3TNFA

Lida from legionella in complex with active rab8a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
170
structure length
170
Chain Sequence
b'DYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-8A
publication title Protein LidA from Legionella is a Rab GTPase supereffector.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 57
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tnfA00
3TUZC 5J5CA 2HLDA 5EXXA 1ZUIA 4Q4JB 2JEOA 3T1VA 3T5DA 2IS4A 3QIAA 4BFVA 3TMKA 1AQYA 2BHRA 4LHYA 4I1VA 2QMOA 2O5VA 3AP2A 3QY0A 1G3QA 5TV2A 1CRQA 1OIXA 4WAUA 5KUTA 1AK2A 3ZYCA 1TADA 4DCNA 1FQJA 4ITRC 4NH0A 2WICA 4BUJA 4FMCF 1S3GA 4ASUD 3BFVA 4B48A 5M04A 2WWYA 4OK6A 1Q1EA 3H86A 4AYWA 5E3HA 1OXTA 1LV7A 3U44B 2XB2A 4QGFA 1X8KA 3QPWA 2MSEB 2B92A 3EPJA 5G40A 5FR2A 2AKYA 5DI3B 2V8OA 4NYIQ 1YZLA 5DLQC 1OW3B 3H1TA 3FFBA 5JSZB 1CR0A 2GWHA 3RAPR 3GJ6A 2W6ID 3ADKA 3OE7D 1ZU4A 3CW2A 1Z06A 4PAOA 3K09A 4UXHA 4C7OB 1JBKA 1GKIA 5KTYA 4PC7A 2N1BA 3PCRB 2E9SA 4QNMA 3ZVRA 4LJ7A 3QF4B 3S1AA 821PA 3HR8A 4TQAA 1J8YF 1FNMA 2VSXA 3GFTA 3GJXC 1ESMA 1NBMD 2LKDA 3IKJA 4PC3A 4ZIRB 1LNZA 1HT1E 4FW9A 3QXHA 3ZZ0A 2O8EB 3UK6A 2AKAB 2HCJB 3AF2A 2JLZA 2QGNA 1HE1C 1UBGA 2GKSA 1N6IA 1BOFA 4WVFA 3X1ZA 3N2EA 1U8ZA 2W2XA 4IOJA 3THOA 1NMXA 2GVDC 1VYVA 4C0KA 4OJKA 4RFVA 3AVYA 4BEBA 1VCMA 1VYUA 3AGQA 4PC2A 2ZU6A 2EFEB 2GDJA 2IWHA 3SJBA 3SEAA 5FUVA 1PZNA 4JSTA 4WOPA 1QHHB 3EARA 4L9SA 1XPOA 1KDTA 2PT5A 4RZ3A 3W6PA 4MUBA 4LHVA 4CRWB 1OE0A 4D25A 2IYRA 3JZMA 1G291 1GDDA 3BFKA 4URWR 2DY1A 2GF9A 3MWKA 2FWRA 4UJ3A 2DBYA 5KYKA 2ZE5A 1OXUA 1U94A 1LTQA 4KAXA 1A4RA 2Z5FA 1P2VA 5E95A 4BPBA 1W0KA 4D81A 2CLDX 4MRSA 4TSFD 2AXNA 3LVQE 4LBVA 1CJKC 3TK1A 5L3QA 3QENA 2RGDA 2CDNA 3I4LA 3L8ZA 4F91B 1UEJA 1DAIA 1W44A 2G88A 5SZKB 1WF3A 3CF6R 5AK0A 4D80A 5CM9C 4LYJA 1TEXA 1WBDA 4B3XA 3B60A 1I2MA 1Z08A 2W58A 3B5JA 1AKYA 4ESHA 4D4MA 5G41A 1JB1A 4Q4AA 2A5DA 3B2EA 1XBTA 2QA5A 1GILA 4TTRA 2DHRA 1T9HA 3DKPA 3TQCA 4CEJB 3AEZA 2XTMA 3EA5A 3RS2A 3TR5A 4PSVA 2WZQA 3T15A 3TSOA 1W36C 2QE7A 1IJFA 5P21A 5L3RA 1OFIA 1IY1A 4DUGA 2CL6X 2ZYTX 4AG6A 1ODFA 1N6LA 1CR1A 1Q0UA 3EZ2A 2NMVA 3CRW1 3PJRA 3B8HA 1G3RA 2QRZA 5KSOA 4IXMA 1W49A 5KOYA 1UF9A 1TNDA 4HZIA 5KDDA 1LB1B 1T8UA 1W4RA 3K70D 1OPXA 4NCKA 1LVGA 4X8OA 2Z4RA 1KO1A 1WMSA 5JWRA 3IO3A 3WHKA 2OAP1 4OI1A 2FDCA 4U7DA 5HKKA 2WOJA 3QXJA 1E96A 4KSBA 3K0CC 1FP7A 4BRWA 1WA5A 2GK6A 2GZAA 4P4SA 4CZ2A 3UKDA 2IYQA 1HEIA 4DT1A 3OESA 1GG2A 4GZMA 3THWB 1HUQA 2O52A 5KNCA 3MFYA 1Z6TA 3EW9A 1FZQA 2WHXA 3U3JA 4KFUA 1MH1A 2JJ2D 1R0WA 4IKEA 2J7KA 3FMFA 1GVNB 5L3SB 2ZYUX 221PA 3AVPA 5DSZA 1KTVA 5BQ5A 1JJVA 4ZV4A 3O8RA 4OHYA 1YR9A 4A9AA 4FWTA 1EFRD 4LV5B 2IYZA 1YQTA 4DVGA 1WXQA 5FTMA 1SXJA 1S9DA 2JCSA 3B6EA 4JLJA 4MKFA 1NKSA 1E9AA 4B3CA 2J0UA 5TARA 1RVDA 4NYJQ 2VP5A 5JWHA 4BE7B 3PEYA 2ZJZA 1XF9A 3FB4A 3GJ8A 1NY6A 3LX8A 3R7WA 5B30A 4WZ6A 4QRHA 1IOZA 2A5FA 3NHAA 4Q47A 4ZDWA 1R2QA 2AK3A 4UXJA 2VHTA 2CL0X 2ORWA 4DSNA 1OIVA 1SKYE 3RHFA 1Y63A 1GAJA 3RRMA 4IXNA 3AP1A 4C0BA 1HT2E 2IW3A 1TUEA 2V7QD 1G6HA 1OIWA 2JIZA 2IHYA 4JJKA 3U61B 2ZJBA 1JXMA 2VIIA 1T6NA 2FFAA 3GLHB 4LY6A 4EFMA 2VSFA 5B58C 1V43A 4Q4HB 5ANRB 2DFLA 1ZD8A 3GLGB 1SVWA 3O47A 1TQDA 3B78A 5DN6D 5F2EA 2EWWA 1GL9B 4Z8YA 4QL3A 2N46A 3RC3A 3W5JA 2QAGB 1VG0B 3ZDQA 4V0LA 4G01B 3DHWC 2JJ8A 2KB0A 4AD8A 5CB6A 3VNUA 3LXXA 1WBBA 3UG6A 1MKYA 4NONA 4NPHA 1RW4A 4B2PA 1OH7A 4C0LA 2O8CA 4MQBA 2YOHA 4FCWA 4M1TA 1T3HA 4LUCA 3PG5A 3ZD7A 1VCIA 5C4GB 1E69A 2VF8A 1OXVA 4GZLA 4G0NA 2OG2A 4V0OA 4ZI2A 5J4HA 4M9XA 3K0SA 2VO1A 1SHKA 3D7MA 3SI7A 4XWKA 4MUAA 3TNFA 1KDOA 4BFXA 4MGIR 1G8GA 2CK3A 2W0MA 4B33A 1TTTA 4C2TA 1KY2A 2IF0A 1AZTA 3RRNA 3FKQA 1KJYA 3OEHD 3BIFA 4AIIA 4F38A 3THXA 2F1RA 2I3BA 1DEKA 1E79A 2XOKD 3PQCA 4A92A 5AJXA 2H18A 2FZ4A 2C03A 1DAMA 4E09A 2VHCA 4Q4JA 4DSOA 4GSYA 4DHEA 2ZJOA 4LV6A 1GRNA 2JAQA 4K81B 3R9WA 1GITA 4K46A 3GJ4A 1ZIPA 2R44A 2YWFA 721PA 1Z5ZA 1OFUX 1P9NA 3C14C 4FMDB 1SVIA 2YYZA 4A6XA 3LVRE 3VQTA 4XVQA 4NZYA 2VHQA 2IYLD 1ZIOA 1M8PA 3HYRA 2Z4SA 1LS1A 3IPYA 2VHJA 1TF2A 3TBKA 1H8EA 2B7CA 3U7EB 1FW6A 3AVXA 2WWGA 2I4IA 3VHLB 2FSIA 3U3RA 2PBRA 5AWFC 3GLIB 1D2NA 1RJ9A 1YZQA 2REBA 5DI9A 4YXWD 1Q57A 4MH0R 1NG9A 4DBLC 3IO5A 3KQNA 3C16C 4DIDA 4V02A 2V3CC 2ZS7A 2HT1A 2WMNB 4HYYA 1U8AA 1NVXQ 2ZVPX 2NZ8A 2VA8A 4IDHA 4NCHA 1ZUNB 2EYUA 1GL6A 4MGYR 2BBOA 5JSZA 1KI4A 2C2HA 3IBYA 4HLDA 1G3UA 3K53A 1PVOA 1Z0AA 2J5XA 4N1AA 2Z0MA 5IK2D 4XH9B 4C7OA 3QG1A 5EJEA 3DEFA 3Q7QA 2CVFA 2ZRDA 5CLQA 3QF4A 1UDXA 1KK1A 4ON9A 5FOTA 4IVPA 2ZI4A 2IA5A 2OV2A 2C8VA 2ATVA 4RD3A 3CNLA 3AVQA 4KODA 2ZEJA 1DAKA 2QQEA 4V03A 5F9HA 1FMJA 1KO4A 1S2MA 4AK9A 3B7GA 1D9ZA 3AH8A 4Z8XA 1Z6XA 1W36D 4H9GA 1QVRA 1CU1A 5J47A 2ZI9A 3U60B 2CHQA 1N6OA 2AR7A 3A8TA 3X1WA 1NKTA 3RABA 1IM2A 1YZTA 2GRJA 4XSHA 1E0SA 4C4PA 2HYIC 4PO1A 1KI3A 1C9KA 1S1CA 4B2LA 1W0JD 5CIQA 2NPIA 2WWHA 3GJ0A 4HB3A 4M9QA 4PPGA 4DEXA 4D0NA 1B0UA 3W5IA 3TH5A 3TJZA 1EWRA 5DNYB 2E87A 2YHSA 4OQMA 4YC7A 4OJQA 4J0QA 5JEDA 4TMZA 4QOSA 3MMPA 3QPUA 6Q21A 2GJSA 2ZUBA 5EXPA 3DMDA 4KFRA 1UKYA 2ZRGA 2J1LA 2ERYA 2IC5A 2GJ9A 