3TNFA

Lida from legionella in complex with active rab8a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
170
structure length
170
Chain Sequence
DYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein LidA from Legionella is a Rab GTPase supereffector.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-8A
total genus 57
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tnfA00
2X8AA 2ZE7A 4X8LA 3QXHA 3IEVA 8OHMA 3LD9A 3X1YA 4KAXA 3B2EA 4MKHA 5D3MB 4AK9A 1VMAA 1QHXA 1KJWA 2P2LA 3KKPA 1ZU5A 3AB3A 3AUYA 2VTKA 4G5QA 5LB4A 1KSJA 2D3WA 3N5CA 4GMDA 3R7WB 2QG6A 3PUWA 4ZI3A 5BXQC 4CEIB 2ZREA 2REXB 5FR2A 2C8VA 1LNZA 4R9UC 1N6KA 1AGPA 4JZKA 3GLGA 3A4LA 4KLNA 2ZRFA 4A92A 1OT3A 2EFCB 2IF2A 3O8BA 1G21E 4KSBA 2O8BB 2OBLA 4A2PA 4HAYA 4LRWA 1N0VC 2WKRA 2FDCA 2E1RA 1AZSC 3QI2A 4DKXA 2CE2X 4MRNA 2J0QA 2C5LA 1TX4B 2QAGA 2P6UA 5CJPA 3W9YA 1CLUA 5AJWA 4BWYA 4TLDA 4D6PA 3EIQA 4KJZA 5GJWC 1Q21A 2CL6X 1SKQA 5FOVA 1QG4A 3C7KA 1VHTA 2NTYC 1HEIA 1XMSA 4OL0A 5CM8B 3L8ZA 4HLQB 2ZS7A 3CBQA 4QHSA 5CITA 2DB3A 3ICQB 4LBYA 4MRRA 1HUQA 3ETLA 3Q5DA 1IN6A 4CEHB 3EC2A 1G8HA 2C99A 3T5GA 3SI7A 1Z47A 4JLJA 1FPMA 1N25A 1ZUHA 3K0FB 4EIWA 1YKSA 421PA 3DOEA 4RD2A 2J41A 2VIIA 2ZANA 3HJNA 4L15A 1D6JA 4O3MA 1T3LA 1DOAA 3E70C 4M0LA 1KI4A 2F1JA 1NLFA 1KDTA 3RWMB 4POAA 1GAJA 2ZU0C 2BEJA 4HDQB 1R0WA 3WHKA 5C1BA 3ZS8A 1AJEA 5HZHA 2ZAOA 1S0UA 3QOFA 1EFHA 5KNCA 5KSYA 2BBSA 4M1YA 1RVDA 3OFND 4I81A 4CT5A 5KDOA 3CLVA 3VAAA 4KV9A 2EWWA 4LI0A 1UKYA 1D8TA 4FMBB 2BBWA 1H8EA 4PR0A 3ADDA 2Q0HA 1XD8A 4PHFA 4CVNA 1N6NA 2JJ8A 2ZSEA 4JLNA 5JCZA 1FTSA 5F2EA 3AVUA 3BERA 2AFHE 3B1XA 5B64A 5JRZA 1PV4A 1Q20A 1T5IA 1W0JD 2OO7A 2QE7D 5EP1A 1CP2A 4AURA 2R8RA 2YC2C 4URXR 1IHUA 4LHWA 5CLQA 1ZNWA 3HR7A 3NHAA 4PXAA 3I62A 1KI1A 2RGNC 2PZEA 3HPRA 4BZXA 3HR8A 2QROA 3GJ3A 4W9MC 2FGKA 5AUPB 1ZM9A 1XZQA 4ZIRB 4CYMA 1IQPA 4Q48A 4GBMA 5CJ2A 3QF4B 1E9AA 3T15A 1GDDA 3DKPA 1GRNA 3ZLJA 2D06A 1WF3A 4QBGB 4ARZB 4IOJA 1YR6A 2Z83A 1Q1ZA 4QGAA 2QT0A 5SZHB 4HUTA 5IF9A 3IQWA 3FHCB 3MAAC 4Q9LA 2GHIA 4KHZA 2R65A 4Q7KA 1D5CA 3P4XA 1WB9A 2C78A 3FFBA 4TYYA 4NYJQ 3U3MA 3C5HA 1W1WA 4LJYA 4URUR 3WMGA 5KDLA 1W0KA 2XB2A 3KQUA 4YONB 4C0JA 5H8WA 3EPJA 3I8SA 2OCAA 2ZTSA 2YWEA 2AR7A 2FJUA 3TRFA 2W6ID 3M1IA 4RKFA 4DCTA 2J0UA 4L16A 2V3CC 4Q01A 1E9RA 3D8BA 4TT3D 4UQOA 2XXAB 2IC5A 2IYUA 1YZLA 1DAIA 5DN6A 1VDZA 1RPZA 3LWNA 5EE3A 5HCIA 2GK7A 3N2IA 5DH9A 4TQAA 2IBMA 3A58B 2YVUA 4HUQB 4WA7A 1II9A 2ZVPX 2NO9A 2ZSFA 4CT4B 4QKQA 1K8RA 3U7FB 3KKNA 4BZQA 1DE0A 4N1AA 4A4DA 4Q7LA 2FV8A 3TUJC 2FPKA 1MT0A 3CNNA 1NP6A 3TW4A 4YXWD 3JZMA 4ON9A 3K70C 4TL9A 3UMFA 3X1ZA 1U8AA 3BH6A 2CL7X 2WJGA 1AN0A 4CEHA 3EZ7A 3IBYA 2IXEA 2GJ8A 3W5JA 1R8QA 4QGGA 1J99A 4BFTA 1G3MA 5BWMA 5AUOB 3FYHA 3UPUA 2ZSBA 1UM8A 3QKSB 2BJVA 4DLYA 1UFQA 1XXHA 4Q1EA 1X86B 4MGKR 1OW3B 3TVTA 5IK2A 3QXSA 4KCGA 1PLLA 3LA6A 1QG2A 1DTSA 2B7BA 4JL5A 4PO1A 2V4ZA 3A36A 4PC6A 4PAMA 4D80A 1T6NA 3ZJYA 3EWAA 1RIFA 4O2RA 4UXJA 2DFKB 4A9AA 3A8TA 2EFEB 4GOKA 1HY3A 3Q72A 3H84A 2DR3A 1L2TA 3FKSA 4URZR 3X2SA 1WA5A 2OSBA 4BZPA 4D4MA 2ZYVX 3EA0A 2HLDD 3O8CA 3CPEA 2G1JA 2JLRA 3DZ8A 3FB4A 5P21A 1M34E 3MWLA 2ZJ8A 3TSOA 3VR3A 3THYB 2J7PD 1ZMXA 3UXMA 2AL7A 1BYIA 2OCPA 2J7PA 3EAQA 3FMFA 3RLFA 4JVNA 2V7QD 4GL2A 2NPIA 1OYYA 4LBWA 5EQTA 4EFLA 2IYTA 1ZM2A 4MQBA 4HLDA 1SQ5A 2QMHA 2QZ4A 1G291 1P3JA 3WBJA 1E2JA 4QC2A 3QBTA 4LJAA 3DEFA 2DYKA 1OXXK 1R6BX 1U9IC 1D9ZA 4HZUA 1KKLA 3L0SA 2X2FA 1GRRA 2EW1A 4B71A 4L5BA 3CUEF 4B2LA 5FL7A 4B33A 1E2GA 1G7TA 4LK2A 4B3BA 2GZHA 1D2MA 4HZIA 2WWHA 2W6IA 5CB8A 3EA5A 1E96A 3KUCA 1VG9B 1OSNA 4P33A 2IT1A 2XB4A 4CZ2A 1TNDA 5L8VA 4LBZA 4DB2A 3R8CA 5TY0A 2YV5A 1EXMA 1NMXA 4LOAA 5EXPA 1QVRA 2W00A 1E1QD 3EASA 4TN1A 2RGAA 5FH9A 3OAAD 1F5NA 3Q7PA 4JVSB 2Q9BA 3BAFA 1WRBA 3LQQA 2AWNA 2ZRDA 2KI5A 5D3QA 3MMPA 4PQFA 3VNVA 1NKTA 1Q1EA 1RYFA 1MABB 4JVLA 3K9GA 2A30A 1HT2E 4YMTA 2ZXUA 3PXGA 1XPOA 3DOFA 5FOXA 1Z08A 3J81k 2XXAA 5IT5A 2BMDA 2REBA 1Q44A 1ZBDA 2WWGA 4D4KA 4CW7A 3U5ZB 1T8TA 3EW9A 1SGWA 3RRNA 5CYPA 2ZI6A 4PC7A 3CX6A 3L8YA 4CEJB 1FW6A 4WVFA 2J7KA 1W36B 1KMHA 3WRXC 1E79D 1D9XA 3WY9A 3BBPA 4G5OA 3BORA 3EIHA 4M21A 3K0CC 3PUXA 1LF5A 3L0PA 3FKQA 3A1WA 3TJZA 1UKEA 4KYUA 2V6JA 4Q18A 3SFVA 2EQBA 3LRPA 4DEYA 1S8FA 1IXRC 1FNNA 3I5YA 3GPLA 3K0AA 3GMTA 1NBMD 4MYTA 3V4RA 1TTTA 1W5TA 1NN0A 3I1FA 1YZGA 4JJKA 4A6PA 5KSOA 3LLMA 3P20A 4I1OA 5G3ZA 3TE6A 2QMUA 4D26A 3A37A 5E95A 4AWXA 4G5GA 5J4YA 1AS0A 1FUKA 4A0GA 1TU4A 5CYOA 4AKGA 3EPKA 4Y0VA 2G77B 2I1VB 4XJXA 5JS7A 4OK3A 2CK3D 3CB4A 3CRQA 2YKGA 2Q9AA 3VR4A 2OBNA 5HCNA 1QHIA 1NLZA 3AF2A 2DCUA 1Z6YA 2VQSA 4IHQA 1YR8A 3QPUA 2JLSA 1AQYA 4UNPA 3K9LA 1IN4A 2W6JD 3BJIC 3CX8A 3IPXA 4KSCA 3HPQA 3V9PA 2C03A 3A4MA 1CXZA 2JLVA 2FE4A 4Q1DA 4DIEA 2O0HA 3NBYC 3Q8XB 4JLVA 2V6IA 1M8PA 4QBHA 3QQ5A 2WJYA 2WWXA 4JBXA 4AKEA 4TMXA 4NCJA 5HE8A 1IN5A 2GAAA 5FPKA 5JSZB 4NBSA 2G0TA 4LSGA 1NRJB 5AR1A 3CF2A 1RC8A 2GCNA 1OH7A 2JASA 2GA8A 5G3YA 2ZVQX 3BH7A 3DPUA 4V02A 4TLEA 3GLGB 2YZ2A 1CJUC 2FNAA 1T4GA 4HAXA 4M8NE 5LD2C 3CWZA 3ZZUA 1KAGA 1XEXB 1Q22A 1AKYA 1KMQA 3EC1A 3C4JA 