3TNFA

Lida from legionella in complex with active rab8a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
170
structure length
170
Chain Sequence
b'DYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-8A
molecule tags Protein transport
source organism Homo sapiens
publication title Protein LidA from Legionella is a Rab GTPase supereffector.
pubmed doi rcsb
total genus 57
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tnfA00
3C5CA 2PX0A 4GNKA 1HUQA 1HH4A 1KOFA 1UJ2A 2AKYA 3AVQA 4A82A 2J0QA 1GAJA 1XWIA 1NKSA 3EAQA 3MUFA 1KJYA 5TDHA 2OSBA 4MGZR 2WBLC 3WY9A 3QBVA 2A5FA 4LJAA 5LD2B 4IDNA 4JLDA 3I5XA 3W34A 4B6EA 4TYYA 4C4PA 4Q47A 3J81k 2FH5B 2QMOA 4B76A 2BBWA 3QENA 4TYPA 5CIWA 1V5WA 1S1CA 1T0HB 5B58C 1XXHB 4WZBE 2NPIA 4JZKA 2WWYA 3Q7QA 3OIVA 4XVQA 3V4FA 3ZZ0A 3V00A 3BB4A 4HAWA 1S2MA 2GVDC 3B78A 2OO7A 4RD2A 3RABA 3KQHA 1Q0UA 3LX8A 1EFRD 5KTYA 1S4QA 2IS6A 4NCHA 1MKYA 5J4VA 4TTRA 1M34E 4D0GA 3B1ZA 4HLUC 2J0SA 2E9SA 3F3YA 1E94E 1FPMA 4O2RA 1IY1A 4LC1A 2CVHA 4IFEA 3KQLA 2ODNA 3B8HA 1FTSA 3WYFA 4A0HA 1YQTA 1D9ZA 4U00A 4DEYA 1XFAA 1XD2B 1MRSA 5FBWB 3SDZA 2O52A 3KDSE 4LHWA 1NJFA 3CLVA 4Q7JB 2C98A 1VIYA 1XMVA 3AEZA 4B3XA 1CS4C 3N70A 4GOJA 4CZ2A 5G3YA 3PEWA 2XB2A 4DIDA 1ZJ6A 4JLNA 5H68A 3VMFA 2ZU6A 2FFAA 4MGYR 4POAA 2WJIA 3BFKA 3LO5A 1OFHA 3T12A 5IRCD 1TF2A 1Q44A 2LCFA 1CJUC 1X8KA 3L0IB 4P3YA 1IONA 2OE2A 4ASUA 1P2TA 2XNSA 1SHKA 3JZAA 2OLKA 2H5EA 3AVPA 2ZITA 4MRRA 4C0AC 2GBLA 1BS1A 4LC0A 2BEKA 4BUJA 3A36A 1AN0A 2MSDB 2AXNA 1HTWA 1NMYA 1R5OA 2QGNA 1M7GA 1H65A 1UDWA 1KI2A 4OHVA 2ATXA 4KXFB 5C4MA 1PVOA 3X1YA 1W47A 1P72A 2RGXA 2H7VA 1D8TA 3U3KA 4CEJA 3SHWA 2P67A 4LJ4A 1Z47A 2BM1A 3N2IA 1YKSA 1NLZA 2ZI5A 3VR4A 4C7OB 4LV6A 2BOVA 1L4UA 4CEIB 2ZROA 3K0AA 2CE2X 1HE1C 2YZ2A 4NYJR 4A8JB 3I61A 1XCGB 1G6OA 1NBMA 4EKDA 4B32A 2A3RA 4QJ5A 1KGDA 1M7BA 5JWOA 2GAOA 4DKXA 2ZRGA 1UKEA 3VKWA 4A8JC 1AGPA 1FMJA 2HLDA 3OIWA 4BZQA 1KDOA 1ZUHA 3OIYA 1SKQA 4II7A 4ACAA 3NH9A 1N6KA 5J4YA 3P4YA 4B71A 2GVZC 1RC8A 3G0HA 3RS5A 1UBFA 4LYHA 5EXPA 2KSQA 4M1OA 1E3MA 3GLIA 2XZLA 1QHYA 4QJ3A 1RE0A 4LJ8A 1E9BA 3FHCB 4H1UA 2V7QA 3SJCA 2EFEB 2NO9A 3ZZTA 2WIAA 2WSMA 4D6PA 4QGHA 4RZ3A 1YR8A 3VR5A 2QAJA 3I5YA 4PAOA 3LW7A 2ZU0C 1RJ9B 3KQUA 1SVSA 2IYZA 4C0QC 4HSEA 3NDPA 4B75A 5KO2A 2XX3A 3QKSA 3GLGA 3UWKA 1ZD8A 3AF0A 2A5GA 1KY3A 1NMZA 2FPMA 3MJRA 4OI2A 1N5LA 2QT1A 4H9GA 1W4AA 5FOWA 3EPHA 3QI2A 2RB4A 4JYBA 2VH5R 4BQSA 3T1TA 3FPAA 5G40A 3GLGE 3HDTA 2FJUA 2V55B 2ZJ2A 2ERYA 3OIUA 3TUIC 3L0PA 4YMTA 3I92A 1J70A 4MITA 5DISB 1R0XA 3AUYA 1T9HA 1OH8A 4Z51A 3X1XA 1ODFA 5DNYB 3BK7A 3I1FA 1S3SA 4F7WA 5L3RA 5ANRB 2B7CA 2JLSA 2ZJ5A 2EWWA 1VHLA 2ZI6A 4W7SA 5GVRA 3BWDD 4PC6A 4OHXA 1XMJA 3DKPA 5FFMA 4XWAA 2ZPTX 3SZRA 1N6LA 4CDGA 1DS6A 4TSFD 3CR8A 4Q4HB 3GP8A 4C2UA 5H70A 1Z28A 1W49A 3MD0A 3ZVRA 2VP9A 3E70C 4LGMA 2I1VB 1PLLA 1DG3A 5B64A 1OIVA 2RGNC 3E1SA 4RD4A 1XD2A 5EZ5A 1RW4A 4C3ZA 1PLJA 1FX0A 1MH1A 5AUQA 3T1VA 5BYJA 3D3QA 4WAUA 1P2UA 4ITRC 2HF8A 4B2LA 2G0TA 1L4YA 4IOMA 1VYVA 4WW0A 2CCJA 5FR2A 1OB2A 4IEEA 5E3HA 5E7JA 3TUJC 1X86B 4R9UC 5FTMA 4EFLA 1NY5A 2G77B 3D8BA 4O2LA 3LRPA 1E98A 3TIFA 2KBFA 4R7ZA 2QTFA 4M8NE 5J47A 1FMLA 3A1WA 1N0VC 4BLQA 2QM8A 5D3MA 2QAGA 2JLWA 3B7GA 4KLNA 1SHZA 2X1VA 1II8B 4KBFA 3B9QA 4Z8YA 1G8GA 1EWQA 4FINA 3RHFA 2ZRDA 4MUAA 4BE7B 1FW6A 4YXWA 3BH7A 3GJ6A 1FQJA 4LX0A 4NYMR 5E7IA 4TMKA 3SFZA 2YNMA 3A1VA 4JMPA 1QHHB 1EX6A 3CF6R 1JPNA 1JR6A 4TQ9A 1G7SA 1Z0AA 2B6HA 1YR6A 4DT1B 4DB4A 5KPJA 5AJWA 5FBVB 1CIPA 1LVGA 2SHKA 1G5PA 3O8BA 3LWNA 4I81A 4IOKA 1ZAKA 2J41A 3RSLA 4Q02A 4PSAA 1IQPA 3PUZA 5FOVA 3BXZA 3MLEA 1L2TA 4B3BA 1WB9A 5CLQA 5GADl 4JBYA 5BWMA 2R6GA 2PZFA 4XD7A 2MSCB 2CL7X 3VKHA 4TMXA 3F5FA 5DYGA 5HZKA 2H1LA 1KSHA 1WXQA 3PVSA 2CL0X 4PPQA 4R2HA 4C30A 5F3WB 5JI3E 4ZIRB 3ZIAD 4D4JA 2GCOA 2IHBA 5DHFA 1K6MA 3A4MA 4OJQA 2PLRA 1G9XA 4AKEA 5J5CA 3NBFA 2GXUA 1KDTA 2VP4A 3PENA 1NNEA 2O8CB 3M1IA 4NU0A 3EASA 1MO5A 2XXAB 2O8EB 2QSZA 2A5JA 1CTQA 1ZC4A 1T3HA 3VR1A 1UKYA 4D80A 5JZVA 1OH7A 4PC2A 2B8WA 1KZ7B 3CZPA 3MWKA 5DI9A 4FCTA 4HUTA 3TUZC 3WNCA 3KFXA 4ZDIA 1YE8A 4A0GA 3BFVA 2WJYA 4TYWA 4EAQA 1TUIA 1ZNXA 5EE0A 2W00A 3GLFA 3CPEA 5FTLA 1W4CA 2QE7D 2ZVPX 3VR6A 3KKMA 2JLUA 1KJWA 3O8RA 1E2JA 2CHGA 3FKSD 3G82C 2CJWB 2EFCB 4LYAA 4Q1BA 2JJ8A 1MT0A 1QG4A 2VEDA 5FTKA 1E9AA 4W5WA 5F2EA 2YC2C 4DCTA 4BASA 3FGNA 3GPLA 4US2R 2ZUBA 4V0LA 4NMMA 4I1SA 4LK2A 5DYIA 1OXSC 1T0JB 5BQ5A 2QPAA 4UNQA 3EG5A 5DE3A 1L7VC 2QENA 4M0LA 3B6EA 4B35A 2XTZA 2ZRPA 2WAXA 2NGRA 3CPJB 2V1XA 3ZVMA 1BIFA 5FBLB 1XXHE 1R2QA 4ARZA 2DHRA 4CRWB 1GKYA 1Q21A 3I8XA 4JLVA 1T8UA 2XITA 1ZUNB 3GCGA 3GFPA 3WP1B 3KTAA 1F5NA 4HB0A 5LPNA 2WSSA 4HATA 1YRAA 2R6AA 2LKCA 1GZSA 2J59A 5KSYA 2GNOA 2JDID 1SXJA 3Q72A 5FPSA 4Q21A 721PA 1WBDA 2AWNA 1GDDA 1P62B 3TKLA 1OSNA 4L9WA 2GETA 2D06A 2WJGA 5UKDA 2CVFA 2D7CA 4PTLA 4BLOA 5JECA 4RKEA 2EFDB 2X2EA 5HKKA 1P6XA 1KAOA 3EA5A 5G41A 3HPQA 2C03A 3QG1A 3FMFA 1J2JA 3BERA 3IDQA 1WRBA 4TLDA 4CEJB 3EW9A 1II8A 3KXLA 2IYSA 4FMCF 4ZCMA 5G53C 1IXZA 3DKVA 4BLSA 3TAHA 2ZAOA 3QE0A 4QBGB 4F4JA 2CL6X 2E1RA 3K0AB 3QIAA 