3MJDA

1.9 angstrom crystal structure of orotate phosphoribosyltransferase (pyre) francisella tularensis.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
209
Chain Sequence
NLYFQSNAMFIEFALKNQVLKFGEFTLKSGRISPYFFNAGLFNTGAQLATLADYYAQLIIKSDVKYDILFGPAYKGIPLVAAISTVLALKYNIDMPYAFDRKEGVFVGADMTNKKVLLIDDVMTAGTAFYESYNKLKIINAKIAGVVLSIDRQEKAKDSDISATKKISQDFNIPVLAVTNFESIFEYVKENLDETMIDKFKQYRQKYGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.9 Angstrom Crystal Structure of Orotate Phosphoribosyltransferase (pyrE) Francisella tularensis.
rcsb
source organism Francisella tularensis
molecule tags Transferase
molecule keywords Orotate phosphoribosyltransferase
total genus 67
structure length 209
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3mjdA00
4RHUA 2PRYA 4P80A 5BRNA 1I5EA 1G2QA 1QCDA 1A95A 2JKZA 1L1QA 4LZOA 5IAOA 1XTUA 4WMLA 1ECJA 1XTVA 5ESXA 5KAMA 4X45A 1G2PA 1U9ZA 2EHJA 3ACDA 1R3UA 2FXVA 4P86A 5K51A 2H06A 4LYYA 4MB6A 1QK3A 2GEBA 4F8EA 4RADA 1WD5A 4QRIA 4RHXA 4RQBA 4P84A 2C4KA 4JITA 2H08A 1G9TA 3LRTA 4OHCA 4RAOA 1UFRA 2VFAA 1A3CA 1IBSA 1UPUA 1Y0BA 4LZAA 1HMPA 1QB8A 2JBHA 4RQAA 1A97A 1ECGA 1QCCA 5BSKA 4P81A 1TC1A 5IPFA 1BD4A 3M3HA 3DAHA 4JLSA 1NULA 1NONA 4QYIB 2WNSA 5E38A 1QK4A 3GGCA 1A96A 1TC2A 5BQOA 1ZN8A 1HGXA 4PFQA 4M0KA 1I0IA 4RV4A 1DKUA 4LYGA 1LH0A 1O5OA 3DEZA 1ZN9A 5BQPA 4Z1OA 1AO0A 3NAGA 4RHTA 4X44A 5JV5A 3ACCA 1Z7GA 1W30A 1P17A 2H07A 1V9SA 1OPRA 3GEPA 1L1RA 2E55A 1UPFA 2DY0A 1OREA 5HIAA 2P1ZA 3EFHA 3OZGA 1I0LA 4FYMA 1VCHA 2JKYA 4QYIA 1QK5A 2YZKA 4PAWA 1A4XA 1O57A 1PZMA 1U9YA 2IGBA 2PS1A 5ESWA 1ECFA 4RABA 2XBUA 3QW4B 3MJDA 3ACBA 5EUCA 1ECCA 1JLRA 1GPH1 3O7MA 4RHYA 1OROA 4WN3A 3S5JA 4P3KA 1P19A 4M0PA 3KB8A 4RAQA 1P18A 3MBIA 4RANA 1BZYA 1J7JA 1XTTA 1CJBA 3GGJA 4LZNA 4P82A 2HCRA 3G6WA 2JI4A 3DMPA 1ZN7A 1I14A 1D6NA 5KAPA 1XZNA 3OZFA 1XZ8A 1DKRA 1YFZA 1JLSA 4ZFNA 3OHPA 1MZVA 1VSTA 1DQNA 2PRZA 4KN6A 1P4AA 4RACA 1FSGA 1GRVA 3HVUA 1VDMA 1DBRA 1ECBA 1STOA 3N2LA 1DQPA 1G9SA 1A98A 4TWBA 5HKLA 1QB7A 4S2UA 4IJQA 1I13A 4P83A 2AEEA 3H83A 5JSQA 4M0UA 3LPNA 1BD3A
chains in the Genus database with same CATH superfamily
3X1WA 3DT9A 2AUMA 4O08A 3S2IA 4BMSA 2PUFA 4GYWA 1AH2A 3IGFA 2WSBA 4IQ4A 3ZZUA 2B4YA 4G6ZA 3TFOA 1YF3A 2IPNA 1QNLA 2BV3A 4HUQB 1Q7EA 5EP3A 5FV4A 5FI3A 1XU7A 2N75A 3QLJA 4NYJQ 3ACDA 5KX5A 1RI4A 5BNIA 2OXEA 3KTDA 1SA0A 4XQCA 3WGGA 3FTDA 2A67A 2I4LA 1OD6A 1XZMA 5IXYA 2CV1A 1NQUA 1SZCA 4M49A 4WY8A 3L8FA 3LK6A 1ZZGA 3OAAD 1IUPA 3E0QA 4R8RA 3RJMA 3V3TA 4AS1A 3PC3A 1W1UA 4G37A 5LJIA 4KQEA 3TLKA 8ADHA 2NP7A 4RVHA 2UDPA 3VJRA 1AY0A 1A9PA 2QUIA 3CN7A 4FD3A 4CETA 3M5PA 5JLJA 4HBZA 2B3DA 4BPBA 1KDZA 4WUTA 2V7EA 1G21E 2WU3A 2IYWA 2IYUA 3QVKA 5I8ZA 3PE6A 1ULBA 1E9RA 1ONOA 1V5FA 2CF6A 2HF8A 4CHTA 5CHEA 4OOEA 4FS8A 4N0DA 1I0IA 3FX2A 2VZ0A 3RRXA 1U9IA 5C35A 3FJ1A 2I71A 2QSYA 4NY1A 1DRVA 5EHQA 2V3VA 2FN3A 4O29A 5FDFA 1N92A 3B9RA 3GX1A 1RXUA 2BHTA 4HAYA 4Q12A 4ENQA 2J9RA 3DOEA 4EL5A 4ZGBA 1NVDA 1IE3A 5KUTA 2R86A 3O1IC 2H54A 3LX8A 1R3DA 5AI4A 2HEGA 4PLHA 3TWOA 1NXXA 1OPRA 3OCUA 3ZU6A 2NYRA 2I6TA 3PPWA 4PCUA 2EJWA 4Q3LA 1ZAYA 3EBOA 4YJHB 1Y8QA 3OKPA 1Z0SA 3CE9A 3E7DA 2ZYWX 1DZ3A 3OJWA 3QZUA 2YWBA 4FFBA 5DK4A 3IB6A 3TD2A 3ON5A 3WXMA 4AO8A 1F3OA 4YRZA 3G5UA 1R10A 3PQFA 4LOJA 4DQUA 2FN9A 4C1BA 4PYLA 3HLTA 1DINA 2C2MA 1OTYA 3SHFA 3R0QA 2WUWE 3TINA 2UYQA 3CONA 3HN2A 4J0KA 2V8OA 3TSYA 5DCWA 4RZ2A 2XDYA 5JE8A 1YRHA 1MABB 1SVKA 1X1RA 4M0LA 2LWIA 4QREA 5DTQA 3WFJA 3ZPXA 3EVZA 4GOKA 4CNQA 4L5YA 3TTTA 1IAVA 3RKRA 2D0OB 2PZAA 1MR3F 3QUQA 4KXVA 4PC6A 3OZFA 5KYWB 3K70C 2PJRA 3CRMA 4Y9SA 2OXTA 3UJNA 1RAGA 5JDIC 1PL8A 1U4OA 1VLZA 3O26A 5ER6A 1HKHA 3A4NA 4AF8A 3CSDA 1IY1A 4ZO9A 2IH4A 1THGA 5KTNA 2VQFB 1CQWA 2EV9A 4ILKA 5BYJA 2B8TA 3P0FA 4KWTA 4LVOA 4Q7MB 5LP6C 3T3OA 2XA9A 4OL0A 4PANA 2WIFA 2Z8YM 3RSZA 1DPGA 5E8RA 3EZ9A 4GXNA 5HCIA 3CLSD 2JLAA 3BJEA 4AURA 4YY3B 5HRUA 3TW6A 4YJFB 5M2QA 3H2SA 3ONEA 3OU7A 1ZMOA 3LMKA 4CT4B 5MF6A 1FUUA 1T8WA 4FGLA 1K1EA 5EIBC 1ODSA 3S2FA 4C3VA 2OEPA 2HMAA 4C7OB 1KY3A 2WG0A 5KOJB 4MDHA 2NPFA 2ACEA 2A0WA 2OHOA 1U9ZA 2WICA 3U3DA 5JAHA 5DCYA 1UJNA 3FCXA 3PUJA 1JNXX 2Q2WA 2G71A 3TLGB 3ZHBA 1BU5A 3G82C 3AB8A 5EMKA 2A0XA 4ECEA 5BV7A 2XQGA 5BPHA 3ZLJA 1EFAA 3LUDA 3LY8A 3SI7A 3WSTA 4R71A 5KJCA 4QDKA 4PX9A 3RIGA 1Q12A 4U5XA 3AEXA 3QH4A 4OAQA 1M2WA 2QK4A 2J08A 2H2GA 2JFGA 2RAFA 1MKYA 1J1IA 3DKKA 1OIWA 2EG9A 4B73A 1O4VA 1P0CA 3ML1A 2H5JA 4X1KB 4RJKA 4ZQFA 4KMSA 3NOOA 4FR5A 5IBQA 4D57A 3IVCA 1N2OA 2DFNA 2HK8A 4MW2A 1UXGA 3MA0A 4G4GA 3KSUA 4E2XA 5JPCA 3HO6A 1IL0A 3D2AA 1R9JA 5KI6A 3ILVA 4RK0A 1J2TA 3RU9A 4HQLA 4GM1A 3C39A 4NAUA 4TS9A 3I5YA 2P7IA 1KC1A 2YMMA 1QIKA 2QGZA 3HZRA 4KI0A 2ZXUA 2GLTA 4N76A 2JDID 3R3VA 4NHEA 5JS6A 4B31A 1B43A 4HS9A 4FSXA 4G5FA 5AHRA 4JI3B 3ZE6A 4QM7A 1WCYA 3FIUA 2X5OA 3B5IA 4KXXA 2XZDA 4OFWA 4PHFA 2GS9A 4FGJA 2KX7A 3NUQA 1GLNA 1TX4B 2FP4A 4EP1A 1DP4A 2Q4EA 4MQBA 4G5XA 2AOTA 4OPMA 4ENTA 5AIBA 3A6ZA 3KYBA 1PUJA 3LKZA 3RT7A 2ORED 3BGWA 5L40A 5FLXA 2UYOA 3LUPA 4JJFA 1CY2A 2XHZA 4W7HA 4C5AA 1IDOA 1L7DA 3D4OA 2FHSA 3M5WA 1K98A 2QL5A 1QBKC 2P6OA 4HN2A 