1D6NA

Ternary complex structure of human hgprtase, prpp, mg2+, and the inhibitor hpp reveals the involvement of the flexible loop in substrate binding
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
214
structure length
214
Chain Sequence
SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLAGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLGSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE)
publication title Ternary complex structure of human HGPRTase, PRPP, Mg2+, and the inhibitor HPP reveals the involvement of the flexible loop in substrate binding.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 37
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d6nA00
1I13A 4FYMA 4P84A 4RHTA 5ESXA 4RQAA 1NULA 3GGCA 5E38A 4WMLA 4JITA 5KAMA 2WNSA 1CJBA 4RHUA 1DQPA 1V9SA 1P19A 5IPFA 1VCHA 3ACDA 5JSQA 2JBHA 1ZN9A 1ECJA 4IJQA 5BQPA 1L1RA 3OHPA 2HCRA 3QW4B 1XZ8A 1BD4A 4P82A 4QYIB 1A96A 2VFAA 1I5EA 1A97A 1J7JA 2H07A 1L1QA 4RV4A 4X44A 3OZGA 1OPRA 1UFRA 4P80A 4RADA 4RQBA 3OZFA 1BD3A 2DY0A 3LPNA 4RANA 1ZN8A 3NAGA 4RAQA 4RAOA 4TWBA 1UPUA 4LZOA 1Z7GA 2PRZA 1FSGA 1QCCA 4PAWA 1ECCA 5BSKA 1QK4A 1G9SA 2JKYA 3DEZA 1STOA 1A98A 4LZNA 4P86A 5K51A 3S5JA 1HMPA 4KN6A 2PRYA 2GEBA 1A4XA 4LYGA 1I0IA 1O5OA 1A3CA 1DQNA 1TC1A 4P3KA 1ECGA 1XTTA 2C4KA 3O7MA 5HKLA 1QK5A 5BQOA 4LYYA 4QYIA 4RACA 2P1ZA 4P81A 2E55A 1VDMA 1R3UA 1GRVA 1DKUA 3H83A 2PS1A 4ZFNA 3GGJA 1QB8A 2H06A 1I0LA 3DMPA 1XTUA 3HVUA 5BRNA 2JKZA 3DAHA 1G2QA 4S2UA 1DKRA 1U9ZA 2JI4A 1ECFA 1OREA 2EHJA 5KAPA 1AO0A 1MZVA 1JLRA 4P83A 4M0UA 4M0PA 1BZYA 3N2LA 1ECBA 4JLSA 5HIAA 1OROA 4RABA 1G2PA 2YZKA 2FXVA 4WN3A 1TC2A 4PFQA 4OHCA 3MJDA 1NONA 3EFHA 1P17A 1ZN7A 3MBIA 5EUCA 3KB8A 1DBRA 3GEPA 1WD5A 1GPH1 1P4AA 5IAOA 4RHYA 1D6NA 1HGXA 1QB7A 1IBSA 2AEEA 5ESWA 3LRTA 4M0KA 3ACBA 1JLSA 1PZMA 4MB6A 1W30A 1YFZA 1A95A 4Z1OA 1P18A 1G9TA 1QCDA 1I14A 1QK3A 1UPFA 1U9YA 2H08A 2XBUA 4QRIA 1XTVA 3M3HA 4X45A 3ACCA 4F8EA 5JV5A 2IGBA 1LH0A 3G6WA 1XZNA 4RHXA 1Y0BA 1VSTA 4LZAA 1O57A
chains in the Genus database with same CATH superfamily
3KU4A 4ZI2A 4KYIB 3H2YA 1IJFA 5ILOA 3AI3A 1U63A 1QRAA 2X5JO 2XITA 3H4TA 2I7CA 1X1CA 2ZUCA 3KK0A 1YS2X 4YBRA 4M0MA 5DNWA 3WGJA 4WVFA 1Z26A 3NUZA 1JZSA 4OXQA 1KFCB 4TT8A 1F4LA 3JRNA 1L1RA 5DSZA 1YC5A 4NBVA 4HB3A 1MU0A 5B30A 3T5AA 1K6XA 1QFZA 4AZ0A 2PZGA 2XCQA 1DMRA 3AL0C 1O95C 1SVKA 2NACA 2BFBA 1VXOA 1ADYA 3X2SA 2O6LA 1C1XA 1T2EA 1GSAA 3R41A 4MR8A 4RW0A 3DZ8A 3NHUA 1P5HA 4MCIA 4U6SA 1C3VA 4KR2A 1BCRB 1WBBA 2GRJA 4Q02A 3FR8A 5LWQA 2HU2A 3T1HB 5DNYB 3N2IA 1ZK4A 2CK3D 4BQEA 3IBSA 1YNOA 3EXEA 2ZIFA 4ZQCB 3PLAE 5FA5A 3ZYZA 5KTSA 2H48A 4B8WA 3DZFA 1GZ3A 4EEKA 3AY0A 4GR5A 3VH2A 2NV0A 1R27A 2QM8A 1L7XA 3NHLA 3PDIB 4LYGA 5D3MA 2BH2A 4HQNA 3OMLA 2ZEJA 1KDVA 1Q0UA 3QVWA 4BWFB 1LD3A 1RWWA 1AIPA 2WICA 3GA7A 4RV9A 3KQKA 3RRJA 4CRWB 4IEFB 5JEEA 4E5VA 1OE0A 2GZ1A 3I3OA 4UREA 4QE3A 1ZP6A 5KJFA 4DV0B 2I2WA 1E1CB 3NDPA 1JI3A 3OX2A 4P0QB 2CJPA 3NOVA 4P3OA 4RPGA 5HIMA 2B21A 2WUFA 1XZHA 2NN3C 4XFKA 3IUQA 3KWLA 5EFOA 4B6RA 1FF9A 1W36C 3VKGA 3DMPA 4AT1A 2CBGA 1NQUA 4F6CA 1V25A 5I3CA 4RTPA 4CHTA 2JLUA 1E3WA 1ZIXA 1G6HA 1PZEA 2DBVO 4C0SA 2WDPA 2ADOA 3GH1A 2LUOA 3H2SA 2QTFA 1IQPA 4D9CA 4IAOA 4Q9NA 3DL2A 2AEMA 3THXB 2BI8A 4Q66C 3DJYA 1ODSA 2AOTA 1K5PA 1U80A 1YBMA 2A7XA 1LTQA 1TD9A 3FPLA 3FRJA 3Q3HA 5ALXA 1YFJA 2P5SA 4DEVA 5C53B 3KB6A 4AECA 1B2RA 2DFDA 3V4PB 1Z4KA 1X1QA 3UXEA 1CZKA 1IXZA 1ZSYA 2AF3C 2EP8A 1VE1A 3B3GA 3L02A 4LRXA 3CWCA 4IOJA 1DT5A 3HYCA 1DBRA 3G2LA 4W9NA 5CD1A 2X3UA 3W3AH 4WOBA 1N6IA 2GCNA 2HREA 2WVJA 2GXAA 3F4LA 1CR2A 3ESYA 4KO3S 4BIMA 4D9MA 1ATZA 2OZPA 2VP2A 3AL2A 1JFFB 3DR3A 5DYWA 4OAQA 5AW3A 3HSYA 1ZXBA 5C7YA 4TVBA 3BEDA 3AYZB 4YXWA 4Z8YA 2CLSA 3TQCA 3W6UA 4EJSB 4CUKA 3WK4A 5JS6A 2HMSA 2EJWA 4XOUA 5F2OA 3B48A 4I50A 3U7QA 4Q9HA 3GZNB 2Y05A 1HDIA 3A1UA 4YAWA 2DB3A 4J4HA 1MT0A 4AVYA 1YB4A 2VHCA 2NUPB 3WLPA 3COSA 3TFWA 4DIDA 3OPYA 2DYKA 3T12A 2OGUA 2Q5IA 2YZNA 3RVLA 2OL4A 2PBZA 4JMPA 5ENZA 2BEVA 3CE9A 2QZSA 3ILVA 4ADSG 4CL3A 4OUKX 2J30A 3IBYA 3PUXA 3B8EA 5L4LA 1SUCA 3Q8LA 5EHIA 3UJ8A 3O47A 3VR0A 2GBPA 3C8DA 2TSYB 3N87A 1RYMA 2G63A 3DDSA 4PIVA 4AJLA 3ISJA 1E2BA 4IJWA 5EIBD 4KHPB 2WAAA 3A70A 2JEZA 5DISB 1FP4A 3SZRA 2OXRA 1Q92A 3Q7RA 4ZJPA 3ABSB 4AKHA 2IIQA 1JU3A 1BQ4A 3NBFA 4GBMA 5AHXA 5CDFE 4JJ4A 4HEQA 4R8SA 1JXMA 2J87A 2WLSA 3WB9A 4X7MA 3P94A 4RVCA 2IS6A 3E3OA 1M5UA 3KT0A 5HF6A 4B76A 3A2LA 2YXLA 3R5HA 3O3NB 2WT8A 3D31A 2O14A 3DZIA 2PGXA 1FFSA 4HWRA 4DJ5X 3QU5A 3BK1A 3ZC3A 3DFIA 4HX5A 1W9HA 1T4CA 4UBJA 2FUKA 1W1IA 3SK0A 2QMUA 4QX6A 3FPSA 4B73A 4MOWA 3LH5A 3O9MA 2WJGA 1TDJA 5JZVA 2TMDA 3K9WA 3PEEA 1CERA 1H69A 1Y7TA 1MJGM 4NMHA 3DQZA 4YB8A 1D09A 2X4GA 1TZKA 3MJ4A 4Y6SA 2KE5A 2F17A 1GTL1 1GPAA 2AZTA 3Q7IA 1T34A 1QFSA 2VHQA 4WY5A 4G1UC 4WWHA 4IQGA 5ESDA 5H70A 3CZ4A 5BYBA 2RHDA 1QAQA 3KJQA 3THRA 4RKWA 1TU4A 3C7TA 1Z0KA 3L9XA 1D2HA 1GUZA 4YRDA 2BMFA 3BB1A 3HVUA 3JASA 1PEAA 2PYIA 2WLTA 1DG1G 2V7EA 3DAYA 2ST1A 5FPYA 1I5RA 2FZ4A 2W2MA 4JLPA 4S2UA 2A5FA 1H1TA 4EKEA 2HLDD 1YO6A 1N92A 5KWIA 5AVRA 4R7TA 3N8KA 4FOPA 4R9UC 2Q6KA 