3FLBA

Rifr - type ii thioesterase from rifamycin nrps/pks biosynthetic pathway - form 2
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
245
structure length
245
Chain Sequence
b'EAEKWLRRFERAPDARARLVCLPHAGGSASFFFPLAKALAPAVEVLAVQYPGRQDRRHEPPVDSIGGLTNRLLEVLRPFGDRPLALFGHAMGAIIGYELALRMPEAGLPAPVHLFASGRRAPSRYRDDDVRGASDERLVAELRKLGGSDAAMLADPELLAMVLPAIRSDYRAVETYRHEPGRRVDCPVTVFTGDHDPRVSVGEARAWEEHTTGPADLRVLPGGHFFLVDQAAPMIATMTEKLAGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RifR
molecule tags Hydrolase
source organism Amycolatopsis mediterranei
publication title Structure and Functional Analysis of RifR, the Type II Thioesterase from the Rifamycin Biosynthetic Pathway.
pubmed doi rcsb
total genus 89
structure length 245
sequence length 245
ec nomenclature ec 3.1.2.-:
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3flbA00
5ALFA 4Y2JA 1OILA 2WHQA 2OAGA 1RYYA 3TGLA 2VAVA 4TVKA 4H7EA 5T4FA 1U2EA 3DL7A 2GYWA 3KWJA 2VJCA 2BUCA 2JEZA 3I2GA 5K3DA 1UK6A 3BDIA 4H77A 3R41A 5EI5A 5C8ZA 5DNUA 1QTIA 2VT7A 4Y2XA 3W2TA 1R4ZA 4EY5A 1RP1A 1UKBA 3WA6A 4ITVA 5IVHA 2PX6A 3ZV7A 3ESDA 5CTAA 3WWPA 5IKXA 1S8OA 4AN0A 4BAGA 1E8DA 5FP0A 4CCWA 3DYIA 4MEAA 3WWEA 3F9CA 2AJLI 1KU0A 4UBLA 3QM1A 3D0KA 3K9BA 3UMJA 3ED1A 2XMBA 1OXMA 4OPMA 4C88A 5AJHA 1NX9A 4Q34A 2Y2UA 1VKHA 1BRTA 5AI0A 1QOZA 1BU8A 2J3QA 5LZ8A 2XMZA 4N5HX 5AM3A 1NU6A 3H2JA 1PJAA 5CH3A 1VLQA 4G8BA 3DYVA 5JYCA 2Z3WA 3DL4A 5AKIA 3STXA 2P8SA 3C45A 4J0GA 4KRYA 1LZKA 3HSSA 1ODCA 4YPVA 7YASA 2HDWA 4ZV7A 5EHQA 2XUDA 1ZI9A 3B12A 1XZFA 4X93A 4Y2VA 4ARAA 5FDFA 1UT6A 4MEBA 1E8NA 1ZI6A 3IUMA 4UHBA 3GBSA 4PSCA 3AINA 2H9YA 3OTQA 1Q84A 4BAUA 5JAOA 5CRIA 4C4XA 3H18A 4QDZA 3DOHA 1EVQA 4Q3OA 3C5VA 1O6GA 4KJXA 3NWOA 5HFNA 2JGLA 5EIHA 3IB3A 4WJLA 3WK8A 4WFIA 1QLWA 2HA7A 1J06A 1WB4A 2OGSA 1XQWA 1JMKC 5ALHA 4J0JA 1SCQA 3STWA 3I2HA 4Q3KA 1Q0ZA 4BC1A 4KE9A 3F67A 5ALYA 4IQ4A 3WLAA 5JANA 2AJ8A 4MWSA 4Y2YA 5AKYA 5LYYA 2WG0A 5D6OA 3TJMA 4Q82A 2ES4A 5FLKA 1SOMA 2YASA 1Y37A 2XQIA 3DDUA 3I6YA 3ESAA 4K2AA 4D9JA 2BFNA 2QRUA 3K6KA 3QMWA 3FBWA 1H23A 3FSGD 1UK9A 1W6RA 5E2IA 1MJ5A 1YAJA 1XRLA 2RAUA 2YYSA 1TCBA 3KXPA 5JD4A 1CIJA 2XUHA 1EDDA 5ALSA 2EDAA 1A8QA 4UHFA 4HS9A 5JZ9A 4H18A 2PSHA 2OCLA 1ORVA 4H7FA 1W1IA 3STYA 3PF9A 2PL5A 2WIGA 2GYVA 4DSAA 4KE6A 2ACKA 1G66A 4AZ0A 1LPNA 1XZAA 2G63A 1F0PA 1WPRA 2PPLA 1ZICA 2AJBA 1PFQA 1UK7A 3EQ7A 1ZIXA 2JGEA 4UPDA 3V1NA 3A2LA 4BB0A 3R3YA 4OB8A 5T4HA 1X70A 4FBMA 4N5IX 2XUQA 2I3ZA 1EK2A 5LIPA 1CUFA 2Q0XA 3G0BA 3A2NA 3G9XA 3IURA 4BCCA 1K63A 4OU5A 1SCIA 2V97A 1CR6A 4LHEA 2HU8A 5ALTA 2IX9A 4Y2TA 1MX1A 3C6ZA 4FWBA 4LXHA 2PSJA 2QR5A 3GZJA 3H17A 3YASA 4B7ZA 3RARA 4GI1A 4FLFA 5ALXA 4AQDA 4FMPA 1AX9A 4BCBA 3ANTA 5AKGA 5JAHA 4F60A 1EDBA 1EI9A 5LKAA 4BRSA 2WILA 2Z8XA 1MNAA 2HM7A 1E89A 5ALOA 3WYDA 2UZ0A 4B85A 2CEKA 4I4CA 4L9AA 3A6ZA 3LIIA 1DX6A 3VDXA 3WKBA 5A6VA 3M81A 1ODTC 2WHPA 1XQXA 3I1YA 4O08A 2VATA 4UHEA 4DTCA 3FLBA 1ZJ4A 5HQ3B 1LPMA 5KWIA 1K5PA 4OD0A 1Y7HA 1GXSA 2VT6A 3R3UA 3OM8A 2PVSA 2WIFA 1TIBA 4CIBA 2W6CX 1TKRA 5E4JA 1LZLA 4AXBA 1E8MA 1C7JA 1XRNA 3W05A 4IH9A 3HZOA 1VJ5A 4UUQA 3WKAA 3VVMA 2JIDA 5LKRA 2CB9A 3MUOA 1DTEA 4W1SA 4KE8A 3OURA 4FKBA 3CCBA 4X94A 1DQYA 1H22A 4K6KA 4AMYA 2GZSA 1CRLA 1SFRA 4MJ3A 3WIBA 5EIEA 1AQLA 4RE5A 3CN7A 1F0NA 2WU4A 5FPQA 1U8EA 4INZA 2HA6A 4I3FA 1EA5A 3EF3A 1DQZA 4CIAA 2JF0A 3DD5A 3R0VA 5JALA 5D7BA 4B84A 1ISPA 1P0IA 4UHHA 2XE4A 2XUOA 2WUFA 5FRDA 1P0QA 4KEAA 1MU0A 4P08A 4ARBA 4AN1A 4DYHA 4HAIA 4B9EA 5LZ7A 3FYUA 3O4JA 3I2IA 1MN6A 4FDMA 1QGED 5ALDA 3RLIA 3EIOA 5AK5A 4UBNA 3PFCA 1FFEA 3FCXA 5AKKA 3C6XA 4YX9A 1R88A 4E14A 4G4IA 3EQ9A 1H2YA 1VE7A 5LZ9A 5C8XA 4A16A 3MVEA 1LBSA 5ALUA 4J0IA 3AFIA 2B20A 2XUIA 3FYUB 2HFKA 1MX5A 2WFLB 2PSFA 1U65A 5CW2A 3WZMA 1XZIA 4NMWA 3BWXA 5AKXA 4AZ3A 2JGJA 3D2CA 3H2KA 1FJ2A 1UZAA 3Q0TA 2XMQA 1XFDA 4PSUA 3AJAA 4I19A 2Z3ZA 3G9TA 4U2FA 2XQJA 3WKDA 3PUIA 4LIPD 1XLUA 1BN7A 3H04A 2HA2A 3DKKA 4OYYA 1CUDA 4DM7A 4JNCA 1P0PA 4KAFA 2JGIA 4WDRA 3ANSA 4K6HA 2DHCA 3W04A 1EK1A 1JU3A 4B83A 2HRRA 1UOPA 5HQ3A 1CUCA 2B9VA 4QDTA 3D4LA 1N5MA 2EEPA 3WL8A 4B80A 3SX4A 5AI6A 4UHCA 1VA4A 4XWGA 5CXXA 1CUBA 3BF8A 5ISMA 4W9RA 3BL8A 1XZMA 4EY6A 4Y9SA 3FOBA 2Y1KA 3PE6A 4A5SA 2HFJA 3H2IA 1UWCA 1IMJA 4C01A 4QNNA 4AB1A 5T4BA 1SC9A 5LLSA 3HXKA 2VA9A 4S0XA 2Y6UA 5C7YA 1XZHA 1QIDA 4WY5A 3NOXA 5LZ4A 4EY7A 2B61A 3QPAA 3VJKA 2DSNA 4KACA 1K4YA 3A2MA 2ZJ7A 4ETWA 2WFLA 3ILSA 1R50A 3MGAA 5DYWA 3BE8A 5ESRA 1PV1A 3AILA 3WK5A 2QUBA 3IVMA 2XMCA 1IVYA 3KOOA 2XUPA 4OU4A 1MO2A 3X3HA 3DQZA 5BOVA 5AKEA 3EQ8A 5CT5A 4KYVA 5K3CA 1BEZA 5K3FB 3IUQA 2BGRA 1C4XA 5HK9A 4ROTA 2ZYSA 3E3AA 5YASA 2G5TA 4U2EA 1AUOA 2WLSA 2OCKA 3WJ2A 2C5GA 2G4LA 2ONCA 2R8BA 1X2BA 5AOAA 3I2KA 3JYHA 2AJDA 2H1IA 1DT5A 4JYPA 1BN6A 1VZ2A 1LPAB 5EHZA 1MTZA 1K6EA 2WJ6A 1QO7A 1UOQA 3D59A 3DS8A 4B81A 1ORWA 4BP9A 4W1QA 2HA3A 4W63A 1QIJA 3PF8A 3O95A 4X7BA 2XMDA 3ZI7A 2OQIA 1H2ZA 1BCRA 1GKKA 5FPPA 4MQMA 4NZZA 3VVLA 5DYYA 4RNCA 2OG1A 2X8BA 3BF7A 3ESCA 2BUAA 3GFFA 1QFMA 4BE9A 1LLFA 2Z5GA 5IVKA 1EB8A 4UFNA 1P0MA 1J2EA 2ACEA 3BIXA 4G8CA 5AICA 3IULA 4U2DA 3IUJA 3ICVA 3O9MA 2ECFA 