4PAWA 4IKOA 2ZSIA 3ZGNA 5JDIA 1UZAA 1QF6A 1LDGA 4PSKA 3KHTA 5HKKD 1JAZA 5AW1A 3O8QA 1XD8A 1OXVA 4WCVA 4R8MA 1ECLA 2YHBA 5EWMA 5CXXA 2B20A 4MJXA 3IUNA 5K4AA 3FCYA 3KB8A 2RDMA 4A9AA 3KUKA 3VKGA 1EGMB 1GUBA 1QCYA 2XB6A 4IINA 3U9LA 8GPBA 4BO5A 1VTKA 1LDYA 4DADA 4KPFC 2R8ZA 2JI9A 3C14C 2BR3A 3BMQB 4URVR 2XB8A 2QJRA 2BFEB 1E3TA 4YP5A 1E2UA 4XIGS 1ZIPA 2HDNB 4YRKA 2I6GA 4F6LA 1YQDA 4V1CA 2C4WA 4WDRA 5F1KA 2ASEA 1ESNA 5JAMA 1GSOA 2Y0CA 1O96B 2XJ4A 2J07A 4NF2A 1EFUA 3WGUA 2RH8A 2DWUA 3FUUA 2ONCA 4JJAA 2JD1A 1STOA 3VH1A 4LY0A 3GG9A 2XF2A 2W2MA 4KV9A 1H1TA 3GMIA 1U1CA 1AZTA 2CF5A 2VZ9A 4KMRA 2O52A 5DJ5A 4B4DA 1O0CA 3PICA 3NHFA 1AUOA 2ZE5A 2ZUSA 2RMKA 3IQGX 1EQ2A 4ZHQB 2JEZA 2O05A 4H1TA 4UM7A 5EE9A 4AB1A 1Q6ZA 4KFRA 3LW8A 4RKWA 3U4QA 7REQB 3LBYA 3DNMA 1JSLA 1UBCA 2ZG6A 1YDEA 5IC5A 2EERA 2CXTA 1KAGA 1KEUA 1GY8A 5EIBD 2F7SA 3TZQA 1E66A 2F3SA 1PR5A 3RNLA 1PT7A 4IDFA 4N41A 2PSSA 3DCNA 3CA8A 4TN5A 2GF9A 1V25A 3KHKA 1GKUB 4JLBA 4NEHB 4FDAA 2AFIB 3DB2A 1TEXA 1JHMA 1UXIA 2CXOA 2BC9A 2QWXA 3H5IA 1J70A 2GN1A 2QG4A 2PDAA 3EAQA 4IXNA 4NBNA 4TMYA 5D5QA 2EP7A 3FUTA 4FBGA 2YWHA 5J3JA 5L4SA 1LA2A 4F8JA 5IH7A 2I3BA 5KNDH 2Q5FA 1T34A 2YASA 4L57A 2NU9A 2J0UB 1GNPA 4RZUA 1AS3A 3HB0A 2RGXA 4ZO7A 1D4AA 1U8CB 3MIZA 2J46A 2REQA 1LBHA 2AE1A 3SDZA 4D9KA 1U8UA 2HF2A 2B1QA 3LJKA 1M0SA 3KPYA 2JGLA 2IUUA 3C43A 4UE3S 2ZBQA 1CDEA 1HT2E 5ALPA 2VYFA 3IIEA 4BFYA 4TS4A 4BEWA 2PUCA 1N2XA 4EH1A 4MWGA 3P5BA 4Q4AA 4NCJA 5KZMB 4C9BA 5GIPE 2IS2A 4PPYA 3TE6A 1IHDA 3KZ1E 1Y48E 4BLPA 2D7DA 4ZYLA 1PR0A 2DRIA 4RIFA 1UFQA 3W7AA 4H35A 4CDGA 5FQNA 4F0JA 1OZAA 2MINB 2HU5A 3B13B 4OHMA 2HO4A 5BNWA 4H7DA 4I1UA 4ZJYA 5HJ7A 1GGMA 1TUGA 3PHJA 3THWB 1NDUA 2C42A 4Y1GA 1L8QA 3VNUA 4UE6A 5J2TB 2WMNB 3LX4A 4GZ6A 1PWXA 4ZN6A 4FJ1A 4OIMA 1G18A 3KVOA 4IL5A 3K73O 4BZZA 4LYEA 3AJ9A 4ESVA 4DAEA 3D2LA 1GCGA 3TKAA 4GI3A 1O57A 4TTVA 1OTXA 2G07A 1SWWA 2DWOA 4PO3X 5LQDA 1X7YB 2J3JA 1UBMS 1B15A 3HUTA 5AXBA 5B3LA 5HVNA 3UPUA 5D8DA 2EP5A 3WADA 4F4DA 1GPH1 3PPVA 5HK9A 2P77A 1UKYA 5FQOA 1XTBA 4K7JA 1UJ4A 4JMLA 4YEDA 4CR6A 4OP3A 5LMZA 2AN1A 3GRUA 2L82A 4HWOA 3UV3A 4WK2B 3SVTA 1JJIA 1W34A 3OTWA 1Q83A 1QHYA 3G6WA 3ZI0A 4PV7A 4X5OA 1PSWA 1T0PA 2H5LA 3Q0EA 5AVZA 4DDHA 4G5RA 4OA8A 4BE9A 2WTEA 3P32A 3SFTA 1NN0A 4XJXA 2C5BA 3CY6A 3E9YA 4HAZA 4ENUA 1EXNA 1V35A 2HLHA 2YZMA 4NENA 1I4LD 5I9BA 4GIBA 1UKZA 4KX3A 3BJIC 4MWZA 4JUCA 3ROEA 5K0GA 4Y6QA 2IY8A 2ZITA 2J5XA 4DB4A 2YFQA 1UDXA 3DFMA 4BQIA 4Q4CA 3LIPA 2WVJA 3I5UA 4OSOA 1DQPA 2HK9A 4ZCQA 4EW1A 4WK4B 4DQLA 4B82A 3D6MA 3EARA 1QB7A 2SKCA 1YRWA 3GQVA 1NYLA 4QJ5A 5KDLA 1FLVA 4A26A 3QBEA 4NXNB 1WMSA 1YRBA 5CURA 3Q6IA 3PHLA 1EYZA 3TDNA 3ZV6A 5MGNA 2E48A 2NTVA 2PRYA 2VEDA 3B2EA 4YAGA 2CL6X 4V1CI 4KG7A 1N2CE 4ID3A 4RVGA 2QRKA 4GYYA 1M6NA 2BZSA 3N2YA 4IRMA 4UXIA 4CU2A 2A78A 5ANRB 3FTFA 3IHTA 3T7JA 4M86A 2NXNA 2GHRA 2RGAA 2P75A 1U7ZA 4X45A 3WGLA 3MWKA 4XCXA 3P45A 5LZ7A 3VA7A 2J7PA 5LIRA 3VR5A 2AJCA 4NPAA 4FZ5A 1RT9A 3S2UA 2QD2A 5FUMA 3JD1A 2ZCUA 5TJHA 2YFHA 1VECA 5LUAA 2PRKA 1BW9B 3BF8A 2R8YA 4N3BA 5HOEA 4Q93A 2PSEA 1XD9A 4Q3CA 4L7VA 3E3NA 1G5RA 1HTWA 4XIYA 1D6JA 3IQWA 3OKFA 5AT1A 1I9GA 4QPCA 2I91A 3VHXA 3LL4A 4NJMB 3NM6B 3SGLA 2CLKB 5A5VA 1EP9A 4G84A 3ME5A 4MRPA 2VYVA 1E79A 1KYWA 3LCUA 1E1DA 1NNLA 2C82A 4GOND 4D3ZA 3PQ6A 1RAIA 1N5OX 3EX7C 3CMMA 2GZRA 2J9GA 1JPJA 2B36A 4M0KA 1U8AA 1R74A 2I6XA 1VMIA 4IJKA 3HE3A 2QRZA 3DT8A 3LKVA 5HHTA 4DQKA 1I0ZA 2WDPA 2FQQA 3T4XA 2JIDA 3AH8A 2V97A 4D2IA 2VDLB 1Z74A 2IPMA 3RV3A 5LYJF 1V6SA 4LI0A 5AVSA 4P35A 2G9QA 4DM7A 5EIOA 1D2CA 1V9SA 4KCGA 4KVGA 3URMA 4N47A 3OKCA 3O8OA 1K8XB 4ND8A 3D8SA 1QX4A 1XK7A 3DKIA 3AZPA 2PBFA 3PX3A 5JVDF 3LOPA 1PK9A 2GJSA 2VWQA 3T3PB 4QTXA 3ZBTA 1ABEA 4C78A 4FEEA 1ZA2A 2JAHA 5EVCA 4D4GA 5EMNA 3UTDA 4F7DA 1ZMXA 3UAVA 1GIAA 3P2MA 3C3KA 2HJHA 4V0NA 3I58A 1BVRA 3EQ9A 4ZAVA 3TIVA 3C5CA 3SIWA 2AQIA 5DGHA 4BAGA 1ECCA 4IDQA 3O7MA 4MI9A 4P3OA 1YB6A 1ZGBA 1ZD9A 1FFXA 4V2IA 2FG5A 4B34A 4EKEA 1LRKA 1SC4A 5ELMA 5JFOA 1WMEA 4RTJA 3CCFA 2RH4A 2K6GA 3NB0A 5PGMA 3TRDA 4J29A 4O4IF 3VBEA 4D96A 1VL2A 1YQTA 1V3TA 1YZNA 3GRKA 3LFHA 2BFBB 5KCMA 1FQKA 3IVRA 1QRSA 5TQ0B 3BX1A 2HMUA 1L9XA 1D2GA 1GTZA 3QVWA 3S1AB 5CDGA 5CFQA 1F1JA 2UUAB 1GN8A 2MR6A 2ZWIA 1NVFA 2H2IA 2W2LD 2XMBA 5KX5B 3RYCA 1X14A 2V55B 4R1OA 4HH0A 3I9V6 2YS7A 3WWDA 4QQNA 5DT9A 1J2UA 3NVMB 1VJ0A 4B3FX 1DHTA 2PV7A 5IZCC 3WKEA 4C7KA 4EFDA 4XPIB 3KTAB 4AWAA 1SCAA 4X1IB 3KZMA 1GPBA 4GPTA 4TTRA 3F8WA 1Y33E 1RRMA 1Y6JA 2QQ5A 2YHIB 1CUCA 1AN9A 3MF4A 1EFKA 1LK5A 1IJFA 4Q3KA 2JKZA 4PZ9A 3MBKA 1RSZA 3A4TA 4F3KA 4BXOA 5FBRB 2N1MA 1IRIA 5SZHB 3CR8A 1XG5A 3HYSA 5EXDA 1T9DA 2PT6A 4PTLA 3FWHA 3O4HA 1PEDA 4Q7JB 4H1UA 4CF7A 4FBLA 1Z63A 3I2JA 3R5HA 4ZVPA 4Q37A 1K4MA 1XE3A 4OHFA 4BB9A 4LV8B 4IWXA 4B81A 1VE7A 1L7BA 3AR4A 2X41A 4IUDS 4RYLA 4QDUA 1THTA 3MJ4A 4BY9E 1F2UB 2VYVD 1WE2A 3OA2A 2AYZA 5HIJA 1FFXB 4JITA 1C30B 4KKVA 1GGVA 4FGWA 1RI3A 4NCXA 3GRAA 4U7TB 3U3OA 4BP8A 1OXXK 3QPUA 5B30A 3V8VA 2PBRA 4EO9A 2JIRA 4A5SA 2M2IA 2YR0A 1HDYA 1QCCA 2Q3EA 5K3AA 3ND6A 4EY6A 4U1RA 3KAJA 3KQSA 4FFBB 1LLQA 3GA5A 1YB7A 1HTTA 3GDOA 4RLSA 2HLPA 3VTKA 2AZ4A 