1F6BA 3CX6A 5SZKB 1PUJA 3U4QB 2VIIA 2YWGA 2VP2A 3SR0A 3VR2A 2IYUA 4S2EA 3RS4A 1N6PA 4NKRA 3U3JA 1SVMA 2L0XA 4A6XA 1GM5A 1T5LA 2P5SA 1XU4A 1LNZA 3LDAA 1N5IA 4B74A 3DVLA 3SOPA 3OE7D 2F43B 2I4IA 3HR7A 4LHZA 5FUWA 3QPWA 4V0KA 3KKQA 4KVAA 3RRNA 5FL3A 3OE7A 3DM5A 4GI7A 3ZS8A 1BH2A 4C0KA 2EVWX 2WWXA 2KBEA 4MQBA 2J1LA 3B13B 1LS6A 2HYDA 4PSKA 1KHTA 1ZINA 4NCNA 4Q1DA 2XOKA 4L8GA 4DCVA 1VCMA 1FFHA 4FXPA 3BOSA 3A37A 4C0JA 1VCNA 1Z0FA 2X19A 2ZI7A 1EXMA 2Q6TA 2GXAA 1GNRA 1IN8A 2OCPA 3TR0A 1NIPA 1XP8A 2F1HA 2J87A 421PA 4IJMA 3THXA 4QHYA 3VX3A 4AKIA 1YRBA 5L3QB 1G291 3OF5A 4JJKA 4MH0R 2Z5FA 1UKZA 1WA5A 4LZZA 3T5DA 4EQ6B 4F91B 2ZAMA 2OBLA 4NBSA 1E2LA 2ZVQX 3SU8A 1OYWA 3AKYA 4X8OA 4F92B 4HDOB 5KNCA 3K9LA 5CJPA 2IYWA 5C1BA 1D2NA 3P4XA 4LJ5A 3U5ZB 3SI7A 5TVKA 3GLGB 3AVUA 5AR1A 3VNUA 4JKIA 4DLXA 3D7MA 1TUEA 5FI1B 1A1VA 1E2KA 2RGNA 1S96A 3W8NA 2OILA 3BD9A 1G7CA 3X2SA 3K1JA 3QNUA 1AGRA 3LLUA 3GJXC 2TMKA 1TADA 2ZJAA 4X8MA 3RVBA 1UAAA 1T91A 1E9EA 4B48A 4YDSA 3ZQJA 4BRUA 1XB2A 5CYPA 1IOZA 2CJWA 4TLAA 1OXVA 2FFBA 4IVRA 1I4TD 4Q7KA 5D3QA 3QVVA 2AX4A 3K0SA 1DTSA 2OLJA 4GSYA 2YOGA 3HU2A 3QJYA 1ZM7A 4QBIA 4B44A 4UJ3A 1YZLA 4JLKA 3OEED 5LBIA 4DC9A 4LYFA 3SYKA 2BMEA 2QRNA 2RHMA 2WSSD 1H8HD 2PBRA 4XVUA 1G4UR 4UJ5A 2XTNA 4A2PA 3SYLA 3ASZA 2WPDD 1O3YA 1Z0KA 3FMPB 1NVWQ 5DI3A 1E1RD 1AM4D 2DBYA 3OAAA 1KO8A 5JCZA 4QNRA 1ESNA 2CXXA 2X2FA 2GTPA 4LRWA 5EE1A 1JB1A 2JAQA 1NJGA 1WMSA 2C5LA 1AQUA 4G5RA 4XVRA 2ZI9A 3HU3A 1E2PA 4M1SA 5EP2A 2NQ2C 3A8TA 4PX9A 1T3SA 2QU8A 1QHNA 4OK6A 4LSGA 1S3GA 3RS3A 3U6KA 2IXEA 1OT3A 4PR0A 4IKEA 4FW9A 3AQ4A 1ZRHA 2GZAA 2JJ1A 4QKQA 1JQLB 1Z6XA 1P60A 1NBMD 4D4LA 2A7QA 5KSOA 2PT5A 1G1MA 2R62A 4HLCA 4KYIB 2C9CA 4EFMA 3RRMA 5JWRA 4UNPA 1UBGA 2XSZA 5TV2A 2J3EA 1GL9B 1QHHA 4W5HA 3M6AA 4G5OA 4KCGA 4D2IA 3LBNA 4OQFA 2XSZD 5KSZA 1CRPA 1R0ZA 1NN3A 2OV2A 2H18A 4XD7D 1JAHA 2IUTA 2X8AA 4L9SA 1XEWX 5FR1A 1Q1EA 5A5GA 5JBQA 4U02A 3RWOA 1XEXA 2J7PD 2H17A 1RFLA 4TYQA 1N6OA 4N1AA 4TMTA 4I1UA 3PR1A 3Q5DA 4BEJA 4DUGD 5CITA 2UZIR 1CKEA 1EWRA 1JR3A 4DLZA 2V1UA 4JBWA 1TL7C 4E22A 1N3BA 4TTPA 2BJWA 2DPXA 1C4OA 2RGDA 4JL6A 1ZD1A 3ECCA 4MKHA 3UKDA 2HYIC 4JLPA 3QSYA 2QP4A 3BB3A 1AIPA 2GCPA 221PA 2OHFA 1QBKC 2FEMA 3TRFA 3A1UA 3QPVA 5DGXA 3D6TB 3PFIA 3IHLA 4Q03A 3FWYA 4GT1A 2IXFA 4Q1AA 3GJ0A 3QF4B 2PCLA 1GILA 1M7HA 1ZIPA 1Z0IA 2HCJB 2OFWA 1TNDA 1GOTA 3X1DA 2QA5A 3FKSA 4BLTA 4RSGA 2FEOA 2BC9A 1Z5ZA 2EQBA 2CBZA 2AD5A 3NBXX 1WBBA 1N6HA 2D4HA 1G41A 4DDUA 3QQ5A 3U7HB 1XCPA 1KMHB 3QKRB 4LPSA 4ON9A 4CIDA 3GLFB 1S1MA 2YC4C 3IIKA 2KWIA 2DR3A 1ESMA 4MKIA 1WF3A 4CYMA 4URZR 1ZNWA 1VECA 1TQ6A 2OT3B 1X1RA 4LHXA 2FU5C 1XD8A 3AGQA 2R6CA 5BN3A 3AKCA 3LY5A 4KBGA 1GNQA 4Q4JA 4RFSB 1JBKA 3QPUA 4MUBA 3BGWA 3K09A 3ICQB 1VCOA 3H2YA 3K70D 2J45A 3CRMA 4XTCS 3NXSA 4NH0A 1CJKC 4KFSA 1KI6B 1UDXA 4P32A 3C16C 1GRNA 2BMFA 1Z22A 3CRRA 1KYIA 1W4BA 3KJEA 3KUDA 4TMZA 1SKYB 4WA7A 1UBEA 2JDIA 5AUPB 1DELA 2XJ4A 2Z0MA 4YMWA 1ZU4A 4HZUB 1U90A 1J8MF 1XXHA 1Z8FA 2NO1A 2VSXA 4G0NA 4LJ7A 4Q4AB 3TMKA 4RY2A 3T5GA 1XTSA 1VG9B 2WVJA 4NE2A 4E09A 2EFHB 2QN6A 1A4RA 1DAHA 1YHNA 3T1OA 2B7BA 1MO6A 1SXJD 3O47A 2ONJA 4JS0A 3B9PA 1KI4A 1ONBA 2PEYA 3AGPA 3EZ9A 3KKNA 2DWQA 1GTVA 2FNAA 1AS2A 2V6JA 2DFKB 4ZCLA 2GWHA 5A4JA 1KSJA 4Q1CA 1ZNYA 1F2UA 3K9HA 1KSFX 2WWWA 3B60A 3IPXA 4HB2A 1XNJA 3AF3A 2Z83A 1YU9A 4Z1MA 2IHYA 2WKRA 2FA9A 1U8AA 1VPLA 2NMVA 4IDOA 5K8TA 2GF0A 1OFIA 1PV4A 3AP1A 3FHTA 1W36D 2Q3HA 2VPPA 5F98A 4ZI3A 2C9OA 3RYTC 3K0CA 4TZ6A 4HAUA 3DMNA 1JR3E 2VP0A 3SJBA 3CRQA 2OEPA 1PJRA 5F9FA 1RKBA 2WZQA 4O3MA 5EE3A 3X1WA 1JXOA 1TQ2A 1UEJA 1COWA 2OESA 1SVWA 3MCAA 1Z6AA 3FOZA 1E0JA 5JMTA 4EPXA 4DLUA 1SXJC 4TT3A 5H1YA 4HZUA 4Q4AA 1X1SA 5HR5A 3L43A 4J0QA 3AVVA 3KXIA 2R9VA 1XF9A 1CEEA 3I72A 5FOTA 3B1YA 2VF7A 4PXAA 2V9PA 1EFUA 3DL0A 5KSPA 3QVUA 3SHFA 3ICEA 4RVCA 1E79A 2VHQA 4PHFA 1CJMA 3Q8XB 4E5UA 2IYVA 5IDVA 1OKKA 1KZGB 3PG5A 3L8ZA 1E4VA 1K5GA 3LX5A 3IO5A 4FMDF 1Q3HA 2QT0A 4C7OA 1CF4A 1OKKD 2Z4RA 3L8YA 4Q66C 4CEIA 4OK5A 2P6UA 2OFOA 2WTUA 1G3RA 4N0DA 2PT7A 3BRWD 3CRW1 3GJ3A 4AYWA 621PA 3OHMA 1E9RA 2FFHA 4UXIA 1HT2E 3ZGXA 1D6JA 3NDBB 5CIQA 4XOIA 2F9MA 1OJLA 4BFZA 3PEYA 1QHXA 4OQLA 1TEVA 4OJKA 4IFBA 3K8YA 3NHBA 2W2TA 2BWJA 1P73A 2G1JA 4EPRA 3OEHD 4DDTA 1UEIA 1GIAA 5FOUA 4Y0AA 1BMFD 1F2TB 1U94A 1GL6A 1Q1BA 2JJ2D 1HEIA 2C77A 3PUYA 3MRSA 3QEJA 4K46A 4MYTA 3NEYA 4JL5A 4ZKEA 4HB3A 1FNMA 1S0UA 3EZ6A 1LV7A 4KYUA 1P9WA 1F48A 3SJAA 1UADA 3I62A 2P2LA 5CB6A 2UZ3A 1JI0A 1WE2A 5K8UA 2EU8A 1KJZA 3GD7A 3VAAA 4JSTA 1P2SA 2ZANA 4BRWA 3CM0A 4FI3C 4KVGA 4QOSA 1DAFA 1Q3TA 2Q9BA 3AVOA 3BFXA 2AK3A 5BXQC 3WNBA 1DAMA 2REXB 3SQXA 2NO6A 3BC1A 2NG1A 1Q22A 3B1WA 3TQFA 3EPKA 5HZHA 1ZNZA 3L2OB 1Z08A 2JCSA 2ZI4A 2Z4SA 5EUMA 2G0NA 5KDOA 5M04A 1Z2CA 5HE8A 4B47A 4PZLA 3CWQA 3KJHA 4PAMA 5A0FA 3ZVNA 1EK0A 4GP7A 3CRVA 2WJHA 4BEBA 5JHHB 2VQSA 4JVLA 3FFAA 1KSGA 2Q21A 2AKAB 3A4LA 3K9NA 1YZGA 1ZP6A 4RJLA 2QI9C 1FNNA 2UVQA 4AURA 4Q4LA 4D0LB 1EFHA 3SN6A 3N5CA 3OFNA 4R2IA 4OBEA 2YYZA 3WXMA 5FTJA 4ZDKA 3I8SA 1FL9A 1SZPA 2IYQA 4F4CA 3WMFA 4QGAA 1YZTA 1NSFA 3L0OA 1JXMA 2GZHA 