3KB1A 1A2BA 2IUSA 3QOFA 4D82A 3JVVA 3QVUA 2R6CA 4KFSA 1MABB 3B13B 3AGPA 1J70A 1GIAA 4LJ8A 2JLUA 3W34A 4AKEA 5JECA 2F7SA 4LJYA 2QBYA 1GP2A 2I1VB 2C9YA 1XZPA 3LWNA 4HAUA 2AN9A 4BLOA 1TQ6A 4BFUA 3BFXA 4DCUA 1XEWX 2A5JA 4KYUA 3ZH9B 2H17A 2QP4A 1UFQA 2QSYA 1XTIA 4B35A 2PMKA 2KBFA 2MMCA 2XNDA 4A15A 2QTHA 2J3EA 4WXRA 1Z3IX 2ZS9A 2ZJYA 4RD1A 3OIUA 4PX9A 4IEEA 2Q3MA 1R10A 2YC2C 3MUFA 4Q7LA 3FTQA 2QEQA 3PITA 3H84A 4G1UC 3KX2A 1AGRA 4FI3C 3T1QA 1US8A 1P2SA 2W6JA 2ZRJA 1RRFA 2IYSA 2R6GA 3UXMA 1JR3D 2XITA 1W5TA 2XZPA 1NJFA 2O8BA 1QHGA 4GBMA 2QT0A 4KCGA 2ECKA 4DCSA 3TE6A 2BKUA 5DHAA 4TT3A 3ZVLA 4Q21A 3U7GA 1YHNA 4LGMA 2O0JA 1EGAA 1PLKA 4BZPA 3TUJC 2VP9A 5L3QB 2CLSA 2IYUA 1II9A 2WJGA 3CZPA 2WBLC 2FNAA 3QKTA 2QMHA 2C95A 4DLXA 4TQUS 1G8FA 2L0XA 1Q20A 4M4SA 3BAFA 4OKSA 4RD0A 1GSIA 1ZCBA 3EZ6A 3N2IA 3CONA 5KPJA 5TY0A 5KDLA 4Q4AB 3PENA 4AI6A 3TSWA 1KSJA 1LW7A 2IUUA 1QDEA 4MRNA 2IX3A 5BXQC 1MO6A 4G5GA 1CJVC 4EPXA 5B64A 1EX7A 4HAVA 3EC1A 2NIPA 1FUKA 4TMXA 2GF0A 5FPTA 2ZE6A 4NU0A 1GOTA 4PPFA 2FX3A 5A4JA 2B6HA 4FCTA 3Q72A 4URZR 1M7HA 3SU8A 2JLVA 2R8RA 1N6RA 3IHLA 3K09C 2F55A 1F48A 1ZM4A 3LNCA 4WIAA 2Q3HA 2ONJA 2EFDB 2X2EA 4I1SA 2CHGA 4LK2A 4DDUA 4M22A 2GEUA 1R8SA 1KIMA 1SULA 5BYKA 2J0SA 2VP6A 4ZO4A 4TMKA 1KK2A 2ZRAA 2OBNA 4KITB 1EX6A 4ZDIA 2C5LA 4TYQA 1R0ZA 4LHZA 4P4SB 5HZHA 3ZZTA 4B73A 3TLXA 1FX0B 4GOXA 4HATA 4DSUA 3B82A 3D3QA 4B6EA 2G1KA 5F3WB 4LSGA 2F9LA 2XZLA 1VG1A 1E9RA 4F93B 1JAHA 3IPXA 2OM2A 2QMEA 3C41J 4MDFA 4W5WA 1II8A 1RC8A 2WPDA 2X2FA 1CKEA 4AYTA 3WP1B 4LC1A 4PC6A 1RKBA 1BMFD 1NLYA 4TMWA 1M7BA 1Q21A 2NO6A 2OCBA 4W5HA 2OXRA 3K9GA 3WNDA 3WRYC 3ZJYA 4BFTA 2NO9A 4XVRA 4TLCA 2E1RA 2ZVQX 4H1UA 3RS4A 1SXJB 2MSDB 5H1YA 2J0UB 3EZ9A 3AP3A 3RS5A 2IWRA 1YRBA 5LD2B 1DADA 2AWNA 1ZNWA 3CB4A 1MRNA 1NP6A 2G0NA 1Q1BA 2JGNA 2V4ZA 1CF4A 3T1OA 1F2UA 2XB4A 4XOIA 4A1FA 3R7WB 1XX6A 3IEUA 3K0AA 4NBSA 3UMSA 4A2WA 1PJRA 4XJXA 2WIAA 3T5GA 5GJVC 2IXFA 5KHOC 2BOVA 4QBFA 4AYXA 2J7PD 3X1DA 2BJWA 4DB2A 1JECA 2O8DA 2P3SA 2QY9A 5E7MA 2OFWA 4UNNA 2BC9A 1PUIA 2GILA 4KJZA 5FH9A 1TQ2A 4QBGB 4I1OA 4OQLA 2FV8A 1Z0FA 2GNOA 3KJGA 5CJ2A 4JLNA 1KGDA 1U0HC 2G0TA 3VHXA 2OHFA 1VTKA 2BDTA 2YOGA 4OK3A 4D4JA 2WKRA 4FN5A 2CVHA 4RSGA 2AL7A 4QJ4A 2PZGA 2FN4A 3ZIAD 3N70A 4JT4A 2QT1A 1EFUA 2ZETA 1NLFA 3KFVA 2XXAA 1J90A 1FQKA 4JL6A 1DAHA 2J87A 2RGBA 4D0LB 3P20A 1E9EA 2CXXA 1E1QD 1U99A 4R9UC 3X2SA 4D4LA 1NNEA 2P5SA 4ZPXA 3TW4A 3L2OB 1KNQA 3UG7A 3CR8A 2FPMA 1II0A 4ZKDA 4JLDA 1EFTA 3GLIA 1V5WA 3THXB 1XTJA 3LXRA 4EPYA 4F7WA 2G77B 4TL7A 3KQHA 4JSYA 5B2ZA 2X1VA 1BIFA 1KI9A 1KSGA 3AVWA 1Q12A 4TQ9A 4KFTA 4PC1A 4Y0VA 1PLLA 2IYTA 5C46F 3W6NA 4TYYA 2H92A 2W2TA 4GOKA 4MYCA 3GMTA 3ETLA 2BM1A 1U9IA 1ZD1A 2GEVA 2GVZC 4UJ5A 5HE9A 1JJ7A 4ASUA 5FOUA 1IN8A 3MRSA 4CYMA 3FGNA 1G16A 1IQPA 1WDTA 3ZZUA 3ICEA 1F6BA 5KNBA 4TZ6A 4A82A 1FP6A 1SKYB 4PQRA 3FYHA 4XD7D 3RANA 3AM1A 4OQNA 1W48A 1NSTA 4L9WA 1U98A 4EPWA 2NPFA 3SR0A 3BH7A 4LOAA 2IS6A 3R8FA 3HWSA 1KJWA 4OQXA 4AC9A 3OE7A 5JCZA 3EPHA 2V6JA 3T1TA 1SXJC 1RJ9B 2DFNA 4XIGS 1WQ1R 1XFAA 5LD2C 3C7KA 3PUZA 2IS1A 4F4IA 3LH5A 4W5JA 3FMPB 1G5TA 2HCBA 2Y8EA 2YV5A 5FPYA 2NOAA 3WBJA 1JAIA 1NBMA 3L43A 4JKIA 1OLOA 3A1SA 4NDZA 3W9YA 4DDVA 4Q1EA 3SN6A 521PA 4PR0A 4BWYA 3WYFA 2BVNA 1Z2CA 2ANBA 2J0QA 2WJHA 1RZ3A 4B71A 1R5NA 4AY2A 5FUWA 4TL8A 3PUYA 1KMHA 3ND9A 4IW3B 1GNQA 5E7JA 1MABA 4LC0A 4BLPA 2PT7A 3K9HA 2JDID 2BBSA 4WZAE 3KJEA 3FMIA 2PX3A 1KY3A 4JBXA 2GBLC 3P32A 3DO6A 3B9QA 3CKLA 4LBYA 5EP1A 4Z54A 2DWQA 2RGAA 1NY5A 2VP0A 3AF1A 5A0FA 1XEWY 3J81k 1QRAA 1TQ4A 4IDPA 2G83A 3T61A 4D4KA 4ACAA 1DG3A 1B23P 1Z29A 2N42A 2ZRCA 3ASZA 4C0SA 4MYTA 4OI0A 3NTUA 3KL4A 5FL7D 2QN6A 1P75A 3BERA 2IEYA 4JYCA 1KKMA 3LBHA 1AM4D 2D2FA 4NYMQ 4TSFA 2UKDA 2QPOA 1C1YA 1Q1QA 3HU3A 3KQKA 4XWAA 1N6NA 3HU1A 2WWWA 2HXSA 1G64A 2B8WA 1KI6A 3PEUA 4ZKEA 2QBYB 1KAGA 3EG5A 2IBMA 4XSGA 4EJSB 2HT6A 4JL5A 4P33A 3QEOA 1HYQA 1W4BA 3OEED 1CS4C 4FMCB 4NKRA 3WNBA 3B1ZA 1P73A 3KKPA 1DARA 2G6BA 3ZQ6A 4JS0A 2CMKA 4Q5IA 1X3SA 4NP6A 5JBQA 2BWJA 1KK0A 1ZUHA 5G3YA 3ECCA 3PR1A 1Q1ZA 3KKNA 2ZRMA 5CM8B 3P27A 4TN1A 5FL3A 3QBTA 3RWMB 5CYPA 2RGCA 3C15C 2Q6TA 1US8B 2YOFA 2CJWA 2BBWA 5JZVA 4TLDA 2OBLA 3BGWA 3OAAD 3BH6A 4RVCA 2O8BB 2QSZA 4HB0A 3DDCA 4TTPA 5LDDC 1OHHD 2H1LA 4Q7JB 1SZPA 1CXZA 2LKCA 3AVUA 4BFZA 1OKKD 5EE1A 3K0EA 2Q0HA 1YRAA 2ZJ5A 4HAXA 4Q18A 3V4FA 1VCNA 1CR4A 1LFDB 3GFOA 5B57C 2KBEA 1T5LA 1X8JA 2FSHA 2VRWA 3QKUA 4YMUA 4P4TA 4BFWA 4CEHB 2QP9X 1G41A 5TMPA 3EA0A 5AJVB 2QORA 1Z07A 2NO7A 4XTCS 5H68A 3SE0A 3I62A 2GCNA 1G5PA 2A30A 4MGKR 1T5IA 4PXAA 2CE2X 1H8HD 1Z28A 2GCOB 5ELXA 1KZ7B 4X8HA 2GJ8A 5D3MB 3WRXC 3CM0A 5GVSA 2VSOA 2A7QA 3O8BA 2P6UA 3ZVMA 3AUYA 1ZVQA 1W4CA 1Z6YA 2GXUA 2CHVA 3AQ4A 1FL9A 1JALA 2QE7D 2WM9B 2WWXA 4L4UA 1EFRA 1FX0A 3FE2A 5EE3A 4EKDA 1F2TA 3VX3A 1K6MA 1XTSA 1DTSA 1T3LA 1FTNA 2OFOA 4MYUA 1UKVY 3LQQA 3O8DA 4KBGA 3PUXA 1NSFA 5GVRA 1C4OA 1OFTA 2WSSA 5EP4A 4JVLA 3SHWA 4JZKA 2PZEA 4JLPA 3G5UA 4Y0AA 4KVAA 2ZSFA 1UKZA 4U5XA 1Z83A 4Q66C 2YWEA 5JS8A 1U81A 3R20A 4HUTA 4BZQA 2OFXA 1IHUA 4YONB 2O8FB 2ZU0C 1YE8A 5DYIA 