS2A 1WW8A 2CUNA 4RJJA 2O7SA 3I6IA 5BORA 1L7OA 1JG7A 2B8TA 2FMIA 3H8VA 2HSWA 3HUUA 3PJGA 4M86A 5EKUA 1PTKA 5LB4A 5C81A 2NXEA 3MLAA 2BGUA 2ZXEA 4XDZA 5HKKD 1K6IA 1GPBA 4EA8A 1HRKA 4J07A 2Q1YA 2ZCJA 1YI1A 2F3PA 3LA8A 4O4LB 4WIAA 3CF0A 3EPLA 4O63O 2BTQB 1ZRNA 1UQUA 3ZWKA 1L7RA 4U02A 1YZYA 2PR2A 1YA8A 4GF5A 4M60A 4YP0A 4XR9A 1BQ4A 4LOIA 5FTJA 3X1DA 5K6AC 1ZY2A 3CVVA 1E1QA 3QLUA 1CJVC 4FB5A 3EG5A 3BB1A 1A27A 3UXEA 1WSDA 4IHAA 4ZGWA 2J5KA 1WZCA 3DV0A 4XPZA 2GA8A 4CG2A 2GFIA 5K8JB 4RE5A 5DB4A 5BSKA 2Q5QA 1YQTA 2WWVD 1F5SA 4PGGA 1JJIA 4PZUA 1M6YA 4D80A 1K7EB 1D4AA 2PRSA 1ZM2A 1JWLA 1KI6B 2VKQA 3AILA 4R71A 4L72A 4Q24A 2RKOA 1ZIXA 2O23A 4BFXA 4ZKEA 4ZCRA 2Z6QA 1MIOB 2C9YA 3ITEA 1QQ6A 4WOPA 1BD3A 3QWFA 3G2OA 4IV0A 2XNDD 4NCAA 2ZWAA 4PG5A 3VHRA 1LPPA 3V1UA 1V7PC 4LUCA 4WZBE 5DKFA 3G7NA 4DUPA 3ICQB 4TRNA 5HG0A 3B3GA 3WK9A 4HH3C 1L4LA 4A6DA 3NHAA 4RIHA 2WE7A 3RH0A 1HA3A 1JF8A 4TRRA 5HE9A 4CTJA 5B4VA 2FN3A 1A2QA 1V48A 2H57A 3A36A 3BXZA 4ZVLA 1GV0A 3T3MB 4DANA 4PX3A 4IGIA 4RF3A 4P80A 2I8AA 5DM1A 3FBTA 2SHKA 4YONB 3TQTA 8MHTA 3E48A 1TCVA 3UAYA 3PFBA 1OBHA 5FR1A 4PW0A 1WHTA 3JVIA 4MGHA 1S4MA 4AI6A 2D1QA 3RVOA 3LH5A 4QG7A 3Q98A 2OZLB 4QTXA 4JJIA 5FUMA 2ZUCA 1F0YA 1CD5A 4JVSB 3I1YA 1XKTA 3OZXA 4WINA 3SHOA 2QHXA 3ZTTA 1ZMXA 1NOJA 2GOYA 1YFKA 1W19A 1Z28A 2HK7A 1RWNA 2Q6IA 3KQVA 2A33A 2C0PA 4S0XA 3AF2A 2HA0A 4I8IA 3WMRA 3FHOA 4XPIA 4G1FA 4PICA 2VHTA 4EMUA 1Q0ZA 1XVVA 1ETUA 5GJBA 1RJFA 5EKXA 2ZJ4A 3HQ4O 3NTQA 3UFXA 1NJ2A 3VHLB 2D2FA 2I6TA 3ZUGA 4E7PA 1HQKA 4HZIA 3AI7A 4OB7A 1C4KA 2ZJ0A 1II0A 4UHFA 4XOIA 2OYCA 4F92B 5KYNA 2OGWA 4G4SP 4YIKA 3TOZA 2PTHA 4H3SA 3KWJA 3DO5A 4YO8A 1IXKA 5AKEA 2ILTA 3H16A 3L0OA 5AKYA 5A05A 4B3CA 5AJUA 1DO2A 4C2UA 2F90A 2F3UA 4EHHA 1T9AA 1ZK3A 1BE0A 5FTLA 1E2MA 1XJQA 1XF9A 3QE3A 4EWLA 3ZLJA 1J7JA 4DLKA 5DHQA 2OGSA 2WPDA 2GCPA 5EOVA 2H5IA 3I23A 3OCZA 2IY9A 2X3YA 4NV1A 1K98A 5CNKA 4Z5XA 2JGKA 1C9KA 2ZYVX 3NTVA 5D5HA 3P4XA 2BFDB 3C3XA 1Z5GA 1XPJA 4EIWA 3UK2A 3EPPA 5B3AA 5DYYA 3LQFA 4TYMA 2O20A 2ZBDA 1U3GA 4N0DA 5KNLA 3P9XA 4EJ2A 4U7FA 1JW9B 3TG8A 2H48A 1F8UA 8ATCA 3QMPA 4M4SA 3L02A 4MP8A 4YMLA 4PYQA 4CKBA 2I2WA 1GO2A 2OGUA 1VI6A 1FSGA 4KZPA 1XEXA 5HILA 4QRIA 1H1TA 1Y5LA 1SC1A 4M9RA 4B4VA 2A9JA 3VO9A 2XH8A 1O94A 1XU4A 3K0KA 5IK2D 1CZUA 5IWAB 1I3CA 10MHA 2OR3A 3D6HA 3A37A 2BM1A 5CT8A 1FW6A 1BCSA 3KX2A 1GGEA 5ERYA 4WLVA 2W2XA 1C3LA 3V3KA 4UHHA 2J0SA 4ZOLA 4IOJA 1J5XA 4O2LA 3VYSB 4D92A 3D7NA 5I01A 4DBZA 1W2WB 1SXPA 4GYJA 4E3ZA 4TZTA 4R3UC 3RYIA 4X8OA 4HPWA 1A0OA 2JH9A 3OY7A 3VFDA 1SBYA 4ZCLA 1E3QA 1NKSA 2ZUUA 1JYFA 1QIEA 3E2PA 3EF1A 4O2AB 4XAQA 1N5LA 3PNPA 1J9EA 3CF2A 4XFKA 2WJPA 1KJYA 3LUHA 4X1YB 3ZWNA 1KJNA 1AHHA 2DWCA 2GZHA 2Q3HA 1MEEA 4OAQA 2BZ1A 2NP6A 3ADOA 4QX6A 2B69A 1DBRA 5HF6A 3F1KA 4WLNA 5FLEX 2QNIA 4KQCA 3H1GA 2P6UA 4E3WA 4YRKA 1ICEA 1NI4A 1EP2B 3G8DA 3PWSA 3DKIA 4PRLA 2CD7A 2TMDA 3CVUA 4MUIA 4Y8VA 3I2HA 2I0FA 4AN1A 2FR1A 1ODLA 2IIVA 4JT2A 2J3DA 4P4TA 2YZGA 4JMLA 2WUDA 2R6JA 3DL2A 3G23A 4I9UA 5DXFA 2A58A 2C1XA 3ETDA 4E5MA 2JG3A 1YCGA 1E1RD 3JQFC 3QLVC 4J75A 4MQ6A 4OJTA 1COWA 1RYDA 2XNSA 2JJ2D 3GL9A 3VGPA 1NU6A 1Y4SA 1G64A 4O4IB 4RFVA 1N9ZA 2HBQA 4Y6LA 5DW3A 3ZJ4A 4BNYA 4DR2B 5JZ9A 3Q85A 3CVYA 3M4NA 1CHDA 3CRRA 5CM2Z 1YZUA 3AT1A 2ZBEA 4NEHB 1NVGA 4L08A 4EO9A 3NI2A 1IZZA 2WEKA 1XYGA 3BFPA 3NM6B 5FB3A 3FCCA 1H3FA 1I7NA 2VK8A 2QLMA 1ZWLA 2PLWA 4BX8A 4KLRA 3EIEA 5JD3A 3AWDA 1NW9B 3FNRA 4M9UA 1RQGA 3A4MA 1UZLA 3H87A 3TW4A 2FPIB 4M76B 4A91A 1VBKA 2I6QA 3QG1A 1GZSA 2Z9CA 1FQOA 4M8KA 4DJEC 5GONA 4RTQA 2BCJQ 1B42A 1WQ4A 2L19A 1I2DA 2BEUB 2YH2A 2VF2A 2ZVJA 3Q0TA 2R0QC 1JJVA 2ORVA 5FWDA 3Q2IA 3DQZA 3C8ZA 5JJ5A 4LXIA 3KZVA 2ZJ5A 4XJSA 3FVRA 3AF3A 4K88A 3AFNA 3F6SA 3PPIA 3MMPA 2XWPA 3I5MA 3PHJA 1NRIA 1VBNA 1PRYA 1QHNA 4MLDA 1HSZA 3PKZA 1G8JA 2BI8A 3ANTA 1SOVA 2B4AA 2R1TA 3KZXA 3ZQ4A 4BO4A 4E09A 4CKZA 3E3LA 1BKYA 1J2TA 4MQUA 5F2OA 5A6SB 3D4IA 2BY4A 4BPRA 4Z1OA 5BPFA 3O1LA 5DRTA 1GLNA 3KR1A 1ONSA 1Z7YA 2PX3A 3EXHC 6REQB 2A5DA 1PNTA 3FPEA 1ADFA 3K0AB 4UFPA 3K2EA 5K3CA 5T4FA 2QVXX 3OOWA 4BP9A 