1P5ZB 4MKIA 5JLJA 4V0ME 2RHDA 3THYA 2PL3A 3UMSA 2ODWA 2WWYA 5DHFA 2WIAA 2CHGA 3V00A 1G4UR 2ZR0A 2FPMA 3LV8A 3AVPA 4Q5IA 3IPYA 1KK2A 2CHQA 4NH0A 4B3XA 1X1RA 1OFUX 1S3GA 1FP7A 3RAPR 4LX0A 1E2FA 1XJ0A 5LBIA 4KITB 3P26A 5L3SA 1GSIA 1E9EA 2JIZA 4GMXA 4TL6A 1HT1E 2GZDA 3U61B 2AHOA 4GSYA 3ND8A 4HZUB 4UXIA 1CJVC 1CR0A 2DFLA 3ZVLA 1QDEA 4B76A 3T5DA 2AXNA 1RZ3A 1VYVA 3PCRB 3M4YA 3O8RA 2GXSA 2V7QA 4P0TA 1Q0UA 5JJLA 1P6XA 1KMHB 4RCYA 4E07A 1NBME 2YOFA 1XPRA 2WPDA 3W34A 1AA9A 2VSXA 2ZYTX 3BK7A 3FGNA 4IDPA 4PX9A 2CDNA 3WRYC 2QN6A 2ZRJA 3QKRB 3THWB 1Y63A 2OM2A 2XJ9A 1US8A 5CM9C 3EZ6A 2GJ9A 3QF4A 2D2EA 4V0OA 1E2PA 3IHLA 2JJ1A 3D3QA 5BQ5A 1OJLA 2N42A 4F91B 1GFIA 4QBIA 2GJSA 4US0R 5M04A 2D7CA 2GVZC 4PC1A 4FWTA 1S3SA 1SHZA 4NP6A 2ZE5A 2OT3B 3NDBB 1G5RA 4E03A 3AUXA 1BMFA 4OJQA 2ORIA 1XJCA 1SXJE 2O0JA 1DAHA 2H18A 2ZIAA 5EE5B 3KQKA 1JXMA 1ESNA 1UF9A 1W4AA 1NKSA 4TTRA 4DWJA 4ABYA 4TYQA 4DDTA 4C0AC 4D0GA 4G01B 5G53C 2J9RA 3QE0A 2IXFA 2TMKA 3H2YA 1VIAA 5EJEA 4XIGS 5H68A 1FMJA 2OAP1 3Q5EA 5TVKA 5L3QA 4RKEA 1Z5ZA 2CVFA 4IVPA 3L43A 3AKCA 3IO3A 2J1LA 2OFOA 4A1FA 1ZM7A 3VR2A 1HA3A 4YQFA 4D81A 2F6RA 1CU1A 2A2ZA 4M1TA 4MYCA 5FI1B 4E22A 1YR9A 4URVR 2Q9CA 4DSOA 3VU9B 4OI2A 1OLOA 1S9HA 4ZDIA 5JFGA 3T1VA 2G9NA 3UKDA 1VKJA 5KSPA 3WBKA 1N6PA 2EFDB 1CBUA 2O8FA 1QZXA 1FP6A 2XZOA 1G6HA 1II0A 3RYTC 3ZGXA 2W2VA 4LYAA 1AS3A 5E7IA 4IJMA 4OHYA 3PEVA 4Z1MD 3KL4A 1QHNA 3AKEA 1ZJ6A 1NVUQ 2VO1A 1WMSA 5C18A 1COWD 1P9NA 3DKVA 1Z28A 2BMJA 4AYXA 2C9OA 4PSAA 1GTVA 1HQCA 3ADCA 4TSFA 1VPLA 2ZI9A 2ATXA 4RFVA 3N2EA 3I72A 3O8DA 1UDXA 1G1MA 1IAQA 1SKYE 3I5XA 3BB3A 3PEWA 2IHYA 2WAYA 3OIWA 1BS1A 1XWIA 2JLXA 2CLDX 1BKDR 5KOYA 1FOEB 1KSGA 4YMUA 1XEXA 2XSZA 3RS3A 3RS2A 2A7QA 3SHWA 1G16A 3S1AA 2WTUA 1G3IA 1AM4D 4H9GA 1JR3E 4GFDA 4WXPA 4DLXA 5F98A 4O25A 1TEXA 3B9QA 2ZR9A 1E0KA 1II8B 1LS1A 2UZ3A 3GJ8A 3NBXX 1J7KA 1WE2A 1UBGA 3NG1A 3LBNA 4B6EA 2OE2A 3K0SA 3U4QB 4NCKA 5F9HA 1LS6A 4R7ZA 4DHEA 5KNDA 2WSSA 4AKHA 1U99A 2C77A 3FWYA 1SULA 2AKAB 1A1VA 1JAHA 2WWFA 2WOJA 1T0HB 2OHFA 3PG5A 1PUIA 2WJIA 4C9BA 4PZYA 1Z6AA 4Y0AA 2JDID 4URYR 3L2OB 2GF0A 4BPBA 4PPGA 4H1UA 2PEZA 2F9LA 3SQXA 4MDFA 2HYDA 2ZROA 3JZAA 5LD2B 1KDRA 3QKTA 2Z4SA 4OHXA 3RRYA 2IYYA 4AD8A 4OI4A 2G88A 2ZSAA 4DVGA 1OIWA 1UADA 3CW2A 2XITA 1OH8A 4A36A 1HH4A 1U81A 4H1VA 4GI7A 2GEUA 2QAJA 1P75A 4KI0A 2ORVA 1W4RA 3OZXA 1BOFA 2G1KA 3QPVA 2ZRPA 3KB1A 1EX7A 1OXTA 1HQYE 1Z0AA 1DG1G 3A1TA 2PJZA 1MR3F 1E4VA 2O8DA 2QRZA 3SBDA 2QMOA 1KJZA 1Z3IX 4JLKA 1E9SA 4RD0A 1M74A 5FUXA 2OG2A 3CH5A 2FU5C 3EXAA 1OIVA 4FCWA 4IKEA 2XOKA 3TSWA 2CL0X 4Q4LA 1IOZA 3B82A 3PFIA 5A5GA 2G6BA 3AVOA 1UBEA 1N2CE 2O5VA 3W3AA 1UEIA 2N46A 2ZJAA 4KU4A 4IOKA 2KWIA 2Z0MA 1YZNA 1ZC3A 2JATA 3WP1B 2IYZA 2VP6A 4GZLA 1TUEA 1W7AA 1R0YA 3Q3JB 2HJVA 5H1YA 1EFRD 2ZAMA 3NTUA 1U2RA 3BRWD 3PIRA 5FI0B 1XCPA 3B7GA 2LCFA 4XOIA 2QM8A 4IEIA 2QBYA 4Q7MB 1OXVA 5G40A 4US2R 5JBQA 4D0NA 2PZFA 4QFMA 1OKKD 1YR7A 3BD9A 3NBZC 2O0KA 3B9PA 4LPKA 4QGFA 4DBLC 3QXJA 1XXHB 2ZS8A 3FHOA 2ZRLA 2B8TA 4YXWA 4F4JA 1RRGA 1GL7A 1ZNZA 2QSYA 4N3NA 1Z0JA 2JJ2A 2QTFA 1XCGB 1U9IA 1X8LA 4FN5A 1W36C 1FNMA 1JR3D 2QUZA 4M9QA 3D31A 1VCIA 1LTQA 4Q4AB 5FTNA 3U60B 2RGGA 2ZJ2A 3Q7QA 4D0LB 3PQCA 3FDIA 4JMPA 5TXGA 3RSOA 1NIJA 1JBKA 4YC7A 4YDHB 4CDGA 3CZPA 5E7JA 3B8HA 1W46A 2L0XA 3CZQA 2QA5A 1ANKA 2NO6A 5J40A 4MITA 4GOJA 1TQDA 1KIMA 2ZRCA 2O8CA 3KDSE 2PCLA 3C16C 3MWYW 1PVOA 2A5JA 1M7BA 2A5FA 2ZUCA 4OQLA 3ONWA 4RD4A 3SBEA 3QXCA 2F7SA 4NPHA 2NGRA 3BXZA 1JEDA 5AJVB 4IFEA 4HYYA 1FX0A 4HLUA 2GKSA 2QU8A 2CCJA 2ZPTX 3EARA 1UAAA 2A5YB 3VTKA 2H17A 2YHSA 4E5UA 1G7RA 2O8BA 4PO8A 1GITA 2HXYA 1VG8A 1J8MF 3S1AB 2YJTD 5KYKA 3B1ZA 4FCVA 3SOPA 5CLLA 4OI0A 2VA8A 1RYHA 2CJWA 1KSFX 5EZ5A 3T61A 2ECKA 4TMVA 1IY0A 1E2DA 3B60A 4Q21A 2V55B 2ZRIA 1T5LA 4OI1A 4A82A 1Z29A 2HF8A 2ZSDA 1XRJA 3K8YA 2GXAA 2JJ2D 5JHGB 1WBDA 3B1YA 3AV0B 2R44A 4MDEA 4DLVA 1DS6A 1PLJA 4WOPA 5EUQB 3TAHA 3VR5A 1KHTA 4DCSA 4FWIB 1NN1A 4OBEA 2ZRMA 1A82A 5FOSA 3T1OA 4BE7B 1GNQA 4URWR 3QBVA 1OYWA 1W36D 1XX6A 2NZJA 2BMFA 3T06B 4EDHA 4LYFA 1Z2CA 2GAOA 1SVIA 1YZQA 3MUFA 4B47A 2DFNA 1DEKA 1P9RA 4BLSA 1M6NA 4EAQA 3NC0C 5LDDC 1RKBA 1DO0A 3AF3A 3OF5A 4GT1A 5EP4A 4OQNA 3TUIC 1WQ1R 1EGAA 1KI3A 2Z43A 1KI8A 4HLUC 4A8JC 3OE7D 3T1TA 1KDOA 1ZD8A 4ACBA 4YDSA 5BN4A 4D4LA 2EU8A 2NO1A 4XSGA 1L8QA 4B3DA 2C04A 4A0FA 4G3XA 1COWA 3MGCA 4IXMA 5L3VA 6Q21A 4Q7JB 4EPWA 5FOUA 3OHMA 3FPAA 2RGCA 4L8GA 1JEEA 5F9FA 4DDWA 4CRWB 1CULC 3W6OA 1JALA 4F92B 2X77A 3AF1A 2RGNA 2HCJB 2OFWA 2VF7A 3G82C 4IEEA 5DIFA 1E9BA 2PLFA 2YWFA 3PEYA 4OHWA 3WP0A 3LLUA 3GJXC 1XMVA 1O87A 3KKOA 4WW0A 3AVQA 4NTZA 2WAXA 1XP8A 4F93B 1DAFA 2IHBA 2AD1A 3BFVA 2H92A 5TDHA 5DYGA 4TYNA 4PO9A 5JEDA 2ZYUX 3SEAA 1J70A 5C4MA 2X1VA 4NYMQ 3ZD6A 4PQYA 4M9ZA 1GZSA 1KY2A 2EYQA 2ZRGA 2BHRA 1N6HA 1XB2A 2D62A 3CF0A 5CIWA 5HKKD 2OBMA 1KI6A 3AM1A 5JI2E 2JLZA 2IF0A 2JLWA 1KZ7B 2W0SA 2IS2A 4BRWA 1HV8A 3LX5A 4ZV4A 3IEUA 1XTJA 2LKDA 1E0SA 3KUDA 5A0FA 1T3HA 4EPXA 3EZ2A 4U5XA 3LXXA 2K5UA 4N0DA 5DE3A 5D3MA 3GJ4A 4CF7A 4AG6A 2QPAA 3ZD7A 1NVVR 4RD1A 4W5WA 4QBFA 1E2LA 4DRZA 