3WP0A 5CIWA 3I32A 4M21A 4RFSA 3QXCA 3CBQA 4BASA 4KVGA 4IVRA 1G4UR 2ERXA 1ZP6A 4B74A 4ZDKA 4PO9A 4JIMA 2GK7A 1KSHA 4D2IA 2QG6A 1BO6A 2D3WA 2EYQA 4P4UA 3P26A 4TTQA 1DS6A 1HQYE 2ZIAA 4V0NA 1Z47A 5HR5A 1XD9A 1OF1A 1IY0A 2NO1A 3MWYW 2O0HA 5DYGA 4DCTA 1IY2A 1P62B 1II8B 1WP9A 2AHOA 1NN1A 2FGKA 3BBPA 5DN6A 1D2EA 4URVR 4N0EA 4CT4B 3RVBA 2EFCB 2EWVA 3M4YA 3ZD6A 1AJEA 2OZEA 4Q9IA 3LQRA 4CT5A 4M0LA 5CYOA 3ASYA 2GAAA 2W83A 3C5CA 3Q5DA 2YWHA 5EUQB 3U3KA 4PQYA 2IYYA 1ZNXA 3NDPA 3KUDA 1JXOA 2XEXA 3P4YA 4QBHA 5G3ZA 2JLXA 3NWJA 5C18A 4QHTA 1OJLA 5J4VA 5EP2A 1S3SA 4II7A 3CX7A 1OV4A 1U8YA 5IF9A 1F2UB 1U2RA 3AVVA 1JEDA 4O2LA 3K0AB 3ZGXA 1AZSC 3BK7A 5JWOA 2OUKA 4DJTA 2AX4A 4HUQA 1BS1A 2RGXA 3OF5A 4L16A 3I92A 1T4GA 3SDZA 1CR2A 5TB5A 1Z0JA 2O8DB 3U5ZB 2VQSA 3QKRA 4YMVA 4DXAA 2XOKA 5SZIA 1H65A 5JCPA 1NVUQ 4LJ6A 1YU9A 1MR3F 3CUEF 4IFEA 2NG1A 2WJJA 3IIMA 3WYAA 3LBIA 1G3MA 4BZXA 2PJRA 1IN4A 4OBEA 1J2JA 3WHLA 4E07A 2V55B 1CJMA 2D06A 121PA 2FE4A 2QTFA 2X77A 4IDNA 5KSPA 5F9FA 1XXHE 2WAYA 3HJNA 2AXPA 3SYLA 4MYHA 2D2EA 1VHTA 3REGA 2OAQ1 4TMTA 3AVTA 2ZXUA 1N6KA 5KDOA 1DAGA 1NIPA 3BJIC 4US0R 4F4CA 1ANKA 2H8KA 4BQSA 4RJLA 4LX0A 1FMLA 2GTPA 2IXEA 2XXAB 1KZGB 5FTKA 1XU4A 2CLCX 4YXWA 3UATA 4ABYA 4A0RA 3SHFA 3RRYA 1UJ2A 1ZU5A 4B47A 3M0EA 4GMXA 3EC2A 2KWIA 2ZAOA 1P61B 1WRBA 5HCIA 1G7RA 2OBMA 5JI3E 4HEJA 3K9LA 5DHFA 4A8JA 1D5CA 1HURA 4MRRA 1G17A 2RB4A 3U3OA 1F5NA 1AS0A 4LJ9A 2P67A 4H1VA 1QHYA 1EFHA 5IK2A 5JEEA 3LA6A 3SOPA 1EK0A 2FSFA 1GFIA 1KNXA 4P32A 1E79D 1ZD9A 4Q02A 2P5TB 4IDOA 2TMKA 4C2UA 2YVUA 1T8TA 1JPNA 4I81A 3T06B 1YJ5A 2JLYA 3OIWA 4ZCLA 1TUIA 2R62A 5C2JB 2DPXA 4M9ZA 3WMEA 1XTKA 1CJUC 1ZCAA 2IL1A 4MKHA 1CULC 3WBKA 1JR3E 2CBZA 1ZW6A 1WCV1 3QKSA 2CNWD 2XSZD 1OT3A 1TX4B 2ODNA 4IJMA 4QJ5A 2HYDA 4PHHA 1XPRA 4PQFA 1GKYA 5AUQA 4MRVA 1E2IA 1R5OA 3GQBA 3IQWA 1TU4A 1XRJA 2BJVA 4B76A 3QG5A 1IBRA 1NN0A 2BKEA 3VAAA 4NYJR 3EASA 1YZUA 2HUPA 1W0JA 4URYR 3NKVA 1IN7A 3CO5A 4OHXA 3H4MA 4QGAA 4Q1FA 1ZRHA 2J0VA 4TLAA 3VNVA 5J4LA 2EU8A 2HF9A 1KO7A 2FFBA 3CLVA 4B6FA 2QAGC 3LAWA 3ZS9A 5JI2E 1MO5A 1XJCA 4AKHA 1E1RD 2PEZA 1NIJA 1UBCA 5UKDA 2OXCA 1P9WA 1COWA 1SHZA 2FFQA 4UXIA 5CK4A 1T0JB 4BLRA 2KJQA 4TZ0A 3BS4A 1E2MA 1O3YA 2H7VA 4O2RA 1NN3A 3CNNA 4A2QA 1CRPA 3VR3A 5J4KA 2DWOA 3WMGA 2OE2A 2RGGA 4JYBA 4QGHA 1KMHB 1Z8FA 5A5GA 1GKUB 2OLJA 4LBZA 2ZRKA 1VECA 3IUYA 5EUMA 5FOVA 2R6AA 2XJ4A 3RRZA 2IYXA 3AKEA 1IXRC 2ZE8A 2ASEA 4Q48A 2LCFA 2G9NA 2RKOA 1N0UA 3EIQA 1Z63A 4OHVA 1Z22A 4EJSA 2GA8A 3MLEA 4V0KA 4Q1AA 1P6XA 1E2KA 3TRFA 4JLBA 4MDEA 1KDPA 2C9OA 1YZGA 2F9MA 5HZKA 3NDBB 5LB2A 3B1XA 2XNSA 5JJKA 4TL6A 1JR3A 1XTRA 2KSQA 1KMQA 2A5YB 1A5TA 2ONKA 3TKLA 2PH1A 4LJ4A 1MV5A 1RE0A 4JBYA 1E0KA 2CCJA 4ZDJA 1DE0A 1ZBDA 2FMXA 4W7SA 5FI1B 3CX6A 2DWPA 5CK5A 4TLEA 4OYHA 2BEJA 2GXAA 2VBCA 5TVKA 3L0IB 2FJUA 3HP1A 1JQLB 3AUXA 3CF0A 3KUCA 2ZI3A 4LWZA 3DKVA 2ORIA 1N0WA 3VKGA 1KI6B 1QHXA 3RYTC 2DFKB 2WJIA 4HI0E 4JBWA 4PPQA 1Z6GA 1OYYA 3K1JA 5SZHB 3RS0A 4IFBA 2C98A 2C78A 4NL4H 1MO4A 3IEVA 4JMPA 4CEHA 1ZNZA 4WA7A 3L82B 5EZ5A 3TVTA 1D6JA 4A6PA 1G18A 2LWIA 2QI9C 4G5SA 1GNRA 4AKIA 4ZCMA 2YWGA 4LYAA 2GCOA 1X1SA 3E1SA 3FKSD 5CJPA 3K9NA 1XCPA 1G8PA 1KAOA 2B21A 2WJVA 3CWQA 3SBDA 4M9SA 2VH5R 5D3MA 3VMFA 2ZRPA 4E03A 3W3AA 4F92B 2CJWB 4M1YA 2WOOA 3Q5EA 4KLNA 2YZ2A 2QM8A 5SZJA 2NQ2C 1NI3A 2P6NA 3KJIA 4HB2A 1DOAA 4LPSA 2QPTA 1OH6A 4YMSA 4LBWA 3K70B 3HDTA 1N0VC 2P0EA 2QZ4A 4FWIB 1Q22A 3AB3A 3NBXX 4LRWA 4LYFA 3DZ8A 1CEEA 1N6HA 3BORA 1ESNA 4PHTA 5C1BA 4C0HA 3GLGE 2Z6VA 2GAOA 3V4RA 1G1MA 2QENA 5GJCA 1E2FA 1UM8A 2FZLA 5KSZA 3R8CA 4KV9A 3VR5A 1E2JA 2ZSBA 4WBSA 2BV3A 2QGZA 1XMSA 5CDFE 3RC8A 2EFHB 5EE0A 2R2AA 4KHZA 3SNHA 2O8FA 1IXZA 3I8SA 3Q8XB 1HQCA 4TYPA 1N3BA 1SGWA 2QUZA 2FGJA 5DO9A 1W46A 1YR8A 1YKSA 2V6IA 2IYWA 2ZREA 3A37A 4PAMA 2V54A 2IS2A 2J9RA 3RSLA 4L8GA 1BMFA 3VKWA 5FUYA 3GCGA 3K0FA 2Q21A 1F2TB 2FFHA 4PTLA 4EAQA 2RCNA 4QJ3A 1GUAA 1Z0DA 2MSCB 2QTVB 4PHGA 2ZRLA 3MWJA 1AA9A 3NEJA 4P3YA 5FOWA 3FHCB 4RD6A 1N5KA 5IRCD 4QM6A 4O25A 3U7FB 4C0JA 3HPRA 5FBRB 4JVMA 2ZSEA 3UWOA 2ZM5A 1P60A 2G1JA 4JL8A 1E9DA 4GOJA 3I3SR 4ERNA 4NCNA 3ONWA 4W9MC 1EFCA 2RHDA 4DLYA 4IRUB 1RRGA 3AF0A 5E7IA 1NVVQ 2J7PA 1ELOA 1E9SA 2RMKA 1T3SA 3GLFE 4RFSB 1R7RA 4PSAA 3FFAA 1ZMXA 1M7GA 5FPHA 3WXMA 4JLMA 4FCVA 4L15A 4E5UA 1J7KA 1NG1A 2JASA 1E6CA 3DOFA 3NIBA 4Q1DA 5EP3A 2P6RA 4DZZA 3THYA 4V0ME 2PCJA 2BM0A 2UZIR 5IDVA 2QM7A 1AN0A 3LO5A 4HSEA 1E99A 4C9BA 3MAAC 2DB3A 3NC0C 4PO8A 1TU3A 2X8AA 3RDPA 1M6NA 1P72A 1UADA 3ZIAA 2HJGA 2PLRA 4HDCA 5E4FA 3MSXA 2WWIA 3QBVA 1A82A 3VX4A 2WIBA 4EPRA 4B75A 4R98A 3I8XA 4RCYA 3EPLA 2MMGA 1LS6A 2YKGA 3TGPA 4ESVA 3U2QA 4Z1MD 1VG9B 4EQ6A 1A1VA 3A1VA 4WXPA 4HUQB 3OFND 2PX0A 2REOA 5JHHB 2V1XA 2WWFA 4P0TA 3NVAA 4B43A 1CBUA 3VR4A 4PANA 3QKRB 2WV9A 4YDSA 1M1YE 4RZ2A 4DC9A 3A36A 4QKQA 1HV8A 4PFSA 1TPZA 1P7CA 2ZI7A 2PZFA 3ZS8A 3O8CA 3REFA 2A5GA 3RS3A 1E0AA 4HLQB 1BYUA 1HY3A 2ZSDA 4ZCIA 1FTSA 4UNRA 2P65A 3W8NA 5DIFA 1E2PA 3TR0A 4I4LA 3EX7C 5JS7A 1AQUA 4O0MA 2HV8A 2ZRBA 3WNCA 4UNSA 4BECA 1XTQA 4B3GA 2FEOA 4JT2A 3NBZC 4JKYA 4OI4A 1P5ZB 2A2ZA 