4LF6B 2LD4A 2CXNA 2D5AA 3D3NA 3H6GA 3IOCA 3PD1A 3I5YA 1MC8A 5MN6A 1SBHA 2OHVA 1IY9A 3WL4A 1M73E 3H19A 1MW9X 2AV6A 3AXTA 1DAEA 1LSJA 2NZVG 3BEDA 4GP9A 1IN6A 2A0KA 1LF0A 1MP0A 1W2HA 3H9QA 3MTJA 4C7VA 5JSZB 1OF1A 3VVCA 1IVSA 1S2DA 2G80A 3NHLA 3QOFA 4WKNA 3R76A 4I55A 3BILA 4TQGA 2MT9A 4DSZA 1U7ZA 4BYMA 3ZHSA 2D00A 1XL0A 2NZ2A 4QG3A 4A0SA 2WKQA 2Q3MA 3O1HB 2O5EA 1MH9A 5DX1A 4EGFA 1WO8A 3BHIA 2C29D 4HGZA 4JLUA 2WFAA 3QXGA 1P5RA 4RH3A 2PMKA 5FWNA 1XTKA 4MKHA 2QWXA 1FDWA 4K0RA 5JAMA 3G68A 2QXTA 3O31A 4X97A 5TX7A 1Q12A 3CJTA 3LSTA 1PEKE 3NGMA 4DYVA 4MPPA 1QE3A 2FMHA 4F3CA 3FAZA 4UMFA 1JQJC 5LKAA 1WDLA 3A2KA 2OHHA 1CHNA 1S0UA 1TEHA 2FRDA 4P5EA 4P7GA 1HNNA 2OQRA 1G4HA 3PTZA 3FF1A 2CF5A 3V4LA 1ABFA 2PKQO 4E1VA 1WPRA 5DM4A 4EITA 1OCEA 3IA7A 4FZRA 4UXJA 1IAVA 4WN9A 2VNAA 1J23A 5IJZA 2FFBA 1VKRA 3GGCA 4XI9A 4CUZA 1SUIA 1IH8A 1SD5A 1S8OA 2DUUA 1R5BA 3H9GA 4JQSA 4DNOA 5ICEA 2P3QA 1WM1A 1Y3AA 3VR2D 4HGOA 1CZOA 2JAWA 3NYWA 5E6UA 3UHPA 4N8EA 4EPWA 1QFZA 3IFSA 3HXTA 1JSCA 3D2LA 3DTVA 2IGTA 1QYWA 1S3FA 4K1XA 2GCNA 4Q82A 5HIIA 1JIXA 2CJFA 1SBTA 2QENA 1RAIA 3IHLA 1XLTC 2C00A 1NW5A 1I4TD 2CHVA 3HEMA 1OWLA 1L9XA 1ONBA 2W6JD 4CMBA 4O4HA 1EQAA 1X7ZA 3D1JA 5F2KA 2Q5JA 1K66A 3Q1KA 4J76A 4O1MA 2XMPA 4AICA 4H6WA 1XZNA 2B25A 2XSZD 4Q5IA 1ST3A 3A1CA 3ZZMA 3GAMA 1L4EA 4JJFA 4LXGA 5ESRA 1R3UA 4GLJA 1FYWA 4PEVA 1D6MA 3PA6A 3L49A 2WG2A 3W5DA 2J7PA 2QM8A 3WLTA 3CKKA 3GNLA 2MSLA 4W8OA 3S27A 1JNYA 1SVOA 4G8JA 4KRXA 1IWPB 4CIAA 1JNXX 4I50A 3R1IA 3VTAA 3KD3A 4YAKA 1UPXA 3C3BA 1TUBA 3TQIA 2Y3IA 1QIJA 3CRZA 4L0MA 4CCWA 3L8ZA 2WYWA 1DAOA 1X7DA 4UBKA 3SFTA 3K96A 3RBAA 3QXHA 3RVSA 4X3PA 1VIDA 3AHFA 3IAS6 2O8BB 1TYCA 4OMCA 2W4MA 4JBXA 3AEQA 2HWXA 2HAEA 1VP9A 3WTCA 4D9NA 1WD7A 3AKDA 3ZGYA 1C81A 2P2YA 3UV7A 2Q50A 2IYPA 4B3HA 3QVXA 1JR2A 3FNHA 3TBKA 3T3DA 4DY6A 4EQZA 1JA9A 2QZ9A 1T4DA 2LBPA 4IP0A 5CFNA 3N8GA 5IKMA 1EIWA 3PJDA 1AUVA 5L9AA 4ZIRB 4QDOA 4LJ6A 3A7DA 2JBAA 2YNMC 3I64A 3UZUA 5ALIA 5FUXA 2OORA 1P0FA 1S7GA 3OQ6A 4M49A 4AECA 3UGJA 3VAZA 4L5BA 3HYRA 3WICA 4YXFA 4JI8B 4Y2YA 4OU4A 4EPXA 2HQBA 3OZUA 4EYGA 3ADBA 5K8TA 3W8RA 3GVCA 2QAGC 1NR7A 3LC1O 5ALKA 5IT4A 3O2SB 2E5FA 3BMXA 3L0DA 3RVRA 4PPNA 2COEA 1A76A 1S2OA 1ND6A 3TJRA 2ZB8A 1Q17A 5T4EA 4EBBA 4JLOA 1AXEA 4U1RA 4J16C 4YT5A 4Q6BA 1FXWF 1H0HA 2XIJA 2ACVA 4TN1A 5DV9A 3URMA 2C9OA 1SUPA 1NYTA 3ZIAD 1DKLA 3C70A 1U2PA 1VPWA 2RIPA 4Z2YA 3U4QB 5BMVB 4A3SA 5LZ5A 1OFVA 4AJKA 3P0IA 3V2UA 4A8JC 4QBTA 3PEWA 2HHAA 4F3TA 4XDYA 4YRBA 1Y4ZA 2NLOA 1RRPA 3PR2B 1SZCA 2XQJA 4K6KA 4R7GA 4BVFA 4X1IA 4N76A 1K97A 1AS0A 2B1RA 3D0OA 2VFAA 1XAJA 3ENWA 1LLUA 3L1KA 3OTIA 5E2AA 5GPBA 1PVDA 2HOQA 3UF0A 3KR0A 4W9RA 4MKRA 2JHCA 3COZA 1Z7GA 5FRDA 2PZLA 3JATB 5EHZA 5B55A 3QF4B 1Q77A 1KIFA 4BJHB 4DDUA 1FRZA 1FQWA 2EW2A 4DLRA 3N2GA 4Q4JB 4EF6A 1BDMA 3HGTA 4F45A 3KT6A 4LDQA 4ZJUA 3N0RA 3FYHA 4AJ4A 5BSEA 5IBRA 2ZBQA 3WXMA 2FEWB 4B79A 1W30A 1D2MA 4L8LA 1U65A 1Q7EA 5EE0A 2VDNB 4IL5A 3WZLA 1EFDN 4C6HA 2FDCA 1K68A 3TKYA 2G4CA 5FWYA 1UCFA 3NOOA 4ZVQA 1GRCA 3PHBE 4LRYA 2ZSUA 4TXHA 4PC2A 5JCJD 3R0VA 4Y6OA 1ZUD1 3MJFA 1EA5A 5JSYA 2GN2A 3GUYA 5EKDA 4ZDJA 5JFOA 1AK1A 5FUVA 1NNUA 2B37A 3OJXA 1Z38A 1PWYE 4TT8A 3QBDA 3JQQA 3I9V6 4B44A 1N6NA 2AK2A 3GG9A 4B6FA 5ES4B 3BMNA 2VDLB 1UP4A 5FAXA 1OH8A 1HMYA 1E2QA 1PZGA 2E6KA 3FPFA 4NZYA 1C29B 2QX9A 4FNAA 4REOA 2TMYA 1CR4A 2VDUE 1ACJA 1XYYA 2RHBA 1W4CA 1YJ5A 2BL4A 2Q3LA 3ESDA 3F3YA 3G5LA 3W2HA 1T8SA 2R11A 3JQBA 3NEPX 3ZNPA 4BMDA 1YQDA 4PCUA 2BGKA 2JATA 2IUTA 2JIQA 2PVSA 3L6EA 1XXHA 2H4YA 1WV1A 2R79A 4DJFC 5JIBA 5CCBA 3DPUA 3I8OA 2D62A 3WYCA 1U98A 1YD7A 2I6XA 2Q8QA 3IQZA 1DWQA 3LZ6A 4RL6A 5AW9A 2KE5A 4JU9A 4EF5A 3TBHA 1K6XA 2OXRA 3IBSA 1CNMA 3EWSA 4WLEA 4O4LA 3YASA 1FUIA 2MU1A 3K53A 3F5DA 3LV8A 2KQUA 1TE2A 3MWEB 2CMDA 5TQVA 2I71A 3PS9A 1MFPA 3K4QA 3EIXA 2Q7OE 3AR2A 4EJSC 3T99A 1U7XA 2OCLA 3Q8MA 3LCUA 4C76A 3MEQA 4R8MA 3NKVA 1GV1A 1P73A 1V41E 4II7A 3ZN2A 1Y5MA 1X38A 5JATA 4WA8A 2PFGA 2PRYA 4HBGA 4MYCA 3CWZA 2VAXA 1XR3A 1KI6A 2JLCA 3ADKA 3K1AA 4YH1A 2GN9A 3E81A 3U0BA 2LP4Y 4EMBA 4EL5A 