2DUNA 3L9XA 4E88A 4Z1MA 3PFBA 5LQSA 3ENKA 4OHRA 1UWVA 1W4LA 5ITWA 2WJHA 3QVSA 4G8BA 5IASA 1FS5A 3ZDFA 1G7TA 4I19A 3CUWA 3BFKA 3BAFA 2MR5A 1OILA 2DTDA 1V5IA 1H6CA 3IKLA 3NHZA 1U2PA 1SEVA 3I28A 5CTAA 1G3MA 2C61A 4WPGA 5IVIA 1G60A 5JV5A 4D9HA 3IAFA 3TOVA 2OLJA 3VZPA 1PFWA 1T1JA 1Z7GA 3BKXA 3P7MA 3RBZA 2BBTA 3MFQA 2IYEA 3PUVA 4P22A 4S2EA 3UK0A 1P2TA 2PGAA 2ZSJA 1W88B 4WXEA 3WMFA 1HTBA 2ADMA 3JQAD 4CBVA 4JI2B 3QXJA 2CD9A 1GAXA 1ML4A 1OWOA 1TZJA 1Z8NA 3QYAA 4IGFA 4Q6BA 4AMUA 4XQEA 2VOEA 3EXG2 1WPQA 1TW2A 5K8VA 5LXTA 3JQEA 2Q99A 4DV5B 1RRCA 2XKAA 1KI6A 1L5ZA 4FLEA 5JNVA 3MJFA 1TVCA 3NJ8A 1YL5A 1AHIA 1I3CA 1KKMA 1UPBA 1VL6A 4C29A 3EQ6A 4JXKA 2F3TA 5M5BA 4WH0A 1RCFA 2P9HA 2IVZA 1N0WA 1DKQA 2LKDA 1SVOA 4C7OA 1HZZC 3AFNA 5AVTA 1VJ5A 2D5CA 2JGMA 4CR8A 2HCRA 2OPBA 2H51A 2VG8A 3RAFC 3BDIA 4MWBA 3WO0A 5CCEA 1PJBA 2R4TA 4CKWB 4AP6A 1RYNA 1KNQA 1QZ3A 3V2HA 3DQQA 1LWNA 1M6WA 3BWMA 1U90A 1R0ZA 1YBFA 3H2HA 4JJEA 4M54A 4Q7LA 1GXSA 1YHZA 2ATXA 4J9VA 4AKGA 1TCUA 2BEKA 3F5MA 3P2IA 1K08A 4ZJPA 3CH5A 3Q3JB 1JHQA 2D2IA 2BBSA 3D1VA 4WY5A 1L1EA 1G63A 5E2IA 4YRPA 3WGOA 3RFCA 4C89A 3FYCA 4I5IA 4Q9IA 4BCBA 4ZZIA 2D1QA 2BGIA 4EY3A 4C5CA 4QO8A 2O0JA 3KHSA 3S2YA 4ROSA 4ZDKA 1R0YA 3VO8A 4KUEA 2ANCA 1X94A 1MHTA 3BRSA 1U0HC 3FF4A 2J0VA 2VHYA 5DLEA 4MPPA 5EHNA 2J8ZA 2IC5A 3CSUA 4MKRA 2JAOA 4C6RA 5IWCA 4Q1FA 2LV8A 4J03A 3U7IA 3AJDA 3VSDA 4ZMBA 3DTNA 1ZM4A 4Q7KA 2R00A 5K3FA 1EDOA 1NVUQ 3LBHA 1QP0A 1C7QA 1GL9B 1SVUA 1Y5MA 2W2NA 2XYPA 3C3AA 3CEMA 3ESZA 3KOMA 4HNRA 4B7AA 5C8YB 2EYUA 1IJBA 1PUIA 1XQ9A 3R7NA 1JS1X 2XZTA 5JD3A 4B3SB 1XCPA 5B1SA 3RG2A 1QTQA 2HK7A 2P9EA 2ZIGA 3CLHA 4UNQA 1ZWKA 1LC0A 1HZJA 3CXUA 4NL4H 3W77A 3T52A 5A4MS 3C5VA 2EJCA 4D0LB 4OI0A 4H6XA 5K3CA 3W5AA 2RHLA 2HZ7A 4R31A 4X66B 2I8AA 1U63A 3L07A 2BRUC 1JLLA 1K2WA 1UUFA 3AHDA 3N07A 2JARA 3OUTA 4BASA 4GR4A 2OY0A 4Q4HA 4P33A 1QZUA 1UADA 3V33A 3UWSA 3L8DA 3EXHC 2FMTA 1LBEA 3NTQA 5FBKA 3RVBA 3NYQA 4JHXA 1EQUA 4LE2A 4QYIB 4D8YA 5E38A 2Q3BA 2YHAA 1OJLA 1KL7A 3L8EA 2QD1A 1UT8A 4LQCA 5ERGB 5TSDA 4RZXA 3G2OA 3V7UA 3FKQA 3L5KA 3BSSA 4PRYA 1IOZA 1VP3A 5AW2A 2FSUA 2PGLA 4EGJA 3OM8A 3WFIA 3LQKA 2XBMA 1SUEA 1D7OA 4GP6A 2RHBA 1SXJA 3IULA 4CJXA 5LB4A 1UPTA 4JJ6A 3OQVA 2OCGA 3IUBA 2O8EB 5HS6A 1SEPA 2B78A 3CISA 1ZGZA 4BMPB 5J59A 1I7SB 2QRLA 1KS9A 4JN6B 5KTPA 1NP6A 4CDMA 4OU5A 3GWGA 3VR3A 3G59A 2ZJ3A 1EJ0A 3OETA 3VJLA 4EQ6B 4AQYB 4R16A 5K2MA 4DREA 3HZHA 5KSYA 1TUBA 4JP5A 2HFKA 3PGMA 2QAGC 1E3QA 2HI0A 4FD2A 4Y1RB 3IH5A 1GLVA 4PGMA 5EZ5A 1Q22A 3ACBA 2P11A 3ZV4A 3T3IA 3PYXA 3G7SA 3HPQA 3AOEC 3F2VA 2WJ3A 2AUNA 5UKDA 4D98A 2CB9A 3WIBA 4LC1A 3G7UA 2Z56A 3OUZA 5G4KB 2VBIA 3S28A 1W9HA 1DOHA 3BXPA 3T9AA 3VR1A 5EKSA 2IOFA 3D8UA 1NFRA 2QYSA 1DADA 2AJBA 1L8AA 4GVLA 1ZGHA 4RYDA 5E7QA 3VAAA 3JYQA 2WF7A 3CW2A 3EQ2A 4UJ3A 4GX5A 1BWQA 1I1HA 4CDRA 4R4JA 1OFIA 4JR2A 3M4YA 3H4MA 4RL6A 1EUCA 3AKYA 3T8YA 3KT8A 4F5ZA 4YX9A 4PRLA 1OYVA 3U7QB 1UF9A 2ZUTA 1Y4AE 1TZMA 4MR8B 5AVYA 4K5QA 1U1GA 4FKMA 1ODIA 4HEA1 3F1KA 4WKBA 5G53C 2NZ8A 4GGOA 1MA3A 1NMQA 4KE7A 3MMXA 4I99A 621PA 1X7HA 3VDRA 5JJKA 2F3QA 3O2QB 4LXYA 1SXPA 3ZCQA 4RF5A 3NP9A 4O0LA 2AGVA 2FW0A 1MABA 4TQAA 3H83A 1H42A 5DSTA 1CX9B 2YY6A 4F3NA 1RVDA 1KJ9A 2BGUA 1UQRA 1USIA 2CNWD 3AM3A 4J7UA 5CNMA 2ACKA 3HJUA 2DCUA 3X2FA 1PTJA 3C41J 3KR0A 3R75A 2G0AA 5EIAA 1KRHA 5BN4A 3H5TA 2PRJA 3GZ4A 2R1UA 1AF4A 4MGKR 2QTZA 1S2NA 1BMQA 3F6BX 2GK3A 2RHHA 3UGJA 1C29B 2XI4A 3B1FA 3O4GA 1E5XA 1QHHA 3AI7A 1WUTA 3JWGA 3LKBA 1KTIA 5HF9A 1JAYA 2R6FA 1X7WB 4EPTA 2HRZA 3G8AA 1R88A 2JFOA 2R8RA 3PTLA 5DK6A 5A05A 4RTNA 3QE3A 1CYDA 1FTYA 2QG9A 1TU4A 3BB3A 4ZOLB 1HDOA 4B3BA 2OA0A 5IH3A 3FFXA 5DW0A 4ZVSA 4BWFB 2GASA 3ISVA 4WFJA 3W5UA 1T1GA 4UTPA 2I7TA 1TU0A 3P9ZA 4JEHA 2PQ6A 2P3LA 1B8NA 2OHJA 2PKYX 2PZMA 4HWSA 2ZJYA 1SHUX 1JTVA 4A82A 1RC1A 2XF8A 2NP6A 2DHRA 1U3TA 4WOBA 3NHSA 5JD5A 3SG0A 3TUZC 1XZJA 2WFZA 5AO9A 1N6RA 3Q3GE 3THOA 4TQGA 2D0IA 3PGVA 1TC2A 4BNVA 4WRRA 1WU7A 4PGGA 1Q0ZA 1V3VA 2QTVB 4MV5A 3CLVA 3JQBA 4IVNA 1N9KA 1BA2A 1MVOA 2RGYA 2VHWA 3FVTA 4MQEA 4INAA 4BNDB 2OG2A 4Z4HA 1T4DA 3D5EA 5BN3B 4HRYA 3BA1A 4OK6A 1YXMA 1ULUA 3PWZA 4BS9A 1ZEMA 4DVGA 4EI2A 5KMGA 2WF6A 3WNVA 2VF7A 5L6LB 3T94A 5CT6A 4S3MA 1W0CA 3OMWA 3CURA 1DBSA 2DU8A 2RGNC 2VJMA 5KNBH 1ILEA 4PG7A 1MJNA 1OGIA 4EF5A 5H4HA 4N40A 3TTXA 1G8SA 2GCPA 5BR4A 1HT3A 4LFCB 1KXZA 1W36B 1TADA 4PXYA 1HLDA 3CKYA 2VA9A 1MC5A 2G06A 3LZCA 4UKDA 5LXTB 4LDJA 3ZWXA 4II7A 3JVVA 1QG0A 4RHYA 3UT6A 4WN3A 4DJFC 3ZD7A 3IL2A 2QMQA 2ZR9A 3NH6A 3SQNA 1UXHA 2X76A 4NLLA 5AKGA 4AG5A 4D56A 2XRMA 1KJJA 3IEPA 1OI7A 3A6EA 2OO5A 5DYWA 4DWWA 1ZOPA 4IY1A 3Q7PA 5AR1A 2BONA 2VK2A 3QA9A 1PZXA 3LBNA 1HYHA 3IMGA 3PTAA 3NBFA 3WZMA 4HUJA 1OI3A 2VKQA 2NV2B 4YBRA 5FB3A 1J0EA 1JXOA 2XGSA 2W4QA 3DYIA 3PNSA 5EMLA 4HNTA 5IUNC 2E85A 1R50A 4WESB 1DSSG 2R6GA 1GHTA 3ODGA 1F2VA 3ZHUA 1JHRA 1UZLA 2DUJA 3I83A 1C41A 4LCEA 1CJSA 1BOFA 4UVEA 1S2MA 3PX7A 5L9AA 5CFNA 3EEIA 3EPKA 1JFRA 1MX3A 1BAPA 3NWEA 4X90A 2HHJA 4OLFA 4BN4A 4INPA 1BRMA 1QV6A 3MRVA 4WVFA 3M9WA 1C3LA 4IKEA 5IP5A 5ADVA 3T61A 4MKZA 5K03A 5JALA 4QX6A 2JIOA 2WSMA 3FDZA 1ESEA 2F3PA 3TAUA 