3NC1C 4M53A 3NBYC 3PUVA 3UMRA 1X1RA 2FH5B 4FMBB 4KXFB 3CR7A 3PV0A 1QVAA 5TXGA 4A2PA 4ARZB 1VG8A 3LW7A 2JJ1D 3ADBA 4A8JB 3SZRA 5FR1A 5KO2A 1E94E 2ZRFA 4OHZA 1XEXA 4Q03A 4PHFA 5DISB 2W6IA 5LPNA 1E9BA 2GETA 4D26A 3CF2A 2DR3A 3T35A 1TMKA 5GADl 1SVKA 2B7BA 1UKEA 3RWOA 4CEIA 4IOKA 4OHWA 4A0FA 4EUNA 2HLDD 2J45A 5BN3A 2WKPA 1SQ5A 3LY5A 1XMJA 3VFDA 4N3NA 1DO0A 2AD5A 3BB3A 4PZZA 3LLMA 3QUSA 2O0KA 3SYNA 1TEVA 3QKSB 3SYKA 4C3ZA 2AFHE 1W36B 2JDIA 2KI5A 4M1OA 1DBSA 1J8MF 4BFYA 1AGPA 2V9PA 3D6TB 2X19A 4LJ5A 3DZDA 2HXYA 2QPAA 3K8YA 3LX5A 4F4JA 3OHMA 1NVVR 3IHWA 5JFGA 2ZPTX 4US2R 1VPLA 5FI0B 4GRAA 3MGCA 1XXHB 3GD7A 3QVVA 2HJVA 5FL7A 1UEIA 1KSFX 3PEWA 3KXLA 2FSGA 1ZINA 3R9XA 4WW0A 2C77A 2ODWA 2J41A 2WJYA 1XNJA 2R9VA 4S35A 1TF7A 4QHSA 4R2IA 5L8VA 3BC1A 4O3MA 4G5QA 3PUWA 2F6RA 3PXGA 3SQWA 1Z6AA 4KYIB 3I5XA 2D74A 3FHOA 1DAEA 5C4MA 2AWOA 2AFIE 1NF3A 4DRZA 5KSYA 2ODEA 2HDNB 5FBQB 3LRPA 3OEEA 3WMFA 2DCUA 3ND8A 1U0LA 1VMAA 2IXGA 4HZUB 1UDWA 1E0JA 3KFXA 4TYNA 4GFDA 2J46A 2QL6A 4KI0A 4YLGA 2GXSA 1KJZA 2WSMA 2ZRIA 3CNOA 2ZUDA 1N5LA 3PFIA 2CE7A 3AVOA 4PZYA 5EE9A 4HB4A 3VKHA 2F3TA 2BCGY 5LB4A 1G19A 5IT5A 1OSNA 1LY1A 4B3BA 4DLUA 5BN5A 1GWNA 1KKLA 1OYWA 2JATA 3T34A 5JJIA 1NJGA 2REXB 3OAAA 2IUTA 1X8LA 4POAA 1L4YA 1G8HA 4QC2A 1CTQA 2A3RA 1D2MA 1SVLA 2P2LA 4QBIA 1OHHA 4D0GA 2OESA 3EWAA 4M1WA 1GM5A 3IDQA 1F60A 1SKQA 4A8JC 3W3ZB 1OKKA 1JI0A 2RGEA 4HLUA 4DB4A 3VU9B 4Q1BA 1PUJA 1E2EA 3IIKA 3HPQA 4CDGA 4DWJA 1QG2A 2HF8A 4Q9JA 1E9CA 3QSYA 1F3OA 1DO2A 2W00A 3E70C 1SXJE 3BH0A 1H8HA 3BXZA 1W0KD 2A9KA 3A1TA 4GPTA 1ZNYA 3IGFA 2DFTA 2ZR9A 3TAHA 4M1MA 5FTLA 1BYIA 1RRCA 1TL7C 2PMDA 3R9IA 4AURA 3SQXA 2C96A 2Q9CA 3SBEA 1RPZA 1XCGB 1A7JA 4AKGA 2ZANA 1KO5A 1E2NA 3T12A 5K8LA 2XTZA 1RYFA 1VHLA 3I61A 1LF0A 3OIYA 4FD2A 3FDIA 1OB2A 1KK3A 1N25A 2JJ2A 2EFGA 3E2IA 1DVRA 3U3MA 4QM7A 3EXAA 2ZI5A 1W5SA 3SJZA 4A0GA 3NH9A 2OEPA 3RS7A 4NE2A 3SS8A 3HYTA 4B2IA 3F5FA 3KDSE 3KXKA 4C0AC 4LHXA 4DUGD 3KTAA 1XJQA 3Q9LA 1RYHA 3DMNA 3Q7PA 4B3DA 2D7DA 3UMFA 3FOZA 1PLJA 2IEZA 4QGGA 1A2KC 1NN5A 4DLWA 2B8TA 3IQXA 2C9CA 2RGNA 3GFPA 3TSZA 4YMTA 3B1YA 1N5IA 4BLSA 4RD2A 1R5BA 3QF7A 2GHIA 3NBFA 4B32A 4DLZA 3UANA 1NVWQ 2ATXA 4ZI3A 4LYHA 2NTYC 2ANCA 4S2EA 1AKEA 1R4AA 1QHSA 2CL7X 3A6PC 1HE8B 3AKCA 1R6BX 2DYKA 4LI0A 1L8QA 2JLRA 3OIVA 2D4HA 5HKKD 3KQUA 3C5HA 3JZAA 3N5CA 2V7QA 2NZJA 1CP2A 4RD4A 4MITA 1GRQA 3K0FB 4B34A 3ADDA 5L3VA 5BW8A 4EJSC 1KI1A 1G7SA 3DL0A 2EQBA 3QNUA 4FMDF 3FWYA 3GEHA 2WSSD 1XD2B 5AJYA 4XTRA 5EE5B 2ZI6A 1IN6A 1Z2AA 3UIEA 1W2HA 5FBLB 2G3YA 2VP2A 3MJRA 4DKXA 4NYMR 1UAAA 2H5EA 1I4TD 2AD1A 4KSCA 4Q9HA 2IT1A 4EIWA 1VCOA 5FOXA 1QHNA 1TAGA 3Q3JB 3W8RA 1SXJD 4YMWA 1JR6A 2QROA 5BWMA 4JVNA 1JQJC 5LBIA 4NCJA 2ORVA 2QAJA 3DM5A 2WKQA 4M2LA 5KPDA 3I5YA 1K5DA 1QBKC 3MJHA 5JMTA 4L5BA 5AUNB 2F43B 2QRNA 3TUIC 1VIYA 1AIPA 5AR1A 4U00A 1IXSB 2D7CA 3IBGA 4KO8A 2XZOA 3OEHA 1EXMA 4AWXA 4PPNA 4DLVA 3VR1A 2Z43A 3EAQA 1D9XA 4A0HA 5D3QA 3THYB 3CRRA 1L7VC 4HDOB 1ZC4A 1AS2A 1XMIA 2HEIA 4GL2A 3QI2A 2GBLA 3PVSA 2JIZD 1MRSA 2H57A 2QU8A 3WY9A 3U4QA 1OH5A 4BLTA 1OH8A 1M34E 1IN5A 1NMZA 3QPVA 3I73A 4UNQA 3HU2A 4E22A 3CRVA 3ICQB 1JNYA 3C8UA 4TMVA 2Q3FA 4IOMA 5EZ6B 5FBWB 1W1WA 2JLWA 4YDHB 2QMUA 1R0XA 3U7HB 1VIAA 8OHMA 3CX8A 3JVUA 2VPPA 3MWLA 1E98A 2FF7A 3SC3A 4DSTA 5DH9A 5AJWA 4EQ6B 1FPMA 4JLKA 5JHGB 3ADCA 4WZBE 2H16A 4CVNA 1MOZA 2VP4A 1S0UA 4I1UA 1G9XA 4C0QC 2PEYA 2OCYC 1GL7A 2I1QA 4US1R 4ARZA 1K5GA 4GDFA 2GZHA 1ZM3A 5H70A 2C04A 3E5HA 4HDQB 3V9PA 2CK3D 4KLZA 4JLVA 4OQFA 3SJAA 3KQLA 3Q85A 1ZM2A 2F1HA 3B1VA 1T0HB 4JLOA 1XB2A 4B44A 3SFZA 5IHPA 2VF7A 4LPKA 2CNWA 2ZR0A 3PEVA 3U6BA 1NLZA 2ZJ2A 2XSZA 4TLBA 1HH4A 1VYTA 3GLFB 1E2LA 3LV8A 1KI8A 4FXPA 1Q44A 2OCAA 2SHKA 3L0OA 4M8NE 2PCLA 1NL3A 2QP3A 4G3XA 4EFLA 4R71A 2OLKA 4QG7A 2YJTD 4Q9KA 5GJBA 2XGJA 2VHUA 4IHQA 2ZUCA 2PLFA 3U44A 4RZXA 1RIFA 1UPTA 1BH2A 2QQ0A 4G5OA 1U0JA 3I72A 2OCPA 1S9HA 5FPSA 621PA 1H8ED 3LLUA 5DI3A 1O87A 1E2DA 1XEXB 1E1RA 2IF2A 2JA1A 1U90A 4GP6A 4N0DA 4DDTA 2WTUA 3L8YA 1G7TA 5EXSA 1R8QA 1XPUA 3AKDA 3A58B 1P2TA 2C99A 1DELA 1XXHA 4CEIB 4LHWA 5TDHA 4R2HA 4EPVA 3GP8A 2ZRHA 1WB9A 4EPTA 2GESA 1Z0KA 3BWDD 2W2VA 5AUOB 3RSOA 4XWOA 4CGZA 3IIJA 5JRJA 1I2DA 3K0CA 1G20E 4ZIRA 1E32A 1PV4A 4PAQA 3F8TA 3GJ5A 2O8EA 2ZR7A 4HAZA 3DM9B 3DOEA 1CLUA 1XDBA 1EWQA 5AJZA 2YINC 2FEMA 3MCAA 1G7CA 3V00A 2XAUA 3RLFA 2RAPA 4HZUA 4URXR 1W47A 2ZJ8A 4HAWA 1D8TA 1KYIA 4GP7A 1L4UA 1XCMA 1EESA 1X6VA 3LW8A 1FFHA 2RGNC 4EFNA 3TQFA 3B9PA 1QHHA 4G5RA 1TF5A 2BEKA 5HTKA 4LJAA 4Z51A 3S1AB 4DIEA 3X1YA 1XJ0A 5K8TA 1Z0IA 5K8IA 3TVDA 3D8BA 1COWD 3X1XA 1S4QA 1XWIA 1R0YA 5FPKA 3ZQJA 4CW7A 1OFHA 2K5UA 1HA3A 3A1UA 3L0SA 1FUUA 2VTKA 2EVWX 3A4MA 5EQTA 1ONBA 4QNRA 3NXSA 2XTNA 2JLQA 2FU5C 3MG9A 1Q3HA 4Q4LA 5H8WA 3BD9A 1QG4A 4LCBA 5J40A 3VR2A 2CCGA 3L0PA 3VU9A 3QXXA 4NMMA 5FUXA 3QEJA 3GJ3A 4RY2A 4UQOA 4Q1CA 3GEIA 1G6OA 5J4YA 1VKJA 3TW8B 2UZ3A 1S1MA 3WYGA 1NMYA 4BRUA 1W4AA 4Q9LA 5KU1A 1YR7A 3LD9A 2ZITA 1KI7A 2BIFA 3KJHA 5FFMA 3FKSA 3SJCA 3IILA 2GJKA 4PSKA 2QNRA 1U9IC 5FBVB 3D31A 3FVQA 4CEJA 4Q7KA 1HTWA 2BMJA 1X86B 