3TNFA

Lida from legionella in complex with active rab8a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
170
structure length
170
Chain Sequence
DYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Ras-related protein Rab-8A
publication title Protein LidA from Legionella is a Rab GTPase supereffector.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tnfA00
4RZUA 2GCOA 2IHBA 1NMZA 1XTRA 1OXTA 3FKSD 3VKGA 5FUVA 4PSKA 4A6PA 1BO6A 4AG5A 4LYFA 3B1VA 3B82A 3NBFA 4QBGB 5BYJA 1XFAA 1VG9B 4DDWA 3BD9A 5E3HA 2GZDA 1J8MF 1XXHE 3OEEA 4QGAA 4U7DA 2O8FB 2VF8A 4POAA 1IONA 3SU8A 4QNMA 4BLPA 3AGQA 3ZS9A 5J4HA 2RGXA 3A1UA 4NZYA 4AYTA 3AM1A 5KSPA 1S8FA 1EFHA 3CRW1 3UMFA 1E2PA 4IXMA 5DYGA 5JSZB 1GDDA 2AK3A 3NH9A 1QVRA 2WIBA 3ZH9B 5AUOB 3I32A 2AXNA 1G64A 3WP1B 4NYMR 3B6EA 5TB5A 3D3QA 1RJ9B 4Q1CA 4XTCS 1RVDA 3U3MA 4D0NA 2JA1A 3OEHA 1GVNB 1I4TD 2WWHA 3OIVA 2FFAA 3CBQA 5DE3A 1KJWA 1VG8A 1GWNA 3KUCA 5KUTA 1LFDB 2AKAB 3PEUA 1UEIA 2NIPA 1ZM9A 5TVKA 3SFVA 3QIAA 2D3WA 4O2LA 1R7RA 5DI3A 5JJKA 1QZXA 1E1QD 1TUEA 3QF4A 1SHKA 2EFHB 1JAIA 4A2QA 1NJGA 3V9PA 1TPZA 5CLLA 1NMYA 2IWHA 2Q21A 2Y8EA 3GLIA 3LD9A 1Z29A 3DEFA 3N70A 2N42A 2P6NA 1NG1A 3B9QA 1F60A 1DO2A 4A2WA 1P72A 1OIVA 4AD8A 4BASA 4R2HA 1E1RD 2BEKA 2CJWA 3SOPA 3BAFA 5ELXA 2PEZA 1IJFA 4PAMA 4NONA 4TYNA 3BB3A 5G40A 1A2BA 3RDPA 4HLUC 2PX3A 1OB2A 5CK4A 2JLRA 2XSZD 2FZLA 1QHSA 4ESHA 3DM9B 2ZRIA 3FHOA 4TMWA 5JJIA 1X8KA 2VLIA 2WWIA 2CE7A 4ON9A 1E9DA 1G20E 2AFHE 1ZM4A 4GFDA 2FPKA 2PL3A 3R7WA 2ASEA 1U8ZA 5KNBA 2FSFA 4RVCA 2O8FA 4TSFD 5FTJA 3O8CA 2MSDB 3P20A 1CJKC 4MYTA 3W90A 4V0MA 1MRNA 2OXRA 5G3YA 3QI2A 4TQ9A 3QG5A 1KDPA 5AUQA 4TMKA 5J40A 3VR6A 2WPDD 3IHLA 6Q21A 3KQKA 1SKYE 5JSZA 1YVDA 4V0NA 3ZZUA 1KDTA 2AD5A 2ZJBA 1XCPA 4D25A 5DH9A 2GBLC 1VYTA 1I2MA 1RJ9A 2BC9A 2CDNA 1CF4A 4Q00A 4AC9A 3OESA 3VX3A 2IXFA 4ZO4A 1P9RA 4CT4B 3M6AA 4ZI2A 5FBRB 1M7GA 4Y0VA 3PFIA 1G3QA 2ZU6A 2QPTA 5C4MA 4PQFA 2OUKA 1OT3A 5F3WB 1OH7A 4CEIB 4ILEA 3QY0A 4PHGA 3U3JA 2J59A 2QGNA 4URVR 3WRXC 4G5RA 1E2LA 4JLKA 4DHEA 4US0R 1M7HA 3A1TA 1E6CA 2X8AA 5FUYA 1JPJA 4PPNA 4M1SA 3UWOA 5EE1A 3TVDA 4HZUA 1II9A 4TLCA 4DEXA 1YR6A 4ZIRB 2H57A 2ZRPA 1Z6AA 2VH5R 2ZI6A 3MD0A 2JLZA 3R9WA 5JWRA 3IEVA 2XGJA 4G5OA 2I3BA 3AVUA 1U9IC 2C95A 1P2TA 5CJ2A 2IS2A 2FGKA 5C46F 4PZLA 5LD2B 2GVDC 4W5WA 5K8IA 4B3GA 5KDOA 4TLDA 3UANA 4WIAA 3LXXA 4LC0A 3VR3A 1U0HC 1H8ED 3QXHA 1AGPA 2ATXA 1E79A 2PMDA 1IN8A 3KKPA 4KLZA 4LJ4A 2PJZA 3K53A 1NLFA 4DEYA 3OZXA 1HURA 3THYB 3JVVA 4Y0AA 1KMHB 1OFUX 1Z63A 4JLOA 3FFBA 1Z22A 2GF0A 2VEDA 4JJZA 3DL0A 3GQBA 4XJXA 4FIDA 2R65A 4Z1MA 3R8CA 4W9MC 3MSXA 5FTLA 2RAPA 2RHDA 3AV0B 1Q1QA 4Q02A 2ZJ2A 1LF0A 4XVUA 2GK6A 1MV5A 4GL2A 1DAMA 1NVXQ 2R9VA 1AKEA 2PT7A 2NQ2C 4CEIA 4WAUA 2EWVA 1XJQA 4KI0A 4BFYA 1E9CA 2EQBA 4A8JC 1OHHA 3GJ0A 1P5ZB 1ZNYA 3EZ7A 1YQTA 2ZRMA 4GOKA 4NKRA 4XSHA 2R2AA 3TSWA 1IQPA 3I3SR 1OIXA 1XTQA 4DUGD 1UBFA 3AB3A 4NDZA 3X1DA 4W5JA 3TAHA 5JECA 1ZNWA 3NBZC 1R4AA 1QG4A 4ZCMA 4CT5A 2JDID 4ZIRA 5HKKA 3ICQB 4KHZA 1OPXA 4PPGA 2GXSA 2DCUA 2CL0X 3C5CA 1SULA 4IOJA 3PXGA 3TSZA 4DDUA 2W2TA 1G7TA 3GEIA 2MSEB 2MMCA 1G5TA 3U6KA 1W2GA 3LDAA 2P5SA 2KSQA 1CXZA 2G77B 4KBFA 2ZR0A 1I4DD 3CM0A 5KO2A 2ZUBA 3NIBA 2BIFA 3T1VA 2IC5A 4B2IA 3PUVA 4P4SB 4A0GA 1CRQA 1BMFA 1KO1A 1XTKA 5EP4A 4HATA 2HJVA 2NO1A 3THYA 4IKEA 3T1QA 4EPYA 1KMHA 2ZVPX 1Z0JA 2I1QA 4TT3D 5KHOC 1GSIA 1U2RA 4ZKEA 2VHUA 5FPSA 1SVIA 4NH0A 5M04A 3ICEA 4A92A 2AK2A 1BYUA 1T3LA 1XX6A 2O52A 3KB1A 2VHQA 3FWYA 5LB4A 4XIGS 4MRSA 3QPUA 4PR0A 2Q0HA 5CDFA 2WMOB 3CPJB 1KNXA 5TARA 3U7GA 2RGCA 3SE0A 4US2R 4TLEA 2B8TA 2HXYA 1IXRC 2F43B 1OFIA 1N6NA 5FTKA 2O8CB 1PLLA 5KPDA 2B7CA 2ODWA 2V55B 1LS1A 4S2EA 2XAUA 4JYCA 5A0FA 1SHZA 2LWIA 3AF1A 3U60B 3GCGA 1XJCA 2ODNA 3PITA 3H4MA 4D26A 4Q1AA 3ZJYA 2PT5A 1MO4A 5AJZA 3HU3A 2ZI3A 1DAFA 3GP8A 4ZV4A 2RCNA 2ZYUX 2W6JD 2ZR7A 1Z47A 2BMEA 4C3ZA 3CONA 4Z51A 1MH1A 1J8YF 4BFXA 1G41A 2CK3A 1T5IA 2CVHA 2WMNB 4RFVA 4DSUA 5KDLA 3O8DA 4NL4H 1OXVA 3OFNA 2IEYA 3PVSA 4GPTA 4EIWA 2ZUDA 4LHVA 4RD0A 4L9WA 4I1SA 3L0SA 4GNKA 5J5CA 4QGGA 5EQTA 1ZU4A 1N6RA 4ZCIA 3W8NA 2GJ8A 2JLVA 3FDIA 3VKHA 3U61B 1GNQA 2QA5A 3PENA 1E9AA 3W5IA 4DXAA 4DCSA 3EZFA 2YINC 4DLTA 3L8YA 3X1ZA 3KX2A 4DSOA 4ESVA 5KNDA 2QSZA 2Q9AA 3QENA 1X6VA 2P6UA 2PZEA 3IILA 1NVWQ 4BRUA 4LCBA 5JI3E 1ZINA 2O8CA 1RRFA 2IYSA 3CWQA 4LSGA 4BZXA 3NC0C 3ZVMA 4DVGA 3TW4A 1KI6B 2EYUA 3OAAA 1QDEA 3C16C 4FMDB 1XD8A 1G8FA 4WXPA 2DFLA 3REGA 3K0CA 5DYIA 1QRAA 1ZP6A 3FB4A 1Z0FA 4DB2A 1T0HB 2W6IA 3EAQA 3U6BA 2JEOA 5KNCA 3NDPA 4JVMA 1DVRA 3IQWA 4JSTA 4JLMA 1NIJA 3LAWA 3AKEA 3NXSA 5FPKA 4Q7KA 1AZTA 1JQJC 1EK0A 3Q9LA 3E2IA 1AA9A 2C99A 1P60A 1NP6A 3AVYA 4NCIA 2VP0A 2YV5A 2QI9C 3K0FB 3DHWC 4RD1A 1WDTA 1X8JA 1KKLA 1U0JA 1UBEA 1ZC3A 4OK3A 1IXSB 4TL9A 2ZYTX 4KO8A 3LBIA 5FBWB 1VPLA 4Q4HB 2IT1A 2VHJA 4A0RA 1B0UA 2J0UB 3QKSB 1DEKA 1XPUA 4DLVA 2GKSA 1T5LA 4UXIA 4B32A 1DG3A 4TTRA 4D80A 5BYKA 4LWZA 1G1MA 1Q12A 1CJTC 5JRZA 1XNJA 3TR0A 3FE2A 1D2NA 4YLGA 4P0TA 3QNUA 1WB9A 1EFRD 1Z8FA 2KB0A 4GP6A 4E09A 1VIAA 2ZRBA 3B85A 2HYDA 4US1R 4ABYA 2XNSA 5DISB 