2RAPA 3LNCA 2JIZD 4L5BA 2YVUA 1GNPA 2WAYA 2XXAA 3U4QA 5HE9A 3KL4A 4FIDA 4JJZA 3KZ1E 4QBHA 4KHZA 1Z6YA 2ZTSA 3GFTA 3GFOA 4IRUB 5EJEA 4A15A 2JJ1D 1P61B 3TE6A 1ZM4A 3ND8A 2GJAA 4Q9JA 2G83A 2QAGC 2I3BA 2Y8EA 1NF3A 4P4SB 4ERNA 4UQOA 4JSYA 5JEDA 1Q1ZA 4TMVA 2XEXA 3RC3A 521PA 4CEHA 2ERXA 4DCSA 2HCBA 2PEZA 4QM7A 2NZJA 3LD9A 3M4YA 5AJVB 2O0JA 4EDHA 6Q21A 2Q0HA 4TMWA 1NVUQ 5CDFA 4RKFA 3GLIE 4CGZA 5FBQB 2CCKA 1YZUA 2QQEA 3SNHA 1Z07A 1OYYA 1QRAA 1NLFA 4V0ME 1KO7A 1JJVA 4JLMA 1KI7A 4DVGA 3ADBA 3KFVA 4AI6A 2ATVA 2J7PA 4C0BA 4JVNA 3NC0C 1T4GA 4H1VA 4KO8A 4Q4HA 4MYCA 3THYA 2GXQA 1F2UB 1GRQA 1SVLA 4DUGA 2FPLA 2P5TB 1GG2A 1KKLA 2QEQA 3PIRA 2WMOB 4LV8B 4D4MA 4OI4A 2DFTA 1ZVQA 5TXGA 3UMRA 2DB3A 1U0HC 2HJVA 3BBPA 1CU1A 2FGJA 4AYXA 4D4KA 5JS7A 5KU1A 1Z6GA 2QMHA 4IXNA 2J7KA 2PZGA 3FMIA 1B23P 2ZRMA 3AV0B 4MGKR 5B30A 2Z43A 4D26A 2ZSBA 2ZJBA 2Q9CA 2IK8A 2QL6A 5JRZA 4IXMA 4RCZA 1U8ZA 5GJBA 1XEFA 5FBRB 4B6FA 1A2BA 4QGFA 4TLEA 2R6FA 1W7AA 1HV8A 2OCYC 4V0NA 4IEIA 3DMDA 1KTVA 3THWA 1CULC 4DIEA 2F1JA 1UPTA 3QXJA 2ZRLA 5BW8A 4M9ZA 3FDIA 3FFBA 2QE7A 4Q5IA 1M2OB 2WICA 2IF0A 3EIQA 2ZYTX 2BCJQ 2AN9A 2FE4A 2JLRA 4BFSA 2PL3A 2O0KA 1T3LA 4URYR 2Q3FA 3P27A 4G5SA 4XSHA 2VHUA 2ZRHA 4DLSA 2AXPA 4FD2A 5IHPA 3KQKA 2ANBA 3CO5A 3SE0A 4TSFA 2J5XA 1RYHA 1OF1A 2ZYUX 2O0HA 1GP2A 1U2RA 4NCIA 1U99A 1G8YA 5DIFA 1LW7A 1W4RA 3RAPR 2P0EA 1E99A 1U0LA 4NDZA 4C2TA 2GCOB 4K8OA 3TSZA 4EPWA 1A5TA 1IN5A 1WQ1R 2J0UB 2BMJA 1OIWA 5DLQC 5FPKA 1R0WA 3PJRA 2OBNA 2YWHA 3BH0A 4KAXA 3R20A 1F3OA 1IJEA 1P7CA 4TN1A 4EJSB 4M9SA 2KE5A 4JYCA 3SFVA 2KJQA 1IXSB 4ESVA 4PQYA 3C5HA 2FV8A 3LXXA 1CBUA 4KJZA 1QHGA 4PPFA 3UMFA 2RH5A 3TK1A 1ZCBA 1SXJE 5E7MA 4QG7A 4ILEA 2HDNB 1D2EA 1YR7A 1ZM9A 2MMCA 2H8KA 2W83A 5DHAA 2F1RA 3Q7PA 1Q57A 2GK6A 2AL7A 1QF9A 3GJ7A 3WMEA 2OAQ1 2NPFA 2QSYA 1RRPA 2A78A 3CW2A 4URWR 1JAIA 3N2EA 4Z1MD 1GKUB 4PC7A 5L3SB 1DAEA 3HR8A 4YONB 1OIXA 1OXTA 2G3YA 4IDQA 4LJ6A 5D3MB 5L3VA 1C9KA 5DN6D 2VBCA 2QQ0A 1FUUA 1E2GA 2OCAA 3RRYA 3GLHE 4TL8A 2ZI3A 4HYYA 5P21A 5FPYA 3FVQA 4ZO4A 2ZS8A 3ZH9B 1OH5A 1TTTA 4AKHA 1I4DD 1DAGA 4LPKA 2AK2A 2IBMA 3K0CC 5C2JB 1XPOA 1P3JA 4RD6A 2RGAA 1H8EA 5HCIA 2XB4A 3H84A 4MYUA 121PA 4FCWA 3T15A 4M1YA 1UF9A 4JLOA 2BJVA 1R5BA 3DHWC 1ZIOA 3IGFA 4BFWA 1P9RA 2NZ8A 2D62A 4NCKA 2VO1A 3R9WA 5CK4A 5KDLA 4BFVA 4TL6A 4DSNA 4NONA 1E79D 4PHHA 5G3ZA 3CWZA 1JQJC 1OFUX 4PANA 4C9BA 3K0EA 5AJXA 1LS1A 1M74A 2C96A 4YMSA 2QMUA 2IWHA 1Y63A 2OUKA 4HLQB 3P20A 3HP1A 1E9SA 2QGZA 4JLBA 4GDFA 1A2KC 3I73A 5CM8B 5IT5A 3VQTA 4JIMA 5EXXA 2O8BB 3QY0A 5KOYA 5EUQB 2WWHA 1ZUIA 2DCUA 2WJJA 3JZMA 1N25A 4YLGA 1G5RA 3GJ5A 4W9MC 3R7WA 1Y3AA 3ZJYA 4URUR 4Q18A 1GKIA 1E1QA 5FUYA 2P6RA 2R65A 3R9IA 1E2MA 1KKMA 1TAGA 2XJ9A 1AQYA 3LA6A 3EZ7A 2QZ4A 1R0YA 1KMHA 3QKRA 3B82A 1G18A 1UBCA 3CONA 1VTKA 2XNDD 3RDPA 3VU9B 3A6PC 2VL7A 3C14C 1I2MA 4M22A 2XNDA 3QG5A 3UATA 4PO1A 4OHWA 4LI0A 2FN4A 2IL1A 4W5JA 5H8WA 1KI3A 4JLAA 4DLVA 1G8PA 3C4JA 4OQXA 2RKOA 3HYTA 1XX6A 2GZDA 3QXHA 1DAIA 2FPKA 2PJRA 1D5CA 3LXRA 2REBA 1V43A 2G9NA 4EJSC 3CX7A 2C95A 1IJFA 3BIFA 2F55A 5GVSA 4LCBA 1Z3IX 2V54A 4PC1A 2DFNA 3GJ4A 3ND9A 3DZDA 4EQ6A 2Q9AA 2ZRAA 4S35A 4GOXA 1KK0A 4GRAA 4KFTA 1PZNA 2AFIE 3THXB 4PFSA 2X77A 4Q00A 4PO9A 5EP3A 4RZ2A 2G1KA 1GFIA 3E5HA 4A4DA 2BIFA 1SVOA 2XZPA 4YDHB 4CVNA 2VP5A 2QG6A 4PO8A 3WRXC 1GVNB 4M1KA 1CP2A 2XGJA 2IYTA 4A92A 2FMXA 1XZPA 2CE7A 4P31A 3ZZUA 3ADCA 4Q19A 3DOFA 4MRSA 1U9IC 1W46A 4KV9A 4LHYA 4KSBA 3SBDA 3U3MA 3U7EB 1OPXA 1W0KD 3UG6A 5FUXA 3GLHB 1SXJB 2PMKA 4G5QA 3NBYC 5FI0B 1Z6TA 1N6NA 2ZJOA 2ECKA 1VCIA 1P75A 2PMDA 3LW8A 1LFDB 3ETLA 2CK3A 2JLQA 4EIWA 4P0TA 4TL7A 4ARZB 1II9A 2ZUDA 4JVSB 1OW3B 2J0UA 2VHTA 1E9DA 2FF7A 3D31A 2IC5A 5L3SA 3U7GA 2Z6VA 4YQFA 2FG5A 3CZQA 3MWYW 1RRGA 4B33A 2FSHA 2BKEA 2ZRJA 3TVTA 3ZD6A 2WMNB 4EJSA 2FSFA 1XPUA 4P4SA 5DI3B 2V8OA 2WV9A 2LKDA 3AH8A 3JVUA 1YZKA 3MSXA 2ZYVX 4UKDA 2A5YB 5J4KA 3O8CA 4X8LA 1ZBDA 4QBFA 4DT1A 3KB1A 2WWFA 4C0HA 1N0UA 4BFYA 2UKDA 2H16A 4M2LA 1SGWA 4I1VA 3RS0A 2R2AA 4DHEA 2JLZA 2XOKD 1DAKA 1Q20A 4HDCA 2J9RA 5TB5A 3ZD7A 2RMKA 3IIJA 3PUWA 2VYFA 4V0MA 5DH9A 2N46A 3Q85A 4AIIA 4M9QA 1QVRA 4HB4A 2J46A 3K70B 3EXAA 2F1IA 3C8UA 1TF5A 1NVXQ 1KI6A 2QBYA 1Z0DA 4QL3A 2KB0A 3KJGA 2QY9A 4DJTA 2ZE8A 4KSCA 1XD9A 3X1ZA 1SKYE 1NI3A 2YOFA 3LVRE 4FN5A 5LB2A 3TGPA 2ODBA 4HI0E 2VF8A 3ZYCA 3IUYA 1LF5A 5AUOB 4NYJQ 1VHTA 4JL8A 2IX3A 1JEEA 2NO7A 2ZSDA 1EFRA 2VRWA 4BPBA 2AR7A 2D2FA 5JS8A 1BYIA 2GAAA 2JJ2A 1DEKA 4PZYA 3B85A 8OHMA 1E2NA 1XBTA 1XJQA 3V9PA 1D2MA 1OE0A 4LJ9A 5GJCA 1SQ5A 1W5SA 1AS0A 5KNDA 3MJHA 2BDTA 4KITB 2OG2A 1E2IA 3CIOA 4CT4B 3PEVA 1DE0A 4DBLC 4NCJA 3THWB 1YVDA 2O8DA 2RGGA 2V4ZA 2N42A 1U9IA 4QFMA 5C46F 1DBSA 1G8HA 4AK9A 3RC8A 2BEJA 4WBSA 2XTMA 4G3XA 4M53A 1OH6A 4AWXA 2RGCA 1HQYE 1EG7A 1LB1B 2OXRA 2GCNA 3UANA 5JRJA 3TSOA 4BZXA 4DLTA 2C78A 2BKUA 2FDCA 1A7JA 1NMXA 1T8TA 5J40A 3SJZA 2O8FA 2QBYB 1S9DA 1NIJA 1E0AA 3CBQA 3F8TA 3EPLA 2D74A 2D2EA 3AM1A 4ASUD 1X6VA 1S8FA 4MKFA 1H8HA 2F3RA 3IEUA 4RD0A 1E0KA 3P32A 1VKJA 1Z2AA 3EWAA 2KI5A 2OAP1 3W9YA 3IHWA 1R5NA 4ZDWA 4AD8A 1VG8A 2QTVB 4N0EA 1NP6A 