3TAUA 2ZJAA 1BKDR 2Z83A 2XNDD 5G53C 2VEDA 4LDJA 1E4VA 1OXSC 1N5JA 4EDHA 5CLLA 2Q9BA 5FTJA 3CH4B 4UNPA 3EIEA 4K8OA 2BBTA 2ZROA 3I1FA 3GPLA 5EXTA 3AF3A 2V1UA 4IOLA 3F3YA 1E9FA 1YR6A 3RNLA 1P3JA 2XJ9A 4OI2A 2W6JD 1MT0A 2GZDA 3G82C 1RRPA 1DPFA 2FG5A 4TL9A 2RHMA 3M6AA 4MKGA 1L2TA 3GLHE 3UWKA 1E3MA 4P31A 4NHOA 2F1JA 4ILEA 3AV0B 4TT3D 1M2OB 4OL0A 4DLRA 2NGRA 1P2UA 3KZ1E 1I4DD 4HAYA 4XVUA 2R65A 2YC4C 2WVJA 4X8MA 1SVSA 5K8UA 2FPKA 3CRQA 2IHBA 3CWZA 1J99A 3OZXA 4OK5A 2AK2A 2D62A 2FPLA 1FNNA 3CZQA 3THWA 4RCZA 3A4NA 2GXQA 3KXIA 1QZXA 2GEDA 4GI7A 3CIOA 1E2HA 4A4DA 5FTNA 5KNDA 3GEEA 1E4YA 4NYIR 4RZUA 3W90A 1ZM9A 2BMDA 3A4LA 2BMEA 2RH5A 2W0SA 5L3SA 1ZYUA 1KOFA 2YNMA 2GCPA 3PIRA 2ZYVX 3EIHA 3KTAB 3NEYA 1SVOA 4MRPA 1GNPA 1Q3TA 3P1JA 1W2GA 1LF5A 1ZAKA 2VLIA 2NO0A 2ODBA 1XP8A 1XD2A 1IONA 1S96A 5JLJA 4BLQA 2A78A 4AG5A 4DCVA 1K8RA 3KKOA 4MKIA 3LBNA 2FA9A 3BRWD 3ZVNA 3EWSA 2R6FA 5HPYB 2OILA 3F0TA 3HR7A 4DT1B 3UPUA 5CB8A 1DG1G 1N6PA 2OO7A 3NHBA 421PA 1YZKA 1YVDA 3U6KA 2KE5A 3NG1A 3ZLJA 2IK8A 4D6PA 2GJAA 4B3FX 5F98A 1IJEA 1GTVA 1FOEB 1G5RA 1XZQA 3H2YA 2F43A 3AF4A 1KHTA 4UKDA 4FINA 1P4SA 4TWZA 5HCNA 4NCIA 4DLSA 2F3RA 1CIPA 2ZS8A 4NTZA 1G4AE 3GLIE 3CPJB 3AKYA 4Q01A 4DDWA 1KI2A 3GLHA 1G8YA 4QHYA 2WAXA 1DAFA 1YZNA 4Q4HA 1KO8A 1GZSA 1VDZA 3C4JA 2WMOB 4Q7MB 1JPJA 3GLGA 1I4LD 2WPDD 3QJYA 3BB4A 2F1IA 1ZC3A 4RKFA 1OB5A 2FOLA 4IVQA 1MO3A 5BN4A 2QAGA 4FIDA 4JVSB 5CDFA 4Z1MA 2R6DA 4I99A 1XD8A 2UVQA 4KU4A 3CPHA 3BB1A 3KKQA 1Y3AA 3QQ5A 3OFNA 4A36A 3P4XA 3W6OA 4KBFA 3DVLA 2BMFA 3M1IA 1E2GA 4HLUC 1CJTC 1ZJ6A 1UBEA 2EW1A 2ZRNA 3LDAA 3EZ7A 1G21E 1JEEA 1E1QA 4HLCA 4Q00A 1W7AA 1KDRA 2BCJQ 3G0HA 2ZAMA 4MA4A 2OSBA 3SFVA 1ZM7A 3K70C 4BGDA 3CPEA 1S8FA 4U02A 4YQFA 2ZE7A 5HE8A 5JJLA 3EZFA 1N2CE 1M74A 1QF9A 1RFLA 4RKEA 3LFUA 4CIDA 5GJWC 3BE4A 3BOSA 1AS3A 1T91A 5FOSA 3QE0A 2Q9AA 2IYVA 3B85A 1WE2A 1IAQA 4JLAA 2ZSAA 4LV8B 1E2QA 3B1WA 1SVMA 4X8LA 1QHIA 4URUR 1G3IA 5JRZA 3U4QB 1XMVA 3GJ7A 3KB2A 2ZQ5A 3KKMA 4R7ZA 5DE3A 1GRRA 2J59A 4TYWA 4CF7A 3MD0A 1NBME 4M1SA 4BEJA 2CEAA 4C30A 4IEIA 3CH5A 4M1KA 5BYJA 2O8CB 3QXSA 5AUPB 3DPUA 3VR6A 2JLSA 4MGZR 4XD7A 3GLFA 3H0KA 3EPKA 3NH6A 3TIFA 2VYFA 4IDQA 2JJ1A 1XEFA 3FPAA 5CITA 2PJZA 4BFSA 4DEYA 2ZYWX 3CRMA 2CCKA 2VL7A 2OT3B 3A1WA 4DLTA 1ETUA 1NRJB 2ZTSA 1P9RA 4PZLA 4Q19A 5DGXA 2XX3A 3VTKA 4GNKA 1UBFA 2PL3A 4QFMA 4ACBA 4LZZA 3FMOB 4GT1A 4JJZA 4GMDA 4QXAA 4V0MA 1OXXK 3FHTA 1EG7A
chains in the Genus database with same CATH superfamily
4R1LA 5AVOA 3TUZC 2GZRA 3HWRA 3FPSA 1G8SA 3O8OA 5FT9A 1E89A 1N2SA 2HLDA 3DD1A 2YWXA 4FE3A 5FUMA 3C6QA 1Z8HA 5EXDA 2XE4A 4BFVA 2ZSJA 4HXEB 4MVYA 2FVYA 3HYLA 1Q91A 3TMKA 4F6CA 3DA8A 1AQYA 2DQSA 3ORFA 4HGYA 3I05A 3C7DB 2FE1A 3JD4A 1QVWA 1DO8A 1IPEA 5TV2A 2OXFA 4M7RA 1EUCB 3OC6A 3PT5A 5KUTA 3WYBA 2X8BA 4LSZA 1TADA 2YR0A 3FRIA 2VDWA 3CUUA 5D3KA 3W4IA 5AVQA 4NH0A 3QHAA 3QXGA 2PIDA 4ASUD 3BFVA 3N8HA 1V4NA 3LIPA 2NU6A 2IXDA 3CNHA 3B3FA 4MVWA 1C0KA 2XB6A 3LCMA 1I2AA 4UVDA 3UMGA 5AW4A 1O4VA 4XWTA 3HJFA 3PI7A 3Q3EA 1X1QA 2Q5HA 2PS1A 4LEIA 3GXBA 2DT8A 3QPWA 1OXBB 2MSEB 2F8SA 1M1YA 5G40A 4C7KA 2ZCUA 2AKYA 2X1LA 3GLRA 2V8OA 5DI3B 1YZLA 4B6OA 4KQIA 1KTIA 1Z5PA 1CR0A 1VPTA 1DJPA 3OD5A 4IJWA 2ZBQA 4D79A 2QXTA 4G37A 4IV5A 3ENWA 2J3JA 3CW2A 1Z06A 5ICGA 3HVHA 5EJ4A 1FMTA 5KTYA 5EHZA 3PCRB 2JPDA 3WYEA 5C53B 4YUVA 3GFRA 2FPSA 3TLGB 3ZVRA 4ARUA 1JDBC 4BBZA 4EYQA 1PL8A 1V3TA 2IEDA 2MDTA 3S1AA 3KZMA 5F23A 3DLHA 5AXCA 2O54A 3MYRA 1ECBA 3GUHA 2WU8A 4X1KB 1J8YF 3ZNQA 1SCIA 3JQCA 4PE5B 4C22A 2H4XA 1FNMA 3AUSA 4TPKA 5B37A 3ZXXA 2WM2A 3GJXC 1U2SA 2LKDA 4MA5A 5B3AA 1F06A 1T5DX 1XEAA 4ZOLB 3W77A 4D9MA 1LNZA 3F98A 4K6FA 3VTZA 5JDCC 3VSAA 8LDHA 3FCCA 1ZICA 4FFNA 2AJ8A 2IYAA 4M86A 4F9EA 1UBGA 1OBOA 4TROA 5ESDA 2G17A 2JBWA 3HADA 2P2NA 2Z2KA 4BNVA 1YT5A 1BD4A 2M6SA 3RYHA 1E3EA 3X1ZA 1FVOA 1MJHA 1QSGA 3L7KA 3THOA 1FIUA 1EGVB 1M1XB 4C01A 1VYVA 3HY4A 5AI6A 4MYRA 5HBGA 3TMYA 4C0KA 4YAIA 4IZHA 1EUYA 4BEBA 1VCMA 1VYUA 1BMQA 2C3MA 1UBTS 2MJLA 2RKBA 3LP5A 4PC2A 2IWHA 4DMMA 1PFYA 2VZ9A 4JSTA 4REOA 4WOPA 1OMOA 1JWAB 1ONSA 5FUVA 1DEOA 4KACA 3ZV3A 1CNEA 1KDTA 4EJFA 3OQBA 4BMNA 3W6PA 4ILKA 2DLCX 1OE0A 1ZH6A 3JZMA 3ED1A 1JFFA 1QAQA 5GOZA 3C3AA 3RK0A 5I7WA 2X76A 4HYEA 1LDYA 2DY1A 3A9SA 3NYWA 2PQMA 4UAVA 5BO5A 2P4EA 4DA9A 1SURA 5CFPA 2W7TA 4UJ3A 2AFHA 3PXBA 3L8GA 1IZ7A 2DBYA 4JU9A 5KYKA 1WX1A 2JC3A 1OXUA 1MW8X 5B53A 4KAXA 1A4RA 1JQ5A 1A9PA 1MN6A 1P8JA 2Z5FA 2B25A 3MQ2A 3Q3CA 4FOPA 5E95A 4Y1RA 4BPBA 2JFYA 1EWTA 3RBZA 1FTYA 1DLIA 1NV8A 2OC4A 1YOVA 4NZMA 2A92A 1S2LA 3QENA 3W5HA 3BUSA 2DEUA 4OU4A 4C2BA 3H3JA 3I4LA 1U2DA 2P62A 4RKQA 3GPDG 1UEJA 4ZCSA 1RMYA 3JWHA 5D51S 3HCWA 1Y8CA 4ZOCA 4LYJA 1OQAA 1QH8A 3D2LA 4B3XA 1UUFA 3EA4A 3ZU3A 4ENWA 5IDWA 3FOEC 5J2UA 3KJNA 1AKYA 4Z49A 5KYGA 2FK8A 3RQIA 4Q4AA 3DEAA 2A5DA 3B2EA 4P3OA 4AMBA 2QA5A 3QEMA 1Z45A 2UV8A 3FGPA 4B4DA 1DCMA 2DHRA 3F90A 1L5NA 3EA5A 1RQLA 4EABA 3KUXA 1BG6A 5P21A 3GF4A 1EGHA 5KBYA 2IZOA 4XXHA 4YT8A 4I9FA 3HCDA 3ZHBA 1R3UA 1ODFA 4AG6A 2PRKA 2H1WA 2QUAA 3GFVA 1OZGA 1W9HA 3V1NA 2RAFA 4FDAA 1E59A 3RH0A 5L7WA 4LFBB 