1MAAA 2GK3A 3T9EA 1E2UA 3O7WA 4QGAA 2QPLA 1XPUA 1MIOA 1WUYA 2VPXA 3U1VA 1EEHA 3SP1A 5HKBA 1ZVMA 5BRAA 1A97A 2VDWA 5KQSA 3UC5A 5JSKA 4E5PA 1KQGA 3IERA 1T9CA 1NG1A 3E82A 2F7SA 3HVIA 1VL5A 5EE5B 1RMQA 1GGFA 1PD1A 1KE1A 3H5RA 1ZR4A 4WFIA 3JWGA 1Z8DA 3NDPA 1CUGA 1V16B 5KSZA 4RTPA 4YP7A 2RGNC 1V96A 1ZAKA 1ZBQA 1NW7A 4QPJC 5D87A 4IYJA 4QYIB 4ER3A 2AE1A 1NC3A 5A3QA 1XEFA 1LC3A 1CUBA 4UJ5A 1M2EA 3WGNA 1XD2A 3FI0A 6CHYA 2O3TA 1CY0A 1R8JA 1AK9A 1ZFNA 1SD1A 3U6KA 1C3EA 2OZLA 4OI4A 3RI3A 4J0DA 3STHA 4CIDA 5CB4A 3E22B 5I9LA 1KQPA 2RIRA 2C5HA 2II6A 1UZMA 2JGLA 1US8B 3NRBA 4FWIB 2J31A 3FMOB 3PUVA 3U7FB 1GTL1 1E5VA 1K63A 3HC7A 2RC6A 1UMCB 2CE2X 2CLLB 1ZOLA 3T12A 4DKXA 5AW2A 1WNFA 4C4YA 3GLHB 4BN5A 2VQEB 5LJLA 2ORYA 4O0LA 3SZRA 3KSZO 2Q4BA 3OJOA 1KYZA 4FE7A 1ODCA 2ASVA 5E9JA 3KG2A 3EMBA 2RB5A 1CR0A 1WPXA 2QE7D 4IINA 3N8KA 1GKYA 2GZ3A 2CCKA 2CV1A 3DO6A 2XCLA 1AZTA 5EIWA 4AUMA 1ZN8A 4F72A 1KQFA 1DAIA 3WB0A 5KDOA 5AUPB 4MVJA 1WA5A 4OP3A 5G0TA 1BFUA 4MVJG 1RS0A 2Z9DA 1OLOA 3DFMA 3ZGOA 2C2OA 4OK6A 3VKUA 3IPLA 2ETVA 5CURA 3JAWA 1OXVA 5BW6B 4ZO4A 1AB6A 3FTPA 2ODQA 4EEXA 3PVCA 1D3AA 5LZ2A 2BFDA 4MV1A 4Z4IA 3FH0A 2AFHE 4LQLA 4RZQA 1Y3IA 4NJMB 2HJVA 5TS2A 1SG0A 4H17A 3IELA 2WILA 4JI6B 1T9ZA 5LLSA 1WMBA 2GYYA 2H8GA 4QDJA 4W1QA 3A3NA 4XB1A 4PSDA 2OHGA 4C4SA 3DULA 3QKSB 4ISCA 4WKOA 2O19A 3SC4A 1XA0A 1BS1A 4B2YA 1VJ5A 3FNFA 3CPHA 3FNGA 4XCXA 4HG2A 3MIZA 3BSWA 3C5EA 1XMSA 1PAUA 3OIGA 5EMLA 4YRNA 1MJGM 3OZWA 4FEEA 4DCTA 2WTXA 4UQPA 2JRCA 2PZGA 3AI3A 3NRCA 2PDAA 5D3ZA 3DDCA 3V8MA 1OAOA 2YJZA 3F96A 1VGRA 1K92A 3GH1A 4GMFA 2V97A 2ATCA 2F1JA 3K1JA 4JEHA 3RRYA 5CAEB 2PZMA 5C3MA 3QLUC 1O03A 1W59A 4LC1A 4XJXA 5E1DA 4GOXA 4Y2VA 4WKCA 2OMEA 4IQ0A 4UM9B 5AK6A 4ZRDA 5A4DA 2Q21A 2CYAA 2WTNA 3B5IA 2PMBA 3K09C 3P0RA 4QUBA 4RAOA 1B1AA 2X2OA 3EQ8A 4EHDA 4JXJA 4O2AA 4KNWA 1U6JA 5JBIA 2I9KA 3KELA 4Z7QB 4PLCA 3R7WA 2B36A 1VMAA 3MMXA 5EZYF 4JFRA 3UKDA 4MZXA 2YV5A 2B94A 2IIQA 4QXOA 2WAYA 1AXGA 3OQHA 5DI3B 3K9GA 2JHFA 3M6MD 1M0WA 1NR5A 2WIDA 3Q3IA 4OBXA 1WZUA 2G17A 1FZTA 3QBTA 1XROA 2BKUA 4ML3A 4BXOA 2H5JA 1N57A 2DJIA 1J39A 4FXPA 2DTXA 1V3VA 4BU0A 3HSYA 3HA7A 3GLUA 1ATZA 4B85A 1NU8A 3AW8A 2ECQA 2G5GX 2EG9A 2PG3A 3QYAA 5K8VA 4P32A 3K20A 2YWXA 5B1HA 1XG5A 2JGIA 1U7HA 1UZAA 4MITA 3P9QA 4KUGA 1YRLA 2UUOA 4N12A 4AFNA 1UT8A 1PK9A 4HRYA 1BOOA 2GF0A 2WM8A 3K5PA 3RRBA 4O4IA 4K6GA 4LJYA 5ADWA 1QX3A 2GKGA 3B9BA 1FUEA 1Q3KA 4TVKA 1UJMA 4RNDB 3RYHB 2IE0A 4Q9LA 5LJIA 2EYUA 3B9PA 2BEWB 5ECDA 5CDUA 4IIYA 1U99A 1JHAA 1O6ZA 1O0SA 3VUFA 3EXG2 4UVGA 2BKAA 2CE7A 4TV8B 1H4TA 1KFEB 3NEJA 4DRYA 4PZEA 5CK4A 1K8XB 2RGUA 4TS1A 2X4IA 4DGQA 1GTSA 4U2BA 1ULBA 4WW0A 1X1TA 1YB4A 4LDAA 3Q7PA 4BNHA 1C7RA 5JVDA 4DV1B 5F2NA 3ZHYA 3ACBA 2EVWX 3HMQA 3U80A 2KBFA 3G9UA 5BV1A 2ZSDA 3QQPA 2P5YA 1IULA 3JQ8B 2C9CA 5IAOA 2X3FA 3SE0A 3VR1A 4WERA 3VVLA 1L5ZA 4LYJA 1DBVO 4AL4A 1GQYA 1QZZA 2V7GA 2Y93A 4RZUA 1A9OA 1Q84A 3NHYA 5FLKA 1LBSA 5FTNA 5KTOA 4D56A 4IOLA 1GT6A 3OE4A 4ZXPA 4MUEA 1L4HA 1OPXA 1J4AA 1RVV1 2O3SA 2VKTA 3OPQA 4GPZA 1UWLA 3UO8B 3UN1A 3GX1A 2Z1NA 1GA6A 2QS9A 2XMGA 1E20A 4JJ7A 5ELLA 1VA4A 1OLSB 1Z2PX 3WYGA 4FD2A 3DOEA 1XDSA 2JFBA 1PF7E 3EZ7A 4D9MA 4CLHA 1RZUA 3UJNA 3TLYA 3C85A 2BJVA 1JFRA 3IGFA 5T67A 3GP3A 2O4UX 2PMCA 1QZUA 2OGTA 3PHCA 1YBVA 2FUCA 2VPPA 3TSCA 3K0AA 4LGCA 1F7UA 4A36A 2F1IA 3G2JA 1RJ9A 2FPRA 3P2IA 4UCFA 2AFIB 16PKA 1JSLA 3KOZA 4LI3X 5CYOA 2C4MA 1RKXA 2JGFA 1KO8A 1ZM7A 1O94C 4KIGA 1ZISA 2C7BA 4AVYA 4BZZA 2OYRA 2OUKA 1NF3A 2GDZA 3SKYA 3B60A 1T91A 3GZ4A 3QY0A 4BX3A 2X9LA 2FW8A 3UFBA 2ZROA 1MG5A 4HTFA 3PQEA 1KFKB 5JSZA 2W37A 1ZMBA 5FA8A 1WAMA 1I9CA 2PH1A 3EARA 5EJEA 4RDXA 1LBIA 1RIIA 4GVLA 5AIBA 2VHXA 4BHTA 2GPSA 1SWVA 2JARA 1WY5A 3DW3X 1RQNA 1UMDA 4BJ5A 1QAQA 1WG8A 3M8KA 1BGXT 3JALB 4URYR 3X0DA 4ZGBA 1GAWA 1G19A 1YVRA 4GOJA 4OH1A 2CV0A 1C5KA 4KBFA 5AVVA 2EJVA 2NSYA 2X6TA 3K9NA 4XUDA 2VRBA 1RBZA 2B30A 5IEJA 1PDVA 5CVTA 2R6FA 4RY2A 3SBEA 3MIIA 2IEIA 2MDTA 1Z0KA 2JDID 2ZVPX 1CQXA 1UXJA 3GB9A 4QOHA 5IZ4A 4UTVA 3U7QB 1OC2A 1E79D 2I5PO 4QXAA 3K8QA 4QARA 4UAUA 