4XH9B 2VPPA 4EFMA 2YYZA 3RRMA 2G83A 1I4LD 2F1HA 2VHCA 4C0QC 3FHTA 1M7HA 4GRAA 5HE9A 2QI9C 2FSGA 4ILEA 2ZI5A 3F8TA 4LUCA 1N5JA 621PA 2H8KA 3CPHA 3FMIA 4JSYA 2H5EA 4KXFB 1ZAKA 1TPZA 1I2DA 3OIUA 3WMFA 4ZO4A 3V4FA 1G8YA 4BFWA 5HTKA 4TQUS 2FH5B 3REFA 4QNRA 4HLCA 4Q19A 3EG5A 4QL3A 1T3SA 2QQEA 2QPOA 4PQRA 2XTNA 2GBLC 1P2VA 2BM1A 3GEHA 3KTAB 2ANBA 4AY2A 1E94E 4UNQA 4XVQA 2WJHA 5FPSA 1XEWX 3KJHA 5DI3B 3W8RA 1U0JA 2Z5FA 1K5GA 3VFDA 3TIFA 1JPJA 1H65A 1W0JA 1ZD1A 2G3YA 3U2QA 1N3BA 4EPYA 2ZITA 3CRRA 4V0KA 2GJKA 4A6XA 1X8JA 2WZQA 4FMCF 4G5RA 2HCBA 1X8KA 2WJVA 4O2LA 3AVYA 4C7OB 4M1MA 1XD2B 2PLRA 2JLUA 5J4LA 1KAOA 1WDTA 2YOHA 2B8WA 4AKIA 1KDPA 1TEVA 1TQ6A 1KO5A 1GNPA 5E4FA 1R7RA 2WOOA 5KNBA 3JVVA 1KO1A 1P4SA 2QQ0A 5JI3E 4G5SA 3ADBA 3E1SA 1KGDA 3KQHA 3CRW1 1F60A 1JJVA 1E2IA 1HYQA 1A2KC 2GCOA 4PFSA 4XTRA 2Q3HA 4NYIR 3W5IA 1G8FA 1RRPA 2IYVA 4KFRA 2ZRBA 4M1SA 2PJRA 3KFVA 3GEEA 4PANA 1LW7A 3I8XA 2H7VA 5KSZA 3CPJB 5AJZA 1E1QA 3CNLA 3QY0A 4DDVA 4LHZA 1KI7A 4MH0R 4PC3A 4NYIQ 4K81B 3OIVA 1DPFA 2GRJA 4D82A 1Z6TA 2AD5A 4MKGA 2H1LA 5C46F 4CEJA 1VTKA 1U94A 3IIKA 1HE1C 2XNDD 3K0EA 3IIJA 3MG9A 4W7SA 2FX3A 1SXJA 4MRVA 3BB1A 3QEJA 1RFLA 3JVUA 2A5DA 4C2TA 5L3RA 4TMWA 2JDIA 5KPDA 4FIDA 5FUWA 1ELOA 2FEOA 1W49A 3CNOA 2J45A 3RSLA 4OKSA 4DSUA 3THXA 4CEIA 3OEHD 4TTQA 3P27A 5DNYB 4RZXA 4ARZA 1ZD9A 4C0BA 3A1UA 3HU2A 3PEUA 4GP6A 4FXPA 4RY2A 1RRFA 1N5KA 2HT6A 3SFZA 2DFTA 2BWJA 2P65A 4BGDA 1A7JA 1D2EA 1E99A 2QT1A 3UK6A 1M7GA 5J4HA 4B3CA 3PJRA 2IK8A 3K70D 3C5CA 3CR8A 3RHFA 3U3OA 1Z0DA 3FFAA 1MO5A 4XD7D 1W2HA 1RW4A 2GXUA 4M22A 4M9XA 4TL8A 2F1RA 3UANA 2GF9A 3DL0A 3RNLA 1GG2A 3QEOA 3QKSA 1NBMA 4HB0A 4P4SB 3GLGE 1EESA 1GWNA 1E2EA 4RD3A 3CH4B 1Z6GA 4KO8A 2WMOB 1T0JB 4NONA 2QSZA 5GJCA 3T1QA 4I4LA 1OFHA 5GVSA 1NLYA 4NCHA 4QNMA 3U44A 4Q1FA 4Q47A 2IYWA 2CBZA 1FQKA 1NSFA 2KB0A 4DLTA 4KLZA 4MYUA 2IS6A 2REOA 2R6GA 4LJ4A 4D2IA 1TF2A 3KXLA 4GPTA 3SJAA 2Z4RA 3SYLA 4ERNA 3H1TA 4ASUD 1EX6A 1VG0B 2YWHA 5DI3A 1ONBA 1CRQA 2CVHA 1AIPA 5DN6D 1KO4A 4U7DA 4B3GA 2RCNA 3LQRA 5FOWA 1Q57A 4OYHA 4HATA 1OB2A 4FCTA 2FFHA 4GZMA 2QAGC 1QF9A 4JIMA 3VHLB 3C15C 1TAGA 4A0HA 1ZC4A 1IY1A 2VHJA 3W6NA 4QHYA 2KBFA 4C0KA 1F2TB 2QTHA 4FMCB 4MGIR 4B35A 1JQJC 3GLIE 3RC3A 1ODFA 1G6OA 4F38A 2RGDA 3B6EA 5EXSA 5C4GB 1NG1A 4JLPA 1QHSA 2IL1A 1L7VC 2DHRA 1DG3A 3ZVMA 4B43A 3WNBA 4Q9IA 2AN9A 2D4HA 4V0LA 2KJQA 3ZIAD 3UATA 4QM7A 2LKCA 2P3SA 2GEVA 3NXSA 5AUNB 1CJTC 3WMEA 4JKIA 1NMZA 2VYFA 2QENA 4UKDA 1V43A 2GDJA 2V8OA 3LXRA 4JL8A 5FOTA 3GFTA 1P60A 3SJCA 1KO8A 4TLBA 1P2TA 4FMDB 1Z06A 4QM6A 2JA1A 4HI0E 2XZLA 3SE0A 1E79A 1ZUIA 2SHKA 3LW7A 4LPSA 4Q9HA 5EUMA 2QTVB 5AK0A 2WSMA 1IXSB 4DUGD 3LNCA 5CDFA 3X1DA 1JECA 4M1KA 3QIAA 2CCGA 3TNFA 2WVJA 1ZW6A 1VHLA 3THOA 2ZI7A 1G3QA 1UBFA 3MCAA 2J3EA 3U3RA 4XVRA 1YZTA 2XX3A 3VX3A 2J0UB 5FFMA 2XOKD 4WZAE 2IYRA 3KQLA 2E87A 1XEFA 2QM7A 2B7CA 2AFIE 2C96A 3U7EB 1KZGB 1GRQA 1OXSC 4X8HA 2WPDD 4ZKDA 5BN5A 3OEEA 2FOLA 3LX8A 2CLSA 1VCOA 4PHGA 1G8GA 1YRBA 2IEZA 4LZZA 3SR0A 3GLFA 1EG7A 3PUYA 4NU0A 3ZQJA 2G0NA 1ZNYA 1R4AA 3T35A 4IRUB 1P61B 2KBEA 3P32A 3GJ0A 1Q3TA 4IXNA 3TH5A 1K5DA 1Z8FA 3TMKA 4EJSC 4OHZA 1KK0A 5K8TA 5K8UA 2J5XA 2BBTA 2I1QA 1KSHA 3F5FA 5JWRA 4A15A 3B1WA 3EZ9A 5CK5A 5B2ZA 2DWQA 2W2XA 1AK2A 1E6CA 3AKYA 1LV7A 2ZQ5A 4HDCA 4EPVA 1C1YA 1QHYA 1DBSA 3KKQA 4QJ5A 3VR1A 2IYLD 2HV8A 4W5JA 4P31A 4J0QA 1E2QA 3R7WA 1AKEA 4GOXA 1GIAA 4FW9A 3VNUA 1KK1A 3F3YA 3HU3A 1A5TA 1E9DA 3OE7A 2J59A 4KFUA 3I32A 1H8HA 4HSEA 1HTWA 1NVVQ 1U90A 2ZU6A 5IRCD 3LBHA 1NN5A 1A4RA 2ONKA 4D4JA 4EUNA 3BFKA 3I92A 4FINA 1OHHD 3OAAA 3QVVA 3NKVA 1PJRA 3CX7A 5KDDA 1G18A 5TMPA 3CWQA 3CRVA 4B3FX 2A5GA 1E9FA 3HWSA 4RFSA 4L9WA 3X1XA 1HURA 1D2NA 2CMKA 2IEYA 4TTPA 4LJ6A 3A4NA 2IYQA 4BLRA 1ZVQA 4KVAA 4A2QA 3CONA 1G41A 2D74A 1O3YA 1GNRA 1KNXA 1ZIPA 2FSIA 3FKSD 821PA 3D6TB 1R0ZA 3KXKA 5DI9A 2VSFA 4AYTA 2ZE6A 2O8EA 3QKRA 2HT1A 2VP2A 3VR6A 2UKDA 3L82B 3SYKA 3GFPA 2GBLA 5EZ6B 2BMEA 1G7SA 4KYIB 1WXQA 5L3SB 2V9PA 4PSKA 1E9CA 2VLIA 2QNRA 2C9YA 3H86A 3PV0A 2FGJA 1EFCA 3FTQA 4XTCS 1NF3A 3TAUA 4RSGA 4IOLA 2BKEA 3K09A 2BDTA 4R2HA 4JBYA 3LAWA 1FFHA 1I2MA 2OFXA 4AYWA 1JI0A 4PAQA 3UG7A 1TU3A 1XXHE 3RDPA 4TT3A 2NZ8A 2HXSA 1AZTA 4UNSA 3BE4A 4WZBE 4KBGA 4TLCA 2OAQ1 1L4YA 4Z51A 1OFTA 4LC1A 1WBBA 1US8B 3IIMA 3SN6A 1ZCAA 4LDJA 2GCOB 3QVUA 3DZDA 3PR1A 1OV4A 2ERYA 1HE8B 1ZU4A 3AQ4A 4ASUA 2OILA 2DPXA 1QHHA 1XTRA 3VHXA 4BLOA 2IW3A 1BH2A 4X8OA 3RC8A 5CB6A 1BMFD 3U3KA 3GLHE 5FBVB 4DLSA 4KBFA 5JJIA 1KNQA 4TWZA 5CK4A 3IKJA 4WAUA 4ZDWA 2QP3A 3GLHA 3BH0A 4NMMA 1E3MA 4II7A 2O8DB 4JL6A 4LGMA 4C7OA 4RJLA 1W47A 3PUZA 4DLRA 1XMIA 2LWIA 3BOSA 4BASA 2PMDA 1XDBA 2F3TA 1YJ5A 1SXJB 3MFYA 4YMVA 1JR6A 4IVQA 4FI3C 2ONJA 2IUTA 3RABA 2OEPA 4F7WA 4RZUA 1CKEA 2R6AA 4LHYA 2R62A 2Q21A 1SZPA 1PUJA 3THXB 1YU9A 3LH5A 2QL6A 5EP3A 1K6MA 1CR1A 1CS4C 2RGBA 4P3YA 3EIEA 4WXRA 3KZ1E 2GESA 1XZPA 2P6RA 1RRCA 1JB1A 2ZUBA 3OESA 2FN4A 1T9HA 3ZVNA 3LY5A 4ZIRA 1E0AA 4RD6A 5E3HA 4GDFA 5EP2A 2I4IA 5K8IA 4N0EA 1W48A 4BLPA 1VG1A 1SHKA 3HP1A 1SVOA 2PT5A 2JLYA 3I73A 4UNRA 2CK3A 4Z1MA 2FZLA 4DCNA 5FBRB 2MMCA 