3TNFA

Lida from legionella in complex with active rab8a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
170
structure length
170
Chain Sequence
DYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-8A
publication title Protein LidA from Legionella is a Rab GTPase supereffector.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 57
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tnfA00
2GZHA 3GLIE 1G21E 1K8RA 2X77A 4V0KA 3U60B 1Z6GA 1ZD9A 4M1WA 3BC1A 1NN5A 2E9SA 2RGNC 1DAFA 1CR0A 1US8A 4ZIRA 4NYMR 1Z3IX 3CM0A 3I5YA 1DAGA 2QBYA 3WYAA 1OH6A 3K8YA 4HUQB 2C9YA 3VR4A 4AWXA 3CRVA 4GOJA 2G1KA 2JJ2A 3I4LA 4GBMA 3HU3A 1N5JA 4M1KA 5B2ZA 5JSZB 5IK2A 3EASA 2F7SA 2ZRKA 2PX0A 3K1JA 1Z28A 1VIAA 4PC1A 4TL6A 4UNRA 4BFTA 2X1VA 1XDBA 4NE2A 4OJKA 5EXXA 4FI3C 3CWZA 1Q3TA 1XEFA 3W6NA 2WMNB 3VNVA 4ABYA 3ADBA 2YNMA 3VHLB 2FU5C 4A8JA 1X1SA 2XZLA 1VHTA 4NHOA 4AYXA 4A0GA 3T06B 4Q02A 1YU9A 1UKYA 1XXHE 2VO1A 3DKPA 3KJHA 4V0OA 5BYKA 3THYB 4K8OA 2IUSA 3FMFA 4TSFD 1UKZA 3AF0A 4P3YA 4KFUA 1AN0A 2MMCA 3DOFA 2GZDA 4D2IA 4W5JA 2ZRJA 4BE7B 2J7PA 2WM9B 5DI9A 3L0IB 3P1JA 4GL2A 2XNDD 3GP8A 1OV4A 3OIVA 4D6PA 1MH1A 4FMCF 1NVXQ 4LHZA 4YMUA 1A5TA 4NBSA 2PLRA 4LC0A 4XVRA 3KDSE 3LDAA 3N2IA 3CPEA 3B9QA 3BOSA 4KAXA 3WBJA 5FPTA 1NJGA 3C4JA 3AP2A 4GT1A 1P72A 4KO8A 3CWQA 1NY5A 3OEEA 1NP6A 1Z07A 4LBYA 2QUZA 1GM5A 5HKKA 1VCIA 4DCTA 1G3MA 3ZZUA 1G7RA 3EPHA 4B2IA 3AUXA 4FMCB 3TQFA 1H8HA 3IDQA 2J59A 1XTSA 5CLQA 2JIZD 2WVJA 3E2IA 3I32A 2FEOA 1N6KA 3QKRA 1O3YA 5E3HA 4DKXA 1EWQA 2EFHB 4MGYR 4TL7A 3L2OB 4HAUA 1XJQA 2Z4SA 2XOKA 1HEIA 4EPVA 4ZI3A 2YZ2A 4WIAA 3RS3A 3GJ7A 4KI0A 1KNQA 3UMFA 1KK2A 1GTVA 4GMDA 5SZJA 3TH5A 1IXRC 1CKEA 3FGNA 4MYUA 4HLDA 4ARZA 2CLDX 2LKCA 3PQCA 4LJ4A 5D3MA 1K5GA 1ELOA 3KJEA 3EZ6A 5TXGA 4XD7A 3FTQA 2ZREA 1W4AA 3B7GA 4GDFA 3REFA 4Q4JA 3TUIC 2RGDA 2WV9A 2O8EB 1FFHA 3MD0A 2HUPA 3U7EB 2V7QD 4BQSA 1RZ3A 4XWOA 2F3TA 1KAGA 1EFTA 1ZJ6A 2PEYA 3QY0A 3AVTA 1VCOA 2CDNA 3B1ZA 1UBFA 4JLVA 1P9WA 2V3CC 4LHWA 1NJFA 2IF2A 2OESA 1DAIA 3AM1A 2PT5A 2BBTA 3OE7A 4TQ9A 1Z0FA 3EIQA 4H1UA 1KY3A 1F2UB 4B76A 4RD6A 1ZM9A 4PC2A 2MSDB 1SQ5A 3TSWA 1M8PA 2IYUA 4DZZA 3FHTA 2YOGA 5FR1A 3P4YA 1N0WA 3CF2A 4GSYA 3K0CA 4MKGA 1YZTA 2QTFA 2VH5R 2XAUA 4PTLA 3SJCA 1YHNA 2IYSA 5FTKA 2X19A 4HZUB 3WMFA 3MJHA 2J0UA 4B2PA 1T0HB 4XIGS 3TMKA 4C2TA 4TZ0A 3ZLJA 2RGAA 3K9HA 1US8B 4EPXA 4ZIRB 2QBYB 4DRZA 4OHVA 3SR0A 1NL3A 2VP2A 4C4PA 5KSPA 1BIFA 3U6KA 2I1QA 3D6TB 4KITB 1QHNA 1RFLA 2QP3A 1II8A 1LTQA 4EPTA 1E2GA 3AEZA 4BFXA 3DHWC 2XTNA 2IW3A 4NZYA 3RSOA 2NZ8A 4LYFA 2BVNA 1FOEB 2V54A 2AXNA 3UMSA 2C9OA 1IQPA 1MO5A 3QF4A 1WBDA 2GCOB 4QBFA 4A8JB 4AC9A 1E2DA 5F9FA 3FB4A 1Q20A 5FPYA 2Q3HA 2VRWA 3CNNA 3CZQA 4HLCA 3BH7A 1R0WA 2F6RA 3MRSA 4HB4A 4HUTA 4A82A 3C5CA 4NCHA 1J90A 4TLBA 3TAUA 3BJIC 1Q0UA 5K8IA 4KSBA 2ZRFA 2QGZA 1UJ2A 1E79A 3LV8A 1TQ6A 2GZAA 1DAMA 2H8KA 2JLYA 4EFNA 4FN5A 2XJ9A 1P2SA 2V1UA 4L8GA 4CRWB 2ZAOA 4UNQA 5FOTA 5JWHA 2DCUA 5C4GB 1DADA 1H8ED 1JECA 5DHAA 2BHRA 3IPYA 4XVQA 2J41A 4FCVA 2VP9A 5DYGA 4D25A 8OHMA 5EZ6B 2CLSA 3LY5A 5JZVA 3X1XA 1W7AA 1W1WA 2ZSFA 4LV6A 2JDID 2QAGA 5CJPA 5CJ2A 2ZJ5A 1OB2A 5AWFC 3T1OA 2OBNA 2HLDA 4AYTA 5J4HA 1U2RA 5G53C 1WE2A 2PMDA 2R6DA 4NCKA 1MKYA 1P9RA 4NYJR 3RS5A 2ERYA 3T61A 1TMKA 4FCTA 1AQUA 1VG0B 3QKRB 2R65A 4IDPA 3ICEA 3ZZ0A 3ZGXA 1U0JA 1XD9A 2VHJA 2OHFA 5JCPA 3U5ZB 1Z83A 4OHXA 2BIFA 1JR3E 3EW9A 3IIKA 2JLZA 2O5VA 2WWXA 3MWJA 4EIWA 2FFQA 3HPQA 1UFQA 4C0KA 2R6AA 3KTAB 2N1BA 3LNCA 1ZRHA 4IDQA 4Q4HA 1GRRA 2F1RA 3UATA 1ETUA 3LH5A 1F6BA 1OIXA 1GNPA 2PBRA 4GNKA 4PQYA 4PZZA 2R62A 3FVQA 3THWB 4BFSA 3RRZA 1OSNA 5D3MB 2JATA 1IY1A 3ZS8A 1KIMA 5FL3A 4C0BA 2QZ4A 1MRSA 4GOXA 4Q4JB 1OXXK 2H57A 2QRNA 3PENA 2WMOB 2CEAA 1G16A 2C96A 4DLYA 1SKQA 3CH4B 2CVHA 4IOLA 3C14C 4L5BA 1I2MA 2R2AA 5K8LA 3HU2A 1XWIA 3NXSA 3U7GA 3LRPA 4WXPA 5CDFE 2FFHA 3B6EA 4RY2A 4TL9A 3RRYA 2RGNA 1E9AA 2CJWB 3PUVA 4PFSA 1E3MA 2LWIA 1E0AA 4QM7A 3BD9A 2V4ZA 2ORIA 3ZDQA 3SHFA 3EXAA 2IXFA 4DB2A 2WKPA 3G82C 4DB4A 2CNWD 4YMSA 1KI6B 5EZ5A 3VFDA 3LFUA 1OXVA 4IOJA 4YXWA 4JJZA 1F2TA 1XRJA 3EIEA 2XITA 1HQYE 4HZIA 1LY1A 1CEEA 3CUEF 2IEZA 5HR5A 1G3UA 3R7WA 3AQ4A 4RFVA 1ZBDA 4IXMA 2J1LA 1XCGB 3FOZA 1NLYA 2O8CB 4PAOA 2GKSA 4OQFA 1HYQA 3V9PA 2IS6A 1VMAA 5KSYA 4C0QC 2OFOA 2FF7A 4A1FA 2P67A 1Z8FA 5TV2A 5LBIA 1II8B 5TB5A 3EZ9A 4Q9LA 3V4FA 3MWYW 1DVRA 4LHYA 1ESMA 2RCNA 2V1XA 3BS4A 4PAQA 4D80A 2NO6A 3PV0A 3QXXA 1H65A 1COWD 3KQLA 2KBFA 2AK2A 4Q7LA 5KDLA 1CS4C 1E0KA 1XTRA 1QHIA 1VTKA 2C8VA 3P20A 2IXGA 1G18A 2UKDA 1QHGA 3A6PC 2IX3A 1RYHA 2CE7A 4Q47A 1G19A 2KB0A 2ZSDA 1A1VA 2RGCA 4MRNA 2ZU6A 3K0SA 1JJ7A 4E09A 2X2FA 1ONBA 1E2QA 3S1AB 1BYUA 4U00A 2WOJA 4EFLA 1JPJA 1N0UA 1CRPA 2XTMA 2P6UA 5DH9A 4A36A 2PMKA 3LQRA 1E98A 4IHQA 1OXSC 1S1MA 3KUCA 4DLXA 3U44A 3UG7A 2FDCA 3M1IA 5DE3A 4MRVA 3TK1A 2HYDA 1N0VC 2RH5A 3SYNA 1SXJE 4KLNA 4F38A 4MH0R 3I61A 1LVGA 4YMWA 2FGJA 3E70C 4QM6A 1YR9A 4IEEA 4CEIA 3HPRA 4RZ2A 2QM7A 3L0PA 3Q9LA 3EC2A 4TLDA 4B43A 3GLFA 1G7CA 1W0KD 2BBOA 4URXR 3EIHA 2OCYC 1KAOA 2WAYA 2IEYA 3FMPB 3ZIAA 3FE2A 1FNNA 1TTTA 5JCZA 