1L4UA 4F91B 1BKDR 3U4QB 2FN4A 2R8RA 5FL3A 1KI6A 1TF5A 4URWR 4MITA 4R7ZA 4B34A 3K9HA 4GMDA 1S96A 3KQNA 1OYYA 2ZU0C 4GT1A 2E87A 1KYIA 1COWA 4JLAA 4OKSA 1JR3A 3DKVA 3CZPA 4QGHA 2JASA 4QHTA 4RD4A 4FW9A 3QQ5A 5FOUA 4LPSA 4XD7D 1M1YE 2RKOA 1NY6A 5FL7A 1FPMA 2BV3A 2OG2A 3CRMA 5A4JA 3I8SA 5L8VA 2YWEA 1ZAKA 4EQ6B 1XJ0A 5F2EA 3L82B 2WWYA 4PC7A 4RSGA 5B30A 1EFTA 4M9XA 3HU2A 3PEVA 3PUYA 4YXWD 1FMJA 3E70C 5DN6D 3IIKA 2V9PA 1G7RA 1LNZA 5FTNA 2NPFA 4Q7LA 3T35A 2G0NA 3K0FA 3FGNA 1Z6TA 1P7CA 4BFWA 1NSTA 2FEOA 2GZAA 1B23P 4Q4HA 4Q9KA 3QKSA 4JT4A 4XSGA 2FMXA 2VP5A 4LY6A 3FMOB 3PR1A 3FKQA 1R5OA 2QL6A 1PVOA 1DAEA 5JJLA 3SYKA 1S1MA 4B44A 2ZRKA 3QXJA 3MWJA 2REXB 4YMTA 5DIFA 2IA5A 4MYHA 2HUPA 1YZQA 4M4SA 4NHOA 1E2KA 2CCKA 1IN6A 1D8TA 1XEFA 3K09C 1KI4A 4EJSC 2YWHA 3X1WA 2BM0A 5IT5A 1II8A 2GXUA 3TE6A 1HT2E 4ACBA 3U4QA 3NHBA 4XVQA 4HAZA 1F2UA 3C7KA 4C0LA 4RD2A 5BN4A 1AGRA 4F38A 2F6RA 1NN1A 3FYHA 2KE5A 4G5GA 3AVQA 3GLFB 4HAVA 1NMXA 1XCMA 4PSVA 1XB2A 1E4YA 2NO7A 5CK5A 5D3QA 1FUKA 2V7QD 4Q4JB 2WBLC 4ZKDA 2H5EA 4ZDJA 1G5RA 1G3UA 5L3QA 5IHPA 4A15A 1UJ2A 1LB1B 1OIWA 2R44A 4MYCA 4A0FA 1VHLA 1GP2A 4ZDKA 2GZHA 4B76A 2OBNA 1N6HA 3H1TA 3CWZA 3B9PA 1CEEA 1VKJA 2FWRA 4PANA 1R5NA 4G0NA 4KXFB 4LK2A 1G8HA 5H68A 3BFVA 2CXXA 1ZIPA 4QGFA 1G21E 1GZSA 2D7CA 2ZRGA 5DSZA 3SZRA 3SQWA 1ZU5A 4TZ0A 3THWA 1NVVQ 1RRGA 2R6FA 1KZ7B 2XZLA 3QE0A 4GP7A 3C5HA 1TMKA 2JLSA 3TMKA 2CLCX 5JMTA 2AXPA 5FPHA 4OQFA 2A7QA 3RWMB 1TQ2A 4HUTA 4BLOA 1OB5A 2VP2A 1KNQA 5EP3A 4CF7A 2JCSA 4XOIA 4JS0A 1XEWX 4LX0A 5TMPA 1KMQA 2QTFA 2BMJA 3L0OA 4BEJA 1VYUA 2GDJA 5FR1A 2BVNA 3GLFA 1K5DA 1LW7A 4A9AA 4TYWA 1XPRA 1LV7A 2GETA 3RANA 3K1JA 4QOSA 3CR7A 3JZMA 3KKNA 3MJHA 1PUIA 4A36A 5BQ5A 3REFA 3IUYA 4JVLA 4Q47A 1A2KC 4Q4JA 2XX3A 1G6HA 3C4JA 3VFDA 1KK0A 4TTPA 4X8MA 1G291 2GRJA 2BM1A 2QPOA 1P3JA 2A2ZA 1A82A 4NYMQ 3DMDA 4Q9HA 1U98A 3ZS8A 4C0AC 5CYPA 5FOSA 4MKIA 1T6NA 5K8UA 2PCJA 2O0JA 1XPOA 2GJSA 4H9GA 1QF9A 2A5YB 3W6OA 5CB8A 3QOFA 3BIFA 4IEEA 1SQ5A 3CH4B 2DHRA 2HLDA 4QKQA 5DHAA 1ZMXA 2C98A 2ZJYA 3QVVA 4NTZA 1Y63A 1WXQA 1ZVQA 2JLYA 3AP2A 2R6DA 2JLQA 2ZRHA 1TF2A 1X1SA 2RH5A 4Z8YA 5KSYA 4Q7MB 3Q7QA 4ACAA 4PQYA 3EPLA 3HPQA 4DCNA 2CCJA 3MMPA 4HDOB 4JKYA 3MJRA 4QL3A 5JCPA 1RPZA 4GOJA 4Q9IA 4DDVA 2QUZA 4IFBA 2Z5FA 1DAKA 1W0JD 3BE4A 2KBEA 2QP3A 1T4GA 4NCKA 3UG7A 5F9HA 1LTQA 1P61B 1HE1C 3K0EA 1E9FA 1D5CA 2ATVA 5HE9A 2RHMA 4L8GA 1YZLA 2WSSA 1T8UA 1M8PA 1NN3A 2SHKA 2BBWA 4QM6A 3SYLA 2OFOA 4QBFA 4CEHB 3WHKA 1UBGA 4I1VA 1KOFA 2BJVA 1TU4A 2PLFA 1E9RA 2GCNA 5UKDA 3KFVA 3SN6A 2HT6A 3RS2A 1SXJA 1KSFX 3BRWD 4TMTA 2GEDA 2WKRA 1S0UA 4KFRA 4LHWA 3NTUA 1W4BA 4X8LA 4WZ6A 2Q6TA 1JR6A 1GRQA 1Z07A 2FX3A 4RZXA 1W5TA 2F1RA 2VA8A 1YJ5A 1PJRA 5FUWA 2QE7A 2ZTSA 4KYUA 1ZNZA 4NPHA 2DY1A 3DZ8A 1W36D 1ANKA 2OCAA 3KXLA 1KAGA 1KI9A 4PAQA 2MSCB 5B58C 4A82A 4MGIR 3EIQA 2BMFA 3X2SA 4LHXA 3EC1A 1HUQA 4KFTA 3GFOA 2QM7A 3LQQA 2VP9A 1GL9B 4II7A 1SVOA 2NMVA 2ZRFA 4LBVA 5GJBA 4HB4A 1Z0DA 5AJWA 2C77A 1VCOA 3LO5A 1E2GA 3SJCA 3ZLJA 2VHCA 1AN0A 3O8RA 3A37A 2QG6A 1F5NA 4OL0A 1NF3A 1YZGA 2J7PD 3T61A 1V43A 4DLYA 1N6OA 3UMSA 4URUR 2XZOA 4F4JA 1R8SA 4MYUA 1QHXA 1OH5A 1U94A 3G5UA 2E1RA 1NBME 3AVTA 3BORA 3U7HB 4TWZA 4TL8A 5FPYA 3LWNA 4BECA 4JBXA 1N6KA 4OYHA 4JL6A 2DPXA 4BRWA 3SJZA 1JI0A 4IDPA 2YOHA 3B60A 4CZ2A 4B6EA 1QG2A 2B8WA 3TUJC 3U7EB 1W4AA 2A5GA 4CYMA 3DO6A 3LW8A 4BPBA 3NDBB 1TEVA 2Z4SA 2OBLA 3ND8A 2ORVA 4TMZA 3R20A 2AFIE 2ORWA 1U81A 2W2XA 3NEYA 1CJUC 1W36C 1OKKD 1NKSA 2XEXA 4C0HA 4YONB 5KSOA 5JI2E 3SYNA 4RZ2A 1XF9A 1KKMA 1MT0A 3B8HA 3OE7D 2CEAA 3QEOA 4JKIA 5AJYA 4ZI3A 1YRBA 4LGMA 1YRAA 3DKPA 4Q66C 3BWDD 5B2ZA 3D7MA 2FF7A 1K8RA 1YR7A 1NBMD 4MDEA 3QPVA 2JJ1A 2O0HA 1AJEA 1W4CA 3AKDA 4N0DA 4RCYA 3K0SA 5JZVA 2HCJB 4UJ5A 4ASUA 2FSIA 2FSHA 3AVWA 3CNLA 1GNRA 5IK2D 2XITA 1QHHB 2ZVQX 3BB1A 3R9XA 4BQSA 2UZIR 4XTRA 4IW3B 3RVBA 1RE0A 1SVLA 2HV8A 3KJGA 2NGRA 2WWXA 3LNCA 3T1OA 3X1XA 4AYWA 3T5DA 2IYYA 2WJVA 3X1YA 4QRHA 2GJAA 5FOVA 2OESA 2IYLD 1ZUIA 3WY9A 2QBYB 1TTTA 1UFQA 1KSJA 4PC1A 3ZIAA 2I1VB 3ZDQA 2ZI4A 4URXR 4BUJA 2GILA 1JAHA 1MO3A 2ORIA 3KTAB 1E2NA 3PUZA 2DBYA 1T91A 4FCVA 1T9HA 4LBYA 1RYFA 5P21A 4AI6A 1N5JA 4Q9JA 3GLHB 4TLAA 5G53C 2N1BA 3TK1A 4E07A 1J90A 4PX9A 5FH9A 5JLJA 1JB1A 4C0BA 5C18A 1VECA 1EWRA 1ZUHA 4LPKA 4ITRC 4KSBA 2LKDA 3B1YA 2O0KA 4LUCA 3K9GA 4RJLA 1KK1A 1OYWA 1N5KA 3T12A 2UVQA 4UKDA 3WP0A 3N5CA 2XNDA 2FV8A 3BK7A 1ESNA 2PLRA 3QEJA 4FD2A 2VTKA 2XOKD 2DWQA 1W0KD 1N2CE 4B3FX 2G1KA 3EZ9A 3AVVA 4P4TA 2IUSA 2JIZA 2F1HA 4PC2A 1HY3A 1XXHB 2ZUCA 2EWWA 1P9NA 3B78A 3U3KA 2QORA 1E2QA 1RKBA 1TEXA 4BLRA 4QC2A 2NO6A 2BKUA 5JHGB 1QHHA 5G41A 3LVRE 2PJRA 3EXAA 3FKSA 4N1AA 3RRYA 1E99A 3TVTA 2GWHA 2AHOA 1NLYA 1GOTA 2RGNC 2DWOA 4MUAA 3T06B 1FUUA 4B35A 2FEMA 1BS1A 2GHIA 3EPHA 4L15A 1Z3IX 4EPXA 4HAWA 4QM7A 4BZQA 2C9CA 1W44A 2IX3A 2FA9A 4PXAA 2VQSA 2OFWA 4RD3A 3A1VA 1E9EA 2IYXA 3L43A 4CDGA 1EX6A 1R8QA 2F3RA 3O47A 4GI7A 3KTAA 4MRNA 2GESA 4L5BA 1US8B 1JALA 1ZIOA 5FUXA 4GDFA 4OHXA 2ONKA 1N0VC 3KJHA 1YE8A 5HR5A 4B74A 4BFUA 3PEWA 2JJ8A 3GLHA 2H92A 2ZE5A 2X1VA 5FOWA 2ZSEA 2A5DA 