4M2LA 3DHWC 2OUKA 4ZDJA 4P4SA 1KI2A 3PVSA 2MSEB 1DELA 2E9SA 1S9DA 2WWWA 3LVRE 5DISB 3TSZA 3R9XA 5E7MA 3ZH9B 5JSZA 2VP0A 2AWOA 3TGPA 2QAGB 3KXIA 3AP2A 2ERXA 1MH1A 1SVLA 1TF5A 2R6DA 3REGA 1JXOA 2IX3A 2GEDA 1MO4A 2IS4A 4AI6A 4RVCA 2ORWA 3T12A 1F48A 4YLGA 2FZ4A 2ZETA 4QRHA 1X3SA 4JKYA 4ZCMA 3EX7C 4D25A 4UJ3A 3W6PA 5JHHB 1G3RA 4Z8XA 1OF1A 1NIPA 2QE7A 4ITRC 5DHAA 2VL7A 5UKDA 3NEJA 4KFSA 1KKMA 5DYIA 2WHXA 4MYHA 4HAVA 4BEJA 2CCKA 1H8HD 2BOVA 3SHFA 4LYHA 3RS4A 3GQBA 4MUBA 2PT7A 3B1VA 3W90A 2O52A 4E09A 1UKZA 5KPJA 1B23P 2AXPA 3BFXA 3IDQA 2IYSA 1P2SA 1RE0A 4WBSA 4DSTA 5B30A 1UDWA 4DB4A 1UJ2A 2CHVA 2QGZA 4M53A 4NCIA 4HAWA 2GWHA 4B44A 1M2OB 1II8A 1NSTA 5ELXA 2PX3A 3KKMA 4DLWA 1NY6A 2XNDA 2WKQA 1CEEA 3DDCA 1R8SA 3TUZC 2OXCA 1TQ4A 2FSHA 3ZZTA 2AKYA 3NEYA 2V1XA 2IUSA 1GKIA 4KVGA 2WBLC 3O47A 4Q1AA 4DCUA 4LC0A 521PA 2ZYWX 4NDZA 1F6BA 4DUGA 5FTLA 4P4UA 5AWFC 2DWPA 4LWZA 4XWOA 1S96A 4EPTA 2YC4C 4AC9A 2H16A 4TYWA 2ODEA 3FMPB 3HU1A 1A2BA 1NI3A 3WYFA 3G5UA 2A9KA 4LBVA 4P4TA 3MJRA 1V5WA 2VP9A 4Q66C 5FL7D 2EVWX 3VX4A 5GJBA 4BEBA 1OH6A 1Z07A 4GNKA 4MGZR 4IOMA 2XJ4A 4UJ5A 1N5LA 4ZCIA 3OIYA 4A8JB 1FX0B 4B32A 1E69A 4NE2A 1OIXA 4DLUA 2A78A 4ZCLA 5JECA 3GLIA 2Y8EA 3TK1A 3UWKA 4LJ8A 2BCJQ 3VKWA 2GTPA 3FOZA 2GNOA 1XD9A 4OQXA 2ZM5A 2BBOA 3MJHA 4C3ZA 3B85A 1YZKA 4DJTA 4HDOB 4DT1A 4Q02A 4L4UA 5EXXA 2PH1A 5CDFE 3THWA 3NHBA 4QXAA 1E2KA 3QNUA 3TQCA 4Q4HB 1XF9A 1B0UA 1X1SA 3K0CA 2R2AA 3W8NA 4Q00A 4AG5A 2HDNB 5B58C 1N0UA 4NYMR 4IDQA 1MO3A 5A4JA 5SZKB 1ZNXA 1KTVA 1XJQA 3K70B 4MA4A 4JJZA 1ZM3A 2WMNB 2ZJBA 4U00A 3Q85A 1YE8A 5AJXA 1F2UA 2QRNA 1TQ2A 3B5JA 3QKUA 4X8MA 3EWSA 5IDVA 1NL3A 4WZ6A 3R9WA 5JRJA 3DMNA 2QBYB 1AGRA 4QGHA 2VP4A 4CIDA 1TL7C 2VF8A 2XSZD 3TW8B 4KODA 1E2MA 2WKPA 4LJ7A 3C41J 4HB2A 2WIBA 4C2UA 1CR4A 2JGNA 2MSDB 2NOAA 1Q1QA 3IHWA 4JT4A 1JR3A 4B74A 721PA 5DSZA 2QPTA 4XWAA 4BQSA 3K09C 3HYTA 3SDZA 4QJ3A 3FMOB 3QXXA 1BO6A 1DAGA 4Z8YA 2HYIC 5K8LA 4US1R 3U44B 3RWOA 3TKLA 5KHOC 4JT2A 1XCMA 2D2FA 1WCV1 4LV5B 3C14C 4B34A 1KY3A 1VCMA 1KI6B 1W44A 2PCJA 1P73A 2WM9B 1XFAA 2DBYA 5LB2A 1XTKA 4TYPA 4XSHA 1FUUA 4OQMA 4M1WA 4R2IA 1EWQA 2PBRA 4EQ6A 3AEZA 3VU9A 4BLTA 2OCBA 1PZNA 1QVAA 4JS0A 4RCZA 4OK6A 1GILA 4NYJR 1FQJA 3P1JA 4HUQA 3SC3A 2J46A 1CR2A 2ODBA 1N6IA 3KTAA 2XZPA 1JJ7A 2QEQA 2UVQA 4PPNA 1JQLB 2R6CA 4IW3B 1W2GA 3SS8A 1U98A 1GVNB 1GM5A 1J90A 1T91A 3KB2A 2P5SA 5KU1A 2DY1A 5EXTA 3LO5A 4Q4JA 4MRPA 4DC9A 5KO2A 1PLKA 4QG7A 3U3JA 5JS8A 1GP2A 2BV3A 4R98A 1NN3A 5C2JB 5HPYB 1EWRA 2ZEJA 3DMDA 4ESHA 2HF9A 1C4OA 2F43B 5J5CA 4BFSA 1R2QA 3MSXA 1MABA 1Z0IA 1EK0A 3QF7A 2BCGY 2V1UA 5SZJA 3BS4A 4JLBA 5FPYA 2A3RA 5FTMA 3A1VA 1MOZA 2P5TB 3AVXA 2GZAA 1CRPA 1JAIA 3OFNA 3K0FA 5LPNA 5CIQA 4PZLA 2Z6VA 3ZQ6A 3NDPA 1GL6A 4HAZA 4UNNA 4BRUA 3ZDQA 1KK3A 1Z0KA 2ZS9A 1EFTA 4TQ9A 2IUUA 1Z22A 1XBTA 2YOGA 5GADl 4TZ6A 3E5HA 4DZZA 2X2EA 1S1CA 1SVMA 5JMTA 1H8ED 4EKDA 1G3UA 1Q1BA 3PENA 2IS1A 2MSCB 2HLDA 3QJYA 3MRSA 3NH6A 1N6LA 4IDOA 3RVBA 4B2PA 3Q9LA 4PSVA 5FTJA 2AX4A 5DLQC 2CJWB 3DM9B 3WXMA 5HKKA 3LW8A 2FMXA 4QHTA 4BUJA 4M1OA 3KQNA 4DLZA 1W4CA 4ZKEA 4MKFA 4I99A 3P4YA 3SZRA 2JAQA 2PEYA 2YINC 4HAUA 3C8UA 3R9IA 5L3QB 2XEXA 3EZFA 1R5BA 4IDHA 3LDAA 4PPFA 2CNWA 1OHHA 4RZ2A 2NPFA 5EE0A 4TMZA 4XD7A 4OHVA 1ZUNB 3NH9A 1OB5A 1QRAA 2ZRKA 3QG5A 4BFZA 3AGPA 2FF7A 3K9HA 4S35A 1G17A 2I3BA 1GOTA 3BIFA 1YHNA 2GCPA 2F55A 2JLQA 4Q1CA 3KJIA 1ZM4A 1U0LA 4PZZA 2VHUA 4OK5A 4TL7A 2XTMA 3K0AB 1I4TD 1G9XA 4AIIA 4C30A 1CTQA 3GP8A 1S4QA 1EFRA 2EWVA 4GP7A 2KSQA 1F2UB 3TR5A 1DADA 1P9WA 1MKYA 3GLIB 1P7CA 2VSOA 1J2JA 1QHGA 1QBKC 1R5NA 4C0HA 4MGYR 4O0MA 1N0WA 3H0KA 3LBIA 5FBQB 1IXZA 1YZUA 1Z83A 121PA 3RS7A 1SVKA 2C95A 3GJ5A 3OEHA 4XVUA 1P72A 2BJWA 1G4AE 1U8ZA 2NIPA 4PTLA 4DSNA 5IHPA 4JYBA 1VIYA 1ZINA 2RHMA 2RMKA 4IDNA 2WWIA 1SXJC 4G0NA 1GKYA 2GJAA 1G5TA 5G41A 4DCVA 2R6FA 2JJ1D 1E1RA 4Q4JB 4ZDKA 2EFHB 2D7DA 2EYUA 2QORA 4DIDA 4F4CA 2OLKA 2H57A 3IBGA 4YMWA 2B92A 5TV2A 3ZZ0A 4ESVA 4WIAA 2O8FB 4NKRA 1RJ9B 2GVDC 2QY9A 2ZJ5A 4XWKA 4R71A 1DAKA 1Z6XA 1F2TA 2IWHA 1ESMA 1IONA 5GJVC 3X1WA 5DO9A 3ADKA 4BFXA 2VP5A 2CLCX 1N6OA 1P62B 1LVGA 1ZP6A 1DAEA 3NVAA 3IGFA 3AP3A 1ZRHA 4JLDA 2NQ2C 3KX2A 1NJFA 1NVWQ 4L9SA 4HB4A 4Q4AA 5J47A 3VKGA 2ASEA 1YQTA 3FVQA 2OZEA 4FD2A 3WYAA 1P2UA 2NG1A 5FPHA 1XTSA 4C4PA 3WHLA 4TMTA 2OESA 5HZKA 2KE5A 3ECCA 3TVDA 3SNHA 4ZI2A 1MV5A 3TLXA 2QP4A 1MO6A 1ZIOA 2W83A 5H70A 3FE2A 2J0SA 4TZ0A 3DO6A 3SYNA 1KYIA 2CNWD 1R10A 5FL3A 1LB1B 4DEXA 5F3WB 4LV6A 2F43A 3IQXA 1IJFA 1XTQA 4TLAA 2Q3FA 3UWOA 5J4KA 2ZJZA 4IFBA 4C0LA 1E32A 1WP9A 5BW8A 3NWJA 1G64A 4U02A 5KTYA 3L0IB 4EPRA 4OJKA 4M9SA 1VECA 3QG1A 5JWOA 4NHOA 2GETA 3VQTA 2QGNA 2FFBA 1SKYB 3U7HB 4C0SA 4S2EA 5JWHA 1TUIA 4HEJA 4MRSA 1XD2A 2ZRAA 4Q9JA 4K46A 5SZIA 1Z63A 1IN7A 1VYUA 3DM5A 2YWGA 3SJBA 5BYJA 4OQFA 2WSSD 3ND9A 3SQWA 4A8JA 2XAUA 3RS0A 1MRSA 3VKHA 1LFDB 2C98A 4YMSA 3T34A 3BB4A 1J8YF 3M0EA 4PPQA 1BYUA 3ZS9A 3GEIA 4TSFD 1SXJD 1UBCA 4JLOA 1XPUA 2Q6TA 1S1MA 1KI9A 5JZVA 2W0MA 3U6KA 1AS2A 1T8UA 2IWRA 2AK3A 1CJKC 2J0VA 3AKDA 3B78A 3GD7A 2Q3MA 3UMRA 1G5PA 2XTZA 1DVRA 2HEIA 2YNMA 