3RI3A 3PJRA 1G0OA 1OCEA 1G3RA 1GNTA 2O3RA 1U0GA 1MC1A 3T5BA 1AB5A 1QQ7A 5MGNA 3L79A 1UF9A 5LXTB 1PJLA 4HEHA 1R6AA 1HETA 2HMAA 4HZIA 4KWIA 1M2NA 4KXNA 3OQPA 2AMVA 4NCKA 5DZSA 2OFFA 3ETDA 5DM2A 3TLBA 1TECE 4BEWA 1KY4A 4X8OA 1ZR4A 4OLJA 1YJXA 1FRZA 2DHCA 3CN7A 4L6CA 3FYUC 5B58T 4KMOA 2XOEA 3EJWA 3SC2B 2IH4A 1Z4MA 1UEXC 3LSYA 1QG6A 1T34A 3EIFA 5K4HA 1JLKA 2YMPA 5CW1A 1E96A 4BO6A 1ZWKA 3ZWDA 1QF7A 4KR7A 1BHO1 4CHGA 1WA5A 3E35A 4QASA 3MMNA 3W2GA 1WZCA 3ZWAA 1LQUA 3L9WA 2WILA 1GG2A 3OESA 3O5AA 3THWB 1HUQA 1D1TA 3H8WA 4XX0A 3MFYA 5LQCA 4J75A 3TRJA 5FB3A 4F3CA 4LFCB 4AN1A 4L8YA 4RVGA 5HFAA 2O5CA 4R8RA 1SWWA 2I2WA 3L6OO 2JRLA 2J7KA 3FMFA 5CVJA 1VL0A 5C8DA 3KP1A 3TCNA 2ZYUX 4ACAA 1Z7BA 2DUMA 2H5IA 2ZTUA 4F6LA 1F4LA 3WA7A 1QE0A 4X3PA 3O8RA 3JQ9A 4OHYA 2RHHA 3MIZA 4ZVOA 1HYBA 5ALIA 5KU7A 1R00A 4DVGA 1WXQA 2P5UA 3UXYA 3KPVA 5EIFA 5EWLB 5JOQA 5LMZA 1D04A 2AC4A 3ORHA 4MWZA 1E9AA 3IVAA 4B3CA 1U3WA 2P7IA 3BF8A 3ZVKA 1PL6A 3NT4A 4PLFA 4RE6A 4BE7B 3DBOB 1BTOA 4PSCA 1DQYA 2SCUA 1NY6A 1M0SA 1HFWA 2W71A 2Y93A 4BMZA 3V2GA 1PR4A 4ER0A 5AKKA 4YRZA 4UZFA 4QRHA 4OGWA 3DE0X 4JU8A 1R2QA 3S81A 3SFTA 3MINA 2G36A 4J2HA 2L69A 4DSNA 4I1PA 5BV1A 1LA2A 3F6BX 2FUKA 1VLMA 2HK7A 2OY0A 2DQZA 3IDSA 4DA8A 2ZTVA 4OV6B 5I9IA 4IGAA 2JCVA 4EUKA 3F46A 1TUEA 4XJTA 2IZ1A 2V7QD 2PH7A 1KBZA 2IHYA 4MW5A 2CUTA 2VG8A 3AY0A 4IFTA 3TOXA 4Z9FA 5ES4B 1T6NA 2Z8XA 3GLHB 2EQ5A 1T8WA 2VSFA 4EFKA 1JSZA 1V43A 1UJ4A 2DFLA 1DCFA 1F3LA 3ASUA 1ZD8A 2OBBA 4AY6A 1TQDA 3B78A 5EIAA 3NW9A 4QREA 2DRIA 2QMQA 3CEHA 1KQFA 4QPDA 2EWWA 1E1YA 1GL9B 5HQ3B 2Q6KA 1RYYA 3T8YA 4GLFA 4OL9A 4LF7B 3DT8A 4HRAA 4YJ2A 2J5KA 3UXEA 4F4UA 1ND6A 16PKA 1WBBA 2QXYA 4RTLA 3KJQA 1NM5C 1CZOA 1OZAA 2G04A 1FNSA 4UCQA 5AO9A 1DBIA 1RP7A 1TCBA 3B9RA 1QS0B 2IDJA 4J3NA 1T3HA 2CNLA 2QRMA 1PNRA 1W19A 1NLUA 2YXEA 1AB6A 2VF8A 4GZLA 3B6KA 5F1YA 3REQA 5J4HA 3O75A 3NOQA 4M9XA 4Y6SA 4H3VA 3K0SA 2WDPA 3E7DA 4MRAA 2JD2A 3ZWKA 4MGIR 2CK3A 3FXAA 3R0QA 3DZKA 2XUJA 3ILVA 3RRNA 1I0ZA 2UZ1A 3I9JA 1BC5A 4QQKA 4YGXB 4DDHA 1L4LA 5LLDA 1I3MA 2ZIVB 2H3EA 3MB5A 1UIRA 2O9JA 3WS7A 4IBOA 5DHQA 1F0KA 3N7AA 4EJ6A 1A72A 1QAOA 3EBLA 1LUAA 4U7TB 2JLAA 5HMLA 3WTBA 5LQDA 4RLQA 3SLKA 2FZ4A 3HFJA 3FJOA 1ZH4A 1S7CA 2AR0A 3RS8A 1T9BA 3TPCA 1B3BA 4Z0PA 1GRNA 4HTFA 5KAPA 3N3BC 3L4JA 4HNAB 2OMEA 3EOZA 4H15A 3BXHA 2YWFA 3EGOA 1Z5ZA 3AC0A 2RJOA 1KZHA 3HYNA 3HMQA 1EUCA 5FA6A 4JOCA 1M8PA 4EF5A 1E9VA 3Q4GA 2XUFA 2VF5X 5BSVA 2Z4SA 3GAFA 5DXJA 1H22A 2BFDB 4G1VA 3U81A 4FT2A 3DV0B 1H8EA 2B7CA 2DVMA 5FBHA 4HMQA 3LLVA 3U7EB 5B6PA 1WMAA 1FW6A 3KAKA 4R1UA 5A5DA 3AVXA 4UU0A 3VTFA 3MGBA 4F60A 1AO0A 3GLIB 1YCGA 1CVLA 2J09A 2X4GA 1D2NA 2WWTA 3BJMA 1G59A 1RJ9A 1YZQA 2REBA 2X6QA 5IX8A 3DWEX 1NG9A 2GF2A 1B16A 3KQNA 1BWSA 1V16A 4V02A 3VPDA 1XQVA 2ZS7A 4CMGA 4HYYA 5IJWA 3I04A 4RIEA 1C7EA 1NVXQ 3PD0A 2NZ8A 4Z8YA 4A8PA 2EYUA 1CUVA 1EQAA 2PU5A 4OHBA 1U0BB 2W2OA 1KI4A 4HLDA 4DQDA 2ZATA 4HYTA 4N5DA 2J5XA 3KE8A 1Q0PA 3ICOA 3PXXA 4XH9B 1UK8A 3QG1A 1JA1A 1A04A 3EOBI 4XX1A 2FUEA 2HADA 2L42A 1KMCA 3VPXA 2CVFA 1N57A 1HTBA 3ANSA 2V97A 2WD9A 1AG9A 4R2XA 3RVDA 4YMGA 3N2ZB 4ZT5A 1UDXA 4CM4A 1J0AA 4Y2VA 2IA5A 4H1WA 4RD3A 1UWLA 3WLAA 1P2FA 3CNLA 3FTCA 1WMFA 3RVSA 1ESDA 4KODA 5AJTA 4D5EA 2PJUA 4ZOLA 4V03A 4N65A 3OPVA 1ORDA 3IDAA 1W36D 3ADPA 4Z8XA 1Z6XA 3HY6A 4H9GA 1CU1A 1SQ6A 2WYVA 1OX4B 2ZI9A 4O4LF 2KQUA 2ZFUA 1NQWA 1HWYA 3DE2X 3FW1A 4NARA 3WK9A 1YZTA 2O6HA 4IIJA 3M6IA 1E0SA 4C4PA 2XT6A 3AIKA 1NW9B 4RTRA 1P2BA 1S1CA 3S99A 5AQEA 1RIIA 1FTQA 1L7NA 2FHPA 4KIFA 5CHEA 3JYQA 1BCRA 1AXRA 1P9OA 4DEXA 1FXUA 1Q3KA 3E7PA 3H65A 2PDAA 1B0UA 3EXIA 3TR6A 5DNYB 1L4NA 1L9KA 4YC7A 2XEDA 4OJQA 3WQHA 4U7WA 3VPFA 3MMPA 4FX2A 2GJSA 2ZUBA 4CFZA 5JNSA 5EXPA 4KFRA 5DX0A 1BVUA 3IQGX 1I7NA 2BFEB 2ERYA 2NTEA 2OD9A 3BXFA 3GEMA 3KB1A 1SZCA 2B8NA 4UEQA 4B85A 3JVVA 4NH4A 4UHFA 1E7YA 5FI5A 1T6BY 4MDYA 2FRDA 3AGPA 2JLUA 1P39A 1QR2A 4Y2QA 2CYCA 1T36A 3R77A 3A06A 4Y2RA 1M66A 4WEOA 3SDSA 1OYVA 2F7SA 3ZE2B 4AKEA 5L7TA 1F9AA 5C3UA 2I1VB 3U7RA 3UJNA 2Y1LA 4XJSA 1KF0A 3V55A 4CL8A 2Y2VA 4EKIA 1LI7A 3EFBA 3T4UA 3W1VA 5K05A 2AN9A 1TQ6A 4BFUA 1XEWX 3AONB 1I80A 4AJOA 4XJVA 2BFBA 3E0QA 1UFQA 3GW8A 3RSFA 3ZHCA 1FE8A 4B35A 4TKZA 1UJNA 1UBUS 3UCEA 4KH1A 4CCWA 2P2ZA 2QTHA 1O94A 3OJFA 4QJBA 4ESEA 2ZS9A 4BWVA 5B55A 3F2IA 2NO5A 3FKJA 4RD1A 1JMVA 2V98A 3MUFA 3CMCO 3BGOS 3K8QA 3FTQA 5C0OE 3NEAA 2ZYIA 2W98A 3FTEA 4G0PA 5EMKA 2QTTA 2UYCA 3KC2A 3H84A 2QPLA 3L1VA 4Z86A 4EJ2A 1AGRA 1A8IA 3TIIA 2Q6VA 1UBNA 3MCVA 4G0QA 2J9XB 2IZ5A 2W6JA 1R4MA 1W8IA 2IYSA 4X85A 5I3CA 2XZPA 4O33A 2TRSB 5E4TA 1O0CA 2GARA 4BLVA 1T1EA 3ZWPA 3P0IA 4GBMA 5U9CA 1ZN7A 2BTQB 2Q6LA 3NOOA 3TE6A 4ZJPA 4J76A 4QOEA 2R5WA 3QELB 3DTVA 1EFVA 4HGOA 3RSZA 3ZE6A 1JG3A 5BWNA 1JWLA 2UXBB 5A3VA 4BZPA 4MNTA 4KAJA 1N9GB 4RU1A 3TUJC 2Z3VA 4GL4A 1E7WA 1O7JA 2IYUA 4QXOA 4INJA 5L3QB 3QKTA 4ESOA 2WBLC 2FNAA 3DT9A 4X24A 3HWWA 2QMHA 3K1AA 4OFZA 3WLNA 1G8FA 4WOKA 4RD0A 3P9NA 2NM0A 1TFRA 3HK2A 3CNQS 3DZJA 1KJIA 5EIBC 4U7HA 1J39A 3H4TA 5TY0A 3ZHOA 1SPBS 1PFKA 4NS1A 4HMOA 2YN0A 5CXQA 3EK2A 4AX8A 5D84A 3ZY3A 