4KBGA 3AF0A 2VP4A 4ARZB 5KYKA 1WBDA 1DTSA 1U90A 1YZUA 4PZYA 1E2MA 5AR1A 4IXNA 2NZJA 2GTPA 2GBLA 1Z6XA 4D82A 1OH6A 1GIAA 3E5HA 4AY2A 4F4IA 2QEQA 1E1QA 4KYIB 2OAQ1 4IOLA 4YQFA 3AVXA 1NIPA 3EG5A 4D4LA 5GJCA 3TJZA 1S1CA 1DO0A 2A9KA 1XTJA 3VAAA 5JHHB 1WCV1 4MGKR 2Q3FA 3M4YA 1XXHA 4M1KA 2C9OA 2FPMA 1A4RA 2ZE7A 4DWJA 1JBKA 3T15A 1DAGA 2WSMA 3LBNA 1NSFA 4OJQA 4WXRA 4MDFA 4OHWA 3C8UA 4A8JB 3ZZTA 1SGWA 3D6TB 1ELOA 5FI0B 5F98A 5AUNB 1P73A 3THXB 1SKYB 1KTVA 4YMSA 4V0KA 2V4ZA 2YKGA 1TQDA 2GEUA 5FL7D 1ZD9A 1IY1A 2FH5B 1V5WA 4WZAE 4CVNA 1RC8A 4IEIA 4UXJA 1TU3A 4Z8XA 2JLWA 1Z0KA 3UK6A 4G5SA 2J1LA 1ZJ6A 2ZI7A 4C0QC 4PAOA 3EA5A 3EWSA 4BZPA 3AVPA 1FW6A 1G8PA 3IBYA 1PV4A 1D6JA 4TSFA 2QPAA 1KI3A 4HAXA 3MCAA 2QQ0A 4FMCF 1AM4D 1U9IA 4LZZA 3L0IB 1L7VC 1HE8B 1NLZA 3CKLA 2WKPA 3C15C 1EFCA 2WPDA 1RRPA 2WOOA 1JPNA 1US8A 2W0SA 1ZBDA 1GNPA 2OCYC 2QT0A 4DZZA 1ZYUA 4KVGA 1G8GA 1KSGA 4LI0A 4UNQA 2AKYA 1OW3B 4MH0R 1N0UA 2BBTA 2VRWA 3VKWA 2WM9B 4BFTA 3CF6R 1KY2A 2IK8A 4ARZA 1KK2A 1QHNA 5E7IA 4ZDIA 4E5UA 1ZUNB 4LBZA 4P4SA 1G18A 3WHLA 1OXSC 3KQLA 2J46A 1M34E 4EFLA 3HPRA 2BCJQ 1H8HD 5JRJA 3RS3A 4A0HA 3KXKA 3VNVA 5EZ6B 3AQ4A 2BBSA 4KFSA 2OAP1 3G0HA 2CCGA 3HR7A 4N0EA 4M9SA 3CF0A 4V0LA 1JJ7A 2BBOA 3I92A 4HAUA 3SJAA 621PA 3T1TA 5IRCD 4FN5A 1NKTA 4O25A 4QHSA 4DSTA 1SVMA 2OM2A 5JWHA 1WA5A 2RB4A 4A8JA 1JXMA 2BDTA 2ZE6A 4M1OA 3PQCA 4TZ6A 1H65A 4PTLA 3KKOA 4GMXA 3WNCA 1MABB 3ASYA 2F43A 1MO6A 2G3YA 3GLGE 1KDRA 2BWJA 5IDVA 4OI2A 3BH6A 4HSEA 1UAAA 4IFEA 5E7JA 4DCUA 4RKEA 1Q1ZA 1H8EA 1BYIA 2ZETA 1XMSA 4MQBA 2RGDA 4UNNA 1NN0A 1HQCA 3THOA 4RKFA 3WRYC 1KSHA 2BEJA 2B7BA 4F4CA 3GJ8A 1JEDA 5HPYB 2LKCA 2IXGA 1N5LA 3I62A 3ZGXA 1S3GA 3GPLA 3TQFA 2F9MA 3K70D 2QSYA 1EXMA 2CBZA 3RRNA 3A4NA 1ZCAA 3EZ2A 3QXXA 4WVFA 4A2PA 4LDJA 3KL4A 4AKIA 4IVQA 3TRFA 1FZQA 1G3MA 1LS6A 4RCZA 1Q3TA 1CIPA 1JXOA 3T34A 5TXGA 3UPUA 4OQLA 3FOZA 4P31A 1DPFA 5SZIA 4TLBA 1AKYA 5CJPA 2PCLA 4DUGA 4QJ4A 3HYRA 4MKGA 4OI4A 5D3MB 1ZCBA 2WAYA 1KIMA 1GL6A 2JDIA 1RW4A 3TUZC 1Q3HA 3NBXX 1MABA 3G82C 1S9DA 5AJVB 4NYIR 5GJVC 2C5LA 1ZM3A 4URZR 2XXAB 1AZSC 3KKQA 5GJWC 1YR9A 5LBIA 4BLQA 2VPPA 4IDOA 3W6NA 3RC3A 3SHFA 3CRQA 1ZC4A 1E9SA 2D2EA 3CPHA 3M0EA 3JZAA 3SDZA 5BWMA 5CB6A 1P9WA 2ZROA 2AD1A 4KAXA 3BGWA 4IHQA 5E7MA 1AQUA 3HWSA 4BGDA 3EPKA 1L4YA 2F1JA 5HCNA 4C30A 2WIAA 4FI3C 4UNPA 3ECCA 3PUWA 1R5BA 2AWNA 3K70C 2B6HA 4C0KA 4A4DA 3VQTA 4LJ6A 4NE2A 4WA7A 1ONBA 4TT3A 1G3IA 221PA 3AF4A 2OILA 4MKHA 3LRPA 4JVSB 1IOZA 1G9XA 4R98A 1E0SA 1WE2A 2ONJA 1IY0A 3TSOA 2JJ2D 1TNDA 4A1FA 3CIOA 2R62A 1ZRHA 2A78A 2UKDA 1OFTA 4O3MA 1G8YA 1TQ6A 2P6RA 4LJAA 1RRCA 4TQUS 3BJIC 3W3AA 1X1RA 3GEHA 4LRWA 3QKUA 4YC7A 2J0SA 3U7FB 2HT1A 3ZD6A 1FP6A 4Q1FA 1TAGA 2J0UA 2LCFA 4LJ7A 1XMJA 5LPNA 2GJKA 3DOEA 5J47A 5H1YA 1CU1A 2ZJ8A 2ZRDA 3WNDA 5D3MA 5SZHB 2C03A 2RMKA 4FXPA 2QENA 4LBWA 4C0JA 1KI8A 1XD9A 2JGNA 2ZYVX 1SVWA 5G3ZA 3TLXA 2QY9A 3RS7A 1E4VA 1YZNA 2CE2X 2P65A 3FPAA 3TNFA 3NH6A 1W1WA 4KFUA 2C8VA 1SXJD 3HYTA 1YHNA 1O87A 4UJ3A 2W6JA 3ZVRA 2XXAA 2QAGC 1ZD1A 2WOJA 1II0A 2ZSFA 4TN1A 4EPTA 3I73A 3LY5A 1CJVC 2VP6A 2V54A 4MUBA 2IXEA 3VHLB 4W7SA 5KU1A 1XTIA 3OEED 2CNWA 4Q4LA 5FTMA 2ZR9A 4AK9A 2H16A 1R0XA 4WOPA 1VCNA 2RGBA 2WHXA 1S2MA 3NKVA 4D4MA 1FFHA 2FNAA 4NCNA 4JLDA 4IVPA 1OJLA 4TYYA 3LX8A 4URYR 2HJGA 1RIFA 1FQKA 2FPLA 4OHZA 3UWKA 1P2UA 3H2YA 1GRRA 4MA4A 4LHYA 3ADBA 4J0QA 3HJNA 4EQ6A 3SR0A 121PA 3OEHD 1G7CA 2W58A 4M0LA 5IF9A 2J45A 1DG1G 3QF7A 4JIMA 4MGYR 3V4RA 4G01B 3FHTA 4UQOA 1TQ4A 2G83A 2QMHA 3CB4A 3W6PA 3SQXA 2PX0A 1DARA 3C14C 3GEEA 3NWJA 3AUXA 3TKLA 4QHYA 3DPUA 2BOVA 4OK6A 4V0ME 4NBSA 1KGDA 2WJIA 3RYTC 4HB0A 1G5PA 5SZKB 1O3YA 3H0KA 4HEJA 2ZPTX 4EKDA 5L3SB 4CIDA 2EFEB 2OT3B 5TV2A 1CJMA 4W5HA 1UM8A 3WYFA 3V4FA 2WWGA 1PZNA 4G5QA 5CYOA 2CMKA 5FBVB 2PZFA 1IN4A 4DLZA 1F2TB 3LLUA 4EJSB 4XH9B 2QAGB 4EAQA 5J4VA 2FJUA 3Q3JB 4Q4AB 4WBSA 2RGAA 1CLUA 3P1JA 3E1SA 2D06A 4LYJA 1Z0IA 3A4MA 4JYBA 1QVAA 1OE0A 1OLOA 2ZEJA 4FINA 4DKXA 1T3SA 4IDNA 1UKEA 2G0TA 4LHZA 5A5GA 2HCBA 1VHTA 4ZPXA 2J87A 4P33A 1A1VA 3IEUA 2ZS8A 5HZKA 4L4UA 4DC9A 1M2OB 4UNRA 1EFUA 4N3NA 3V00A 1XU4A 2IL1A 3EIEA 4JSYA 4QBHA 4L16A 5JCZA 2Q3HA 3FMPB 4MGZR 5JS7A 2GNOA 1VMAA 2OE2A 4CW7A 2UZ3A 2WJYA 3K0AB 2PH1A 3EW9A 5F9FA 1YZKA 3NC1C 2CL7X 1L2TA 4R2IA 1DS6A 4ASUD 4C7OB 2C2HA 1NL3A 2OFXA 1S9HA 3AP3A 1WBBA 2ZRAA 3K9NA 2OLJA 1Q20A 3F5FA 5DHFA 2CVFA 5B57C 4GZLA 3QXCA 3IPXA 1XP8A 1C9KA 4ZCLA 4D0LB 1E9BA 1GKYA 3F3YA 1TUIA 2OXCA 2EU8A 2A5FA 3KDSE 5H70A 3UG6A 5JEDA 5L3SA 1ZNXA 4MRPA 1Z6GA 2D2FA 3IIMA 4HLDA 1N6PA 1JECA 5HTKA 3DDCA 3AUYA 5LB2A 1FL9A 2MMGA 2FSGA 2BCGY 1QHIA 1XDBA 3K09A 1F2TA 3ASZA 3GJ5A 4EJSA 3BC1A 4PPFA 2W00A 3GJ7A 5SZJA 5LDDC 2Z0MA 5AJXA 4AKHA 4XD7A 2GK7A 2GCPA 1R10A 4PC6A 5JEEA 3GFTA 4Q21A 1HH4A 3WNBA 4JT2A 4GSYA 3SEAA 3SNHA 1N6IA 3LX5A 3SFZA 3I4LA 4B2LA 1E79D 3P32A 4D6PA 3LQRA 4YXWA 1R0YA 3WXMA 1KJZA 1T8TA 5DN6A 1GILA 2FFHA 3OHMA 5DI3B 4JL5A 2OLKA 4LC1A 4C4PA 3EX7C 2BJWA 1NVVR 3CNOA 2ZE8A 3K0AA 2DFKB 4LYAA 2WAXA 4RD6A 1L8QA 3MFYA 4E03A 1EX7A 3AEZA 4C7OA 3BERA 4Z1MD 3GD7A 2F3TA 4XWAA 4LYHA 1VTKA 