3W6PA 4KI0A 4A6PA 3OAAD 2JEOA 2CLCX 5JWHA 4AYTA 1G7TA 4QGGA 1FTNA 1NN0A 1R4AA 4Y0VA 4TLCA 5EZ6B 1AKEA 1JPJA 2CNWD 1U98A 1ZYUA 1X8JA 2CDNA 1UM8A 2V6IA 3PUXA 1CRQA 1VYTA 2CCGA 2HF9A 3LBHA 4NHOA 3UIEA 3W3AA 5HKKD 2PCJA 2GBLC 4PHTA 3HU1A 3AF2A 4ESHA 1BYUA 1OLOA 5DN6A 1R6BX 1DADA 3FHOA 4CEHB 4QNMA 2RGBA 1E4YA 4XJXA 4BFUA 1JNYA 2ODEA 2XAUA 4CT5A 4FMBB 4RCYA 4TQUS 3LBIA 2FZLA 4HLUA 2GRJA 1H8ED 3TLXA 3U60B 1ZU5A 3UPUA 3GJ8A 4C0SA 2D7DA 3GEIA 1E2FA 3H4MA 4LV5B 2ZSEA 3ONWA 4M1MA 5CK5A 3W8RA 4EPTA 2AWOA 4TZ0A 1UFQA 4M21A 1NKTA 3NWJA 4IVQA 2R44A 1HA3A 4Q7LA 3BE4A 3C41J 3CH5A 3VR3A 1K5DA 1X3SA 1KO1A 3EZ2A 1AKYA 4BLPA 2IA5A 2P3SA 3RNLA 1KO5A 4V02A 1BOFA 1S9HA 2VA8A 1P2VA 5FUVA 4EPVA 1LTQA 4OQMA 1YZQA 5AK0A 3CF0A 5DO9A 3UWOA 3CR7A 3QOFA 3ZIAA 4RFSA 3QBTA 1E96A 1XZQA 4IVPA 2ONKA 4L4UA 1RVDA 2JASA 4PAQA 3DEFA 3QXXA 1RIFA 4O25A 4RZXA 1OHHA 4Q9HA 4RFVA 1HY3A 5TY0A 2ZIAA 3OZXA 1NG9A 4OK3A 3BJIC 4LBVA 4MDEA 3QKUA 4LWZA 1HURA 5EP4A 3GQBA 2B8TA 1G64A 2ORWA 4HUQA 2ZE5A 3Q3JB 4A0RA 3A1SA 4XIGS 2ZR9A 5JHGB 4HZIA 2ORIA 2GA8A 1MOZA 2OFXA 2W0SA 4UXHA 3UXMA 1IY2A 1MR3F 2FFQA 3NEJA 5LB4A 4DWJA 3ADKA 3W3ZB 5JFGA 5FOSA 3AVXA 1IY0A 5LDDC 4BFXA 3OEHA 3OESA 4A0FA 4NP6A 1BMFA 1EX7A 4KLZA 5KUTA 3U44B 5AWFC 3TAUA 4LDJA 1ZM3A 3R7WB 4OI0A 3VU9A 3U3OA 1KI8A 2ZR7A 4LHVA 4NL4H 3L82B 3B1VA 1GL7A 3IILA 3MG9A 1ZD9A 4HLDA 3WMGA 3KKOA 5EXSA 2A30A 1KI1A 2IT1A 2WJVA 2NIPA 1Z06A 2YJTD 3KXKA 5DSZA 4E07A 2IS2A 2ZM5A 3EIHA 2IEZA 4DLRA 5ELXA 2P65A 3QXCA 5CB8A 4Z8XA 5EE9A 5F9HA 1P4SA 1JALA 1A82A 1MV5A 4JLJA 2AD1A 2YOHA 1ZM2A 1XTRA 3U3RA 2BCGY 1P5ZB 2ORVA 4B3FX 2IW3A 5BN4A 2DWPA 2Q3MA 2BHRA 2PJZA 2QNRA 1XTQA 4OHYA 4Q9KA 1RJ9A 1O87A 3QF4A 1VIAA 3TH5A 4BZPA 4B2PA 1X8LA 4LBYA 2HXSA 3KKPA 1CJTC 2WKPA 4B34A 1G6HA 2R6DA 3HWSA 2YWEA 1E6CA 1KIMA 3FMOB 1IN4A 3LH5A 5AUNB 1OFTA 4IHQA 1IXRC 4A2QA 1TQ4A 4JVMA 2WPDA 2ZRKA 1E1RA 1LY1A 4B3CA 3GLHA 1YJ5A 1BO6A 1XJ0A 2CNWA 3P1JA 3T1QA 4ZI2A 4ZIRA 4PHGA 1KK1A 3H1TA 3WYGA 1XCMA 1E2QA 1IAQA 5KDDA 3K09C 3OFND 2QPTA 5FPTA 1XPRA 2YINC 3RSOA 1R8SA 3CF2A 2REOA 5KNBA 4HAXA 1MRNA 2ZRNA 4M1TA 4MA4A 3MAAC 4YXWD 3AP2A 3GEHA 2QUZA 4GBMA 3FB4A 3IQXA 1IM2A 1XTKA 3AP3A 2EW1A 1AK2A 2VP6A 3L0SA 1QHIA 4NZYA 3FE2A 2O8FB 3IQWA 4P4UA 2O8EA 4OKSA 2IF2A 3LVQE 4KFUA 1G4AE 4LBZA 3NC1C 4QC2A 5IK2D 1ZMXA 4LY6A 1COWD 1VDZA 3RS7A 2WHXA 2CLDX 1Q12A 2HLDD 3UG7A 4ZKDA 2VTKA 3P26A 4G5GA 1KAGA 1SVKA 4PC3A 4HEJA 2W2XA 2BV3A 3PV0A 4U7DA 3NH6A 4WXRA 5BN5A 2F9LA 4PQRA 1G7RA 2GF9A 1IN6A 3H0KA 1E69A 2IYRA 2RHDA 4M4SA 2CMKA 1OXUA 2JATA 4HAVA 4R71A 3W6NA 1RRCA 3GEEA 2ASEA 2F6RA 4AG5A 1CR4A 3A58B 3FKQA 3WBJA 3QEOA 3GLFE 1G20E 5J4HA 4PZZA 5FL7D 1CLUA 2PH1A 4A9AA 1OHHD 1G3QA 1G5TA 2NTYC 5B57C 5FL7A 2OXCA 4B3GA 1XMIA 3MWJA 2WKQA 4QHSA 1W1WA 3ASYA 1L8QA 4OL0A 5CJ2A 1HYQA 3K9GA 2R8RA 1FX0B 1DARA 4GMXA 3PITA 3KQNA 3B2EA 4BECA 3NKVA 1VG1A 2ZE7A 4FWTA 3HYRA 1MABA 3FTQA 1Z83A 1ZCAA 2A5DA 2QPOA 2RGEA 4AY2A 1Z63A 4FCVA 4RD3A 5JI2E 4HUQB 4GMDA 1XMSA 4HAZA 4XTRA 3IEVA 2HXYA 4L16A 2QAGB 2WOJA 3DO6A 1TU3A 4PPNA 3I4LA 2QRZA 3REFA 4I1OA 4WVFA 1NVVQ 1WP9A 3VKGA 1MO4A 2ZXUA 4E03A 2GESA 2F7SA 1Z29A 3T61A 3W5JA 5B2ZA 1QDEA 3QXSA 2ZE6A 1NN5A 3E2IA 2WWIA 2MSEB 3EA0A 3CX8A 2FGKA 1NG1A 5BYKA 5KPDA 1QVAA 4FMCB 3CH4B 3K70C 2VHCA 3AB3A 1RZ3A 1M8PA 1ELOA 3A4NA 3IIMA 3U44A 3VNVA 2QMEA 1W36C 3THOA 1II0A 4KU4A 2CHQA 1U81A 2EYUA 3KUCA 3OEEA 4LOAA 4Q9LA 4WXPA 3WYAA 4PPGA 1XTIA 4FWIB 4DZZA 3F0TA 1W5TA 4DLWA 2V3CC 3ZLJA 2ZETA 2JGNA 2QP9X 3IBGA 1OB5A 4TYNA 4NYIR 2OZEA 1G19A 1KDRA 2HJGA 2HUPA 4GZLA 1PUIA 4XWKA 2ZREA 1W48A 1MO3A 4BFTA 1DPFA 4QRHA 4ZCIA 5EXTA 1AZTA 1RYFA 3FYHA 1G8FA 2ZJZA 3WHLA 2W2VA 3TBKA 3TVDA 3PXGA 1N5KA 2BBOA 3EARA 1E2EA 2CHVA 2IXGA 2ZJYA 1XRJA 3B1XA 4D0NA 5HTKA 3SS8A 4DRZA 5JSZA 1W36B 1WCV1 3W6OA 3T35A 4BGDA 4MGIR 1NSTA 4IW3B 1C1YA 2VSOA 2C04A 3Q9LA 1EGAA 4I4LA 2QORA 2DYKA 4JKYA 2PX3A 3EC1A 2IUSA 3NHAA 2AHOA 2H57A 1NY6A 3LQQA 1N6IA 2D3WA 2F43A 2PLFA 4DXAA 1G16A 4TLBA 4MKGA 4D25A 3KB2A 4OQNA 4TTQA 2JLVA 2WOOA 2GK7A 3TW8B 3RRZA 1J99A 3TR5A 1J7KA 2IYXA 3DDCA 3WNDA 1SULA 1TU4A 3LLMA 2IWRA 2FOLA 1AA9A 4WIAA 5SZJA 1KK3A 4G1UC 5HCNA 4URXR 5CDFE 4C0LA 3QF7A 1GUAA 1W0JD 3Q5EA 4K81B 4Q7MB 4JBXA 4KODA 1D9XA 1VG0B 3VHXA 2XZOA 3V4RA 2W6JD 3U2QA 5E4FA 3KJIA 3LAWA 4A36A 2RCNA 3AKDA 5IF9A 3AF1A 1W44A 2ZEJA 3WP0A 2CEAA 3DZ8A 5EP1A 4WOPA 3G5UA 1QG2A 4IDHA 3EWSA 1YR9A 3KX2A 4GPTA 5CLLA 1G17A 1NBME 4D82A 3IPYA 1IN7A 4UNSA 1W2HA 1NVVR 3RWMB 1FP6A 1KO4A 2A9KA 1E9CA 1I4LD 1DOAA 5EE5B 2G6BA 2QM7A 5C4GB 2O5VA 1CR0A 1ANKA 2QP3A 3CPHA 1GITA 1SVIA 3IKJA 3NBZC 4ZDJA 4AC9A 3LV8A 2QROA 1EFCA 2OBMA 3A1TA 4QHTA 2ZRFA 1E0SA 3CUEF 2GEDA 3PQCA 3CNOA 4JT4A 1EESA 4TL9A 1R7RA 1TF7A 3RANA 1K8RA 2DFLA 3NG1A 1DVRA 4UNNA 1E1QD 2C99A 2A2ZA 3R8FA 1N6RA 4O0MA 2GHIA 1HT1E 3SBEA 2ZQ5A 3EX7C 2O8DB 3ZS9A 4TWZA 2BBTA 4AKGA 1CR2A 4B2IA 2IYLD 1HQCA 2ZS9A 4B43A 4GL2A 1ZC3A 3H86A 2EYQA 2JA1A 2AFHE 2K5UA 2GEUA 3C15C 1DG1G 3C7KA 1IHUA 2ZR0A 3VFDA 1E2HA 3TSWA 2IS1A 4P4TA 1NLYA 3ADDA 4XH9B 1DO0A 5TARA 4MRNA 4LYJA 4NTZA 2FWRA 1F2TA 3I32A 2IYYA 2BM0A 4NYIQ 3U7FB 