2VQ6A 2WSLA 3KWFA 1MNQA 3I2FA 4X6YA 4GDMA 1XQVA 3G0DA 1L7AA 4Y2SA 4B0PA 5CMLA 3H1BA 4F21A 4XJVA 4C4YA 2C0PA 2WIDA 1USWA 1HKHA 4DMFA 3E0XA 3PICA 5ALJA 5AHXA 3D7RA 1X2EA 4WFJA 5LZ2A 4FTWA 4W1RA 1IZ7A 4Y2PA 1CLEA 1I6WA 5AOBA 1XZBA 4X85A 2WFMA 2WIKA 3C43A 4FBLA 1TCAA 5CURA 1B41A 5K3FA 3R3ZA 2ZYHA 5ALVA 3WWCA 5K3BA 3DLTA 3M3DA 3QVMA 3FYTA 4N8SA 5DNVA 1VXOA 4MYDA 2OAEA 5HF6A 4CI9A 1NU8A 4X92A 4J0KA 2NW6A 1CVLA 3ZLUA 5AKLA 4E46A 4KRXA 4HXFB 2C5FA 2Y6VA 1XZDA 1XZLA 3C70A 5HCUA 2ZJFA 1K8QA 2WG1A 4HRYA 5A7HA 3G9ZA 1QIHA 4HXGA 5K5EA 5FKJA 1E5TA 4MYSA 3WMRA 1FFBA 4H0CA 2GBFA 5AKHA 4BBZA 4TGLA 3LP5A 3Q8WA 3VXKA 3U1TA 2H7CA 2QMQA 4U2CA 3JWEA 1CUIA 4WFKA 3C8HA 4JEIA 3DNMA 3WL6A 3QMMA 4BVLA 2O7RA 1XZKA 3IA2A 1YAHA 5AI5A 5I8PA 4MXDA 1MAAA 3BIWA 4DMCA 5ALLA 5A7GA 4AO7A 5CT9A 1A8UA 1CUGA 4FNMA 1DWQA 2RGUA 4J0HA 3W9BA 2DHDA 4CCYA 1FFCA 2D0DA 4QA9A 4WCVA 2XT0A 2VJAA 4ZWNA 1DX4A 3QMVA 5EFZA 5AM5A 4M0FA 2ZYRA 5AIBA 2O7VA 4ZI5A 1VE6A 1WOMA 1C7IA 4EY8A 1GKLA 4IHAA 2VJBA 3G0GA 1WPXA 3F96A 3W9UA 1CUZA 1ACJA 4GHWA 5E4YA 4J0DA 1CUVA 2C0QA 5HZGA 3L1IA 4E11A 5ALIA 2PM8A 1CQWA 2C58A 3HEAA 2C4HA 4X90A 1MT3A 4CG1A 2DHEA 1FSSA 3DEAA 3E4DA 1E3QA 4UFOA 3BJMA 4G9GA 2AXEA 1EINA 1JMYA 3WYNA 4DIUA 1HLGA 4GW3A 4M0EA 3RM3A 5D3ZA 1W4LA 4Y7DA 1DU4A 4X91A 2QJRA 1DWOA 1CUYA 3O9VA 1XZEA 1XZCA 4G4GA 3OG9A 3I2JA 1IUNA 3WJ1A 1DINA 2RONA 3IDAA 4P93A 3N2ZB 1ZJ5A 3H2HA 4YASA 1GPKA 4NVRA 4UBIA 3RK4A 3H2GA 3H19A 5C8VA 5EHNA 4P92A 1TRHA 3PI6A 1G42A 4L72A 4TPKA 4MQLA 1W52X 2VF2A 4DNQA 2GBGA 1YSCA 4EUSA 3G7NA 3S8YA 2HA4A 3FAKA 1JU4A 4UBMA 1BROA 1XRRA 5D3KA 3ZLTA 4DLNA 2HA5A 5AK6A 3PUHA 3AIMA 4G5XA 3V1KA 2HA0A 3PFBA 1EVEA 1L7RA 2XDWA 4X71A 5ALGA 2QM0A 4PSDA 3QITA 2QKYA 2JGKA 2XUFA 3CCCA 3SWWA 5K3AA 2ZSIA 3FCYA 4BC0A 5HK8A 4X95A 3H1AA 1DWPA 5C81A 1XRPA 1QIGA 1YA8A 5JARA 3HYSA 5DWDA 2O2HA 4N8DA 1XRQA 4HZGA 2QS9A 1QFSA 2D5LA 4AO8A 3QPDA 1HQDA 2OGZA 2VEOA 4KR0A 4G8DA 4BZZA 2XUKA 3E1GA 2FUKA 3U0VA 5JAUA 2XMRA 2WUEA 4LXIA 2VSQA 5HFAA 2HHAA 1LBTA 1JFRA 1ZD4A 2DR0A 1YR2A 2OXEA 1J07A 3FYUC 1LPSA 4FLEA 3FVTA 1UOOA 2ORYA 3W06A 1QJ4A 3ZPXA 3HRHA 1CV2A 4FFVA 4GXNA 4UFPA 1XRMA 4GLBA 4RGYA 4YK7A 4BATA 4FFWA 5A71A 1M33A 3AZPA 2PSDA 1RWQA 4OYLA 2V9ZA 3WWDA 5ALQA 2E3JA 4Y2RA 5AM1A 1XZJA 1THGA 3C87A 3QYJA 5FUMA 4C87A 5JAPA 5AIAA 2QVBA 4PO3X 2FX5A 4GBGA 4E15A 2XQKA 3STTA 1EXWA 1D07A 1IZ8A 3LIPA 1AMNA 2DQZA 1B6GA 1AC5A 4X6UA 2XMGA 1ZOIA 2HU7A 4FLMA 1AGYA 1JJFA 2ZSHA 4BVJA 2PSEA 4EBBA 5JD6A 1CUEA 3HJUA 2HRQA 3DOIA 3HABA 5JADA 1UXOA 2RIPA 5JZSA 1XZGA 3LS2A 1TQHA 1EDEA 5DYTA 3R40A 5FXMA 2JGMA 4Y2QA 4WY8A 3H0CA 1GT6A 3D5EA 1WHSA 3EBLA 1CUWA 1O6FA 5F4ZA 2QTBA 3QZUA 5ALWA 3C6BA 2HU5A 1N5RA 3AIOA 1LGYA 2Y2VA 3RKSA 1Y7IA 1ZGCA 4OB6A 1TAHA 4DNOA 5AKZA 1WM1A 5JIBA 4C6HA 2HADA 1T4MA 1DT3A 3AUKA 2ZVDA 3T52A 1TK3A 3G8YA 1VZ3A 1CPYA 5AI9A 4ZV9A 2DQYA 2PUHA 3WKEA 4H7DA 3TEJA 2GYUA 2DCMA 2PU5A 4X3CA 1GGVA 2W22A 2O2GA 4J7AA 4DGQA 1J1IA 1W76A 2QT9A 3NGMA 2FJ0A 3WK4A 2WTMA 4BTVA 2J3DA 1IUOA 5AOCA 2FJPA 2XUGA 2LIPA 3G9UA 3WZLA 5ALMA 1CQZA 4U2BA 3FSGA 3GELA 4Q1VA 1Q0RA 1CEXA 2WHPB 1LPPA 4J03A 4H7JA 5CT8A 2CUTA 2BUBA 5J3JA 2BCEA 1R3DA 1GZ7A 5CBKA 5EGNA 1N1MA 4BRZA 3HACA 3V9AA 4FNGA 4EY4A 2J4FA 3STUA 3BJRA 3UUFA 4AO6A 3ICWA 5AH0A 3C6YA 3O0DA 1WCYA 1EB9A 5DJ5A 5AK4A 2WJ4A 2RI6A 1ACLA 2JGFA 4PQEA 1CUHA 4BTLA 4BVKA 1YCDA 1EHYA 4ZGBA 3HI4A 1QIMA 4LYDA 5IVIA 2WG2A 4QZVA 1XLVA 2PKYX 1H2WA 4F0JA 1A88A 4B9AA 1QIEA 2OQVA 3SK0A 2VTVA 5A7FA 4QDUA 2I03A 4BE4A 3AZQA 1U4NA 1GQSA 4V2IA 5ALRA 1VXRA 4RPCA 4N8EA 5EIAA 3STVA 5EHXA 1F8UA 5K3EA 3FWHA 2GBCA 6YASA 5AM2A 3M82A 5SYNA 4CG2A 3O4IA 1THTA 4IH4A 5DNWA 5AP9A 5FV4A 5A62A 2H7XA 3HLKA 2QJWA 3F98A 3D3NA 3I6MA 1ZIYA 5I9IA 3O4HA 1JKMA 1ZD3A 1F6WA 3ESBA 1IUPA 4BAZA 2J4CA 5DTJA 2WJ3A 3IBTA 4PNZA 5KBYA 1QIFA 2WFZA 3OOSA 3HC7A 4UBJA 2XLBA 5CT6A 4ZRDA 1FFDA 1QIKA 3SC2A 2CZQA 3KD2A 5ALZA 3ZWQA 1WB6A 2YXPX 3DJYA 1VOTA 4H7HA 2XUJA 1AKNA 2I78A 3IUNA 4GECA 4B82A 5CXUA 5HF9A 2V96A 5CH5A 1UFOA 1QE3A 5DLPA 2PBLA 2OCGA 4FOLA 4KE7A 1ZGBA 2WU3A 3CXUA 4QEKA 3WL7A 4CG3A 1G5FA 3WL5A 3WA7A 3QPCA 3C8DA 4QDOA 4L3WA 3UUEA 5IVDA 4H7IA 4QWWA 1HPLA 2OLEA 2WHRA 2PUJA 5AK3A 5AM4A 1CUUA 4A23A 4LYEA 3O4GA 4EZIA 2GBIA 3M83A 4FHZA 4GEGA 1LPOA 2PU7A 3I6ZA 1FFAA 3K2IA 5DTIA 1CFJA 5CT4A 2OPHA 3V48A 4H7KA 4CFSA 5JASA 5AI4A 5E4TA 1JJIA 1YB6A 5ALEA 1ZI8A 4X97A 2CBGA 1T2NA 1H2XA 2ZYIA 3WWOA 1CUAA 1LNSA 4GWLA 5ALPA 2IIVA 3VJMA 1KEZA 3T4UA 1G4HA 1YA4A 3OC0A 5ALKA 3FLEA 3D2BA 2GZRA 4NS4A 1BEEA 4DSZA 2WM2A 3B3QA 1XROA 4DNFA 4W1PA 4JUIA 3BDVA 2RHTA 5HF5A 3KDAA 3GA7A 4P9NA 2QXTA 4Y2UA 3WQHA 4OSEA 2BAGA 2BJHA 5HKAA 2VAXA 1XKTA 2XQFA 3F8SA 3AIKA 4QDXA 5H3HA 2H7YA 5AO9A 4H35A 4J3JA 4QE3A 1EX9A 4XX1A 1BS9A 2CMFA 3JW8A 4Z49A 3KSRA 3F97A 5BV7A 4OUKX 4B6GA 1HDEA 5JD5A 4RE6A 3V1MA 4ZXFA 4K5QA 3GROA 4HVTA 2DFPA 4DMKA 2VJDA 4QLAA 5HF8A 3R3VA 4EHBA 1JI3A 4BDTA 2JBWA 1Q83A 2XLCA 4Q3LA 2OCIA 2QUAA 4AMZA 3VKFA 3L1JA 3D2AA 5AM0A 3A70A 3GUUA 4BP8A 2AJCA 4LXGA 1XKLA 3OPMA 3NUZA 4G1FA 1YS2X 4OCZA 4UHDA 3AZOA 1WB5A 4UBKA 1EH5A 4OB7A 3LCRA 1SCKA 1AZWA 5KWJA 1W75A 4PF1A 4JH0A 5JZBA 2CKMA 1HBJA 4X6XA 