2Z5FA 5AJXA 2MSCB 2YWFA 3U3KA 2FFAA 4PPGA 2W6JD 3UXMA 2ATVA 2BM1A 4PPQA 5G41A 1ZCAA 2W0SA 1WCV1 1N6NA 1P2UA 5H68A 3SFZA 1XFAA 2QROA 1KDTA 1PV4A 2WICA 3GLGA 4Q48A 3CIOA 3TRFA 1ZINA 2AXPA 4ZCIA 4ITRC 3PITA 3RYTC 1Z5ZA 4LHVA 3FPAA 2RGEA 2FZ4A 3IEUA 3TNFA 2OG2A 4TYYA 2EVWX 3LBIA 1MRNA 2PJRA 4PQFA 3AVQA 4DSUA 4W9MC 3EG5A 1H8EA 1N25A 2ZI7A 2O8DB 1QF9A 2PH1A 1GKIA 2C77A 2KSQA 3A1VA 3MFYA 4LBVA 2FPMA 2ASEA 3KXLA 2QTHA 4R9UC 3CZPA 2YWEA 2D2FA 2C98A 4LJYA 1R8QA 4P4SB 1TQ2A 3LXXA 1CJKC 3CBQA 5JWRA 1XBTA 4PZLA 4BRUA 4EPRA 1T0JB 1WDTA 4M2LA 2JDIA 3W3AA 3RABA 1E1QD 4AG6A 3T1TA 3BB3A 1MO6A 2FSHA 3T1VA 4CIDA 2G3YA 1S2MA 4I99A 4MKFA 2XTZA 1YR6A 4TQUS 4AURA 1M7HA 1NBMA 1GUAA 2GVDC 2ZE7A 2FGKA 3GD7A 4FMDF 5JECA 2G88A 3PCRB 5E7IA 1O87A 4UNNA 5FFMA 3T1QA 1U99A 1LF5A 5LDDC 3GMTA 4LJAA 5IHPA 2IYZA 2VHQA 1HE1C 3BE4A 4QHYA 4B32A 2EU8A 3OHMA 2R44A 3CNLA 1DOAA 4V0ME 4B6EA 4LSGA 1JJVA 4HDQB 4S35A 5AJYA 3ND9A 3R20A 4QC2A 4I4LA 1S3GA 4QHSA 1MABB 3QXHA 4IVQA 5FOUA 3KUDA 4CEHB 1KSGA 1G64A 3VKHA 3MJRA 5CK5A 3GEHA 5L3QA 2WHXA 4YC7A 1II9A 4RZ3A 5FUWA 2ZYVX 3R7WB 3GFTA 3PJRA 1OFUX 4Q03A 1UBGA 3B5JA 2CMKA 2QN6A 2ZYWX 4DDTA 1UADA 1IN5A 1DE0A 1CBUA 1D5CA 1T6NA 1ZYUA 1T8TA 2PJZA 4M9XA 4F92B 1Z08A 1JAHA 1P62B 1JR3D 1ZC3A 4HYYA 4PHHA 2ZRDA 3H0KA 4KV9A 4C7OA 5JHGB 5AJZA 3GLHB 2QMHA 1TF7A 1TU3A 3GEIA 3X1DA 4LV5B 2F1IA 3PFIA 2G83A 1XF9A 1C9KA 3B60A 5EP4A 1AZSC 4JBWA 1E2KA 5KU1A 1FQKA 1AS3A 4Q7KA 5DI3B 3L8YA 4NCIA 5FI0B 1YJ5A 1UKEA 1OB5A 2O0HA 2CNWA 2HV8A 4O0MA 3QVVA 4CYMA 3G5UA 2ZUBA 4QGGA 4ZI2A 2Q9CA 4J0QA 1PZNA 3C15C 3Q7QA 3GLHE 4KODA 1E2HA 2H92A 3FWYA 2VIIA 4FCWA 4G5RA 3FMIA 2ORWA 2IYXA 4HDOB 4OKSA 3VR3A 3VR6A 1V43A 1S4QA 4XTRA 3ASZA 1F5NA 3TLXA 1XD2B 4BPBA 3ZVNA 1CU1A 3WNBA 4P4UA 3QKTA 4ASUA 3T34A 4Z54A 4OBEA 3B2EA 1IN8A 1E9FA 1G291 4IOMA 2QM8A 3NKVA 4E03A 3RVBA 4ZDKA 2Z4RA 2G6BA 3U61B 3C16C 2GVZC 4AKGA 3QKUA 4CW7A 4TTPA 4IFEA 2YC4C 1L7VC 1IXSB 1KSJA 2QMUA 1GITA 2WKRA 1G8HA 3OFND 3UKDA 3KQKA 3BIFA 4NYIR 5C46F 3LD9A 5DN6D 2LCFA 3AVWA 1E4VA 3W3ZB 1VYUA 1KYIA 3SJZA 2PEZA 3HR8A 2GHIA 2J46A 1P9NA 2GESA 5CIWA 3IUYA 3GLGB 1KI4A 2W6IA 4TLAA 5HZHA 1G7SA 1W49A 2A5DA 3VTKA 4FMBB 4LC1A 1YZUA 4TQAA 4LGMA 2ZJ8A 4JVNA 1FUKA 1KDOA 1FUUA 3OIWA 4A6XA 4BGDA 3JZMA 2FA9A 3M6AA 1BKDR 2GK7A 1FP7A 2WIAA 3TAHA 3RWOA 2ZE6A 3QIAA 2BDTA 1YR7A 1OLOA 2Q9BA 4X8LA 5DLQC 1R6BX 3ZQJA 2B21A 4UQOA 4KSCA 2HCBA 1U0LA 2GETA 3FDIA 4DIDA 2W2XA 4PC6A 3K53A 2QORA 1LV7A 1R0XA 3IKJA 5H70A 2D4HA 3LQQA 4GP7A 4DT1B 2B6HA 2CCJA 4S2EA 4RVCA 1MOZA 3P27A 2W6JA 3Q7PA 3UG6A 2EWVA 2GBLC 5BQ5A 3BFXA 1WBBA 4G5GA 1Q3HA 3DVLA 1N6RA 4Q4AA 2B92A 2B8TA 1F3OA 3DL0A 1SXJD 1J2JA 1KTVA 4C2UA 1DBSA 1C4OA 4LV8B 1Q44A 4BFZA 3H84A 3I73A 3QKSA 5SZKB 3IPXA 4WZ6A 1L8QA 2QSZA 2ZU0C 3QEJA 5FPSA 1DEKA 4NYMQ 3EZ2A 5B57C 5BW8A 1A82A 4UXHA 1S8FA 4YDSA 3VQTA 1L4YA 1DAHA 2P3SA 4UJ5A 2JA1A 3AVOA 5KSZA 2AKAB 3UIEA 3LX5A 5HCIA 1NVUQ 3ZVRA 4B3CA 4AYWA 4ERNA 4QKQA 2OBLA 3R9IA 4RZXA 4NCJA 1E2FA 2E87A 3P4XA 1E1QA 1G9XA 3PIRA 1Q1BA 4XJXA 2ZPTX 3LW8A 4HEJA 2IHYA 1QHHB 4LBZA 1YRBA 2OCPA 2VP4A 3AF4A 3THOA 4V0LA 2ECKA 2BWJA 4JBXA 4R2IA 5JBQA 3IBGA 1G8YA 1E99A 2NO9A 1KO7A 2IXEA 5K8UA 2P6RA 2B8WA 2ZRMA 1EK0A 721PA 2NOAA 1RYFA 3DO6A 4M1YA 1IONA 3ZH9B 3QSYA 4TYWA 2RMKA 4XWAA 1ZU5A 3QNUA 1SVLA 3TE6A 1DELA 1XMIA 2BBSA 1VG8A 1LS1A 1ZP6A 1LF0A 2JJ8A 2H17A 2OM2A 2QNRA 3VX3A 4BLPA 5JMTA 1J99A 2J45A 4BLRA 5DIFA 1PVOA 4H1VA 1E9BA 5J4VA 2UVQA 4MYTA 2F43A 4IVPA 2FX3A 1XTIA 4N0EA 1AQYA 1OJLA 1HA3A 1ZUNB 1CLUA 5A4JA 2NZJA 2V55B 3PEUA 2GEUA 2W2VA 5EUQB 2OSBA 3RS7A 4XH9B 4QJ3A 3L8ZA 5M04A 1KO4A 2WJHA 1G1MA 3BAFA 4LUCA 3SQXA 1QRAA 1FPMA 4A4DA 5AJVB 1R5NA 1RW4A 2GCPA 2A78A 2AFIE 1Q12A 1KKMA 2P6NA 4Q7MB 1W36C 3CNOA 3GJ3A 3MSXA 4KBFA 3JVVA 1ZM7A 3SJBA 1P3JA 2FNAA 4EQ6A 4JBYA 1XMSA 5GJCA 1CIPA 4F4CA 1G20E 1LNZA 2IC5A 3EARA 5FR2A 3AH8A 3WNCA 1W2GA 5EXPA 4EUNA 2ZVQX 4LYHA 3WXMA 1R0YA 2XX3A 4Q19A 4BECA 1NKTA 2GK6A 2REBA 1NSFA 1XEWX 3F8TA 4NU0A 4KFTA 3VHXA 4OI4A 1EFUA 4JLNA 2GTPA 3RC3A 5L8VA 3TJZA 3W34A 3OIYA 2IBMA 3SNHA 5FBVB 2ODNA 3HWSA 4N1AA 3LAWA 4L16A 4MRPA 4URWR 4YLGA 1Q22A 4G3XA 4LJ5A 3X2SA 1HY3A 2BC9A 1CR2A 1W5TA 2FSIA 2ZJBA 4L4UA 4BRWA 2ZAMA 1AJEA 2IF0A 3PUWA 1Z22A 2OE2A 4D4KA 3IILA 4HAZA 3PG5A 2H16A 4EJSC 5H1YA 3TSZA 4DLSA 3QPVA 3UPUA 3OFNA 4KCGA 3TW8B 5DN6A 5TMPA 1P2TA 2B7CA 2C9CA 2IT1A 4PPFA 4B75A 2J5XA 1UEIA 1HQCA 2IYVA 2WJJA 3ZVLA 1RJ9A 4K46A 2J9RA 2O0JA 5LD2C 4Q4AB 2GRJA 4U7DA 1NIJA 2C78A 1K5DA 3W8RA 2K5UA 3OEHD 3CO5A 1W36D 3QQ5A 5JEDA 3KL4A 1KO1A 1CXZA 1GKUB 3C5HA 4PSKA 5EE0A 2JAQA 1E69A 3FKQA 4Q1FA 2AL7A 4Z51A 1JXOA 3MAAC 1CJVC 5BN3A 2CE2X 1GSIA 2BEKA 2QSYA 4XWKA 2ZROA 4XSHA 3BFVA 2JLWA 1E1RD 1X6VA 2BBWA 4TMKA 4B48A 2QA5A 2RB4A 5DO9A 3RWMB 1EXMA 5KNCA 4AKIA 4JKIA 4B44A 1J8YF 3DPUA 4C0LA 2C03A 4RFSA 3T35A 1DS6A 1FZQA 1P7CA 4BFYA 2ZRAA 3SS8A 1OH5A 4G0NA 4IKEA 2P2LA 4B2LA 2CXXA 4JYBA 5FOSA 4D4JA 2O8BA 3GEEA 2ZRGA 1SHZA 2NO7A 1WRBA 4QGAA 2Z43A 1IM2A 4HDCA 4DLUA 1WXQA 2FFBA 4B3DA 3BFKA 3U7HB 2WWWA 1KI2A 5J4LA 3QG1A 4BFWA 5AUNB 3DKVA 4M1TA 3MUFA 4DUGD 2GNOA 2QP9X 