3AVTA 3AVYA 3IBYA 2W0MA 4EPYA 2MMGA 2ZS7A 3I3SR 5JJLA 3DM9B 2NO0A 2O8BA 3BB1A 3AUXA 4XSGA 1OV4A 1U0JA 3EPJA 3WHKA 3DPUA 1ETUA 2ODWA 3MWLA 4MRVA 2HT6A 2O8CA 3CNNA 4QJ4A 3QUSA 4V0OA 1Z0JA 3BORA 4DCUA 3CKLA 2EWVA 1UKVY 4UXJA 4V03A 4IDPA 4FMDB 5L3QA 1FOEB 4A2WA 4Z54A 2NOAA 4MDFA 5JLJA 1NN1A 5FOXA 1TEXA 4Q9IA 1FZQA 3QKTA 4A8JA 2C9YA 3ZVLA 3K0FA 3LQRA 3U61B 4GZMA 2QTHA 3K53A 4RD1A 1US8B 2GILA 3SEAA 4DEXA 2LWIA 4KFRA 1ZW6A 4XWOA 4TQAA 5L8VA 2JIZA 5TMPA 2FZ4A 5FTNA 2YHSA 5GJWC 1TQDA 1CJVC 5IK2A 1W2GA 2HEIA 4AG6A 1NL3A 1VYUA 2FSIA 4US1R 1FUKA 1G3UA 3HPRA 4MRPA 1XTJA 2ZSFA 1Q1QA 2B21A 4F4IA 3EC2A 3EIEA 1KNQA 4TT3D 1W0JA 2IS4A 4Q1FA 5CYOA 2H92A 1G21E 3TQCA 5SZHB 4ZV4A 2GKSA 4UNRA 2C8VA 4DSTA 4GOKA 4PQFA 1G3MA 2IUUA 4NPHA 3PCRB 3KTAB 2CLSA 3IO3A 4YMUA 1CXZA 5LD2C 4X8HA 2BMDA 3W90A 2BVNA 5SZIA 3K0FB 2V7QD 2F3TA 3DOEA 4OHZA 4DSOA 5EQTA 5J4LA 1R10A 4OI1A 2W6IA 3T34A 5K8LA 1FQKA 2ZJ8A 1AS3A 1KK2A 2WM9B 2JLXA 2VHJA 4B73A 1JR3D 1NRJB 4F38A 3T06B 1U8YA 1R8QA 2W6ID 2FX3A 2ZSAA 2W58A 5JJKA 3CB4A 1E32A 4IOJA 1E2DA 1BKDR 1XJCA 2GEVA 4IOLA 4QXAA 4NYMQ 4DCNA 2IEYA 4LUCA 4D81A 3VX4A 4WZ6A 2OCBA 5JJIA 3VTKA 1I2DA 1KDPA 1N5JA 3UK6A 4A1FA 4QM6A 3THYB 4Q1EA 3SQWA 1JECA 2WIBA 3PEUA 3NIBA 3EZFA 4N3NA 3U6BA 1AJEA 5KHOC 4BLRA 4ACBA 3QKSB 2GJ9A 1XEWY 2E87A 5FH9A 1KI9A 1PLKA 2EFGA 1M1YE 4JT2A 1EFTA 3B5JA 2YKGA 2DWOA 5K8IA 4EUNA 4HAYA 1XDBA 1T5IA 2ZYWX 3TJZA 2VSFA 4YMVA 1MABB 1RRFA 5AJYA 4GFDA 4PSVA 4US0R 1FP7A 1TPZA 4GP6A 4I99A 3SC3A 3W5IA 5JEEA 5JCPA 1J90A 4RZUA 4B3DA 1JEDA 4M1WA 4U5XA 5C18A 3AF4A 3MGCA 4G01B 4P33A 5KYKA 3LFUA 1KMQA 3PUVA 1KY2A 1GSIA 3AVWA 1DO2A 1TMKA 2ZRIA 2YV5A 2ANCA 2VLIA 4CF7A 4DSUA 4ZPXA 3BH6A 3S1AB 3O8DA 4MYHA 4URVR 1B0UA 3TNFA 3R9XA 4LBWA 2HT1A 5AJZA 2C2HA 1QHSA 5HPYB 821PA 1RPZA 3SYNA 4DDVA 1AZSC 1E9FA 1XEXB 2OM2A 4ABYA 2B92A 1LF0A 2GJKA 1TX4B 4YC7A 5FPHA 1F60A 1VMAA 3M0EA 3ZDQA 2JLYA 1HE8B 2J0VA 3MMPA 3NTUA 3R8CA 3MFYA 1GRRA 2DY1A 1JJ7A 1WDTA 4Q01A 4R98A 3CNLA 4DLYA 3GLIB 5CM9C 3BAFA 2YWFA 2ZUCA 2HV8A 4L15A 4EFNA 4DDWA 1CR1A 4F93B 3JVVA 3VHLB 2I1QA 2PZEA 1KNXA 1W0KA 3AKEA 1M6NA 5GJVC 4LJYA 2GJ8A 4DB2A 3ZQ6A 1G3IA 1P9NA 2GXSA 2P6NA 4OYHA 1US8A 1QZXA 3NVAA 2WWGA 3TW4A 1OXXK 1GWNA 2CK3D 4WZAE 3REGA 3S1AA 3WRYC 2FSGA 2GJSA 1IBRA 3BS4A 1J8YF 2N1BA 4HDQB 4Q4JB 5JSZB 2ZRBA 2W6JA 3GMTA 4M9XA 2GDJA 2G88A 4Q48A 3RS2A 2ZRCA 3HJNA 1YZNA 3WBKA 3UMSA 1T6NA 5E95A 4BWYA 4CW7A 1N0WA 3RLFA 1N2CE 2BBSA
chains in the Genus database with same CATH superfamily
3C5CA 5A9TA 2HSEA 2HNKA 1NUPA 1W85A 3M49A 1IG0A 4I6EA 1NLMA 4EHBA 5K3FA 4Y2UA 2J0QA 3NGLA 1M1NA 3M3DA 3UXEA 1XWIA 1NKSA 3RBVA 3RVJA 4CUJA 3WL3A 4L27A 5TDHA 2OSBA 5E1BA 4KQFA 3TCNA 1UMDB 1UPUA 4LJAA 1GPBA 3MCUA 1DBRA 4IDNA 3BTOA 4ZANA 1U65A 4NS1A 3W34A 1F2VA 1G5QA 4B6EA 4EG1A 1J4AA 3TLYA 1ZN7A 1TW3A 4B6JA 4D9MA 2FH5B 4B76A 1N9KA 3EFEA 4D3YA 4ZK2A 1P45A 4X24A 2ET6A 4JP5A 1XYGA 3QV1A 1YE3A 1F8UA 2OG1A 2G4CA 3T5AA 4ZRMA 2G08A 3WGNA 4D9HA 2WWYA 1N8TA 4XVQA 5ALSA 3DVAA 3LGXA 3O2SB 5JOQA 2ETXA 1S2MA 3O84A 4C3OB 3VJKA 3QYFA 2XGOA 5KYXB 4PNEA 4POOA 2PX2A 1E2BA 3LX8A 1ZK2A 1EFRD 5JARA 2Z9DA 2Z2JA 5AHXA 1QQ5A 5HF9A 3WFZA 1MKYA 2IY7A 1EGMB 1M34E 2VK2A 4KXXA 4TTRA 4A2CA 4Q3OA 2J0SA 3E7DA 3ICOA 4H59A 5LZ7A 1L5SA 4B5LA 5CT9A 1CFZA 5I7FA 4O2RA 4LOKA 4WOKA 4D8VA 3WLQA 2ODNA 3PL5A 3BD6A 2G72A 3SF8B 3S0JA 1D9ZA 1XFAA 1ZX1A 3HVUA 2Q3EA 2O52A 3RKUA 5FAKA 3LMKA 4RCVA 3LX4A 3GJRA 4Q7JB 2SNIE 2XEDA 5EP4A 5EWMB 4LY0A 3KTOA 3BZBA 4U0KA 1VIYA 3RUAA 5BWOA 4MPJA 3LECA 2B36A 3AEZA 1CS4C 5ALGA 3DFUA 3O83A 5FJIA 5G3YA 4BPRA 3WAGA 2LGJA 1Y37A 1QQTA 3UJHA 4B7UA 2FFAA 4POAA 4IQFA 3LO5A 1JDJA 4DR7B 1NV9A 4FBLA 3T12A 5IRCD 1TF2A 1Q44A 2LCFA 3NHRA 3QX8A 4JEMA 3DV0B 2HSWA 2H9YA 3OT4A 4LXTA 4AJOA 2BEVB 1ISSA 2EARA 3VPBA 1ABEA 4LNUA 4EH1A 1OLUA 1U3TA 2GNPA 1SHKA 1EJ2A 5CM2Z 2OLKA 4HDAA 1HL7A 2FG7C 4IIFA 2ZITA 4MRRA 3T3EA 4L02A 4RJKA 1VSUA 2HPZA 2W6QA 5BVHB 3K92A 4MUGA 4DE5A 5F64A 2Q1YA 5ALPA 3T1TA 1GL3A 1R4MA 2CV0A 2QGNA 3UNXA 4DA8A 1W6RA 3PYLA 1ODSA 3HCAA 2AOUA 5EAIA 4BDTA 4I5FA 4NESA 3TTWA 1KI2A 4OHVA 4WOJA 3K1AA 1YQXA 5I3ZA 2FG6C 3IE1A 2ZIEA 4BVBA 1D8TA 4J0KA 2PH3A 5ED4A 3N2IA 4S04A 4TKZA 4CKYA 5JBNA 1BFKA 1NLZA 2DH5A 4PZAA 2OFFA 4TT8A 3KV1A 4BCDA 4C7OB 4LV6A 4EO7A 1YF3A 2NXEA 1L4UA 2ATIA 2ZZMA 3PX3A 3WB1A 1EX9A 1YNSA 1G66A 2HIAA 3F8WA 1V8DA 3GB9A 3HJHA 3K0AA 4TYMA 1KH3A 3UQZA 4E2WA 4A8JB 3M6MD 3T5MA 2JLBA 1P19A 2AQ8A 1I5RA 4B32A 1YJAA 4FT2A 4AT1A 1Y0BA 3EEYA 5A7GA 3D5TA 5JWOA 4D1YA 2QD1A 2R00A 3V4VB 3SXJA 3FAKA 4OGFA 1O5TA 1NW3A 1NVEA 3FHLA 2FPPB 1SHLA 3ZGYA 5JC8A 3O4VA 5JE8A 3P0IA 4DAEA 3ACCA 4A8JC 3BTVA 2G82A 1FMJA 3OIWA 1G20A 1RQGA 3OIYA 1N5DA 2VDLB 4X9XA 4XUCA 4PG7A 4RESA 4UTRA 4AVYA 5A5VA 4R5HA 3C24A 2BFBA 2BLLA 2DLDA 3P4YA 1BSVA 5J4YA 4Y30A 4KR7A 2GVZC 1DDIA 1PS8A 3EA4A 4EMSA 4F4FA 3RUHA 5EJ5A 2YV4A 5LIRA 3QLTA 3AC0A 4M1OA 3QKWA 1VMKA 4H7DA 3GLIA 4QJ3A 1G55A 2VPQA 1TCVA 1RE0A 4LJ8A 4E4TA 2NVBA 2P9ZA 4S24A 4CMEA 3R6LA 4I4IA 2EFEB 4U7DA 2XVMA 3RAEC 4D6PA 5CFZA 4RZ3A 1HLPA 2G63A 3X1MA 2VJLA 2AZTA 2VJYA 3MOSA 2Z8YA 4X45A 4PAOA 