2L18A 1FK8A 2ORVA 4BQEA 3NVDA 1M8JA 1W0JA 3STUA 3QU7A 3PDHA 1U8EA 1G5HA 1QCDA 5A6SA 1IXYA 4I0WB 3GLVA 5TS2A 3VR6A 1JQDA 2WU0A 3U26A 2AN4A 3HWWA 1QFYA 1AKTA 4IVRA 3U16A 4X94A 5DSXA 4Y1FA 4KRGA 1LSOA 2WD9A 4B46A 3T7RA 2GO7A 1ZHFA 1JN0A 3QVGA 4H1HA 4O2AB 2IX3A 1DQSA 2G77B 3D6FA 4OHWA 4F2WA 3GXOA 1NX9A 2NVUB 3U7EB 1TXGA 2HSEA 3OQJA 3AKCA 4GPD1 1TECE 1ZH0A 4H08A 4RZQA 1EEXB 3OIVA 3VX3A 4KVFA 4PXSA 5KYTA 4M0MA 4HDRA 1N1GA 2PPLA 3QKSA 3PNMA 4GZ5A 4ZV7A 3TR6A 1G5IA 2IHKA 3HBLA 4RAOA 4KAAA 4RA9A 4XWWA 4QOGA 3HQ4O 4FMPA 4QT4A 3A0UA 2FRDC 3UMFA 1P74A 3FMPB 1RU3A 4YPOA 3VU0A 4Z2YA 2IZ6A 3UWKA 3OESA 3FKSA 5IJWA 3JWHA 3ZKAA 1CIPA 2XB4A 1O3YA 1OFVA 2OGSA 3G9QA 2B25A 3GJ4A 4GMDA 4W5JA 1RI2A 1EINA 2VCEA 5EQFA 4C6TA 4DUYB 4ZV9A 1LLUA 1KFKB 3HLKA 2FH5B 1ZXXA 4NV0A 4WSOA 2HPHA 2IQIA 4E30A 4PTZA 4WINA 2ZTMA 4ER7A 3AO0B 3I32A 4MUGA 1GZHB 1O8CA 1IBRA 5AOBA 4UVGA 4MUHA 4EJ2A 1CQZA 1UP6A 3GGGA 1HKUA 2EW1A 2JRCA 4QOJA 2UYGA 4ODIA 3AP1A 3G8BA 4BB6A 5CG2A 4DPLA 4YMSA 3L6UA 1UJCA 3LY9A 3PEUA 4G26A 4UMFA 2GAAA 2LDBA 5AKXA 4I9FA 3U7RA 2IRWA 3TDMA 2PMFA 3FCCA 1JXAA 3HLYA 3ZDXB 1IZ8A 4BJHB 2Y4OA 2Z08A 3HA7A 4RY9A 2ZT5A 1LFDB 1MTZA 3ANXA 1QFXA 5HIMA 3I2YX 2QX7A 1YKFA 3PI7A 3F98A 5ALKA 2QRJA 4FGSA 2DF8A 5HMMA 2A94A 3R5KA 2FRDA 1JQ3A 1L5RA 1TNDA 4ZV4A 4O4LB 5KEIA 1O6FA 1SXJB 5EIXA 4FJ0A 2G5GX 1YUMA 3OLCX 3KKZA 5B7GA 1ZGJA 2D13A 1XN1A 1AIPA 2A59A 4JSTA 1R9GA 3VC7A 2IZOA 4EIWA 5K3EA 5KOYA 2WAAA 1MH1A 1CFZA 2XT0A 3FKJA 5EJAA 3W8NA 2NSYA 2Q3MA 1NYQA 2PK3A 2GBPA 1VHWA 3KL4A 1KTVA 3S1AA 5FI0B 2NZVG 4YJ3A 1P33A 5LYYA 4TYNA 4K6KA 1BXGA 1YQEA 4LDNA 3NDJA 5E4FA 3JARA 4BVGA 4MV1A 4DMLA 1Z73A 5A4JA 1O5TA 1A77A 3WYCA 2IY7A 3LX6A 2JLWA 2H52A 4CF4A 1USWA 3T5MA 4HX5A 3VPBA 1X9GA 2F4NA 2FDXA 2EX0A 2BR4A 3JALB 3Q72A 1SBHA 4Y9DA 5LBUA 4BLQA 3IBGA 4P92A 4I1YA 4E2YA 4DR1B 4IYJA 2CJWA 2X8AA 3HBNA 2OV3A 3QXGA 4I6EA 1J25A 2GPWA 4L73A 1QO0D 3NHBA 2ZYSA 1II8B 2A9PA 1AS2A 3AJEA 4IIJA 4ZAYA 5G0SA 1TAHA 1YL6A 4PZUA 5MN6A 1RQGA 3O4IA 4IH1A 3RODA 3FGOA 3V4VB 3QW2A 5EHZA 4ZOEA 3KYDA 4M1WA 1IK6A 3V7YA 4PTYA 3TD6A 1T9HA 1AKQA 2DPGA 3U1TA 1TKBA 3THSA 1ODTC 4JJZA 1DJOA 3L6OO 5FEUA 3FGZA 3EPPA 3PQ2A 4YDSA 3WYNA 4B79A 1HDIA 2VYND 5AHKA 4YB8A 4EITA 1DEKA 3F9RA 1K7SN 1I01A 5JO9A 3FPKA 1L4HA 2Y1FA 4D4MA 5GJBA 5T67A 2J3KA 3NFYA 4CI0B 4RJTA 3DDZX 3KX2A 3GQBA 1LDEA 2H06A 3LLCA 4K28A 4R68A 3F6PA 1RTTA 3IURA 3NKFA 3PR3A 4AO6A 3V32A 2QUKA 2IITA 4A8HA 1WMFA 1W52X 3X1ZA 4EABA 1M1XB 2W2PA 3I01A 2CMKA 4LGCA 1GUDA 1A9OA 1VOTA 3CBQA 4PLGA 1FMJA 3FYSA 1FP7A 2Z2JA 2ZXEA 4C0WA 4HGRA 5ADUS 1LPNA 1VFNA 5BV2P 4L5CA 2Q1TA 5EXXA 2F55A 4LTNA 4Y2YA 2WSYB 1XAJA 4FHEA 4GHWA 4H7PA 4LPSA 1T4CA 4CWAA 1R8SA 4W99A 1CHDA 5JZSA 3D0QA 2O50A 4YMTA 4XASA 2CXQA 1RAFA 2HJWA 4HLDA 4WVLA 1VLHA 3TOSA 1PK7A 1J4AA 4PYRA 4HNAB 5FHRA 1XDWA 1WOYA 1BW9A 5FOTA 1B16A 5HBRA 1QGDA 2QMUA 2QR2A 5BVGB 1IIRA 5LL6P 1FTQA 2X0NA 1PTJC 5HM8A 3A2LA 2P0AA 2PKWA 3T7TA 3VJKA 4C7VA 4TT3A 3DHYA 5DZSA 3QMPA 4YYZA 4IDNA 4EUSA 1SRQA 2NVWA 3NANA 3BXZA 1XPJA 1SVWA 3Q88A 1UZMA 4P31A 5JG7A 3FD8A 2GK7A 3AVOA 4B40A 5ULLA 4GDFA 3WWZA 1WMAA 1BGXT 3A1WA 4FOPA 2R7LA 2CC2A 2DBZA 1IY2A 1AK9A 2F1KA 3A9TA 3EFOB 2UZ3A 4QAQA 4RKYA 3ZE2B 1YZ3A 5F7OA 4FS3A 2H0QA 4TL8A 1J9GA 3F3MA 4YACA 1USKA 1E32A 4KO3S 2DPLA 5KX5F 5C53B 2HL6A 4DLSA 2I62A 1N77A 4CQNA 4UZFA 4Z4CA 5FORA 3FSJX 2JEOA 2C2ZA 4FIZA 4C01A 1F7VA 2EATA 4RQUA 4D9FA 3KEGA 2FMHA 1W29A 3RTCA 3DDCA 1ISSA 3TMKA 4WEQA 3AILA 3AVXA 1Z7BA 1D1PA 4CEHB 1XQVA 2X0JA 2C5FA 3AOEA 4KO1S 3KJNA 4UHKA 4YREA 2J87A 3B48A 1XZ8A 1Z5ZA 2ZUBA 1P5HA 1W59A 5ED0A 2E9SA 3EEFA 3F7NA 4IDCA 4BYMA 1M8GA 2Z4SA 3GCWA 2PA0A 1NBAA 4GRDA 4MIYA 1GDDA 2XXAA 1R0RE 5ADHA 6AT1A 1E60A 2HSJA 3BIOA 1U0NA 4H2DA 3GW8A 4MPRA 1QG2A 4PFKA 5AKKA 3K0FB 4ZJZA 1AA6A 5IMSA 1U7UA 2GCNA 3IUYA 2Y6UA 3OLXA 5BQXA 3COWA 3E1GA 4B7UA 2QGNA 5HZKA 2GFIA 1NTRA 2BCJQ 3ANTA 4MKGA 4MQLA 1F2UA 2PT9A 3KZCA 5D1HA 3UXHA 2I2BA 4QPPA 4WKCA 2O54A 3EG5A 5F51A 4OQZA 3QGMA 2Z43A 3THYB 2F43A 1G2QA 1YAJA 5CJ2A 5SZIA 1GL3A 2VHEA 3AEYA 3KWMA 2R6AA 3B70A 4FE3A 4QOIA 3W5IA 5J2TA 1GFSA 1KGSA 1JG1A 5IAAA 3COVA 1NQXA 4RFVA 1Z82A 5FBHA 2J5QA 3D8TA 1CJMA 1L3BA 4JVOA 1FUEA 1LY1A 1RVV1 2MMGA 4Z1MD 3I6IA 3BWDD 3GJ7A 4GI5A 2NQ8A 2GRUA 2XMQA 3MWYW 3L82B 4JCCA 4EPRA 3HU1A 3DL0A 5EFOA 3UJ8A 3Q85A 1QH1A 3QE2A 2P6UA 4D44A 2VQEB 4K03A 5BQ5A 1G2OA 2JRLA 1VGVA 2VA8A 2BRUA 2YJ3A 3C15C 4IMPA 4KDFA 5BUCA 5IKMA 4JU9A 1A3CA 1JKJA 3DBHB 4QPZA 2RGBA 1LCIA 1PVOA 4Q3NA 1CNMA 1E6UA 4IAOA 1A8IA 2CLMB 3TXAA 1S5PA 4P32A 3OZEA 1EE2A 2GWHA 1JZQA 3FWYA 3SDBA 1DKOA 3SJBA 2BFAA 4MAMA 2C8LA 1D0IA 1UH5A 2GMWA 4G1BA 2OC9A 3OPXA 1UKBA 1YZKA 2D5BA 3DTTA 4H18A 4RSGA 2XUHA 6ABPA 1LSSA 4JSRA 3MUNA 2VNIA 4IBOA 3ITDA 4LMRA 5FR2A 3EAGA 1TA0A 1FW6A 1KO5A 1N6PA 1L5YA 2FA9A 3BEDA 1P17A 1JFLA 1KBOA 1MA0A 1S3SA 2MU1A 3LZ6A 5B7NA 4TXLA 3TZEA 1U7XA 3I9LA 4D8XA 2CFSA 4A7PA 4EWLA 5IW8A 1IULA 2ZVJA 1QO7A 2G1JA 5FCDA 4DJJA 3MGGA 2Q41A 3GUYA 3UJPA 4JLWA 3DA8A 4JD5A 4R1NA 3UOWA 1DB3A 2X0RA 3A25A 4G4SP 4J1TA 5JQGB 6ADHA 2P0EA 1SA0B 1AUXA 3Q7SA 4ZU1X 3B6MA 4R9UC 3SMVA 3ZUGA 3C98A 4CMAA 2PWPA 2Y0BA 1AM4D 