3OT1A 3ZNOA 4JCCA 5FV4A 3N2YA 1G98A 1XAGA 2E4UA 2X9QA 2XWBF 3GRAA 4DMCA 5JEDA 1W36B 4AIIA 1KVQA 4PHGA 3UOAB 4X66B 2YFKA 3OU2A 1QZTA 4WVLA 1NM5C 1TJYA 1ZIDA 3LBHA 1U6KA 2I9KA 4CF6A 3ITKA 4H9GA 1NBWB 3UOWA 4DTCA 3A6HA 2EBHX 4R7ZA 5KPJA 2GPAA 5AKIA 3F1LA 3ICEA 3M6MD 4INPA 5WRFA 2ECFA 3RYIA 4M89A 3M6VA 3E9CA 1JIQA 1U2PA 4K86A 4BFWA 1VOTA 2YJNA 2HXSA 4WIAA 1GG8A 3FPCA 4RCYA 4ZEVA 1YA8A 4V1CA 4IDBA 1TAUA 1G6KA 1L7EA 2O2ZA 1M1YE 3EXAA 1QYWA 5F2KA 2JGFA 3IE2A 3SQDA 2BTOA 2JJ2D 3NAZA 3BJZA 1P18A 5HXAA 5EMMA 1H3NA 5FBQB 4ETNA 3H42B 1J5EB 4BQPA 3C48A 3E70C 2WDZA 3B1ZA 2R1VB 3KLPX 3SJAA 3ZDRA 5JJBA 3W8FA 4G4SO 4MLPA 4NU5A 4CU2A 3WBJA 4UTNA 3D8RA 1DEHA 1FQWA 4QG3A 3OCCA 2NUAA 2Q0XA 3DLPX 5AK6A 3LD9A 1ZIOA 1DXOA 1YCDA 5BSUA 2QJFA 4JJ8A 4RGVA 5F52A 4DBLC 4X92A 1LRKA 3NYRA 1OX6A 4KAJA 3SC4A 4PLPA 3LX8A 1N4AA 1HE5A 2WM2A 3MLBA 3PJDA 4FE3A 1YR8A 3RREA 3LWNA 4F2WA 4QJBA 2RGAA 3WE7A 2Q62A 5CXSA 1BEEA 5KAMA 4WMLA 3UA3A 1U2GC 3WWYA 3ZXYA 4CUJA 4JQSA 4RF2A 3RFFA 4DB4A 3K5PA 2NZVG 3M33A 1B00A 2YL2A 4CMAA 3TR5A 4YMGA 2W8BB 3LKDA 5CBPA 1NP3A 3CNLA 3H5WA 4CI9A 2ERCA 2J41A 3M34A 1PV2A 3OIFA 1XQ9A 1YK0A 3RAJA 3VNAA 3LBAA 1EVJA 3DZKA 1ZDMA 1T2CA 1Y1TA 2CUNA 2I2BA 1UJ5A 5AVVA 1ISIA 1OR8A 1ORHA 1G5PA 1RXCA 1U0HC 2H9YA 2H29A 2WOJA 4WA7A 3B52X 3CTMA 1CR4A 4LMBA 3PFWO 4KWCA 1E2KA 3NX4A 3OM1A 4R84A 4ZDWA 3F5FA 5HQTA 2F43B 4I3HA 1GLNA 1ODLA 1DV2A 3HEAA 3N8DA 1HLFA 4PO9A 3ZGVA 1K8QA 4MULA 2YN4A 4YLEA 4LOJA 3F8WA 1SZPA 1JLKA 2BV3A 1LRJA 3OZSA 4YRTA 3VOTA 3ZG6A 3SXJA 1XPRA 4GNKA 4Q3BA 2O8FA 3TB6A 2GT1A 1HH4A 1BMTA 1GILA 2DTXA 2F59A 2H1WA 2O2JA 3IO3A 4Q1VA 4C4SA 1OXTA 5U4XA 4GEKA 2NOAA 5JAIA 2AC7A 2VYNA 1IONA 3D4PA 3M5WA 2QWXA 2XA9A 1C7RA 2R1UA 3JZFA 1DQSA 1KAOA 2YFYA 1FQOA 3TL3A 2VTBA 5JMOA 1P33A 4QYXA 4Y2GA 2H7XA 3EF0A 3SHWA 2ZQYA 1TK9A 2FUG1 1ZJ5A 3WL6A 3LIPA 5EJIA 2ZBQA 3AG5A 3KKQA 2JGDA 3DLTA 3PKJA 4K88A 3FI9A 2OTCA 2CHEA 3LT0A 2G5CA 1RLTA 1G63A 1IOWA 5ITZB 3CUEF 3IP8A 4X6XA 1UBNA 3GA5A 3FVWA 4UM8B 1P44A 4QOSA 6GPBA 1FUIA 4O2BF 1VBNA 3M6UA 3E5RA 3I2HA 4XQGA 1E9FA 2ID4A 1I24A 1RWOA 3I9KA 1EQ2A 1ODJA 1ISHA 4C4AA 4CF5A 1U28A 2ZRGA 3QKTA 3R3YA 2I78A 1S8FA 4IIFA 3W5BA 1CJSA 4BXOA 2FR0A 5DM70 1JG7A 2EWMA 2HNAA 3QLVA 2CVZA 4QECA 3CGGA 1J8VA 1RYBA 1JDSA 4RD0A 2C3OA 2PU5A 2SNIE 4P7BA 3RRZA 3AIKA 2QG4A 3IESA 3CIOA 4NCHA 1SZCA 2VDRB 4QQNA 5HFJA 4N47A 3EGXA 4LK3A 4EHAA 1SKUA 4YLGA 4K46A 3C2QA 4PM4A 4EUEA 3QE4A 1R4NB 4JHLA 2IVZA 1VJGA 5C81A 3D3NA 4MS1A 2ZTUA 2JFVA 5KUTA 5K1ZA 3RU3A 1RI3A 3M83A 3LPMA 3DTVB 3CBGA 4BBJA 1K0FA 4NQZA 1QHFA 4OQDA 4V39A 2YXBA 1T9AA 2PKWA 2JCSA 4WXEA 2WYHA 1L4UA 5FBKA 1COWA 3X1MA 4MVJG 2DY1A 3ONVA 1RT9A 4L5CA 3STTA 3LYLA 3VJRA 1GTJ1 2F3SA 5BP7A 3N53A 4OP3A 1PGJA 1KIFA 2DVMA 3B6KA 1D0SA 1DZ3A 1L7VC 1D8TA 1RRGA 1GR1A 1YR6A 1YVUA 5LM3A 2NZ8A 3L8ZA 1LVHA 1E58A 2BW0A 5ALKA 4GL2A 3IKVA 2GYVA 3OEWA 5JXHA 1LH0A 4DWWA 2RGRA 3DOCA 1ZIPA 4DLPA 3I9NA 1GVHA 4I55B 2OPHA 4URFA 3C5WP 1E1RD 2FEMA 2WMNB 1V5EA 1FXSA 3WIOA 1QE0A 1WW8A 1LSSA 1QANA 2R2GA 3QQPA 4CL8A 4CVNA 1DPFA 4N4AA 5IX8A 1PJQA 1N2CB 2AVDA 1GGJA 1PSWA 2OMKA 3FMPB 4KQFA 2LCFA 3DV9A 4LOKA 4WECA 1N78A 3EAQA 3HB1A 3Q3GE 1YL7A 2GJKA 3IAM1 4PWYA 5B1HA 3W1VA 4CWAA 5GVSA 1I1QB 4LYAA 3MM4A 2D54A 4NHEA 1CQJA 4L3WA 3FZNA 1QO0A 2FDCA 4FW8A 4BNDB 1PFVA 3EVTA 3OVMA 4CMIA 1E3SA 2B1GA 3HDTA 3LWZA 4BDTA 2P9GA 4JOSA 1XMSA 4OOEA 2Y0EA 5ALHA 3GFVA 3GJ3A 3ICWA 1ZWKA 2B35A 3TUZC 1PF7E 2INGX 1LQTA 1NMYA 1NF9A 1X7GA 2AOWA 2D5BA 1XDDA 1M66A 1YL5A 3E7XA 3OJFA 3QU7A 4MKGA 3TR6A 4B6JA 4AULA 5DX8A 4P86A 3M6IA 3DP9A 3WJ2A 3ZY5A 3ZX5A 2WE8A 3PS9A 4Y0NA 2R4QA 3NYQA 3QG1A 4OXXA 4DZTA 4IHJB 5KNBA 3HR4A 3S5UA 3TZKA 1V3QE 2FZEA 1WPXA 3X1YA 5LZ2A 1M6VB 4IDFA 2ZIGA 3ILSA 3UV7A 1ACMA 3IA2A 4WK6A 1Y1KE 1O5TA 3O2SB 3I6QA 4KQIA 4C21A 4F93B 3MC1A 2GUGA 4A6DA 5ENDA 3WKBA 2UAGA 3L2OB 4NU8X 4ZO6A 2O59A 3ND8A 1L5GB 4BX3A 3P32A 3C70A 2WFMA 2CDCA 3E03A 4JH0A 5KJEA 4QPJC 2LNDA 3U0BA 1Z75A 2HJVA 1DHRA 1U9IA 1M2NA 2PD3A 3ETHA 4CEJB 1SVLA 2VEOA 4XVHA 5K6AC 5EWLA 4ALJA 4JEIA 3AHEA 1V71A 1JEQB 1V1MA 1ZI8A 2K7ZA 3FPFA 3OWHA 2VP3A 2WKQA 1V43A 1N6PA 5COQA 4OKIA 4WLFA 4IILA 1KSGA 1G4HA 1NXWA 2OHJA 1ESEA 4E12A 3MMSA 4U2FA 4ZT6A 4U00A 4ZOEA 1IU9A 1V11B 1BFDA 2OXCA 3X0DA 1AGRA 1ZRSA 2PUAA 4RD3A 1S89A 3MBOA 2IX3A 2D5IA 4YCMA 4J16A 2I4MA 4KO1S 3VISA 2BUAA 4PZZA 5ALPA 1C9YA 2WYWA 1P1JA 1X6VA 4J3JA 4PAOA 3U1VA 3P71T 1H42A 5JU6A 3P26A 5FWYA 2BL4A 1M9NA 4DLSA 2QP4A 1XKXA 4BUCA 5TARA 3OY7A 2NYUA 1OAOA 1YB6A 4P5DA 1LFDB 3EA0A 2B99A 4N3GA 2ONJA 4I0WB 1DC6A 2GGSA 3JWHA 4EDFA 1PVVA 3WDSA 2JIZD 3HKBB 4U3JB 3RVPA 1NTOA 4RJKA 4MUGA 4QVIA 3RRXA 3F5SA 3AESA 4K1LA 2PCJA 3TK1A 4LRWA 1P31A 2EGUA 4BLVA 3EQ7A 2PUWA 4QUAA 2AEFA 1N9GB 3JQAB 4WL0A 1QH8B 3OKFA 4CN9A 2GERA 5I4BA 3IHTA 4NXMB 1W8IA 1U1EA 3JVUA 3OIYA 4JOBA 4BX8A 5B7NA 2QXYA 2NO1A 4IJVA 2HH9A 1Z5VA 2ZUDA 5I47A 4K6GA 3MRVA 2NU8A 1TMGE 4WI1A 1D0VA 4R0MA 2HT1A 1KYZA 4QXPA 5A4FS 1XVIA 5FTJA 2IX9A 1NQXA 1U6JA 1UBMS 1SA0B 2C9OA 2GPSA 4A15A 3WL5A 2JJ1D 3B1YA 5BMOA 4FK8A 4N3NA 1NRWA 5J3JA 2VT6A 2H2WA 4BVKA 1WQ4A 4HFRA 4O1MA 5KTOA 3ILXA 4N39A 5LQKA 2LKDA 