4J0CA 3CN9A 3IIIA 1LPBB 1UKCA 2RHWA 4UBOA 1QIIA 1WHTA 2B4KA 4KAAA 2QXUA 2O2IA 1CUXA 1BE0A 1GPLA 1CUJA 4U2GA 5ALNA 3R3WA 3FLAA 4DNPA 2QZPA 5LP1A 3QH4A 4XIIA 4IH1A 1TCCA 3LLCA 2WTNA 2HIHA 2HL6A 4X00A 2C7BA 4DMHA 5LZ5A 2WUDA 4KAJA 3G0IA 2BKLA 4G4JA 3VISA 1BCSA 1UKAA 4K6GA 3FNBA 2EDCA 1ZD5A 4CCYB 3FVRA 1A7UA 5SYMA 5IH7A 3B5EA 3R3XA 3V1LA 1XQYA 3WIOA 2XMSA 2BGNA 2IITA 1Z68A 3TRDA 1E66A 2XUAA 5BWBA 3WK6A 1QO9A 1ETHA 3ZLVA 4ZREA 1YS1X 4BZWA 3MUNA 1GQRA 1VA5A 3BXPA 3QBJA 5I7UA 2QOEA 3P2MA 1HL7A 4JYMA 2XB6A 4PW0A 4MWTA 2XQGA 2Z8ZA 4HRXA 3WK9A 3I28A 3L1HA 5AI8A 3WI7A 3S2ZA 3WK7A 1MX9A 2K2QB 1QZ3A 4AX4A 1KU6A 4L0CA 3N0TA 5JATA 5AKJA 2R11A 3G0CA 1ZD2P 2YH2A 3DKRA 4XVCA 2G5PA 1MPXA 2ROQA 2X5XA 2WKWA 1YASA 4C4ZA 1ODSA 2CJPA 1N8SA 4M0MA 2V98A 2OGTA 3VJLA 2WQZA 5A2GA 5FOQA 1CUSA 5BWCA 1YB7A 3WKCA 4HTAA 1JT2A 1GPNA 1UK8A 4Q05A 1R9MA 4EB0A 5T4EA 2I3DA 1XLWA 4BCDA 4B0OA 2WIJA 1MAHA 2WUGA 4EA6A 4BDSA 1QTRA 5CH8A 3PDCA 4WDQA 5KREA 1A8SA 4G9EA 4HXEB 3C5WP 2XI4A 2X76A 1R1DA 2ZJ6A 1L7QA 4QWMA 1OCEA 4QLOA 5HKBA 1QONA 1JJBA 1R9NA 3DCNA 4F5ZA 4C89A 4BYMA 1AURA 2JEYA 4LKOA 4PV7A 3I1IA 4IO0A 3G02A
chains in the Genus database with same CATH superfamily
3SYRA 1UAYA 3ZZUA 3PQCA 1E9BA 2FK8A 4GGPA 1I4LD 2FPGB 3B6ZA 1O6CA 4MDFA 4RD0A 4GWGA 4Y2JA 3V7FA 2C9MA 1I8TA 1V5EA 1DAIA 2VAVA 3CGWA 1CERA 1KGDA 3PXUA 1Z7WA 1GPAA 5EXPA 1DIRA 1J00A 3DL7A 4FVTA 5FJIA 4CODB 4EJFA 3PEEA 1QV7A 4GYYA 5T64A 1W87A 2JVKA 1UK6A 4IQ8A 3B3FA 2OUKA 3WIUA 2QE6A 3H9BA 1WQ1R 1P80A 1JIIA 1LWNA 2AW3A 3CPHA 1YS6A 2FSGA 4IX9A 2LCIA 2JH9A 2O2EA 4EEXA 1WLYA 4E33A 5C5CA 1UPAA 4PNPA 4PHTA 3II6X 1L8OA 2CLEB 2VT7A 4F71A 5CDFE 3W2TA 4HK4A 3WAGA 1R4ZA 4PTYA 2AHOA 1MVLA 1U2GA 3VC2A 3U56A 1SUEA 3NC1C 2HT1A 1RP1A 1RRVA 2O23A 4MRVA 3JWHA 1U9YA 4CKEA 2A1TS 4ZEMA 4HQRA 3EYWA 2PX6A 3IDQA 1I0LA 1PJ4A 4O1HA 3V46A 1ATIA 1IL0A 5FBLB 4ARZA 4DRYA 2YZKA 5L3ZA 3LCVB 1BE1A 3HBFA 5IKXA 1NXSA 2X1LA 1JECA 4PZEA 1FZQA 2GF9A 3R8XA 3WAKA 2J6BA 3Q40A 4IXNA 4PXAA 2GN4A 4AMBA 4IEFB 1ZGHA 3ZDRA 1UFKA 4X1IB 1UJBA 4DR1B 4E5SA 4EQ6A 3D4PA 1C9EA 3AEQA 3IAAA 3U3KA 1FVOA 3DAGA 2NT3A 3ZG6A 1NP7A 3RC1A 1DARA 4D8XA 3GMSA 2FP3A 2QIOA 4MR7A 3N3BC 4Z53A 1I6MA 1O2DA 4X84A 1R6UA 3SY8A 1DE0A 3LH5A 2XT6A 5BN3B 3OM0A 1JHVA 1OXMA 3NH9A 3ROKA 4CUJA 1YHZA 1WR8A 2GYYA 4C88A 3C3DA 3KKEA 1TFUA 2FW8A 4DDUA 4X62B 4PGMA 4KSYA 1NX9A 3OSZA 4JYAB 1YMVA 1JG6A 1KDTA 4Q34A 2VP4A 3TRFA 4GL4A 2G0NA 4UAGA 4YJ3A 3OZVA 5BN1A 8ABPA 4QAJA 2J3QA 3HBMA 1E4EA 2GPBA 3ROQA 1RVDA 2BM1A 2DH6A 4GPEA 1BW9A 2W70A 5BR4A 3JQGB 3L7MA 3AY3A 1A5TA 3W1EA 2A5FA 1MW9X 5LQDA 2GSDA 3A6LA 4ZIRA 2JH8A 1W35A 5D1NA 4W6ZA 2QX7A 3U31A 4GZ5A 3H2JA 2IF0A 3AEUA 4G86A 4BZXA 3LU1A 4DHEA 4G8BA 1IJKA 4GPZA 2O7NA 3AF2A 2VOEA 3LC1O 3OPQA 1ULAA 1TUBB 1N0HA 3SZGA 5JYCA 1XWWA 3NRJA 1E2IA 3DL4A 3OA0A 1Y3AA 4LSMA 4MRSA 3T3PB 4PYQA 4JBHA 4F96A 1Y3HA 4EI8A 5BQ5A 2XNKA 4RJKA 3H84A 3TD9A 1JTVA 4Q93A 3KQNA 1LZKA 4RPKA 1A77A 1OZFA 3THXA 1OT3A 2C4NA 2G09A 2FQXA 3H05A 1P2GA 2PA0A 3V1UA 4DCMA 3N8KA 2HDWA 3RKUA 3VPAA 4WBNF 3VSAA 1OH5A 4JK3A 1ZI9A 1UBGA 2PO5A 5JHHB 2ZK7A 2RI1A 1TM2A 2BGLA 2R85A 821PA 3AY6A 1ZUD1 1Q7EA 4KI0A 2V8BA 3CRRA 4PZUA 4XQCA 5E2AA 5ERGB 3OMLA 1XZFA 4X93A 3TXAA 3GLFA 2GK6A 2H4FA 2POCA 4H08A 4L0DA 4G9BA 5B7NA 4B34A 2IYZA 1H0RA 2VHWA 3NTOA 2D7DA 1SH7A 3OZ7A 3DJFA 1W30A 4K6CA 1GNQA 2VTKA 4KU4A 2WLTA 4R2LA 3QYPA 3HXMA 1T9HA 4UHBA 1G5QA 1HY3A 3CH7A 3GBSA 3O94A 2JLVA 3ND7A 1FVFA 1ABFA 1K6MA 2H9YA 3CNLA 3N8GA 3GFGA 3OTQA 4ALNA 4NLLA 1Q84A 1H4SA 2X0EA 4IHQA 5JAOA 3PDJA 1DBSA 1FFXB 2QG4A 1OYYA 2A58A 3NBFA 5CDYA 3MMSA 5FBZA 1T4CA 4J3FA 4Q3OA 5FL7A 1O6GA 2QB5A 3I3OA 3NWOA 2Z5LA 4KXNA 2XEXA 2JGLA 3I45A 3JTEA 3TL3A 1IG3A 2NU6A 1M1YE 3QUAA 4IV8A 4GYWA 4IUBS 3DBLA 4LRSB 5CLJA 4D4KA 3O7MA 3DAYA 4RD3A 1C9NA 4FYWA 3BRWD 4H3SA 4ZMSA 1YRBA 3EH1A 3C7DB 3HKBA 3SYKA 3BJZA 3ZWYA 4B3DA 1CB7A 1D4FA 1JMKC 1UBHS 1P4SA 1BJTA 2BDEA 5ECWA 3ZXUB 1LQ2A 3RIYA 3EEFA 3V1YA 3FOAA 2YQZA 4P83A 3UMMA 5I9LA 2G0AA 5ALHA 4TMKA 4S1WA 1GUYA 3W79A 1NUAA 1NGSA 2RJNA 1GTSA 3DFZA 4N3BA 3QIAA 5IDYA 3VZDA 5A04A 5F9HA 4DCUA 2CK3A 1ACMA 3ZWCA 1UXGA 4Q7LA 4MAMA 1T5TA 2G07A 2Q4TA 3CT4A 4BC1A 4KE9A 1SXJE 3F67A 1HZJA 3L3BA 4IQ4A 2AOWA 4FHDA 5E9JA 1A5BB 3TSZA 2I3AA 1OX5A 3EQ2A 3T3GA 3ZGXA 5ILOA 3HU1A 3R0IA 4MWSA 2JD2A 4FEEA 4E70A 3PRJA 4FZJA 3I8SA 2OWDA 3FX2A 3IP5A 1QKJA 4HC4A 3GLTA 2WG0A 3FCEA 3IMFA 1NVGA 3T7SA 4AS1A 5H9VA 3TNJA 1E2LA 2A6PA 4MIKA 3K0KA 4Q82A 4WNAA 5DTRA 1QS0A 4UPEA 3BKXA 4F1KA 4Q9JA 2XQIA 4EKNB 3GJRA 3QVXA 4FFNA 2BFNA 2XF2A 4JGBA 4C5AA 3LZCA 1C8BA 1GUBA 4GG1A 2D62A 1HEUA 2WSSA 3SPXA 2ZM5A 1IY9A 2HQRA 1SXQA 3LGSA 4G5GA 4TL7A 2R00C 4X1OA 4BKOA 3FBWA 2AMYA 5EJAA 2BFFB 3HY6A 4KQMA 3SHOA 3ZY5A 1AKQA 8AT1A 5IT0A 2QUZA 2QAJA 3NTVA 5J9FA 3D4OA 3ZR4B 4WKBA 3E9MA 3FY4A 4M7RA 4D96A 1C1XB 3K09A 4KO2S 4LZZA 4CM7A 3DZHA 1J8QA 2AMLA 4QUHA 5T67A 1VI2A 2W71A 5LXTF 4RJ2A 3KXPA 2VDWA 1GN8A 5KQSA 4MUNA 2Y93A 2RAPA 1U0BB 3M4YA 3ESRA 4KWCA 2WVJA 3D8NA 3QF4A 3GG9A 2XXAA 1G2IA 1P6UA 1X1BA 2PX3A 4RKQA 4EK9A 2VQDA 2FMIA 2QV0A 2XUHA 1YZ3A 4G2TA 1X9HA 4D3DA 5B12A 2IE8A 3FKSA 3FTPA 4H1HA 4QHYA 3WBBA 