4ER6A 5JD4A 5L40A 2GVNA 2XECA 3GLGA 3EC2A 4RZIA 1UJ4A 4C07A 4CV3A 4C06A 5C46F 5DSXA 2V55B 5AVSA 4S1WA 2VS1A 4U2CA 2WSIA 3AI1A 3OBBA 1CQWA 3VSAA 4ZVMA 2F1HA 1LPBB 3T5TA 4IDOA 1GTRA 3OPMA 1YR1A 3TQFA 4G4SO 3OI7A 3WLKX 3WJAA 3R3JA 2QYHA 3CB4A 3WGKA 1NSYA 3CINA 4M9CA 3SF8B 1AGNA 3F6YA 3UM9A 3LYUA 3OP1A 4IMIB 4F4DA 1Y9ZA 4FFRA 2VF4X 1MPXA 3V8BA 1P4HA 1KRHA 1SIUA 5HTOA 5E7MA 3A6KA 3I2YX 3I53A 1DVRA 4AKGA 3R9XB 2PZAA 1PWHA 4PX5A 3WMXA 3QKTA 2PSFA 4NABA 2VYVD 3AR5A 1VB5A 2W2QA 3EGCA 3PWTA 1KK3A 4X20B 4R6WA 1K9SA 1U4OA 3KJEA 2EGGA 4MCAA 2XNHA 2PRJA 3R6WA 1UJ5A 2WAMA 5B4TA 1WKCA 4RUKA 2BI4A 4TLDA 4RQTA 1OC4A 4E13A 4LHYA 1A8HA 1MO5A 2K7ZA 3QPUA 5TE9A 2PS9A 3WLJA 4C4ZA 2JAUA 5DWQA 3TUZC 4FMDF 2E4YA 2HJ9A 1E64A 4X54A 2WT4A 2XHZA 2Q46A 3KZ1E 3AIMA 2Q45A 4UZSA 2XUKA 5B7NA 3V55A 2QMQA 4FNOA 2VJQA 4M8NE 1CNEA 3A1EA 1RD4A 2OB1A 5DN6A 5ARBA 4MAFA 4HDKA 1E3IA 4YJGB 3WGGA 1QZTA 3HNOA 5E8RA 3Q7SA 4JL8A 4DCVA 4V1CI 2JFNA 3I6MA 1WMEA 1E1LA 1FS6A 1Z74A 4WESB 1QGAA 2QD1A 2RC5A 2Z95A 4X00A 1X7YB 4OXIA 2AQKA 2RGBA 1FU4A 1N2CE 2VTEA 4ZOBA 4KXUA 1VE3A 1G7SA 3LYHA 2DCMA 1PT5A 1U7DA 1XZDA 3SAJA 4RTMA 4AN0A 3WL3A 3IOEA 4D4LA 3KOXA 1JZTA 4TKUB 1VIAA 5L4NA 5JD5A 3LY8A 2Y2VA 4RQAA 4EHNA 1DG9A 4EZBA 4HDQB 5I4IA 4MV8A 1BU5A 1VYVA 4JEMA 1DLIA 1UJBA 4ZIRA 2C82A 1Y6FA 3V7YA 1MKYA 3OEED 2VR1A 3IQFA 3R09A 2O3JA 5EQTA 2Y1LA 2CLFB 2OKGA 2VPZA 2R8RA 2XQGA 3ZS8A 3BS4A 3FSJX 2RMKA 1DKPA 1FX1A 3MWLA 4JJKA 5K0BA 3ZHOA 1JPNA 2Z8XA 3MWDB 1ZD8A 1UDXA 4ONEA 3COWA 2O0MA 2EIHA 1U0OC 3AGQA 2PYDA 4GU5A 3AP3A 4LXUA 5EPEA 1W0KD 2XOXA 3DDHA 3IMCA 4M1QA 4N03A 4OGWA 5ILGA 1DT3A 4UHEA 3MMNA 3SSMA 4GM0A 3DE4X 5EJIA 4D41A 1PG5A 3ENVA 1JMKC 4MO9A 4DAOA 3K1TA 4EH1A 4BNVA 5BMVA 5F7OA 4R51A 3U4QA 4I0WB 3URKA 1Q3TA 1UDRA 4RFSB 4ZYXA 5DNYB 3TJZA 5DK6A 3LVBA 2JW5A 4QELA 121PA 5BWBA 5EP3A 3SJ7A 4EYOA 3I1IA 1RAFA 3PXCX 2E37A 5BT8A 1MQSA 1E69A 1V4BA 1RRVA 5FCDA 5TQJA 3WWZA 4EHFA 1ESCA 1JIIA 1OWPA 1Q7CA 4G67A 1G2QA 3QA9A 1RM0A 1FPMA 4MDFA 2OHFA 1RP1A 1RXUA 1V37A 3FFBA 1LI5A 1EFPB 3JATA 1HK7A 2PR7A 2YY5A 4FGUA 1T8UA 4ID9A 5JLAA 2HDOA 2HSEA 4ZMBA 2GXAA 2P9EA 5CH5A 1LPSA 3HXPA 2GCIA 3KB6A 1E4YA 2PUTA 2HRQA 3M9WA 5ADVA 4EI2A 2IEAA 1LJUA 4GECA 2E2WA 3RGWS 1P33A 1KAGA 2YJ3A 3LPLA 5AW7A 2Q6VA 3IQDB 2YUIA 4FEAA 3UANA 1XHFA 5DM60 3JD3A 4KYTA 4OPMA 1L4BA 3UG7A 1ZH4A 1L5HB 5IJ0A 5E3IA 1UKYA 3ZXSA 5KWVA 3K9HA 3ENQA 5DO9A 9ATCA 4ZCIA 4IGAA 1V1RB 1P62B 5DISB 1DDIA 2DR3A 2EZTA 4GWKA 4PGHA 3VPBA 3U7GA 4QYXA 3OEWA 2KHZA 3ASUA 2Q4EA 3D31A 5EFZA 4ARBA 4DSTA 1QWSA 1YK0A 2AKEA 3QPBA 2XJ4A 1MABA 3FVTA 4KQ1A 5AW3A 1O89A 2XGJA 1MOSA 3FCYA 1KS9A 2Q5FA 2C2KA 4BQNA 1U1DA 2I1VB 3O84A 3VOBA 1TX4B 2QE6A 3I6QA 3WFZA 2WWGA 1W4RA 3BX1A 1FIUA 1GL6A 3K6SB 4AULA 1NY6A 2HA6A 1TAHA 1GRQA 2CLMB 4N9QA 3I5XA 4QQ8A 1JDPA 1R8QA 2XCOA 4XXHA 5IXJA 3C8MA 4LRTB 3NHUA 2BMEA 3LHIA 1X7WA 4G0XA 1HEYA 1Z8NA 3OLZA 3LK6A 1SKMA 1I2BA 4IH4A 5BWCA 2M1XA 2FSSA 2HRZA 1YA6A 1T4MA 3GRAA 4RAQA 2ARKA 2NYRA 4XGRA 4C0AC 2PMWB 3BG5A 5ERGB 3FWZA 1SOUA 4EPVA 3MWEA 3A04A 3C41J 1E5LA 5CVJA 5JDCA 4M0MA 4G0NA 1SC6A 4QNNA 1ZGGA 3QEMA 1SQ5A 2YIDA 3JWHA 5I9MA 2G83A 5HEKA 4BC1A 4E88A 2P27A 3Q3VA 4IX9A 3HCWA 4ZZ0A 2CFIA 2PXAA 5ALSA 2PUBA 3ORSA 5EIHA 3HA2A 1C3OA 3ACCA 3IIEA 1SQ6A 4U7TB 4WTOA 3RAEC 3M82A 5AM1A 2O54A 1YDWA 3OMLA 1KH1A 2Q5HA 4BMXA 4EVRA 3M6AA 2BGWA 1KO4A 1E4EB 4RHEA 3V8VA 4Q05A 2BBOA 1W88B 1V4NA 4PANA 4PC7A 2A84A 3JAMA 4ZEOA 1QHYA 2I7TA 4QE3A 5JFTA 4I6GA 3ECAA 4HNAB 4MJXA 4JQCA 4E22A 2FW1A 3OOYA 5EE9A 4PHFA 1OX6A 1PT6A 3O75A 1J42A 1VCMA 4BGUA 3LQRA 3B1ZA 1VYTA 4PYNA 3ZIUA 2AG6A 4ECEA 3ZHBA 4JYAB 2ID4A 4PQEA 3RU9A 4LK3A 5M5BA 3Q1LA 3SE7A 3VJMA 1NZFA 4P3PA 2F1RA 4H15A 3RABA 3JZMA 4HDAA 3KJNA 4ETWA 1P7YA 3W2GA 2P75A 4P4SA 3ZE6A 1RYMA 3NUQA 2YWBA 4QYIA 3ZVRA 4EJMA 5FX2A 4Z9AA 5DLQC 4TYPA 2DTDA 4NAVA 4XOUA 1DBPA 4OHXA 3S2FA 1JHRA 4C6TB 3SDBA 5KNBA 1N78A 2R68A 2PQ2A 4L8FA 4JOSA 4Q3NA 1S5PA 1ZP6A 1XB2A 1RRGA 4E5KA 1QP0A 4LSZA 1ID1A 3E22A 4QBFA 2TSYB 4AWBA 1GPMA 1T5BA 1SKYE 5BQXA 4DRXB 4ITRC 1GQOA 3PZBA 2IBSA 3FY4A 2TMKA 3O8OA 