2C61A 2VT2A 2C9YA 4RA6A 4B17A 3GEGA 2OM2A 4K81B 3IQGX 3DCIA 2DF8A 4GP9A 2A6PA 2PA3A 1L5HA 3EXIA 3SSOA 2H4JA 3LSYA 4I6EA 1BHJA 4TSKA 3VBCA 1QCCA 1ORTA 3BXHA 3VNQA 4NCKA 4RVNA 2D0IA 3T6KA 2ZATA 2FSFA 3HLYA 4L1KA 3KYDA 4LZNA 4NCIA 2FG6C 4A2PA 1A9ZA 1AQYA 4D74A 4E3ZA 1D3AA 3VAYA 1KJQA 1L5SA 4DA7A 3IL2A 4R1PA 1SGWA 4RVSA 5LZ4A 2HKIA 4KU4A 5LC1A 3U5TA 1UPTA 4CFZA 1QC5A 3CGWA 4ATNA 2A86A 2FW8A 3G5LA 4A26A 2M9MA 4BNIA 3A10A 4D41A 3AHCA 2ZR9A 3M4ZA 3PQ2A 2LDXA 4FT2A 3GP8A 2ZIEA 1AK9A 3DE0X 3JU3A 3TQRA 5J4KA 1ST3A 4ZJUA 3Q7PA 3LECA 2D74A 1LJUA 2Q1WA 4CQLA 4EIWA 2OVBA 2DH6A 3I4FA 2OK8A 3AKDA 5LKRA 2PWPA 4UE2A 1DKRA 2JI4A 4QNRA 5EJGA 1QF6A 3CUSA 2NYVA 1D2CA 2P5UA 3EXHA 5K3OA 4RLFA 2PUJA 1DWUA 5EFZA 1PNTA 2WFAA 4AY5A 2J8ZA 1YULA 4B82A 5JBQA 4R69A 3AVXA 2FOXA 3QVXA 5IJ9B 2XLCA 2WTAA 3WIUA 4YMTA 2IQ5A 3ZD6A 4RA9A 2OCKA 5FO0A 2DHRA 3CLSD 3GFTA 4ZVOA 1HDOA 3ZR4B 3GJ4A 2JI6A 4BPBA 5FL7D 5SYMA 5BN5B 1PZNA 3AYXB 4J3NA 3FCEA 3ITNA 4O2BA 3O2QB 2FMKA 1T3GA 2E4ZA 3CPEA 3OZ7A 4YONB 1K6IA 5K4GA 2AEEA 2X3YA 3O21A 1SKMA 1MV5A 1JFVA 4WKNA 3V4ZA 3WLOA 3L1JA 3ZEIA 4EITA 1WUYA 2VJDA 3LXMA 3UMFA 1ZOLA 3O4JA 4GI3A 2XVXA 5F4ZA 3WGYA 1F6BA 1C9MA 5E7QA 4HDNB 4OH7A 2VUSA 4G4GA 1Q95A 1N6LA 4RMIA 4TXMA 5AKHA 5DK6A 1O94A 1EK0A 1EHCA 1M8KA 4H7DA 3ZQKA 4F4JA 2H1LA 1OFUA 3HWWA 3MK31 2GVZC 1TFUA 4I36A 6AT1A 1V8OA 2OQIA 3BFPA 2BHTA 1EM6A 2HQSA 2CHGA 2FPOA 5BW8A 4IICA 2IOFA 4N5HX 4OYYA 3MXTA 2D8AA 5F3WB 2NSYA 3U4CA 1KZYC 3MF4A 3SVTA 4PGHA 4TQUS 2R96A 2X6TA 4F7DA 4UTZA 3ZE1B 5L3ZA 4JXJA 3IOBA 1J5PA 1DQPA 2BIFA 3P2YA 4JLUA 4R4JA 3WZ2A 4J1NA 5CA0B 3DOOA 1QQTA 3O1LA 4LHSA 3TD9A 4BLSA 1NYRA 3THYB 2QAGC 3ACDA 3FKQA 1OA0A 5AM1A 4IDPA 4E5NA 3CLTD 3D6HA 1IH8A 2XD9A 4DBLE 2B5WA 3RJ5A 5DBIA 1TT5B 3NU1A 1II8B 2C8LA 1G5FA 1TCVA 2VFAA 2EFYA 3KO8A 1J7JA 4KO8A 1KYYA 2ARKA 4OIMA 4OMUA 4Q9AA 5FYDA 1BKYA 3T5CA 3B2NA 1DU4A 4KN8A 3C8HA 4WEOA 2FZ5A 3F1KA 4DIBA 1YQ9A 2X58A 1TCBA 2YNMA 3VDXA 1L4EA 4HBZA 1UC9A 4N0EA 3SXPA 4MUNA 2SKEA 1N8NA 3DXFA 4B7UA 3P96A 1HQKA 2OZEA 1HQYE 1H0HA 4DWJA 5JI2E 2JKYA 4B71A 2PKQP 4ZI7B 3AM5A 3TZBA 5LXTB 5FP0A 2JFHA 3OKPA 4P6VF 3LT5A 2H2AA 3UMCA 5KNLA 5FR1A 3O74A 3L8DA 2Q99A 3UMJA 2KJQA 3OD5A 5K8JB 3B6ZA 1VKRA 1KBQA 3JYLA 3RFXA 2ZXUA 4DMFA 3EAFA 5B1SA 2WJAA 3HJFA 1KWGA 1Y9JA 3JATB 2BGIA 2BTQA 1ZM4A 2H5IA 3O95A 3SKVA 2JJMA 1RMYA 3O0DA 2W2LA 4LISA 1JJBA 2HADA 1B41A 1S1MA 2V6FA 4GBJA 5JROA 4PO1A 5BYJA 2RHTA 3IQZA 5ERGB 5I7UA 5KHOC 4UOQA 4H3KB 3Q8WA 3GFQA 4KK3A 4RKRA 4JLAA 1FTSA 2GN8A 4E11A 3GGOA 1FL9A 1J97A 2FJPA 3CMMA 4HAYA 1T25A 4WESB 2H4FA 5FWXA 4M0PA 3VO2A 2OO3A 2FPPB 1GUFA 3HLTA 2C9MA 2ZYIA 3JW8A 3V9PA 2HIHA 3LHKA 3EZFA 4CLHA 2HSWA 2QIOA 2IYFA 4O4JB 4W7HA 2ERXA 3DOIA 5FI5A 5ADUS 3HTXA 2BEWA 2QN2A 1NW9B 1OU0A 2CXOA 1GNLA 4QUKA 3KEGA 5AQEA 4MTCA 3UB4A 4Z3KA 4E30A 5ALFA 1QFYA 2HDWA 3ON5A 5DW3A 1CT9A 2RKBA 4LNUA 5IVIA 1E63A 1PUIA 3GRUA 5AVJA 1B3BA 5D85A 3RSSA 5IFKA 4LYDA 3TLYA 6ADHA 4KV9A 5CVTA 5CFOA 1ZXLA 3AQ4A 2OO7A 3ZVRA 3GPDG 1OZFA 2DULA 1HRDA 3E9DA 5D7NA 3I8SA 2H08A 4ROSA 3LZ6A 3H11B 1W93A 5F1OA 4Q12A 1DAKA 4NBLA 4U7JA 2GQ0A 4K3VA 4A0GA 3BJEA 3UB2A 3ZY6A 4BJ6A 5FWXB 3P97A 2EGHA 5DLYA 5J59A 2J3JA 4CKCB 4HWGA 1XXHB 2HWUA 3K6JA 4ILEA 4M8KA 4YJGB 1NVTA 1U8XX 3F8TA 3PDCA 2A9RA 5E38A 1U3WA 4KFCA 4DABA 1O3YA 4OGFA 3DVQX 2DWOA 2I67A 2QX8A 6LDHA 1NXTA 4YAOA 1PG2A 4UZEA 3K53A 4YCSA 3F6CA 1NXXA 2FHSA 3L9WA 3LXXA 3OFNA 1UJBA 2IOFK 2B7CA 1BHSA 2GHRA 4M55A 3DE2X 1PJBA 3W8NA 1GKKA 4GMDA 4CKBB 5I45A 2HQBA 2VWQA 1QUEA 1R9NA 4B6GA 1FVHA 3JQEA 1RPNA 3MCZA 4LGVA 5TQ0A 4B8YA 3QYAA 1Z7YA 2VWPA 2JGMA 4I8XA 4N18A 5EUMA 1A9XA 2QAGB 2X13A 3GC6A 1XZFA 3LLUA 4E94A 1MFZA 2YFQA 2WM9B 4FZ3A 3U3MA 4DBZA 3NTXA 4EQZA 1H93A 1SD1A 1ZD9A 2GETA 3KL4A 4ZMBA 4FX2A 4QUIA 3A1VA 1PJLA 2PL3A 1FQKA 3AB8A 3N8IA 1PJ2A 2XDQA 3AERA 4ND3A 1H4TA 4E2WA 1T3SA 1JECA 1KKLA 1C7IA 1PI3A 2IYZA 2KM1A 1KDTA 2R62A 3PD7A 5T3YA 3QELB 3UKJA 5BN4A 4DG8A 1DAMA 5JATA 1SCIA 4DA8A 3EUEA 5L7YA 1OTXA 1CG6A 1KI4A 3IIMA 4UHJA 5FTWA 1SH7A 1SNYA 4FYWA 2YYYA 3GARA 1JAIA 3GRYA 3OQBA 5DTRA 3R7DA 1S4MA 1Z3CA 3CJQA 2FEWB 3CH6A 2XADA 3HSSA 3ROKA 2IDMA 1C0PA 3OD1A 2JLYA 3UJ9A 4K9SA 2GD2A 2QW0X 2WM3A 4EI8A 1XTQA 4U7PB 2SICE 5K0FA 1DDIA 1E32A 4QAJA 5IJAA 4R1MA 2BBSA 4FMCB 2ZRMA 3TW8B 3OPVA 4G5GA 4JUIA 3JV7A 3QUTA 1UBLS 3BXOA 3O4FA 3DXZA 3QA9A 4QUDA 2ZLBA 5EJ5A 3D7MA 3WLQA 4R2JA 1LY1A 2KYRA 1JLRA 4KO4S 3WIBA 4NSNA 1KGSA 4M4SA 3BWBA 4BTLA 1UJMA 1CV2A 1VP9A 5A6SA 3VDNB 4PPNA 1BXRA 1Z0ZA 3BXXA 3KAPA 4EPRA 1W85B 5HF9A 3Q8XB 4EAQA 1SFRA 4P58A 1U1IA 2UZAA 3ZQ4A 2EX0A 2VSFA 2WJWA 4PQYA 3WB1A 4GZ6A 1VIVA 3OKCA 4V02A 3ZDBA 4BCDA 4DB2A 4LHWA 2IZ5A 2O1XA 1NRJB 2BHSA 1IBSA 5IAKA 2EYUA 5GZ3A 4IOLA 5CGQB 1IHOA 1WSAA 4NE2A 2ZIXA 4LJRA 3QU9A 4FQ5A 1GZ6A 1WMEA 1YOVA 5AJTA 1H94A 5KNDH 1P77A 1SWWA 2FSGA 2R2AA 4JJFA 4LXQA 2IY8A 1VFPA 3V7WA 1LS1A 1ZNQO 4AKSA 4CQMB 3PQEA 4BMNA 1A04A 4DEXA 2IVFA 3G9UA 4AM8A 5JALA 4W9MC 1E1MA 4CUZA 3FLBA 2FSUA 4KX3A 1OVMA 1P3Y1 2R48A 1XLTC 4KREA 2Q46A 3CSSA 5AOCA 5DRTA 1Z0JA 1YV9A 3JQ9A 2XLBA 4KI0A 3NM4A 4UM7A 7MHTA 3DE6X 3SI7A 3HJBA 3VHXA 4I1RA 4KFTA 