1WBDA 2REBA 4WZAA 1GL6A 4WGGA 3UMRA 1JHMA 5K45A 4G09A 1WCIA 1XCOA 2HK7A 3LWNA 5REQB 3URKA 4DMUB 4BV2A 3I76A 3KQSA 5BY2A 1Z5VA 1E58A 1VE5A 3MWLA 1ZD8A 4ND3A 4RZ2A 1Q1EA 4IVRA 3K30A 1NZFA 4OIMA 4JP3A 2F8TA 2OFPA 2EAUA 3V80A 5JFTA 4WCFA 5FWXB 1E3SA 1ZD9A 4MDEA 1QP0A 2HJ9A 4RYLA 3O2NA 1OAOC 5CFRA 3A6GA 2PYZA 3M6UA 1L4EA 4I4NA 1RI5A 1G66A 2P2YA 3NRCA 1P2DA 1LPNA 5EVJA 3GP5A 2XOKA 3MS7A 2G63A 2V55B 1YONA 2WIBA 4GPTA 4JDPA 3MAJA 4L3VA 2IHBA 4YRLA 1DFGA 2FW0A 1F51E 3RIGA 3VYUB 3WLNA 4O2RA 4Z4GA 3AR8A 4MDHA 3AU8A 4OQMA 3RU9A 3EQ7A 3MC1A 3GJ3A 4JT2A 4P0TA 1SUSA 1M2HA 1T25A 2EKPA 1U5BB 3MFYA 1QZTA 4BO3A 4BVBA 3LTNC 1Q1NA 1MXHA 1LDYA 3A2LA 3T5GA 1N34B 1NZJA 4B75A 3G85A 4WX2B 5J5AA 3R3YA 3DQQA 5T4HA 2NZWA 1NE7A 1X9IA 3ECCA 5CYGA 3OQJA 2BLLA 2B5OA 3CZ4A 4JUCA 2XUQA 2QI9C 5ESWA 1EDZA 2A9JA 3DYBA 1ICEA 4QJ5A 1ZOLA 3GNSA 3G0BA 5B1HA 3NBUA 1UJMA 5JWRA 2HMYB 4E09A 4DV1B 1K63A 4X5OA 3MCAA 2A0WA 4JY7A 1CR6A 3NGLA 4FFSA 3ZTWA 5ALTA 4B43A 2EQAA 2OG2A 4JJGA 3RUDA 5JU6A 2Q6KA 4MV8A 3NVDA 3CA8A 4Y2TA 4QYWA 5C2JB 3C6ZA 4P4GA 2VI5A 4MUJA 1BGWA 3B2NA 3DO5A 1OBOA 3OETA 3GZJA 1GJRA 4C6SA 4JEMA 1FEZA 2VNSA 4NYMR 2JFNA 4M7PA 3DZJA 2O8EB 2FUEA 3PWSA 4GI1A 1TYAE 1D1SA 5B4UA 3LUPA 4Y18A 1QU2A 3OFKA 5COQA 1AB5A 2AE1A 3OF5A 4X7MA 3HUFA 3T35A 5FV4A 5LKAA 4PLPA 4IJMA 1JE1A 4AJLA 5IWAB 4UE6A 3WNDA 3IP8A 2FCRA 3BWDD 1B8NA 1BWPA 2GD2A 2NU7B 2WWWA 3D8BA 4O8CA 4EO7A 1N92A 5MGBA 1N6LA 4H6PA 1NPTO 4LJ6A 4B85A 2CEKA 1C1YA 3JRWA 2NV2B 3QIVA 1ZL0A 2JI8A 4I4CA 3DW1X 3A6ZA 2IWHA 2PLNA 2AD1A 1DX6A 4XPZA 1IZ0A 3LCCA 3TTYA 2XCLA 1U8YA 3M4JA 5A6VA 4JGGA 3OUZA 1ODTC 1DO2A 2Z09A 1OE0A 5DOVA 2X1MA 3TWOA 1DJMA 1WVMA 2I6GA 1C0KA 4UHEA 2BGKA 4DTCA 2VLIA 3C14C 4XUEA 3EZ6A 2RGEA 4D0NA 1Y7HA 2V59A 2I22A 3N3AC 3R3UA 3EDMA 5G41A 3VX4A 1GL3A 1TIBA 2WTEA 2BFPA 3BZWA 3H3JA 2A5GA 1AA9A 3ORQA 2JFVA 1Z5UA 3HVJA 2DHQA 2W6CX 1E2HA 3VMMA 1DG1G 3RDPA 2XYGA 1RVV1 4XB2A 4GKKB 4AXBA 1E3WA 2HNAA 2JJ1A 3CUVA 1VBMA 4MI1A 1E8MA 1QC5B 2MOKA 3ETLA 3E5RA 4Y0NA 3D1VA 2NUAA 5CCDA 2X8WA 4YYZA 4L1KA 5F98A 5HKLA 1QAMA 5EWLA 2G9QA 5TNXA 1XRNA 4FDTA 4UJ5A 3WGYA 2G1UA 2FPXA 4IH9A 5LLTA 1GRCA 1BSVA 4ES6A 1VJ5A 3R6WA 4QC2A 3SF8B 3H2YA 3PG5A 2IJGX 2Q29A 1N5LA 3B53X 5JCOC 3D0RA 1R5OA 3PB3A 4QRIA 2FPWA 4ZIRB 4J9UE 3MUOA 5BOSA 1DTEA 1FW8A 4LQLA 3F2VA 3SYNA 4MUKA 3WWCA 5AW4A 1UWVA 3ZS8A 4AJJA 1NY5A 4FKBA 1J4AA 3CCBA 2RHOA 1RPNA 2B69A 1H22A 1NT2A 2ZSBA 3N2IA 4P5PA 4R81A 4UTZA 4AMYA 5B7PA 1KP9A 1Q1AA 1X3SA 3EASA 5E1OA 4IDNA 5JZ9A 1CRLA 1L5SA 1I24A 2GVDC 5HUJA 2CT8A 3S1AA 2WAXA 3HCFA 1UFVA 4NV1A 2NYUA 4NBRA 3RFTA 3LUDA 4D9EA 2WDZA 3RUPA 2OC4A 4QJ3A 1Y9AA 1UM9A 1BO6A 3W3AA 2YYZA 5K03A 3UV6A 4W5JA 1F4LA 4Q3AA 4MINA 4A8JB 2BFEB 2F3SA 5F5LA 1PEAA 3EA4A 3G59A 1F0NA 1KI1A 2WU4A 4NX2A 4YP5A 4Z1OA 2H8KA 3GLGA 4INZA 4O4HA 2JPDA 1E1QA 3NALA 4J4TA 3OT1B 4GQAA 1C0IA 4UNPA 2O8FB 5JSYA 2KX7A 1G1MA 4B84A 2YUIA 1MTOA 1P0IA 1P5JA 2JAUA 2XE4A 4OXKA 3C98A 4DIDA 3PQ2A 5LCXA 1BDJA 1YOVB 1A1VA 5HE8A 4NQRA 1UM8A 4W9NA 4ARBA 3OUTA 5T8KC 4AN1A 2QAIA 3EZFA 4V0RA 4AJKA 3FF4A 1EUDB 2JFQA 3BGOS 3ODPA 3JR3A 3QUBA 4JHLA 3ZW9A 4ZHSA 5AUOB 4ZC1A 4R31A 3O8BA 5U1PA 1KXZA 4C0KA 4YJHA 1EFCA 2V0CA 4NMHA 3L77A 1QFJA 5FI0B 5KMGA 3IQWA 3VHRA 1AOXA 5A6SA 4KB5A 1KP3A 2CCKA 1MQ8B 1R4AA 4LAFA 1M5TA 3JY6A 5ALDA 1W59A 5DOZA 2QI9F 4C29A 4EHKA 4RQBA 5C34B 4GR5A 1QOPB 5TEVA 4EWLA 3UHFA 3OKCA 1NM5A 4UBNA 1A95A 5ECDA 3T9FA 5DGXA 4YX9A 1LKZA 2ODWA 3MS2A 2AN9A 3EDRA 1SUAA 1KAQA 1R88A 1N1DA 1WWKA 3VDNB 4NCKA 3BE6A 2AL7A 4ACAA 4UOZA 2VJNA 4A4DA 4V0KA 2V4MA 1KQPA 5HKOA 3KTAA 1SVOA 1GPDG 2FN8A 4OBEA 4A16A 3R8CA 2ZOSA 4DY6A 1LBSA 1T29A 2F9FA 1PNRA 1ECFA 1BVYF 4J0IA 1H0KA 2XUIA 1L1RA 4RAOA 1G21B 3KG2A 6REQA 2HUPA 1HDGO 3QRWA 2WFLB 3W2FA 2PSFA 2Z4SA 1OBFO 2EG9A 3Q8XB 4OOFA 3A1NA 5LN1A 4E51A 2W8BB 1QVWA 5CW2A 3UA3A 4ENWA 1HTWA 1B74A 2BISA 3WZMA 4D4MA 5JV5A 3WRXA 1BCSB 3K5WA 3THOA 3W5IA 2VZLA 1MEOA 4WADA 5G40A 1VSBA 1U7XA 3KQKA 5HCIA 3BWXA 4CMGA 1U0LA 2AG5A 3VI3B 3PWTA 2QQ0A 2MWMA 3D2CA 5ANRB 1FJ2A 1PGJA 1OWMA 3IP1A 4UVHA 5HVNA 3G3EA 4OLHA 2GJ8A 1NRWA 2I66A 1Z56C 2JAPA 4MV4A 2XV1A 2ONJA 4HEA6 4L5AA 1N0VC 2C54A 3Q6MA 1N0UA 3PHHA 4YIHA 5JH7F 3TINA 2G4CA 2CSXA 3B2EA 2TS1A 1BFUA 3GBPA 3LV8A 3RQSA 3PC3A 1NN3A 1CQPA 1YZHA 1M76A 5KVAA 5KC9A 1H8HA 2QPOA 3IAFA 4QFMA 5B55A 4EW1A 3PGKA 3PSAA 2HNBA 3CH4B 5LP6F 4JI1B 4BNFA 3HL4A 4CZ2A 1N4DA 1GRNA 2IYTA 4TTPA 3WXBA 4M0KA 1K1EA 2IOQA 4MR8B 2ZUTA 2P4UA 3PUIA 4LIPD 5E7MA 1M1NA 3P2YA 3NDRA 3ZI0A 2I4TA 1BN7A 2P5YA 4NFLA 3HUUA 3O1IC 1II8A 1ZSVA 1AD2A 2HI0A 3CR8A 3EISA 4GX1A 4I5FA 3DKKA 3KEQA 3P2JA 1U0OC 2D2VA 3QEMB 3VPCA 4DDVA 5EJ9A 1D1TA 2GBLC 2VZ8A 5A2QA 4JNCA 4N47A 3WHLA 2W37A 2WJPA 3A1TA 2HNKA 4C21A 4DLUA 3MWGA 3IAHA 2YXEA 4A0HA 2JGNA 1G7TA 4K6HA 1NVMB 4JJKA 4XM0A 2DHCA 4YJ3F 2A1UB 3CBQA 1GFZA 3W04A 1MT0A 4BN5A 3GT3A 3DSRA 3K2EA 2C8LA 1IEWA 1PVDA 4KGDA 3ADCA 4P0PB 2PS1A 1V71A 4NDZA 2HRRA 4LBWA 1UOPA 2OM6A 4M21A 3OH8A 2FW6A 4O2BA 1I14A 5EYPA 3ESZA 2WF6A 4D4GA 4EX7A 5HQ3A 4KPFC 1U2TA 3LKDA 2VN8A 1F38A 2UVDA 1VC2A 4RIFA 5DB4A 1NQUA 2CLKB 2HLDA 5B3JC 5KPDA 3TVTA 4X60A 3SDSA 3ELWA 4EHHA 7MHTA 1EP3B 2FOIA 