5LC1A 3TQSA 2NO0A 3HDJA 2X0FA 2M1ZA 1G8PA 3SYKA 3OQMA 3LQ4A 2OT3B 1UMCA 4M89A 4BQFA 4HDRB 1BEEA 1UJ6A 2H2IA 3O93A 3Q6MA 4WWHA 4AUKA 3DF9A 3MOGA 3PTLA 3FWPA 2DULA 2IV7A 4F4UA 1YQQA 1LS6A 1NF2A 3NWEA 4M2LA 4MQFB 5P8WA 3TCNA 4HC4A 4U2DA 3MJ4A 4DA0A 5FEMA 2J48A 4RVSA 3W6ZA 4KQ2A 1VLHA 1YUNA 1R8SA 1BN7A 2JCGA 3N8DA 3S2ZA 3PXUA 5NULA 3OWHA 1EWKA 4QKQA 2ZJFA 4LCEA 2REOA 4QUIA 4S35A 4EGQA 4O8ZA 1Z6TA 5EMHA 2G9RA 3CZQA 4FPXA 4RXUA 3MMZA 5TC4A 1BA2A 3OU6A 1OVGA 3TSZA 2JLSA 4F7WA 3COJA 1U0TA 1L5GB 1E8NA 1DZ3A 2DSNA 3C7AA 4BNDB 2FN4A 2FWJA 2DE0X 1XALA 2HGZA 4UAJA 5AJYA 4CQLA 2E85A 3JD2A 3PL5A 2V4MA 5GGXA 3KTDA 4RQUA 3L1VA 1LQTA 3BREA 2WKWA 4GI1A 1DHTA 2O8CA 2E49A 5KOYA 2PUWA 3K8ZA 4CLEA 3BEOA 4EG3A 4NJMA 4JP5A 3E2MA 4QOGA 3R74A 1N0IA 2X76A 4EA7A 3EZ9A 4YRMA 5FXMA 4QICA 5EUBA 9ABPA 1RRKA 2PJZA 3JQBC 1AHNA 4L6CA 2OV4A 2PKRA 3EISA 2CSXA 3WSTA 4K9MA 3NHKA 4G81A 1CFJA 3FGPA 1ZU5A 4C1BA 1BX0A 2JIZA 2Q0HA 1LSSA 1YVDA 2J4FA 3A6JA 3B2NA 3NUZA 3P9NA 4YP1A 1U8ZA 5FBHA 1GM5A 2WTMA 1EMDA 3QH4A 4OOFA 3HJGA 5HUJA 1Y1LA 4M1ZA 5JWRA 5DGXA 5E4TA 3FKSA 2B3TA 2DHDA 1U63A 2I6GA 1QZXA 1ZGZA 1ZNQO 2J33A 4Q9IA 1MHPA 1W6UA 3A1SA 2VDVE 5EUMA 1PJAA 3G0GA 2UZAA 3IAHA 3TRIA 5M2QA 3EEYA 5LIPA 3K0FA 1DIOB 3B48A 3RBZA 1SBQA 3FD8A 2QRZA 1XJ5A 5KYUB 1JFFB 3IALA 4ZVTA 3QU4A 5AOAA 3DEFA 3EN0A 2FDRA 3QKRB 1M67A 2O7VA 2JGJA 2XMSA 3OIUA 2DBYA 3SOZA 3WLHA 4DC0A 1H0KA 4KDEA 4FSDA 1USUA 4IIEA 3A9CA 8GPBA 3CM0A 4WFKA 3C3WA 3WNQA 4DA8A 1DP4A 3PEYA 1INLA 1DJLA 1KPHA 1LNSA 3DHWC 4HN2A 4Q7JB 2ZTSA 2J8ZA 5DI3A 4EENA 1O77A 4H7HA 5FUBA 3AETB 1IOVA 5ALYA 4GWGA 4UTRA 3TQRA 4PYOA 2ID9A 3UOAB 1BC5A 3ZV3A 1PV4A 3IP6A 4U63A 1FTNA 1RAGA 4F71A 1XZMA 1L7XA 2FWMX 1GZUA 2V7WA 3SIRA 4L78A 1JUDA 3ZU2A 2EIXA 1R9NA 3C74A 3K05A 4IIHA 3K72B 3MYRA 2F59A 5B1YA 4CU5A 4OD0A 3OFND 5ECWA 4R0MA 4JI3B 1PGJA 3M6LA 2CWWA 4GSLA 3J7AC 3CX7A 3TVTA 2ES4A 4DLBA 3LQ1A 1DBQA 1M7GA 2I54A 3GEBA 3OCJA 1G3IA 1Y1SA 4ASUA 1N0VC 1V5WA 3AM5A 4K26A 3WK6A 3HB7A 4R5HA 2XD9A 4B5KA 5DXAA 5IAAA 3GJ8A 1CB7A 3SNHA 5KWEA 2VDPB 1PTJA 1P1FA 4G5OA 4BO2A 3D43A 4QXPA 4D98A 1G5IA 1Y7HA 2H8KA 5HFJA 5K3DA 1QBGA 4EEKA 1MVNA 5C51B 3PITA 3F46A 3QEJA 2GPTA 2CB0A 2Z0MA 5CA0B 1S8FA 3WGYA 3WHPA 1ORTA 2B20A 2CK3A 1BOFA 1DX9A 4KN9S 4TSKA 1N3LA 2QV0A 1V6SA 2J3JA 4WN3A 3SMVA 1V11A 3QX7A 3DV2A 3EFOA 3GWZA 4Y2SA 3ROMA 4ZK2A 2RB4A 5IAKA 1R1DA 3TTXA 2HQ1A 5JWHA 3WGQA 4Q16A 1XJWA 3L7MA 4K9RA 4D57A 1NWHA 4TQAA 2VNJA 4GW3A 1A69A 1Z68A 1CRLA 2IZ1A 1UP6A 3D6JA 3TSAA 2HJWA 3RJ9A 3WMEA 3AJDA 2IV2X 1V2HE 1OYYA 4YPFA 3PCXA 4DQ0A 5BQ3A 1PNVA 4ZT6A 3JQ8A 1WZ2A 3OE1A 4FD3A 4MHOA 4MIYA 4QWWA 1N7GA 3P2KA 3F67A 4S2UA 1PL6A 2DWQA 3ZZUA 5DEOA 3X1YA 5JYCA 4G5SA 1DWPA 1K3TA 3GGOA 2F00A 5THQA 5DVZA 4BRSA 3OFJA 1T2FA 4UU7A 1U7PA 3N2EA 1B6TA 1VPLA 5KYWB 1ULSA 5I6DA 3FSEA 4Q1CA 4D42A 4N54A 3K0HA 3TJMA 3V8EA 2ZT6A 3D6TB 4CMCA 2QU7A 3IJEB 2V54A 5BVHB 1Z6PA 2Y67A 2PLAA 4WLOA 2FR8A 4KAFA 1B8VA 4EPYA 3UH1A 4UCQA 3MGBA 2M6RA 4R1MA 3IT3A 4AY3A 1AKWA 1KY4A 4Y2HA 4ZO6A 3T9CA 2OHJA 3U9TA 1M1XB 3M5CA 1NJ5A 1L8QA 2DTEA 4QASA 1DC7A 3FB4A 4X8MA 3RKUA 3SVLA 2I34A 1IVNA 4WZBA 1QIKA 3WJ2A 1P7PA 1LLDA 1WEKA 5IPFA 1OAOC 1P5JA 1QIHA 1MVOA 2CWDA 4MLCA 4DHWA 3GI1A 4AJ2A 1GOTA 3BSFA 3VI3B 4N9WA 4ZYYA 2RGCA 5DHRA 3WYNA 3X1JA 3T5PA 5JXIA 2VBIA 4H7DA 4YRPA 2AMFA 1UBKS 4OKSA 4D44A 4PNPA 4Z1MD 2FUG1 4YR7A 2DYKA 1UKEA 3RUDA 3UWPA 3MCAA 2BEKA 2QR3A 1HTBA 4L0CA 4P3XA 3SZOA 5BSWA 1N5OX 2C4TA 4A8PA 2BMDA 1OT5A 2E4UA 3CNEA 1DBWA 3FOZA 1Z5NA 4MX8A 2XRZA 2CLDX 1FZQA 1SJ9A 1XTUA 1IK6A 3OCCA 4GL4A 4JHLA 1XVTA 4TYYA 4LCJA 2OGZA 4ZMSA 4MGEA 1YDFA 1Z5UA 1YZTA 3B6IA 5H4HA 5JH7F 3U7QA 2HM7A 1KP3A 1J2YA 1YL7A 2Q1SA 5FNVB 1KFCB 3WDKA 3VPCA 3PPYA 1G9TA 2QZJA 5JE8A 1DBIA 5SZHB 1SY7A 3F5FA 1C2TA 4RELA 2D7CA 3BFXA 3L6DA 4OVKA 1GL7A 2AIRA 2EJUA 4G1CA 5CYFA 3I05A 2CHFA 1RPNA 4B5LA 3ROGA 2DQSA 3ROTA 4EDHA 3C7KA 2ZJ7A 1T8TA 4BZXA 3CEMA 3ICPA 4V0KA 4BMZA 5EC8A 4ZAVA 5K0LA 1P1HA 3FDFA 3WSVA 5J4KA 1H2AS 4BFTA 3BICA 3HU3A 2EYQA 3HDVA 1AOXA 4B4OA 5BSVA 2HB6A 2LGJA 2MYUA 1TTHA 4QQKA 3SXPA 