1TX4B 1U9IC 3DMNA 4E5UA 3SEAA 2DBYA 3AV0B 5JLJA 1JR6A 2RHDA 4M1SA 1NMZA 3CKLA 2VHCA 1XCMA 1NF3A 3QOFA 3IHLA 4MQBA 4KLZA 2RGBA 2Y8EA 2WKQA 3KX2A 5JHHB 2ZJZA 2XZPA 1JEDA 4EPWA 3GFPA 4LJ7A 2A5GA 4MKIA 5KYKA 2BCGY 2F3RA 2D2EA 2ZVPX 4QXAA 3RSLA 2WSMA 3I92A 2D7DA 1T3HA 2G9NA 1L4UA 1NKSA 4C0JA 3WY9A 1R5BA 4A6PA 3NHBA 1BMFD 1KSHA 4NYJQ 3WYFA 5EQTA 2XB4A 1W48A 3JVUA 2A3RA 1TQ4A 3LW7A 4NMMA 3GJ4A 3EPKA 3WBKA 3LXRA 3K70B 1KNXA 2R6GA 2RGGA 2QENA 4TSFA 4DC9A 4OQLA 1Z47A 5J4YA 3NEYA 3NH6A 1XU4A 5F98A 4HB2A 3R9XA 621PA 3L43A 3AUYA 1X1RA 2XNDA 4ARZB 2KJQA 2O8FA 2GXQA 1FL9A 3D8BA 1CP2A 2VP0A 4HLUC 2AD5A 1WA5A 2YC2C 3MGCA 1NRJB 1G3IA 1R2QA 3KFVA 1L2TA 4PZYA 3SI7A 2R8RA 1GNQA 3K0EA 1M74A 4MA4A 1W0JD 2VA8A 4GPTA 5BWMA 1R10A 1TU4A 3X1YA 2BMEA 3C7KA 2GBLA 1KMHA 4KVGA 3CRRA 4PSAA 3SDZA 4LJ9A 4R71A 1UBEA 1EFRD 1S1CA 1OIWA 4PHTA 1P75A 2QQEA 1Z29A 3SN6A 1VPLA 4JSTA 2QI9C 2JIZA 3H2YA 2FWRA 1KO8A 4UNSA 3KQHA 2ATXA 5JI2E 3VAAA 1GNRA 3CW2A 1U8AA 1SVIA 1SZPA 1VG1A 2AHOA 3MLEA 3RRNA 1SKYB 5HZKA 2JASA 2ZANA 4ILEA 4PO9A 4O3MA 1Z2AA 4GZMA 4PR0A 1TF2A 1CJUC 2AD1A 4TYNA 3PEWA 3FYHA 4M9ZA 4ESHA 2FV8A 4RCYA 2N46A 3VKWA 4NCNA 4B73A 1NVVR 3JZAA 1Y3AA 2ODWA 2QMOA 4LRWA 1DAEA 2J0UB 2NG1A 4KFRA 5IT5A 1CRQA 1W46A 4LWZA 3CRMA 2GXUA 1D6JA 3CR8A 1G5TA 1W4BA 2ZTSA 2ZJAA 5CYOA 1EG7A 4AIIA 2FSFA 1KDPA 4YONB 1AIPA 5G3ZA 2V7QA 4G5OA 4KBGA 5LB4A 4JMPA 3ZQ6A 2HJGA 4K81B 2QG6A 2XNSA 4DDUA 3F3YA 2IS1A 2DHRA 3HP1A 5FPKA 4JT2A 4NP6A 1E9RA 4PC7A 1Q1EA 2G0TA 2WPDD 3A1WA 2FEMA 3K0AA 3QF4B 4US0R 3MWLA 5FTNA 2DPXA 2GEDA 3QENA 4RFSB 1FMJA 3VMFA 1VECA 1RRPA 1HV8A 4M0LA 1AGPA 3Q72A 4ZDJA 1E0SA 4I1VA 1G8PA 1SHKA 2O8BB 4ON9A 2ZSEA 2F1JA 1FMLA 1OFTA 4TT3D 1R4AA 3R8FA 1YQTA 3U3MA 2XEXA 1Z2CA 4B33A 2HT1A 1UKVY 3FMOB 5TDHA 3KKPA 5HE8A 3VKGA 1BOFA 3VR2A 2D06A 3H1TA 5J5CA 2CK3D 4RKFA 5FBRB 1F60A 1ZD1A 4WAUA 4Z8XA 5FL7D 4PO8A 5EE3A 4MYHA 3QF7A 3WNDA 1YR8A 5L3VA 4IXNA 3A1UA 2Z0MA 5DNYB 1UAAA 2ZJYA 1Z0AA 3CH5A 2BM0A 2AN9A 2QAGB 3FHOA 3WHLA 4OQXA 2CBZA 4C0AC 3ICQB 4U5XA 2QY9A 4WZBE 1KY2A 4GZLA 3LVRE 1AA9A 4WXRA 5C18A 4PAMA 3VR5A 4R2HA 1IJFA 4RZUA 3KB1A 1TEXA 3Q8XB 2ZITA 2HXYA 3WMEA 3A1TA 4US2R 4JLKA 2FN4A 5JJIA 1SVMA 3TUZC 5KNDA 1OHHD 2X2EA 4UKDA 4JLDA 4WVFA 5JFGA 5ELXA 1E9SA 1QVAA 2QMEA 2ERXA 3GQBA 4QGHA 2ZUDA 3G0HA 2ZRBA 1ZNYA 1X8KA 4Q4HB 4A0FA 5C4MA 1YKSA 1NN1A 3AKDA 1RKBA 2D3WA 2WWFA 2O8FB 3EA5A 4Q1DA 4Q4LA 1Y63A 3IBYA 4JVSB 4P0TA 4JLAA 5JRZA 3B1YA 4DUGA 3C8UA 1OKKD 3B13B 4W5WA 4EJSA 2CVFA 2C2HA 2VP6A 3OAAD 3QI2A 4V02A 4WA7A 4ZKDA 2CHQA 2ZJ2A 5JRJA 2ORVA 5FBLB 2CCGA 1C1YA 4LHXA 4ZCLA 5C2JB 2AR7A 5AJWA 1OH7A 4CF7A 3FHCB 4M1MA 4Q1CA 1XZQA 4OQMA 2FSGA 1E9DA 3HU1A 5BXQC 4PX9A 4KYUA 5B30A 1I4DD 3BK7A 5BN5A 2HJVA 1M2OB 1B23P 4M22A 1XEXA 3B8HA 4V0MA 5IK2D 2NO0A 2W58A 3GLIA 3U4QA 3SE0A 1VDZA 3EZ7A 4TMZA 1RPZA 3J81k 1G4AE 2HEIA 2WIBA 2IL1A 2JJ1D 1JQJC 4LI0A 1NMYA 4CEJA 4MITA 3ZD7A 3Q85A 1EX7A 2JGNA 4JS0A 3K09C 1OE0A 4Q18A 3B1XA 3PVSA 2QT0A 4N0DA 1VYTA 1J8MF 1F2TB 2EQBA 4CT4B 2A9KA 3A4MA 4TL8A 4KFSA 1D8TA 3F5FA 2OCAA 1BYIA 1GRQA 3IQXA 1Z0KA 4Q5IA 4WBSA 1CR4A 1CULC 4B3GA 1Z63A 4DIEA 3TVDA 2OLKA 3EPLA 2J7PD 4QHTA 2FPLA 5EJEA 4POAA 2BMDA 3WRXC 3AVUA 2O0KA 3VNUA 1N5LA 2CHVA 2KE5A 2YINC 3AVXA 1KGDA 4NL4H 2AX4A 1UF9A 1A7JA 4QOSA 2QGNA 1NLFA 3A4LA 4V03A 1XXHA 2F1HA 1GRNA 1DARA 2PT7A 2OEPA 3UWOA 1BO6A 1LB1B 1EFRA 1D2NA 1QZXA 2PCJA 1BS1A 1ZAKA 1JBKA 3GFOA 5EUMA 1ZM4A 1GILA 3MG9A 3QPUA 3ZYCA 5JSZA 1GG2A 3OEED 4FWIB 3CX6A 1GIAA 1UEJA 3WP1B 2V6IA 4I81A 2VPPA 4G5SA 1N6LA 1VCMA 5KPJA 2D62A 4M1OA 4B35A 1U9IA 1IN7A 3K0AB 4KJZA 3NC1C 4IOKA 1XJ0A 1H8HD 3NIBA 4JLOA 2G0NA 4Q1BA 1YZKA 5CM8B 2YJTD 2FPKA 5B58C 2GJKA 1P73A 4WOPA 4B3FX 5E4FA 3Q5EA 5AK0A 1ZIOA 3Q5DA 3THYA 4DLZA 1WF3A 1E4YA 2XOKD 1U8YA 2IYQA 2R9VA 1TNDA 1N5IA 2HXSA 2QAJA 4LOAA 4JT4A 4B3XA 2JEOA 3U44B 4LYJA 1X8LA 2VSXA 3UANA 1DTSA 5G40A 4KXFB 3O8CA 2XZOA 4DWJA 2EW1A 1G4UR 2X8AA 4II7A 3DOEA 2DWPA 2ZYTX 3D7MA 2RGXA 1ZCBA 4OHZA 1G6HA 1CJMA 2AKYA 4XD7D 3O8RA 3GLFB 1NI3A 2NPFA 4CEIB 1SXJC 4D0GA 2OUKA 3VX4A 1KK0A 1J7KA 3ZJYA 5JS8A 1KK1A 1X86B 2QPAA 2IS4A 3QG5A 3T12A 2B7BA 5CB6A 3QEOA 2J3EA 5CITA 1T3SA 1CR1A 4CGZA 4XVUA 5F9HA 2ZS8A 1NN3A 3BB1A 3AVPA 4HLUA 1COWA 1OYYA 1XCPA 4QBIA 5ANRB 5C1BA 2WPDA 2ZSAA 3CR7A 5DSZA 2A5FA 521PA 3W9YA 3F0TA 4NYIQ 3SHWA 1SVSA 4LJ8A 1KI1A 2MMGA 4QGFA 3RHFA 4G5QA 2XXAA 4NPHA 2GA8A 1QG2A 3EZFA 1NG1A 3VU9A 1KJWA 4C3ZA 2GEVA 2H18A 3N70A 1XJCA 4TT3A 3GLFE 3SYLA 2J0VA 2QQ0A 3WYGA 5KHOC 1UDWA 4FW9A 4A2QA 3A58B 2WWGA 1Z0JA 3K9LA 3N5CA 4DLVA 5J47A 5FI1B 3HYTA 1M34E 4C30A 1E6CA 3WP0A 3SBEA 1IY2A 1DO2A 3A1SA 3PR1A 4PHGA 1P2VA 1YVDA 2HF8A 4DLWA 2CK3A 1VIYA 3BXZA 5GJVC 4NDZA 3DZ8A 3TR0A 4QJ4A 3TVTA 1QG4A 2DYKA 2WOOA 4HSEA 4AY2A 1E0JA 1GVNB 1KI8A 1E9CA 1RVDA 1Q1QA 1Z6TA 2E1RA 4IJMA 4TTRA 3CX8A 4UNPA 5FOWA 4Z1MD 5L3SA 3GLGE 1W0KA 5KTYA 1B0UA 1XTJA 2BOVA 4H9GA 3K0FA 5FBWB 2O8EA 1ZNZA 1EESA 1VG9B 2QPTA 2Q3FA 3QUSA 1D9XA 3B9PA 4G1UC 5JEEA 4M8NE 2WZQA 1HT2E 1XMJA 2YV5A 2JLQA 3IO5A 2QPOA 3A8TA 1ZM2A 1A2KC 5KPDA 2XGJA 2W83A 1D2MA 3NEJA 2XSZD 4ZPXA 4LK2A 