3PITA 1TMKA 2C9CA 3QPWA 4LY6A 3WNDA 1UKVY 4QOSA 1E98A 2ZI3A 2VRWA 2PMKA 5B57C 1QHHB 1LY1A 4PAOA 3TR0A 1UPTA 5TB5A 1G19A 3MLEA 4NZYA 2PZGA 4JSTA 4BLQA 4EJSA 3KJEA 4DDUA 5FPTA 4EFNA 2VBCA 2ATVA 1N5IA 1LF0A 3MD0A 2PX0A 3CRMA 1XEWY 2GK6A 3EPLA 3SU8A 3ZVRA 2IXGA 1NJGA 3MWJA 1GUAA 4LJ5A 5GVRA 3AVWA 1NVXQ 2MMGA 2JCSA 2N1BA 3OEED 3VMFA 1Q12A 3GCGA 1ZCBA 2ZE8A 4EJSB 2UZIR 3GLFE 3IO5A 2FPLA 1R5OA 1W5SA 2ZI4A 2WICA 4P32A 3L0OA 3NC1C 4BECA 1SVWA 2VEDA 4JYCA 1M1YE 4FMDF 1E0JA 4DXAA 1XNJA 1DAMA 1XU4A 3K53A 3G0HA 3B13B 2V54A 3SJZA 4LJ9A 2BM0A 4PC2A 1MRNA 5JJKA 3D7MA 5BYKA 5EE1A 1CJMA 3AGQA 3RRZA 1IJEA 4KFTA 5BN3A 4I1SA 2BC9A 2JEOA 4LV8B 3LVQE 4I1VA 3I4LA 3BC1A 4BFVA 2W2TA 3GJ7A 4BFYA 3BGWA 3HDTA 3CIOA 3QUSA 3AF0A 4EQ6B 3R8FA 3GLFB 4V03A 5FTKA 3MWKA 4IVRA 1GKUB 2EFGA 4QJ4A 221PA 2QMEA 3U4QA 2P6NA 2FFAA 1I4DD 4M4SA 5EE9A 1E4YA 4ZPXA 1RJ9A 3F0TA 2VHQA 2WV9A 5DGXA 4A2WA 1OH5A 2RB4A 5FBWB 3R20A 2FA9A 4PHTA 2OXRA 3K1JA 1TADA 3ASZA 2CEAA 1CF4A 2J87A 4JBWA 2B6HA 1FMLA 4B2IA 3UIEA 3NBFA 4PHHA 1OPXA 2HJGA 3U6BA 2OLJA 3ASYA 1E1RD 5IK2D 2BVNA 1N6RA 3CM0A 5FUVA 2VHTA 4Z54A 3CKLA 1C9KA 4LCBA 2CXXA 2XGJA 4UXHA 4V0MA 2O8CB 2FFQA 2BIFA 2FSFA 3RS5A 4JLAA 2HUPA 5KUTA 3ZIAA 4B48A 3A1SA 2NMVA 4W5HA 2RKOA 2RGEA 1VCNA 3TQFA 3ZYCA 4I1UA 2F1IA 5TARA 1OKKA 1Q3HA 2B21A 2O8EB 1G8PA 3QSYA 1E2NA 4F4IA 2VH5R 2CE7A 4Q03A 1NY5A 2NO7A 2ZR7A 3NIBA 2JIZD 4K8OA 3E2IA 2DWOA 3A6PC 1IBRA 4LYJA 4CGZA 3HYRA 3GJ6A 1W4BA 5HR5A 4B75A 5JEEA 3ICEA 1YRAA 1NMYA 5FBLB 1DO2A 1Z2AA 3TBKA 4B73A 1IN8A 3IILA 5AUQA 4RZ3A 1OFIA 1NNEA 4JLMA 2P0EA 5JCPA 2FG5A 4G1UC 5AJYA 2ODNA 4MUAA 4RFSB 1ETUA 1YVDA 4HB3A 2GXQA 2ZRHA 3GLHB 3QENA 3WNCA 1TF7A 3KJGA 4NCNA 5FUYA 3CO5A 2BKUA 1U8YA 2RGXA 1ZYUA 3AH8A 1CIPA 1SVSA 2ZJOA 1AQUA 2F9MA 1KOFA 3KFXA 1R0XA 2NO0A 1FTNA 4JVMA 3AVTA 4DT1B 4LHXA 1W0KD 1JPNA 3W3ZB 1BIFA 3EPHA 4ACAA 1UEJA 2FWRA 4V0NA 2IYXA 2AK2A 1S2MA 1Y3AA 3N70A 3RANA 3IUYA 3H4MA 4B6FA 1KO7A 2IA5A 1GL9B 1G20E 5J4VA 1OXUA 4Q9KA 3AVVA 3I3SR 1EFUA 3BWDD 2ANCA 1NG9A 1XMJA 3AF4A 3U7GA 1KJYA 2C2HA 2P67A 5FR1A 1FL9A 2RH5A 1FZQA 1IY2A 1DARA 1U0HC 3K9NA 3GFOA 4NL4H 1IM2A 2W6JA 2FEMA 2WJJA 2W58A 2ZJYA 1E2HA 3WYGA 1XTIA 1OE0A 4TMKA 1L4UA 3DVLA 1X6VA 4BFUA 3CR7A 2BEKA 1Z0FA 3I61A 2ZRNA 3LFUA 1G7CA 2OV2A 3M6AA 3PUVA 2X19A 2F3RA 2GILA 1JNYA 5ANRB 1VYTA 1F3OA 4LHVA 4Q4HA 3AP1A 2R9VA 4A0RA 3CF6R 2QP9X 2RAPA 2XNSA 2ZUDA 3UG6A 2OCYC 4Q1BA
chains in the Genus database with same CATH superfamily
3E23A 4GU5A 2X8AA 2PUTA 4TRRA 3AX6A 4FKZA 5E8JA 8OHMA 2ZKIA 2XB6A 1KYTA 3ANNA 4KAXA 4MUNA 5ECDA 4O4IF 1A7AA 1QF6A 2V0GA 4GOLD 5B3JA 4Q12A 3DMHA 3R7WB 4ZI3A 4EVQA 2C31A 1L5HA 4FFMA 2Q4TA 3IP1A 4BVGA 1RQ7A 2P9JA 4HYEA 1AGPA 3NYIA 3UUFA 4XUCA 1OX6A 3A4LA 1U2DA 3OCJA 3QY9A 2I5PO 3GLGA 4A92A 4AS3A 5JJBA 1JAZA 3ZKWA 1G21E 4EX6A 4HAYA 4LRWA 2WKRA 4LW8A 4WKOA 1C81A 3WK8A 4D6XA 2R6HA 1PT8A 2PZKA 1AZSC 5A3VA 5H4GA 5J23A 2AA3A 5CDUA 4EUFA 2L42A 2XZDA 2PT6A 4Q15A 2ACEA 2YWDA 4QVKA 1Y81A 5G0TA 4M6WB 1T4BA 4L78A 3GP3A 5GJWC 1RPTA 3S99A 1IU9A 2CL6X 1EAYA 1SKQA 1V0JA 3CA8A 1ZI9A 4JOQA 2FUG1 3OZCA 2OENG 5LD2B 1HEIA 1RWWA 1XMSA 4TV9F 3FW1A 2GT1A 4QQNA 3QW4B 4AJPA 2DB3A 3ICQB 5CITA 1S3FA 2P2ZA 2B20A 3P9YA 3SIXA 3IODA 2Y6UA 2AR9A 5DT2A 4D8TA 1G8JA 1WBJB 3NORA 4FGWA 1K5PA 2PNFA 3I83A 4TVBA 2AW3A 1S5PA 5K6AA 4UBJA 3RFUA 3T5GA 1DKQA 2AH5A 2F1OA 3SI7A 1M5TA 4B45A 1Z47A 4YV0A 3K8QA 3OMLA 1FPMA 4IGEA 1ONOA 3SYTA 3H99A 3RG8A 4C5CA 3QFSA 3HA7A 1X42A 5DCLA 1VMKA 2OB2A 4M7WA 4EDFA 3IQIX 2GN0A 2VIIA 3O2JA 3HJNA 3SEFA 4EHHA 1SKMA 4HOYA 2OOSA 2XCSB 2J6CA 3Q3CA 2PKWA 3Q7RA 2F1JA 1KDTA 4HRYA 1GAJA 2ZU0C 2BEJA 2HL6A 4HDQB 1MZPA 2Q3DA 1C14A 1NAHA 4CM5A 1FTGA 1JA1A 1T26A 2ZAOA 4BX3A 1S0UA 3QOFA 7AT1A 3GVIA 4HTFB 4EX7A 5KNCA 2RHGB 2Q5FA 3H5IA 1PSZA 1OLSA 2CNLA 1GAWA 5IC6A 3GRAA 3RTCA 4CT5A 2H65A 1C4KA 3GH1A 3CLVA 3GPIA 4JJGA 3TW6A 2O4CA 1QE3A 3OQBA 4MHTA 1F4LA 2G8LA 4TTAA 4FMBB 4DV0B 1N2GA 1ZW1A 2EBUA 3LM8A 4HWSA 3B51X 4FNOA 3UH0A 2BTEA 4GXTA 2WV7A 4IZOA 2XF2A 1N6NA 4QASA 3ROMA 6AT1A 3V4LA 5JCZA 1A9SA 5TGTA 1I0LA 1RWOA 2EP8A 3DNPA 3L6UA 5F2EA 3SKVA 4BMCA 4EO7A 3WAGA 1C1HA 1V39A 4JNKA 4M60A 4DR3B 1DWOA 1Z6QA 1WSBA 2OO7A 3TLEA 3D81A 4E6PA 5FI5A 1DV1A 3FLEA 4GG1A 3EVGA 4FGSA 4AZ0B 3WLKX 3H9UA 3ZE7A 3ZE1B 3I62A 3I2YX 3OMXA 1A9RA 3UA3A 2Y1CA 3MMZA 5DNDA 1UM9A 4W9MC 4CDRA 2FGKA 3EVZA 4MV5A 1QGED 1I3KA 1IE3A 1KEPA 1T2EA 2OD2A 1SC9A 1GCUA 1R8YA 2RC6A 3QF4B 4P4LA 1E9AA 2GD2A 3FMGA 4X54A 5H81A 4N5HX 3WX0A 2F3PA 2ORYA 4KIGA 1KFKB 4QBGB 4D3DA 2XRZA 2IHTA 3IJPA 3ILVA 2IE8A 1S2LA 2ZPUA 1E7SA 1LDEA 2CLLB 2QT0A 3DL2A 3FLMA 3IOEA 4KLAA 4LZLA 5EFZA 1RWPA 4JJ4A 4FPXA 3DJYA 4OQZA 4Q9LA 4Q16A 3SSOA 5MGBA 4D8VA 2B94A 9ABPA 5D6NA 4TYYA 1VE3A 5HIMA 3C5HA 2JKVA 2HXGA 3JPWA 4BQPA 4IXWA 1Z26A 3O0TA 2C4NA 3HDHA 3RVOA 4C0JA 2NV0A 5H8WA 1ST3A 2W37A 3DMTA 2OCAA 3EISA 5LLSA 2W2QA 3M3DA 4JCOA 5M3BA 1N5MA 1ZI6A 2ATIA 4RKFA 2P1RA 3FWHA 4E2YA 1SBQA 2YXDA 1K88A 4MGHA 3WZMA 2HPVA 4YRBA 2V3CC 4L5YA 3JVDA 4FGLA 1ZESA 3ZKAA 4TT3D 1C9EA 3FVVA 1RU3A 2ISSD 4NWIA 4UQOA 1DU4A 2IYUA 1YZLA 3WLMA 4ZP1A 