4QJIA 4OOFA 3T5TA 4XJTA 2VWGA 2FG7C 5T4BA 1FXWA 3PUVA 3UIEA 4MRMA 2Q6LA 1PT8A 2W2VA 2ZT6A 1CX9B 3QUQA 1QWSA 4QYWA 4NCAA 4KIWA 3U80A 1SKQA 3VPHA 1HR0B 2V5VA 2A5LA 5FXMA 3L6RA 3FCUB 1M2JA 1H9CA 1T0PA 3H6KA 3S44A 2FUNB 2HA3A 3NGLA 1DTWA 5HCNA 1L7DA 3QBDA 3I34X 1XZ8A 2XUQA 2A0YA 3BZBA 2IZ0A 4JNCA 2PLNA 3H65A 1E2MA 1EHIA 1SCBA 3A3KA 4C4OA 3N3AC 4O3MA 4NDNE 3TRKA 2VJAA 1SQ6A 4QRHA 5IWAB 2QV7A 2P8JA 1IUPA 1I6WA 3KVRA 3PQ6A 3QVLA 2ATVA 5CU7A 3UPDA 3EDCA 5FWDA 4RFVA 1YRLA 3SHFA 1Q16A 4F6LA 5D5QA 2J9XB 1Z7GA 5DWQA 3RSLA 3SN6A 1G5RA 4NFYA 3WLEA 5JZ9A 2I2XB 4F6RA 4P93A 2ZPTX 3E22B 2ZBGA 5DKFA 1BJRE 1T9BA 2P6NA 3AHHA 3EVGA 4UCWA 1DVRA 3MSXA 2NMVA 4M1OA 1ZJJA 2Z3ZA 3CUKA 5BMVA 2JA1A 1R9GA 3UMSA 2VYND 1W88B 1SHTX 5F76A 4QQKA 1ACLA 2C07A 1CHNA 3U4MA 1HDXA 4I1UA 2I6FA 2I7VA 3BKWA 3AWDA 5FPKA 1IUKA 1UUFA 2OV4A 1V4VA 1HKHA 2RGEA 4IJKA 4EPWA 1E3DA 3EJWA 4H35A 4J2HA 5E7MA 5CCXA 3MSCA 4M9RA 1T8PA 1DJLA 3DKPA 4ZOLA 5TPWA 3SR3A 2DERA 1L4NA 3QYJA 1YVDA 4ZODA 1FDWA 2G06A 3ZIUA 3W9SA 3K70C 2J67A 1NR1A 1X9GA 2YIVX 2L0XA 1X8XA 4ZIRA 1ECFA 1MHPA 3QEKA 4RPJA 3ROXA 5CT5A 4ND8B 4R3WA 1N5RA 1PR1A 4DLRA 1HURA 2IPMA 1ZK0A 5AW0A 2CJFA 4UOEA 1C3EA 2DUJA 3T52A 4R1LA 5ISMA 5JJKA 3VKWA 3CN9A 4J43A 2SBTA 3UUEA 2ZR7A 2M1XA 2B8NA 1GU7A 4MS4B 2FFBA 4H4CA 1TQ6A 4LXGA 1TM1E 2GTHA 2ZS8A 4MWGA 3G5AA 3K4HA 1ZN7A 3IQHX 3R3HA 3RSGA 4BNLA 3S6JA 3N8GA 2L2QA 1G7RA 3ASYA 4IDQA 5JXGA 3DSRA 4ZKDA 5BT8A 3P4YA 2QPLA 2R8PA 3RYCB 1RPTA 2OB2A 1PLJA 3LRTA 1Q50A 2A9VA 3HB5X 3UJPA 2NP7A 3TPCA 1TEXA 5I01A 5A06A 1WCV1 1UJNA 3RVRA 2UU9B 4FOSA 5LIRA 3P20A 1NBMA 3D81A 3PX2A 4Q7EA 2IC5A 1CHDA 4LTDA 4RQUA 1U7TA 3EEYA 4DADA 2AXNA 1UFKA 2PT9A 2X9LA 4PPYA 4M60A 2NU6B 1OW3B 2UVQA 3AV0B 3FTQA 2CSUA 3GBVA 2A4KA 1K63A 3OLYA 4FFBA 5H9WA 1M1UA 1OB5A 2RCNA 3RTCA 1BAPA 1VI6A 4DCUA 1VMEA 5BV7A 4OHWA 4F4UA 4EATA 4TKLA 2RGGA 2BLNA 2QUBA 4FSDA 2BYTA 1XZNA 2EG9A 1OF1A 1TZMA 4L74A 2VHVA 1E7WA 1UBFA 4GLBA 1JQKA 2EV9A 2IYWA 4BGUA 4D4KA 4CIWA 2XUIA 3SEFA 4JVSB 3ZWBA 5EE3A 2WNSA 5HRAA 2WKPA 2CD9A 1Z8NA 1AS2A 1YTLA 3EH2A 4MVXA 1W96A 4HR7A 4PICA 3WR5A 2F8MA 3I6MA 4P3XA 1ULBA 1CUVA 4MICA 1JILA 3B53X 1RP7A 1XCGB 2Z5GA 3G8YA 2XUKA 3MT8A 3DA8A 4OHVA 1RQ7A 2PKQO 5CVEA 4CM8B 1AG9A 1KFEB 4U9IS 3U61B 1F8XA 1MW8X 1P62B 5HQ3B 1QRRA 2JFNA 3I58A 3QY9A 4QU8A 1UFRA 2QZJA 3RHFA 4CM7A 3F73A 4ZTZB 4D82A 3P9QA 2RC5A 3LFHA 1ZMBA 3LNTA 4YIKA 2I4OA 1M1NA 5BVHA 2CLIB 1ZHHA 4GFDA 4GM4A 1SIUA 1WBJB 3ZK9A 2BUBA 4E2ZA 4AJEA 2ZRLA 1NLYA 3PJFA 1QBGA 1PDWA 4FMBB 1FDIA 2BC9A 3M3DA 4G0ZA 3IB3A 1WCWA 4JJEA 4K0RA 4G5OA 5L9AA 2IBSA 1ICEA 3AHJA 5IT0A 3EFBA 2IPNA 5LL6P 1KO5A 2BI7A 1IDOA 2CZGA 2P9CA 4G41A 5K8VA 1LWNA 1Y3CE 2BEKA 1XWFA 3AFNA 2V9CA 2XSZD 4NJOA 5DLEA 3R7NA 2X22A 3RCBA 3WLSA 4CTJA 4YJFB 2ZR0A 4L4RA 2OO5A 1BH2A 2GKSA 3MWEA 4LRSB 4RHEA 4TQAA 5JIBA 2Q3HA 4JR0A 5D5HA 3V97A 3JR7A 2BH9A 3RFCA 4JJZA 1VDMA 5HPYB 2WJHA 4D7AA 3DEJA 4X6YA 4GOXA 4IEIA 3AH8A 3A11A 4IGFA 4R51A 2AN1A 2AXEA 3G2OA 4KWTA 4DCTA 1RHJA 1DRWA 1Z4JA 3FFWA 1P8AA 2VJBA 4H4EA 4X84A 1FFWA 1ADBA 4Q47A 3OQJA 4UNQA 5BNFA 3ZHSA 2EZ8A 3WMFA 1XEXB 4KTTE 1NOIA 1E66A 1EEXB 3FBGA 2VK1A 4TL8A 4B3TB 2Z5VA 3A6ZA 4N0DA 4MIKA 2CNLA 1MB0A 1XZPA 1XD8A 2X2FA 3F7OA 1QF7A 4BEVA 5LQNA 3PPXA 3K70B 3D6VA 4IIJF 3W5IA 3RC8A 4YJ2F 5FPQA 3ROGA 3WGVA 5B7PA 4JX8A 2Q6OA 1T1EA 4LEIA 4N0MA 3ANYB 2DUNA 4MYCA 4YV2A 1S1CA 5CCBA 3RU2A 1R5BA 1U5AA 1LC0A 3CV3A 2J0SA 4YP9A 3NASA 4KHZA 3URMA 4RXMA 5A9SB 3R7SA 4EW3A 3KZXA 3AHDA 1FMLA 1KH2A 4Y1RA 1EI9A 5H81A 3RVSA 1EDBA 1RLIA 3GLHA 1MV8A 3HUEA 4M9XA 3DLAA 3UJCA 4ILKA 1MC4A 3LUBA 3KXLA 1LGYA 5DCWA 5TQ0B 2WABA 2QTVA 1PV1A 4XWTA 2H65A 3EFOB 3KJIA 3T7CA 4B7XA 1CUXA 2R11A 3UPTA 1HTTA 3ZV6A 1RAEA 3AJ8A 1FOEB 1JPVA 4UMEA 1XT6A 2X19A 5ICGA 3HS3A 3K16A 4AF7A 1C8BA 4LOIA 3ZX4A 2VPQA 1MJNA 5CXQA 1X2BA 3BCHA 1G7SA 1OWMA 2UYYA 3BWVA 3DHNA 4BL5A 1YMQA 4DANA 1DX6A 1FK8A 3VFDA 4HUJA 2YOFA 1Y89A 4Z9FA 4AY6A 1C0KA 4GO1A 4HNAB 4WLVA 3STUA 4RSGA 1B23P 1E6MA 1ECJA 3KAKA 4K9MA 4EHHA 1H1LA 1SXJD 4KQ9A 4CM4A 3ND5A 4DR1B 1PJ4A 1U9CA 5C8YB 2SCUA 2OKCA 4X44A 4C0AC 3GLQA 1WX1A 1LI4A 1JIVA 2FN8A 2IXDA 2NXJA 2IRWA 2PG3A 1CSEE 1QR2A 3EQZA 4RDCA 3ZXSA 4NCJA 1WHTB 4JYCA 4M3NA 4OEHA 4TLEA 4YX9A 2GEFA 3GEHA 3G88A 5C9ZA 2HEGA 3IAAA 5LBIA 2B37A 3FKJA 1X7XA 1EFCA 3GUCA 5TXGA 3R7BA 4RTJA 3BHNA 4NAVA 1SOWA 1RZ3A 1YCHA 3ZHUA 1P2BA 1LBSA 4KDFA 3SQLA 2PSSA 3OICA 1A1SA 2J5XA 2DLNA 5BW6B 1LF5A 3ZQ6A 3IFSA 2R6CA 4F4HA 5D84A 5TRTA 4QUBA 1E98A 1L7MA 1W4LA 4ZYUA 4C6SA 3VU8A 5DH9A 1VPLA 1SELA 4FFNA 3IHKA 5A2QA 1HETA 2WFLB 3EVZA 3SM9A 3PDWA 5AICA 5GTDA 2G7MC 4NE7A 2B4YA 4A8JA 1YZ3A 3K0AB 4REQB 4DYHA 5HZGA 3V2GA 3HJCA 1JR3D 3GBPA 2W2KB 1UOOA 3IT3A 1X2EA 4KLCA 1UWVA 3HRIA 3SF0A 3Q2IA 3TW0A 4BO4A 3SDSA 1L9KA 5EHNA 5AUOB 3BXFA 4RX1A 1VCOA 1NT4A 1ZSNA 3HCWA 4IRUB 4NF2A 1DAIA 2LKCA 3DXXA 3H8WA 4TLCA 3DL0A 3TB4A 4GT1A 1ZRMA 2FW0A 1GNVA 4XWYA 3ICVA 3UJ3X 4CLRA 4ZQHA 1GR0A 2BEJA 2BY4A 3RASA 4GYJA 1KQGA 1XQWA 3I45A 5KJCA 2OFPA 4EF4A 3DG9A 4J3FA 1RSZA 2GYWA 3E9YA 4XUGB 4GQBA 3VVMA 4B9EA 3H97A 3C7KA 1E2GA 4GP6A 1XEFA 4M0LA 3WDLA 5B64A 3CRRA 4L0CA 4U7TB 4D9BA 