3PX3A 3UQZA 3FCOA 2W6ID 5B1SA 4EABA 1K5GA 2ZR0A 1A50B 2ZI6A 3MWKA 3A6ZA 5DNWA 4H6VA 3OQOA 2VP6A 3OX4A 3SM9A 3ZVMA 4R69A 4DNQA 5DBFA 1EUCB 3KQQA 2PCLA 4X20A 5JAHA 2HYIC 3QBJA 3Q9SA 1IB6A 3HYSA 1UC4B 1O5OA 4CN8A 4FMPA 1ZPDA 2K2QB 3LLCA 2OXIA 3WLRA 5K2OA 2JS7A 4J49A 2VH5R 4JKYA 5M7EA 4P35A 3T52A 4FBGA 2A7XA 3T54A 1HQYE 1UOOA 4ZT2A 1RHJA 3MT0A 3LBHA 5AOVA 1JQEA 1N8SA 1WU7A 3F78A 3HY3A 4V2UA 4XWWA 4H4CA 4QYWA 1RXCA 1Z8FA 1VLQA 1W85B 5JNWA 3OPYI 3CXUA 4N7BA 3KYIB 2P1ZA 1U5CA 5CLJA 1M34E 1X1DA 3WG9A 3M34A 4M46A 4UEJA 4ZQEA 4OQXA 4AYWA 4UEKA 4QIHA 4HZGA 5A4MS 1KVSA 3A1WA 4X60A 2CSUA 2G5PA 3C2QA 1U3DA 3PLRA 1ZEJA 4WESA 3UENA 1XRJA 2D1TA 1AGXA 2Z3ZA 3N0VA 4GLBA 3SCZA 1M6VB 1P5ZB 2BF7A 2RGEA 4IDEA 4F5YA 3U7HB 3UAZA 2KBEA 5D84A 1JE1A 4NKRA 2AW3A 3Q3EA 4OYHA 1N6RA 4IZIA 4V0RA 5FJJA 3UH0A 7ABPA 4DA9A 2PA3A 2GXUA 4X92A 4TKUA 4UTZA 3ZIDA 2JBHA 2H5EA 4CIWA 4K6MA 1OY1A 1HYGA 2QAIA 3B5JA 3D4NA 3PRJA 3EMVA 4GX5A 4PFSA 4XFDA 4B47A 4DIDA 1BS9A 3FCXA 4DZRA 3F73A 4O8CA 2C0QA 2N0SA 3HXKA 4Y0NA 1G0NA 5FPSA 2XT6A 5HDBB 1A8SA 1WNTA 2JB9A 2BYTA 1BCRB 5F3RA 1M5UA 1VL8A 2X1MA 3WLIA 5JMWA 1IPHA 1PWXA 4RTNA 3TLMA 3JQGA 3BE8A 3MWDA 2FP3A 3ANXA 2JAPA 1U0RA 3OHPA 2GZAA 4J0CA 3H9UA 4QHYA 4J3NA 3ET5A 4L9WA 4KFSA 5D5QA 3UTCA 3MZ0A 2O0JA 3O26A 1Q2UA 1FMLA 1W29A 3OQIB 3VNRA 1E3EA 1XLWA 2R5FA 2I62A 3I5AA 1J07A 4EKEA 5C1PA 1OFHA 2WJ6A 1Q1QA 2C77A 3CSUA 1JU4A 1XTBA 3EEFA 4RLQA 2V9PA 3TW0A 3V6MA 1KAOA 1QV6A 1T9GS 4KI0A 3B1WA 2ZDGA 3BD6A 3RHSA 4AP5A 1RRCA 1SAYA 4YNBA 1C2YA 3A70A 2ZE5A 3D5TA 2VRWA 2R1ZA 5BV0A 3K3PA 2W6CX 1GNQA 2HJSA 3C4JA 3LCVB 3NXKA 1KBOA 2EQ5A 4Q34A 4ZZ2A 5C31A 2CUTA 5LQMA 4I66A 3P9YA 5C3UA 5B3JA 2R4QA 2RK6A 3ZCRA 1T3ZA 1NYRA 1RWXA 1EFPA 4M1MA 3T38A 4RIGA 4X65B 2J9GA 2XOKD 3MD0A 1FJ2A 4D0LB 2IKSA 3SSOA 4ZK6A 4B1FA 9GPBA 4IJ5A 1R0BA 3V34A 3ZV4A 4TWJA 3AONB 2I2AA 2EBUA 4IWXA 1WLYA 1XLVA 1S6YA 3FHCB 2HLPA 2CNOA 1IY2A 3ASZA 3L4BA 1NMYA 4UMEA 5ALGA 3NVKI 1L5VA 5KHOC 5K3FB 2UVPB 1KNQA 1Y37A 4D9IA 1K8QA 1EXDA 3H7AA 1Z07A 2FZWA 3EJ6A 4E33A 4F3YA 3ZOZA 1J8DA 1R6UA 4FS3A 3W0LB 1WP4A 4I9NA 5LYJA 3A6GA 4I1SA 3UMCA 2GZRA 5JY6A 1EFHA 4X45A 4XB6B 2W98A 1L1QA 3KQPA 1ISMA 4JX8A 1T36B 2QUZA 2KS6A 5HM8A 4MS1A 4KXXA 4LJLA 5CFPA 1ZM9A 2QRLA 4P36A 1AQUA 1TAUA 5IUNC 5BWNA 1VHJA 1VDZA 4ETIA 5L4LA 3GY0A 1DLJA 1LWOA 1K7FB 4IGKA 3R44A 4E2XA 4BNXA 1X13A 5IM4F 4XGIA 2ATEA 4P22A 5JYBA 3K6SA 4IS2A 2IY7A 3UMJA 3DFIA 2BC9A 3ILYA 2CF6A 2JGRA 2PQ6A 4FKBA 5KTRA 5ILOA 1SG6A 3NKLA 1W8IA 2RJNA 4CMAA 2UAGA 2ZSJA 2EBFX 4PBTA 4RS4A 2WQZA 4QPPA 2CT8A 1NQXA 3PQ6A 5TF4A 4Z0PA 2OCAA 2B1IA 1IBLB 1J22A 2IEYA 3M33A 1CUDA 5C80A 1NJ6A 4AX4A 1AKMA 4C88A 2R6GA 5AW0A 1PQYA 1Z8HA 4RF4A 3A4TA 3SLRA 3EPHA 4CDNA 2VK1A 2VQDA 1SUWA 1I6MA 1ITZA 2GRAA 4Q3OA 4XQ0A 4D9EA 1G8FA 2DU8A 4CW7A 1CK4A 2X5NA 4NICA 2DUNA 1OOEA 4JUBA 4I08A 1RSZA 1YE3A 2PEYA 2O2CA 2WKRA 4JOQA 2ZYIA 3COSA 3R40A 4DUYB 3LBYA 4RHXA 1JQKA 3F7TA 3AV0B 4HPXB 5AK5A 5KHLB 3W2TA 1QP7A 3CZ9A 4KOEC 3HCFA 1QCZA 3P20A 4M53A 4KV9A 5IN5A 1MD9A 4FR5A 2HU7A 4DZZA 2XZOA 2DGDA 4PGMA 1E4EA 3FYSA 3LP6A 4K9NA 4WSOA 1RWWA 3TX2A 2G5CA 1O87A 2A3RA 2VYFA 2RHTA 1HDRA 1D9XA 1GITA 1R0CA 2FQYA 3SY8A 4ZEVA 3IL2A 1WEHA 2KYRA 2X58A 2MSCB 1Y4AE 4EB0A 7REQA 1VGVA 1ODSA 4ALJA 2B6NA 2AK3A 4EG1A 5JRZA 2JAQA 2YHBA 1Y8QB 3Q6IA 4OL9A 4OXYA 3DPIA 2A8YA 1W1UA 3EGIA 1WF6A 4NP6A 4Y9TA 4C04A 4CT0A 1PE0A 3OF5A 2IHVA 4E46A 4ALIA 4QBIA 4FJ1A 3ESZA 1WL8A 1I7LA 1TF2A 3VSDA 3E3OA 4GKBA 2QLTA 5JAZA 1UXIA 3MC1A 2QRVA 1T4CB 1LSOA 3OQPA 2AFRA 3HEAA 4IVRA 2QD2A 3CVXA 2ZZNA 2VT2A 4XDHA 4RXMA 4C6TA 1SXQA 2VT7A 3KU1A 4YJHB 2X4LA 3WKEA 3LUCA 3TXAA 1J8MF 4XD7D 1ORHA 1UK6A 3QELA 1Z17A 1KO5A 4QGBA 4V3CA 3SEQA 4BX2A 3VJRA 4DRXA 4EJFA 3C43A 3ABSB 4GI7A 1PL7A 1K6EA 2FVYA 1UDAA 1GPUA 2CXUA 2I4IA 4EI8A 1EA7A 2QBYB 4HDRA 3IE1A 1BXKA 3KP1A 2O8FB 3ASVA 4GP7A 1XVAA 3IJRA 3F9RA 4YAUA 4J8PA 3GNSA 4MQFA 2WTBA 4U2GA 4MNTA 3WLPA 5KAPA 2BKEA 4UNPA 4RTRA 3CZRA 3OCWA 1WUHS 3BD9A 1UMBB 4QNMA 2PZBA 3OICA 3U49A 4DMGA 2J9XB 3DEHA 5AJTA 3FIUA 4FYYA 1VP3A 2E7ZA 2YC4C 5A9SB 2AUMA 