1OXXK 1OSNA 2C9YA 3KQHA 5FPTA 4V03A 3H84A 4C2TA 4V0OA 1W48A 1KK3A 4KJZA 2AX4A 4OK5A 2XZPA 5FBQB 4M22A 3ZVLA 3EIHA 1OHHD 2X2FA 3GJ3A 3ONWA 2AL7A 3Q7PA 5HZHA 2D7DA 4GZMA 3R7WB 3QVUA 2P5TB 3SJBA 2B92A 5CM9C 4B48A 4B33A 4BWYA 1OV4A 3CF2A 4I4LA 1RFLA 4PO1A 4V02A 1J70A 2BKEA 2VSOA 2YYZA 3L2OB 2WKQA 4NYJR 4Z54A 5HKKD 2IS1A 1RZ3A 4BLSA 3PG5A 2IF0A 2GVZC 2XB4A 5JWOA 5K8TA 4TYPA 2ECKA 1YKSA 5CDFE 1E2DA 2IYVA 3GJ6A 3EPJA 2R6CA 2C78A 2O8EB 2V7QA 1T3HA 2R6GA 5K8LA 4KVAA 2EFDB 2WWWA 1N0WA 4M21A 1D9XA 2ZS7A 1N3BA 4KLNA 4PQRA 1XEWY 4NU0A 5BXQC 4JBYA 3BXZA 5J4LA 2NTYC 5GVRA 1Q44A 1NNEA 2ZSDA 5C1BA 3ADCA 2YOFA 4BEBA 2WTUA 4IDQA 3CX7A 1Z0AA 2GXAA 4NP6A 1DOAA 4JVNA 1BMFD 2C96A 1X8LA 4CEHA 1E0JA 3LW7A 2QMOA 3P27A 1E96A 4EPWA 2QN6A 2ZRCA 1ODFA 1CR0A 1P6XA 3LFUA 3HP1A 1UBCA 2ERYA 5J4KA 2ZXUA 1E94E 1LF5A 3FFAA 3S1AB 1E3MA 1S4QA 2HXSA 2YZ2A 3WMEA 4DJTA 2Q3MA 3SHWA 1Z83A 2QQEA 3QUSA 3OF5A 4IDHA 1DADA 4F92B 2J41A 3NVAA 4HZUB 5BN5A 2Z4RA 1EG7A 3BOSA 2AN9A 1JJVA 3KUDA 1E2EA 2E9SA 4HI0E 2X2EA 4XWOA 3J81k 1BOFA 2XTNA 2WVJA 1E98A 1XTSA 4K46A 1X86B 2OCBA 3F8TA 2Z6VA 2F7SA 2N46A 1XMIA 3MLEA 2V1UA 3TH5A 1D2MA 1AQYA 1NVUQ 3ETLA 3H86A 1YU9A 1R0ZA 4IOMA 3ZD7A 2PMKA 1Z28A 4FWTA 5LD2C 1Z5ZA 5L3RA 4X8HA 1FMLA 1XCGB 1HTWA 2CHGA 2CL6X 3EASA 2O8EA 1Z6YA 4MKFA 4BFZA 1N6LA 2CK3D 1DE0A 1ZW6A 2GJ9A 4CEJB 4AURA 1OF1A 5DI9A 2D4HA 3RABA 3OIYA 3VR1A 3A58B 1GFIA 3CZQA 4IRUB 3RC8A 2ZJOA 3OFND 2ZITA 1GM5A 3HU1A 4FCWA 1W36B 3DM5A 4CGZA 5FBLB 1SZPA 4F93B 2WV9A 1AIPA 2X19A 3NEJA 4TQAA 4FMBB 3RS0A 1WMSA 3KQUA 3BH7A 5BN3A 2FDCA 4Q1EA 1CR1A 3S1AA 3UIEA 5CITA 2DYKA 2VBCA 3RAPR 1SVKA 1ETUA 3PUXA 3ADKA 4WZBE 2A3RA 2NO0A 4LV6A 4P3YA 1Q57A 4IJMA 2YVUA 1UF9A 1YZTA 1RYHA 4QJ3A 1Q0UA 4UXHA 3FHCB 4M9ZA 2IW3A 1UPTA 3QBVA 2QTHA 3TQCA 2JAQA 4MRRA 4Q1BA 4DB4A 2ZQ5A 1MO5A 3VU9B 1AS3A 2KWIA 1UKVY 1T0JB 3LVQE 1IN7A 1UEJA 1W0JA 2IF2A 3CH5A 1Q21A 4JJKA 2KJQA 3D31A 3OAAD 2ZM5A 3RHFA 4Q9LA 5H8WA 3K8YA 5TY0A 3T5GA 2HDNB 3Q85A 4L9SA 5KSZA 2QM8A 3F0TA 2F9LA 5GADl 2W6ID 1GRNA 2YWFA 3BFKA 2VL7A 1G4UR 4QJ5A 1UDXA 2EYQA 4AWXA 4EDHA 1P4SA 3I72A 2EFCB 1KO7A 5KPJA 4CEJA 4F7WA 4HLUA 3VR5A 2G88A 4HLQB 5KTYA 3EWAA 2QBYA 4FMCB 5AWFC 1EESA 2OHFA 4OHYA 2IYUA 1C1YA 2Z83A 1KZGB 3LBHA 1JR3E 1CS4C 2ERXA 2J3EA 3B2EA 3QG1A 4M1WA 2D74A 3Q72A 1HT1E 3O8BA 3CO5A 4PO8A 2TMKA 4OI1A 4HUQB 3N2EA 4HDQB 2O8DB 3LXRA 5KDDA 4I1OA 1G4AE 2ANBA 2XJ9A 2B21A 1QHYA 2AR7A 1E2HA 4B71A 1M74A 1NI3A 4D4KA 4JLBA 4AYXA 4YDSA 721PA 4HZIA 1FNMA 4BE7B 4DDTA 4KODA 2J7PA 2J0VA 1JQLB 4JLJA 4GBMA 2IBMA 4LJ5A 4U00A 4PHTA 3VU9A 1E2FA 3K0CC 4TTQA 4OHVA 821PA 2ZANA 5EE0A 1MKYA 3CPEA 2VYFA 1PLKA 3UATA 4E22A 4TYQA 1ZM7A 2ZI5A 2ZRLA 3EARA 2IUUA 2DFNA 3HR8A 4DCTA 1E1RA 2NO9A 1COWD 3BS4A 1M7BA 1JR3D 1XMVA 4DT1B 1AS0A 5FFMA 5JBQA 2H18A 2XSZA 5TDHA 1KO5A 2YC4C 3JVUA 2EW1A 2G1JA 2QNRA 2CLSA 2QT1A 3IO3A 1VIYA 1OKKA 4QG7A 1VDZA 3AVOA 1WP9A 4KSCA 2NOAA 4TMVA 1DELA 1XZQA 2ZAOA 3ZZ0A 2GAOA 1HV8A 1PUJA 2BMDA 2GA8A 2Q9BA 1KDOA 3KKMA 3OE7A 2IHYA 3KJIA 4M9QA 2EFGA 3DOFA 1CR4A 3TGPA 4Q19A 3Q8XB 2W2VA 1F6BA 1IJEA 4U5XA 3BBPA 2ANCA 2OO7A 1NBMA 2V6JA 5EE5B 2YC2C 3OIUA 1SKQA 1WF3A 4KV9A 4Q7JB 4B2PA 1XZPA 3QPWA 4HUQA 4OI0A 3P26A 3FVQA 1W5SA 4PFSA 4PHHA 2O8DA 5DNYB 4ZDWA 2OV2A 4NCHA 3P4YA 4Q01A 3BH0A 4PSAA 1U99A 2QTVB 4JZKA 4K8OA 4MRVA 4QBIA 5IK2A 3B5JA 3LA6A 2G9NA 2H1LA 3OIWA 4HAYA 1R2QA 2KI5A 1Q1BA 1Q22A 1NJFA 1ZD8A 1P2SA 2PBRA 3ZQ6A 3RNLA 1GG2A 3UKDA 3LLMA 2NZ8A 1G7SA 3W34A 4DLXA 2GXQA 3I1FA 3W3ZB 1SVSA 1XWIA 1ESMA 4NYIQ 2CNWD 2FG5A 3CRVA 1R6BX 1W2HA 4ERNA 4D0GA 1FX0B 3THXA 1KAOA 4PO9A 2RGNA 3L8ZA 3SBEA 3CRRA 1D9ZA 4DT1A 3B1XA 1OH8A 2YHSA 4O0MA 3B7GA 4TL6A 1Z08A 4C0SA 4U02A 3PIRA 3SI7A 4AG6A 2J9RA 3BFXA 421PA 2OCPA 2YWGA 4B3CA 3U44B 4H1UA 2RGEA 4H1VA 2A5JA 2O8BB 1N5IA 4B43A 3AH8A 3GLFE 3VMFA 1NG9A 3ZQJA 2PZGA 1W47A 1W7AA 1DBSA 1KO8A 3W9YA 2IS6A 2XOKA 5CIQA 4OQMA 1GUAA 1W0KA 2QMEA 2JLXA 2IEZA 5L3VA 4JBWA 3AF3A 1KI7A 3IBGA 3MWKA 3GJXC 1F3OA 1XBTA 2H7VA 2DFTA 4AKEA 1VCMA 2G6BA 2Q9CA 2VHTA 2QRZA 3PV0A 4OQXA 3WYGA 2QP4A 4PHFA 2QRNA 2WZQA 3U3RA 4QNRA 5J4YA 3WBJA 2GAAA 4GOXA 1J99A 3CLVA 2XTZA 1QBKC 2YOGA 1GTVA 2FFBA 3I61A 1VCIA 5DGXA 2HYIC 4OJKA 1IM2A 3VX4A 1U8YA 3CNNA 5E4FA 1G19A 1FP7A 4UNSA 1M6NA 5C4GB 1FX0A 1UADA 2FGJA 3DZDA 1HA3A 3L0PA 3PCRB 2ZI9A 5E95A 3AKCA 1XEXB 3VHXA 4QXAA 4EFNA 1CULC 2VSFA 4QFMA 4JLNA 2YNMA 1Z06A 2P67A 3WBKA 5BW8A 2ZYWX 5FOTA 3KZ1E 1W4RA 2NG1A 4LJ8A 3U44A 4S35A 2P0EA 4AKGA 2RGGA 2O8BA 2QU8A 1I4LD 4B3DA 1XD2B 3R8FA 3MGCA 2ODEA 3B1WA 4JMPA 2XJ4A 4M1TA 2FOLA 3TIFA 1NRJB 1XRJA 1UDWA 2J0QA 1CRPA 2J5XA 3AGPA 4DSNA 5AUPB 1TL7C 1SXJE 4DRZA 1II8B 4JL8A 3GFPA 2HLDD 4P4UA 5ANRB 2V3CC 5JFGA 4Q5IA 3ND9A 1OFHA 3ZYCA 3FMIA 3TR5A 5EE3A 3A4LA 5DO9A 3W5JA 1IN5A 1F2UB 2ZSBA 3SBDA 2J7KA 3GJ4A 4FCTA 1P2VA 2V1XA 2W0MA 2WJJA 2VIIA 4FMDF 1E0KA 1MR3F 1G6OA 1VG1A 1Y3AA 1IHUA 4I1UA 4D81A 4IVRA 3A36A 3AF2A 3RRZA 4B3XA 3RLFA 2BHRA 5FOXA 1E69A 2FFQA 3WMGA 2ZIAA 5EXXA 4K81B 3QJYA 1FTNA 5L3QB 4R71A 2K5UA 1TADA 2QZ4A 4Q48A 3RS5A 1W49A 3MWLA 3NG1A 3N2IA 2AWOA 1CKEA 2WSSD 2IUTA 