3CRW1 3FUUA 1U8CB 1C7RA 1T2CA 1XXHB 2Q4DA 3AR3A 4G0MA 1YCHA 4UHCA 5GM2A 1V5GA 2QD5A 3DC2A 5CXXA 1CUBA 4D9MA 3BF8A 4ZYWA 3LT0A 5B64A 3T41A 4F46A 2YMPA 2QYOA 2LE0A 4W5HA 4W9RA 4YV7A 3A0RB 4R84A 1X1RA 1I2MA 2EJCA 2Y1KA 2NVUA 4A5SA 2BHTA 2EKBA 2HFJA 4TL8A 3H2IA 1V8DA 3F6BX 4EI7A 4ZOEA 1UWCA 3DP7A 5EP4A 4DB4A 2IH4A 1FDVA 5KMGB 3Q3IA 4I55F 5F73A 4C01A 4DS3A 1W2HA 1A5SB 1N2ZA 4YDSA 5LLSA 3LTEA 3DTVD 1BHSA 3KFVA 2Y27A 4Q21A 1T8UA 1IHPA 2WMDA 1V2GA 3HLTA 3CB4A 4TRRA 2IY7A 521PA 1KAOA 1N3LA 2OXIA 4E3WA 2Y6UA 2QN3A 1D2CA 4X0EA 1KWKA 3GMIA 4I36A 1RE0A 1VB5A 1E3LA 2C2MA 2X9LA 3EPPA 4RGBA 1QIDA 3LDAA 2R97A 1ADFA 2HMWA 4IXWA 4MWCA 3N87A 3N2GB 4OHXA 5AMXA 4AFNA 2WIAA 4CEHB 4YREA 4NH0A 3RRFA 8ATCA 4FZRA 1JEEA 3NOXA 5LZ4A 2C7PA 1TZBA 1WHSB 1YCGA 2ZJAA 5CGQB 1V25A 1Z0FA 4E31A 1ZINA 4E1AA 5L8VA 1YFJA 1MRZA 5DCLA 1I7QB 2QN8A 1SHJA 4OFBA 1E20A 1U28A 1WY7A 5IEBA 4A6PA 2I4MA 3A4VA 3VHXA 1NMYA 4HTFB 4QHSA 1DAHA 3EZXA 3SOPA 2WFLA 3RABA 2BTQB 1U0GA 1JDPA 2JAXA 4OXRA 1GAQA 1ANKA 3R4CA 5HEKA 1BHQ1 2P6PA 2YV4A 3WB2A 2JZNA 1NURA 3FFXA 5CJJA 1QPBA 5A0FA 2FWBA 3R5KA 1IXYA 4YVFA 4NYIQ 5LDGA 2AHRA 1UPFA 3WK5A 5DH9A 3KRTA 4M1EA 4TMZA 4REQA 3NHUA 2CXOA 3AVWA 4KFUA 4UM7A 1L3BA 2X9VA 2CLOB 1MAWA 2YJZA 2ZSUA 4NFSA 1CC1S 4PX5A 1PG0A 3I58A 5E9AA 3ZH2A 1DEKA 3OEYA 5BYKA 5JHGB 3ZCTA 3HXQA 1M2VB 1AB6A 4OU4A 1Q0LA 3BGSA 1I01A 4A5OA 3BE5A 4YCJA 2FWJA 2K87A 3EQ8A 1P2VA 1NN0A 3I73A 3EWAA 4XFDA 1HF3A 3O92A 2WJYA 2PKEA 1A98A 3M6IA 4OVKA 2XDQA 3DEHA 3NIDB 5DGDA 5DVZA 5HDQA 1NBMA 3ZGLA 4BZPA 2DE0X 3H99A 1VG8A 1BOOA 2R6HA 3IUQA 5D5QA 3UJBA 4CLDA 1TJPB 5EG5A 4R7GA 3NAMA 3WJAA 1ST3A 2BGRA 2I76A 3IT3A 4F8YA 1H4QA 4IVPA 1PZFA 5B2EA 1TZMA 2JANA 1GQOA 3F5FA 3ZDCA 3BHMA 2XNDD 2OUIA 1PX2A 1T26A 4QT0A 3DBHB 2G5TA 1SD1A 3O83A 2QL7A 2NO6A 2DXIA 3SU8A 2WLSA 3B7PA 4BFUA 4F92B 5CTJA 3A9WA 3WJ2A 2OBFA 4QUGA 1YK0A 2G4LA 3BYZA 2FSSA 4EOGA 5LQMA 1Y6JA 4ZVVA 5DT2A 4BNTA 4CQJA 4JVLA 5AOAA 2LTAA 3FSEA 3A6FA 3AG6A 4L27A 3SXPA 1JTFA 3UB2A 3FWNA 2AJDA 1KK0A 3OX4A 3NRBA 4KFRA 3D3JA 3INRA 2C4UA 3EN0A 3H0KA 3H6KA 4DN6A 4V02A 1QLHA 3K8YA 4J29A 1VZ2A 2BDTA 1F6BA 1N78A 5EHZA 1ODLA 1MTZA 1JKJB 1K6EA 1WP4A 1K9VF 1Z4PX 4ERNA 3INTA 4DSOA 4P3KA 5KNDH 1UOQA 4KX3A 1DCTA 5IBQA 1H9CA 4ZTZB 1G7SA 4BEVA 3LT1A 4A91A 3CUTA 1EFRA 3OUUA 3QVTA 4Z4HA 1VE9A 4B81A 4CKCA 2JLYA 1ORWA 4IIVA 1P9LA 4BFZA 3L02A 3A1FA 1XTRA 3MBKA 4CMIB 2IYYA 1EVJA 3ZI7A 1S3FA 1JIKA 1H2ZA 3IMEA 3GLHB 1H6BA 2G08A 1T9GS 5BORA 4NZZA 2QV7A 1Q3TA 2XNJA 4WIAA 1J0EA 1RWPA 3EZ7A 3G2OA 3WNVA 3IAEA 4CM9A 2G4VA 3W8DA 5EKXA 1I4OA 4AY6A 4FILA 2DEUA 2BUAA 4XIJA 2ORIA 1LLFA 2RH5A 2Z5GA 3V97A 5IX8A 4WESB 5F1OA 2EQ5A 4BLUA 4EF5A 5CB4F 1T4DA 4YB8A 4G8CA 4I55B 4HQLA 3ANXA 3IULA 1QUFA 5B36A 3F6EX 2FQQA 4AZTA 3IUJA 1XU7A 3Q15C 4R9RA 2J5KA 4GKVA 1OHHA 1KF0A 2FFBA 2IYQA 2Q1TA 3KWFA 5D3MA 1LDNA 1GKYA 2CB0A 1MNQA 4AG6A 1GYPA 5JSHA 3TFOA 1KY4A 1Y6FA 2HHJA 1TCVA 2OHFA 3CX8A 4IFBA 4J49A 3M9WA 4X6YA 4LC9A 4B40A 2R62A 4E13A 4RPIA 2CFRA 5K8IA 4RD1A 2OORC 5HGJA 2X58A 2Z1DA 5HBRA 3EF0A 1OMOA 1JQJC 3LHFA 1AKUA 3KQYA 4LYGA 4C5CA 4F04A 2C84A 4C3ZA 1SCJA 5E2BA 4AKHA 1F1JA 3ETEA 4C4YA 2O8DA 2WIDA 1UEJA 3DKVA 3TLGA 3AUUA 2Q7DA 3V4VB 4G6ZA 1M6WA 4ISBA 1AZLA 4URFA 4ER0A 1PK7A 3BGDA 3E6AA 1NMXA 3U3ZA 3ADBA 1EP2B 4CGYA 3E0XA 4ML3A 3UJDA 3AYXB 1EIZA 4BRUA 2AI3A 3B1FA 1L5GB 5AHXA 3OFJA 5D5PA 3J7AC 5ITWA 1SZCA 4NE7A 4QSMA 3EBPA 3Q8KA 2UUCB 4RXMA 1M66A 3RUIA 1SZJG 2WV7A 5BYJA 2AN5A 5LZ2A 3C7CB 5TB5A 4QM6A 3K15A 1K4MA 1E6KA 2X8LA 3AW8A 3IKVA 3AHDA 2VHEA 1GADO 2IZ7A 3D6HA 3KQTA 5G0SA 3VV2A 1G8YA 3K1YA 2XA1A 4QGSA 4X85A 4P31A 3K5HA 2WFMA 2YIMA 4QBGB 3C43A 3QX7A 3JYNA 1RHMA 2X4GA 3G17A 3V3TA 1PJCA 2FOLA 2IYPA 2XVAA 1GSAA 3R3ZA 4NBVA 1O08A 5ALVA 3G2LA 3EVCA 2YYAA 3IAUA 4OP3A 2YV2A 4Y6PA 3I72A 1LFDB 4D0LB 5IAEA 1NATA 4ZPXA 3N5CA 1C3XA 1H4VB 3ZIAD 3LM8A 4R0VA 2YIVX 3B6EA 3F4KA 4RFLA 2V4ZA 3BXEA 3L46A 5DBEX 3OEWA 4P36A 4RV9A 5I4IA 1CVLA 1MC5A 2FHPA 2J6HA 3HKEA 2PLRA 3KZKA 2RGNC 5AKLA 3FJOA 3N75A 4F5DA 1NBHA 3DVAA 2V6BA 2CSUA 1ULHA 2HJRA 1DPFA 4LFCB 1PBNA 1H2BA 2HQBA 2Z9CA 1AKEA 3N70A 3SBXA 3GJQA 3UGKA 3VPHA 1SU7A 5GAJA 3LXUX 3P2IA 3PQFA 4GMHA 1UMKA 1M7HA 4HRYA 5BNTA 5JZOA 1RZRD 2PUEA 2B5VA 1ZVKA 3CKLA 1VIVA 1EDOA 2ZS7A 3L40A 5JYBA 1D1PA 1E5TA 2LCQA 5L6MB 5ENDA 2VDUE 3QMPA 3RVKA 1V9LA 3N58A 1I2ZA 5H3CA 2KWIA 5REQA 1ZOOA 3USCS 3GLSA 4BHTA 5I7VA 4BBPA 2PD3A 3K1JA 2GBFA 3FN4A 3SMQA 3BCRA 2V7QD 4W7IA 2GKSA 1OQAA 3MEQA 3JATB 2C2HA 1E2DA 1AH2A 2H8GA 4TGLA 2R5WA 3DL0A 1N3YA 3V8BA 5B58C 5I3CA 4OM7A 2FZKA 5FEUA 4Q1DA 2ZB4A 1OUMA 4JR1A 2ODQA 3JQRA 1BAPA 5JNRA 2ZI7A 4PY2A 2VZ9A 4QEDA 3KCQA 2H7CA 5B37A 1Z6ZA 4U9IS 3JWEA 1W47A 3MJDA 3TLGB 1JH8A 4QU0A 4LSZA 4ZRMA 4B4OA 1B8UA 2PX4A 5A9RA 3EC2A 3IEVA 5K51A 3GVHA 3DNMA 3DLPX 4U7JA 2ZBFA 3AKCA 2IZ5A 5TGZA 4X20B 4D26A 5G02A 5JCOA 4D5EA 1LBEA 1XCGB 2WA2A 3FGNA 4S3MA 2OD7A 1PJSA 2FMHA 4RCZA 2P9JA 5AI5A 1OTHA 2IHNA 5HDBB 4MXDA 1LDGA 2QW0X 3K71B 2HHHB 3BIWA 5CA1B 4K46A 3E2PA 2EX0A 2WOOA 5HBGA 1HYQA 4ZZ0A 1CWUA 1GGJA 4OEHA 3C3EA 3DOFA 2BFBB 3K32A 1RYZA 1KPGA 5ES3A 3CF4G 3ZHOA 2VHUA 3VA7A 2NOAA 3QWHA 1ZSNA 2GK7A 3E9EA 