5MDHA 2DBVO 2Z4TA 3BTSA 4P93A 3TD9A 2PSSA 3FKJA 4KUGA 4EEZA 3AESA 3AQIA 4YRDA 3RRXA 3DDSA 1PKEA 2FPIA 4HSEA 3WBFA 2XX3A 2JEZA 4DCCA 2PD6A 3PQEA 4RK1A 3AF0A 1GGVA 1NYLA 2BHSA 3ABQB 4QUEA 4Q34A 4R8KA 1U3DA 1KY3A 4PCVA 4CM5A 2OD2A 4EGQA 3KALA 2WHPB 2YASA 1W4AA 4KUHA 2AJTA 4RHXA 3SSMA 5FOWA 4D3XA 1VB5A 3ZU6A 1K98A 4LXQA 1V1RB 4DMMA 1YJQA 1T36B 3I92A 4C4AA 1I0ZA 3RFTA 1R0XA 3BIWA 2P41A 3IR6A 3OTQA 5AW6A 4K5QA 1LX7A 5KYGA 4K9RA 4KIGA 1T9HA 2QXYA 2WMYA 1OH8A 2OO5C 2AC2A 4QRIA 3ULKA 3X1XA 5M5BA 1QYRA 3E5RA 5H3LA 4LZJA 3W1VA 4ZVTA 1F8YA 4DLNA 5TQ2B 5ANRB 5HGJA 4DQLA 3TNYA 4OLBA 2TECE 5I9TA 4R1OA 3STYA 5GVRA 1VFNA 2E49A 2P0AA 4XQ9A 1QIDA 5B3AA 4AZSA 1O97D 3HB7A 4PC6A 2JK0A 3EPPA 6REQA 2I6TA 2RG7A 3DKPA 1ZI8A 1VE6A 1R00A 2ZPTX 4XWAA 4YAWA 1DS6A 5EMLA 4AB1A 3ZJUA 1E8NA 4MO2A 3PQ4A 5HMLA 4K9MA 4Q4HB 3RT9A 4EUKA 2B4AA 4PHCA 5D51S 4V0RA 1Z28A 5H70A 2R1TB 5D86A 2QJFA 4LGMA 1NF2A 3LY8A 5H9WA 1NXXA 5EUCA 5FWNA 5H16A 5TSDA 1PLLA 4JDUA 4BO6A 1AQIA 3WNZA 4BKMA 2HHLA 3E1SA 1VLMA 4PN3A 5J2UF 3BZUA 2CLOB 1RW4A 3DL2A 4LXGA 2AMYA 1PLJA 1Y3BE 4OHUA 1MH1A 1X94A 5K3SA 5BYJA 3T1VA 2PH5A 2DJIA 4MI3A 3IVGA 2HF8A 3BSYA 4B2LA 4IOMA 1VYVA 2GOYA 2CCJA 4WW0A 4HDSB 1RR6A 3M5WA 2FHPA 2B8JA 5E3HA 3SD7A 5LCXA 3GBVA 2O6HA 3ZCTA 4RNDB 4A8TA 2AEJA 1KS2A 1ZOSA 5IUJC 2Y99A 4RHCA 3PA8A 2MIIA 1PEAA 2CXNA 4Q3NA 3HDQA 1N0VC 3HFRA 2MR5A 1VJRA 1F12A 2QM8A 4HWSA 4RWEA 1X2BA 4W8HA 5FX2A 4MWSA 2PUDA 4B3TB 2JLWA 3T5PA 1SHZA 3QP9A 2DRIA 3C3YA 2I4MA 4HQNA 1UBHS 4CFYA 1TVEA 4KBFA 1H6AA 1CIJA 1G8GA 5JXGA 2HZBA 3O2NA 3P2KA 3HY6A 4YXWA 3TECE 1J1IA 3GJ6A 1FQJA 2VNKA 5E7IA 1XCLA 2GN2A 1R16A 1LDYA 1R4MB 2Q49A 5K0BA 2V7XA 4EABA 2FZEA 3FYUC 5I45A 4JMPA 3DBHB 1QHHB 3CF6R 4GPAA 4M0DA 4U9UA 1ZN2A 4IF4A 1I2CA 1O4VA 1A04A 4C4OA 2WF6A 2YWCA 1JR6A 1Z0AA 2B6HA 4C08A 1U6KA 3TTVA 1BCRA 3VU1A 2BRUA 5BRAA 5AW1A 2I2BA 3IA2A 4ARCA 3AETA 5FBVB 2C4UA 4OHRA 3I6MA 1G5PA 4QO8A 5E6RA 1ZMBA 4B3RB 1LBIA 2PXXA 3HA3A 2R96A 2FP4B 2J41A 1ZVMA 4Q02A 4TVBA 2DHCA 3KL2A 4XW2A 3PUZA 1NJ8A 4NXNB 3PD0A 3MLEA 1WB9A 4IEFB 3EHEA 1VHQA 1UODA 5EHGA 2CBXA 2HC9A 2DQSA 3LCRA 2MSCB 3K7EA 3UFXA 4Z4IA 4K0KB 2CL7X 4O2AA 3G2HA 2FJ0A 4ZYZA 1F1JA 4JBGA 3KWLA 1BD4A 3FPHA 1T9ZA 5IW8A 1AQJA 2BFWA 1AUOA 2CL0X 1FNSA 1H94A 4D9NA 1EQ2A 3VH1A 2VDQB 4G81A 2XPCA 1TMYA 4D4JA 1SEVA 3FOFC 2IHBA 5DHFA 4QQ8A 3ZGOA 2VUHB 4IIYA 3ED1A 2PKQO 2DQZA 1ORVA 4AKEA 4Z9FA 5K03A 1QU3A 1KDTA 2L69A 2O8CB 4AMVA 3FDJA 2GPTA 4NU0A 1OGJA 3ZWPA 4MUYA 2B2XA 4BJHB 2EKDA 1GU0A 2QSZA 1ZC4A 4NJEA 1T3HA 3B7WA 1UKYA 4PE5B 1NUHA 4C6SA 2V7WA 5T3YA 4D80A 5JZVA 1SJ9A 3E5NA 1CERA 1KZ7B 3JX9A 4ZYVA 1IXKA 2DQ4A 4FCTA 5DK6A 3DH0A 3KFXA 1YE8A 4GVPA 3DQZA 4L8WB 4PRLA 4TYWA 4FC6A 4JB8A 4XWYA 1TUIA 2NXJA 5AP9A 2GZRA 1ZEMA 3CPEA 3LUGA 5CA1A 5L7TA 4QYIB 3QFFA 1E2JA 1GZ3A 4GPZA 3TWOA 3CKMA 4KYTA 3DE0X 3A1CA 3SQLA 1EUDB 5FTKA 3ILVA 2ZT8A 4JB3A 3TSAA 4AJ2A 5JNWA 4BASA 1M2EA 4TWBA 3H3FA 3IEXA 4US2R 2ZUBA 3ZPXA 5CA0F 2CVZA 2OA0A 3D5QA 5FADA 3U37A 1T0JB 4AXBA 1TJYA 1ZUWA 2QPAA 3FROA 1WVIA 4KQKA 2W9XA 3DLTA 3EG5A 3FCAA 5JJBA 1P8AA 1USUA 3KJNA 4RJJA 4JC8A 4B35A 1KDZA 3SC6A 2V1XA 1R6DA 3ZVMA 1VLVA 4KE6A 2OZVA 4BO7A 2UYCA 1HX7A 4G56A 3FF1A 1XXHE 3O1IC 1NRIA 4EY7A 3DV2A 4C7VA 2DHRA 4QDOA 1Y1RA 2FW0A 3MT0A 2Q0QA 4S3MA 2FMHA 2NU7A 3OKCA 3R3VA 4QTZA 1V2GA 2I9PA 2XITA 2Y3IA 5KU7A 1MCZA 2VDNB 1J24A 3GFPA 3WO0A 1GZ4A 4LJKA 3WP1B 2P77A 3HFGA 4QBTA 1ENOA 1LRLA 2WSSA 2WVAA 1A76A 2I7TA 4MWTA 2R6AA 4J0JA 2RBKA 4X94A 2GNOA 4HQFA 721PA 1FJXA 1UPFA 2PS3A 1AUXA 1Q0LA 1UJ4A 4CM4B 1GDDA 1OAAA 1JH8A 2HX1A 3RTCA 3UENA 3ZNOA 3GT0A 1OSNA 3OX2A 4YCNA 4O4JA 1RKXA 8MHTA 1UM9B 3AM5A 4EW6A 4IBOA 4BNKA 1FNDA 4CTKA 1J7JA 8ADHA 3BDAA 4BO1A 1EH5A 3HEAA 4HQ0A 2TSYB 4RK7A 4R16A 1WOYA 2EFDB 1YQDA 2X2EA 4QODA 5LP6B 5CT6A 5FWYA 1E0DA 3NJ4A 2C03A 4IIJB 4BNDB 2ENUA 3NHJA 4E12A 2O6LA 1B73A 3FMFA 4U7HA 3BERA 4XDHA 4DRZA 4PYOA 2NXNA 1O8CA 3UN1A 3KQYA 3SZMA 2X6QA 1E1LA 3WA7A 1LBTA 3CEJA 4A8HA 1CD5A 1C8LA 2A58A 4DIEA 2IYSA 5B1DA 2G76A 2QMYA 2WA1A 3HACA 3V2HA 3JAKB 2XE4A 1UQRA 1N7JA 3GF4A 3UOAB 4OMFG 3DPIA 2I6GA 3TRJA 4CF6A 1RYEA 2ZAOA 3QE0A 4F4JA 2CL6X 3F3SA 4K9QA 4YJGB 3SHOA 1F6BA 5SZKB 1RWVA 4JCCA 4OA5A 1PUJA 3O94A 4JBIA 2VIIA 2BP7A 4OL9A 1CEYA 5TLSA 2VP2A 2YZNA 2IYUA 3EDMA 4S2EA 3WB2A 3ECAA 1K7CA 3PHLA 1Z4PX 2HF2A 4GMFA 3RS4A 4NKRA 5IT4A 3U3JA 3PHIA 2L0XA 4A6XA 1F7UA 1T5LA 2P5SA 3X1KA 2AVDA 1GU1A 1LNZA 2B1IA 1A4UA 2DECA 3FIJA 3LDAA 3OOWA 5EHNA 3SOPA 1DAOA 3WGGA 2Q07A 2I4IA 5CXQA 1R5JA 4LHZA 4O4IB 2GTIA 2EIHA 3SEZA 4JXZA 2GKGA 4O6VA 3CC8A 4OM7A 3L41A 2B4TO 2WJ4A 5KOJA 3DM5A 3DOHA 4XZ3A 3N7UA 3VC3A 4LF9B 3KHSA 4CL8A 5SY4A 4C0KA 2EVWX 3H8VA 2CVOA 2E82A 2FW6A 4KC0A 4PBRA 1KBQA 4HTFA 5T3UA 3WG9A 4IDBA 1K2WA 4CHTA 1V2HE 2HYDA 4PSKA 1R9MA 3BMQA 4NFYA 4Q1DA 4XAQA 4WK6A 3QUBA 3NDJA 4M8LA 3TOCA 3BOSA 4C0JA 3H83A 3GNLA 5A2GA 3NOXA 1PR3A 1VCNA 2X19A 2Q6TA 1GNRA 1N0HA 2WE7A 1F8FA 3M2PA 2QL5A 3AJDA 3EXHA 3M5CA 4IJWA 2Z2ZA 1U5BB 1PWEA 1N34B 1YGPA 4IJUA 2J87A 1UC8A 4UTVA 3SXUA 1SUIA 1DNPA 3IODA 2EZTA 2ZRQA 3PWSA 1P1HA 1RKQA 3VX3A 4AKIA 3RYCB 3QTBA 4JJKA 