1ZS9A 1QYIA 3HFSA 1WVMA 1KSJA 5BNFA 2OCKA 3DYBA 5LOVF 2I71A 1QDEA 2OYSA 3C5WP 4JLWA 5H5JA 4DMKA 5BNZA 4FKZA 1MO6A 1ATIA 1J2RA 1CNMA 5BQPA 4EPXA 2XECA 5KKCA 3D3NA 4WESA 2NIPA 1XQ1A 3R8XA 1UZNA 5L95A 1KZ6A 1MQ8B 4NU0A 5CB0A 4GXNA 1GADO 3GN2A 2FX3A 3A6GA 4FCTA 3W3AD 2VFAA 4EG3A 1C81A 4URZR 2FZGA 4ALNA 4IH9A 2WE7A 3BRWA 3FGOA 4AKTA 1ZGHA 2B37A 1N6RA 1OAOA 4HAIA 5C1IA 5AKYA 4NFHA 2C5AA 4LAFA 5CA1A 3D54D 3WJ7A 2ONJA 5I5EA 4FNMA 4IH4A 2AX3A 2B5VA 3DB1A 4I1SA 4LK2A 2R8PA 1LBTA 4OBWA 1J6UA 4QYTA 1R8SA 1KIMA 4DGQA 5BYKA 1CIJA 5HVNA 2J0SA 5K0ZA 3L0CA 4TMKA 4RDXA 2ADOA 1KMIY 3GGCA 1YGYA 2QRHA 4CM7A 3ORSA 4KITB 1EX6A 4BBPA 1DDOA 2FWPA 3Q0IA 4ZDIA 1VXRA 4MI9A 4GPIB 5BWOA 2QIOA 5HZHA 1BEZA 4HGQA 2GHQA 3EPPA 2Q8PA 2WU4A 1SOVA 3HXQA 2EDAA 3I76A 2CDAA 4NSNA 2ISQA 5DHRA 3UMCA 1U7TA 1EDBA 1WCIA 4L1KA 1J1IA 2F9LA 1YACA 3H7AA 2DZDA 4UPVA 1CZNA 3V4VB 1ES9A 2CT8A 1E9RA 2C5FA 5JH7A 3U56A 2OM2A 1HOTA 4MDFA 1KORA 2VF2A 4RXTA 2R1VA 3O1LA 5JNRA 1CKEA 3WLKX 4LC1A 1UC4B 4I4IA 3NVDA 1I7QB 3WRYC 1CZUA 4W5HA 2P2YA 5KYUB 3K9GA 2QN2A 1EYZA 4CF3A 1VGQA 2NO9A 1V8DA 2E1RA 3I64A 1YJAA 1WZEA 1JFRA 3I6YA 4H1UA 4D92A 4EYKA 3UUFA 2QUIA 1NVMB 1WXIA 2C42A 3BGVA 5HRCA 1YQUA 1M9NA 1OC4A 3R7NA 3Q1KA 2X3YA 2CUZA 2J0UB 3RS5A 3ZE8A 1WAMA 1WPGA 1DADA 1YFKA 1MIOB 1ETHA 1R12A 4BNIA 2IXAA 3NLLA 5HQ3A 1U4SA 1RTKA 2H8GA 3TPZA 1MAHA 2J85A 3EZNA 4S1TA 3UJ7A 1I4WA 2BFFB 3R7WB 3K0AA 1YB4A 3IEUA 3JR3A 5FFFA 4GR4A 3UMSA 4A2WA 4XJXA 3AX6A 4JLUA 4TM8A 3O84A 4LW8A 2J3KA 3NHKA 4PG6A 3KOMA 3IUJA 1QZZA 4MULA 2QZJA 5DRYA 4QBFA 4AYXA 3R5KA 1B2LA 1PQPA 4UULA 3VOBA 3X1DA 3W5CA 4P0PB 4J9VA 4N0PA 3SF0A 4F1JA 3Q8LA 1J9GA 3JV7A 2XQGA 4UNNA 1CUWA 2NACA 3P9XA 4DLKA 4DNPA 1ADYA 3C3XA 3IYLW 5FH9A 3GZTB 4WFKA 1SBZA 3UV7A 1Z0FA 3VDRA 3DO5A 3OC0A 2X0NA 1LI4A 4XCVA 1Y1SA 3NHPA 3T4EA 3CGGA 2WUEA 3H2KA 5TPWB 3HKEA 4AFNA 1U0HC 5J43A 5EMNA 1U5BB 1WBJB 4IJQA 3A9UA 1VTKA 2BDTA 3KZXA 4XFDA 4RTNA 3DVAB 3F3MA 2CVHA 4RSGA 1TQHA 1L5GB 3ZIAD 3W2TA 4QGBA 4EKEA 3WLEA 3QOXA 1BW9B 2AB0A 2IOYA 3BGSA 1F38A 1RSZA 2XUIA 1V1JA 2XXAA 3MUEA 1PJBA 3E9CA 1YJQA 4TV9B 1T1IA 4HDMA 5FWNA 2TS1A 3NAMA 2DGDA 2IEAA 3UTDA 2RHRA 2IQIA 2RGBA 4X63A 1IXYA 3V5NA 3EF3A 3OOEA 1QGUB 2BFDA 1U99A 1NRWA 2BUCA 4HGPA 3X2SA 2X5NA 3VPHA 4D4LA 1K9VF 1IWPB 1Q15A 4J90A 3T7CA 1RAIA 2D2XA 3UJ6A 4UDYX 3GLIA 2NU9B 4KMRA 2AXQA 5EVJA 2NSDA 3EGDB 1RCFA 3HS3A 4EPYA 2Q3CA 4F7WA 2HMSA 3KG2A 2FOXA 1E1NA 2WPNA 3ZCPA 2IP2A 2QD5A 2WVHA 1KR5A 1Q12A 3HCNA 5T3YA 4TQ9A 4PC1A 2A9RA 5AQ1A 1I2BA 2IYTA 3FPKA 3EYAA 3H16A 3N59A 5DHPA 5AXBA 3WLTA 1OLSB 5AFSA 4GOKA 1EM8B 4CRWB 4KL8S 3QHQA 3FCXA 3TECE 4UJ5A 1JJ7A 3CZRA 3ZGOA 5DGIA 2VXCA 4G5XA 3L93A 4AO8A 4DQVA 2TMGA 3ZZUA 3HLYA 4EQZA 3ICEA 1F6BA 2PKRA 2QD1A 3M83A 1BDJA 3LBAA 2JANA 3MA0A 4IXWA 4A82A 1PHRA 4P36A 1REQB 1JB9A 3FYHA 1YJ8A 4OQNA 4MS1B 2PH5A 2YY7A 3SR0A 3B36A 1QQ5A 4E5SA 5K0FA 4HH4A 3AI2A 2IS6A 2JF0A 3OPXA 1THGA 1ISGA 5E38A 2HQSA 2Z8YA 3MS7A 4KXXA 3UT6A 3GH3A 1UH5A 2DFNA 2HM7A 3EE6A 1OX4A 2EATA 3TQIA 2C7VA 3OT1A 1UMCB 1WQ1R 2OGSA 4IR7A 4MW6A 2IS1A 4F4IA 1U04A 3LH5A 4W5JA 4DTCA 1G5TA 3JQEA 1T2UA 3H9UA 4OG2A 1SCKA 5DXAA 2BISA 5FPYA 4ETNA 3GY0A 1U7OA 4TT8A 3WBJA 2X9NA 1RHKA 3PIDA 1OLUB 4ZXPA 2Y4NA 3X1MA 1JAIA 5BRAA 4JKIA 3A1SA 1ORVA 2XWBF 4Q1EA 4AY4A 3GIDA 5JDIA 3ZHYA 3FCUB 4G07A 3U1BA 1UAGA 4PR0A 3OTGA 4K0KB 4IJ5A 1E5TA 2XQJA 2LIPA 1YQDA 1V1RB 3OY7A 1EHCA 1JKMA 3HB9A 4LK3A 2J0QA 4P6VF 2WJHA 4QGHA 1Q16A 2WP8J 1WMDA 1J24A 3SX2A 1VSVA 1GZVA 2WT4A 5J1SB 5FUWA 4TL8A 5JVDB 3SYMA 4E3ZA 2AJDA 4I36A 3QVWA 4H6WA 3L1UA 5E7JA 4C88A 5BSGA 5CPBA 3IMKA 1FFWA 1DIRA 2OHHA 1JQKA 2PT7A 2V6GA 2JDID 3FOAA 2GWRA 3QLJA 4I2NA 2YX1A 4EGSA 3FMIA 1KQNA 3ET5A 1KY3A 1JTEA 3G2OA 4A10A 5FFNA 3DO6A 4UEOA 3B9QA 4LBYA 1Y3HA 4C3VA 4DOMA 2RGAA 2D5AA 3DAFA 4R83A 1M67A 4TKUB 3AF1A 1OV6A 3GFSA 2E4VA 1UJ5A 4IDPA 1DBWA 4XGNA 1YI8A 1AKWA 3FBWA 4LYEA 4D4KA 1F7UA 1B23P 1Y8ZA 4BGEA 3DC2A 3DAOA 3D0RA 4JBLA 4OHKA 5HGJA 1GY8A 3V4ZA 3ZHSA 3K30A 1F9EA 4GWKA 3VBCA 4C0SA 4R31A 1YR1A 2RCYA 4FYJA 3O1HB 4H6VA 4MYTA 2MCFA 1QOZA 5AK6A 4ZT3A 3Q9SA 1SG6A 5SICE 3AL0C 1P75A 2IPXA 2GYVA 2YY6A 2ZDHA 2IEYA 4JYCA 3HCBA 3LBHA 3ROEA 2YY5A 3LTNC 3G2NA 4MZDA 4B4KA 5KOHB 2C94A 2QT9A 5J5AA 5L7YA 4E31A 2UKDA 2QPOA 2J48A 3MTGA 3BHIA 3PDUA 4B3RB 4RF3A 1N6NA 5ECYA 4TWJA 1OTXA 3A3OA 1EPUA 4PBSA 1C7ZA 2JFHA 4Z4IA 1K97A 2LDXA 3VH2A 3BAZA 4GR9A 3WK7A 3PEUA 3NYIA 4GYJA 3RROA 1NJ6A 3KETA 3EG5A 4EUHA 4XM2A 2JGFA 1BRMA 4XSGA 2VDLB 3MS4A 2HT6A 4XB2A 4JL5A 1Y0BA 4P33A 3VR5H 2BW0A 2I7VA 1HYQA 5K7SA 3SIRA 3D6VA 3G2IA 3KQOA 3AR4A 3RGWS 4B6QA 2ZBVA 4D9GA 4JS0A 1AE1A 1EXNA 2CMKA 2OECA 3BSWA 1GCUA 1XZBA 3HWX1 3IDFA 4QDUA 4RV9A 3SQOA 5G3YA 5JBQA 1JHDA 4XYBA 1ULUA 1YS7A 5TEVA 3PR1A 4MCIA 4XCXA 2I6QA 3KKNA 4M6WB 2MSLA 1AKMA 2CWWA 2ZRMA 1UMBB 2LP4Y 4TN1A 3PXUA 4TVOA 4R1QA 5C80A 3RWMB 4FHFA 4IMJB 2RGCA 3NHJA 1ISFA 1XCBA 1BVYF 2PD4A 3GMDA 2Q6TA 3M3PA 4R6WA 5AW2A 2ZRQA 1GNVA 1UKBA 3PLNA 1NQ5A 1U0EA 3OAAD 2PUWA 3BH6A 4ZV7A 4FWBA 3JQBA 4HB0A 4TTPA 3A6LA 4QRIA 3T3HA 2R8ZA 3ROQA 3VDMA 3OX1A 1SZPA 3SICE 5HIMA 4BFZA 5KQMA 