1OHHA 2R6FA 4HAWA 3ADDA 1U0HC 3BWDD 4CZ2A 4LPKA 4QJ5A 2ZYUX 1T8UA 3QXJA 3TIFA 1W4RA 1NY6A 5GVRA 4US1R 4F4JA 3BH6A 4QBHA 2VQSA 1VKJA 1AKEA 2V6JA 1JPNA 5FH9A 1VYVA 4BWYA 3LLUA 1TADA 4OYHA 3NDBB 5L3QB 4M21A 4TWZA 1P5ZB 1E79D 1T5IA 2FMXA 2GWHA 4JYCA 2IUUA 3U2QA 4A2PA 3THXA 1E2PA 4TZ6A 3SFVA 4XTCS 1NBME 3OAAA 1AM4D 5CLLA 3LBNA 5CIQA 1EFCA 1YE8A 3DMDA 3KB2A 3N2EA 4HZUA 4KYIB 4Z8YA 4DDWA 2ZRLA 1XXHB 4C7OB 1KK3A 4D4MA 2YWGA 1G3QA 3A36A 3LX8A 3W5IA 1PUJA 1UPTA 1XMVA 4DDVA 4HI0E 4IDNA 3H86A 1I4TD 1X8JA 3KFXA 1AS0A 2ZRCA 4JJKA 4UXJA 2A30A 4Y0AA 2DB3A 2PL3A 2A7QA 4FWTA 2OFWA 1JAIA 5KDOA 2ZI3A 3FFAA 1MT0A 2HLDD 4LPSA 1OF1A 1AK2A 3NWJA 4MRRA 2JJ1A 3U3RA 3EPJA 3CRQA 1JEEA 4TYQA 4WZAE 1WB9A 5DGXA 2JLUA 3W8NA 4MKHA 2GCOA 2Z83A 3TBKA 1V5WA 3CF6R 3TKLA 3RS0A 4QL3A 4HAVA 1OW3B 4BLSA 1T5LA 3HJNA 5E7JA 4LYAA 1QHSA 3K9GA 3DM5A 2IYYA 1W47A 2KI5A 2VL7A 3CLVA 1A2BA 3NG1A 2ANBA 2SHKA 3KKOA 3IIJA 4MUAA 3VR1A 3AVYA 4X8HA 2QU8A 2L0XA 2WJVA 4AK9A 4JZKA 1N6OA 4F7WA 3X1WA 1E94E 1JQLB 4HB3A 3I3SR 1JR3A 3E1SA 5CK4A 2ZI5A 2IWRA 4DHEA 1Z06A 1ZUIA 1KMQA 4MYCA 1T91A 2ONKA 2REOA 4C0SA 1E2IA 2IA5A 5EXTA 2ZRPA 1T4GA 5AUQA 4UXIA 3I72A 3EAQA 3ND8A 2YHSA 2XB2A 4ZKEA 2HCJB 1RRFA 1ODFA 4BUJA 3AKYA 4R98A 2WJGA 1ZW6A 1U8ZA 1WQ1R 1DG1G 4MUBA 3ZZTA 3ADCA 2XXAB 3VU9B 3ZS9A 4AKEA 2ZXUA 5EP2A 1E32A 3KXKA 2DFNA 4XOIA 2AFHE 4Q66C 3RNLA 1EX6A 4ESVA 1UM8A 5KO2A 1XPOA 2OBMA 4IFBA 1N6PA 1XPRA 2IK8A 5FOXA 2ZI9A 3IEVA 5CDFA 3KTAA 2Z6VA 2ZS9A 5EP1A 4A9AA 2GCNA 2NQ2C 3UMRA 4YXWD 5AUOB 1S3SA 2GJAA 2W0MA 3AP1A 4JIMA 4G01B 1S9DA 1XB2A 3THWA 1D2EA 2IS2A 4MDFA 4RD1A 4OJQA 1TEVA 3B82A 4OHWA 1RC8A 2EFCB 3K09A 4BLOA 2F9LA 5L3SB 2I3BA 3EWAA 2WSSD 1Z6YA 1GOTA 2CL7X 2ZI4A 3K0FB 3O8BA 4MGKR 3KKNA 3RANA 2KBEA 5D3QA 2VBCA 1EGAA 3KXIA 4DCUA 2GJ8A 1AGRA 1FX0A 1ESNA 1HH4A 5FBQB 4PSVA 4LJ6A 1M7GA 1XNJA 2V9PA 4JLPA 3MWKA 2W2TA 2JLRA 2ZRNA 4LY6A 3WHKA 3ZVMA 2BKUA 1QDEA 3HYRA 2UZ3A 3P26A 2CJWA 3BBPA 4GP6A 2NGRA 4FINA 1IN6A 3B85A 2OXRA 2QTVB 4RSGA 4NH0A 1IY0A 1DPFA 4HB0A 4JLJA 1I2DA 3QKSB 2ONJA 5J4KA 2WJIA 3NC0C 1KI6A 4D4LA 1ZUHA 1NMXA 1LFDB 3BGWA 2IYWA 1JALA 5FTLA 1W4CA 1GP2A 3M4YA 3KQNA 2H1LA 2FJUA 2VYFA 3THXB 5EP3A 4ZCMA 1II0A 3AKEA 4URZR 2QRZA 4PPNA 4DCNA 4AG5A 1ZMXA 5KSOA 4Z1MA 1MV5A 2HYIC 2O8CA 4X8OA 3W5JA 1JI0A 2PCLA 2BV3A 4RCZA 4PHFA 4TTQA 2VF8A 4OI2A 4P33A 1S0UA 3REGA 2FOLA 1GL7A 3PEVA 1P61B 1Z0IA 4L15A 2GJSA 4OK5A 2CL6X 3ONWA 3ZIAD 2NPIA 1T9HA 2F55A 3DZDA 5GJBA 1FQJA 4JL5A 1FP6A 2YOFA 5FTJA 3UK6A 3GPLA 4PC3A 4F4IA 2XSZA 1QVRA 5FUYA 2OXCA 1SXJA 4JL8A 1FTSA 1SVWA 1J70A 3OESA 5GJWC 4MGZR 4PO1A 4MDEA 4LBWA 1W2HA 2W00A 2DR3A 2GAAA 2TMKA 1R8SA 3H4MA 4OI1A 4V0NA 2F43B 4ZDWA 3BORA 4DEYA 1FW6A 3TQCA 2DFTA 2YOHA 1DAKA 1GL9B 3PEYA 3KQUA 1D9ZA 3S1AA 1OFHA 4EAQA 2IYLD 4LZZA 3IGFA 2C95A 1YRAA 3CONA 1S9HA 3AP3A 1R0ZA 2DFLA 1SVOA 4DSOA 2P5SA 4PANA 3IO3A 1ZIPA 1YZQA 2VF7A 1HURA 2D74A 3HDTA 1KZGB 3GJXC 2EYQA 1MR3F 3L0OA 4I1UA 1R7RA 1G7TA 4EQ6B 1AKYA 3KJIA 5JI3E 3CRW1 3OIUA 4QNRA 1K6MA 4RD3A 421PA 2WWIA 4Q1AA 4Q21A 4A92A 2OT3B 4EKDA 1G41A 3I8XA 4DSTA 3K9NA 3LWNA 2UZIR 4E22A 1NBMD 3V4RA 4DBLC 1EWRA 1AS2A 1KHTA 3L0SA 4Q00A 2HT6A 1N5KA 5K8TA 1CJTC 1XZPA 1IBRA 5JWOA 3GJ6A 3RDPA 3SZRA 3QJYA 4M53A 1M1YE 4URUR 1RRGA 4TYPA 4GI7A 3KKQA 3RS2A 3RRMA 3FKSD 2WJYA 3SBDA 5HPYB 1PLKA 2QE7D 5BN4A 2WTUA 3RS4A 2C5LA 2MSEB 3SQWA 2Q9AA 2O8DA 2PZGA 1IAQA 2BJWA 1AZTA 2ZIAA 4JVMA 4D0NA 1FTNA 4A2WA 5LB2A 121PA 4L9WA 1IXZA 4KVAA 4P4SA 3IQWA 3E5HA 4EFMA 1CF4A 4LCBA 2ZR0A 4OHYA 3AGPA 4Y0VA 1XP8A 2GILA 2Q0HA 5A5GA 1FX0B 1NSTA 3W90A 2GXAA 4Q9JA 1GL6A 1TUEA 5B64A 4C9BA 1TQDA 1RJ9B 1BH2A 4YMTA 3EX7C 2ZRHA 4DLTA 4QNMA 2J87A 2A2ZA 5FUXA 1XD8A 2GF0A 3SJAA 3TSOA 2HDNB 2OCBA 3GJ0A 1RE0A 3PUXA 4BZPA 2OZEA 1NVVQ 1TUIA 4JLMA 3TUJC 4OI0A 4BEBA 1OXUA 1Q21A 2Q6TA 1FNMA 2DY1A 2IYRA 1OH8A 3W6OA 1SKYE 5A0FA 2G1JA 4YMVA 2ZRIA 4E07A 3BERA 3X1ZA 1Z6AA 2NO1A 1MABA 3AB3A 3AGQA 4CEHA 2J0QA 4FD2A 2OO7A 3EC1A 3BH0A 3T5GA 2GAOA 3CPHA 1U81A 2IHBA 2O52A 1KDRA 5CM9C 2QEQA 4CDGA 1IJEA 1PLJA 4P4TA 5DISB 5HTKA 2C99A 3RLFA 4DXAA 4AI6A 4L9SA 4ZO4A 2WSSA 1KO5A 2BJVA 4QBGB 3I5XA 1GZSA 1MO4A 3GJ5A 3OZXA 4HATA 4ASUD 4BFVA 1IN4A 3RC8A 4QRHA 4RD2A 2QL6A 3NBXX 2NMVA 5EE9A 2JLSA 2Q21A 1F48A 3GLHA 4ACBA 1HE8B 1U94A 4ZDIA 1QHYA 1IOZA 3ECCA 2ZI6A 1KOFA 5IRCD 3EWSA 2H7VA 4JKYA 1KJZA 3OF5A 5SZIA 4TMVA 5HCNA 2OAP1 1E2JA 4P32A 3LLMA 4I1OA 5FUVA 1SXJB 2VHTA 2WWHA 5DI3A 4A0HA 1OXTA 2JLVA 3OEHA 1HTWA 1G8FA 4URVR 2ZEJA 2PZFA 2ZQ5A 4DLRA 2BCJQ 4PXAA 2J0SA 5G3YA 4B34A 2W6ID 3CX7A 1QHXA 1U90A 1Z6XA 2FZLA 4KHZA 4BZQA 3AVVA 2YKGA 3T5DA 4A8JC 4NTZA 3QVUA 1GFIA 3D3QA 3MMPA 3R9WA 4A15A 2JCSA 5CB8A 1ZNXA 1E2LA 2RKOA 1E1RA 2C04A 4URYR 4BLTA 5GADl 1SULA 2ZJOA 5TARA 1KKLA 1XD2A 4W7SA 5DYIA 2EFEB 2YVUA 1E2MA 2BKEA 1ZNWA 1ZVQA 4OK6A 3U3JA 3LO5A 2CLCX 3O47A 3DM9B 2WWYA 2YYZA 2GF9A 4BLQA 4Q7JB 2JLXA 5UKDA 3R8CA 4QG7A 3DEFA 3T15A 1OYWA 1P60A 3AF1A 1G6OA 2FH5B 5IDVA 1ZC4A 3ZD6A 2GJ9A 3DDCA 2ANCA 3QE0A 4JSYA 3NVAA 4RD0A 4UJ3A 1Q57A 1XTKA 4F93B 2ZS7A 5F2EA 4BFUA 3CF0A 3M0EA 4TMTA 4WW0A 2N42A 2NIPA 1TL7C 3AKCA 