4M38A 1P4RA 2J3EA 1ZH2A 3NHKA 2CNOA 1PBNA 3SGLA 5IM4F 1ST2A 2IL1A 5AKKA 2BMVA 3EDYA 3I23A 2UZ1A 3FLEA 3PQCA 2JJYA 3DBIA 1AQIA 3WLKX 4CV2A 2BFDA 621PA 2C4HA 3NVMB 1Z17A 2P3SA 1JE0A 3GB9A 2VUIB 2I0FA 4RNCA 2WBLC 4OHPA 4DUGD 4OQFA 2EZTA 1GOTA 2JFUA 4LXIA 3KQYA 1QKIA 4NCBA 4DPLA 1FS5A 1SY7A 3OUUA 3VHQA 1EGMB 5EHZA 5JAHA 1H8HD 1ZNYA 3PB3A 1SKBA 5JAMA 4AX8A 3ANXA 3DLBA 4MW5A 3ZLJA 3QJYA 3RHZA 2COUA 1E2FA 2X5NA 2JIDA 2O0HA 4RZUA 1SAYA 4XB6B 1VE7A 2ONZA 3CVYA 2XH8A 3E35A 4DCJA 5JCPA 1V8BA 1OASA 1OXUA 1RZRA 2XNSA 5C1PA 4IP0A 3NXSA 2AZXA 1R0ZA 3N74A 4R9RA 4A0SA 4DAOA 2E6UX 3DO8A 2I8CA 4DA0A 1TLLA 4QHSA 2GAFA 2QMQA 3EC7A 1OZGA 3OKAA 4ITVA 3VYSB 1T6XA 4P8RA 3WQRA 1Q19A 4Y98A 5HUQA 4S1NA 2IUUA 1ZK3A 2PX5A 2OCPA 3JD2A 4GPEA 2OQ2A 3V8VA 3LDFA 4MUIA 2UYGA 5H4HA 4EJMA 2AG6A 1JH8A 1W19A 3I2GA 4JVLA 1ABBA 3EH1A 2CVFA 5CEEA 3GLIB 4QEDA 3AFMA 1E64A 4R68A 3B1VA 4P35A 1AKNA 2WB4A 3FZQA 4E6EA 2DFNA 2QLLA 2OWDA 1BXGB 2JDID 4QSMA 4C6TB 3RAFC 1QLWA 4L2IA 5DV9A 5HKKA 4RO0A 2OR3A 1RYFA 1VG1A 1XRQA 2ECQA 2HT6A 2ESRA 5LZ5A 3PHGA 4BZQA 1T29A 1D7AA 1M2KA 1QVZA 2P7IA 4G5YA 4GGOA 3IXQA 3N9IA 4K9NA 4KQJA 4R1NA 4BQFA 3RC9A 4R3UC 2FN9A 3DGEC 3QF4A 3DZJA 3W9BA 4W8GA 4D3SA 3CONA 3VOSA 1ZD1A 2HDNB 2QTNA 4GIBA 4M7OA 4QBKA 1L5FA 5B37A 3P1JA 4BKQA 5KQLA 4V0OA 4KKXB 4MI6A 3DMTA 5MGBA 3MTEA 2C3PA 4LW8A 4WOPA 2V9PA 3DFKA 3Q1LA 2C2YA 2E4VA 3R0IA 3EOAI 3G8BA 4XQ0A 3KUDA 3KPYA 2HPZA 3STHA 1ZGGA 1KJ9A 3CH7A 1KR5A 3R3XA 4OI0A 4TV8F 3E18A 2D7DA 1E5QA 4H7HA 4R9NA 2YUTA 4K9RA 3C5EA 1C30B 2MU1A 4Q3LA 4QOGA 2CXQA 2EEZA 4L6CA 4OU4A 4GGPA 2Z98A 1TRHA 4RKFA 5EMHA 1D6MA 2FK8A 1NV8A 5HJ5A 4WCFA 1ZCAA 2ZDQA 3B89A 5AJWA 5ESRA 3ZJTA 1JPUA 2JK0A 3QMVA 1IMOA 3ETNA 1Z7WA 4HQ0A 3PFFA 5AHKA 3FNEA 2NPFA 4AUMA 4TKUB 1Z06A 2XYPA 2DETA 4CTNA 2PUFA 4QEKA 2FP4B 1C41A 4FEGA 3KFVA 2ECKA 1I9CA 3KDAA 4GHWA 2C4MA 2C04A 4BIIA 3A4MA 1CRQA 2XODA 3WLAA 4D9GA 2Y1XA 2FMUA 3WMEA 4HLUA 5IJZA 2FPGA 2AG0A 2GCIA 1CUFA 1IZ0A 2IYVA 4E5SA 3OQMA 3ACBA 4WACA 1NOKA 1P7VA 2GAOA 1LK0A 2C2OA 3OQIA 4EA8A 2AZ4A 1V8PA 2D1FA 2VYQA 2Y76A 3QSGA 1Z13A 2W2XA 1LTHR 3HPRA 3Q15C 3A1CA 4M8NE 1CP3A 3LT4A 4G8CA 2VSYA 5KTMA 4DR4B 5DFAA 3SQNA 5LLTA 2HTEA 2CMFA 3FSJX 3FUXA 3KEQA 4Y6RA 5KX5F 2OZLA 4BP3A 3UGJA 3P0HA 1PJZA 1Z5PA 2CYBA 2KQUA 1THMA 2FMHA 2XBLA 3TPZA 2B4KA 4PHFA 4UAVA 3H5OA 3KOUA 4US0R 2WUWE 3TSZA 4EKIA 3MJSA 1R6AA 3T7IA 3ND9A 1X7WB 3KU1A 1S7CA 2A9JA 3BH6A 4MDEA 4TV9B 1YOBA 3G2QA 4E08A 4GMKA 1PE0A 2GCOA 2NT3A 1I33A 3FTPA 3K6SB 3NDBB 2OC9A 5EQDA 3TIGA 4TXNA 1IK6A 4I9FA 4P0PB 3CZCA 3C1AA 1JDUA 1X14A 2AL7A 3BMQB 1RI2A 3I2KA 4TUYB 3AR7A 4O1HA 1E3IA 4AMZA 5BN1A 1IEVA 3HHEA 4NBTA 1RMTA 4NNJA 4TWIA 3UFXB 2PSFA 3DB2A 3VJKA 4NDAA 3T0GA 1GG9A 1NHGA 3F98A 1DUIA 1H23A 1T4BA 4MZDA 3TMAA 1QE5A 4ZTBA 2ZRFA 3IUPA 3C1OA 4ZEWA 2C2WA 1GCGA 2TRSB 2VRNA 4F56A 2QF7A 3ONEA 2JGIA 1MZPA 4AYXA 4L0MA 5GM2A 5HKBA 3AWIA 3K2EA 5J2TB 4HEJA 3A6JA 2WWIA 4OREX 1ZM7A 3HI6A 3AF5A 5CM2Z 1BG6A 4JWKA 1WM1A 3S5JA 2NSHA 3T35A 1XTZA 2FVXA 2IHZA 4ZMRA 4WY8A 1U5BA 2KHZA 2R7AA 3LUGA 3KUCA 2WAXA 1ZFNA 5MFZA 5AH0A 1VI5A 3H1EA 1N2OA 3MS2A 3CWZA 4K6OA 2VTKA 4K6HA 5JS7A 1CJTC 4DA4A 3WIEA 2FMFA 4AUNA 4DMGA 4DM7A 2OV1A 4BJHB 3GJ5A 3R5XA 3EBOA 4YA6A 9LDBA 6REQB 4KBYA 1EFKA 3JQCA 2W6NA 3AUSA 1TECE 2W93A 4EY6A 1M34B 1Q3KA 4K2HA 4YRJA 1PQYA 1E6EA 1ZC3A 2XB9A 5HBRA 1MUUA 2BLLA 1ID1A 4K7JA 1T0HB 3WL8A 2BF7A 3GJ8A 1CRWG 1ZZGA 1XUOA 2WF9A 1PLLA 3EGWA 3OJCA 4HNHA 1D03A 3LKZA 2I4LA 3W78A 2C1EA 5E3HA 1SKYE 2B5OA 2AFIB 1IEXA 3CPSA 5HCUA 4B32A 5B58C 2ZQ5A 2J7PD 4E5UA 4BLTA 3QENA 4D8TA 2P1DA 3DE3X 5EIEA 4JYZA 3ELUA 1TC2A 2GJAA 2Q5QA 3Q7SA 2PLAA 4RELA 4TQ9A 4HGPA 521PA 2O4CA 5F1KA 1OAAA 3PRHA 4YNBA 4YJHB 1L3BA 3TVDA 4BE4A 2EARA 4MV3A 2PKRA 4M1SA 3HNRA 1ADFA 2O20A 2P9BA 3EZ6A 4YCNA 5B7QA 5CBKA 3ZIAD 2ANCA 2WTNA 1R0LA 2FQQA 2WV7A 3UTCA 4UASA 1OXMA 5HE9A 1QFXA 3BXPA 1MB2A 4TL6A 1NJ2A 1TM4E 1ZCZA 3NALA 4G09A 4DG9A 3LVQE 5FA6A 4B4WA 3HXMA 2NZUG 3C43A 4D9KA 1Q1AA 4IVPA 4D9FA 4Z1OA 5HGXA 1O0BA 2C29D 2H4ZA 4G8DA 2HHAA 2VDUE 1MN6A 4MV1A 2GR9A 2C5SA 3M89A 3DBLA 4FHZA 2P6RA 3D7RA 2H4HA 4QRIA 1X39A 2XBUA 4JB2A 3D54D 4XVQA 1SURA 5HRUA 5KVQA 2D2EA 5AI4A 3PJRA 1IM8A 2XTAA 4UCXA 4TRMA 2YHIA 2EGGA 2OV2A 2EKZA 1DIBA 3FF4A 5EKTA 5FH9A 1PSZA 3PVZA 1YJ5A 2QMOA 4QBTA 1Q7BA 5IZ4A 9MHTA 3SVZA 5FBVB 4EPXA 1YZTA 2HK6A 5CFLA 3OAAA 1NULA 1ENOA 3R9XB 4XWGA 1WU8A 2D7JA 1QH0A 2VHWA 4G1VA 4QQRA 4W8HA 2LCQA 3PSAA 4OB6A 3BMNB 2HDOA 2N9UA 3G9ZA 4H1VA 3QOWA 1T5DX 1D4ZA 4HQKA 5F73A 1JEYA 4NZMA 2JBHA 4DC1A 5HS4A 4GMXA 4OK5A 2AJCA 1YBFA 4HTFA 3EVBA 4OXIA 4XPIA 4JQZA 3U1BA 1O2DA 2XA2A 2FGJA 1XCPA 1DBPA 1FP7A 4XUCA 5HWSA 3D2LA 5G41A 3IVCA 1A8HA 1NATA 4L75A 2DFKB 2GBFA 1OPRA 4G0YA 1XXLA 2HD4A 5JNWA 1GFSA 4MQ5A 1ZN8A 1UP7A 3O03A 3OLZA 4NLLA 4Y1EA 1L5QA 4TWBA 4G4IA 1JHUA 4R1QA 4ZANA 3IUEA 3GYBA 1QQAA 1MJ5A 4NJMB 4LSZA 1N7IA 1C9NA 3ZHTA 1TJ5A 5H4GA 5IJ0B 4IUYA 4QTTB 2B82A 2LP4Y 4W9NC 4D81A 4DLBA 3O8QA 5DDIP 3P9KA 1YGYA 3UW3A 1UXKA 3CLUC 4ZZ1A 3SQWA 1QFMA 2YWHA 4Q03A 4QIHA 2G8LA 4MO2A 3H4IA 1O96B 5LJLA 3L1IA 4ZC8A 1DWQA 3FR7A 4J6FA 1PQPA 4I4TA 4B5KA 3NATA 2MINB 