5KOYA 2FSFA 1JSRA 1FP2A 3HS3A 1YJCA 1ZIDA 1D2AA 3GUZA 1X7WA 4LRUA 2TMDA 3PXCX 2RAFA 5I9TA 3T9EA 1T2DA 2A0YA 5KX5A 3A04A 4NV0A 4CEIB 2Q8NA 1K2WA 1CJKC 4P22A 3THYB 5DTEA 4YRKA 4CCYA 3N86A 5DWVA 3EIQA 3CMCO 4H0FA 4NCJA 5JY1A 2C2GA 1KEEA 2W2PA 5LQKA 1T4GA 2B4YA 4QA9A 4WCVA 4YACA 2GWHA 3CHYA 3GLFE 1DX4A 2QK4A 3QMVA 4R51A 3A26A 4GZ6A 3IRUA 4CM3A 4EEZA 1ZBQA 3K9FC 5HIJA 5CB6A 2WWYA 3GDGA 3PXAA 2ZYRA 3X44A 2DPLA 5FBQB 5M29A 1AKWA 1XRJA 3TNDA 1GKLA 1NNI1 2D5IA 2QL6A 5JBNA 5EP2A 3BFVA 3LK7A 1TJNA 3G0GA 3WBFA 1WPXA 3SHWA 2V3CC 3F96A 3RHFA 3CZMA 2BSQA 4QEZA 5K2MA 1U98A 1G0OA 2W4QA 3PQ6A 1ACJA 3IDSA 3KFXA 4G0QA 4GHWA 4B3TB 3JQGA 1W1UA 4FX2A 2DG2A 1WW3A 1J2JA 2R8YA 3GGCA 3P9YA 2GPTA 4RCVA 4Z8YA 1JALA 2W6ID 1K6XA 3V42A 5IBCA 1DELA 3D6MA 3VTKA 2PGAA 2UAGA 5ES4B 2QX4A 4O02B 3S40A 4DXDA 3L1IA 2XWBF 1RYMA 1TL7C 1CQWA 2RK6A 2PZFA 2ZXEA 3DM5A 3GFSA 1RJEA 2P9YA 3G79A 4X90A 3PI7A 4K26A 4OQXA 4RQUA 4PZDA 1E3JA 3CKKA 4NOMA 5KSZA 1K0UA 3S68A 3LL7A 5EWMA 2I2CA 3MIIA 2PBZA 3G5TA 2AZ4A 4LHXA 5KQGA 2PWZA 4NK5A 3W2IA 4UFOA 3BJMA 3NVMB 3QLJA 2EHDA 3HA5A 5JO0A 4JMPA 1EINA 3B89A 3WYNA 2AFIA 4G5RA 3B7GA 2R6AA 3KLBA 5IASA 2OZPA 2YMLA 3OFND 3PPYA 4M0EA 4MLCA 1E1KA 5JRDS 1L5ZA 3QKSA 1UJ4A 2H2DA 1XYGA 1E59A 3IIKA 4NZOA 4E7PA 1W4LA 4UUMA 1IIRA 1DU4A 2XCTB 4F4CA 1CCWA 3ORFA 2Q2WA 2QYTA 1XIVA 5FO0A 3WQRA 4MV6A 3H9EO 3DEJA 2BGWA 4ZO9A 3D02A 4HVCA 2CVQA 4QUKA 1XZEA 3B7WA 4EX6A 2MYTA 3H8WA 1GA1A 3OG9A 3ZCRA 5IDXA 1P45A 2RONA 3IDAA 5IC5A 2UZ4A 1ZO8A 3PUJA 1JAIA 3KZCA 3VDMA 3GRUA 3WGJA 5CVEA 4LQDA 4NVRA 3FMVA 2GO7A 3EZGA 2X4DA 1BX3A 3NB0A 2OZVA 2Q1XA 3H19A 2DWCA 4MRPA 5C8VA 2NNLD 2W6OA 5L3SB 2CFCA 3L7YA 1D2GA 1TRHA 1UBEA 2IYUA 3PI6A 3FOZA 5BSUA 4CMAA 1AKVA 2BLNA 3KAPA 4IFEA 4L72A 2GCIA 1YNSA 4TPKA 1WUTA 4LSGA 5KC8A 3GNTA 4MQLA 4MYRA 2VF2A 2ENUA 4R2XA 2VDNB 4CQLA 5J2UF 2HTEA 4LW8A 3N6RA 1YSCA 3GFBA 4YR9A 1FNNA 4QJIA 1BXGA 3D64A 1AKTA 4IZOA 4HMOA 5D00A 4PPQA 1U7PA 3IKMB 1VRVA 2XVYA 5AUNB 2R8ZA 4CQMA 1JU4A 3EZLA 1I36A 2I6FA 2LWIA 3AY0A 4X44A 1OZHA 5FWAA 1KAGA 1U6IA 1C4KA 1XRRA 3FKQA 1E9DA 3G2PA 4Q9NA 1HE8B 2XRZA 4P4LA 2JKYA 4G0NA 4DLNA 3ZLTA 1BJRE 2IUSA 3T1NA 4C20A 5E0OA 3DG9A 3G6KA 3RIMA 4WZAE 1D2HA 2C96A 3GDOA 3H9GA 3R76A 4QFBA 3HVRA 1U3UA 4Z7JA 4M88A 1U1DA 4K3VA 3TLAA 1FXSA 3GJ8A 3HJCA 2DSTA 3IVXA 3PFGA 4ARZB 4B09A 1H3FA 3D4IA 4O2AF 4PZ0A 3VR4H 3T1HB 1HG0A 3FVVA 3O5AA 5AQ1A 1OOEA 2W6MA 3FUWA 3UJNA 2NP7A 4D9CA 1YQEA 5F5NA 4CUKA 3I05A 4PSDA 4S1TA 1VCIA 3HWX1 4CQNA 1NT4A 2QKYA 2JGKA 3D6NB 2XUFA 3JYLA 4KXLA 4W8HA 4ZODA 4C7BA 3HBJA 4HUQB 4I9FA 2F8SA 5CK4A 2ZETA 1MO6A 4GM0A 5JH7B 1KFBB 1N7JA 3A4IA 4KK3A 4N41A 1V2HE 2FUG1 3C3PA 1RKXA 4LA4A 1UPTA 1MOZA 4X95A 5TPWA 4LDNA 3QEBZ 3JYQA 2KI5A 3EGCA 1PK8A 1P3Y1 4L8WB 3A1EA 1FUKA 4F9TA 5DW0A 3Q7TA 4V0NA 2ZIXB 1PX0A 4RMGA 2XD9A 1E3DA 4PO1A 4ZCTA 4D81A 5I4KA 2NQ2C 3LK6A 4KXYA 1NP6A 2O8BA 4UVEA 4R71A 1KHHA 2A9KA 4R6WA 5DWDA 1KKLA 3Q9LA 5CCXA 1VMAA 4HJXA 4XQGA 3WJ7A 1IBLB 1AF7A 1A04A 1QFSA 1ZEMA 3CURA 4YI3A 1CHNA 3KYJB 3J80A 2IH5A 2ZE5A 1GG8A 2GRUA 2Q62A 3L6UA 1CY7A 3U7QB 5TIIA 1E2QA 2VEOA 3KB2A 1DKPA 5KDDA 1UP7A 4ALJA 5JI3E 1YHNA 2DVMA 1YL7A 2B92A 3E1GA 3U0VA 4QGGA 4ZEVA 1U1EA 2NXEA 4M6WB 5JAUA 3J81A 2V0NA 4LF9B 2WUEA 1YR3A 2QTVB 5JROA 1I7SB 3ISTA 2EFHB 1G3MA 4J0QA 2R1TB 4Z0HO 2IOHA 3FWKA 3LP8A 4NE9A 1L9KA 5TXGA 1W44A 2DGDA 4CHTA 4FEAA 1ZD4A 4DLTA 1FTNA 1G9SA 2DR0A 2YXDA 4EUHA 2GARA 4P7KA 4L4SA 5GV7A 1HX7A 4IG9A 3CEPB 1QCZA 4XIYA 3TRJA 2YC2C 1UXHA 4O4IF 3AUSA 1A2BA 1LPSA 3FVTA 3RS0A 3I52A 4JLSA 2VP6A 4MW2A 1IPEA 5I7WA 2XKJE 3VV3A 3PC8C 3ZPXA 1XC7A 3IOBA 1NW9B 3K4HA 1RQ2A 1CJTC 1SJ9A 1TM7E 4AUMA 4FFVA 4UFPA 1QRUA 3A4LA 3TYXA 3FJYA 3IOEA 1FPMA 4AYXA 4YT2A 4BLQA 2SCUA 2NU9B 4ZV4A 3F6YA 1JXMA 4BATA 2XBMA 4LE2A 4YRNA 4TMTA 1RRCA 2F3TA 1M33A 2V7QA 2REXB 2ZWMA 1G4AE 1XKQA 4CM4A 2B83A 5F7ZA 4K9MA 3CLHA 1F4PA 4MQFB 5EPEA 1D9ZA 4HSGA 1C30A 3T1TA 3BXZA 3NM4A 4OYLA 1VLVA 4Q7KA 1G6HA 1HDOA 1USGA 4MKHA 4U63A 3ZDZB 2F1IA 3WWDA 3CW8X 3EFOA 1WUYA 3LW7A 3WLFA 2DETA 4UMDA 2J67A 4N5DA 5AM1A 2FZ4A 3RGWS 2X2OA 2PL1A 5H4HA 4HNUA 5DXFA 1TZ2A 2XT9A 1Y4AE 2MMCA 2VRNA 5JAPA 5AIAA 2QVBA 4PO3X 3RH0A 3UQZA 4EHIA 4E15A 2Q27A 2JLWA 4DIOA 1XP5A 5BR7A 1L7NA 3EJ6A 4MV9A 3BIFA 3STTA 5C5DA 3L0PA 5HHTA 2O2YA 2ZXUA 4JU8A 1EXWA 4J0EA 1CF4A 3I4LA 3EPRA 4MQBA 1D07A 4E21A 3B3JA 1KZ6A 5JJCA 4Q4AA 1NVVR 4TWRA 2OILA 1YJ8A 3M1AA 4K6OA 4YCDA 3FYCA 2DQZA 1EWKA 4LF5B 1RAGA 1B6GA 4PQRA 1JEJA 4Z9YA 4X24A 2XMGA 5KJ1A 1J2YA 2AR0A 3K6JA 3A1DA 3C5EA 1PYDA 2CHUA 3LF1A 3OCWA 4KN6A 1Y5LA 2B4AA 4HKTA 1P1RA 4Z9BA 1AGYA 2FKAA 1ODKA 2PSEA 2P3QA 5LOVA 1ZKMA 1XDUA 2X19A 3DHNA 3FZEA 3ISVA 1RYEA 4TLDA 3QPUA 4IV5A 2DP4E 3W1VA 2P78A 4I1OA 3GVIA 4CN8A 1PHPA 2PVCA 2HRQA 1QPGA 3K31A 2YY7A 1UXOA 3FZQA 1ZU5A 4HRAA 5L6LB 3U4AA 1M8JA 1PZMA 3EEIA 1F2VA 2YN0A 1XZGA 2JG3A 1M83A 1SKUA 1TQHA 3MCWA 3DKPA 1PLLA 3LUGA 3W6PA 5KVSA 3NBKA 3R40A 1EM8A 1H6AA 2NX2A 3KT0A 1NI4A 1ZK2A 3BK7A 3CF0A 2NADA 3OPYB 4GU5A 4UXHA 4C4RA 5CFQA 3WNQA 1SU8A 3DGFC 1SIUA 5JQWA 1OX4B 5LQJA 2GZ1A 3O74A 1TVKB 3D5EA 3RAPR 4D0GA 1WHSA 3EBLA 1CUWA 1DDOA 4LJRA 4ZAWA 3S99A 1S9DA 2QY6A 3AVTA 