3IIMA 5JS7A 5AUPB 4GOKA 4Q9IA 1KZ7B 3GJ8A 3U3OA 3WRYC 1RRCA 2Q3MA 4W5HA 4PQRA 2AWNA 3NHAA 4GMXA 1GAJA 5TVKA 4EPYA 2KWIA 4HAXA 1KMHB 5CYPA 2IWHA 1N3BA 3HR7A 4YQFA 3U7FB 3K70C 4RD4A 1KSFX 4RKEA 3RAPR 1ZD8A 2JJ2D 2DWQA 2V8OA 4DJTA 4Q9KA 2LKDA 5E7MA 4YDHB 3NBFA 5H8WA 1BMFA 2CL0X 1M6NA 1VCNA 3L82B 3A37A 3PUZA 5J40A 5KNBA 3EA0A 4R7ZA 3CB4A 3CPJB 1EFHA 1N6HA 2EFDB 821PA 4FXPA 2DWOA 3AF3A 3LA6A 3NDPA 1UDXA 1YZNA 5F3WB 4IEIA 5KDDA 4ZV4A 1SGWA 5TY0A 3FFBA 4DT1A 4IDHA 1QBKC 2FG5A 3I1FA 2YWHA 1HT1E 2EYUA 4HAYA 2EWWA 3KZ1E 4TLCA 2VSOA 2QT1A 2OAQ1 1W44A 3QBTA 2PLFA 3MCAA 1NN0A 1E96A 6Q21A 3TR5A 4DCSA 4JL6A 4DEXA 4IW3B 2ODEA 4O2RA 4Q01A 1W0JA 2R6CA 4Q1EA 1DG3A 1Z0DA 2I1VB 1E2NA 4OL0A 4OK3A 1Q1ZA 3FKSA 4DCVA 3BRWD 4HUQA 5KOYA 1NNEA 1A4RA 2QE7A 4IDOA 1G8GA 1NLZA 3PXGA 4FMDB 5DHFA 2VHUA 3I8SA 3A4NA 2CHGA 4MRSA 3UWKA 5HKKD 2VP5A 1DO0A 4D0LB 3QXSA 1OPXA 3K0CC 3C41J 3SC3A 1E9EA 4DVGA 4O25A 1IHUA 2P0EA 1WMSA 2XJ4A 3SYKA 2H5EA 5AR1A 4IVRA 1QHHA 1PJRA 2G77B 1PLLA 1OT3A 3B1WA 3K70D 4I1SA 3W6PA 1P6XA 4KU4A 5BYJA 1N6IA 4O2LA 1I4LD 1N2CE 2HF9A 2J7KA 2WBLC 5KUTA 5FTMA 1JB1A 3B1VA 3NH9A 1T3LA 3LBHA 1CTQA 2ZE5A 3NBYC 4EDHA 5LPNA 1W36B 5HE9A 4MGIR 4B74A 221PA 2ZR9A 5GVSA 1LW7A 1TF5A 2ODBA 5JJKA 1JNYA 1NVWQ 3KJGA 1G5PA 1VHLA 2VSFA 5IF9A 2DFKB 1G5RA 4XSGA 4A0RA 2FE4A 2OLJA 3SU8A 2BEJA 3I62A 4B3BA 1P4SA 1JXMA 1GDDA 4D82A 4M9QA 4ACAA 1ZU4A 2CCKA 1R5OA 3ASYA 2A5YB 4JVLA 5SZHB 4AKHA 4B47A 4N3NA 3SOPA 4TLEA 2ZETA 2ZSBA 3U6BA 5E95A 1TAGA 4BZXA 2VLIA 3QPWA 4TMXA 3GCGA 2PX3A 1HUQA 4B6FA 2ZM5A 3BB4A 5EE5B 2QP4A 2A5JA 3OE7D 4HLQB 2IYTA 2IUTA 2ZR7A 2WAXA 4OQNA 4C0HA 1UBCA 4U02A 1E2EA 5EE1A 4D26A 1M7BA 2OFXA 2VTKA 1S96A 2RAPA 5L3RA 1ANKA 4TN1A 1RIFA 1WP9A 4X8MA 4AD8A 2ZUCA 2QAGC 4P31A 2VEDA 1NIPA 1XX6A 2RHMA 4EJSB 5EXSA 3ETLA 2F9MA 5FL7A 3NTUA 4CVNA 3V00A 1KI7A 1G17A 1XEWY 3AF2A 5FOVA 4D81A 4BASA 3O8DA 1G3RA 1MO3A 2GDJA 2OV2A 4F91B 3LVQE 4BEJA 4IRUB 1OIVA 1XPUA 1U98A 1YZLA 2PZEA 5LD2B 2I4IA 4GRAA 4Q9HA 4TMWA 3QXCA 1XEXB 1XTQA 3B78A 1W5SA 3NBZC 3P32A 4NKRA 2P5TB 3GLIB 1KJYA 3U4QB 3KKMA 1ZM3A 3ADKA 4QFMA 5JJLA 3IHWA 1OFIA 2AWOA 1GWNA 1SVKA 1YZGA 4JLBA 4LX0A 3QBVA 1PUIA 3TGPA 1GKYA 2EFGA 4CEJB 2OILA 1F2UA 2ZE8A 4GFDA 2D7CA 2REXB 2P65A 4FIDA 3WMGA 4LDJA 4CT5A 1KI9A 1TPZA 2BMFA 3TW4A 4M9SA 4RJLA 4B71A 2GXSA 1X3SA 3PUYA 1LS6A 3Q3JB 3D31A 4NONA 4M4SA 1NG9A 2BMJA 5FPHA 4DSNA 1KI3A 2AK3A 2NTYC 5P21A 1OKKA
chains in the Genus database with same CATH superfamily
2GZHA 5LXTA 1NASA 1O9HA 1GZ5A 1G8MA 1ND6A 1CUVA 3ZX5A 3GAAA 3OZIA 3EMBA 2GPYA 4FILA 4A8HA 5BMVF 3EQ6A 1RKXA 2AF3C 1NN5A 2E9SA 2FW1A 3MN1A 5HK9A 1FJXA 1US8A 4ECAA 4MTCA 4DV7B 4NYMR 2EAUA 3NX4A 3DAGA 3GV0A 2PMEA 2QBYA 2X9VA 2GZ1A 1DWOA 2G1KA 3VSEA 2OGSA 2P77A 5C34B 5JSZB 2BGMA 4LDPA 2NSLA 2ROQA 5IK2A 1BE0A 3FXAA 5BSHA 1X39A 2FHSA 1W36D 1RHMA 3K1JA 4TL6A 5AI5A 1AMUA 3QJGA 3T9EA 4UNRA 3G2JA 5LC1A 4BFTA 3TTXA 5EPUA 1GNVA 4HAIA 4LRTB 5FNVB 4IV0A 2R79A 1PK7A 1XA3A 4X3PA 1XEFA 1CUWA 1ZK1A 4BNDB 1WULS 5A9TA 1ADYA 4ZMRA 1U1IA 3ZCXA 1X1SA 3HBNA 3HM2A 3SVTA 2WJPA 5HS6A 3UJCA 4E88A 2DT5A 4NNPA 4C05A 4M6WA 4ROSA 3CEAA 4J91A 4PXYA 2QRMA 3AF0A 1E64A 3HACA 2PAAA 4P3YA 5E1BA 2MMCA 5G0WA 1PWYE 4B6PA 2Q5EA 3KUXA 2O57A 4D9KA 4D2IA 3DEHA 3UM9A 3QLTA 1R6UA 3DBRB 3FMVA 3Q7EA 2WM9B 3TXYA 1FRZA 1UMBA 2UDPA 4ZCTA 2V74B 3GP8A 1OV4A 2PRYA 4CQLB 4D6PA 4DGQA 4NOLA 5FQNA 3AM5A 5LUAA 1A5TA 2XGMA 4O4JA 3KQQA 3CG0A 1EBFA 5LOVA 5JJ5A 1I0LA 1HO3A 3WQQA 1SKUA 4FGKA 3TMAA 4F12A 2P0AA 3MD9A 3EIWA 5A1TA 1IUNA 1K9VF 4B3IA 1ODLA 2YMQA 4OGWA 1XDZA 5AM1A 5FPTA 3C4JA 1IDOA 2I6FA 3AP2A 3T4PA 1A4UA 2JKVA 2YH2A 1JMYA 4MUHA 3PGXA 1PJSA 2QUZA 5AKHA 1EXVA 5HKKA 3I3OA 4F9FA 2DKOA 5EINA 3STXA 3OZTA 2BKLA 4QVIA 3EPHA 2PX6A 3AUXA 3X3HA 3IDQA 4OGKA 5ICFA 1QC5B 4F1JA 5CLQA 4RA9A 1I2AA 1DXQA 4GL4A 3KJXA 1RI3A 4XB2A 3I32A 2FEOA 1QIIA 1N6KA 2Y1WA 4WJLA 5E3HA 3QKWA 4HG2A 1EWQA 2NAFA 4XGKA 1L7RA 4JI6B 5EJ6A 1B3BA 4HQ0A 5I01A 3C45A 1T1JA 1T29A 3NM5A 1BA3A 4I4TB 4PONA 1DOHA 2XOKA 1HEIA 3AYZB 3O1IC 2X4LA 5AHOA 4WIAA 4RDIA 3NOOA 1M9NA 2NNLD 3DOCA 2GASA 3HUDA 5SZJA 1RNLA 2P9JA 1H6DA 1SXHA 1E8MA 2FPSA 1IXRC 1FTGA 3D1VA 3PT9A 3PDJA 4ND8B 2C3OA 3DUFB 3SNKA 4ARZA 3C6XA 1OILA 5C8XA 4RA6B 1K27A 1XVTA 4HY3A 3KOZA 3V7YA 2POQX 3KJEA 3EZ6A 4XD7A 3FTQA 3HJAA 4Q3EA 5BQPA 5K3OA 1W4AA 4JODA 3TUIC 2WV9A 3F4BA 5U4XA 1Y5NA 4E6EA 5I7HA 4JN6B 5F7JA 2WU0A 1UBRS 1NGSA 3IUMA 4JJGA 1RZ3A 4QPCA 3MMXA 5J2UB 3D3WB 3R23A 1KAGA 2O20A 1ZJ6A 3JQBA 3KSAC 3A4VA 5CW1A 4WADA 3F78A 4MV1A 2G6TA 1LI5A 2Q1TA 3IBTA 3N8IA 4JLVA 4OD0A 4PX3A 1RHQA 1ZD5A 2H6EA 3U9SA 2Y9MB 2IF2A 2OESA 5CFLA 5ADHA 5JSUA 1DAIA 5ES3A 3AM1A 3QPAA 2JFYA 4CTOA 1C80A 5K4HA 4Q4CA 1Z0FA 4MAMA 5IDXA 3DXFA 5DTEA 4UD2A 2OXFA 4BV9A 4B3JA 2EBUA 2YJGA 1ODSA 1PTJA 2FRVA 4S24A 3V1KA 4NECA 2IYUA 4E94A 1C0EA 1QU3A 1CR6A 1BJTA 1V4NA 2GQ0A 2ODTX 4S1WA 3UC9A 3L0ZA 4TWAA 1YZTA 3M9WA 1MDBA 2JIMA 3A31A 2OO5C 4K9DA 5HEKA 5LXTB 1RXCA 3SJCA 3GU3A 5IEJA 3ANYB 5FTKA 3SE7A 1QVVA 4E6PA 5I7WA 3U19A 4YRAA 5KTKA 4TZ0A 1FMFA 3K9HA 1US8B 2JA2A 3QOXA 3O38A 4NWIA 1UCFA 4PNEA 