1M10A 3DTTA 1S8AA 4YAIA 3R5JA 1JXQA 2ODQA 4D42A 3H83A 1NW3A 1JEDA 4GYYA 1RC8A 3CIFA 2BN4A 3DQQA 5ALIA 4B43A 4MWTA 4LNHA 3E8MA 4X1KA 3EEFA 4KE8A 5HVNA 3K1AA 4FZVA 2WT4A 1ODTC 2I6SA 1NPYA 1OLSB 2B92A 3HY6A 2C1XA 5C3UA 1QO7A 5ABPA 1MO2A 1JA9A 4J76A 3ZHQA 5FOXA 2GZ3A 4KWIA 4AKGA 1JIXA 5D01A 3U26A 1N6HA 3T1VA 2FW9A 3EVEA 2EFJA 3D1JA 1G5HA 3FBTA 1XEAA 4LDZA 5TQ2A 3R5SA 3WYFA 1U1FA 4FYKA 4EW6A 1NLZA 2PAFA 4L8LA 1S2LA 3ET5A 3P5BA 1KAQA 4J0DA 4XJXA 2NWQA 4MVJA 1FJGB 4F46A 4D99A 1U2ZA 1GUDA 5CXUA 2CLKB 5DHQA 2IV2X 2V74B 5C37A 2NYAA 3K9NA 1OC4A 4R6XA 1SHKA 4E2YA 1WOYA 2Q50A 4R2XA 1NE2A 4YO7A 3UK6A 1CRPA 2C7OA 1ISRA 2GCEA 3DT9A 5SY9A 5THKA 1QTRA 1S2OA 2EQBA 1RC0A 1VRVA 4GX0A 1MTZA 4I1YA 1CR1A 5ALDA 4BFTA 1U0EA 4R2LA 4AZ0B 1D1TA 2ENUA 4XH9B 2F1HA 5MF6A 2BFBB 3PENA 4L51A 3IV9A 2BFOA 4MR8B 5LUAA 2XXAA 2Z0MA 2ZG6A 4QTXA 2DBZA 1UJ4A 2FGKA 2RJNA 4KPYA 2WU0A 2O8VA 2WUGA 4DUZB 1ITZA 1GP2A 3T7AA 4Z6KA 2XTJA 3EXEB 5FTNA 5K51A 1SG6A 1E4OA 2VCEA 1RKUA 5EZQA 1RLUA 4G9EA 3P5SA 1A88A 3HR7A 3QPUA 1WCYA 4HC4A 4PNZA 5D3MB 4ZU3A 4IGEA 2WUEA 4F85A 1PJSA 1CFZA 2Y0BA 2FPIA 4INAA 4D8VA 1XRRA 9LDTA 3WKDA 3WSWA 4KR3A 4R41A 1HXHA 3HUTA 4WLNA 2YXPX 1TKAA 3NEPX 3NHSA 5DN6D 3PQ3A 3FDZA 4R8RA 4D96A 2H0RA 4OM7A 3CX7A 3ZJ5A 2GPJA 4J7XA 1K7EB 3M6AA 5BV8A 3N07A 1TQ2A 3OG9A 1KEWA 4QAQA 4ACBA 1EZ1A 1QHEA 2YMPA 4MGEA 3R24A 1UDXA 4XVUA 1EUCA 4W5HA 1E3WB 3DQPA 3BA6A 2ZYHA 3CUWA 3MGAA 4KDEA 5IBPA 2FSHA 3FJYA 4GM1A 5TLSA 5K3SA 2ZDHA 3AUTA 2ZI5A 3FX2A 4L9AA 1PN3A 4FD2A 4TTJA 1QK4A 1ZGZA 1L6IA 3GCWA 2XX3A 2AOTB 5DT9A 5GWXA 3AINA 1ULTA 1OXKB 2IXFA 1BEZA 3GF4A 2EXXA 1HMPA 3N7AA 4KNWA 1ZGBA 5HDQA 4GKVA 1N75A 1XZAA 4FB5A 1CF9A 3KKZA 3GRKA 3V55A 5CJ2A 5LYJA 4JVNA 4I9UA 2HIMA 3C3EA 1QPZA 3C39A 4A0FA 4MQFA 3CXUA 3U3RA 1KDOA 2YJ5A 3T4EA 1GLVA 2A59A 2W6CX 4LCEA 4MWZA 4PCVA 2Q7DA 7ADHA 1RLJA 1SN7A 2Y1CA 1UIRA 1O77A 1KE2A 2VSXA 2BKUA 3V8BA 2FSPA 3O8RA 5EHXA 1KO8A 3UCXA 1P2GA 3ROMA 2PMDA 5DX1A 2DX7A 4FXOA 3BHMA 1PFYA 4O0MA 3LK6A 5DCUA 1W75A 5IK2A 2YY7A 4J2TA 1J5XA 4U5QA 3KXIA 2V6BA 4OLBA 3FOBA 4GKJB 5KMGA 3ORQA 1M34E 3NIWA 1PX2A 4MQEB 3U09A 1Y6JA 5F3RA 3HB0A 4I50B 5EN4A 3U7QB 2QUKA 2ZJ2A 3E2MA 5G0SA 4I5GA 1WUIS 1AHHA 3JQBA 3U2QA 5BSVA 1QHYA 3E8SA 1BJKA 3GFRA 4G0QA 1CQWA 1XQXA 3ZCRA 3IV6A 2X14A 4JI6B 2FRDA 2D3TA 1GPJA 1P80A 3ESDA 4BGEA 2A1IA 1X1DA 3OPYB 3UF0A 3G0OA 2AFIE 4BEWA 5ICSA 1AXGA 4LF9B 1X1EA 2BEVB 1UOPA 1JE1A 3I53A 1T35A 4OPMA 1Y8QA 1T2NA 4UD6A 3UHOA 2OGSA 4ZREA 3NNDA 4MYSA 1D2NA 4Q7QA 1N5JA 4KAAA 4UCFA 3D6NB 4JT8A 2C97A 3TMKA 1KAHA 1HO3A 4KBFA 2QL5A 4Y2PA 3G0CA 1LBHA 3JARA 3SFZA 1JLSA 4K03A 1AZSC 2RBEA 2R6HA 2WHYA 1KK0A 1QSGA 4IX9A 1IPHA 4M2LA 5L3SA 5KPDA 1FP4B 2WA1A 2CKMA 3RW9A 5JNUA 2C5EA 5F9FA 5K3BA 1KP9A 4MEBA 4ZQIA 2DQ4A 2J32A 3MTQA 3MRXA 2JHGA 3GRRA 3QITA 1TCAA 4NK4A 2F55A 1N5KA 2G40A 3V4OA 4ND4A 5C5CA 3AUFA 3QVGB 5SYNA 3TGPA 4WJZA 4HB4A 4OYLA 1ZGAA 1Z6TA 4FFLA 4Z0PA 5F1PA 4I1OA 5ERXA 1FNMA 4HMQA 3ZU2A 2QRVA 3E2PA 3V7UA 2ZIAA 5JC8A 2PFSA 1Y5NA 2RJOA 4W9RA 4Y9TA 1S3IA 1T4CB 4RHTA 3HCBA 3TIIA 2CB0A 3WLIA 4JEUA 2VO1A 5L4NA 3F97A 4G5RA 2VATA 4QQFA 1UZNA 1WOMA 3L04A 1AKQA 5FUVA 4BLUA 2FE4A 1NDQA 4X6LA 3W8DA 5KYGA 4FWBA 3RK1A 3STYA 4Q05A 2CDAA 4FUTA 3SJBA 2VAVA 1K6MA 1LBIA 2E87A 3K8QA 4ODIA 3UWOA 3IMGA 4MUFA 1Q6ZA 3W05A 5KOHA 1XMXA 4KQXA 3VZPA 1ZUIA 1LLCA 3QVUA 1E3EA 1U28C 4LE2A 3JASB 3WG9A 3PNVA 2G77B 4FYYA 5ALSA 5A4KA 5CFPA 5JBNA 1I7QB 3QLVC 4ZZ0A 2OM6A 5J47A 2NO7A 3QNWA 2DPXA 4YMHA 4HO1X 3U4HA 4ABYA 4MSUA 2CXPA 3W5JA 1UIMA 2NV6A 3CLHA 3OT1B 4WXPA 1ZICA 3CH5A 4NTZA 3CUYA 1USGA 3BJIC 3CKMA 3SVLA 2QLJA 3RK0A 5C8XA 5I8WA 1MAUA 4PYJA 2E89A 1JQEA 4IGAA 1M2EA 1VIYA 2QVXX 3GGGA 1NY6A 3ONFA 5C4MA 3GFGA 1JDBC 2PRJA 2WSBA 3EQ2A 4XQCA 4YYZA 1WCIA 2WKWA 4LPKA 3WWOA 5ICMA 4RPCA 3HQ4O 3MS4A 2J1LA 2XTZA 4R2WA 2OBNA 3KBOA 3RYIB 4CM3A 4MHSA 1G8MA 1AMOA 3IUSA 1E9SA 2GBCA 4OI2A 4UU8A 4IKPA 2JI9A 2JC3A 4INOA 4UQPA 3VH4A 4TZKA 4V1CB 3TX2A 1NDHA 4FS8A 2IYYA 1CWUA 2N42A 1M0SA 1RHKA 2B8EA 2JIBA 1S8NA 4DT1A 2Z2ZA 4UHDA 1P9NA 5CB8A 3UUGA 5DWVA 4RK4A 4DLLA 1P6XA 1D7OA 1UC5B 1IVNA 3E82A 2IW3A 3N2NA 2Z1DA 3G8AA 4ZZ3A 2A1TS 3RANA 3ZI7A 4CI0B 2NUAB 4EL0A 3OQVA 2HU8A 1QIGA 1AMUA 1MD9A 4G5HA 1OQAA 5FPHA 1KHHA 2RGWA 3JPWA 1ZA2A 2DJIA 5NULA 4K0KB 3NHPA 3BSFA 1BX3A 4DKJA 1H4VB 5FUMA 2I3ZA 2Z6AA 4POOA 3W2FA 3EOBI 3GCGA 2WJZB 1FMFA 1QHNA 3BCRA 5D7BA 4X5OA 5K3FA 5JZSA 3OEHD 1Z62A 2H0QA 1T5SA 2JFYA 1Q44A 1I32A 4MV8A 4EVRA 2PZJA 1GKIA 3ASVA 2OUIA 2QT0A 3WLRA 1DX9A 1OU4A 1PYDA 1YB2A 3EGCA 4J1TA 1THZA 4FKBA 4DW8A 3UICA 4UEJA 2G9NA 2F6RA 4KGXA 3WGKA 2HY7A 3IOMA 8LDHA 1XA4A 4EYSA 2IZZA 4OJYA 1JHYA 1QPBA 2DQYA 2IPXA 4WKGA 1DGQA 3B5IA 4DF3A 4UCQA 2G71A 5CDUA 3WAKA 4JJAA 1X1RA 5ARCA 5EL0A 2AR0A 4LVUA 3DDWA 1ONSA 5LQCA 3IMEA 4LJAA 3WL7A 1E96A 2DU8A 3OJ0A 4EW1A 1T8UA 5A0VA 4JNKA 4MUXA 2HAEA 3OOEA 2ZVDA 1UJ6A 1RZRD 1E1NA 1VGQA 1IATA 3T3HA 2P9JA 1Y9DA 4Z4HA 2GA8A 4ZCQA 1TKRA 3GDWA 3PXGA 3G0BA 4CCWA 4TVOA 5I7AA 4F72A 3NTUA 4DLKA 1JDTA 3LC2O 5A5VA 2VTBB 3WNVA 4C9BA 1AS3A 1QFJA 5I9IA 4LQCA 7YASA 2IH5A 3AVWA 1V26A 1DWOA 1K1EA 1X92A 1OXVA 2HA0A 1U9IC 1CZLA 