3TNFA 4UM9D 1HEYA 5C9ZA 3DQPA 2ZWVA 3NP9A 4LV8B 2CVFA 4MH0R 4E5VA 3LX6A 4Z6KA 4RWEA 3PPWA 4R8MA 5AQEA 4DAOA 1LGYA 4BO7A 3DT6A 2Y2VA 2JHPA 1LX6A 1XTSA 3T7CA 5JQGB 5AD1A 3V8EA 6ADHA 1NLYA 2CL0X 1O5IA 2PX8A 4MR9B 4U6SA 4XCXA 3UG7A 5C7IO 1BHO1 2JS7A 1K3TA 4RK6A 3CLUD 1TAHA 1UODA 1FS4A 4JI4B 3OLWA 4CM4B 1F14A 1YC5A 4NYJQ 5AKZA 4N18A 3TJRA 4DM3A 3OTOB 3RW9A 3S1AB 1Y1KE 1DTWA 2XYVA 4PONA 1WM1A 1OZ0A 3ENNA 4KFTA 4X8MA 3QV1A 1J39A 4PAGA 1WRBA 1QHGA 4AF7A 1GA6A 1TK3A 3VZCA 1OFUX 3M6MD 4KCGA 2ZRKA 5ECGC 1CPYA 2BDUA 1RS0A 5AI9A 4LF8B 1RXUA 2DQYA 4QNRA 4MYUA 3O03A 4ID3A 3MTDA 2GM5A 2MU1A 2W4MA 2PUHA 4F6LA 3WKEA 3U81A 4RM3A 3BWBA 4RMJA 2QP3A 3OMXA 4KDCA 4GKAA 2YZGA 3I4FA 2BEVA 2PR2A 3OIVA 2GYUA 4UZSA 5CNKA 3I5AA 2CXUA 1NHGA 4JP8A 1T36B 2D5AA 4KN9S 3KWLA 1G98A 5DXAA 2AG6A 4ZT4A 2YFHA 3UGTA 4TVOA 1PW5A 1ECPA 3OAAD 2O2GA 3KBBA 1JKXA 1IEXA 2OXFA 4WL0A 5AESA 4QYIA 1PWZA 1Q44A 3PC7A 4I4TB 3D31A 2WRZA 2H59A 1NJFA 2LV8A 5JMTA 4ESVA 1B0PA 1YQWA 1B26A 3NEAA 5LQAA 5DCYA 5E6RA 1N2CE 3IJRA 4WK0B 1Z4JA 3KFLA 5G4KA 4EB6A 5MFZA 2OCXA 3F1KA 2FJPA 1W0JA 2XUGA 1WDLA 1OC4A 3R7SA 1XJ5A 2O3TA 1T2VA 1NG1A 2DWOA 3COVA 5HCNA 3ZY3A 1H5QA 3WQBA 2UKDA 5C4IA 4U2BA 2I34A 4YY3B 4YAJA 3FSGA 4K9LA 2YS7A 1GGHA 4XQ0A 3ZQKA 2GAJA 4DM4A 3GELA 4Q1VA 2JNWA 1Q0RA 2A88A 2OGUA 4AK9A 2WOJA 2GHIA 1NVDA 1Q7CA 1KOJA 2W6PA 2WHPB 3W0LB 1AF4A 1TZCA 2D3TA 4WNIA 4L51A 5FR2A 4HB0A 3U13A 3ZVRA 1WTCA 1RWVA 4NENA 2IUEA 2CUTA 5P8WA 5CB8A 2ZRGA 4QTYA 4JYCA 5JH7A 4NI5A 4LF4B 1ZM2A 3RUEA 4UUAA 2J9YB 4BFYA 2Y4OA 3N6XA 4CQMD 4CT0A 5HKKD 4NONA 1RDFA 2VXCA 3X1YA 1U2ZA 4PO8A 3U3OA 3WGUA 4MS1A 9LDBA 3RC3A 4JJIA 1OW3B 2QZJA 3QF7A 4OYHA 1Z0AA 4DCNA 2XCUA 4GPBA 5D84A 1U8XX 3TTUA 2Z95A 1JAZA 4ZAYA 3S7TA 3ZCPA 5JUWA 3VHLB 1HT2E 1MORA 4B8ZA 1WXFA 3HACA 3MTAA 3PVZA 2OC9A 4MV1A 4FNGA 3V9AA 3D7KA 2WUVA 2J4FA 1IMOA 2Q0HA 3C3XA 3STUA 1WF3A 3BJRA 5E7QA 2O8EA 1T13A 4FW9A 3RBZA 1GGKA 2Y99A 4OP2A 5LPNA 4BO5A 5EJ6A 1O77A 2GEKA 2J46A 1A8PA 2W93A 3A7DA 2CLLB 3H1GA 3NIGB 4D8YA 2OAQ1 1E7MA 2B94A 3AW9A 5K3SA 2C97A 1OFUA 1IXSB 5DJ5A 3L92A 2VTBB 3PX2A 1ACLA 3AHCA 5BV0A 3U1VA 3DULA 2JGFA 2FA9A 2DBZA 4X66B 3TW0A 2QRQA 3KHSA 3GUVA 4HYTA 1Q0PA 3IJ5A 1EHYA 2ZLBA 2WWFA 1L5LA 3UATA 2EYUA 3CUYA 2WQ6A 4HCJA 4YT4A 2VJPA 3H3FA 4IO1A 4JS0A 1MENA 4H6XA 5FLEX 1QIMA 4ZRNA 1A9PA 1X8KA 3VKHA 1TU3A 4TS1A 1TRKA 1QNFA 1XLVA 3ASYA 2XAUA 5J58A 1H2WA 2ZU0C 1DAFA 1X13A 2R6FA 2VXYA 3D8SA 2BW0A 2OQVA 1JG3A 1OVGA 2VTVA 4MS4A 3SK0A 5J4LA 4XXHA 3HDVA 3B9BA 4B8WA 5B2ZA 3HY4A 3BA1A 3R7WA 3WGMA 2FSIA 5J2UA 4JT4A 2ZPTX 1GQSA 1MQSA 1VXRA 2XY4A 3ONEA 2DFDA 1RXWA 2X4LA 3MYRA 4FYMA 3FKJA 5IT5A 4ND4A 2VCEA 3UFBA 5EHXA 2C4TA 3EXAA 5A9SA 2GBCA 1PKEA 3E22A 5CCEA 5ICCA 2B1QA 3W2GA 5AM2A 4LJKA 2G71A 4XOIA 4B8YA 2XTNA 2PYDA 2PH1A 3FHOA 3GLRA 4TV8A 4O0MA 3DVSX 1VSQA 1Z2PX 5SYNA 4CG2A 2PGOA 2LVBA 1W8DA 2C9BA 3K72B 5CVJA 3WV4A 3MELA 4IH4A 5AP9A 1S01A 1G8SA 4HJRA 5ERXA 2QLBA 4NF2A 4Q66C 4R1UA 2QL5A 4DG8A 4J90A 2OQRA 3HLKA 3EPKA 4BLOA 3NI2A 4EYSA 1K08A 4N7MA 3BZBA 2QSJA 3FCUB 3TQQA 1M8KA 4EENA 3SZ3A 3D3NA 1WLSA 2NO0A 4R1OA 4LJ5A 1SOAA 1D7OA 5AJVB 2FUNB 3KCNA 3QQPA 4WGFA 5F12A 3CLKA 5BRAA 1IC6A 3MGCA 3EAGA 1E1QD 2FN3A 1LW7A 3AP2A 3NBAA 4JGIA 5PNTA 3ZC3A 2EP8A 2QUIA 1RC0A 3W5HA 3WMWA 4BAZA 3RNOA 1RFLA 1ONNA 3QFRA 1YMUA 5DTJA 2WJ3A 1K7CA 2R47A 2PS0A 3BIJA 2JFFA 1T2FA 4M53A 1EFPA 4P3NA 5EE1A 1V5WA 2C9CA 5AXCA 5TS3A 1M6VA 1RAIA 1PR6A 1W85B 4IOLA 1EJ6A 1ZQ9A 2XLBA 2GI4A 3ENQA 1PW7A 1QFYA 2X3FA 5BQPA 4ZJPA 1K06A 3QV2A 4QSHA 1NTOA 3C6KA 1EMDA 4MZDA 1ITZA 3E22B 4YAIA 1LLUA 4WY2A 3ONDA 3T0IA 5L53A 1U8AA 2ECOA 5AFSA 3TGPA 3L0IB 2A9QA 4NIMA 2WHYA 4Q3DA 3PX7A 2AK2A 3FIJA 3P94A 5ALZA 1H2AS 1UPUA 2YXPX 2ZJ4A 3DAFA 3L4EA 5EHGA 1FRVA 4WNAB 4OTZA 2WF9A 1EKXA 1JLKA 1SC4A 1PEYA 2BH9A 3FPKA 4BNWA 4UNSA 2PG3A 3AC0A 4NOLA 3MJRA 3MM4A 3P5SA 3VKUA 3ZE2B 1K89A 5F3WB 4RHTA 2IGBA 1D8TA 2IZ0A 4XDGA 5GGYA 4CBVA 3W34A 4F5EA 4RTNA 2NZ8A 4MVJP 1L6RA 1PUXA 4JKOA 4HX9A 1MD9A 4DA7A 2DB3A 2ERXA 2FTKE 3LGXA 3VH4A 2OKCA 1OJLA 1URPA 2A0FA 5DLPA 3KR1A 1VDZA 1XVLA 2Z57A 3RRZA 3D3QA 2OHVA 4EG1A 3GLFB 1SBIA 4ARCA 4RU1A 2OCGA 1F2DA 4GBMA 1AN0A 5IXJA 3GD7A 4FP9A 4FOLA 4PBSA 1VYUA 3KUCA 3O91A 4HDRB 4MHOA 2C77A 1DO8A 3RTCA 4JXZA 1GZVA 2A5LA 2FZCA 4HH0A 4DLZA 1GA4A 2EZ9A 3JYOA 3DA8A 4LZJA 1X7ZB 1Y3DE 4MQ4A 5G0UA 4C0AC 1SBHA 4KZPA 3C3WA 4PNEA 1FNDA 3ITKA 5EKTA 5KAPA 3WL7A 5JXGA 5PGMA 5AVVA 5BV1A 5CDTA 5KYXB 5LQSA 3ZWPA 1E2JA 1TJ5A 4IFTA 1MHTA 4DDHA 3MTJA 2I87A 4HX2A 4ZALA 5JPCA 4UATA 2YWEA 1TECE 3X2EA 2Z5VA 3BA6A 1Z6QA 2KB0A 2HH9A 3QKIA 1PNQA 5F7XA 3OQBA 1EESA 3UUEA 2AI2A 4MOWA 1E61A 3HGQA 1YVPA 2C00A 4QDKA 1CF2O 1PWHA 4G37A 3V9PA 3OZTA 1QRAA 4DQXA 2PUJA 5AM4A 1E62A 1XEXB 5SICE 4LYEA 2IOFK 2G1AA 2B3TA 3AF5A 3KYBA 3O4GA 2FMFA 4HWTA 2GBIA 2JIOA 3M83A 4HFJA 4WI1A 5IM4A 1Z4KA 3IQZA 1EFLA 5FAXA 2PZGA 3TTWA 4QPCA 3MT9A 1XTJA 4J1SA 2PU7A 5CHYA 3RQIA 3UKOA 4MW7A 3DTVB 4C22A 3GZ4A 4R98A 5J4VA 3KAKA 4EKIA 2OPHA 1WW8A 4YAEA 5AYVA 2HCBA 3BCSA 4CFSA 5JASA 1EAMA 1GLGA 2OL4A 4XUDA 2Y67A 1O7JA 4IIFA 3DLAA 1R0CA 2VXOA 3R3HA 4UZFA 2IXAA 3RSZA 2XVMA 1DP4A 3K09C 4RQTA 3MJ4A 1YIDA 3O21A 