1YR7A 3DE6X 3GYBA 4H7EA 1F14A 4BNMA 3L7KA 4XWYA 4NV3A 5KSOA 1EUQA 4LOLA 2ZTUA 1NQ5A 2TECE 3IUQA 3DBOB 2ZS8A 2FN7A 1NXTA 3MT7A 1HSZA 1VHJA 2JD0A 3T0FA 5AM2A 2LPMA 4EQZA 2QIOA 4RGQA 1QZXA 1JFSA 2V6FA 3K30A 2AFHA 4LV6A 1XEWY 2ZWVA 4R8LA 3VV2A 2ZYAA 4PQGA 4NXMB 5GADl 3RK1A 3ESAA 5AI6A 4M1KA 3SC6A 1KK3A 4TKUA 4AZ0A 3SHWA 3VHXB 4AIRA 1JG7A 1O9BA 2R97A 4CQMB 3HFJA 4ZQIA 1C2YA 5EHXA 4RACA 4HRXA 2G1PA 3NAZA 5AKYA 5AOCA 3ND8A 2R1ZA 4XOUA 1Q7BA 1E2GA 1EX7A 3AP3A 3CF6R 1TRHA 4IF4A 3GDHA 1PNQA 4HGZA 1P4JA 2GK6A 4GRAA 4YP0A 1P3JA 5LYJB 1EP1B 3VPDA 2EIHA 1ONNA 3ZQ6A 5HILA 1YZGA 3K9NA 4P36A 1RHRA 5BMVF 5L6MB 4RHCA 1NPTO 1RYBA 1GG8A 1YVDA 1E3SA 3FGNA 4TMVA 3I9KA 5D51S 4B17A 4BVEA 5C80A 3CPSA 2JGIA 3IMKA 2ZYIA 4M99A 5DYTA 1BXRA 3H1TA 3G2HA 3Q2KA 4WLVA 3JY6A 2I99A 2P9GA 4FX2A 1V1MB 2KLBA 4JA2A 2Y1EA 1JEEA 4HMQA 3DL7A 5H59A 1NXQA 5DN9A 3NBUA 1ZM9A 3ORYA 4OI1A 5EXEA 3AEQA 2QRPA 4U9UA 5EJ5A 2XCIA 2ZSEA 4HYTA 4B9AA 1OH6A 2DVMA 4QRIA 1Q16A 4XX0B 4BYGA 2Q46A 1KMHA 1M2OA 4MMYB 4BMOB 4UUAA 1KNXA 3LZDA 1YDGA 3OBIA 4LZAA 4XFDA 3SP1A 4NNOA 1VGRA 4UQLA 4C4TA 2P69A 1DG1G 4TLLB 5FOUA 3BG5A 3NNSA 1J33A 1X7XB 2HUNA 3DBVO 4FOOA 3H75A 4IOJA 2QSJA 4OBBA 3TZHA 4JZKA 5IDWA 1Y9AA 2WJZB 2AT1A 2I6UA 3NNNA 4YAEA 5IXSA 1E1MA 3DV9A 3KAPA 5BQOA 3RF7A 5JECA 1T10A 3O75A 2OD2A 6REQA 3R3YA 3KQHA 1E0JA 3ZV5A 3IVXA 3V4RA 4CV2A 2C78A 2COEA 2CLLB 2G9ZA 2VBFA 3B3QA 3Q3HA 2OZKA 2AEMA 4PYMA 2V7XA 4CCSA 1X1AA 2QRQA 4L4RA 5ALLA 1QWOA 1GFIA 1LXCA 1FRVA 1YA8A 2BJVA 2Q3DA 3G2JA 3ONNA 3G6KA 3EASA 4DC1A 5B36A 1CR0A 1XMQB 5ALYA 5G4KA 2OK8A 1ZPDA 3D8RA 1WSBA 4MKHA 4E07A 3IA7A 3DCYA 2OAGA 5KYWA 2UXCB 3KCQA 4RIIA 1ZR2A 2ECOA 4E5NA 2ROQA 5J43A 5I9LA 5ALRA 5EY5B 4WNAB 4N5LA 1Q1QA 3PQ7A 3RYTC 1AZSC 3AB3A 3D4NA 3K1AB 4Y2JA 3EIQA 5EWLA 2C5EA 4EEZA 5CLFA 6PFKA 2X9QA 1A1SA 3DW3X 3JQDA 2Y9MB 5D5PA 1P7ZA 3HP4A 3UUWA 2QYOA 2KPOA 4TZKA 3T7IA 4U7DA 3BMCA 1FDRA 4BTLA 2EGHA 1E3MA 4E22A 5KWIA 4P7KA 1J99A 4UCFA 1SG6A 4OA5A 4MYDA 2O7RA 2DXIA 5CVCA 1N7IA 2CMHA 4DR6B 1Q7TA 4ZOAA 3EY4A 5A6SB 3EEOA 4R2JA 4GEKA 4FSHA 1KH2A 2IGTA 5EZYF 3UKJA 1GPAA 2XADA 2OWDA 2ASVA 2EZ8A 2PKQP 4IIYA 2H8GA 1OBCA 1KC3A 1E2LA 2NYVA 4J0FA 4QPJC 2ZRDA 5TE9A 4PW0A 1GQQA 3H9QA 4DJAA 1TYDE 1PNVA 4KWIA 4NH4A 1U1IA 3TBKA 3ZV3A 5IYZA 1KVSA 1L0BA 2R6CA 2Z2ZA 3GUHA 3DBLB 3BN3A 2FF7A 2INGX 2ATCA 3IVMA 3NBAA 3NNDA 4CL2A 4D0SA 1HOXA 2P9TA 1NRWA 4P3YA 1NC3A 4BNGA 2AZTA 4QUGA 1X8XA 2LIVA 4RH0A 4RH1A 5HFAA 4QLBA 1VKOA 2XKKA 5I3CA 5A3SA 3ZE7A 2VRWA 4M0FA 5C1BA 1GEGA 1DX9A 4DUGD 1R6TA 3EWNA 5FF9A 5J4LA 2JHCA 3U09A 2Q0XA 2RHGB 4NHOA 3ED1A 4MRMA 3SLRA 3HB4X 4MQUA 3VU3A 1VCMA 1TE2A 3LXXA 4LF8B 1U7WA 3M4JA 4NJMA 4DEVA 2D2FA 4F2PA 1RBZA 2HRRA 1UIMA 2VDRB 3CPEA 3EXAA 4G9EA 1NMZA 3GVPA 4NNPA 2YVKA 3QEBZ 1JPNA 2IHVA 3CV3A 1UPAA 4GE3A 3HO8A 1P9OA 4FN5A 1SKAA 5DB4A 5E6SB 5F4ZA 5AI5A 2PS3A 3UMSA 2CXNA 3EXEB 1YJCA 2DBVO 1YRLA 1NVGA 3KOZA 4JP1A 1F2TA 1DX4A 3H2KA 5J2UB 1YI8A 3PSHA 2IEBA 4L27A 3GPLA 4CQLA 3IB3A 1KDOA 4IZOA 1E1QD 4V0LA 1Y7TA 4MO2A 3WWOA 3R6GA 1XZLA 5E3HA 3CC8A 1HE8B 2IYSA 4OKIA 3JX9A 1MAHA 4J2OA 5EI5A 4Z99A 2ZBDA 3M3HA 1JKJB 2POQX 1KEPA 3UY4A 4EUEA 1RRKA 3KD3A 5FWAA 1MC8A 3PJEA 2XY4A 4R98A 3WL8A 2NQTA 4AQDA 1OU0A 4UUMA 5DTMA 4ZZ0A 2NU6B 1HGXA 1WVIA 4M6WB 3SEQA 4F85A 3Q10A 1RXYA 1YDMA 2OWEA 3C3WA 3FZEA 4XWAA 4UZEA 4ZJUA 2CEAA 3K72B 4UREA 1QAMA 1M8FA 3MD0A 3STXA 2CE2X 1I51A 5EPOA 1B41A 3BH7A 3I39X 3KJXA 4I1RA 3EE6A 1GAEO 4LSWA 5E1MA 1TM2A 3G7NA 3H2JA 3L77A 4M9RA 2A84A 3KJFA 2DZDA 4O2BB 4Q39A 3WSWA 1J42A 3I4FA 5E4YA 2W00A 3G0CA 3OQHA 2QLBA 2FPPB 4GR5A 4HMOA 2J9FB 5J4VA 2NWQA 2H7VA 4JVSB 1Q91A 1JE0A 1YS4A 4U7PB 4P5DA 1WDLA 4QAJA 1E98A 1QJCA 1Q0SA 2QR3A 4W8GA 1EXDA 4JJ8A 2YY7A 1EWKA 3G2LA 4I1PA 5AM1A 3FDXA 4L0DA 5E7IA 4DQDA 5C8YF 1UDBA 2DSTA 4KYVA 3QEMB 3F46A 4L5AA 2IWRA 3UHAA 3WLEA 4R2XA 2CCJA 5CUQA 3RTGA 5AVUA 4FHZA 4JX9A 2FEAA 2L42A 1KP2A 4M1ZA 3NIBA 4GI7A 4D6PA 2FI1A 4L9AA 5LJLA 3K6SA 1II8A 3GNTA 2CWWA 4HQFA 4NG5A 1B1AA 3B6KA 3BMNA 3KCNA 1YS2X 4N03A 3H2BA 3VZRA 4BO4A 3MM4A 5FBZA 4ZK2A 4E3ZA 5I9NA 1CNFA 2PYZA 1JT9A 1R37A 1I6MA 3QXCA 1Q77A 2P9CA 2WJVA 4J8PA 2J59A 1W93A 1JDPA 3BTSA 4WNYA 3ZHZA 1C81A 4LRSB 2H1SA 2ZUDA 1OXKB 3QKUA 2OESA 4HZIA 4KV7A 1QIEA 4B6OA 5LWHA 2JLSA 1FF9A 2BTQA 3ZCUA 2GUGA 4B2PA 4PZEA 1SZPA 4G07A 4JBHA 1WU8A 1XQ1A 2P68A 1ZUWA 3DOOA 3MQ2A 2GN4A 1JHPA 1QV7A 4A23A 1ISIA 4H7KA 2C2GA 4DA7A 3L1JA 3ICCA 5YASA 2JLVA 4S2UA 4IFEA 3WBJA 2PT5A 1EBUA 4FFOA 2AFHB 5CK5A 3ETJA 2I80A 3HADA 3LK7A 4C03A 3CLUD 4WD3A 5BP7A 1XZGA 4PIMA 4C21A 4EO4A 1D4OA 1XA4A 1R1DA 1S1MA 4LZZA 1O58A 2C7BA 4U39A 3VVLA 4Z7QB 4HQKA 4OHBA 2JJ8A 4OMCA 5ARDA 4ER3A 1OX4B 1S2DA 3PB3A 2IS4A 1IK4A 1XYYA 4XYMA 3IUSA 3R4CA 1RQXA 4JIGA 3KS9A 4WKPA 2FW8A 5CLGA 2FUKA 1J23A 4EO7A 1IQ0A 2PFSA 1KARA 4I50B 4KQ1A 3TVTA 2BGGA 4K88A 4V0MA 1E62A 3HHPA 4IVPA 4F9FA 4LHSA 1VIAA 1Y3HA 1IG0A 1G64A 3CZMA 3R7SA 4CM1A 4HB2A 2RHOA 1E94E 2JH8A 1O08A 5ETJA 1LU9A 1OYOA 1ZJ5A 3PNQA 4H6VA 5DYYA 3ZTYA 5T7BA 2CV2A 1YBAA 1YR2A 1I10A 2YXBA 4K6HA 4UNPA 4Z7JA 1G8MA 3DB1A 4R3WA 4EZBA 1IN7A 3TQCA 5A02A 1PSZA 1TVKB 3H4VA 3ECSA 3VC2A 1I7NA 2BHSA 