2QBYB 2IUEA 1M73E 1SHUX 2VP2A 4XUDA 5KSPA 5LZ2A 4DUPA 4EHNA 1BW9A 3RSCA 4KXXA 3O90A 4F5WA 1EP2B 1XRLA 5AD1A 5IM5A 4UUPA 4FR0A 1CRWG 3N1UA 5LUBA 3DHWC 2OLEA 2ZGVA 3QYJA 2WG0A 1QGUA 4NZYA 4ZA2A 2CXTA 4G97A 1EWYA 4EQZA 5ALFA 2AXNA 2PKWA 4ZZ0A 3W5CA 4GH5A 1MNAA 4IKPA 3SF8B 3AERA 4LWQA 5DXFA 2CUNA 2BMWA 3QF4A 3GARA 3BWYA 1Q20A 1G38A 1JIJA 3N07A 5FO0A 1EMDA 3ZLUA 1ZGAA 2F6RA 1I33A 1D1PA 2IHUA 4GYKA 3RAJA 1GPNA 5HNKA 4IS3A 1QK3A 1UJ2A 1J1UA 4GLLA 2HKIA 1WWKA 1TLTA 1XQWA 1TK3A 2GZAA 4CMHA 4JUDX 1DIBA 1DC8A 3Q98A 2AMVA 2QYHA 4YX9A 1QIKA 2ACEA 3QLVA 4DHWA 4EB0A 4NSNA 3FI9A 5J2TF 3T3NA 2HMVA 3RFVA 1OLSB 1QIMA 2X7HA 5DEIA 3A9TA 4G1VA 3IPYA 4DWWA 1IRXA 3OPNA 4WGFA 4FCVA 2VP9A 3MOSA 1CDZA 3EWNA 3A6FA 3NIGB 4P22A 2GF2A 2Q41A 5KJFA 1QFSA 4KQGA 4OG2A 3GYBA 4ZVOA 2A1IA 1DZ3A 3ETGA 5GZ3A 5JPDA 1FUIA 1IC6A 5JZVA 1X19A 4KWEA 5FI3A 3DPIA 5LN1A 1R74A 1NVMB 2VHVA 4R9SA 4X1KA 5CJPA 1Y4AE 2PU7A 3OU6A 5CJ2A 1CJBA 2F8LA 3BM5A 3D6AA 3WBBA 2OYSA 4X85A 1SUWA 3C39A 3NETA 2AG6A 3O2NA 4KQWA 1U2RA 1C41A 1W88A 4QO7A 3RS5A 1DEHA 1P9RA 4FEGA 5IXJA 1RSZA 1TMKA 1UMCA 4OH1A 2PK3A 2POCA 2WJ3A 1N5DA 4IDPA 3ZZ0A 4HCJA 3K71B 3ZGXA 2GSWA 3OUUA 1XD9A 1C7QA 3H7IA 1B42A 2OHFA 4MIOA 2V7XA 3DMHA 4OHXA 2WQ7A 2BIFA 3SZ3A 3D2BA 4KXNA 2UUCB 5LA6B 4M0DA 4MDYA 3FNHA 5J9FA 1QIEA 4EA6A 4Z86A 1WKVA 2ICAA 3AFGA 4X93A 4D92A 4G0QA 1N2SA 2Q9UA 1BKSB 5KJEA 1UFKA 2R6AA 3PBKA 2N1BA 3LNCA 2H4YA 3FH0A 4IDQA 2F1RA 4P82A 4H3KB 1ETUA 1YT5A 4UQPA 5TPZA 4BNKA 1F6BA 1OIXA 4TKMA 2NTNA 3L3BA 1FFAA 5JAHA 3EIFA 1GQYA 1I6KA 2R62A 3RG2A 3THWB 2VR1A 3MGBA 4DR6B 5E2AA 2RI6A 3F1LA 4HDAA 5BRJA 2JATA 3O3CA 2QZ4A 3H87A 2YIJA 2V9CA 3ANTA 1SQFA 4RACA 3VR0A 4JOCA 1EBBA 3TB4A 1C1HA 2Z1DA 1AOXA 1ZMTA 2H57A 3CINA 4DLYA 2C96A 3UYKA 3WKEA 4FHFA 3ZLBA 4A1OA 4LZNA 1H4TA 1Z37A 4L5BA 2W6PA 3EVGA 1VB3A 3HU2A 1LGYA 1XWIA 3CHYA 4AY4A 2C4NA 4PINA 4RLHA 2D0PB 1J6UA 1O57A 2FFHA 4P5PA 4RY2A 4OFBA 4TL9A 3RBZA 4MVCA 3HXOA 3LT2A 1TVKA 3NYWA 2VYNA 2CJWB 3BDVA 2LCQA 3CF4A 1E3MA 4I1YA 2PA0A 1VBMA 1XK7A 4JELA 4XYMA 1YCHA 2O2YA 3EGXB 3LQ2A 3SHFA 4BX0A 3OM0A 3LY8A 1U9CA 3R09A 3T99A 5I7FA 4QOJA 3USES 5KVVA 2V6GA 5HF9A 3CNHA 3WZ2A 5IMSA 3G68A 4IOJA 1M1UA 4QVKA 1LD3A 4Y1FA 1F2TA 1VPVA 1Z62A 2VAMA 1XRJA 3C7CB 3ZZMA 3EOBI 4JQZA 4YJ3A 4KN9S 2PXCA 2IEZA 3WKDA 5K01A 1Y1PA 3L7AA 2QRQA 3DBHB 4NDAA 1PSDA 5DLYA 3GUCA 3KUKA 1G2PA 4IXMA 4DABA 1RXEA 1XCGB 2RJOA 4B3RB 4JMLA 2H4WA 2VDVE 1GNSA 1QH0A 4I9GA 3VKVA 2RBKA 4KXLA 4BNFA 4DYDA 1RMYA 1OAAA 4D97A 5KSYA 1NURA 1USIA 4A1FA 3KQSA 1BW9B 1Z8FA 4QFCA 1SD5A 5ALMA 3O2SB 4KTTE 3HJCA 5C7LO 5BOVA 1PEAA 4IV8A 3V9AA 3MWYW 1CUIA 2G7ZA 1ESMA 2RAUA 2V1XA 1TYZA 2DT8A 4D80A 1GZVA 3PV0A 1KVTA 4YUAA 1IQRA 2DX7A 3TXAA 1M0SA 4PLPA 1XU7A 2AK2A 3I9NA 3R3JA 3AERB 1KU0A 1XTRA 4OIMA 3AY6A 5HKAA 1QNFA 1JDUA 5ALLA 2VCYA 1COZA 1NKVA 2UKDA 5EMNA 1JQ5A 1PW7A 3W5UA 4Q47A 4ZMBA 5KJ6A 3R3VA 3U17A 1VMDA 4OLHA 4RABA 1A1VA 5DCYA 3DOIA 2AZTA 5LP6F 3K0SA 1OLUA 5ERYA 2WOJA 1MG0A 2OPBA 3K5PA 4EFLA 1JPJA 1PJZA 4HYEA 3W5DA 1N0UA 3GT4A 2XTMA 2P6UA 4CKWB 2Z6UA 3HKEB 3HZZA 5AP9A 3P52A 1OXSC 1S1MA 3AR8A 2Q7DA 1V5GA 1WTCA 2AG0A 3UG7A 3U44A 4X9XA 5KX5F 1P0MA 2PLAA 2SNIE 5JBIA 1KIAA 2JIBA 3QELB 4GLFA 3SYNA 2DH5A 4TV9A 1UJNA 2DQKA 2X0JA 4LY9A 4UUAA 4ZREA 4RF5A 2CV0A 1J23A 1ARZA 4DAEA 2WJ4A 4YMWA 3E70C 2DHQA 4DWVA 1SU4A 3D7SA 5FHQA 3GLFA 5ALSA 1O4VA 3Q9LA 4J75A 2CD9A 1NDUA 1MQSA 2OYRA 1JJAA 3T5TA 3EIHA 2OCYC 3INNA 1P1BA 3SYMA 4R2LA 3I76A 3NRBA 1UPFA 2H5JA 4U7FA 5HIJA 3L05A 4RK1A 3E61A 3E7XA 1TTTA 2R6JA 4XDHA 1ESZA 4O4IA 2I4LA 2MSCB 1FFEA 4ZFNA 3EMVA 1YCGA 4B45A 3GUYA 4PPGA 4BN5A 2W6JD 2P3QA 2VWGA 4E0BA 5G41A 2QMQA 4M8SA 5F3RA 1WMFA 4GR5A 4PRKA 1N6NA 2FEAA 4D9IA 3JPWA 1KQPA 1XZGA 2I2WA 5H68A 2JIOA 4O2AF 4XUEA 3GLGA 4KDFA 1ECGA 4HGOA 2NV2B 3HWRA 1KS9A 3CIOA 2Q28A 4LY3A 1ZINA 3KDAA 4FJ2A 3MB8A 2G1UA 3ELBA 3HB7A 4ITRC 3PHLA 5I6DA 3RYTC 5E6RB 2I2CA 1DINA 3FPAA 1JDBC 3O8QB 3OQJA 1DKRA 2XDQA 3T7AA 4C04A 5BQXA 1NHGA 4Z0TA 1L4KA 4RLFA 3GHHA 1TKCA 3W2HA 4PQFA 3QW4B 3FUWA 3BMXA 5KOIA 5HKOA 1H8EA 2HU2A 2RC6A 1N25A 2DFPA 1Q83A 4IIHA 4RKYA 4F3YA 1A69A 3LUDA 2PH1A 1GKIA 4BO0A 3GQVA 3FTCA 1Q7RA 3UW1A 1QH8A 3E3AA 2QTHA 2PWAA 1T4BA 2D2FA 2C98A 2B5WA 3MJFA 5ECGC 1ZH8A 2BW0A 1TTQB 1V7CA 1TQ2A 2EJUA 2QB5A 3D0KA 2PYZA 3F6SA 3LXXA 3HUUA 1P4HA 3WIUA 3SG0A 1T0JB 1WDTA 3RABA 1HDYA 2FOIA 3W3AA 3VNSA 2B3DA 2ZLBA 3A2LA 4M8KA 5LNK1 1BGXT 2OO5A 1YACA 3HZOA 3DC2A 3DZIA 4X90A 2PWPA 2QD5A 3QMMA 9LDTA 5IX8A 1HLGA 2Q46A 1FQOA 1M7HA 2GVDC 3PYXA 2VPYA 1T4DA 2FGKA 4PIVA 5L3RA 4EVSA 3QX8A 2J4FA 3TLJA 1O87A 3T1QA 1U99A 1RKQA 5JC8A 5IHPA 2I7DA 2VHQA 3BWVA 2O3SA 3DBIA 1NVKA 4L5AA 1WSAA 2MU1A 2OBBA 4WRRA 3TAXA 3FYTA 4ZOQI 1WHTA 1P8AA 1RAEA 4V0ME 1HRKA 4IXDA 4IGFA 4LSGA 4S35A 1VZ2A 4X92A 4QC2A 3U7JA 4BUZA 1A9OA 1CF4A 4MB2A 4IVQA 2Q29A 1J5XA 2WHPB 3KUDA 1QYIA 1KSGA 1FUEA 3KETA 3VKHA 2ILVA 3R4CA 5CK5A 3GEHA 4PLWA 1GUFA 2ECOA 1II9A 2V0CA 4U7WA 4YC7A 3RC9A 3RVSA 1WQ3A 3PJRA 1EX9A 1SPXA 4MEAA 3CCCA 4Q03A 5BQFA 1TJPB 1QCCA 2QTMA 1SUPA 1XWFA 4D74A 1ZMOA 2QIOA 4L4YA 4R84A 4DDTA 3KE9A 2PGDA 1D5CA 