5EP3A 5ALEA 3UYKA 4HQFA 2B99A 2Q8QA 1ZI8A 3EVAA 4M1WA 4X97A 5K0TA 2C78A 2XXJA 1W581 1X8XA 4F2WA 2I2AA 1U0TA 4EJSB 3OE7A 1STOA 2AJTA 1YQQA 5TT1A 2DU8A 4WA7A 2VK2A 5ALPA 2DLCX 4MQ5A 4EPTA 1THMA 2HJVA 3CEMA 2PNJA 4ZDJA 4HYQA 1AHIA 2IV3A 2FFHA 1BQ3A 4KNWA 4JQYA 3HH8A 2WD7A 2QBYB 1XD2A 1ENPA 1GP2A 1KEZA 2BHRA 3K0FB 4JQOA 4L4RA 4R41A 3T4UA 4Y9UA 3VR4D 1PEKE 3NBZC 1FNCA 1YA4A 3K8OE 2R5NA 3OC0A 4DKXA 5ALKA 2G8LA 3FLEA 4J7XA 2CMDA 2GZRA 1VJTA 5JMOA 3JSAA 5BV8A 4L15A 1HO3A 3F3MA 3DFUA 2UZIR 4HATA 4HAWA 2E37A 4CKYA 3EXEA 4RA6A 2ZUVA 5I9NA 1W46A 1IK4A 2C3YA 1HDYA 2VPWA 4JUIA 4EVIA 2Y76A 2VNJA 2R65A 3GA7A 3UXEA 2ZBVA 5H16A 1DAGA 1HDXA 2OV6A 3MQFA 5IK2A 5CBPB 2JIMA 2X8JB 4MUEA 5KYWA 2WPNA 1BHJA 1W88B 3G8BA 4ITRC 2C29D 4MWGA 3EGOA 1IBRA 1XNJA 5JAZA 4DCOA 2VAXA 4M1TA 3MRTA 4IS3A 1ID1A 3FTEA 3KKLA 1C9YA 1UFRA 3RBVA 4QT4A 4WZAB 3G5UA 2IS4A 4E1VA 3V8NA 2ZATA 1OA0A 2ID4A 3VO8A 1XVUA 3RRYA 1JFSA 3UTDA 4QDXA 3HYNA 4G5QA 5H3HA 5AVXA 1J97A 1M8FA 2YWFA 3PITA 2J3JA 3RVSA 421PA 1MRSA 2QRKA 3IELA 4J3JA 3AEQB 3TZBA 1EX9A 3F5SA 2VZ0A 1WNFA 4EIWA 4LOIA 1ZLYA 2CMFA 5L3VA 2BFCB 2G82A 4M7WA 3VR0A 4D3YA 1Y1QA 2GJKA 1N2SA 4R69A 2GF2A 2YJ5A 4NEGA 5DMHA 1T6BY 4OUKX 4C14A 4RF2A 5JD5A 2CVHA 4ME6A 3V1MA 4ZXFA 4QO8A 1AG9A 3BFPA 3P0JA 1PZNA 2BBTA 2GEDA 3IIEA 3K35A 2PKCA 3MJCA 4D8WA 5HP4A 4Q1FA 3PVCA 1Z8NA 3RFFA 2VJDA 5AVUA 4LHWA 1IN4A 3PPVA 1EFKA 1WZNA 2D1TA 2PV7A 3DDOA 3L1UA 3ITDA 3R3VA 5T6MA 2E1RA 1E5VA 5B4TA 2ZBUA 1RABA 2LCFA 3L8YA 2GZ2A 2W7TA 3AVUA 4DABA 3GFQA 3PDIA 3CWQA 2XBLA 3RYCB 3SDZA 5L7WA 1R9GA 3FNIA 3FGZA 2QUAA 3D1LA 1TGYA 3D2AA 1Q15A 4Q16A 2HSJA 1EK5A 2V5UA 1U7DA 1ZMBA 3QXSA 4M1QA 3OZFA 3HJFA 2BMDA 2AJCA 3GVPA 4LXGA 4XSVA 1O6BA 3RUCA 1CJSA 1XKLA 3I9V1 4LFBB 3JARA 4R3WA 2FPPA 3CF2A 4ADSG 1W4RA 3PDUA 1O03A 4BNDB 5JVDB 4H31A 3FFBA 3TVDA 3GLUA 3Q85A 2OXCA 5JS2A 5FB3A 4Z0NA 4WESA 2GKOA 1B8PA 3GK3A 4YH1A 1X39A 4NYMQ 4UHDA 5CVCA 3OHPA 4OAQA 2C8JA 2ZBRA 3FB4A 5F4BA 3WOVA 2CWDA 1NRIA 3LCRA 4D42A 1NBMD 1SCKA 1G3UA 3FUXA 5TV2A 1WG8A 3G5AA 4PF1A 3NWPA 5L40A 4LISA 4B32A 5FOUA 2F64A 2P1DA 4JH0A 1WZEA 5CB0A 3NU1A 2P4QA 4G2NA 3WFJA 1CY6A 3QVLA 3EEOA 1R0YA 2IVFA 4OLAA 1JEOA 2X0JA 2EF0A 3JAKA 5AW3A 3K4QA 3ZQUA 2BOVA 3FMIA 1YDHA 1MQAA 3NW9A 3LNCA 1B6TA 2J3HA 2Z9BA 2BGUA 3FNQA 3PUZA 4KMRA 4CR8A 1RPJA 4M1MA 2RHWA 2HQ1A 2HWKA 1XQ9A 1OYOA 2FQYA 3D4NA 3EHEA 1ZXLA 1O9BA 4FMCB 4KAAA 4U5QA 4KLNA 3M6AA 4UD6A 5CM9C 2ZP1A 1G8AA 4EG7A 4HYYA 2FEOA 4QPZA 3EMKA 7REQA 4CE6A 4X8HA 1QORA 2NPIA 1SHZA 4GP7A 4NCNA 3QWFA 3PEUA 3DMFA 4OBXA 1IAVA 1WV0A 5ALNA 2C2WA 3R3WA 5DLEA 2QTLA 2WJGA 2O2JA 4TX1A 1SOVA 1V4VA 3MBIA 4RDXA 3GXOA 4RTJA 3CY6A 4Q9LA 4DSNA 5GJCA 4QOFA 3GZNB 3ZU5A 4DNPA 3MT8A 2Y1EA 3QH4A 4DWWA 5CG1A 2QLNA 3K0HA 1KL7A 2R44A 4O3FA 2HR1A 5IABA 2WTNA 4MR9A 4TKZA 5JISA 3A2KA 3L9XA 3P52A 1E4OA 2C7BA 3QVUA 5LZ5A 1QB8A 1C9MA 4BB6A 5J4KA 4KDFA 3DBHA 1RMYA 4ZZ1A 3NHSA 4C78A 3A6HA 3RROA 3VISA 1UKAA 4E2ZA 3FDJA 5TPZD 2EDCA 3ZDFA 2GZ3A 3BEDA 1RKQA 4O4LF 5IZ4A 4AKGA 3KLMX 2FEAA 1O95A 3CF6R 5U4QA 4OHZA 1E0KA 2P5UA 5GIPE 1QGZA 3BG5A 3IPAA 3W5VA 4CF7A 3B5EA 1Y6GA 3U62A 5A3RA 4BO8A 3V1LA 3K1AA 2BR4A 1E1LA 1XQYA 1GPMA 2XMSA 5EL0A 5AR1A 3WISA 1JLRA 2IITA 2R7KA 1IWOA 2UV8A 2HPHA 4HPXB 4R8RA 2I80A 1SHTX 4UMEA 5BYBA 5BSVA 4EJSC 3Q9SA 1X9GA 4OMCA 2X8AA 5A4KA 1NBAA 4IDEA 3ANNA 1R0XA 2ZBQA 4FOOA 1T0JB 5CIWA 3ZZ0A 2AFHE 3FMOB 3TTSA 1S3IA 3BRQA 3KSDO 3OLYA 1T1EA 4JU9A 3LBIA 1T43A 3HDQA 1ORHA 1ETHA 3BK1A 1DJQA 3VMFA 2ZE6A 3G2MA 3IQDB 3Q0EA 4PSVA 3EVDA 4LDAA 1G3QA 2ISCA 2FZ5A 4R2HA 4RL4A 3PK0A 1YS1X 2BKEA 4YMSA 2DBYA 3ZWDA 2H4ZA 3QQ5A 1GQRA 1TLLA 2FZEA 4KO3S 2R1VA 4FGLA 1I7LA 1NR5A 4JC0A 2F59A 3SJAA 1M0EA 2CJYA 3BXPA 3H9QA 3KKZA 5ICFA 1YV9A 1E7YA 1EPUA 5FWYB 5FBRB 3F6CA 5KWSA 5H59A 3LUAA 3PHIA 3Q6IA 1HL7A 3OHSX 3P9CA 1M6EX 1Q3KA 2XB6A 1SUCA 4ZO6A 4ZAFA 5F21A 1B23P 1GSIA 2FPGA 4QPDA 3VSEA 3JS5A 4P3XA 4HRXA 2VYFA 2V3WA 3G88A 3I28A 5KS2A 4IMRA 3UJCA 5LQNA 3LQRA 2B1RA 3WX0A 1EZZA 1FRZA 1VL2A 3LE8A 1GUDA 4J9VA 4AJ1A 2R751 4CU2A 1J0DA 5EINA 1H1LB 1I3CA 3S2ZA 3WI7A 4BUCA 2DYKA 3I9KA 3WK7A 3TF5A 1KH1A 3JQBA 3GLGB 1DC4A 4NAVA 1NJSA 2WT8A 1QZ3A 3BOSA 4KOAA 5KJCA 1U2RA 5KYTA 2ODNA 3F7MA 4YNBA 4ATNA 4BQNA 1KAMA 1HNZB 1FBNA 3N0TA 4R1SA 2GA8A 1G2OA 5FCDA 3AI2A 2M98A 5JATA 2H2FA 1U0HC 2X2PA 5EMNA 4NNJA 3CEAA 2BFEA 3AF0A 4XARA 2HJWA 2OAP1 2YXNA 4HO1X 4Y98A 4K9NA 3G0CA 3W4KA 3TD2A 1TXGA 3CJRA 4D6PA 4ZI2A 9GPBA 4GT1A 3VU9A 3QNMA 5HPYB 3SG0A 2ROQA 1EFUA 1LTQA 1XAHA 3K7EA 2Q21A 3E8SA 1YASA 1GG2A 4LOJA 2BMEA 4JFAA 4MKRA 5CFPA 4WKCA 4OKIA 4RF3A 4K9KA 1GCAA 2V98A 2Q9UA 3ZIAA 3DDHA 2A2ZA 2Z9DA 3QBEA 2LGJA 1ULTA 5DLDA 4DXHA 2V7WA 1CUSA 3CZPA 2I71A 4G0PA 2B1GA 1R10A 3I8OA 4HDCA 4Q7QA 1XXHE 3K1AB 3S0JA 3T1VA 1X74A 1JRLA 3GPDG 3QFCA 4CGZA 3UF0A 3O1HB 2C2BA 2B35A 1ADGA 2H92A 1JT2A 4OK5A 3UMBA 2C98A 4BVGA 4EGCB 1MB0A 3E7PA 4EI9A 2ZJ0A 2QHXA 1VPTA 3MCUA 3V8RA 4AUKA 5KOIA 4ARIA 3PD0A 3IO5A 2ZANA 4HYEA 3GNLA 1XQ1A 4OKSA 1OIVA 1R9MA 2IX3A 5IJAA 4EB0A 3HM2A 4LKRA 2I3DA 1NKTA 2OGWA 4IOMA 4P6VF 5LUBA 4C4TA 1B16A 4ZK2A 4OUDA 1TB4A 1Z5NA 3ZHTA 4E30A 3O47A 2R7LA 2B7CA 4KXVA 4RPHA 1IXRC 4DWOA