1G5QA 1M1YA 3KOOA 4FZ3A 4DV0B 2GZ3A 3PG5A 5FLEX 3LLUA 3VNVA 1R6BX 2G88A 4GECA 5ILQA 1Z12A 2MTBA 3HCWA 3SQOA 4A0FA 1D2AA 2WHQA 2VHZA 3A2MA 1O8BA 3QU9A 5JTUA 5BQPA 1BA3A 5KHAA 1VDZA 4WZZA 4QXQA 1BMTA 4MZDA 2WT9A 3VUEA 4EVSA 3CO5A 1QFZA 5C8XA 3G3EA 3GBPA 5KTMA 4WZBA 4W9MC 4OI2A 1BHJA 1J90A 3OO0A 2LNDA 1ETHA 1Q7CA 1UWLA 3GRFA 3UK6A 1KI7A 4TVOA 3RYHA 4EGSA 3A3PA 3OH8A 2R1TA 1S0UA 2HLDD 3KDPA 3VR0A 2H4HA 2H9IA 1ND5A 1PD1A 4QRHA 1A9XB 4E14A 4RMGA 3RASA 4JBWA 5JOQA 3WK7A 1JHXA 1FCJA 1K8QA 3G2PA 5KNCA 4Q1EA 4PZCA 4NV1A 1I7QB 3D6UA 4QWMA 2PLRA 3WGKA 2FZEA 3MJEA 1O97D 2FMIA 3CUTA 3LSYA 4ROTA 4TTPA 2PWZA 1SULA 2JGAA 4R8SA 4XUCA 4A3SA 2GOYA 5F5LA 5K0ZA 1RHJA 2C00A 4NBSA 5FTKA 3WK6A 5DNCA 1UKAA 3ZVMA 3N8IA 5C7YA 1VMKA 2NXWA 1F9EA 2HKIA 1A88A 1JP7A 1NJGA 2Q28A 5IKXA 2JA1A 2NO1A 3RUDA 3U37A 3R0JA 4ZCTA 4WLFA 3ZWOA 1A9ZA 3M2PA 4D9EA 1YVUA 2D3TA 4MUYA 1UM9A 3GLKA 2B9VA 1NF8A 4RLHA 1LFAA 3FOBA 2FB9A 3GD5A 4J0IA 4YRDA 3Q5EA 2AMLA 5EESA 2G0NA 1VJ1A 1OI2A 2F6RA 3PQ3A 1QH8A 2CFIA 2OYSA 3R3ZA 2IF0A 1JR2A 2ARKA 4EYOA 1XJ0A 3C7AA 2Q6LA 5B1IA 1KOGA 4RY2A 4RTMA 4JT4A 1SNYA 2B0JA 4ER0A 2V5AA 4TTSA 4ND2A 2V6MA 3OHSX 3DFZA 1VLLA 1FDSA 5CXUA 4Z3DA 5BUQA 1WTCA 2VBGA 3L7IA 5BRNA 1GU7A 3PUHA 4NBVA 1MQ9A 1OX4A 3FNQA 2I7DA 3ZJUA 2GKSA 2C77A 3KYJB 5T41A 2YJGA 4CEJB 3BORA 2HCJB 2Q49A 1SB8A 3EIOA 1QVRA 4K3UA 4RPGA 5EIHA 3T0IA 1OAKA 4BHTA 4EYGA 5DN6D 1N3LA 5I4BA 2Q62A 4K9OA 1SM4A 3F67A 1F17A 3NC0C 5LXTF 1U65A 4YAWA 5LLTA 2E1PA 1FEZA 1M75A 1Y5NA 1S1CA 4JC4A 3TPFA 1EX1A 3MGBA 2AMFA 3FOWA 4QEKA 3RS4A 4AS3A 3L8CA 4C0LA 1QGAA 3CX4A 3RU7A 1O0BA 5AK0A 2Y1CA 2Z83A 1XWIA 5C9ZA 5JADA 4JT8A 3HNOA 4NQRA 3STYA 2P1DA 1SKMA 1B93A 1PQ4A 1M2EA 2GTPA 4P4NA 4G25A 3G2QA 3ITEA 4DILA 4LJ6A 3H18A 5CYPA 3ELDA 1L5VA 3QIAA 4YDHB 1Y6RA 5GOZA 2MHCA 3DZBA 2YWFA 1TUIA 1NM5C 1I6WA 1JHVA 3DP7A 4KR0A 5CP8A 4U00A 1NLYA 1SHTX 1XKLA 1FNCA 2WWGA 3KXKA 4INJA 3WYBA 3MYRA 1L7OA 3GJ5A 5C5IA 2BFMA 4DLVA 1M9NA 2B1GA 1TO6A 1WXEA 3CTPA 1VKNA 3EXEA 1F48A 3LHKA 4H0FA 2B99A 3ETHA 4QDZA 1E77A 3JQ8A 1XVIA 3JS5A 4I4NA 4WLUA 4CMEC 3V8MA 1DUVG 3ZY5A 2NVUA 3VZDA 4TRNA 2HQSA 2Q5HA 4NS4A 2VDVE 1KBQA 1ZGGA 3AGPA 4WBSA 2GHQA 1DHRA 4D8WA 4Q4HB 3CZCA 5K8CA 1C7ZA 3BE8A 3L18A 4DPMA 3L7NA 4WZBE 1QO0A 1POXA 4EF4A 3H84A 4KSCA 3D6JA 1XRLA 3ABOB 3SC3A 1QG4A 1O95C 1H2YA 2DH6A 3ADPA 3V1NA 3BHMA 4LDZA 4OREX 2H3EA 5B64A 2ZBPA 4YP6A 2G1AA 2P2DA 2GPYA 3LA8A 4LNHA 3IILA 1QK5A 4RL4A 1RAAA 2BIFA 1JIUA 5K8JB 1OLUA 2VDNB 3SYMA 1O97C 4L4XA 1JBQA 1TOAA 2B1JA 1KHTA 4O2BA 5TARA 3DMFA 2XE6A 2H16A 5LZ2A 1OYWA 1P19A 1RTKA 2MYPA 2FPPA 1YQUA 2XV1A 3IR6A 3PYMA 1XIVA 3BMNB 4K0KB 5L7WA 3BE5A 1WL8A 1B23P 1FFAA 4U5QA 3UA3A 4DBLC 3ZJVA 2PGNA 1K4KA 3R40A 1FUYB 3IQFA 2QD4A 5AWFC 3AINA 3GFTA 4JI4B 5LNK6 5EMMA 2YHSA 2FFQA 2FUG6 3QEMA 5JS2A 2NU6A 1IAQA 1UXKA 1UKEA 2DR0A 1TCCA 1KFJB 3HUUA 2CLCX 2Z2IA 3UMBA 1NRIA 3TPCA 3ITKA 4D42A 5D84A 1FNBA 4A6DA 2XOXA 2Y1LA 2QN1A 4CTJA 3K1AA 1NBHA 3DPIA 1XP8A 4ZODA 1NBME 1G9SA 1G5TA 1NJ8A 3GN2A 3OJCA 3D02A 1BWRA 1NUAA 3G88A 3PR1A 1LQUA 1H85A 1RPJA 5D3MA 2NU8A 3T5DA 1SXIA 1PFQA 3HP1A 3FFWA 4ZPJA 4RTRA 4LF5B 2BM0A 1KQPA 3BWEA 2ISQA 1I5EA 2NTNA 2Q4OA 4P80A 1TGYA 1I6KA 4QNMA 5C7OO 1J07A 1B6RA 1Z18A 3G49A 3U7QA 1ZVQA 2O7VA 4PONA 3VTAA 5CLJA 3DVAA 3V42A 1Q0RA 3AHHA 5E9AA 3KVYA 1KI6B 4GO1A 4MWTA 1C3XA 3Q41A 3RFXA 2YV2A 1PDVA 1D5CA 4IDGA 5JD4A 2WFAA 2R3SA 3ZY6A 1VHTA 1B14A 4KACA 1V1RB 3MW8A 3IOCA 4B7CA 3DWGA 2AFIE 4LJ8A 1EXMA 3EHDA 1FDTA 4YJ2F 3GR6A 1XXHB 4KQCA 4GYKA 2XUJA 4O1MA 5COAA 4MS1A 1EVYA 3L06A 3TW8A 1QB8A 5ILGA 2TSYB 4CMHA 5I7UA 2RAVA 3KQPA 4ER6A 2WTBA 10MHA 1BD4A 2VUHB 1A9YA 1YUBA 3DBHA 4JFRA 4RFSA 3RARA 1ESCA 3TI9A 5GIOE 1M2GA 5LQJA 1G59A 1Z8HA 5BPFA 1BWPA 2NAPA 1MXHA 4FKZA 4RHFA 2FMKA 4PFQA 3B6EA 3FFTA 2J30A 2PVPA 4BKUA 4S1WA 5JH7B 5KQRA 3MMPA 2DFVA 3MINA 5AKIA 3PRYA 5KYYB 4ZZ2A 3P52A 2WE7A 3VR6D 1IOVA 1U99A 3LP8A 2PUJA 5KHLB 3NBKA 5DNDA 3Q15C 5LBIA 4B4OA 4DMFA 1QR6A 3MJRA 4EHNA 2C5LA 5U4XA 1CDZA 5IANA 2AEJA 2ST1A 2QN3A 4XUDA 1HE4A 5ENZA 3SKXA 2P9ZA 4BQNA 2WSIA 3ZXUB 1RABA 2IP4A 1KK1A 2FZ5A 4IYRA 5FWYA 4W4TA 2J6CA 3WLIA 4ASUD 4RX1A 4B83A 2BFCB 1U9CA 3KRTA 2IOQA 3LQYA 3NVAA 2D2EA 3E23A 2BYTA 4P0TA 3EBPA 2ZBRA 5CX4A 3VSCA 2BBOA 3VUFA 4AICA 1NU8A 2VSFA 3DT6A 1V3UA 5L51A 4EHDA 1P6QA 3K0EA 1Q44A 3DBRB 4I36A 5CFPA 4H3HB 2X3FA 4N65A 5K1ZA 2D00A 3T12A 2O20A 1PDWA 2AG0A 3K9LA 3T7SA 5JANA 2A9QA 2RFLA 4FTWA 4I9GA 4HCJA 5BNTA 1KQGA 1SCNE 2GCEA 3GVXA 4BVLA 3HHEA 3W5HA 2NO5A 4CMBA 5G0VA 4Q3OA 1OHHD 2Z2KA 5GAJA 5ALFA 5JZMA 5AJXA 4GXQA 2FTKE 3S4YA 4RDIA 4EMSA 5AW3A 4GE0A 4WZAE 4UTXA 2WJPA 2YDYA 3RS9A 3BXXA 5I4IA 4XARA 5I51A 1DQNA 4E21A 1HDZA 1AQIA 2YQZA 3LF2A 5EHIA 3WA7A 2I4IA 3CW9A 3AY7A 3QVOA 1AB5A 2G70A 4R7ZA 1JV2B 4D82A 1LVGA 1J2RA 4YT2A 5LM3A 1JE1A 3KQWA 1DRUA 4IHJF 3HUEA 2J32A 3NEJA 2HMYB 4W8OA 5CYFA 2VO1A 1EGVB 1Z68A 3BGOS 5AXCA 2PQ0A 2YHIA 1PGNA 1HYQA 1ZH8A 2AEEA 4CIAA 1X9HA 1GZUA 2O5RA 2YUTA 5KYXB 2FVXA 1VJCA 2MWMA 1BG6A 2EAUA 4CL0A 3WGNA 4DE5A 3AUYA 4EI7A 3OMLA 2ZJ0A 3ZHCA 1JSZA 3PFGA 3E3OA 4YGYA 1GUAA 3USES 3DVAB 1RZUA 3D2CA 2XMSA 3GLQA 4G4JA 4TVBA 4ZMRA 4II3A 