4EPRA 2X77A 2W83A 3SC3A 4EUNA 1XEXA 1G3RA 3IIJA 4FWIB 3IQXA 1N25A 2HEIA 4M1MA 1KJYA 1W46A 3IPYA 1FTSA 2FE4A 2P2LA 8OHMA 3CW2A 4RFSB 2QP9X 2ZAMA 2C04A 3GMTA 1CTQA 1GITA 4PC3A 3U3OA 4YDHB 5B64A 3GLIE 2JLUA 3NBYC 2CHQA 2IYRA 2Z43A 3EZ6A 3K70B 3THWB 1S3SA 1GAJA 3KJEA 2ZRJA 4DLUA 3B13B 3C41J 4YMUA 2QE7D 3A6PC 1XD2A 4B73A 3U2QA 3UXMA 3QKTA 4DCVA 4I99A 4B6FA 3PEYA 4YMWA 3QKRB 1H8HA 1UKYA 3MRSA 3RSOA 3GLGB 3CX6A 1DAHA 3W8RA 1OXUA 1ZM2A 1HYQA 3U5ZB 3VNUA 3UMRA 3K9LA 1NN5A 4X8OA 1YR8A 2R6AA 1U8AA 4NMMA 3QBTA 3PJRA 1KI2A 3M1IA 1FQJA 4EFMA 1JNYA 4M1YA 2IYQA 2OBMA 1R0WA 2QMUA 3I5XA 4PZZA 3I8XA 4BLTA 5GVSA 1DAIA 1AK2A 3A1WA 3LV8A 4KCGA 2REBA 3IDQA 4YMVA 4C2UA 3VTKA 2F55A 2WJGA 1UKZA 4HB3A 4I81A 2ZJZA 4TL7A 2IS4A 4DBLC 4G3XA 4M8NE 4LV8B 3MAAC 3KXIA 1K5GA 1GL7A 2CHVA 1MOZA 1FOEB 1TF7A 1JEEA 3KB2A 1J2JA 1KI1A 5CLQA 1I2DA 2ZSAA 3MG9A 2WWFA 3A8TA 3FMFA 2FU5C 1SXJC 5KOYA 1K6MA 2XTMA 5HCIA 3B1ZA 3RRMA 3MUFA 1E2JA 5EJEA 2QGZA 4HYYA 2O5VA 2IYZA 1P62B 1Z2CA 3Q5DA 4CRWB 4LOAA 3LH5A 4DLSA 2ZJAA 4JLPA 2DR3A 2IYTA 4DLWA 3D8BA 2QROA 1LY1A 3CX8A 2F1IA 2ZREA 2GEVA 3NHAA 2OSBA 4RFSA 521PA 1IBRA 2DB3A 2XB2A 1A5TA 2ZRNA 2VF7A 4P32A 3EA0A 4RZ3A 4B47A 2H8KA 4D2IA 3IKJA 2JATA 5AK0A 4DLRA 1A7JA 1Q1EA 3QKRA 3GLGA 3IO5A 1GKUB 4B3BA 4GRAA 3QXSA 3TUIC 3QSYA 2P3SA 2JJ1D 3IGFA 2OZEA 3P4XA 4OQNA 2OEPA 1FNNA 4BFSA 4OBEA 4Q03A 2L0XA 5EZ5A 5EXSA 1VG0B 4XWKA 2V8OA 1J7KA 1EWQA 1C4OA 3VR2A 3DMNA 2D62A 4RY2A 3CR8A 3BB4A 5EUQB 5EXTA 2GCOB 1TX4B 4M53A 1EGAA 3WYAA 1EFRA 2DWPA 2WJHA 3ZVNA 2H17A 3TBKA 2YJTD 4B75A 1VYVA 1HEIA 1SXJB 2I4IA 2VO1A 4NYJQ 4C9BA 1CBUA 3HDTA 2GF9A 5CIWA 4KITB 3RWOA 4HDCA 2REOA 5DLQC 5EUMA 1E2IA 1KY3A 4HB2A 5EP2A 4PPQA 1CP2A 3EC2A 2QAGA 1KO4A 3ZIAD 2FZ4A 4Q4AA 1WRBA 4IOKA 1IY2A 3RSLA 1GKIA 1G16A 5HE8A 4TMXA 5FR2A 2NPIA 1BH2A 1WQ1R 2KBFA 4G1UC 3RS4A 3I5YA 4O2RA 2ODBA 1G17A 1F48A 1IAQA 3WMFA 1HQYE 2WICA 4JLVA 1CR2A 4KU4A 3R9IA 1BIFA 2HF8A 3VR4A 1P75A 3AKYA 3TAUA 2PEYA 4BFVA 1MRSA 1LVGA 2JJ2A 2QAJA 4NCJA 4LV5B 4R9UC 2V6IA 3CUEF 5EE9A 4LJYA 4M2LA 4EPVA 1Z2AA 3ADDA 3A1SA 3QF4B 4LJ9A 3IHWA 2XNDD 4Q18A 5EP1A 3KFXA 3TW8B 4A6XA 2HF9A 2CLDX 5C2JB 1NY5A 1E32A 2A30A 4AIIA 2ZJ5A 2ZS9A 3GLIB 2JIZD 1QHGA 4D4JA 1D2EA 5FI1B 2IWRA 3MWYW 1E0AA 4Q1DA 1X3SA 4WW0A 5JS8A 2EVWX 2VSXA 3GLHE 3DVLA 3AP1A 4HLCA 1AS2A 4XVRA 4DIEA 4DIDA 1KHTA 3FTQA 5EXPA 1PLJA 2CJWB 3Q5EA 1U0LA 3SS8A 1IXZA 5CM8B 2IYWA
chains in the Genus database with same CATH superfamily
3CGWA 5D87A 4JHXA 2GCOA 3RRBA 2WIJA 4R8KA 3VKGA 3FKSD 4PSCA 5FUVA 1JMVA 3V1NA 2Q1WA 5CA0A 4LYFA 4AG5A 1OWPA 3KJZA 3PJDA 4NK5A 4M9RA 2W9XA 1Q0HA 2PXHA 2VZ0A 4BX0A 2FF5A 1QH8B 3PGMA 1KMNA 4IS2A 4HRYA 4B9AA 3QQPA 5F5LA 3EZNA 4CNQA 4P3XA 1WD7A 4YJFA 1J8MF 4N9QA 2W2MA 4QGAA 3VTFA 1UXKA 3KSDO 1GRVA 4A5OA 4EFDA 3SU8A 5LP6F 3VNRA 4CF5A 5C80A 1HSZA 4ZQHA 2BD0A 1YHZA 4NR0A 2RJ3A 5BSTA 3TBFA 2RGXA 2BTEA 2H0RA 1H94A 3FROA 1EFHA 1H05A 2P75A 3NOXA 4I50B 4N82A 2GUWA 3UJ6A 4DTIA 4EB0A 4LNAA 1LJ8A 2AK3A 3NH9A 4HDKA 2WIBA 3IUPA 2YQ5A 3MMNA 2WDPA 3GDOA 1J49A 2I2BA 3U9TA 3LUPA 4GX2A 4LYEA 5TB5A 4Q1CA 3WP1B 4AVYA 2MSKA 1RVDA 3STUA 5HW0A 3Q87B 1MH9A 4G4SP 1T9GR 4XQEA 3W5AA 2Q2VA 1E89A 1TKAA 2CBXA 1Z2OX 2FFAA 1HRDA 2WWHA 3G5LA 3HCNA 5DT9A 1I3LA 2E4WA 1GWNA 3TZKA 2W93A 4WMLA 4HGOA 2GN0A 3IP5A 3NWPA 2L69A 3OIGA 4Z3OA 1UXGA 4EG0A 5JR3A 3GZ4A 3MGAA 5DI3A 1E1QD 1TUEA 2X8BA 3NVMB 1UZUA 1AKQA 2EFHB 2VLBA 5H83A 1NJGA 2WP0A 4KACA 3GLKA 1JKJA 1JP7A 4MWTA 5IW8A 4A0QA 3CY6A 2YDXA 1G8MA 1HYGA 5DWQA 2IWHA 5DCLA 1O0CA 3LD9A 2JH9A 2C5FA 3DYVA 3N2KA 1NULA 4U0JA 2FVXA 3IXMA 4DZRA 3EODA 5C1OA 3MAGA 3B9QA 4E21A 1BDBA 1F60A 3ANTA 3NJ8A 1O2DA 4AD8A 5EOVA 1CWUA 4GYYA 1KRXA 1KAEA 3FJOA 3SOPA 4YRZA 2BZGA 1ZW1A 4PAMA 3B2QA 3H13A 2AR9A 4V2IA 4PICA 1I6LA 3DZGA 3WAJA 5L4LA 5LLSA 4J03A 1Q92A 1CUJA 3FHOA 4UM5A 1X8KA 2WWIA 2CE7A 1KARA 1NTRA 2AFHE 3P9QA 3R7WA 3GQVA 4UVDA 2L82A 4URFA 4KQ1A 2V5VA 3WQQA 3LPCA 1VE6A 2QRGA 4JI2B 1WDKA 1YB7A 1N78A 1CJKC 2HCTA 2FWNA 4WUVA 1MRNA 2ZIVB 3CKMA 5DM4A 4TQ9A 3QG5A 1KDPA 4MULA 3ZHRA 1J1UA 5J40A 3CC8A 1I4OA 3RC9A 3TEFA 3VR6A 6Q21A 1T2DA 4BP3A 2XRZA 3H2ZA 1Y8RA 1YVDA 1YOBA 5IKEA 3HMQA 3ZZUA 2JFXA 3IVGA 4HXEB 4WFKA 1WVMA 4BY9E 3CH7A 4XI9A 4UEJA 5DH9A 1EH5A 2CFOA 4RHEA 3U56A 3F96A 3WGYA 2BC9A 4DIUA 4LOHA 1CF4A 4OM8A 4Q00A 4PGFA 3FGPA 3OESA 3QLUC 1ZX1A 2IXFA 3GWGA 3A6FA 4ZO4A 3RGWS 1YMUA 4CT4B 1OMOA 4P7JA 3GMSA 3DR3A 4XE5A 4ZV7A 4ZI2A 1GU7A 5K0BA 2HJ9A 3RV4A 3H2KA 1HK7A 2OC9A 2ZSJA 3PFIA 1CNEA 4U8HA 4Y0VA 1Z7YA 2PVPA 4CV3A 1AE1A 1QJ4A 3L8FA 1QE5A 3NT4A 5HS4A 3SVLA 1VL2A 3K7EA 3C3PA 2IU6A 1DEAA 2JH8A 5F3WB 1OH7A 1A98A 4ILEA 5ALLA 3GRAA 3D2CA 4Q3LA 3G0GA 2JZCA 3KSZO 3D81A 2ZUSA 3EUEA 4PZCA 3L9XA 1OVMA 4QSHA 2FPGB 2CJXA 4RPHA 1M7HA 4GMHA 1KH1A 4RMIA 3UH0A 1NQAO 5FUYA 3QY9A 1JPJA 4YP0A 1MNAA 4PPNA 2VH2A 5CIYA 1UQRA 2B20A 3TVDA 3AIKA 3H8SA 4DEXA 4E33A 2HBYA 4EHKA 1QC5B 1SQ0A 3E9EA 4BTEA 1Z6AA 5JWRA 4IJQA 4IH1A 3PC2A 4MEBA 4ZT6A 1VHQA 1HYEA 4G5OA 2I3BA 5KYYA 4YAEA 1J0XO 1U9IC 2QTZA 3TWOA 2C95A 2OORA 1P2TA 5CJ2A 4OUDA 4IEFB 5F51A 1LPBB 2IS2A 5GQSA 1NV8A 