1I1NA 1OKKD 4MEJA 3M8KA 4KXWA 3DE1X 3N7TA 4Q18A 3V4FA 1T5TA 2W9XA 5BORA 1BXZA 2VRWA 4FDMA 3FVTA 4BFWA 2P4HX 2NW6A 4MIEA 1E6UA 4CQMB 4MICA 5TMPA 4CEHB 3FZQA 2QORA 1Z07A 2NO7A 4MI1A 4PCLA 3SGLA 5IYZF 2JI9A 5HS6A 5PGMA 1DRWA 3BSFA 2CE2X 1H8HD 2DPYA 2YS7A 4KPUB 1Z28A 2UUPA 2X5KO 2GASA 3KT6A 3SZUA 4BCDA 3C39A 5HJ7A 3G17A 2I91A 5DCUA 4WY5A 3VNRA 3MUNA 3SAJA 3G9XA 3GVPA 4EYEA 3L1KA 5DOVA 1P5RA 3O3CA 2A7QA 3O8BA 4G9EA 4ZCRA 4Q4CA 1UOEA 1W4CA 1HFKA 1ZVQA 1GEGA 2CHVA 3DR3A 3OF3A 5CNIA 4PX3A 3TXXA 1QCYA 2R0QC 4CHTA 3I0NA 3RR2A 4KZKA 2Q1TA 3VX3A 2IRWA 1EFDN 4P08A 2J08A 1KR2A 3KU1A 5DX1A 1UKVY 3BWYA 4H7PA 4D9HA 3PUXA 5EP4A 1DJOA 4CG0A 3PTAA 2J6HA 1DUVG 3OJCA 3R3ZA 4OXRA 3AR7A 4X00A 4H3HB 4JLPA 2PSJA 3E1GA 3ME5A 5FCDA 4BKMA 5K6RA 3STHA 5J59A 4KVAA 5KYUA 3KAJA 2ZSFA 3JYLA 4M88A 4U5XA 1Z83A 1MC5A 2XVXA 1GT6A 3GZ4A 3DSRA 1S7GA 4KDFA 1K6IA 1W87A 1OBVA 2VHVA 2O8FB 2BKAA 2Q29A 4YONB 5BSKA 4ZRNA 4WFIA 3WE7A 3ZXYA 5DYIA 3RASA 1MIOA 3WGOA 2GD2A 2XWPA 3IP3A 4IIHA 2GA9A 4L9AA 3WLOA 4RFSA 1P74A 5A4FS 2XVZA 4HQRA 2V45A 3FDZA 1IEWA 1ORWA 4H6PA 5DM1A 2Q4DA 4B74A 1UXKA 2V6MA 4QARA 1DDGA 2GK7A 1KSHA 4NOKA 1JQ3A 1RT9A 4UBOA 1BO6A 1VPDA 2BONA 2WB4A 1CEYA 2VPXA 2V0GA 1M2HA 2IY8A 4TTQA 1HQYE 4WT7A 1QH9A 1HYEA 1YK0A 1Z47A 4JASB 5A9SA 1Z6PA 1IY0A 1QTNA 3K4QA 2O0HA 4U7PB 4DCTA 2FMUA 4G0VA 1P62B 4BNDB 1WP9A 2FGKA 1NN1A 3BBPA 3OKFA 1TE2A 3QVXA 1QFYA 4H7JA 1MB2A 5FNZA 1KFEB 2Q46A 1D6SA 1BGXT 2DWUA 3UY4A 4EARA 2EFCB 2EWVA 4PVCA 4EATA 1WD5A 2I6UA 5DNDA 5JD6A 2NP7A 3LQRA 3FIJA 2D0IA 3ZQKA 1NMEA 1YAHA 3AUFA 2YWHA 1CT9A 1GPKA 5TPWA 2ZWMA 4CCAA 3WA6A 4CN8A 1ZNXA 1JHZA 1N1MA 1PGJA 4M83A 3TLZA 4QBHA 4EGJA 2AEEA 1EK5A 3KWLA 3IEPA 3NWJA 4JK3A 4QHTA 3DAPA 4W5TA 5J4VA 4AZ0B 1DU4A 1DRKA 1GLGA 1S3FA 4HOYA 4II7A 4LOKA 4KAAA 4UAJA 2XWSA 5KVQA 1U8YA 1X9HA 5IKOA 1U2RA 4OIMA 3AVVA 1ML4A 1YL5A 2R8BA 4N7MA 3ZGXA 1AZSC 2HPAA 4JELA 4AMVA 2OUKA 4DJTA 5AP9A 4B82A 3C3PA 2SNIE 4LRUA 5CYFA 4AZSA 2B1IA 4O4IF 1E5VA 3I92A 3WKCA 2IDMA 2ZXFA 1WWKA 1DKPA 1Z0UA 1U7UA 2VQSA 1QGUA 2C88A 1JVSA 4CIXA 5CUQA 3GRCA 4HQOA 1CUGA 4R9NA 1RXWA 1PJCA 4LJ6A 1EUZA 1SXQA 1O5IA 4J0EA 5ECDA 4IFEA 1H2HA 3AL2A 3UMYA 3WYAA 1NTRA 2PJRA 3ZWCA 1IN4A 4OM7A 3OT4A 2NO4A 4E07A 3WHLA 2FE4A 5GOTA 2OVFA 4ZTBA 1MW9X 1XXHE 1GU7A 3RSHA 5F9FA 4U4AA 4MHSA 3CV3A 3HCAA 3S2UA 3VHXB 3M4JA 3SYLA 3ZEIA 2X4DA 3HACA 1VHTA 1N5RA 3N5KA 2G4LA 4MUEA 5KOJB 2OAQ1 4C7MA 5CVVA 5A7HA 3G5LA 3QA9A 4PLZA 3SIPA 1LH0A 1N6KA 3SQMA 1ZO8A 1M8GA 5EN4A 2AS0A 1PKEA 4RJLA 1FMLA 2IDKA 1RAEA 4QEZA 4UHDA 2Z95A 2Q1SA 2QZPA 5FTKA 2C5EA 3UATA 1REQA 1GQ2A 4PW0A 1QG0A 1GGHA 1P80A 4EW3A 3MSCA 2Q2QA 3EC2A 2KWIA 3N2YA 2ZAOA 1A27A 2QIPA 5HCIA 3C97A 4HEJA 3K9LA 4A8JA 1IN1A 1D5CA 2PSSA 1FK8A 1AURA 1FLVA 2XT0A 3TI9A 4EZBA 5JD4A 3LT4A 1A5SB 4LDAA 1A50B 4U8HA 5LYJF 5HIIA 1O2DA 1SCUA 4IDDA 3U3OA 1AS0A 1H23A 2AUTA 1U7HA 1QHYA 2YN4A 3UMJA 5IK2A 1G1AA 1UMCA 1L5FA 1C1XB 1EK0A 3GRRA 3SOPA 3WWEA 5CLFA 4OREX 1KNXA 3K73O 2IJGX 1QC5A 4BFCA 3G2HA 2VJAA 1IYZA 3L3BA 4IDOA 4ZMRA 4C3OB 2AYXA 4P9NA 4F0JA 4I81A 4ROTA 1GEEA 4ZCLA 3IEIA 4MUXA 2F8MA 3G2KA 1XTKA 1CJUC 4HBZA 2I8LA 4LISA 3S40A 4ZZ3A 1XQXA 3WBKA 4IYJA 4J1TC 4JR2A 1ZWLA 1AV6A 2CNWD 2HLHA 1JF8A 2QHXA 2Z5VA 3L8FA 1TX4B 2ODNA 3AUUA 4IHAA 4IJMA 5JATA 1LRLA 1V5FA 4G0ZA 1E2IA 4MRVA 3IQWA 4ODIA 4XGQA 5JC1A 3QG5A 2X1MA 2I87A 2K6GA 5JVDA 1NN0A 4LVOA 2JAXA 2I3DA 2YVQA 1OFGA 2I7TA 4NCBA 1HNXB 3HRKA 3O9VA 1MVOA 4H7HA 4MW4A 1TM3E 4I46A 2PMCA 2FQXA 3D43A 4LF8B 4OHXA 4REQA 2CXHA 2XQVA 2VZ8A 2R8YA 4K9LA 3BCSA 3WLLA 3AUTA 2HF9A 1DWUA 3DOUA 1XJ5A 2EARA 3IERA 2M6KA 4B6FA 5JR3A 5FWYB 1IOWA 1P5JA 3S2FA 3ZS9A 1T4BA 4FQ7A 4U0JA 2HBQA 2A1TS 4UXIA 3HR4A 1I6MA 2FFQA 2ILVA 3I12A 5CK4A 4YAEA 5T67A 1ID1A 1RYDA 1U0FA 3OZUA 3QLUC 4OGFA 3C7CB 4BLRA 4ZZ1A 2KJQA 1KPHA 2HDOA 1E2MA 4QOGA 3QPDA 1VL8A 3B3QA 5C3MA 4KQFA 3A4IA 1VLHA 4IG4A 4MS4B 6CHYA 1M2FA 2DWOA 2RKWA 3WMGA 2OE2A 1JZQA 1K7CA 3JZFA 1S5PA 5AKXA 3AWIA 3WZ2A 2J3DA 2DH6A 4BVFA 1VECA 2WM3A 5IC6A 1ZMOA 2J5BA 5ED0A 5GZ6A 4TVKA 4F06A 4KK3A 3L6UA 2FPPA 3BCUA 3QM1A 4CLOA 2X8JB 1MB4A 1R1DA 2AZDA 4V0KA 3RFVA 3EPHA 2R1TB 3AESA 1V3UA 3MXTA 4Q1AA 1JFLA 1P6XA 4D96A 5IXJA 4LXTA 1PFUA 2I2XB 2C9OA 2F9MA 2BFMA 4XLLA 5HZKA 3R6DA 3UHAA 2JH9A 2X0JA 1ZKDA 1F8GA 4GKKB 1JR3A 2QTNA 3RBAA 4XQEA 3KQPA 1JDJA 1MORA 1KVSA 3JWIA 3O94A 3TIGA 4NBRA 1E0KA 1P44A 3LUJA 4W9NA 4W7SA 4K1XA 1TIBA 4DQ0A 4NV3A 2JIBA 2XCLA 3GD5A 5DHSA 1C9EA 4IJUA 3DUFB 2BEJA 3AJ8A 2ZJ6A 4P93A 5DCYA 5TVKA 4L5AA 1KDZA 3UF0A 1DIHA 2HPHA 3LHIA 1JQLB 3KO8A 4R8VA 3KUCA 3TEFA 2ZI3A 3H2ZA 4FDVA 1MQSA 2JZOA 4MEAA 1L4KA 1ISHA 3I9V1 3FAKA 1IFXA 3SQDA 2WQ6A 3RYTC 1RC8A 1W88B 1KP3A 2WJIA 2P35A 5A0VA 2E48A 1Z6GA 2X3UA 3L7BA 3STTA 4BKOA 4X71A 3GGOA 4O2BF 3USCS 4GYYA 4WKNA 1HMYA 1BAPA 2DHDA 3IEVA 4JMPA 1IE3A 4NK5A 4BO9A 1QRSA 3E2PA 4CEHA 1ZNZA 3E8MA 4CQMA 3I5MA 3L82B 3TVTA 4CM3A 4I3FA 4EHBA 1Y37A 1SKBA 2F4NA 4YIHA 1TCVA 1TIPA 4F5DA 1CUJA 4O4LB 4YCBA 4LTMA 5BR1A 2P2SA 2WUWE 1YI0A 1TO2E 2H5JA 2QRLA 3WKBA 4LYAA 5BVHA 3E1SA 1GG9A 3WL6A 1LBSA 1V5IA 2Z04A 2X0FA 2G25A 2Z2JA 2WJVA 2