5HBGA 1G2PA 1PG5A 4IQ0A 4YRIA 5DH9A 1O9HA 3I2GA 5CDFA 1H22A 2OO7A 5BT8A 2ZRMA 2WJWA 3CPJB 1E3JA 3EBLA 1I9CA 4J1NA 3GB9A 2PKQO 1CFJA 2PY6A 2XUAA 4TSFD 3RUPA 3O4JA 3NHKA 4I08A 3LM8A 1GO2A 3H2IA 4XH9B 1RBYA 3K70D 1WNTA 3IKJA 2CWDA 1KXJA 4RQBA 1KE1A 3TX6A 3U80A 2DBQA 2XTZA 1CUEA 5BN5B 2BLLA 5JSYA 4AJOA 3L79A 3QV1A 4RQAA 1VPEA 3T9BA 1R8XA 1ZA1A 4MA0A 3KVVA 1JKFA 3B51X 3E8MA 3EIEA 4PPGA 4X00A 1L5LA 1UBJS 4E08A 4RPKA 5CBPB 1VG9B 2BH2A 2A0KA 1R6DA 3V5NA 4BO7A 3ZHTA 4BOYA 1MEOA 1A1VA 2PX0A 1AZWA 1T9GR 4LBYA 3MUEA 5B37A 3WMXA 2RHCA 4A15A 3Q0IA 1UBTS 1A8HA 3SKVA 1UQUA 2WB4A 2WC1A 5FPQA 3PHHA 1ISHA 1B1CA 3MMZA 2XCLA 4FHCA 3TRHA 3UB4A 1ZM2A 3CEJA 4XJTA 5CYOA 5DMHA 5EWMB 5IKOA 3V8PA 3W9UA 5HFNA 2WHPA 4G0MA 3EPHA 4YQEA 2COKA 3OZTA 3OFJA 4KWHA 3FCOA 4I81A 2J3LA 4CIDA 4O4HA 1LD3A 3A6GA 4NBUA 4W5RA 3ZX5A 4DQVA 5JATA 2FLVA 3V2UA 4LXTA 1WR8A 2P3SA 3K05A 4YTEA 2RCYA 1CRLA 3WL7A 4IICA 5THKA 5DDIP 3T5GA 3UZUA 4ZQHA 3UGQA 3VI3B 3W4JA 4DRXA 1WQ3A 1M8KA 2IGBA 2XITA 1HRDA 3HH8A 3CKMA 1F5NA 1LW6E 3KR2A 3MOGA 3HFRA 4KO4S 4OB7A 1L9KA 2QBYA 2IDMA 3R44A 1LDMA 1LV8A 3A6HA 3SVLA 2MJLA 2GH1A 3AVUA 4OV6B 4E5VA 4MHTA 1EIZA 2O8DA 2BL4A 5FOWA 1JDSA 2OZEA 4UM5A 3R09A 3MC1A 4NDAA 3RS3A 3L0ZA 2ZRJA 2RHJA 4JEUA 3W9BA 4KO8A 3NT2A 5H68A 5IT0A 3CWZA 2GBLA 4HAVA 4DV1B 1RMYA 1OKKA 3AFIA 3EHEA 3IERA 2GT1A 2QW8A 3WK4A 4TKVA 1SK9A 5JRDS 1P80A 3OE5A 4CLHA 5KU1A 1FUKA 2QI9F 1FSGA 3O74A 5E6UA 3B89A 2VHUA 3TOZA 3THXB 2QTWB 5E1DA 5KSPA 2VPWA 1R5OA 3UWMA 1ZICA 4C3UA 1EK0A 3I6ZA 3E48A 4E31A 1GGNA 3GFGA 4NC9A 5EJ6A 4O3MA 3CB2A 3H4TA 1L5OA 2JAWA 4JGIA 2O2HA 5JY6A 1ZJ4A 3AF1A 3CMCO 4CM5A 1DC8A 1E5DA 2GCOB 1E61A 2I55A 2QE6A 3BFXA 2P79A 4ARAA 4YIHA 3WJAA 5IK2A 2H1IA 2FV8A 2P2ZA 1NBIA 1JILA 3EGVA 4O4IB 2ECFA 4UMVA 1T9AA 1UEIA 4KWCA 3ZDDA 2WNHA 4NDNE 3T7CA 1A5BB 1Z4NA 2FWBA 1ZIOA 3C5HA 3M6AA 1G4AE 4MS3B 3UQZA 2R25B 4BNFA 2ORIA 3A9RA 5CDFE 4GEGA 4N5NA 3GHYA 5I5GA 4LYYA 1ORWA 4JLUA 3ZTTA 3P9YA 4O2LA 3KUXA 4I4TA 1R0BA 2JLQA 2FEOA 4PLVA 3KT3A 2YL2A 1XLTC 4GGMX 4GOJA 3GJXC 4C2TA 5FA6A 4MCJA 1G9TA 5FLKA 5I9TA 3ZZMA 3D3EA 4ARUA 1OXUA 4PG8A 3DUFB 1Y0BA 2ESRA 3CNNA 1I1NA 3EPJA 4RKRA 1LZKA 4WIAA 2M6KA 3K8OE 4K1XA 4YJ3F 3WLOA 1W4RA 1F0KA 2IIVA 1CZKA 2CVPA 3HXMA 3EXG1 1V8FA 3ZY4A 3VH4A 1U98A 1VHLA 2GO1A 3E22B 3O8DA 3QKRB 5G3ZA 4EPVA 5GTDA 4CYMA 2C29D 2XD4A 5DLYA 3A6FA 1ESDA 1VI6A 3AKEA 4ZDIA 3IJRA 4NZZA 5AK6A 1Z7EA 2PSFA 3MWEB 4CF6A 3DLCA 4DBVO 3A3YA 3KQQA 1RJDA 2VSQA 3LWNA 1A7AA 4JL6A 5PNTA 2H29A 3PQ5A 4DSAA 3U3KA 4B3RB 2QUJA 1QHFA 3GFBA 2A3NA 4OB8A 2P78A 4AULA 1RLUA 4WL0A 3HYTA 3SE7A 2X6QA 3WHPA 1G3IA 1I36A 5IMBA 1RZRD 1ZVKA 4D43A 2E4YA 1CR1A 1CUBA 1HL7A 2VS1A 3ILSA 3MCZA 1T9CA 2C9OA 5E1OA 5FPHA 1RKBA 1KY4A 4GRIA 2Q5LA 4TSRA 3E5NA 4HATA 4KR7A 4FHDA 2B8NA 5CPBA 4E12A 4ESOA 5AW4A 4PNEA 5J4KA 4YCBA 5C1OA 1XMIA 1FB5A 4RKQA 2HX1A 1WMDA 2N3ZA 2Z1DA 3IO3A 2Q27A 4HS4A 2P4QA 1QR2A 2O2DA 2ZSDA 4FP9A 2J9FA 1A5SB 1PSDA 1QLHA 3B5JA 3Q2IA 3VVCA 2ZRHA 1GPNA 3MBIA 3N0RA 4RESA 4CODB 4HDCA 5F64A 3UF0A 2ICAA 1NKSA 2WMDA 3PZRA 1HG1A 3PITA 1O6CA 5CGQB 4BO0A 4X93A 1R8YA 3AR9A 3H4IA 4B1FA 4Y6PA 5LKRA 3FYUC 1A4UA 2C7VA 2WKRA 3BCRA 1TO1E 3MLEA 1E96A 2RB4A 1RWKA 5H7XA 4CG0A 4M7PA 1N9ZA 2QX4A 3HKEB 4TLCA 4XZ3A 5H9VA 3BILA 3PUYA 5ALWA 4OF4A 2X5XA 1RKQA 4RCZA 1C9DB 2M1XA 3EH2A 1PJ2A 5DIFA 1KE2A 2QJOA 4A1FA 3C3CA 1T8SA 4BNNA 3H8JA 4L51A 1R15A 1WZ2A 3HZOA 1K8ZB 2BSAA 2XEXA 4Y9RA 1L5KA 4JJGA 4ZTUB 5E2AA 1P9NA 3LKDA 1PT6A 3ZLUA 2K7FA 1GSHA 1RCTE 3MELA 1ENPA 1U8TA 2VXCA 4U63A 2VZEA 3SF8B 5IAOA 3O8OB 4JYMA 1V2HE 5JHHB 1IEVA 1FYWA 2SKEA 3AKDA 4M60A 4IX9A 5KAMA 2IELA 2DEUA 1U7TA 1P1IA 2VP0A 4O4JA 4TUYA 3ZI4A 1P0MA 2QJTA 4D9MA 3CFYA 4EBFA 1UBFA 4O0MA 2CYAA 3ZGYA 2ZRIA 2BD0A 4DNFA 4W5NA 2JGDA 5K99A 5AOVA 1YCDA 2O2EA 3OSZA 3I3SR 1Z29A 2VWGA 4EZEA 1XVTA 2V1XA 1XTJA 4DLKA 1GQYA 2I2WA 4IW3B 3DUFA 2VXOA 2ID8A 1ORHA 3N28A 3LY7A 1T13A 2OPHA 1LK7A 3SNHA 3RSGA 2BFPA 1FTSA 2OHXA 2QD5A 3AB7A 3CLTD 1ENZA 4L76A 2BFWA 2C4UA 1CZUA 3JARB 1JWBB 4DIMA 4JBNA 1SY7A 1M1YE 1ZEJA 2HJ9A 2OVBA 4MO9A 2D2VA 4NZYA 3RABA 1REQB 3KJGA 1EA7A 5BW6B 1SHJA 5LCXA 1H2XA 3CVWA 3D3KA 3JQ7A 1OX5A 3K5HA 2ERXA 4KMOA 3KPUA 4R84A 1UK8A 3EULA 4Q47A 1PS9A 1VL0A 3O94A 3LO8A 2XB2A 1SIBE 3A9WA 5EP4A 1P81A 4P38A 2PLNA 1K9SA 1QZTA 3HB9A 5DBHX 1G8JA 2VNAA 3GIWA 3HC7A 4IP0A 4N54A 3W8FA 4LDAA 3V4ZA 2FKAA 2I78A 4JLOA 1DMSA 5INTA 3MMNA 1E0SA 1X8LA 3GJTA 3KELA 3QELA 2MMCA 2TS1A 5A9SA 4FNOA 3CVVA 1IN1A 4A4DA 1FMTA 1MT3A 2O2SA 3LUJA 5C4GB 1X80A 5DOVA 3U60B 4MB0A 4F04A 4DDWA 3EFHA 4HBGA 5JUWA 2XDAA 2C7QA 4KQ6A 1MJGM 6NULA 2H31A 2G7MC 3OPVA 4IJMA 4PICA 4B84A 4CM4A 1SPXA 1U9YA 1U6KA 2JJQA 1E63A 3UAXA 4OJYA 2FK7A 2EHDA 3CS3A 1IONA 5B7PA 3USCS 1NNSA 3FG9A 3IIJA 4NOJA 1HETA 3WYGA 4F91B 5EWJA 4G56A 3GLHB 1NZDA 4MRVA 5FBQB 5JAQA 1KQ3A 5LA6A 3SQMA 4DA9A 4PN7A 3P0JA 1P7YA 3K53A 1KWKA 5DIZA 3X1DA 1D2EA 2PO5A 4R01A 3DC7A 3E9MA 3FSEA 2H0AA 1U2DA 1ZK1A 1EVLA 4BC1A 1P7CA 5JSFA 1S3IA 1WNFA 3NIDB 4B32A 3DMPA 1BVHA 4JLVA 3UHOA 2ZETA 2YS6A 3R0XA 3CF0A 4MVJE 3RBXA 1AQJA 1TA9A 1Q20A 3AEUA 1F6DA 2GILA 3ESYA 3NV9A 2W6ID 1P4SA 3CNQS 1F20A 1DBVO 