2GVDC 2VT3A 2B2CA 3DCIA 4X20A 1T4BA 1Y1KE 2QVYX 4KDFA 5EHQA 3UANA 5KDOA 1H8ED 1XZHA 4LJ4A 3KKPA 4BVFA 4E03A 1IN8A 4KLZA 1BXGA 1XNRB 2H63A 4AZSA 3VI3B 5JY6A 3OE5A 3NOVA 2PJZA 4G5FA 2Z3VA 3IQDB 1RWXA 4RVSA 4QEZA 2OQVA 1HURA 1EK2A 3ANNA 2HK8A 4Z4QA 4B3TB 1IJBA 2NXJA 1KMHB 2GB4A 2XRYA 2IIQA 4FHEA 4MV8A 2FPIA 3RKUA 2DTXA 4NOKA 1Z22A 3FZGA 2GF0A 2Q5EA 2VEDA 1EJBA 3CLUC 3SSNA 3SZLA 3VZCA 1THTA 3GQBA 3IUSA 2DLDA 4XJXA 4Z1MA 3R8CA 3G9QA 1YH3A 2VBIA 3IIEA 3K5WA 3UO8B 4A16A 4F3TA 3GCZA 1J07A 4X3PA 3FD8A 4IDDA 2ZJ2A 2GK6A 1DAMA 1IWBB 3O1IC 4GW3A 4FWBA 1WF6A 2XUOA 1AKEA 1GCUA 1F51E 2CXTA 2XDWA 3K94A 5IBCA 1XJQA 3KD3A 4KI0A 1J56A 1PSDA 4MCIA 1E9CA 1BDJA 2EQBA 5CFQA 5LMZA 1CERA 2DHDA 1AG9A 2HRQA 2CVPA 2YHAA 5IABA 4GR9A 4NPAA 1WY5A 4DJAA 2R68A 4NDZA 1ZI9A 1T6ZA 5JECA 4KN5A 1R4AA 1ACMA 5LQMA 4DDHA 3L01A 4ZCMA 3DO8A 1YZFA 1WZIA 4ZIRA 5HKKA 3ER6A 4KEAA 2CD9A 2EFJA 5LJLA 3L8CA 3OT5A 2JGJA 3DP7A 3MERA 3TIIA 2WIDA 3ZHYA 1UOPA 4TV8B 4IOJA 4JBNA 4AZTA 4B1FA 3ZCUA 1CQJA 1KY5A 1NBOA 3EWNA 4B87A 1J6UA 1LJLA 4ND2A 4CM9D 5KQMA 4XM2A 3U6KA 3LDAA 2P5SA 2C3MA 1T13A 5AOVA 4DIKA 5CEJA 1CXZA 2G77B 1PBNA 3F4LA 4KBFA 1Y1RA 3CM0A 4HCJA 5KO2A 4IGKA 1I36A 1F5SA 3NIBA 4RV5A 4IY1A 5AXCA 5LUBA 4B2IA 3PUVA 2O2CA 4A0GA 1B1CA 2NPOA 1I32A 1DBIA 2Q1TA 3IURA 1EMDA 9ATCA 1KO1A 2PKRA 3KS9A 2NO1A 4PAGA 2CLIB 4CG2A 3THYA 5ECYA 4B2YA 4G0QA 1VI2A 2OXFA 3BDIA 4Z86A 2ZQZA 2WFLA 3CIFA 4KUGA 4R3UC 3DGEC 4BNYA 1ORVA 2VHUA 3PL1A 4TTAA 5JS2A 5FPSA 4XWWA 3FUXA 2VJKA 4NH0A 5CB4B 2E5WA 2PU5A 4PXSA 5H5JA 2AK2A 1T3LA 2O52A 2GM5A 5DJ5A 3P0IA 3F73A 4JQYA 5ILOA 2D0DA 2YASA 3QPUA 4MVJM 3RSGA 2RGCA 3H9EO 3SMQA 1SHUX 4OJNA 5DOVA 3V6MA 7ABPA 1XNQB 1H6BA 2B8TA 3HEMA 1IXRC 2F43B 3L7JA 2JB9A 2ZULA 1OFIA 1N6NA 4MQ5A 4O1HA 4WKCA 4BNXA 5IYZA 1M2GA 2CSUA 4PNZA 3WYBA 2UVPA 1V0JA 3ZWYA 2UZAA 2B7CA 1V1MA 3OF3A 4S2EA 2FQXA 2HKIA 2XAUA 1SHZA 3AF1A 3DB1A 4R2XA 3U60B 2PM8A 4BO8A 1LI4A 3RSHA 1D2CA 1B8OA 1UWKA 4RF5A 1XAJA 3ZJYA 1Z12A 3ZXIA 1VRVA 4IDEA 1TVKB 1O4VA 4A26A 1DAFA 1BE8A 3GP8A 2OMEA 2W6JD 2ZBGA 1Z47A 2BMEA 4J8PA 1RKVA 3QM1A 4YV2A 4QYTA 5CDSA 1J8YF 3SS7X 1QYCA 2OQ2A 4FDUA 1WTCA 4MP3A 1PD0A 5AI9A 2W42A 5JAMA 4BV9A 4YRPA 1C7FA 3RJMA 1T0BA 1R6DA 2M32A 4BBAA 2VBGA 4E2YA 3S44A 5KDLA 5DZSA 1D2RA 1X9IA 5C9ZA 5JBNA 1XMQB 2HMAA 1QHFA 1TU0A 2OPHA 3IV6A 2PL9A 1NBAA 1DT5A 1OXVA 1XCBA 2IEYA 2ZIWB 3EISA 1ZKMA 2A59A 3OFNA 3HCPA 4GPTA 4GUDA 4JEHA 4MO2A 1Y4SA 3KZVA 5TLSA 1FDOA 2CXUA 5EQTA 1ZU4A 1N6RA 2UYOA 5IAGA 3RE1A 4EKGA 5KYWA 1XZFA 3DDZX 5CVDA 2EL9A 3FFTA 1CJCA 2HHLA 3FDIA 4HWRA 4MIYA 2H51A 2Y27A 5K9ZA 1MQ8B 2WF7A 2HA7A 2H4WA 3LCUA 4X6XA 3U61B 2O54A 1ZISA 1QRDA 4E1AA 1KJJA 1Q50A 1U65A 3EHDA 3SJ7A 2QIOA 5CCXA 4CI0B 5D5HA 2QYSA 4URHA 1TTHA 3ENZA 3E7FA 4GLLA 3KR2A 4IDFA 4ENQA 3R7FA 1M5RA 2RBKA 3JSAA 2AZTA 1PEYA 3A6ZA 5KNDA 1BVHA 4XQ0A 2PZEA 4DV3B 4ZEWA 4UD2A 4RV4A 4LCBA 5JI3E 2Y1CA 4DNQA 1SAYA 1A50B 3OJXA 4D79A 5G4KA 1KZYC 2E55A 4FGUA 5AW3A 2VJPA 4C7XA 4FMDB 3D3NA 1G8FA 3SC4A 1D6SA 2XA1A 4G1VA 5DYIA 1UT5A 3VJLA 5G0VA 5IBRA 3EAQA 3G2NA 4CDMA 3PFBA 2XNKA 2QR5A 1RWNA 1E3EA 2E4AA 3EF3A 1KWGA 3IQWA 2WHYA 4JLMA 4MZXA 5KOHB 3AKEA 4EVSA 4O4JB 1FDVA 4K2AA 4BKRA 2Y9MB 5FPKA 3VAZA 4HGQA 1XVLA 1U8TA 1P0CA 3WWCA 1XYGA 3HB0A 5BNFA 1P77A 2OKGA 3R5JA 5TPWB 1YQWA 3I58A 1I9CA 4DQDA 1NT4A 5K3FA 3AVYA 4NCIA 1GLVA 2VP0A 3G9UA 1TQ8A 2IHTA 4M0DA 4LQLA 1ORRA 3IBSA 2QI9C 3I6QA 4CCYB 3DHWC 1J2YA 2MSNA 4DYVA 4JGBA 4M0KA 3NTQA 1QPBA 3A6LA 1U0JA 5B37A 4C4OA 1CNFA 1P9OA 4GEGA 1Z8HA 4OK3A 4YP6A 4ZU1X 4RTJA 3ORYA 4EM6A 3T1HB 1VPLA 3BSYA 1P6UA 2VHJA 2QN2A 4MW1A 5IBPA 4EGSA 4COKA 1XPUA 3KUUA 2VK4A 4UXIA 4EO7A 4B32A 2ARKA 3TTVA 4TTRA 1Y5RA 2CL5A 2HC9A 3VVMA 3KUKA 2RK6A 2VEOA 2BF7A 3NWBA 4PXYA 4BTLA 3OP1A 1Q12A 4CLRB 4GX1A 1XNJA 4CUZA 3TR0A 5ED4A 3DQZA 2HX1A 2AJBA 1OWOA 2PH3A 1Z8FA 4RK4A 3TLYA 1U7TA 2KB0A 4GP6A 3RM3A 2O9JA 3I45A 3IPCA 4LS3A 1P4RA 1VIAA 2ZRBA 3DBLB 2HYDA 4KXWA 3EGCA 4US1R 4L02A 2QT9A 3W3AH 3HEBA 4H0NA 4QIHA 4LXXA 1KI6A 3JWEA 4MITA 2QLBA 2ZU0C 2SCUA 4GT1A 4EDFA 3G2HA 3DAGA 3QE2A 1JR3A 3N28A 4OXRA 3D8UA 2AEJA 2H0AA 3FVWA 1FFXA 1YUNA 4JBIA 2NSYA 2Q0XA 4LPSA 4XD7D 3EE6A 2PYIA 2PWBA 2BV3A 4K9MA 1OZ0A 2Q28A 3DPIA 4E0BA 3MPOA 4G0WA 5A4JA 1WUHS 2HFJA 2QIPA 5DM2A 5DNDA 3T7KA 2YWEA 4ZYZA 5C4IA 2QLLA 2V0NA 3EMKA 3L82B 4ZZ1A 3UTDA 4XFJA 1F20A 1YS2X 1M2EA 4TVSA 1P44A 1EFTA 2RONA 3AR2A 4YCDA 3PUYA 3H1PA 3RTBA 1GTL1 1IUKA 1ULZA 1PGOA 1DIBA 2GFIA 2V9PA 1LNZA 3V1UA 2BGLA 2ZYIA 3K0FA 3P97A 2ZTMA 1OLXB 1P7CA 4BFWA 3LNTA 3P4UA 2WHPA 3EQ2A 5H3HA 3S2FA 4BQFA 3TIGA 2XWJI 3JYOA 2WHRA 3MXOA 2JJYA 3GT7A 2O5EA 5I01A 2VP5A 3JR7A 4TZKA 4GI3A 4C5CA 2QVZX 3FKQA 3E8MA 5B3AA 4FBMA 3REQB 2ZDGA 2PIDA 1E1YA 3SYKA 4O08A 1JDUA 2ZRKA 3VVCA 1ZVVA 1DCKA 2J0EA 2F67A 1SOAA 2LRHA 2REXB 3MWJA 5TGZA 1OILA 3VC3A 4ZCTA 5CLFA 1UP4A 3PP8A 4NHOA 1X7ZA 3S8YA 4YJ3F 1IN6A 1OYOA 1WG8A 4QEDA 5BV8A 2XE7A 1ECPA 4CFZA 4EJSC 1WZUA 3FYUC 1HFWA 3OLQA 3NHMA 1XZDA 1K7YA 3U4QA 1FYWA 4RTNA 4OHMA 1JU4A 1MN6A 1JT2A 3UHFA 3AOGA 3H8VA 3V1TC 4RD2A 5IC4A 1AGRA 4I5GA 1YBHA 4X7BA 1XZIA 2CXQA 