4IR7A 5DN6A 3TMAA 1VDZA 5LYYA 4E11A 1E3WB 3IOCA 5I9TA 2OBXA 2Q46A 3NU1A 5A71A 2IBMA 3N05A 4P3KA 4HUQB 1DAPA 1DX4A 4PFJA 2ZVPX 4UTVA 3R44A 4CT4B 5DBGA 4MAMA 5LJIA 1QJ4A 1UT5A 1JDUA 3FNHA 2Y93A 4XQ9A 2M98A 3L77A 3TLCA 4A4DA 2FPKA 2FWPA 1MT0A 3ILXA 5HCUA 3WKAA 1EDBA 3VR4H 1FDRA 3TW4A 2UU9B 4X97A 3MPUA 4F04A 3X1ZA 4HCJA 1U8AA 1YJQA 2ALJA 3OUZA 3BZUA 4NV3A 3W5JA 3WL4A 5IAAA 2HCTA 2O5EA 1UBLS 1R8QA 2BZGA 4C22A 3UPUA 1W581 2O7QA 4E2XA 5G4KB 1NNUA 3PCXA 4XIIA 2PMFA 4MICA 1W9HA 1T9GS 1X86B 2A0KA 3R0JA 4Q1EA 3TVTA 1PLLA 3OQ6A 1HBJA 4ZAXA 5IYZF 2Q2QA 3E7PA 2FZCA 4YRDA 3THXB 3FTNA 4Y7CA 3PQ8A 3HNRA 4JL5A 2PWAA 3BWCA 4PO1A 4ALMA 3A36A 3S2YA 4RWZA 2CDRA 4LHEA 1T4CA 3P9QA 1P4RA 2XUQA 4JOBA 1RIFA 2H9AA 1CUBA 3DYVA 5JNTA 2C2MA 4R0MA 4ZHQB 2ZIVB 5DWVA 1HY3A 2QLNA 2DR3A 2ZAYA 4URZR 3HA5A 1T5OA 3MJTA 1UFKA 2FSVC 3LBFA 5FB3A 2HLDD 3SLGA 2X7XA 2NLOA 2LTAA 3CPEA 4JOCA 3FB4A 2A88A 5BSKA 1AY0A 3MWLA 2UYCA 1IVYA 1E5TA 2C3MA 2VZEA 4LG1A 4Y1FA 1BAPA 4Y2UA 3DFMA 1XVAA 3FMFA 3D8NA 3RLFA 1AKUA 4HJXA 4GL2A 4RGQA 1OYYA 2IYTA 3HYCA 3H2KA 3PS9A 2C2KA 3BE5A 4U4AA 4YAFA 4ND4A 1KVSA 3DF7A 3GFVA 4MQBA 3GV0A 1PQ4A 3MUEA 1VLHA 3INYA 3NTOA 4QC2A 4M86A 1OXXK 1U9IC 2JAWA 1KKLA 1Z37A 4AJ1A 2EW1A 1HSOA 3WISA 3BMCA 3FZYA 3HYSA 4QQKA 5LQMA 4B2LA 1CUAA 2QLTA 5FL7A 5IAEA 4G9EA 3WK5A 4B33A 3U4MA 2VCYA 4LI3X 3EIXA 2GZHA 3AIIA 4QX6A 1D2MA 4ER7A 5FX2A 5IZ4A 5KTOA 2W6IA 2VQ6A 3BM5A 4G0YA 2X1MA 1W9MA 4KWEA 1YK1A 4WESB 3UAYA 1LTKA 4IS3A 5ALKA 1EX1A 3E61A 3USZA 2IT1A 2C84A 4IO0A 4CM1A 3OG9A 3NYRA 4LBZA 3ZLUA 3ITKA 4TXJA 3ZHRA 3ETCA 3EOZA 3PJFA 4J2TA 2AX3A 1L7BA 2FN7A 4KQ1A 2QTMA 3WB9A 1EJBA 3PA6A 4WSOA 2VJAA 1L5ZA 5THXA 3WGNA 2P30A 5FAXA 5AKGA 4OP1A 3RBVA 3A6LA 1NT4A 1VPTA 3EASA 1IUNA 1S02A 2YIDA 5B1SA 4URFA 2JFBA 3OAAD 2AC7A 3CVWA 4G0UA 1DXOA 1NNLA 4I9FA 4UE2A 4ND3A 3C8ZA 3EQ9A 1WRBA 2KI5A 2W2LD 4D9IA 3MMPA 1CY2A 3TSCA 4EEZA 2CLEB 5DNVA 1HZZC 3VAYA 1RLUA 2JH8A 2JVIA 2J3LA 2A30A 3COZA 2HRCA 3VC7A 5FUQA 2F59A 2ZXUA 3ACBA 4ECAA 3DOFA 1T5SA 4IDAA 3VNSA 3VYUB 1O94C 4BPRA 3H42B 4EG5A 1XK7A 3UB3A 2BKLA 3KPUA 5EIHA 3CZ5A 4DS3A 3C6ZA 5TQ0A 3RRNA 3UENA 1FW6A 3NNDA 4DGSA 4MWGA 3L6CA 2J7KA 1DBPA 2J8ZA 1QZ3A 4AY4A 2JGFA 1TZKA 1E79D 3RU9A 1U02A 3ZK7A 2XLBA 3WY9A 2IH5A 2X5JO 3QPBA 3HY3A 3WOHA 5IM4A 4QYIB 2CL5A 3EIHA 3L0PA 2GFIA 3TJZA 1T29A 4PZUA 3NHPA 1UKEA 1YCFA 1WS6A 2PQ0A 4POOA 2DHDA 3BCSA 2VPQA 2A94A 4ABTA 3M5CA 1BDBA 4WX2B 3JRXA 4V1CB 2NNWB 3LRPA 2O05A 5BN4B 1PS8A 1W73A 1GYPA 4Z7OB 5AXBA 3NTVA 1NBMD 4HNTA 3JQGB 1CWUA 2W6NA 4RIGA 4PX5A 4XUGB 4H4EA 4K0RA 3SIPA 1TTTA 2Q1WA 1QNFA 2R96A 5M2QA 4UDYX 4I1OA 5K2OA 1E1CB 1C8KA 3F2IA 3N6RA 1YIAA 3I3OA 4MW1A 3TE6A 3ZD8A 1Y8QB 4IWYA 4JV5B 2OBFA 4C76A 3H1GA 4JXJA 1K6IA 1LLQA 5E95A 1VP3A 4EZIA 3F4BA 2WDPA 1TJ3A 3HU5A 5LJLA 5J4YA 1SRQA 3VA7A 2XNKA 1XZCA 1TU4A 3KYDA 2BGTA 4MUKA 4D5GA 1L1QA 1U2GA 4F3RA 2G77B 1GD1O 2WF9A 3BILA 5JS7A 4KR2A 1F7VA 1CJSA 4KE6A 2CK3D 3C8HA 4KQJA 4RVUA 3PWTA 3VR4A 1NDUA 4X3PA 5JASA 2Y0DA 3AF2A 1GY8A 3UKJA 4IHQA 1SBZA 4X6UA 1B8UA 3GFSA 2PRIA 3QPUA 3TPZA 1H6DA 4HDRA 2HCFA 4DCGA 5IASA 1SD5A 1AQYA 3VDXA 3IR7A 3FAZA 2W6JD 3BJIC 4QNNA 3TLYA 4O08A 5KYYB 5LQSA 3L01A 1T13A 4F1WA 1SU8A 3IPXA 3BQNB 2I33A 2R5NA 2VXOA 2IDMA 3D3NA 3DTYA 4O1HA 1F8YA 1NM5A 5T4FA 4WJLA 5A5EA 2FE4A 3OY7A 1ENZA 2JLVA 3WK9A 4DIEA 1EE2A 3Q8XB 5GOZA 5JE8A 2V6IA 5BT9A 2B0JA 2WJYA 3GJQA 3REQA 3ZU5A 4BN0A 2NVUA 3NCTA 3DMPA 3TG8A 3AFIA 3WIDA 2WVAA 3HB7A 1GRVA 2G0TA 4LSGA 3M6XA 1E1KA 4M7PA 5AR1A 3DR3A 2RCYA 3UAVA 2Y1DA 2GPSA 3C7TA 2GA8A 3L7YA 4Y1GA 2ZVQX 1D7OA 4PGGA 1YTUA 3ORQA 3ROKA 1CJUC 2IP2A 4QPZA 4KIJA 5C8YA 2X8LA 1A98A 3RVMA 2PMCA 3A04A 4MR7B 3CWZA 3D7RA 1WVGA 2PX2A 1AKYA 1VKHA 4DM7A 3TLMA 1ICEA 1ISFA 4M9UA 1TCAA 1TQ8A 1GNSA 2TMDA 2QTNA 3LPNA 4FCCA 5HBRA 3ZTWA 1P4HA 2IEDA 2RHDA 2PL3A 1CJBA 2WIAA 1B0ZA 3BDAA 5CNKA 3HKDA 1T4DA 4BVBA 5F2NA 2J32A 1T9KA 3S27A 1PSDA 3AVPA 5G02A 5JTUA 1OFUX 4MW0A 3RYIB 2GMWA 1FP7A 1X7XB 1XNHA 1KH2A 5E2BA 2CXRA 5COBA 1XQVA 4TUYF 1THTA 1CQXA 5FI3A 3QMWA 2PSJA 3U09A 2Q49A 1N1EA 3HEBA 3N39C 2WJZB 3BMNB 1HT1E 4Z0PA 2AHOA 4G0VA 4ALIA 4EB6B 3UGQA 1NR7A 1LI4A 3FI0A 4UUNA 2OV3A 1CJVC 1CR0A 1CQJA 3GRFA 3H18A 1W5AA 3LGSA 4JUIA 4QGBA 3ZVLA 5HFJA 1VL8A 4G0MA 1M1YB 1LCIA 1AC5A 1F5SA 2LP4Y 3FF4A 2X15A 3MQ4A 4NJMB 3T5DA 4CLDA 2D6FA 1RZ3A 3DBRB 3PCRB 3O8RA 2PRYA 2XVYA 4P7KA 2IFTA 1E6EA 3OPXA 4ZRNA 4OX9Y 3FIUA 2B4AA 1XPRA 3C1UA 1XKXA 2ZYTX 5AM0A 2P9QA 2MSLA 1DIHA 2XQKA 5AH0A 3WRYC 2IU3A 3WICA 4RESA 2ABWA 4AT1A 2QN6A 2ZRJA 4KR3A 3KYBA 2O06A 1JG7A 4H1HA 2O0LA 2XJ9A 4KNWA 3T7DA 2O7SA 2XWSA 3GBPA 5K20A 3QF4A 3UMYA 2PQ2A 2XAAA 4V0OA 4TSRA 5E7QA 4QXQA 4DJJA 5BQ5A 3GOQA 1TEZA 1VLQA 3LT1A 4F45A 1OJLA 2N42A 4F91B 1GFIA 5E2IA 5HKLA 5M04A 2GVZC 4PC1A 1ADBA 3TLZA 2GERA 4H3HB 2VDWB 1DX6A 1S3SA 4ZV7A 5HF6A 1RACA 3QJ5A 1ZRNA 3V4SA 5JYCA 1XDDA 5DX8A 3GPCA 4L5JA 1ZSYA 1JTFA 1BXRA 1SK9A 3TOCA 3I01M 1BFDA 2W43A 3B1FA 1IUOA 4IGIA 2DKFA 2AOTB 4WGGA 4L85A 5DKFA 1WXHA 1RYBA 2ODAA 4RKRA 1T9DA 1XJCA 2VA9A 1SXJE 2O0JA 1U7OA 2OFPA 3E7WA 4H3SA 4PHCA 1QTNA 4RK0A 3FNIA 4JY7A 