1P81A 3RUHA 2GZMA 2QRMA 3DG9A 1Q3HA 1V9LA 2Z58A 4E70A 2R8ZA 4EKNB 4YT4A 1GPH1 1YQUA 2BWJA 2W2TA 2C4NA 2Z3WA 2ZRPA 1B00A 3O9MA 4G4IA 4Q3BA 3EDCA 1PJZA 1UEJA 1HC7A 4B9AA 4BNDA 2PUEA 2JLBA 3L7CA 3O1IC 1TMYA 2A88A 2J9FB 1U8YA 1L5YA 1UAYA 3FPJA 3LX4A 1JR4A 3HTXA 1JDSA 3HNPA 2J1LA 1PEDA 4CUKA 4G0VA 1XK6A 4CKXA 2ODPA 5DU2A 5KJCA 3OZ7A 1D4OA 3BH6A 1E2NA 3A6HA 3REGA 2XB9A 4Q4AB 5DSZA 5DM0A 3TMKA 1X8JA 3N87A 1C8BA 1XTSA 2JVKA 2Y4OA 4A8TA 1CE8B 3E9ZA 3NWOA 3I2IA 4YQYA 2FPGB 3EDMA 3ZJUA 4WH0A 4YJDA 4WACA 5REQA 1KO7A 3N6RA 1Y6JA 1IG0A 2Q1WA 1P6UA 5AYVA 4DJTA 1VZ3A 2VTDA 4Y0AA 2DECA 4G6ZA 1FF9A 5AW1A 4X93A 2GZ1A 4LGVA 3CEPB 5JDCC 5KQMA 4MOWA 5IDXA 4TS4A 3RFCA 3M7IA 3QVGA 4C0QC 1GFZA 2HNAA 1WXDA 3HG7A 4PSAA 4AMGA 3WGJA 4HPJB 2YV4A 4PIPA 3DWFA 5CHYA 4QEDA 5CNJA 2AJBA 5KYUA 2ZATA 1IDN1 3TQOA 4W5QA 4IW3B 3IAFA 5IN4A 2HIMA 3BIJA 3ITNA 3QKRA 3OIVA 2R62A 3UCXA 3OZDA 4B84A 3GJ3A 3MTQA 3Q87B 5IJ9B 2R8OA 4BU1A 1NMEA 2DSTA 4RTLA 4FBLA 5LQDA 4JR1A 2J5RA 2HJRA 3B12A 3FVQA 4MS3A 4PO8A 3U4HA 1GR0A 3V00A 1II8B 2PKEA 3CZPA 3DT6A 4IKEA 1L6IA 5H02A 4BO7A 5A5FA 4DVJA 3P2JA 3T3OA 4G3XA 2ZYRA 1E6WA 4CTKA 2OO7A 3AETA 2HRCA 1JALA 1J8YF 4PTYA 1A7JA 1SBCA 4FX2A 5EXSA 2R66A 3K0CC 1ZESA 1BKDR 4PSUA 4G1EB 2PJRA 1PHPA 4Z0HO 1BX1A 2HHLA 5ITSA 3JR3A 4PIMA 4TM7A 1EFUA 2XB4A 4BV2A 4P8RA 1KKLA 4FB4A 5KYXB 1U8CB 3L7BA 1Y3DE 4I4IA 1RYYA 3ZLBA 4MV7A 1XPOA 3R23A 1UKBA 4WJLA 4L51A 4WZAE 3NJ4A 4NBKA 4BWYA 3KKEA 1QIFA 5F21A 1OLXA 5ABPA 5EJMA 1YFZA 5C7IO 1TK9A 3UV6A 4GYKA 4PRKA 2WYVA 5ESWA 1E7WA 4L1KA 2IOYA 1KTVA 3NGLA 3BL6A 3PL1A 3R9IA 2N1MA 3W6OA 4X8LA 5JJIA 5LZ4A 4W1SA 1N6LA 1BIFA 1IY8A 1YZGA 4LBVA 1O2DA 4JX9A 3TAXA 2YZMA 4HVTA 3ZZ1A 2PQ0A 3PLNA 1T5IA 2WLTA 1EZ1A 1CF9A 2DQZA 4OL0A 2FZCA 4JJAA 4L15A 5CA0A 3SFVA 4RD0A 1SRQA 5GIPE 1CQIB 1QV7A 4YJFA 4F8JA 3D4OA 4R6XA 3KPJA 3IVXA 2C8JA 4NBWA 5DIFA 2CVHA 3AKZA 1I6WA 1M2JA 1KGSA 4LSGA 4GQBA 4QECA 4J7AA 4R2HA 2A5LA 3OT1B 5IS2A 4L9RA 1YKFA 3QVTA 3KLBA 3L0CA 3R7NA 2PL1A 3EZYA 2PQMA 2YBDA 3H6KA 4TMKA 4HN4B 3U3KA 3CNNA 1JGTA 2GR9A 2XADA 4WI1A 3THXB 2WF8A 3FOBA 4BGEA 3PK0A 1YC5A 2P9GA 2IT1A 4Q3AA 2VBCA 1F2VA 4DC9A 2GAIA 4YVFA 4QD3A 4RHUA 4R16A 4F60A 1Q7BA 2CFCA 2G08A 3ETHA 3UJAA 4F1WA 4NYJR 4YJ3B 1VG0B 2OVFA 2X7JA 1L5NA 3H4IA 1JEQA 4MAMA 4QEZA 4PSKA 3FRIA 3V4OA 3WYFA 4XX0B 3FSRA 2R7AA 3WAJA 4IX1A 5I9TA 1JMYA 1QYRA 1NPYA 4FI3F 3RTBA 4EDFA 3ZJTA 3WBJA 2I8LA 5BW4A 2HTEA 3G8BA 4QXMA 4YAEA 2MYNA 1PV1A 2PEZA 2FZ4A 5EXDA 4LZNA 3H6HA 3E5NA 4I36A 3D5EA 4ENUA 1IC6A 1ZKDA 3EGEA 4D26A 1CY7A 3CIFA 5F52A 5HA5A 3HHPA 5HX7A 5IYZF 1PZMA 2XJ9A 3I04M 1KDYA 1Z29A 2BKXA 3BERA 3ER9A 3NBUA 4JLMA 2G1AA 4DMRA 1TQDA 1USWA 1BGVA 2P11A 3A2MA 4NCKA 3VUEA 1RXWA 1HT2E 1U2GA 1XTPA 5CFRA 4C22A 4ALKA 5CCDA 3ZI7A 4GQAA 2EX4A 3VBCA 1R4MB 3CZ5A 1PJBA 2P0AA 2NXWA 2WMNB 1H2XA 5DLYA 4B3DA 1SUDA 1DEOA 2VUSA 1ODIA 4OLJA 4NCHA 4HAZA 3WLEA 5EVJA 1TDJA 3DW1X 3E1GA 4LN1A 2EJWA 3UJ9A 1FFEA 3HBMA 3HBLA 5ALOA 1YV9A 4Q7EA 3ZHTA 4IJMA 1LPAB 3HSSA 3O2QB 3VR5D 4M0PA 4BOYA 4NRDA 3E0QA 1ZGAA 2HU2A 3FCUB 3U2QA 2MSNA 2WJ4A 1C7ZA 1G8YA 2PSSA 3S70A 3LT5A 4PHTA 3TM4A 5AI6A 2QQEA 4MGYR 4EA6A 3BMQB 1ESDA 4CG1A 4IDFA 5HIJA 1COWD 1UDBA 4DIFA 3I72A 1U02A 1YE5A 2DWOA 3DBIA 2JCYA 1CIVA 4K6CA 2JI8A 1EVKA 1E2LA 5FNVA 1IPFA 1NXXA 2QTGA 3ZX5A 4IEEA 1QGED 1P6QA 4LYAA 5JOQA 5KQGA 4C7JA 4Q00A 3LXUX 3SQXA 1FL9A 2ZT8A 2PO5A 3JRXA 4PZPA 1DIGA 1WVIA 4KQJA 3STXA 3HCOA 4BDTA 5ELXA 1FBTA 4R5MA 2IBTA 1RADA 4QLBA 2BGRA 4PZAA 4MMYB 1GQRA 3DMGA 1TD1A 2BM0A 4MUNA 4X44A 5T64A 5JSQA 1UZUA 2PWAA 4U6QA 5H3LA 2NVBA 1VSTA 2QY6A 1U0JA 3GVIA 2GHIA 4HNVA 1PTJC 2WF6A 4HUQB 3ORYA 5FOTA 1EG7A 3E5RA 1MJHA 5LSAA 4X8HA 2NT4A 3MG9A 4RPKA 3H3XA 1DAPA 3H5OA 4Y2UA 4GOND 5JANA 1EWTA 2H59A 1NOKA 1B76A 3LOUA 1Z39A 3CGGA 2HO5A 3QK7A 5JPCA 1AQ6A 4XB2A 1A4UA 2GN4A 3HKEA 3PTAA 1JMVA 2HO4A 3I4LA 1PDWA 5EIFA 3EVGA 5FI5A 3QNMA 3AL0C 2A7QA 1XTJA 3HDGA 2AFHA 3R0QA 4HLQB 3OFSA 4XSGA 3ZGLA 4LDPA 1X1RA 3VZQA 3WTBA 1VJ1A 3KTAA 4ZO9A 1P29A 1QP8A 4R40A 3GJ4A 1W36D 2YJNA 5EWLA 4X91A 1Y8ZA 1XVIA 2O7QA 4NC9A 1JEOA 2DHRA 