3SD7A 2WWFA 2Z09A 1GU1A 2JHPA 4CNBA 2P8SA 2X0JA 5HGJA 1ORDA 2JGDB 1KWKA 3SQXA 3OEED 3P9PA 2WG1A 1XTBA 4ZQGA 1ZISA 2FMIA 2JRCA 1D0IA 1RABA 3L8GA 2FFJA 3QY0A 1T24A 2EBUA 3R1IA 3CVUA 1I0ZA 4FZRA 3I9V1 1RCTE 2CC2A 5E4JA 4QUJA 3OT5A 3W4KA 3PR1A 5BOSA 4V0RA 1QORA 4NXNB 3QVTA 3NHAA 4IWYA 2BBWA 4Y0AA 2WMOB 4MWEA 2ZRJA 3USZA 1G2IA 1L8OA 4C2BA 4BXOB 4F1KA 1FE8A 2X0KA 3TTTA 1G1AA 5ES3A 1T0IA 5BXYA 1TTTA 4J16C 4KVGA 1WZIA 1KPIA 1I3NA 3A1DA 2J9RA 2LR0A 4ZVMA 3ZJVA 1GA1A 2PZLA 1O5OA 4LNAA 1DRJA 1E3TA 3ZV7A 2D59A 1ZNXA 2G83A 2I8AA 3EGXB 3P9CA 4HCJA 4P3KA 5DNAA 5C7LO 4R1UA 3WLHA 3Q6NA 3DFMA 4MRPA 5THXA 4LYJA 1CUWA 1XFDA 3PU6A 1EGVB 4MS1B 1NN5A 1Z6GA 1OAOC 1L4HA 5CEFA 2PUCA 1KMQA 1OJLA 2O8CA 1ULSA 4ZCLA 1JDBB 1I0LA 3LZDA 2PVSA 4MLCA 3DFFA 5J4LA 3PNPA 3B3AA 1RYDA 3KCQA 1GARA 3QQ5A 3KQUA 4AWAA 1YB7A 2J31A 4U7GA 1Z18A 4RK7A 5A7FA 2CCJA 3CM0A 2BSXA 5TMDA 4AD8A 3CG4A 3UCEA 2XUHA 1KEKA 2VUUA 1NG9A 4OYRA 4WZZA 1CB7A 1SIWA 2F8SA 1ECBA 5EJ6A 1PR6A 1BJTA 2UYQA 1FPQA 3B3QA 3MRSA 5DBEX 3RI3A 3L0CA 1YR9A 4HH1A 4KSYA 1I6KA 1XKLA 4AZVA 4OHOA 4AJOA 3AZQA 3OTHA 1G5QA 1UBUS 4OQNA 1RAHA 3DBOB 4BN0A 5FT9A 4DGQA 4FFRA 3FOZA 1TKCA 4X7RA 2C96A 5IYZF 4CDRA 1VHDA 4D4IA 3FYUB 5LKAA 1PYOA 4HGYA 1ULUA 2IY7A 1SHUX 2XEDA 4FMPA 4KGVA 4P92A 3REQA 3AVVA 3OIGA 5G0WA 3O84A 3NBKA 4YCCA 3WGUA 1JFTA 3NGMA 3PA6A 3U4IA 4NABA 2YN2A 2ZUEA 1CQJB 1I7PA 5DYNA 2JFXA 2H52A 3ZKAA 4LWOA 5CVDA 3QGMA 2IGTA 3HSKA 4ID3A 3F0TA 3SHOA 4CMIB 3TGLA 1EDDA 4I5IA 3LUDA 4L8FA 2JCGA 4ZAXA 4IF4A 1BTOA 4AUEA 3HZZA 3OQ6A 1WHSA 3DVLA 3HFGA 3SKXA 4RPIA 3IJPA 4EVIA 2XYRA 4BO6A 4CIAA 2I2FA 3SE7A 2ZSBA 4UNPA 4B3CA 5C7OO 4PSKA 4LZAA 3IP9A 1NAIA 2CMKA 3UG6A 4EY4A 5I9TA 1U7WA 4J0GA 3TFOA 4MCJA 3HXQA 1A0OA 2P7HA 2ZIWB 3K35A 3FGNA 2UUAB 1CS4C 5D8DA 1CJBA 4HLDA 3MWDA 3A31A 3DNFA 5T5QA 4BMPB 3VYTB 5LMZA 3GOHA 2ZRDA 2PN1A 2ADMA 1OXSC 1UT5A 4DQVA 4C7OA 1N0HA 2C84A 2VHJA 3MTJA 4IXTA 2AWNA 1D2GA 4XSHA 3BT7A 3SZ3A 1DFIA 1T8WA 3DYVA 1JT9A 2O7NA 5EZ6B 3ORSA 1OH5A 1IRIA 1I5EA 1QZUA 2WJ3A 2BPOA 3EXHC 5KNCD 4RV4A 4BKOA 4F04A 4GICA 2FPKA 1CFJA 1YR2A 3NHBA 4URVR 1BD3A 4TLDA 4RWZA 4A10A 3T61A 4EARA 1QAMA 1BRTA 1K3TA 4C07A 1TA9A 3EDRA 3EGIA 4GWKA 5CXXA 4ZRNA 4DV4B 1NUUA 1B26A 2PGIA 2Y92A 5CFNA 1T8RA 1ISFA 3DKVA 3LQKA 1KYQA 1LK7A 1OWPA 3NWBA 5ALWA 1OH8A 3H6HA 3U4QB 2BKAA 1WNTA 2J9YB 4B6QA 2PS9A 3B2QA 4EGJA 1WLYA 1PT9A 1V1MB 5K01A 3CZ5A 4ME6A 2ZE5A 2NZYA 1B0AA 1Q0QA 2ALJA 1N0VC 1U0GA 1OGJA 2LXNA 2Q5CA 2VDNB 3B2EA 3BTVA 1A4XA 3DM9B 3OZIA 4NZPA 1MABA 4UJ5A 5CCDA 4OKNA 3A6PC 4KMSA 1AKEA 1EK1A 4QDOA 4AW9A 1P5ZB 5GQSA 4OMFG 4RZSA 4DIFA 3NNSA 5I7FA 1UPAA 3LT1A 3GGSA 3CWQA 1FJXA 1GZ5A 2Q5HA 4JY7A 4PHHA 3BORA 1O94C 1GQOA 1NN1A 1PGQA 2JH3A 2VDLB 1MDFA 1Y82A 5IAAA 4Z4IA 2Y67A 3ADBA 2G9QA 4IWNA 2BTEA 1U8CB 3GZTB 3RODA 4PLFA 5FWYB 5DN9A 3RLIA 4FNAA 2Y27A 3BFKA 4KRFA 1AJEA 1G7TA 1FLNA 2XVZA 5KC8A 2NZJA 1G2OA 3GPIA 3M1IA 4DKXA 4LY3A 1ZOIA 4ZVNA 5AESA 1CVIA 3DVSX 3FDIA 2WPDA 2X77A 3EWIA 1VTKA 2BGJA 4BYMA 4DDMA 2B8TA 4L4UA 4MHTA 2NO9A 3P8ZA 5J58A 4ZRDA 5KNCH 3AESB 1SQSA 4US2R 3P9IA 1SQ0A 2ISQA 4HMOA 2OENG 4JB8A 2EAUA 8GPBA 4OHCA 3KT6A 4Q9IA 3OC6A 1P17A 1U0LA 1KKMA 3R3JA 5DB4A 4ZAYA 3S4YA 1KI6A 1RWXA 2NU8B 1R8XA 2RGYA 4JXKA 4CFYA 1Z0FA 1L4LA 1JDJA 1J0XO 2YNMC 5F7XA 1YA6A 5CNIA 4ZZ2A 3TTXA 4RD1A 4MLDA 1XRNA 1KFJB 2V7TA 4LJ9A 3CZQA 5JHGB 2UDPA 4KR7A 3B12A 1J8YF 1UPFA 4LE0A 5ALEA 2A58A 4RA6B 2B61A 1QONA 1URPA 4I4CA 4P4SA 1L5HB 2QU8A 4TROA 4WBSA 2FYTA 3F9RA 3G6WA 1UOEA 5FR2A 3WNBA 3ZTTA 2JA2A 2O48X 1TKBA 1B42A 2R1TA 3KYDB 2WFZA 2WZCA 3GELA 3NUGA 3OAAD 4MARA 3T3IA 3Q8KA 3B85A 1R5NA 4ZCIA 2O8BA 2YWFA 3FDJA 3ZNNA 1GN8A 3KEMA 1F4PA 3C41J 1P5RA 1QC5B 3PGKA 1F5SA 3UXMA 4ZP1A 4L7QA 2ZUFA 1U5CA 1QH1A 1AZWA 3B3JA 3JYHA 2QM3A 5HZHA 1RKQA 1NW8A 1ZAYA 3GEBA 3KWFA 3OPMA 3UM9A 3RLFA 4BNYA 1DE0A 1U90A 3I5MA 5IUNC 5E4YA 2J9FA 2QL9A 4Z0HO 1XCOA 4YPVA 2ZZMA 3I6ZA 3BZUA 3R3SA 3LFUA 4CQLB 4ZI7F 5LXTF 2QNRA 2P2DA 4C76A 5FLXA 4YAJA 5FNZA 4I1PA 1XN4A 3AI7A 3EC2A 4G0UA 3CF4G 3X2FA 3AI2A 2RH4A 4JL8A 2E4YA 1JHMA 4HGQA 3ZHOA 1NFRA 3ERCA 1DB3A 4PNPA 1U4NA 3MWGA 2PGAA 2UVPA 1EP9A 2BGLA 3JVIA 3ZHCA 2ATCA 2V7UA 2XWJI 3DFUA 4QREA 4A91A 1HT3A 1ZS9A 4G3XA 3B1XA 4RA9B 4MCAA 5GJVC 1IC6A 2UXBB 4IIXA 1Y6QA 4Y9SA 4TYPA 3FSEA 4N7JA 5GVRA 1RIIA 2CBZA 3M2PA 4LBVA 4O2BB 5A62A 1COZA 1T9ZA 2F1JA 2PD4A 3LGXA 2Q6IA 4PGGA 3MWLA 3C24A 3KUUA 1R0YA 1QQBA 5KSOA 4ZFNA 4RVHA 4JC0A 5AKLA 1X9HA 2PMKA 4D3YA 1ND6A 2YIJA 3VAZA 4QL3A 3S2UA 2PXAA 3QYFA 3U3DA 1TW2A 2GK3A 3GBSA 3RUPA 3ZPXA 1OREA 5BXQC 1XEWY 3RABA 3CFYA 1A69A 4O4JF 5LSAA 1JEEA 2R60A 1QP7A 2VDVE 2FLWA 1CUEA 2Q29A 2QPOA 2WYVA 5CLQA 5KDLA 4C1NA 5IANA 2F8TA 3KSZO 2PKEA 1D2RA 3G7NA 3U81A 1LW6E 3INNA 3UQZA 2O3SA 4GWLA 3PUHA 1LDBA 4ANFA 4PC2A 3E9EA 2ZWIA 2A30A 3QHPA 4PLWA 4WQMA 4MVJD 5AM4A 3MBIA 3MTGA 5FBZA 2QVBA 3N86A 4ZI3A 3ZWVA 5BORA 3BFJA 2H7CA 4MP3A 4WFKA 3RJZA 4V1CI 1JLLA 3SKYA 4PXAA 1UR5A 1Q83A 2BHNA 2COKA 2QROA 2ZB7A 4H6VA 4ZVRA 2IUSA 1FSPA 1E2NA 2YV3A 2CVOA 3KPJA 4P98A 3OUZA 4WKCA 2IBMA 3ZU6A 2BDTA 3CZAA 2WF6A 2R00A 4MUJA 3RHTA 5A0TA 3ELDA 2CCGA 2F3PA 4JASB 1VJRA 4AS3A 