3LDHA 4UDOA 3V1LA 1JIXA 5IJ0A 5K6RA 1W4AA 2GN6A 4FFDA 4TTRA 2JHFA 4KQWA 4UZSA 2EERA 2IXDA 4R8VA 5CT8A 4ZQFA 2WJ4A 4WBNA 4RMIA 1T0UA 4REQA 4DDTA 4HEA1 1WUIS 3L3BA 5G53C 4ZI5A 1N3LA 4AP5A 5BV2P 3EMBA 1Q1GA 5H68A 1FMJA 4YWHA 2Q8QA 5K6AC 4P4GA 4CMHA 3GUCA 3WWOA 4IVPA 4ID9A 3WYNA 4EI7A 1LNQA 3IO3A 3T3GA 2DH5A 1DUVG 1IFXA 1O6FA 2ONCA 2AG0A 2H1FA 2WIGA 1FDIA 4OVKA 4D81A 3N87A 2D1QA 4IX1A 1CU1A 2Z9CA 4MYCA 1Z8NA 5FI1B 5BWBA 1HQDA 5AI0A 1YR9A 4HNAB 2DTXA 5FA5A 4DSOA 3NJ4A 2WAOA 1SHUX 4OHOA 2NVBA 4KRYA 1TC2A 1XDZA 4PEVA 3NALA 3T1VA 2HIHA 4H4DA 2G9NA 4R9NA 1URPA 5IF3A 4BNDA 1N6PA 5EHXA 4TTVA 2C7QA 5TIIA 2MOKA 2Z98A 3PF8A 2EFDB 2W8BB 3H8SA 1CBUA 2O8FA 1P0FA 1QZXA 5B1IA 5CA0A 1U5AA 5CW1A 5ULLA 3K5WA 2OECA 1G6HA 5K03A 5JQWA 3RYTC 3ES9A 2EKZA 2C1EA 4I5GA 1O08A 2I3AA 3K1YA 1A9QA 1LLDA 2Q4EA 2QTCA 1EVEA 3PEVA 4FC6A 4JWTA 3MINB 2Z9DA 4M0UA 3KL4A 1QHNA 4KPYA 1IUKA 1ZJ6A 2X4IA 3BTSA 1DC6A 1WMSA 3DQQA 4UREA 3ANSA 3OCVA 4BNWA 4K3UA 4KQKA 4MVCA 4UAJA 5C4IA 1QM5A 2FEWB 3VO8A 1C8VB 3KBBA 5JADA 1PFVA 1PUXA 3O4RA 5DHRA 4YMUA 1YIOA 2OWEA 2X9LA 2WUGA 4TSFA 3ADCA 4J4HA 2J6IA 2JLBA 2WHPA 3UJBA 4GE3A 4I14A 5K0LA 2IEIA 2V7VA 3NUQA 3I72A 2IYAA 1NYQA 4HRAA 3MN1A 3QPAA 5EJIA 1SKYE 5MN6A 4MA0A 1PK8A 4AO6A 2HF2A 3BB3A 1KMMA 1RBQA 2M9MA 3IIEA 5DX1A 3ZHQA 1VE1A 4YRIA 2CLDX 3LGXA 4YHBA 1BKDR 3UHPA 4FX5A 5KOYA 1IG0A 2HJRA 3O2SB 1STOA 2ECOA 3SHWA 2WTUA 1G3IA 2A59A 3B7PA 1JR3E 1O95C 1VSUA 2R6R1 3ETHA 5ELMA 1UPBA 1OBFO 4X3OA 5JXJA 2YMMA 3SF0A 1SUSA 2ZIZA 5CB4B 1J7KA 1WE2A 5K4GA 4B6EA 3FI9A 2C3OA 3WLRA 2OCIA 4R7ZA 4DHEA 4S1NA 4AKHA 2FFRA 1SULA 2EC5A 4MS3A 2WWFA 1A1VA 1V6AA 1T0HB 3OZVA 3M2TA 3QFFA 1H4SA 3IXMA 5ALQA 3MXOA 3G13A 4YAJA 3V1TC 3H4VA 1C2YA 1Z6AA 4IDDA 3D02A 4U6QA 3L2OB 2GF0A 5K99A 3I04A 2OWDA 1CVIA 1XC7A 2H4ZA 3EVDA 4CV1A 4AY5A 2PEZA 5JYBA 3SX0A 1OWMA 1XZDA 4MDFA 4V38A 4KWHA 1QFXA 3EEIA 3DD5A 3IKMB 4TLMB 3RHTA 2WTNA 1QC5A 3RRYA 3AZQA 1DNPA 4OI4A 4AD8A 2PZBA 4EY3A 5BNIA 1BGWA 1UADA 4DR4B 1EG2A 1U81A 2LDXA 1KORA 3EDCA 4UVDA 1KJ9A 2GEUA 3EUWA 4WJKB 5KHLB 1P75A 4BZZA 4YGYA 4G2NA 3SICE 4AP9A 3MTDA 4GVPA 4ZAVA 4JQSA 2VJCA 5EKXA 3KVNA 3V4OA 1EX7A 4EHBA 4LXTA 2Q4OA 1JUDA 4IQ4A 4P7BA 2EWMA 2PJZA 1EM6A 1E4VA 1MR3F 1YDGA 4XGRA 1J39A 3SBDA 3USES 3AR5A 3L9WA 2AOUB 3IMEA 3ZK9A 4DMKA 4ZJUA 3C74A 3TW8A 4CTJA 1U6KA 2HA7A 4TRMA 3ZJTA 3O4VA 1MAWA 1BDHA 1LDGA 4O4JB 3TLBA 5LA6B 3WGMA 1OIVA 1GR1A 4FCWA 5EHGA 5F7ZA 2GNPA 3SZOA 1I2AA 2FR0A 2YWRA 3TN7A 1K89A 5CLHA 5ESRA 3NT5A 3QBJA 3X3HA 5LBUA 2HEGA 2N46A 1U0OC 2HFJA 3VNQA 4EOGA 3FYTA 1VJGA 3OPNA 2KWIA 1W59A 1I3NA 3PSHA 2VP6A 3B70A 4ZRDA 2GPTA 2R66A 2PG3A 1OU0A 4ZJPA 2XLCA 1QOQB 3FYUC 4C6TA 5H1YA 4YFYA 2I99A 1EFRD 1Z18A 2H3EA 1T9BA 2OYSA 2ZAMA 3ACDA 3AWDA 1POXA 3BRWD 3NTUA 1P29A 1KZ6A 4PLPA 1NFFA 5E6SB 3B7GA 3STYA 3EY9A 4BB0A 2B30A 3H9JA 1ATZA 4WWHA 1V26A 1XKQA 5IABA 4MVYA 1XQXA 4UU7A 4ICIA 4IP0A 4Q7MB 1OXVA 1IH8A 1X1BA 2IZ6A 2F00A 2G5CA 3KLPX 4GR4A 4WY2A 4GSLA 4Y2XA 4US2R 5JYEA 1R4NA 1R66A 3JQ7A 1WY7A 4D0NA 4J1TA 4GL4A 4G0QA 3NBZC 1N7HA 1Q7TA 3OZDA 1WABA 2O0KA 4CXMA 4LNUB 1DXYA 2X4DA 3H11B 5LOVB 2Q5JA 2I8AA 2H7YA 2NSYA 3LL4A 1PNVA 1C30A 1CVLA 2FMIA 1TVCA 1RRGA 3O31A 2CVQA 1GL7A 2WYIA 1Z82A 3PRJA 5CVVA 3G9TA 5LOVF 5FKJA 4U2CA 1T6BY 2PVPA 1ZNZA 1SOUA 2VPYA 4N3NA 4TMYA 4DG5A 3DV0A 5MF6A 1XCGB 1R6VA 1SZCA 3N2KB 5BSHA 1PE0A 1U9IA 2QN2A 2FMUA 4FN5A 2JIDA 3WZ2A 4BV8A 3O94A 3RRFA 1TYEB 1CG6A 4YCJA 1KDYA 3E8MA 2GD0A 4GQAA 4M9QA 5HDBB 3RROA 3A9RA 3MSCA 2INGX 3EGDB 5IH3A 5FYDA 3HL4A 2HHCA 2HMVA 2Y4OA 1YDWA 1Z3CA 3AEUB 4XPIA 2EJUA 2RGGA 1NQOA 2NU7B 2VK8A 3AZPA 4D0LB 3ILYA 3EXHC 4R3UC 1ZJYA 3JD1A 3MTGA 4TV9B 3QWHA 3DMRA 1PR6A 5FUMA 3W05A 4PLHA 1T10A 1EVIA 2WUFA 1B6TA 3IIIA 4UAGA 5KI6A 4MNTA 1FSPA 1PW7A 2VJMB 4CDGA 3CZPA 3AM5A 4D98A 3B8HA 1OX4B 3CZQA 4F56A 4EZBA 5LQDA 2ZT8A 4YRPA 2BFFB 2VR1A 2R86A 4J1QA 4LE2A 2CD9A 2LVBA 5JQGF 5J40A 4MO9A 2FOXA 3AERB 1Y5LA 4EK9A 1V7PC 2O8CA 4DFDA 1A7KA 2XMDA 3CFYA 2A5JA 4TV8A 5JD6A 4DLBA 1N75A 3S1SA 2FK8A 2ZUCA 5FULA 3DKRA 4OQLA 1NJ1A 3QXCA 3ZCRA 4NPHA 4PGMA 1X7ZB 1JEDA 3QX9A 5H02A 2WYUA 2NX2A 2CJXA 2YQ4A 2I7VA 4HYYA 1XGKA 2QU8A 5AW3A 5CFNA 2Y05A 4G84A 1HT3A 2YFKA 4RM3A 5F1KA 3TRJA 3V97A 2H17A 3GDGA 4D0RA 2O8BA 1GITA 4BVEA 4D4HA 1FVOA 1KE2A 3EJ6A 2NVUB 3WWCA 4YUAA 2IX3A 3KU4A 2JFUA 2Q5EA 2WJWA 1ISGA 4Y1EA 4D4MA 1FP4A 3AHJA 4WN9B 3WRWA 3A9TA 3Q0IA 5KOIA 3F6SA 3LHKA 4N5DA 2JAPA 2VA8A 1T2DA 3W5UA 5U9CA 1KSFX 3N7UA 5EZ5A 1DCTA 1QZZA 4CUKA 2HK6A 2GJ4A 1BHQ1 1XYGA 4GPEA 3RVRA 4QUHA 1ID8A 5BT8A 3B60A 4Q21A 1W1UA 4RULA 1UWVA 2ZRIA 1T5LA 3K30A 3V7NA 1LKZA 1LNSA 1WOMA 2HF8A 2UDPA 2V4MA 2C5FA 3QYFA 4YQEA 2DF8A 2JJ2D 4YJDA 3PGKA 3STWA 3CV3A 3U4DA 3VO9A 5EWLB 2XWQA 5K0TA 4MDEA 3VR5H 4DLVA 4WOPA 2HSGA 5EUQB 1NDHA 3AW9A 2IQIA 1RI1A 1VI5A 2H1IA 2PS1A 4OBEA 3PHHA 3TIVA 1T1EA 2AF4C 3F5DA 3KAKA 4TKVB 5FOSA 5EOVA 3T1OA 4BE7B 4N65A 4L2IA 1U9JA 4URWR 3TCKA 1M2VA 1OYWA 1X9HA 4YCAA 2FW0A 1W36D 1ZSNA 4RVFA 4Y2SA 4LFAB 3RW9A 1XR3A 3T06B 3G7SA 1Z2CA 4RPJA 2ZJ1A 2ZJFA 1EKXA 2PWBA 1BOOA 3KEQA 4B47A 2DFNA 1DEKA 4KREA 3GLTA 1J56A 1SU7A 