2D8MA 5CT5A 4IGEA 1NN1A 3GLFB 3L6RA 2FEWB 4UBMA 2X5JO 1TCAA 5SYNA 1XCMA 1OLSA 2BRUC 2VXBA 2NVOA 2I71A 2NO7A 5CK5A 2HJRA 3RBZA 2QXYA 2CYAA 1TKRA 1YQXA 2WBLC 2ZYSA 4AXXA 3FDFA 4ZAYA 3JD2A 1QH9A 1HT3A 4OKNA 2C0QA 1G5RA 1TK3A 3LUDA 3R23A 4P80A 4ZDJA 3NGLA 2IX9A 2EEPA 2JJQA 1UJ2A 1LB1B 1OIWA 4MYCA 4RVDA 1Y6GA 1F12A 3M6WA 3NYWA 2JHPA 3WLJA 3NWEA 1C81A 4ZQEA 3UJDA 2G8NA 2OBNA 2NSLA 2HA3A 3CWZA 1HXHA 2ABWA 2HEGA 3B9PA 3F1LA 2I4LA 2FWRA 4YQEA 5LP6C 4PANA 1GEEA 1N3YA 2NU7B 1UJNA 2QSJA 4EABA 4AKSA 4AM8A 5HTOA 1GGMA 1V5GA 3BFVA 1E3JA 3UPTA 3G0CA 3HCOA 1PR0A 3P9RA 4L5YA 4CMEC 5I6DA 3QI7A 3R7NA 1QMPA 2D7CA 1ZU5A 3W7BA 1G0NA 2AS0A 3N74A 5IJZA 3WLEA 5HBGA 3N8IA 4R8RA 3F97A 5IULC 3QE0A 4GP7A 3C5HA 4CGYA 1TMKA 2ZOSA 3M4ZA 3NTLA 5JDCC 3BMCA 2CLCX 3TMKA 3KTOA 1QO7A 2QRMA 3N0WA 5A4IS 5L4NA 2V7UA 3FH0A 4OQFA 1DWOA 2A7QA 2B4TO 4WLNA 3RWMB 4HUTA 5L6LB 1JBQA 3VSDA 1KMIY 5EP3A 2ES4A 3K31A 1QRSA 2N3ZA 3CE9A 4XOIA 5JD5A 4ZYVA 2O7NA 2ZAGA 1XEWX 5TMPA 1HF3A 1KMQA 2WT8A 4HYEA 5AW4A 2UU9B 2FQQA 4BEJA 3EGWA 1VYUA 5FR1A 1HWYA 3J7TA 1K5DA 4A9AA 4L76A 5C5CA 3AJ9A 2GETA 3OLZA 4RK0A 1Z34A 1EFLA 4QOSA 4WH0A 1W8IA 4NBKA 4A36A 1L4HA 3L1JA 1PUIA 4GL4A 4RK7A 3TCXB 3OOYA 3VDRA 3DW3X 3NBMA 2XX3A 1A9TA 1H4VB 4TZ6A 2HIMA 2WAMA 2ZSKA 3PDWA 4ZZ2A 2R1TA 3CG4A 2H8GA 4L8FA 2NT4A 3AWIA 5CW2A 3AM3A 4BXOA 4Y2HA 3NTXA 3D1VA 4TTPA 2W6OA 2BM1A 5ILGA 4B4OA 1P3JA 2B7LA 1Y8CA 4NYMQ 4HN4B 4Q9HA 4EHBA 1ONOA 4MCHA 4WESA 5CYPA 4EVIA 5CDTA 3EJ6A 4ME6A 3EC7A 3COPA 4LJKA 3ZHOA 1CUSA 1UMBB 2ADOA 3RVQA 3VU8A 1N8NA 3BILA 3VC7A 2GRUA 2CHFA 1V7PC 2YY6A 4KTTE 3QOFA 4WZZA 4XR9A 4AY4A 2J08A 4KWEA 5PGMA 4Y6OA 1I7DA 4CV2A 1BD4A 2GWRA 2HLDA 3CH4B 5AKXA 4QKQA 3A04A 5DHAA 1YUMA 5EESA 1G8JA 3NDRA 4B7CA 1Y63A 1YF3A 2IOQA 1ZVQA 3AZPA 4FQ8A 3V4ZA 1CB0A 4TS3A 4M46A 1ADBA 2JLQA 5A5EA 2RH5A 5KSYA 1EUYA 3VNAA 1HE2A 4Z1OA 3I6MA 4PQYA 4NZOA 1YWGO 2BR5A 1V8PA 3CWCA 3PJGA 5AVKA 5K4AA 3SMVA 3ZIDA 1E2UA 4HDOB 1I51A 5IKMA 3GDWA 3MJRA 2M6KA 1LQUA 1RPZA 3C5WP 4MR8B 4Q9IA 5IH7A 2QUZA 2JFOA 3NNDA 2XT6A 2WP8J 4HOYA 3CSUA 1U8EA 1S8OA 4MHSA 3BE4A 2KBEA 4DADA 3RC1A 5A7HA 1FUEA 1WXIA 4J3JA 1LPSA 5AI0A 5K6AC 5I51A 1SCBA 2OGZA 2ATVA 3FWHA 3WRWA 1P18A 3BE8A 4PZEA 1M8PA 4NOMA 1BWPA 4KXVA 3M8KA 5HOQA 1DTWA 4UREA 3N7AA 1C7IA 2QX8A 3TOXA 1UBGA 1GKKA 3WHKA 1TU4A 2PLFA 1E9RA 2IDJA 3RS2A 1SXJA 4XSVA 1KSFX 1PI3A 2AN5A 3B3GA 2QUJA 1S0UA 3LY7A 4MWBA 4DA7A 5JAHA 5GIOE 4MJLA 1Y37A 3VR5D 3RREA 2FX3A 1P5FA 4XM1A 3T0IA 2VCEA 4WADA 2IELA 3PDCA 3W6ZA 1N34B 3UMBA 1YJ5A 3NW9A 4IQ0A 5FO1A 1ZNZA 4O4HA 5CCEA 4J0GA 1Z0ZA 4JC4A 1KI9A 3ZH2A 5AIAA 4FHFA 4ZHQF 2HWYA 4LRYA 4KO4S 3GFGA 5U4QA 3X2SA 2FEAA 3EC1A 3OT1B 4KFTA 2PMWB 3P2OA 2QM7A 3RJ5A 4ZN6A 1LNSA 2VP9A 3WGKA 2VJCA 2NMVA 3ZDFA 4HB4A 2NSDA 4Y2QA 3LO5A 3G7NA 5JSUA 1E2GA 3OC6A 2VHCA 4PRYA 4MWZA 1AN0A 1G5HA 3A9WA 5AVOA 5H9WA 2OORC 4RQBA 5FA6A 1GSAA 1JTEA 4OL0A 1NF3A 1YZGA 4QXPA 5B3LA 1U2TA 4I66A 3ZJTA 4N18A 4R1OA 3TTTA 4KWHA 2ZBDA 3UMSA 4BZWA 4JITA 4JJ6A 3ZWKA 4F4JA 4MYUA 5H59A 3SGLA 1RYYA 3TW6A 3G5UA 1J42A 1NBME 3BORA 1I5RA 3R3YA 1XK6A 4O4IF 3V8PA 4EGFA 5KINB 2VPYA 4TWJA 5DGHA 5FPYA 3LWNA 1WNFA 3HJGA 1N3LA 4Y1FA 2WF6A 5A71A 4JBXA 2W4MA 1XEAA 3U48A 3GGJA 4ID3A 5ITWA 2RSLA 1X80B 4B4VA 3B60A 2XODA 2Z9BA 4EY6A 1O97D 1ULTA 2O7RA 2B8WA 4G9BA 1D03A 5TQJA 3TUJC 1WUYA 1JUDA 3C74A 4PG4A 4D3YA 3GP3A 3ZGZA 2EZTA 3LW8A 3RVJA 4BWVA 1ITZA 3W5UA 4C3VA 5A2QA 1U1DA 2EJVA 1PFUA 4LSZA 2H4ZA 3R20A 4IYJA 4M86A 1R9JA 1W36C 1GAXA 1I3KA 3DFFA 4YN3A 4BTVA 1G66A 3C48A 1K86A 3HSYA 5JI2E 3F98A 4IDBA 5AQEA 1PWYE 1GCGA 3FJ1A 4JKIA 1HE5A 4AJHA 5ALIA 2BHNA 4PR3A 1XZJA 1YRAA 4NEHB 1FTWA 3BWDD 1OYVA 4Q66C 5B2ZA 1HLPA 2QS9A 2A9JA 1MQ9A 2FF7A 3L6BA 4Y2YA 4JLUA 5EMKA 1NBMD 1PNRA 1M73E 3EGEA 3JALB 3ECAA 1AJEA 2C1ZA 1Z8NA 5DGDA 1A7AA 4UARA 3FPBA 1JPUA 3NT2A 1H85A 4MWCA 4NV1A 3ZU6A 4ER5A 4YLEA 1MAVA 2QZSA 2UYHA 1IRXA 4BKPA 2FSHA 4KV7A 3AVWA 3DOUA 2XCTB 2ZK7A 5AVSA 1H0KA 1QHHB 4DLLA 1BE6A 2ZVQX 2R4TA 3MT0A 3NIDB 3SWWA 5JJ5A 4I0WB 4N6GA 2XCLA 1DCTA 3WYEA 1D2HA 5I7WA 3GCWA 4BMDA 4EBBA 2FR8C 2FMUA 3BIJA 3PD7A 1YE5A 2VYVD 1KETA 1RE0A 4LKRA 5GGXA 3URKA 2NGRA 3O75A 4EB3A 4G4SO 4Z2AA 1T9ZA 3X1XA 1AU9A 4IQ4A 5JH7F 4F84A 4ZXPA 3PZBA 1D0SA 3X1YA 4RY8A 2EJUA 1LZLA 2GJAA 1P0FA 3A7EA 1QLHA 1CZOA 2Z56A 4LOKA 1V7QA 2XKAA 1VKNA 4YRSA 3CLRC 1OCEA 3OIFA 2AF3C 1DSSG 2Q6VA 2QTAA 1TTTA 4OYLA 4FX2A 3ZDQA 2EGGA 3SQMA 3IKMB 2GILA 3UEOA 3HK2A 4U7TB 3KTAB 1PFYA 1E2NA 4FCVA 1CVLA 4RDXA 3I9OA 2HGSA 4ZVVA 3C6QA 3MTQA 4KQ6A 4LBYA 1ZD5A 3T9BA 3TFWA 1LI7A 1PWXA 4OOFA 2WD7B 4IYRA 4PEVA 4PZDA 5FTWA 3ZDZB 1QTRA 4TLAA 3TK1A 1EM6A 5FH9A 1JB1A 1OX4A 2DQ4A 2X7HA 3ZU4A 1EUCB 1VECA 3ZCTA 4XW2A 1QGYA 2BMWA 2O0KA 5AK4A 4DG5A 4IZIA 3QFSA 3EK2A 3K9GA 3CYFA 3FVTA 3HWRA 1WUIS 3P2IA 1F9EA 3FUCA 1TYDE 2H07A 2UVQA 3E81A 5AKGA 4UKDA 5CFMA 3ESBA 3WP0A 4DAOA 3QEJA 1Z0UA 1EP2B 2GM3A 2PLRA 2XOKD 2Y1WA 2VP3A 3CSDA 3CZ9A 4A23A 3EZ9A 4UBLA 4P4TA 2IUSA 3N76A 3BQ9A 1XXHB 2R4UA 2H5LA 2ZUCA 4RZHA 3NBKA 5EJ7A 3JQBC 3JW8A 3NB0A 2EWWA 2FMTA 1P9NA 3B78A 3U3KA 4XX0A 2QORA 3CRNA 3KKLA 4FBGA 4L74A 