1T36B 1UBRS 4DQ0A 4URZR 2PUDA 2C54A 4LDNA 1QCYA 3RRYA 4NESA 3TL6A 4BPRA 5IYZA 2R68A 1M76A 2LIPA 2Y99A 4X45A 1Y8ZA 1AHIA 1FYWA 3IE0A 5DM1A 2XUGA 4UNRA 3RIHA 3OZUA 3DHVA 4MAMA 4FBMA 3S27A 2C7GA 2QMYA 2RB5A 3HXOA 1F8GA 5DTQA 4TZTA 3M6XA 1DRUA 3BB4A 3PVCA 4B3HA 5BW4A 4QWMA 1F17A 4H18A 4PWZA 1I2BA 2WJ6A 1N3LA 2I1LA 2CYCA 1P4GA 4O63O 2BTQB 3K8ZA 2AYZA 2O5RA 2QUHA 2V7QA 3EVNA 4ZYYA 1RKXA 1KK3A 3C6YA 2CBXA 3G02A 5EIWA 1VBKA 1UT6A 3RFVA 2P77A 3MA0A 4Q21A 2ODTX 3K1ZA 3UAGA 3PDJA 2QYOA 3L8CA 1NXOA 1P5JA 3GMIA 4OFBA 1UPUA 1YJCA 1XP5A 3A4IA 2V5AA 2ZP1A 3C8UA 4QXQA 1FSGA 5DCYA 2Q41A 3DCJA 1L8QA 2P41A 3DKIA 1SCUA 1Z38A 1ZM2A 3NGXA 4NY1A 1OT3A 2V96A 5AOBA 3W0LB 4ARBA 5IS2A 3LTNC 3MAGA 5EI5A 5LMCA 1Z0UA 1IBRA 4DN6A 1CIPA 5AM5A 2QDXA 3I1IA 1IZYA 3LUJA 5H3HA 3C8MA 4BP1A 1W5AA 3JVEA 2ZAYA 5EIAA 2BEWB 1CQZA 4B79A 1PR2A 4A16A 2PR2A 5IASA 4XIFA 3L79A 1HKUA 2FPUA 1Z15A 2JG3A 2H1FA 2TMKA 4JP1A 1RI1A 5EWJA 2O1WA 2PUVA 4HAVA 1C3OB 4EB3A 3L4JA 4FM9A 3HM9A 4LNUB 4XW2A 3WIDA 2FPMA 1PKXA 2XMDA 4ITUA 2W00A 3RS0A 3Q3JB 5BRNA 5IK2D 3JQ9C 2Q9UA 2O50A 1U2DA 4XGQA 4MHOA 5DGIA 1A5BB 3PWKA 4MWSA 5EP1A 3VOBA 4BNNA 1MVOA 2VPZA 5ECDA 1I4EB 1IN7A 1NNI1 4UBIA 1E5TA 4BNXA 2QBYB 3KSUA 1FLVA 2W37A 1HWYA 2WHEA 1EXMA 5K0BA 4E5PA 4F7WA 1UMBA 1AV6A 1OGYA 2FPXA 2JIQA 1IZ9A 1P9RA 1ZC4A 2X2EA 1ZGCA 2ZR8A 4FT4A 4TMWA 1RJFA 4JK3A 2XGJA 1CUYA 4GPTA 5EJEA 3LOPA 3GFFA 2QJOA 1PNOA 2OV8A 5EYPA 3ROFA 1RJEA 1DG3A 2BGWA 1MB4A 2V7WA 4UOZA 1Q1BA 1BWPA 2B1JA 4KN9S 4W6QA 2WUVA 4QODA 1U0TA 2LD4A 3PPVA 1FP6A 3GLGE 1QS0A 1A82A 3GUVA 4TM8A 3QPVA 4C2UA 1GCAA 2NO4A 3AUKA 1H65A 2ZIVB 3Q12A 4IOKA 3AY7A 3IHWA 5G3YA 3FFBA 1OYWA 3LUHA 1ABFA 3COPA 3EVDA 1Z2CA 1Y4UA 1YA4A 2BEUA 2ZSKA 3IIKA 3ML1A 1I14A 1KI9A 2W0SA 1LDGA 1Z4PX 1A9XB 3D1LA 2CLOB 3DO6A 3OM8A 3GAAA 5ECWA 1GQRA 5A9TA 4B34A 2WHXA 4E88A 3N3BC 4FNOA 4E1BA 1SXJE 3P4XA 3PYLA 2JASA 4ZCTA 3JQDA 3FMFA 2EFHB 2R6JA 5E8JA 5JDIA 4DLXA 3AERB 5FJIA 1TE2A 3X1WA 3CT6A 1U8AA 2D0DA 2ODWA 1V5GA 2R6AA 4J0FA 4AUKA 1PGPA 4D8XA 1PWYE 1XJ5A 2J6IA 5BN4B 1C1YA 4A5OA 3KIPA 3T7DA 1Z68A 2VZ8A 4FFWA 3A7DA 1XVAA 4WCVA 4IGKA 1VMKA 3IEPA 4ZCMA 2NGRA 2I33A 3SIRA 1WXEA 3GVPA 4JEHA 4UHEA 5B6JA 1U04A 3A6KA 4LIPD 4WX2B 4FILA 2IYXA 1GGHA 4N12A 5A05A 1PD0A 4WGFA 5H8WA 1FU8A 2YWCA 1FBTA 1JSZA 1RHRA 1DJOA 2FETA 1B8VA 4KTVE 4BB6A 3D8HA 2DTDA 4N3BA 1P73A 3TTSA 1TAGA 2GVDC 3Q98A 3K09A 4RY8A 1OYOA 2HPAA 3A6DA 4QQ8A 3TEMA 1H0SA 2G1AA 2W48A 4RTQA 2R8EA 2G67A 3R0JA 1WD7A 1WEKA 3LX6A 4M37A 3ASUA 4G9GA 4L9RA 3TZEA 4TT3D 1QYIA 5ITVA 5KWEA 3WTCA 4IHQA 1XGKA 3CW9A 3MT9A 1CUBA 1JR3E 1N57A 3AJ9A 4C5CA 3TLKA 3V4VB 4NPAA 1BXRB 4QATA 2PRYA 4MR7B 4Q1BA 5KNBH 2IU4A 1W0KD 5IAGA 3KG2A 2VPTA 3GGDA 3HDQA 5KINB 5AXBA 1ECGA 4EB6A 1CZHA 4O2AF 4CTOA 1KFKB 5TJHA 2REBA 5JXJA 1X1AA 3TQOA 2F3QA 4P5EA 1CBUA 2NZWA 5L95A 1I4DD 2PS1A 3QVVA 3RT9A 4BKUA 1QIDA 4LBZA 3FTFA 2QJRA 1YOVB 4ZOAA 5DZSA 1NYLA 1VBFA 4M1WA 3DV0A 4B31A 4YV7A 1LBTA 2HA6A 1PT7A 3TOZA 4MKXA 3ZZ0A 4G0PA 5ARDA 3DOUA 4MINA 4TTSA 2XIQA 3C3BA 1EGQA 4LGYA 2NVUA 2BRUA 2I2CA 2VC2B 1ZINA 5CGZA 5L3QA 3LWDA 4YMUA 1VA4A 1K7XB 4FFPA 3VHXB 4UM5A 3MB8A 2MHCA 4ARVA 1IVYA 5EMKA 3EEIA 4EHDA 4KLRA 4EG3A 2WG2A 3LX4A 4PG6A 4PXSA 4DJAA 4X65B 2W42A 3ZDDA 4WNYA 5E6SA 4MRMB 3RIYA 5BV0A 1EJ0A 3LW7A 5THQA 4I08A 4RD2A 1FX0A 2J0VA 1P74A 1NW6A 3GRCA 3UHAA 4WN9A 1ZQ9A 4DLZA 1GL6A 1YRAA 3QUSA 1DTWB 5HJEA 3L4SO 3FCYA 3FFTA 3MGBA 3OHSX 4HZGA 4RTSA 1S2GA 2V8OA 1G9TA 2C5LA 4URHA 5I5GA 4AC9A 2VHUA 2P6MA 1PJTA 1N6RA 3GUYA 1DAOA 3FZEA 4KQ2A 4K8OA 2MYNA 4GECA 4MW7A 1SHJA 1UXOA 3NBMA 3NEYA 4RWEA 4TRRA 5IMSA 1ECLA 3EDMA 4ISBA 3LDUA 3PQFA 3RRMA 1EQUA 2WU4A 4BFSA 3L4BA 1XNQB 3KP1A 5D00A 1TVCA 1M8GA 1V3TA 2NSDA 4K2AA 3K0HA 2R66A 1NQ5A 3NZEA 4GR4A 4RL4A 4ENWA 4YMVA 3A2KA 5A4MS 4X54A 1W59A 2OO5C 1D04A 1TGVA 3KTDA 4HN9A 1J0CA 5BMVB 4F5DA 1RD4A 2VXOA 1G8AA 5TPZD 1YB5A 3VX3A 3E15A 3OLCX 2D13A 2NTVA 2BMJA 5IG2A 1HG0A 2Y93A 3PNBA 1P1RA 3FTDA 2Q9AA 3LS2A 5CX1A 3WWPA 5EJMA 4UXHA 3G0HA 3BRSA 1TEZA 2VBIA 1HT1E 4FWIB 4RIFA 3IR7A 4X20B 3LP6A 1YS4A 5CD9A 1VPDA 3QYPA 1HPLA 4YVFA 5E9QA 2PYDA 1N1DA 3V4RA 1SR8A 2GCGA 4MVWA 4ZOLB 3PHIA 5TPWB 4KR0A 4OQZA 4YUVA 5PNTA 1YZGA 3DWGA 3FGOA 4BVGA 2Q4BA 3BX1A 4HFMA 2F1OA 1AB6A 2HM7A 4PX2A 3WSVA 4ZIRB 3A37A 3O82A 3U6KA 1YGPA 4U39A 5EPEA 2LZ0A 2BM0A 2OORA 4UVGA 4KLAA 1GFZA 2ETVA 1YQGA 4BS9A 2EIHA 4E1VA 1XCJA 1PWEA 1V6SA 4KPUB 4W5NA 4Q93A 1HX7A 3LQ4A 3ZU4A 4R05A 2ORVA 1D1QA 2IIBA 4MA4A 2A92A 4CLDA 3AIIA 4G26A 3QVOA 1DQNA 3HBFA 2ZI6A 2WJYA 4KYVA 4Z8XA 1A7JA 1TYEB 5E9WA 5C51B 3IUMA 5LLSA 4NZNA 5A1TA 1BIFA 3GLUA 5TE9A 3KSBC 4I9GA 3ZU5A 4Z54A 4OH1A 5BT9A 2A0WA 1RPZA 4B75A 5LNK1 3CLKA 4HVAA 2HSDA 3D7NA 4JC8A 4BKRA 3FRIA 2ODNA 2WSYB 3GZ4A 2J4FA 2X0DA 2JLXA 1CD5A 1QE3A 5AI0A 4FN4A 1TM7E 3OTQA 2C7BA 1IHXA 2GEUA 3B6EA 1NQTA 3LY8A 4NICA 1A8IA 2VP4A 3O91A 3TSWA 4PW0A 4MV0A 1WTAA 5KAPA 4YI3A 1LCIA 1R6UA 2AFVA 2WZQA 4FFBB 5JNSA 3NM5A 1PJRA 3QTBA 4EX7A 4FOOA 3OLVA 4FVTA 4A0HA 3KV1A 4EB0A 1J21A 2P1RA 1U7PA 1ZY2A 2BT4A 3QVJA 3B51X 4KEAA 4B4KA 2GM3A 4Y6PA 3I62A 4AJKA 1LWOA 5ECGC 1WZ2A 3L0ZA 2FV8A 2JIPA 2IBTA 2W22A