4X7MA 3AF3A 1DQYA 2PZAA 3ETDA 3KB8A 3OF5A 3ZHOA 5I7UA 5EP4A 4KFCA 3TUIC 1WUTA 2G63A 4NJMA 5FCDA 3QFRA 3IE1A 3T4PA 1DFHA 1BXRB 1KDOA 1ZD8A 3LO8A 3L7CA 4ACBA 4EG6A 3D6MA 3IUMA 4YDSA 3RREA 4AXXA 4D4LA 5BN4A 3D3WB 4XSGA 5HOEA 2DHQA 2GAFA 3GIDA 4IEFB 4B3DA 1E7WA 1GLGA 4R7GA 4NXMB 1Q0PA 3UJ6A 1VL2A 2H1HA 5KBYA 5L3VA 8ATCA 4Z2YA 4Q7JB 4ZK2A 2X3YA 1YQEA 3BIOA 1D3AA 1BCRA 1QQ6A 1TVKA 2RGCA 4L8GA 2BZ1A 4R3WA 4RVHA 3KKKA 3GCDA 3ZU6A 3TFOA 4Z7JA 1UBRS 4F72A 1JALA 2BGMA 2P3OA 2VF7A 3KNZA 3QYJA 5AJUA 5DIFA 3RCBA 2G17A 3LP8A 1E9BA 4G8DA 3GN1A 4RE5A 2NUAB 4TWBA 5AVTA 1OBVA 1CQZA 1MENA 1E77A 1PQYA 3LLUA 4XIFA 4DQ0A 1MHPA 4EO4A 1ECCA 4X95A 3BQMB 3WSTA 4NTZA 4FFSA 1UM9B 5IEBA 3CEJA 5TS2A 1M6WA 3OT1B 3QMPA 5TDHA 4FYWA 4IMIB 3O4HA 3ZCTA 3S8YA 4OHCA 2XUJA 1XA0A 1XZ8A 5HEKA 4RJIA 2XCQA 1V3VA 2X0RA 3VUFA 4HNUA 3T1HB 5BSUA 3KCNA 4UBOA 3ZD6A 4PQYA 5IU6A 1MQ9A 1CUCA 4XJSA 1GEEA 2W98A 1H3EA 4FX2A 2BHRA 2JGLA 1XB2A 4COKA 3OQOA 1Q0TA 2B78A 1MLDA 3CF0A 1IEWA 4PRZA 4KO2S 5CIWA 1BEZA 5JZ9A 1N7GA 1G38A 4DA0A 3QYAA 2IXBA 5IKPA 5D7NA 2GBFA 4WBXC 2IS2A 3AY0A 3LX5A 4Q24A 1ETHA 3IEUA 4NC9A 1U2DC 4Z2AA 1F17A 2G5TA 3MFQA 2H1RA 4FEYA 3DT9A 5JAIA 1E0SA 3KUDA 2R84A 1BFKA 1E6WA 3PI6A 4EPXA 1AGYA 1J8DA 1K5HA 3I58A 1HDYA 1YDEA 2F2TA 4U9HS 3EIOA 3GJ4A 1DT3A 4PX2A 5LWHA 2QPAA 3TPFA 1Z4QA 3ZD7A 2H2DA 2UVPB 1OLSB 1W4ZA 3VVLA 4W5WA 3RS8A 1AKMA 3FN4A 3CBGA 3QWFA 2QTRA 3VTFA 4XH9B 4DRZA 4EFMA 4ENWA 2YY5A 2G83A 4BUZA 1TKAA 1WZ2A 1HLFA 2F1HA 2VHCA 3ST7A 4E6EA 1L4EA 4GRAA 3WOVA 2QI9C 1C0IA 1VLMA 2DWUA 4RQBA 1M6HA 4F7DA 1PBTA 3P52A 1AMOA 2WILA 3IUQA 621PA 2XZTA 3WFIA 3HB9A 1TA4A 3CPHA 5FWNA 4JYZA 4C4SA 1RM4A 1ITZA 1YBMA 3WMFA 1VA5A 3NHRA 2RGRA 3D6FA 1G8YA 1GDHA 1LRLA 3LL7A 4GZ5A 4Z9YA 4BFWA 1ZIXA 3NLLA 5HTKA 3TZCA 4H7PA 2FW6A 3UQZA 2PUAA 2EZTA 3G8BA 3IJEB 2BGLA 3CS3A 3DB1A 1P81A 2Z2JA 2QQEA 5GZ1A 2OAGA 3Q3EA 4TROA 3TOSA 4EF4A 4YT4A 1M1YA 2GBLC 1P2VA 1C3OB 2Q6IA 3Q3HA 1AHHA 1XCOA 4D41A 4ZOAA 2PQMA 4AY2A 5THQA 3IT0A 2PRSA 1UBHS 3HKCA 2WJHA 1PFKA 1R0RE 3JQAB 1JSRA 3ISVA 3EY4A 2OVFA 2Y9MB 3DL7A 2Z5FA 1K5GA 3RJ9A 1KEKA 3TIFA 1K9SA 3A2KA 3PL5A 1JPJA 1ECFA 3QWAA 3CUTA 4E1BA 1PZEA 1MMFB 1N3BA 3G2MA 2IY7A 2GJKA 4HMPA 1NXWA 1G60A 4OQDA 4H7IA 5BRAA 1X8JA 2V6BA 2WZQA 2X7HA 3N86A 2BSQA 2OL4A 2F3UA 1I3LA 2V0NA 3DOOA 4GWLA 4E14A 3DV9A 4IMPA 4QU5A 4KLCA 2JLUA 1UDCA 2ILTA 3PXDA 5DZSA 5LCXA 2KPOA 2XCIA 4FBMA 3AY7A 1XZBA 5EJMA 3PQFA 1KO5A 1GNPA 3PPXA 4O2BB 4RPKA 3H1EA 3HC7A 1SMKA 5KNBA 2QQ0A 3PNOA 4YLYA 1JP7A 5JI3E 3A4VA 3E1SA 4Q39A 2QTTA 1KYVA 1HORA 3PXBA 1F60A 1NW7A 4QXOA 1CUHA 1HYQA 2Z09A 4KE8A 4AO7A 1A2KC 4E21A 1RE1A 1TCCA 3W5IA 1Q77A 3WK6A 1NW5A 2IYVA 2UZAA 4J3JA 1GNVA 2PJRA 3KFVA 3J80A 4E0BA 3GEEA 3QNMA 1B43A 1NP7A 1LGYA 3CPJB 4S1OA 3CNLA 5AJZA 4BTEA 4EKIA 5JFOA 1F8UA 4V1CI 4U2KA 1H9BA 5K3AA 3DC7A 1KI7A 1W5FA 3THRA 2EJBA 4A6DA 3HFSA 2I4TA 4PC3A 3O8OB 2G06A 4LNHA 4K81B 4NFYA 1UC9A 2QHXA 5LA6F 3S40A 2MU1A 3T7RA 1TT5B 2J30A 2DT8A 2PE5A 1Z4MA 3IIKA 2HMTA 5DGIA 5M5BA 1YD7A 2RGYA 3RS9A 4ZJYA 2FX3A 4MRVA 5CFPA 3QEJA 2J3MA 1ONSA 4OJTA 5EY5B 2A5DA 1DTWB 2JGDA 3MBKA 4C2TA 4CLRA 4OQQA 2PT9A 4ARBA 2XRMA 3ZY5A 3MERA 4BO1A 2FEOA 3RSLA 4GKAA 2AVDA 3D5QA 4OKSA 3SGLA 3THXA 1DDOA 1RQXA 3FDZB 3FG9A 1EK1A 1LW6E 1UXOA 1ZD9A 3CGGA 1VLZA 3NZEA 4BGEA 2R00A 2ENWA 3VHXB 4G37A 1N5KA 1GR0A 5CT6A 4DIKA 2JIMA 3UK6A 3RVNA 2HM7A 4DY6A 4ZZ2A 4EW6A 2M6SA 3U3OA 1Z0DA 4XWTA 3B8EA 4OFXA 3FFAA 4BQNA 2X3UA 3DV0B 4RS3A 4XD7D 4TL8A 4M9XA 2XD9A 3C6YA 2F1RA 3O83A 1ZQ9A 3OE4A 4A91A 3DL0A 4D9MA 2VK4A 5CYGA 5IHXA 3BRSA 3VZCA 1AUPA 1CY6A 3MXTA 2Z2IA 3KOWA 4OKIA 3RWBA 4R1QA 3EC7A 5IM5A 5BN3B 5HRCA 5JNVA 1K92A 3ID6C 4KO8A 4J16C 3UAOA 5LP6F 3USCS 2OVBA 3RFXA 1KIFA 1T0JB 1QYXA 4NONA 1GCOA 4P35A 3RF6A 1BGVA 5KWIA 1KQOA 3ULKA 2HQBA 3SBOA 4MEAA 3HDJA 3EAGA 1ZUWA 1KZHA 2QE6A 4Q1FA 2GBGA 2FP3A 2XUPA 3K3PA 3QUCA 4QICA 4CG2A 1V16A 2H4FA 1NSFA 1Z7WA 2KB0A 4FEAA 2GARA 1EIWA 1UMCB 2YYYA 1P39A 5IW8A 1IM5A 3GVCA 3KXLA 3L6EA 3SJAA 2NP7A 1Y8QA 2GTHA 4M0PA 1L5RA 2ZR8A 1VG0B 2YWHA 2JNWA 1ONBA 5DYYA 2I3GA 1JJIA 5JALA 2ROQA 4OGKA 1KO4A 5FOWA 2XXBA 1M8JA 1N9KA 3V8EA 3NQ41 5JZBA 3R6GA 4X20A 1H3FA 2O20A 3VHLB 1SKAA 2FZEA 2FSVA 4EZEA 3H87A 3MB8A 5H9WA 1ZC4A 2PL5A 2VKTA 1Y8RA 3LOUA 1QRDA 3AEUA 4B83A 4QHYA 1DLJA 1UBMS 2KBFA 1E3EA 1B0AA 3OJLA 1F2TB 4DAEA 2I1WA 4FMCB 2PWZA 3ZJVA 3ZV4A 3VOBA 3L8GA 4C5BA 4B35A 1JQJC 2OCKA 3VPDA 3SHTA 2XDWA 4EA6A 4HADA 3RC3A 4KBYA 2EZ9A 2IPNA 1ODFA 4PZAA 4RTJA 1UT6A 3G6WA 3MB5A 4C4RA 3V2HA 3T3HA 3UJ8A 3B6EA 2PDAA 1ZD5A 3KTFA 5TQ0B 2XMQA 4EKEA 5C4GB 2PXHA 3CLUD 3B7WA 2YR0A 1X15A 4JLPA 1Q1NA 2WSYB 4G2TA 4MMZB 2LV8A 3FYUA 3LP5A 2FMTA 3A31A 5EGSA 1QGYA 3O9ZA 4H7DA 4GLOA 2XUKA 2O07A 3UATA 4IY1A 1Y1PA 4OJYA 1CNMA 1JFRA 2GEVA 3NXSA 3W1VA 3WGGA 4UMFA 4JKIA 5IXSA 1NMZA 3FXAA 2VYFA 2QENA 3GDWA 3H0CA 3EF3A 1V43A 2GDJA 2RONA 1RRVA 2V8OA 1SCAA 3GFTA 3P71T 2PHZA 5CNIA 4JJFA 4WN9A 5C3MA 3VOAA 3U49A 3A3NA 3FNEA 3KYCA 4UUMA 3SIWA 2XZLA 2SHKA 4KLRA 3KLBA 4DUGD 3LPLA 5LMZA 3BPSA 2WYHA 5CDFA 3Q5GA 5DDIP 3GRVA 1NW9B 3DE6X 4M1KA 5B4TA 1Y3HA 3QIAA