2PJZA 2WM2A 1D1QA 1CUCA 3FUCA 4ZZ3A 1QAQA 4XJVA 4Y0NA 4I6GA 3T7IA 1LX7A 2CLEB 2RHHA 2UAGA 2ZRDA 4HYYA 4PHHA 3G2PA 3KD2A 5EJAA 5AJZA 3EVDA 1KXJA 2W8BA 5JHGB 2V6MA 2UUPA 4L5IA 1BAPA 1XIVA 4INAA 4OUDB 5E1OA 3X1DA 2NZ2A 3ZHOA 4DA6A 1Q7TA 2F1IA 4RHFA 4BLUA 1ECCA 2HDWA 1ITZA 1C9KA 2Q4EA 5REQA 5K0TA 2XKAA 2EBHX 3BHIA 1AS3A 5CYFA 4Q7KA 1O0CA 3ZXXA 3ANMA 3KAJA 3L8YA 4NCIA 5BMVA 1ADGA 2ZAGA 4HFMA 2FPXA 2P4SA 3KYJB 4KC0A 5FI0B 1DDOA 1JG1A 2YDXA 1UKEA 4JB2A 3OO1A 1CP3A 2CNWA 2HV8A 5LZ9A 1BWPA 1VSVA 3PKJA 3QVVA 4O0MA 3V4PB 4M8IA 1YTLA 4D45A 1T6XA 2QZ9A 4ZI2A 3C15C 3BXPA 1HEUA 2O1XA 3Q7QA 4KODA 2R6HA 4IUYA 5LQNA 4G5YA 3FMIA 4AZTA 1N7IA 2YJZA 1OQAA 2J9YB 4WXMA 1EEXB 3H05A 5JV5A 1F5NA 3HM9A 3PI7A 3SR4A 4ETIA 1AKNA 1W35A 3EIUA 2PNJA 4P4UA 2XGSA 5B6IA 5TMDA 2C5FA 3ZBTA 1HNNA 3TW0A 5LLDA 1IN8A 3EPRA 5LBTA 4E03A 2QM8A 3W77A 4AZ3B 3JRNA 3RVBA 2BEWB 5JJCA 4Q34A 2XRFA 1P91A 3DJYA 1L4BA 2IU4A 3C16C 2HI0A 3LPAA 3OFKA 5CVEA 2YC4C 4OL9A 3C6KA 1L4MA 3OTWA 1GITA 1V96A 4L85A 1G8HA 3OFND 4RS4A 4WINA 5ILQA 3RVDA 4Z7OB 4NYIR 2DVMA 4YR9A 3AVWA 1MVLA 2ZYSA 1BQ4A 4O4IB 3ZY6A 1WCIA 1RYMA 2IYAA 1VYUA 4H17A 1HL3A 1Q77A 2RHOA 4L27A 4OOEA 4LZPA 1A9YA 1E92A 2XMBA 1L5HA 3GLGB 1UXKA 1KI4A 2VC2B 3CVUA 1C30B 4LQLA 3FM9A 3GGPA 2GM3A 3LUJA 3MTDA 5AHKA 1W49A 4UFPA 3VTKA 5IWAB 3RODA 3RNOA 1CQWA 2VK1A 4A16A 1YHYA 1YZUA 4IINA 1P7PA 5D01A 1QPBA 3SY8A 4JVNA 2I66A 4DIOA 2OV8A 5I9NA 3ENVA 1FUUA 1OWPA 2ZQZA 4KQMA 4N5MA 5LP6C 2D5AA 2VHWA 3QE4A 1IEQA 1BKDR 1P0PA 3M6AA 3H5LA 4M76B 4BTLA 1RLTA 2JGFA 2HF2A 2ONCA 3KG2A 3L6UA 4L8FA 1QH8B 4PU0A 4XQ0A 3JS5A 3VHRA 2QTLA 4X8LA 5DLQC 5EOVA 2FPIB 3N05A 4I8IA 4YS6A 5TVGA 1UC9A 3PWTA 1RWKA 4TKUA 3EGWA 1FVHA 1K6XA 1U0NA 1U1GA 2ISSD 4FDUA 4DMCA 5AVVA 5JS6A 3K53A 2ZYGA 4BQEA 3IJEB 3UJ3X 2WM3A 1M6HA 1IPHA 1LV7A 2FZGA 2PS1A 2WSYB 3ILSA 3IKJA 4DT1B 4GP7A 2B6HA 1ULHA 2GYWA 3P27A 3HXLA 1HYEA 1ZOIA 2RHCA 1I6LA 3B3QA 3GOQA 4RHYA 3ST7A 3U4DA 3AJEA 3K5WA 3L06A 4E4RA 1WBBA 5H0IA 3HB0A 2VUTA 3PNKA 3PP8A 1IK4A 5TNXA 3DVLA 2I1LA 1H6AA 4IX1A 3WJ2A 3QLEA 4KQFA 3S8YA 5AM0A 4EECA 5JPIA 1UPUA 4Q3OA 1YC2A 3RVLA 5LU8A 3STWA 1E3SA 1WHTB 4JDPA 3TZBA 3N2KA 1DBSA 1VZ3A 1C4OA 4CQNA 5C1OA 4BFZA 1T1GA 1UJMA 4IDGA 5SZKB 5JBNA 3IPXA 4WZ6A 2C82A 5L9AA 1ESCA 1KQ3A 4CCYA 3BXXA 4O3FA 1V1JA 4MUKA 5B57C 5BW8A 2VXOA 5JNSA 1DFGA 4B5KA 4YDSA 3C1AA 5EY5B 4UARA 2JH8A 3QX9A 1DAHA 2I3ZA 4ZCSA 3QOYA 4UJ5A 4Y9SA 2JA1A 3QV1A 4MQMA 2Y1XA 2N3ZA 5JAQA 1MTOA 3LX5A 1DV1A 1WSWA 3KT0A 5GGYA 4OX9B 4RZXA 4WN9A 4LXQA 4MP6A 2ASVA 2XIQA 3PF9A 4BYMA 3C74A 4EX6A 1E1LA 1MIOB 3JU3A 1DC5A 1DQPA 3WWDA 1Q1BA 3G2OA 3GBVA 4I14A 3V1NA 1KZ1A 2A7XA 1QHHB 3JQ9C 1A5SB 2R6R1 5M29A 4PGGA 1YRBA 2IOFK 2RHLA 3GT7A 4YVFA 3RFTA 3THOA 4E3ZA 5K05A 4JBXA 1JDPA 3F5MA 3A0UA 2HMUA 3IBGA 4R2IA 3Q6NA 1E99A 2J6CA 3IKLA 3L6OO 4MQ4A 4QT4A 1KO7A 2PKYX 2YXLA 1CC1S 1L3BA 1YAJA 1WPGA 2H4HA 2Y0DA 5REQB 5J3JA 4UM9D 1M6VA 1FB5A 2P6RA 3V4LA 5LJIA 3N9IA 3DO6A 4M3NA 3F9IA 4JY7A 1IONA 5AM3A 3QSYA 4TYWA 1PJQA 3NAMA 2RMKA 1C14A 5BV0A 3EEIA 2AFIB 1VG8A 3U80A 1SG9A 1LF0A 1XRPA 2QNRA 3MNFA 3PE4A 1U4NA 2BE9A 1LU9A 3Q8MA 4HZGA 2J45A 1P5RA 3R41A 4XX0A 4A91A 4RE5A 2HO5A 2PBLA 5J4VA 3BRWA 3LYUA 2F43A 4MYTA 5AKIA 4FFOA 2FX3A 1XTIA 4GDMA 4KE8A 5JUWA 4EKYA 4BXOB 1J8VA 2H8GA 3JSXA 2EOAA 3CLHA 2JGKA 2ZUSA 3Q5GA 2NZJA 2X8JA 2V55B 1G20B 2I6GA 3WIEA 2GEUA 2W2VA 4G0YA 1NRIA 3L8ZA 4HQRA 2GARA 1DHTA 4F0JA 4R2XA 4LUCA 3O4JA 5JXWA 3G8YA 1SK8A 4Y1EA 1NATA 2BM9A 2WNSA 2AFIE 3HY3A 5TE9A 5KVAA 4NVRA 1HQKA 3CUVA 1RWOA 4Q7MB 3C1TA 3CNOA 3GJ3A 3O1JC 1TLLA 2CMHA 4KBFA 4Y2YA 3V3TA 4DSZA 1Y9ZA 4E2WA 1V25A 4Y7DA 4QXRA 1J0XO 3SJBA 2R8YA 3LCRA 2CLOB 3S2FA 1WCIB 3PJDA 1XMSA 3JQ8A 2K2WA 2P7HA 3RTEA 2MT9A 1G20E 1XZCA 2BD0A 4MI1A 1LNZA 3AR3A 4K0RA 1E0DA 1RP7A 4G0XA 1Q0LA 1KFEB 1NU8A 1ZFNA 3HLKA 4EUNA 1L5HB 3WXMA 4BNUA 4KR3A 2MYTA 4PF1A 1XRRA 2XX3A 3IQGX 1Q6YA 3HCNA 3NHWA 4JXKA 2X9GA 7YASA 1E77A 1NKTA 4S3MA 1OZHA 2UV8A 3JQAD 4ZMSA 4NU0A 4QLBA 1BTOA 4YJ2F 1FDRA 4OI4A 5DK6A 3ELYA 3OLZA 4OXKA 5L8VA 4C3VA 4YAWA 3W34A 1CEYA 4JBNA 4PVDA 3OIYA 4G0ZA 4KW7A 5KWEA 4X6YA 2ODNA 1U65A 4BO3A 3HCFA 4R2WA 3N6VA 2VCHA 3O4RA 3TN7A 4TS9A 3UNXA 4CIBA 3LAWA 4D8YA 5KSWB 2JCYA 2C4TA 3N53A 1ULTA 4D3XA 3HYLA 5ALOA 4RJKA 4RHEA 2HNBA 3BA1A 1DCFA 2FSIA 3IAFA 1C29B 3HKDA 4FNOA 4DQLA 3QVKA 5FUQA 1QHFA 2OE2A 4I9NA 2H16A 3L79A 1SCDA 3TIXB 2XZDA 1ENOA 1SKBA 5DN6A 5TMPA 1N9GA 1GPLA 1P2TA 2E55A 4NJOA 2C9CA 1QFJA 2IT1A 2QD3A 4X65B 2R5WA 2NP7A 3V7FA 1UEIA 4CQMD 2QOEA 1SC9A 3HA2A 3ZVLA 4TM7A 1RJ9A 2Q4RA 4E70A 2G17A 2J9RA 1QCYA 1KWKA 1ML3A 1QJCA 2UXCB 1NULA 3PTAA 1TJ4A 2IXDA 4L4SA 1VKZA 3C3MA 5EWLB 3SXPA 3GRRA 5H02A 2YVQA 3FPSA 3OEHD 3N2KB 2GVNA 2XBLA 2QSUA 2W2MA 3C7AA 5AVOA 4QG3A 5JEDA 1YI0A 1KO1A 1CXZA 3LE8A 4FKMA 1IBCA 4GI3A 5EE0A 2P2SA 3CGWA 4PYOA 2OHHA 2JI9A 1BXGB 3REQA 1AUXA 2C4UA 3NUQA 4GPD1 2Y0EA 4PM4A 2VBFA 4MI3A 4KV7A 2X6RA 3RGWS 4Q1FA 1TFRA 2BF7A 3C3JA 3DOHA 4I1RA 2C2WA 3WISA 4PCVA 5BN3A 5C7IO 1P80A 2WABA 5M7EA 2JFBA 2W6ZA 4MV8A 1ZVVA 1TT5A 1O03A 3E22A 3R5KA 4L4XA 2JLWA 1X6VA 4DGSA 2IU0A 2Q1WA 1ETHA 