4L0QA 2BD0A 1UKZA 2H1FA 3OIFA 5EPUA 4CIVA 2B2NA 2JGFA 5ILOA 1HNXB 1DXYA 1J39A 4L0CA 4L85A 3AKYA 3PFCA 1H1TA 1K0FA 3M4NA 3FBTA 4WFQA 5H83A 3BHIA 3HRHA 4DYVA 5FLXA 3OEWA 4NDAA 1PI3A 3JQGA 4ZHSA 3PFBA 1M1UA 3GRFA 2Q99A 3N2NA 1OGYA 2C83A 1FS4A 5D2CA 3ZK9A 4EG8A 4B46A 2E7ZA 2IPAB 2Y0CA 1TUEA 5FI1B 1A1VA 4GSLA 5I7VA 1JQ5A 4GXNA 4CQMD 6YASA 3W8NA 3LUAA 1UJ6A 2OILA 3DJFA 3BD9A 2I99A 3Q1KA 3K1JA 2VOEA 3O75A 1GQOA 3HLTA 3GJXC 1LRKA 1VSQA 3KBOA 2GFHA 2VZEA 3O9MA 3B38A 1TADA 2C92A 4JYPA 4PZUA 4X6XA 3QA9A 4TUYA 5B2EA 4O0LA 1U3VA 2J31A 5G4LA 4YDSA 3I28A 3ZQJA 2PUEA 4BRUA 1N33B 4BQIA 1JA9A 2CJWA 3KYCB 4TLAA 1SBZA 1RT9A 3GP5A 2FFBA 3OM0A 4RMIA 4AKSA 4TVSA 5JQGA 3KKZA 3OHSX 3QVVA 4XIJA 1P7PA 5KWEA 1TOAA 2ZZKA 3FZGA 1Z2DA 3HU2A 4FWBA 4RPJA 1ZM7A 3ME5A 1E63A 2X4GA 3HKDB 4MVJP 2PR2A 2OP1A 3PGA1 5LBIA 5KEIA 4LYFA 1VL8A 2IHZA 2LIPA 2PLWA 2BMEA 2YIDA 4YCSA 8GPBA 4H0FA 5E4JA 1LBSA 1F20A 1JWBB 2YJ4A 2QVZX 4MMZB 3ITNA 4MW6A 1IHXA 1P5HA 2WF8A 3EXEB 1IRIA 2ZYRA 3N6VA 4UJ5A 5E2IA 1GTRA 4LF4B 1Z0KA 5DI3A 4DLKA 4IRMA 3OAAA 4I55B 2XUIA 1U1DA 1JAXA 2NM0A 4IZIA 1KEZA 3LRXA 3MLBA 5EE1A 2GN6A 2DQKA 1WMSA 1B0ZA 1M73E 4RK5A 4PGHA 1N4AA 3VGPA 4QNNA 3G1TA 4MV0A 1NP3A 1YRYE 3CCBA 3EOBI 4GAEA 3WZMA 5I7OA 2C9ZA 2NQ2C 3BVPA 4XQGA 5CVVA 2CNOA 3CGGA 3WK5A 4OY3A 4FONA 1WHSA 3VDXA 1J2TA 5C51B 1S3GA 1SY7A 3VNSA 3HVHA 3W05A 2IXEA 4DRXB 4JJAA 4YRTA 3AQ4A 1ZRHA 4JI7B 2GZAA 2JJ1A 3RV3A 4CCWA 1P60A 3IAS1 2BEUA 4YREA 1LGYA 4D4LA 2A7QA 3BGSA 3LYLA 5AMXA 2PT5A 2H9AA 4GM4A 2R62A 1ZD5A 4HLCA 2VBGA 4KYIB 5DCYA 4PG8A 5LP6A 1UP7A 1UBGA 1UR5A 5AQ1A 1FRVA 3G2IA 3PWTA 1JDBB 2EZUA 2QAIA 1Q6ZA 4G5OA 4KCGA 3ZU3A 2ENWA 1L4HA 1YONA 3KIPA 1CRPA 1R0ZA 3KOMA 3WB9A 2H18A 2XMGA 2H4FA 2VTBB 4YQZA 1JAHA 2X8LA 5K8JB 2CUTA 1UBLS 1JPUA 1XEWX 2X8AA 1YB4A 1VRCA 4HSGA 4L9SA 4BVGA 3OZFA 1LI7A 3RWOA 5K0SA 1RJWA 1JEOA 2H17A 1ZWLA 2P9BA 1ZGBA 3K1YA 1RFLA 1N6OA 3ZDFA 1SUCA 3CF4G 4X6LA 3AI7A 3EVCA 4E30A 4XQEA 1NYTA 3PR1A 4ZMSA 3GQVA 5A4DA 2B5OA 1GLNA 3Q5DA 5CVUA 1X7ZB 4CMEC 4CJXA 5CITA 7MHTA 5AVTA 3ZCRA 1OTYA 3R3YA 1N3BA 2BJWA 2DPXA 1C4OA 4JL6A 1EB8A 2AN5A 4MKHA 4QDZA 1DKOA 3WLNA 2HYIC 2ACWA 3WJ7A 1K0UA 3QSYA 2QP4A 1KWGA 1AIPA 2FEMA 4RY9A 1DPGA 2F3UA 1SB9A 3TRFA 3ZHTA 5DGXA 4QRDA 4YS6A 5TEVA 4Q03A 2R97A 5GINE 4KAJA 5JU6A 3NRCA 2YVLA 5CEJA 3FN4A 4Q1AA 2I4RA 3A70A 4CMAA 4U5QA 2A0WA 2HCJB 2WHRA 4O4LA 1M5RA 3L0ZA 4WLEA 1WDMA 2N0SA 3LLSA 3S2SA 3SCZA 3FKSA 1J8DA 3DKKA 3PLRA 4RSGA 2BC9A 4ML3A 4A6DA 4E7OA 3LPDA 1QX3A 1EVYA 1ZXXA 2EQBA 3PNPA 1PJAA 3BMCB 4R1LA 5ICSA 4ZA2A 4GKKB 1T8RA 1RHKA 3G0BA 3UWMA 3ZDRA 3QQ5A 4DDUA 3U7HB 3JZFA 4FEAA 1KMHB 1EBUA 1TLLA 3OOHA 4ON9A 4GRDA 1RM5A 3GY0A 4MV6A 3TW6A 4UMVA 4UASA 4CYMA 3IAEA 4ENTA 5EMHA 1DQYA 4AWAA 3EN0A 1VECA 2VC2B 3O38A 1X1RA 2INGX 4ZQGA 2ONYA 5C37A 3UF0A 4LHXA 3WDMA 2FU5C 4HNAB 4MDHA 1CX9B 1H3FA 2P4HX 3FWZA 3LY5A 4RFSB 1T8YA 1ZGZA 1EK6A 2Y76A 3NHUA 3G9XA 2FZWA 3QPUA 3K09A 4MINA 2WTMA 2QW0X 2WYWA 3FBGA 3FRHA 4I3FA 4XD2A 2Y93A 3MRXA 4ATNA 4XTCS 4NH0A 1CJKC 2PWPA 1KI6B 2PWZA 4KFSA 4O3FA 4P32A 5IJAA 2OYCA 1GRNA 2BMFA 4TMZA 1W4BA 3KJEA 5DRYA 5AUPB 1SKYB 1SZJG 1UBEA 4NULA 1C7JA 1JLKA 3FPSA 2VT6A 4GICA 4P36A 1O95A 4Q4AB 1K8QA 3DUWA 4WWHA 1R0SA 1DKQA 1I30A 5AM2A 3WMRA 3BUSA 4EG6A 3IEKA 5EL0A 3R77A 4P38A 3PRYA 2XTJA 1XTSA 2J0EA 3T5GA 2CJFA 1TMOA 1WS6A 2OMKA 3EODA 3C0KA 1TK2A 4GBJA 2IPOA 1ZOIA 2ONJA 2PEYA 4V1CA 3LHKA 3HYCA 4URFA 2FNAA 4X95A 3DKIA 2WQ6A 1MX1A 2C5EA 5A4JA 3AR7A 3GCXA 3U4DA 1KSFX 4IV8A 3H1PA 4L5CA 4RFLA 1TVMA 1WXDA 4QOGA 1KGSA 4MKXA 1XNJA 1CDEA 4DC1A 3KD3A 2GWRA 3VVLA 2WKRA 3DOJA 4TMFA 2EDCA 3NWEA 2NMVA 1BG6A 5KOHA 2GF0A 2FW1A 3GDHA 3L6EA 3PNLA 2BT4A 4QYSA 3W4JA 2C2OA 4OO3A 3L1JA 4KVFA 4M87A 4MICA 1XZDA 1JEQA 2WT4A 5A6SB 1T6ZA 1WHSB 4OQPA 4F1KA 3EXHC 4HAUA 2EWMA 3E6AA 2LPMA 3ESDA 3B51X 4C4RA 3BMXA 1YKFA 3CRQA 4HEA1 4FVTA 1TYBE 1LKZA 1DRUA 3KZNA 5EE3A 3G9UA 3JAKA 2ZUUA 1UEJA 3AONB 2R11A 1COWA 3A4VA 1SVWA 4PINA 5J59A 3IR7A 2XA2A 4LXUA 3P9RA 1E0JA 5EYPA 1A4IA 4DLUA 4EPXA 1L5ZA 4TT3A 3D6FA 5AKIA 1T1JA 5H1YA 5J9FA 5K2MA 1X1SA 5DEOA 4CODB 2PNJA 1KYVA 3KXIA 3R0XA 4GLFA 4M0PA 4BNXA 3B1YA 5HF8A 5KSPA 1WY5A 2PQ6A 5IFKA 1XLVA 3HCBA 1NQXA 1YL6A 1QC5B 3UKOA 4ESOA 2NP6A 3FXAA 1CJMA 3Q8XB 5IM4F 1DKLA 5I7EA 2IYVA 5IDVA 1CLEA 3I9MA 4H3KB 3SBOA 3QU4A 2QVCA 2VXOA 4D43A 1TEHA 3LX5A 3IO5A 4QUDA 2AEFA 4AZ3A 4MULA 1B8PA 4D8UA 4HMQA 3H1EA 2Z4RA 2Q8QA 1S3FA 1JU3A 4JI3B 2XNJA 4AJEA 3B9RA 3CH6A 3UWSA 1RRVA 1RADA 3Q87B 1V8ZA 4N0DA 1MB3A 2XMRA 3BRWD 3GJ3A 4PONA 1T9CA 3WYCA 2QS9A 4AYWA 1C30A 1ST2A 3HKCB 2HHAA 3OHMA 3TSYA 2IDJA 2W93A 1TEZA 1CEXA 1UINA 2O3UA 1N9GA 3BE6A 4NU6A 3UJAA 3ZGXA 3GUCA 1D6JA 1SH7A 2MINB 4XOIA 5IDXA 2J9FB 3WWCA 1OJLA 1VA4A 4BFZA 3R3HA 3PEYA 3VSBA 1QHXA 3ZIDA 1X80A 3CLTD 3DDZX 3DLCA 1KETA 1HRKA 1TEVA 1E3LA 1KZ1A 4IFBA 5DM60 4CCYB 4KIJA 3KK0A 1P73A 1WKVA 2RI0A 2PUWA 1QOZA 2ZBVA 3AIKA 3JASB 4HG2A 3HZRA 3BWMA 3OEHD 4YAUA 4PG5A 1SO8A 4Y0AA 5FFNA 1G8AA 1Q1BA 2JJ2D 3VOAA 3PUYA 3DMYA 4K46A 3VJLA 4FEYA 4QE3A 3OOEA 1RXCA 1Y8RB 1MOPA 5DGHA 4CQMA 1H4QA 4CM1A 3CKKA 3VOBA 3ZHOA 3L0YA 