3O9MA 4BLRA 5JOQA 2BKUA 1I1NA 1YUBA 4G0XA 2ZT8A 3LVRE 3JQGA 4MUNA 1JDBB 5CHEA 1WZ2A 4KLRA 3JXEA 5K6TA 1E99A 4J2HA 4QOIA 3TVTA 4YT8A 4TWIA 2BFBA 4KIFA 1FYDA 2AHOA 3LLCA 3W5HA 5L7YA 1N0IA 1XTBA 3ET5A 4MXDA 4XQGA 1W5AA 3N6VA 2OXIA 2GHIA 3VUEA 4BBZA 4C1BA 5B2FA 5IXSA 2PUFA 3EPHA 3SZ3A 3FWPA 1C1DB 3B38A 3GRRA 3JYPA 1V16A 1SB8A 1YS9A 1S8NA 4LWQA 4D46A 4UHBA 1B42A 2GO7A 3SM3A 1KEEB 5FWXB 2FA9A 3ENNA 2EW2A 2AIRA 4RD3A 3A1VA 3NYIA 4GOMD 4N54A 3GL9A 4O6VA 4CDGA 5MDHA 1R8QA 3K71B 4MQMA 4JR0A 2YJNA 2CWWA 4MRNA 1RI4A 1JALA 2AC7A 3LUAA 4INPA 1NC1A 2ONKA 1P1IA 3C43A 1WXEA 1YE8A 5T4BA 3BEDA 5DTIA 5AK3A 4LFCB 3UENA 5K5EA 3L4BA 1L0BA 4P58A 1X7DA 2KLBA 4G8DA 2H92A 2ZE5A 1V39A 1GT91 1J9GA 4L6CA 2F3QA 3H7IA 4JHLA 4NVRA 2P6MA 5FOWA 3RSCA 4ARZB 1M3SA 4DLNA 1DTSA 1MEEA 1AVTA 3O2JA 3VTAA 5IKXA 2NZJA 1IPEA 2GTPA 2XF2A 2D2IA 5TVGA 5C5IA 3E8XA 2CFRA 4BMCA 3QEKA 2FK8A 1GTRA 4KYIB 1E66A 5C53B 1A5ZA 5G0TA 3H3FA 4IOLA 4YQFA 1R12A 1NIPA 3AF5A 4PFQA 1AV7A 3LP5A 1N9ZA 1UFRA 1S1CA 3TJZA 1PQ4A 4C03A 4IIJF 3GXBA 3VKVA 1RYNA 3G9TA 1WCV1 4RCVA 1S3IA 2VTVA 1EK1A 4KE6A 2K2QB 1B6TA 2EHDA 2GN9A 1JBKA 1VPTA 5E2BA 2RIRA 2OCDA 2EQAA 5I9SA 4AJ4A 1ZH2A 4R1SA 3D6TB 1HOXA 1P73A 2QD1A 1SKYB 2C8KA 3JVIA 3CF4G 4M8SA 5AKEA 5FL7D 1LPAB 4MA0A 2I7CA 2FH5B 4WZAE 3P7MA 2VRCD 2QUHA 4CVNA 5JPCA 5JQGF 3BGIA 1M2NA 4QG3A 2GD0A 4R31A 1RHUA 4F1JA 2CUKA 4PAOA 3EA5A 1CUCA 4P8RA 5CDYA 2AV6A 4KREA 2KYRA 5A7GA 2HOQA 2V6BA 4FJ1A 1JU9A 4TSFA 1LPNA 1ZGZA 1JX6A 4HAXA 4L73A 4Q1VA 4EATA 1YGYA 4MGHA 1MEJA 4FMCF 4LZZA 1NLZA 2X5KO 3BSSA 3O91A 3CKLA 1SEVA 2WKPA 3FOAA 2Z8YA 3F8WA 4FNOA 1Y89A 5F33A 1RRPA 4W9NC 4E51A 5ITSA 2W0SA 2EERA 3A3YA 1DWPA 1GNPA 2F17A 3OCJA 3KTFA 1ZYUA 5K3CA 3RUHA 2Q3JA 5EJ5A 1Q95A 1M9NA 5HF6A 1G5IA 1OW3B 1HTBA 3STTA 3HP4A 3AHCA 2E4YA 1GTJ1 2WM9B 4QUAA 4BFTA 3CF6R 3T9DA 1DQSA 2WM2A 5DXAA 2WNHA 4ZDIA 2PGNA 4YPFA 3ABIA 4BO6A 3WHLA 1OXSC 2P9ZA 3L06A 3HJAA 4UTPA 1DKUA 4UAJA 2RKWA 2REQB 2YL2A 4K28A 4N3BA 1B6RA 2WWVD 1OA1A 3RS3A 2BTQA 3KXKA 3N8DA 5C8ZA 4E2WA 4QJIA 4UDYX 1G20A 2WSYB 3RTGA 3TR6A 4I36A 2NU6A 4KFSA 4ZU3A 2OAP1 1MO2A 3HR7A 1QS0B 5BSHA 4E12A 4MCAA 3I92A 2VZ8A 621PA 5IXYA 2C2XA 4YYZA 3QVWA 2ATCA 4FN5A 4WDRA 5KHLB 3TZCA 1GGKA 1SVMA 1WTAA 1JKFA 2XTJA 4DNXA 3GV0A 1Z9BA 1WA5A 1Y1TA 3GN1A 3ZIUA 1N4DA 3PQCA 3IVRA 4L4YA 1H65A 3KKOA 4M88A 2E4VA 2I1WA 1X1EA 4DHWA 1N2CB 1XTZA 3QMMA 2FWMX 2QYOA 4FZRA 1JLLB 1CS0A 2XDQA 1KDRA 1UAGA 1L8XA 3ANXA 1OAOA 4GVXA 3NLLA 3NRJA 3V1MA 4B8ZA 4N41A 2B5WA 5MF6A 3RR2A 1GAQA 1JT9A 4BO1A 4ARIA 1H1TA 1HFJA 2PRSA 1Q1ZA 2D54A 3ORHA 2COEA 3CX3A 4N0QA 3IEMA 3DFIA 3MRTA 1FBNA 1NJSA 1S6YA 1XMSA 2ON6A 2RGDA 3KQMA 4UNNA 1FQWA 2JANA 4JR1A 3T7JA 3WRYC 3PC8C 2WPNA 2B7BA 3HGTA 3E4DA 3G89A 3GJ8A 5EJ2A 3T54A 2VPTA 2VDQB 4LHEA 2LKCA 1SBNE 1XRSB 2ESRA 1A27A 4C01A 1VSUA 5ALJA 2GR9A 2XGSA 3SKXA 2WTEA 3TQFA 3VOBA 4D3FA 1YBFA 4MJXA 5C7OO 3OLYA 1ZUNA 4J0IA 4R68A 1ZCAA 4UVHA 1RQGA 1I7SB 4PG8A 4QEKA 4P08A 1FP4A 4LDJA 3ETGA 4X6YA 3HO6A 4AKIA 3AW9A 4FGKA 3TRFA 1FZQA 4HWOA 1UEXC 1XZEA 1CE8A 1Q7CA 2JAOA 2Y2VA 1G98A 4TS4A 1Y4AE 5TXGA 1KTIA 4PYRA 2ZM6B 3HFGA 1DPFA 5IEBA 5SZIA 4XGRA 4D99A 4N6OA 5CJPA 3OJLA 1EDOA 2ZBRA 4DUGA 1ZRSA 1Z2NX 3A1CA 2PPVA 1NV9A 1W93A 2ZATA 4E3WA 1YL6A 2WZDA 2BUAA 5D3MB 3K4HA 4QREA 5JCXA 4ZC1A 1GL6A 3KFLA 2BFMA 5FLYA 3TG8A 4BNUA 2V0GA 1N9GA 4DQVA 3GIDA 2X76A 1RW4A 4MWSA 1PSWA 3NBXX 2QQFA 5AJVB 1BXRA 1H0RA 1PHRA 3WYAA 2DETA 1JE0A 2XXAB 1KZ4A 4G63A 3W6NA 4HH1A 4N0PA 1UH5A 4XYLA 5CFOA 1CUVA 3LA8A 4GRDA 2D2EA 1V37A 2R48A 2WUDA 4EENA 3BGWA 4IHQA 4JT9A 5JXIA 3EPKA 1C1XB 2F1JA 1Q74A 3KVOA 3JTEA 4TGLA 1BAPA 2CHUA 3ECCA 4DDKA 1ND6A 4E4TA 2P9TA 1ZK1A 1V8BA 1Q1AA 3VZPA 2B6HA 1L9XA 3A3PA 4C0KA 4HX5A 3AEXA 1E63A 2X15A 2DRIA 3OJWA 3R44A 3WIVA 1EX1A 1S89A 1TA9A 3M4XA 3QK7A 4IDAA 4S0XA 4MKHA 4CG0A 5HRAA 3LRPA 1Y9DA 1XKQA 2Q1SA 1IOZA 1J20A 5AM2A 1DOHA 2QWXA 3JATA 4C06A 1PZEA 4CF4A 1E0SA 3QLTA 3NHPA 2NZWA 3WO1A 1J8DA 4ZCRA 4MV9A 4DLKA 1TW3A 5I9MA 5LYJF 4O3MA 1RWOA 1RLOA 3P2JA 1ABBA 5DM60 3WDLA 4C0WA 5E1MA 4K05A 4B6RA 4TQUS 4LZAA 3ORSA 3SQDA 4YC7A 3E7PA 1KQ3A 1L5LA 1FP6A 5B7GA 3G5AA 4Q1FA 2Q5QA 3PHLA 3W8DA 1BDIA 4N5NA 1XMJA 1L5FA 3AYZB 3NR2A 3HTXA 4HQLA 2PRZA 3TMAA 4LYDA 1WVGA 3WNDA 5T7BA 2G06A 5FXMA 2I99A 3NHUA 4ENPA 3CZ4A 1XDGA 4FXPA 5JQWA 4LBWA 4WFQA 1CY7A 4IP0A 3OY2A 1P4JA 3DNFA 3H2JA 3D4BA 3ILVA 5G3ZA 3RT9A 2QY9A 3RLIA 3RW9A 2AX3A 3H1EA 5KWEA 4QU8A 3KHSA 3ROQA 3NH6A 3PLNA 4Y6LA 1E92A 2E49A 3BHMA 1YHNA 1O87A 4IMRA 5GV8A 2QAGC 3L4KA 5HKBA 4EPTA 2B3DA 1NR1A 2VI5A 3KEOA 4MQUA 5KU1A 2V8BA 4FKBA 4BB5A 4BE4A 4Q4LA 4AK9A 2ZR9A 1OC2A 4ZMSA 5IT0A 3QEMA 3U4AA 2DF8A 4F71A 3L8GA 4JI6B 1WD5A 2RGBA 4OLBA 3NKVA 1S2MA 1R4MB 4AB1A 1FFHA 2FNAA 4NCNA 4D4MA 3A6JA 4NJMB 3TKAA 4K5QA 4TYYA 3LX8A 2IYAA 1QH1B 4ZARA 6PFKA 4N65A 4RKWA 5ALRA 2FWJA 1M33A 1V11B 4YRTA 2V6FA 5IUNC 1OPRA 3HWX1 4P93A 4DPMA 3OOEA 2JAXA 4EQ6A 4ZO6A 3SR0A 5CG1A 3V4RA 2J45A 1DG1G 3BN3A 2H1FA 4UQOA 2PMBA 2XYVA 2HUNA 1CHDA 3HA2A 3NHRA 4FB5A 1XOIA 1POWA 3AR4A 1OFVA 2GTHA 3D0QA 2HA4A 2Z98A 1FU4A 3DPUA 2VCHA 3FYDA 3MS4A 3OPYA