1M8KA 3H2JA 4IDBA 1J8YF 4B44A 4BV3A 2PXHA 5CB4F 2A33A 3T35A 3IB6A 1FZQA 4WNAA 3GXOA 2ZRAA 3QBDA 1MA0A 2PD6A 3OEWA 3I9OA 4IKEA 3ZBPA 5CYGA 5KNDD 1XQXA 2XLCA 5FOSA 3ZE9A 2ZPUA 1JZSA 3KT8A 1F51E 1QQTA 3OZWA 2ID8A 1NZJA 1WRBA 4QGAA 4HDCA 1RD4A 1LK0A 1ZJZA 3GR6A 3R44A 3FOFC 1WXQA 1M6VB 1ZXBA 3FTEA 2H9YA 3JATA 5ALEA 3RVQA 3UMYA 3QU7A 2C1ZA 3BFKA 4BO7A 2WWWA 1QGYA 3BQMB 1FU4A 3EHEA 1RMTA 4HNTA 2NZUG 2PSDA 3IR5A 3TJMA 5DBHX 4BFWA 4FDAA 4DCJA 2Y99A 3DKVA 3E0XA 2NVUB 3MUFA 3QRWA 5AUNB 5ALWA 5K8VA 3D8RA 3OKCA 4FLEA 1QCZA 4HFNA 1U9IC 1YUNA 1ZKMA 1O0SA 2DPHA 2HA7A 2ZTVA 3GWZA 3G2NA 4FTWA 4K87A 3SEAA 3AV0B 5HF5A 2Q5QA 2RHDA 1NMZA 2HTEA 1LLUA 1QV9A 2ZSJA 1NF3A 3N3BC 4KLZA 3LSTA 2Y8EA 1JLRA 2WKQA 3B6ZA 4PVCA 1P1JA 2ZJZA 2XZPA 4ZVRA 2TMGA 3K8QA 3G89A 4B4VA 4EPWA 1R8XA 3IUQA 3D1LA 4MKIA 2YYSA 2E7ZA 2OCXA 1N34B 2FPUA 2VNSA 4QD3A 2I4NA 3CZRA 4PZUA 1T3HA 2G9NA 3BZUA 2P9YA 2CF5A 3WY9A 2QX6A 3WAGA 1BMFD 4YV1A 4GX2A 3RWOA 1KSHA 5EQTA 5KNBD 4JCOA 2A3RA 2IXAA 4FYJA 5IVHA 3S2YA 3RH0A 4CM4A 2R6GA 4R1PA 5LP6A 2QENA 1RZUA 4MWOA 4DC9A 2BT4A 1RTTA 1Z47A 1YRHA 3NEYA 3LKBA 4RY0A 3WWEA 4BKPA 4CLXA 4I9HA 3JQ8B 4BQIA 3NH6A 4RIEA 4ZYZA 1GDTA 2WKWA 2C7PA 5F98A 1NPYA 3C24A 3AUYA 2J9FA 2XNDA 3C3CA 2KJQA 3H99A 2W2KB 3TPFA 1WO8A 3LZCA 2GXQA 1FL9A 2C2MA 1CP2A 5BSUA 4FYVA 3G5AA 3CBGA 2JS7A 4CGYA 4A23A 2YC2C 4N48A 1NRJB 3OQHA 4ISBA 3KFVA 3P8ZA 1E5QA 4PIPA 3ZV7A 2FPPA 4D7AA 2H1RA 1O97D 2R8RA 3MRXA 5E6SA 2FPGB 2JHGA 3EA4A 1U7PA 4PV7A 1W0JD 4EARA 4LRQA 2QKYA 3OBIA 2BMEA 2EFYA 1WABA 3HZRA 3ULKA 4BO6A 5G0VA 1TO2E 4B3HA 4RKRA 1KMHA 2RI0A 4GYYA 3CRRA 3U3ZA 4BKMA 1TJ5A 3SDZA 4R71A 2OC9A 1EFRD 1S1CA 3DG9A 4Y2HA 4BWVA 4PHTA 4CMBA 1XTTA 5KWIA 1SU8A 4AWBA 5BSFA 5DGDA 2WVAA 1VPLA 3TEFA 1NBAA 3H2YA 2W48A 4YDQA 4WKPA 2XMGA 3WGYA 1W34A 4FPXA 1H2ZA 5BT8A 3R3ZA 1N8SA 4UNSA 2ATXA 5EJ2A 3W8FA 3ZW7A 3G79A 1FVFA 1U8AA 4TQGA 3WG9A 3RRNA 1VG1A 2LW7A 3SVZA 3LWZA 2W9XA 4FJ0A 5HZKA 2JASA 2ZANA 3NUZA 4PO9A 5ARCA 5C5DA 3IP8A 5KYUB 4O3MA 1Z2AA 4GZMA 2WYOA 3EDOA 1TF2A 3PFBA 3FGPA 4IY1A 1I4EB 1J09A 1BS2A 3F3KA 4FDLA 1TIPA 3ETCA 3FYHA 4M9ZA 4MYDA 2NYAA 1TMOA 5HDBB 2I76A 1RQGA 3T6KA 5JFTA 5KYYB 5E38A 3F9CA 4QGSA 4XJSA 2NYUA 3VKWA 1MC4A 3ZWBA 1NVVR 3JZAA 4G4GA 1GTSA 1UC5B 3QEBZ 2ODWA 2QMOA 3DL7A 4AFNA 2VYVA 3CY6A 2XB8A 2WAAA 4YTEA 2IFTA 2NG1A 2VTDA 3JQ9A 3JWIA 5IT5A 5ICMA 1CRQA 1W46A 4KXUA 4LWZA 3LDGA 4TTJA 2EZTA 3KLBA 2GXUA 1D6JA 1GUZA 2V0NA 2WQZA 1G5TA 3K1YA 3LPDA 5LIRA 1I4OA 4HNAB 5EEHA 4D3FA 3IAHA 4JOQA 5G3ZA 4F4HA 3FHTA 3OCVA 3GZ4A 1UR5A 4JMPA 2JCGA 3AEQA 1HETA 1V8PA 1MT3A 2HJGA 3CRNA 3OOEA 4KX3A 4PIMA 4K81B 1H4SA 3KPVA 2O14A 2XNSA 3BBLA 1AB6A 3BHNA 1N2CA 4IBOA 5IJ0A 1WIWA 1F3LA 1TJNA 1WCYA 4RV9A 1OOEA 2XAAA 3CWCA 4JUCA 2DHRA 1MUUA 4JT2A 1CUSA 1E9RA 3KXDA 4PC7A 3GJZA 3PRKE 4KAFA 3FPLA 3LDFA 2WPDD 3D6NB 2PFKA 2V7BA 3KUUA 2FEMA 4OFWA 5FTNA 2D2VA 4LE2A 1LI4A 2DPXA 2WB4A 1THTA 1U9JA 2P11A 1OREA 2DUUA 1AQIA 2ZIZA 3GGDA 3W2IA 2HN9A 1AGPA 1NJ6A 1SM4A 2IKQA 2OQRA 2YBDA 3PPVA 4ZDJA 3NT4A 1NVTA 5K9ZA 2G9ZA 1G8PA 2B4YA 2QV0A 2CFIA 5EIBD 2ZSEA 1LPNA 3L04A 5ISMA 4ABTA 1FMLA 1OFTA 1JQBA 2PH7A 2VK8A 4NATA 3WWYA 2XEXA 3JATB 4XGRA 2WMDA 1RR6A 3FMOB 2W42A 2GYYA 3KKPA 1S8OA 3ZXUB 1EVKA 2EDAA 4UPDA 3VR2A 4HLNA 4O8ZA 4D4HA 2WR8A 1IDN1 1B8NA 2O2JA 1VSBA 1C1XA 4RKFA 1DWUA 1NTRA 3PX2A 2COEA 1VLQA 3IVAA 4PO8A 1JHVA 1C9JA 4G81A 3R7LA 1JYFA 3P2JA 2FZ5A 2O1EA 4ENVA 3A1UA 5EWMB 4O4HF 4Z1OA 5DNYB 1UAAA 5C8ZA 4JVOA 1Z0AA 4ARCA 4I4NA 2BM0A 3CT6A 5LMUB 3FHOA 4IIFA 4CV0A 5JS2A 1ZN8A 4J8PA 4MJ3A 2QY9A 3Q3CA 4WOJA 2EARA 1TVCA 3F6PA 5BW5A 1P1IA 1EK2A 3DXXA 3ORSA 4QYIB 1NF9A 4PAMA 3VR5A 5DOVA 4PNZA 1DKUA 1XTBA 3H0CA 3UK2A 4W5QA 1A95A 3A9VA 4IGEA 1KPGA 3KB1A 5CPBA 4KO1S 4HBZA 2OP1A 5EVCA 4B83A 2JL1A 3A1TA 1SOMA 2J48A 4JLKA 4XQCA 4US2R 5HHTA 5BQOA 5AIAA 1C3LA 1UINA 2D5IA 4ND4A 4CM4B 3GH1A 1HWYA 1B0PA 4YJGA 3NHMA 3IERA 4JLDA 5ELXA 3V80A 1UP7A 1E9SA 2QMEA 5CNJA 2JRCA 1ZNYA 3DZHA 3HHPA 2NZVG 2UU9B 5FAXA 1NN1A 1Y6JA 3GB9A 4GP9A 5DNAA 4XDYA 3ZK9A 1H1DA 3I9LA 2D3WA 5F12A 1SEPA 3ROZA 3D2LA 1I3MA 2WWFA 4X61A 1GPDG 3EA5A 3MAJA 4Q4LA 3VR6H 4JLAA 1HYGA 3B1YA 2E4VA 2HUNA 1PT8A 3C8UA 1OKKD 1YGPA 2XUJA 2F3QA 2BKVA 3IR7A 3H9QA 3QI2A 1XUOA 1I4WA 3EUFA 4KRGA 4ZKDA 2ZJ2A 2VJPA 1HDEA 2ZDGA 2VNIA 4FQ5A 3F7NA 4GPZA 5C2JB 2QN8A 4CF7A 3DKKA 4R0VA 5GAJA 1ZGJA 4QPDA 1D07A 1TEHA 4Q1CA 4R9VA 4OQMA 5ER9A 1JWBB 4YPVA 1MW8X 2RGWA 1E9DA 4QUGA 1VPDA 1DI0A 1UBOS 2X13A 1DRWA 2LXNA 3NBKA 4NOJA 1DXYA 3B8HA 4L8WB 5FNZA 5IK2D 2MSKA 3O73A 3U4QA 2H9IA 3SE0A 4LF7B 1OTXA 1ZOOA 3AJAA 1QYDA 2OQVA 4CM8A 2C94A 2TMYA 1UKBA 3PHIA 4Z4HA 5C80A 2BFMA 2WIBA 3VPXA 3AU9A 2IL1A 1BE8A 2TRSB 2JJ1D 4ZT4A 2AMJA 3R5JA 3CLSC 4N5NA 4MITA 3WYCA 3Q85A 3GYGA 4R05A 3A3NA 4F56A 1H0RA 4MKRA 2ODQA 4N0DA 1VYTA 1J8MF 2EQBA 2QLNA 4K6HA 2A9KA 3ABZA 2UYYA 1U7ZA 3A4MA 5SV2A 3RPEA 2X23A 3TM4A 4ZGGA 1KEVA 3F5FA 3M6MD 4I36A 5FWXA 5A4AA 3PT5A 2Q5IA 1BH6A 2ZXFA 4WE3A 1GCOA 4FD3A 1Z63A 1QU2A 3TVDA 1FDSA 3STTA 4RZHA 2FPLA 2IOFA 4POAA 2BMDA 2XDYA 4CFYA 2XRYA 3O0DA 1N5LA 4BDSA 4C88A 1EDOA 1K0UA 2YINC 4BQOA 4JJAA