1LZLA 3PXXA 3VR4D 5A6VA 1WB9A 2J41A 3F71A 1BKDR 1V7PC 3OZVA 1KPHA 1MQSA 5E6UB 4IJWA 5ITZA 3ZBQA 3B3AA 3FCEA 1ESMA 2GZHA 8ATCA 2OO3A 4RETA 3WNCA 2FLWA 5DCUA 1RE1A 1VHDA 2I67A 3EVCA 3T1YB 2DPXA 1B8PA 1FQWA 5JU6A 5FRDA 3NWBA 1ZN2A 1JAIA 1JKIA 4ZVUA 1J8QA 2DUWA 4D1YA 2VHCA 3H11B 1GPYA 4JKYA 1PDOA 2ZU6A 4X84A 1VE5A 2W22A 3U3XA 1S8NA 2LE0A 1T6ZA 2ZIVB 2W0SA 1IPHA 4RTSA 3RF6A 3ZCSA 4O63O 1L3CA 2Q2OA 3RREA 2GXUA 5FTLA 3G8CA 4YO7A 1IEQA 1W2GA 2NO7A 2ZS7A 5LOVB 2QN7A 1Y3DE 4YUAA 3PX2A 4FR2A 2QVYX 3BIJA 4DCOA 2ZR0A 4ZC1A 1OGYA 3QF4B 2I3DA 5K0LA 2R751 3VZBA 4D9IA 3KJQA 8ABPA 3TQTA 5A03A 4F3CA 3CVOA 3DVSX 1V96A 2FSGA 3HP7A 3KPWA 5DNUA 3MHTA 2ZI9A 3UWDA 2R1VA 1DFIA 1ZQ1A 3L0CA 5ESDA 2HJRA 5EKDA 3TM4A 3LUFA 5LR6A 2EYQA 2OBLA 3BRCA 3FB1A 1V8PA 1AD2A 1BHSA 3LOUA 4Q4JA 2MYUA 4MS3A 3PC4A 3QU5A 3UMJA 4DJTA 4JC0A 1AMOA 3L05A 4PLZA 2NO6A 2ZAMA 5CA0B 1GN9A 4QBIA 3E7FA 1V6CA 3TL3A 4EFLA 1T3HA 2RKOA 4Q21A 4DC0A 4RH3A 3TQIA 4XYLA 4EF6A 2NZUG 3BGDA 1YJQA 5IVKA 1PR4A 2OFOA 4L1KA 3ROPA 4A0QA 1VC2A 1M5TA 1BX3A 2OKGA 4BNYA 1IZ9A 2GBIA 2IUEA 3OIFA 1MN6A 4RK7A 1J2YA 2F1IA 2ZBUA 3DE5X 1NL3A 1MORA 1WW8A 3ITNA 1NSFA 3M6VA 1OMOA 2H2HA 1R4NB 2IZ0A 1D0VA 2GAFA 1HEUA 3KLBA 2C03A 5LLDA 4YCMA 4OQNA 2O06A 3EGXB 3IAEA 4KFUA 5FOVA 2C57A 1D3AA 4UDXX 1BEUB 3K92A 5BN5A 4BV9A 2Z5GA 1GZ5A 3RC8A 2FXIA 1NTOA 3DGEC 5IKEA 1H3EA 4BGDA 2VYCA 4WAUA 2UZ4A 4LG1A 4B7XA 1VRCA 1Y1LA 1LLDA 2EQ5A 3OFND 4EENA 5IZ4A 4BP3A 2GPTA 2J3MA 1IN6A 3MCWA 2O8FB 3QMWA 1DO2A 5DHTA 4UHJA 3O8RA 4XVHA 1JZSA 3U40A 3VDQA 3WYFA 4CM9A 3UTCA 3MVEA 4LDQA 2OSBA 4Q02A 4UU1A 2W8ZA 4P4SB 2ODQA 1KEEB 2Q8NA 3UH0A 2CZQA 1NQWA 5C51B 1HR0B 1IXRC 1XZHA 1HLPA 3PFCA 4FFPA 4TMKA 3WLAA 2HGSA 2O8BB 1JJBA 5EEGA 2BLNA 3TMYA 4IV0A 4HSEA 3UC5A 1N8TA 3KALA 5K0JA 3O4FA 3CUYA 3PJRA 4GI2A 4NARA 2OHFA 5DASA 4YR7A 4K9KA 4CL3A 3ELYA 3RUEA 4A10A 3MZ0A 3Q6MA 1VKHA 2G9UA 4EB0A 3HFGA 4FWBA 4H17A 1W4AA 221PA 2X19A 1VSVA 2YVQA 1QX3A 3E2IA 2I3GA 1VPTA 3RCBA 3TOCA 3FHJA 2GPNA 4DLWA 1YJBA 2Q3JA 4LYJA 4K05A 3O1HB 4UOQA 2XNHA 4COKA 3KOWA 3TM5A 3A1TA 2AJ8A 1FX0A 1L8XA 4BLUA 4CMKA 5A4AA 4EUFA 3DLHA 3H0KA 4ZKEA 5FA5A 2OD7A 1YFJA 5ICEA 2R84A 4MUMA 1VSQA 4Z9AA 4O3FA 1MO5A 4MV0A 3KBOA 2DGDA 4G1MB 3S5UA 5BMVB 2G63A 1QYDA 2OGZA 2W2OA 4OXKA 5KYNA 3EPLA 1JJFA 3TQOA 2DLCX 1FX1A 2EBFX 3BVPA 4GC5A 5BWOA 1IZ7A 3LUAA 3QVTA 4CMEA 1NF9A 1S7GA 2W4MA 3NYWA 3BJRA 1P0PA 3ZE9A 5F77A 2WAMA 1TQ2A 4XD2A 4TMTA 2V03A 1YGYA 4BNLA 3UAWA 1FSSA 4GVXA 1AMNA 2RGRA 5HRAA 5CB4F 3BYZA 3LGAA 3F5QA 3R24A 4ID9A 4ZRDA 2NVBA 2NO9A 5G41A 5IUJC 4Q3AA 4QD3A 1WVMA 4PC3A 1ZHOA 2RK4A 3F6RA 4DIKA 1B3RA 3W9SA 4B87A 5HZGA 2O0LA 1MDBA 1F5SA 9MHTA 3GZTB 3LG2A 3W6UA 1JEYA 1ONBA 2YX1A 1NW7A 3MS4A 1XTPA 3BL8A 5JAZA 2G9VA 4G23A 4JUAA 2AOUB 5F7JA 1VJDA 4ZD6A 2PG3A 1KU6A 4P3NA 2PX3A 1NONA 3EPRA 3E5RA 3H8VA 2FPIA 3H3JA 4FSDA 4Q00A 4A8JA 4CUKA 2X1MA 3KFVA 1AUPA 2QTMA 2P9JA 5CFLA 1XEXB 4DMHA 4EY4A 5IYZF 2A0UA 1QONA 4JT2A 4X1YB 3ESCA 4DCCA 2UXBB 1I3KA 1EBBA 4KLZA 5KVCA 4XPIA 1EAMA 3CU5A 1ZN9A 3F96A 3D3WA 1BCSB 4EBBA 1YVEI 2GVZC 4N8SA 2OL4A 1G8FA 3GLSA 5K09A 2RI0A 2OBBA 1DU4A 5CLHA 2FVYA 1Y4SA 2QMHA 3VMMA 2BI7A 4TVSA 4GKKB 3WR5A 1XZBA 2XH8A 2GARA 3UJDA 4CEHA 4CKZA 4IHKA 3OLZA 3HBJA 3DZ8A 4M22A 3R7FA 3UOAB 1KI1A 3BBLA 2O07A 1MNAA 5CHYA 3T41A 1SOVA 2H4ZA 3WL6A 2MSDB 1G4HA 1CUIA 3QKTA 3U3ZA 5K20A 1YA6A 3OUUA 4P4SA 2IYXA 3B5EA 3K0AB 4LYHA 1ZBQA 5HS4A 1PYGA 2GYVA 4WOPA 3JWJA 3V4PB 2VJCA 2XQFA 1XQ6A 4XJVA 5A5EA 4HXFB 4C20A 2NV0A 3QBVA 4CM8B 3QHPA 3PXAA 2HXYA 5KCZA 4DCTA 1AO3A 1H3NA 1B00A 1AUQA 3MCUA 1QGZA 2HLNA 3ILYA 4WZAA 2RH9B 5FADA 1P44A 5IJ0B 2J6BA 2A1TR 3V2IA 1P91A 2HNAA 1Z4MA 5TJ9A 1I3LA 3ZI7A 1QRDA 3BXGA 1DC4A 2R6R1 1MZVA 1NQVA 3B2NA 4PSUA 4JBYA 1WDTA 3TKLA 1J49A 4FMCB 1CRQA 4KBYA 1LC3A 3AYXB 4UASA 3AEQB 4EPXA 4JROA 4J90A 1JKXA 3A3OA 3NTVA 1ORVA 4GAEA 1DGQA 3W3AA 5F9FA 2Q1YA 2O0HA 4V0SA 3A1VA 2VPXA 2DFTA 3K4QA 3OWHA 1IZYA 1WZCA 2XKBA 5CLQA 3LQ4A 2WG2A 3HVHA 4J4HA 2EF0A 4GICA 4ZO4A 3GRYA 4J49A 4ERNA 3A05A 3DR5A 2PGJA 2Z6VA 1QDLB 4P98A 2HA6A 5ES3A 2GA9A 1TCVA 4QUEA 4KOEC 2H5EA 2Q2VA 1TJPB 3RUIA 1GPDG 1W8DA 2PKXA 4RGVA 1N0VC 2P6NA 2XVYA 4R7GA 3RT1A 3W1WA 2HCFA 5B3JC 1KVUA 2I9PA 2HU7A 1VG1A 3WIEA 2HH9A 4MYCA 1C0EA 1QTIA 2GNPA 3F2IA 3HY6A 3L5OA 2YJ4A 1K4YA 1N6HA 3OCXA 1GKYA 3WYDA 1QPGA 4GPEA 3PDIB 3FHLA 1FP4A 4AK9A 1TJ5A 3D4LA 4G9BA 5AUPB 2YN0A 1K5PA 3ZDYB 1FNSA 2ZTVA 2A57A 3AUKA 2OO5C 1E6KA 2D3WA 2DQSA 5K0TA 3SJZA 4FDMA 4A27A 1SVMA 1YOVA 1Z6ZA 2CBZA 3JVDA 1T43A 2D5AA 1HC7A 2DYKA 2P9QA 1SOUA 1USVA 1QFMA 1H2EA 3QLVC 5JMPA 1DI0A 3KEOA 4QULA 4DVJA 2FSIA 2Y77A 3GGCA 2ZM5A 3DMGA 2IW1A 3KTFA 5EWLB 1XDGA 2QZ9A 4PHCA 3ABRB 2DUUA 1P1JA 2PLWA 1NVVR 2W5UA 3RK4A 4NX2A 1E1RA 1AKMA 1HLGA 2HWKA 4AL4A 4FUTA 3MMSA 3NWOA 3GLIA 2Q0SA 5BOVA 5F98A 5LQMA 3LDAA 3VM6A 5L4NA 3BXHA 2P0YA 3NPAA 1RP7A 1VE3A 2GCIA 2J1LA 3KXIA 3OJLA 3PD0A 3Q9NA 4H7JA 5FL3A 5DM60 1SAYA 4Z5XA 5EQTA 3I0MA 1S01A 1NNI1 5JLAA 2XBLA 1M83A 1V0JA 1JW9B 1YOBA 2JB9A 2YVLA 4Q48A 1ZITA 3WLHA 1K3TA 3HV0A 3UMRA 2XOKA 2QI9C 5CTJA 1QAQA 1UJBA 4P7BA 4YFYA 3I3OA 5A1TA 5IDQA 4FFNA 2EEPA 4H31A 5BN1A 4Y2RA 4P4L