2D3TA 5IKOA 1W85A 5CH3A 4OAPA 5BVGA 2GK6A 2A2ZA 2WZBA 4I46A 1NSFA 5DM2A 3H13A 1P44A 1U7OA 4IRMA 2SBTA 3WLQA 2ZK7A 4A6XA 3WKAA 4I2VA 1CX9B 4F1JA 1WB9A 4BE7B 1MJGA 1FYVA 3TH5A 2C54A 4OHZA 5K5EA 3FPHA 1Z56C 4M7RA 4FYKA 1PS9A 4WEQA 4GX1A 4MMXB 2IYLD 3KT0A 5TGDA 2ZWMA 4I1PA 1M6VA 3PGXA 3RQIA 2CJWA 4BNFA 4QU5A 3V4FA 3CYFA 4L4RA 2FFQA 4RMGA 3U7EB 2WSLA 1QQAA 1KH2A 3UUFA 3V1KA 2EERA 2VJBA 3WE7A 1NNI1 4F38A 2Z2ZA 3RREA 3ELUA 2ID8A 2FR8C 5KU1A 1W4LA 1BWQA 1HF3A 2XY4A 4HDNB 3CKYA 3EXFB 2Q29A 4RHCA 3F90A 4LGYA 4WLFA 3TR5A 4KRYA 4LRQA 1TF7A 8ADHA 4P1ZA 1DEXA 2X6RA 5ALPA 3MCZA 1BCRA 4PF1A 5KTPA 4MCIA 2WHRA 1XRRA 2ENWA 3O90A 3FMPB 4MRPA 4P33A 4C0KA 1P1RA 1U28A 1VG1A 2H0AA 1KOLA 1IUOA 4HB3A 4BUZA 2QUAA 5L3RA 2P35A 2QM7A 3R3VA 4KQMA 1DCTA 1N4DA 1ZGBA 4G1UC 1I1HA 1G7CA 2WHPB 1YHNA 3B85A 4TZKA 4K46A 1N5IA 1XELA 1NC1A 4FT2A 6GPBA 4N3GA 1WD5A 2VNKA 2Z83A 3EODA 5F3WB 2BF4A 1OWMA 1WVMA 4B4KA 3I2GA 4BBAA 2NP7A 2JVJA 5IVHA 2XAUA 4KN6A 5ENVA 5IX8A 5GJCA 1JKFA 1Z5ZA 5TQ2B 3TIGA 5DE3A 1RM5A 4AJNA 2VWQA 4LV6A 3DVAA 4N39A 4YFVA 1NJ8A 3ZI4A 2BSAA 4WX2B 1FFDA 3DTVD 1C8KA 5KOHB 1UF9A 4BRUA 4A7PA 1CUHA 4HMPA 3L41A 1GZ6A 1WTCA 4I1RA 5KOIA 6ABPA 5CJPA 2HA7A 1NVUQ 1QHGA 5BV8A 1CJKC 3GYGA 3JAKB 4LWPA 4DYHA 3GYBA 2PMFA 2V3VA 4YK7A 2FSIA 4YCSA 4KB5A 2WB4A 1CZHA 2F17A 1T1IA 4GGMX 3H7IA 4CLRB 2PJUA 1QGUB 2PV7A 3E9MA 3IR5A 4O4JF 3RAJA 3SKVA 1AB5A 4KNVA 2HSZA 1W5EA 1IATA 2V7PA 4U2FA 5J2TB 1T9KA 4H6XA 1YS9A 2NXCA 4UUMA 1CQZA 5KTSA 5L53A 3FNEA 1DAHA 2UVPA 3N53A 5J4VA 4NZZA 2OCIA 2XLBA 5TIIA 4LY6A 2WHYA 3QENA 5EP1A 4YUZA 3OBIA 4RULA 1P0CA 1T6BY 3V8QA 3WGUA 1W25A 3MS7A 5BW8A 1ECFA 2FLVA 2ZT7A 3CUKA 4TZ0A 1T1GA 1L4FA 1RCFA 3GJRA 4G2TA 4FOPA 3C1UA 1IXZA 1R27A 4Q1BA 1NLFA 4IIDA 4WY5A 5BMOA 1CSEE 3ZDZB 5AI5A 4PGAA 3SBDA 5LUAA 4FWTA 1B7GO 2C2BA 4J9VA 1T2VA 3KJFA 1CEXA 3CLVA 4FFBA 1AQIA 4X62B 1CEYA 2J0UB 4H18A 4ZAZA 4IOKA 2VBFA 2X0EA 2IDKA 1D2AA 1LBHA 2POCA 2C7PA 1N2GA 1J9GA 5JO0A 3RSOA 2ZSAA 4HB0A 2PIDA 4U7GA 3W4IA 4QBHA 1KAHA 4RJLA 3L92A 5BY2A 4TQ9A 3KSUA 3CBGA 3AOEA 5IXYA 3DE0X 2G09A 3ZDEA 1UBUS 5DP1A 2O50A 4NYJQ 5KSOA 1YO6A 1DT5A 1CRQA 1EBUA 2A30A 2D2EA 2J32A 2ZIVB 1AMUA 2O8DB 2EW1A 2VQSA 2YKGA 3AKYA 3H8JA 2F67A 3W5SA 1ZOIA 2HSDA 4BDSA 4G5QA 3CR3C 2NV6A 4D45A 4G5FA 3DXYA 1R4NB 2QV7A 4N5LA 1RCTE 4TQUS 3WK8A 5TMEA 1FSFA 2B21A 2VHQA 3B7GA 5BSUA 3WRVA 4EJ6A 2CJYA 3A1NA 1WWKA 3ZDXB 2HWKA 4N3AA 1CZRA 1WXQA 1Q7TA 5CPFA 3CT4A 3BM5A 1XT6A 1LI7A 1NASA 3CH5A 1D9ZA 3EGOA 3N7AA 4LG1A 1FP7A 3IV7A 4GKAA 3TZLA 1XMQB 1G3MA 4F5EA 3CNBA 5DGTA 3R7AA 2P6RA 2IX9A 1B2RA 2AOXA 4J1TA 2UDPA 3AUXA 2CBXA 3DVSX 1CYEA 2GN6A 4J90A 4B6GA 1P4SA 5K9ZA 1N0UA 3H11A 3AUYA 3KJHA 1CUZA 4RA9B 1YRYE 4YUYA 1ZCAA 3PQ5A 4RJIA 1FRFS 3V1YA 5MGNA 4JYPA 2IZOA 1Y8QA 2WJVA 4LQDA 5ALJA 1G1AA 4TRMA 1E0AA 2B92A 2B8JA 1KXZA 3W5UA 2J0VA 2JGDB 2MINB 4ETNA 1QH8B 2BFNA 1N8KA 1RTKA 1EZ4A 4GL2A 1FLVA 1AKQA 2PK3A 2QZ4A 1H2WA 3E7FA 3Q72A 3WLMA 1GWNA 1XX6A 3K6JA 1T4CA 2ZS8A 4GS5A 4RETA 4PVDA 2QJWA 3VNVA 4NK4A 3WOVA 3UWSA 1WJGA 1OAKA 5DBOA 5TRTA 1XRNA 4YCDA 4CMKA 4KPEC 2A1TS 1KYIA 3IAS1 4NMHA 3KUUA 1RZRA 2ISCA 3I9LA 3H42B 1YT5A 2ZIFA 3KB1A 1P2FA 5JNSA 1DS6A 2VA9A 4N41A 3UCEA 2I2DA 2JFQA 3EHEA 3O2JA 4FN4A 1EG2A 1ZIPA 5B3JC 2P69A 1XZHA 2F3SA 4I1YA 1THZA 1WF3A 5IHPA 5M04A 5K3SA 4K9PA 2QBYA 4OM8A 4F3NA 1ZD5A 2O8FA 1V1MB 4G0MA 5BN3A 5I3ZA 1KVQA 2QTVB 1HZJA 4OM7A 4RD2A 1ZKMA 4M1YA 2D4HA 2FHSA 3HKDA 3IUEA 4BQIA 2JKZA 4UNRA 3L4BC 3TG2A 4UVDA 4UVIA 1M34B 3PI7A 4KWCA 3L0PA 3C7DB 3DTYA 1UPCA 2WUVA 3G2HA 3O74A 1CU1A 1LZLA 3C87A 3MBIA 4IKPA 1XF1A 2CBGA 2VI5A 4LV8B 5CIWA 3ZVLA 4CFYA 4ESOA 4J43A 4TTIA 1N32B 4U3JB 5GMOA 4QRDA 2ZXFA 3KU4A 4DTIA 4YJ2F 1LV8A 1N2CA 1NW6A 3D8BA 5IMBA 3AR7A 5I8ZA 4WXRA 3NO4A 5J2UF 1TCAA 4AU1A 4HYYA 3DC2A 3DE7X 3B36A 1PUIA 1GCGA 3DEKA 3RDPA 1DC6A 3TL6A 1U0HC 2RARA 6NULA 1KZ9A 3OUUA 3N0WA 4F1KA 4ACBA 4FYWA 1R9GA 3VOSA 4LF4B 2Q0SA 5JUWA 4H2DA 1JQBA 1Y98A 2BZGA 3BHJA 3RCBA 4CMIB 3KQMA 4Z9XA 3D6VA 5GV7A 1CE8A 1CJUC 3IMEA 3I2FA 2G3YA 4AX8A 1QMGA 5FAKA 3TI9A 2LW7A 2Y1KA 1V5GA 4BFVA