3VO1A 3UA3A 3FPJA 4KYUA 1P9WA 1IFXA 1UADA 2F00A 2D3TA 1NE7A 2VQ3A 2UZ3A 2RBGA 1JI0A 1WE2A 2F2TA 3LUDA 5LBUA 2YS6A 4U0JA 1W76A 3GD7A 1MC8A 2QRGA 1I94B 1YBMA 2FEAA 2FI1A 1DAFA 1NW6A 1Q3TA 2F48A 1RJDA 1UT8A 3DEJA 3I53A 1L7OA 3F6PA 5CDUA 3TG2A 1UPBA 5BXQC 3AESB 1OTXA 3MVEA 3D7NA 3SQXA 1UT5A 4LQDA 1YI1A 2NG1A 3PIDA 4LJLA 3TQFA 4WV3A 3EEOA 3QEKA 4BVHA 5EQDA 1ZNZA 4UUOA 3L2OB 3VVCA 4IXTA 4D97A 1SHUX 2Q45A 1N8KA 3IC5A 1WMDA 5CGZA 4B47A 4U39A 3GLTA 4PZLA 3CWQA 4PAMA 1PQYA 3ZVNA 3U16A 1L4NA 2JI9A 5JHHB 2WJHA 4MV8A 3MFQA 1WMAA 3TB4A 1AO0A 3O8LA 4HQKA 2CDBA 2CXPA 4JVLA 3UMVA 4MV9A 2D00A 2HWWA 3EIUA 5EIBC 5SICE 4JFAA 1YZGA 4RJLA 1RQRA 2ZT7A 5CA0A 3HI6A 4JKOA 4Y98A 1XZLA 1LVUA 2V5AA 3HNRA 1JMKC 2AG8A 2NUTA 4G0QA 3S5JA 4CL0A 4Z1OA 3KEGA 1DIAA 4LGCA 3UFBA 5K0ZA 2ZIXB 1EFHA 2O2JA 4KX5A 4I9UA 3OFNA 4PZEA 1PEYA 4LXXA 4PTYA 2QTMA 3AHIA 1FL9A 3X44A 1URPA 3PQ7A 5GONB 3EZLA 1CZUA 4GG1A 1PT8A 3L4JA 3EF3A 3HHPA 4LGVA 4QGAA 3WMFA 4U2KA 1I7PA 3C87A 4WD3A 5ALLA 3L0OA 3LNCA 4EGFA 4YRAA 3R3ZA 4YRBA 2RKWA 3F6CA 4L5BA 5HJ5A 2WAYA 3QGMA 4B3IA 2IOFK 2G9VA 3HL4A 2W4QA 3HXLA 4BB5A 3GFOA 1ULUA 5AKJA 4KO4S 5IF3A 3I58A 3T7RA 1Y5RA 4WHMA 4ZGWA 1T2EA 1ZM4A 4RA6B 1SCNE 4FS3A 2IH4A 4Q9JA 1XLTA 2QM3A 3TCKA 2I3BA 2VJBA 2UVPA 3NFYA 4UHEA 5EIAA 4TMVA 2V7GA 1T1SA 1L6RA 3MA0A 1S2DA 1KEUA 2ERXA 2X0JA 4BMVA 3NATA 2GGSA 3COJA 1D3AA 3M4YA 2PWBA 4AZTA 4WBNB 1O4WA 3DVQX 3QVSA 1SZCA 4S1VA 6Q21A 4FTWA 1NVUQ 3LKBA 3O8QA 3QWBA 3EGOA 5CNJA 3AF6A 5B4TA 2QQEA 5K45A 1JG6A 1Z07A 4X90A 1XZHA 1JYEA 2ONCA 2NU8B 4JLMA 1KI7A 1E3DA 3VJRA 2H2AA 1AF7A 3NGXA 4NICA 4AI6A 3DFMA 3NHZA 5F23A 2WNHA 3ZDDA 1T4GA 4H1VA 4KQJA 1VLZA 1H23A 1M2NA 1WXIA 4MYCA 4Q4HA 1GRQA 4EL5A 5HQ3B 1JKMA 3K15A 1GG2A 1NOKA 4D4MA 4GL4A 1T9GS 1TZCA 4ZMBA 2DFTA 5TXGA 5I9MA 4YRZA 4OBBA 4Q7EA 1U0HC 4NU5A 3CX3A 4JI0B 4AJNA 1Z7WA 3BBPA 2H4YA 3KO8A 1NDHA 3LGAA 1ADGA 1EVEA 4OG2A 4WGGA 4RKRA 5JS7A 3RVNA 2QMHA 3Q9UA 2OP0A 4WCDA 4Q7QA 3W0LB 2QTBA 2ZRMA 3AV0B 1DUSA 3O31A 2CJYA 2YXEA 4CIBA 3KU1A 2ZSBA 4D26A 3VDMA 3UUEA 2ABWA 3VVBA 2C5HA 3PF8A 2I2WA 4IXMA 4IX9A 4RNCA 4RCZA 4IGAA 5FBRB 4QGFA 2HGSA 1QWOA 1MB4A 4IEIA 5CFMA 4QYMA 3G0GA 1U2QA 1KTVA 2KW5A 1EINA 3DZJA 4OXQA 3UMMA 1EU1A 3QXJA 5K6AA 3CEMA 4UM9B 5BW8A 1KYXA 1W1UA 2Z5VA 4GOND 4M9ZA 1R4ZA 4QATA 3WDSA 2TMYA 4Q5IA 4OJMX 5AW5A 1Z37A 1M2OB 5JD3A 5EWJA 2IF0A 4X66B 3EIQA 1N9GB 1O03A 1YBFA 2FKAA 5F1PA 2AN9A 4XQCA 3THRA 3ICWA 4N40A 5CDYA 4DEVA 3OP4A 1AMOA 2C82A 2C2KA 3GUZA 4FKMA 4BB6A 3P27A 3UBMA 1XUOA 4NF2A 5GGYA 4ZYLA 2W6OA 5REQA 3FFTA 4X3PA 3QXGA 2ZULA 1PWHA 3LFTA 4FD2A 4QQKA 3UK7A 5IHPA 3CO5A 3SE0A 2XNKA 2J5XA 1MV8A 3ANSA 4NLLA 1YK0A 4Q12A 3U4MA 2DLCX 9MHTA 5IZCC 1PCXA 2EBHX 1ISMA 1ND5A 5IPFA 3D2CA 2UXCB 3R0JA 1GP2A 3JQRA 3H9GA 4BB9A 5GTDA 1KRXA 2BM8A 4DM7A 1SCDA 3TSZA 3BCRA 5J2UA 1F0KA 3WKBA 2BMJA 4QPDA 1VLQA 3FMVA 2J9GA 3RT7A 2JW5A 3CSSA 4CPDA 3LRTA 3BH0A 4G85A 4KAXA 3K6SB 2HNAA 1F3OA 4KLCA 3C4QA 2ALJA 4BX8A 4PGGA 4EJSB 2L82A 2GS9A 1WOMA 2E18A 2I6UA 5A9SB 2AW5A 4JYCA 2WF7A 1T35A 1SC6A 4XM1A 2XYGA 2QE6A 4MQFB 4PQYA 5E6UB 2F3QA 3RV4A 1Z4MA 2FV8A 4I9FA 1QHGA 4FHCA 3NT5A 5I7WA 1DEXA 1P7WA 2AG1A 4G9EA 2QR5A 3TK1A 4NAUA 1JG2A 2YJ6A 4ILEA 3RG2A 5LMNB 1YR7A 1ZM9A 2MMCA 2QU7A 3PK0A 3CINA 4M3NA 4WA8A 5DV9A 3IH5A 4JQZA 3Q7PA 5DFAA 3RH0A 2GRAA 5HX7A 3IKVA 2YMQA 1TJNA 1RPNA 3EUAA 3N28A 2EQAA 2OCDA 2QSYA 1S2NA 3E9EA 3S6JA 3DQQA 5KVSA 2FYTA 1E1CA 1AUPA 1P2GA 2C2GA 3N2EA 3FSGA 3MJVA 4L7VA 4NDNE 5L3SB 5L51A 1DAEA 3T7KA 3HR8A 1PGOA 1OIXA 5LA6F 4M7OA 4IDQA 4LJ6A 5D3MB 1C9KA 3G9TA 1OZHA 5DLYA 3KYBA 3L84A 3IESA 2IZ6A 5ER6A 5ULLA 3RARA 5TQ0A 2VTBA 1THGA 4DLPA 1UOPA 1K75A 2Q4RA 2ZWIA 4H60A 4TL8A 3OZCA 2ZI3A 4AKHA 1RXWA 3FVQA 4ZO4A 5C5DA 1DAGA 1KEKA 4L51A 1T1EA 1NX6A 3K0CC 1JEQB 4DOMA 2IYOA 4JELA 1XPOA 3F5DA 4RD6A 1EBFA 2OLEA 1GPMA 3F2IA 3O74A 5AKHA 5HCIA 3VR3D 5K7SA 2G70A 2AE1A 1NPTO 1UF9A 4LMRA 4JLOA 4LMAA 2XWBF 2ZTMA 3DHWC 3IGFA 3R4CA 1PSWA 3RR2A 2X9LA 4CV0A 2NZ8A 4HNSA 4G37A 4PGAA 4DYHA 5CK4A 1L5HB 1E92A 3AW9A 4CV2A 4DSNA 3IAM6 4S1NA 2FPPA 1DLJA 2FQYA 2AYXA 2M1ZA 1JQJC 5AH0A 1L8AA 4X7BA 3PNKA 3RKRA 4C9BA 2C61A 3DLHA 2OK8A 4L22A 2QMUA 1ADJA 3GT3A 4UNIA 4JLBA 1OX6A 3VR5D 2O07A 1ADBA 2O23A 3K32A 3CG4A 1B2RA 2B4QA 13PKA 1TIKA 2I33A 2RHOA 3PL1A 5EXXA 4ZI7B 1QRSA 4KRFA 2GD6A 2WWHA 1ZUIA 2DCUA 2WJJA 3VU0A 2C2WA 4HVTA 1JNXX 3SYTA 3K6JA 1T6YA 1Y3AA 2X7XA 4Q18A 1OWPA 1QE5A 2WE8A 1GKIA 1E1QA 1KJQA 1KOLA 2CGEA 2PFKA 2IU3A 3R9IA 1YRWA 3JRNA 1F2DA 1AQYA 3NRJA 3QTTA 2QRPA 1HLDA 1GPJA 1R0YA 4LTMA 2PJUA 5FO1A 4M49A 4YUVA 1M5UA 3N3AC 1UP4A 1KQOA 3RDPA 3VU9B 1SXHA 3OCVA 1QIIA 3UH1A 4RELA 1T5OA 2ECOA 5DYNA 1I2MA 4YT4A 1ZISA 3RYFA 2I7XA 4YAKA 3KSBC 1LFAA 3TIGA 2CSXA 3RODA 1QYVA 2E37A 3RGWS 1EQAA 1JFRA 2IZ1A 3GNTA 4HEHA 4LDQA 1RYBA 3THSA 3F4BA 1OILA 1T34A 4RVSA 5GIOE 1ZOPA 5FD8A 1O9HA 1OLXB 5HHTA 2SKEA 3N1UA 2E0IA 1WY7A 1LPSA 2IYPA 1KI3A 3AEUB 2HLHA 4JU8A 4WCVA 3B1FA 5BQXA 4OX9Y 2QL9A 3DLBA 3C4JA 3EOAI 4HL6A 4BNMA 3OICA 3JQQA 1L1RA 1QNLA 1QAOA 2GZDA 4OUKX 4ZVKA 5CLHA 1H93A 3NWPA 3W8FA 2FPKA 3UV3A 3WGJA 4DDKA 1IOVA 4R3NA 4