3FLBA

Rifr - type ii thioesterase from rifamycin nrps/pks biosynthetic pathway - form 2
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
245
structure length
245
Chain Sequence
EAEKWLRRFERAPDARARLVCLPHAGGSASFFFPLAKALAPAVEVLAVQYPGRQDRRHEPPVDSIGGLTNRLLEVLRPFGDRPLALFGHAMGAIIGYELALRMPEAGLPAPVHLFASGRRAPSRYRDDDVRGASDERLVAELRKLGGSDAAMLADPELLAMVLPAIRSDYRAVETYRHEPGRRVDCPVTVFTGDHDPRVSVGEARAWEEHTTGPADLRVLPGGHFFLVDQAAPMIATMTEKLAGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RifR
publication title Structure and Functional Analysis of RifR, the Type II Thioesterase from the Rifamycin Biosynthetic Pathway.
pubmed doi rcsb
source organism Amycolatopsis mediterranei
molecule tags Hydrolase
total genus 89
structure length 245
sequence length 245
ec nomenclature ec 3.1.2.-:
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3flbA00
4N5IX 1CUGA 4B9AA 1UK6A 5AHXA 3AZPA 4KE6A 1K6EA 4DYHA 4OB7A 5AJHA 1D07A 4CG1A 2XMBA 3PE6A 2OQIA 2XUJA 3G0IA 2GBCA 5D3KA 2BJHA 1VLQA 1TKRA 3QMWA 2VSQA 3I6MA 5AK3A 1HKHA 5A7FA 4TGLA 5JZBA 1XQWA 3KSRA 3V1NA 1QO7A 1MNQA 2XUAA 3VJMA 3X3HA 4P08A 2PX6A 5ALPA 4INZA 4H77A 2ZVDA 2NW6A 5LLSA 2O7VA 4X94A 3TEJA 5ALZA 5JASA 1IVYA 2WFZA 1Y7IA 2RONA 4H7HA 5AKIA 1CUUA 5JYCA 1MAHA 5CT4A 2WFLA 1AC5A 1KU0A 2WIKA 2XUHA 2FUKA 1UOOA 1UK9A 3N0TA 1N1MA 3R3ZA 4CIAA 1QO9A 4KEAA 4LYDA 5EIEA 1QIGA 1QFSA 4L72A 4OUKX 4A23A 4U2EA 2ACEA 5D7BA 3IBTA 1KU6A 2IIVA 3A2MA 5JADA 1GXSA 4B84A 4I19A 2OCIA 2HDWA 5K3AA 4Y2XA 3F8SA 3MUNA 2Y2VA 5A2GA 5CT8A 1QIMA 1CUAA 1R4ZA 5FP0A 4F5ZA 4JNCA 1MX1A 2BUAA 4A5SA 1EVQA 1QIIA 3B12A 2Z8ZA 3H1AA 3HZOA 3E1GA 2JGEA 2WG2A 4LHEA 2Z3WA 4DSAA 5IKXA 3HEAA 2ECFA 2BCEA 4BC1A 1GPLA 2XQFA 1ZICA 3VXKA 1AGYA 3QPCA 3FOBA 2HA5A 3G8YA 1ZGCA 4PO3X 3A6ZA 5LKRA 1DX4A 1EINA 2OCGA 4BE9A 3GFFA 2CJPA 5ALLA 5C81A 1EB9A 3BDVA 5ALJA 4K6KA 5D6OA 1XRRA 5T4HA 5HQ3A 4Q34A 3ZLUA 3HYSA 1AQLA 4BRSA 4EHBA 2WHQA 1S8OA 2J3QA 2UZ0A 1IUOA 2WM2A 5ALFA 3LLCA 3R3WA 4WCVA 4KACA 5LZ8A 1XROA 2VA9A 3WZMA 1E8DA 2PM8A 1JT2A 4BRZA 2G63A 4PNZA 1SFRA 3B3QA 2QXUA 1MX9A 3A2NA 5LP1A 4WFJA 1JU3A 1JJFA 5DLPA 1VJ5A 2CBGA 4G9GA 3G0GA 4K2AA 5E4TA 1CVLA 2R11A 1XZMA 2C7BA 3ESAA 4MEBA 3FLAA 1CUZA 1JFRA 3G0CA 3ZPXA 3PF9A 2Z3ZA 4L0CA 2XLCA 3C45A 5ALIA 4U2GA 3QMMA 5IH7A 1XRPA 2RIPA 3QITA 3O4JA 4E46A 4CFSA 4IH9A 1E3QA 4RGYA 5K3CA 3IB3A 4EB0A 4TPKA 1BS9A 5CH5A 1CV2A 1L7QA 5I7UA 3I2FA 1EDDA 3STXA 4B81A 4UUQA 5BOVA 1E8MA 2VF2A 3HLKA 4E11A 2OG1A 3WK4A 1KEZA 4XIIA 1XZAA 1MT3A 1H2WA 2X5XA 1QIDA 4U2DA 1WB6A 2QM0A 4J7AA 4ETWA 2VJDA 4J0GA 4G8CA 1UKAA 3WMRA 3KDAA 3K6KA 4HZGA 3DL7A 3E3AA 5AOBA 3WKCA 5E2IA 4BCDA 4GW3A 5E4YA 5K3DA 1G5FA 4ZV7A 2XUPA 3AIOA 5ALNA 5K5EA 1DT3A 5DTJA 3W9BA 4BYMA 4WJLA 4Z49A 1GT6A 1GKLA 1X2EA 2FX5A 2QMQA 3WWOA 2CB9A 1OXMA 3PUHA 2DHCA 2V97A 4LXGA 1YSCA 2Y1KA 3V48A 3D4LA 3C6BA 4BVKA 4OSEA 2I78A 3F98A 3NGMA 4IH4A 1BE0A 4YX9A 2DCMA 2R8BA 1FFDA 1EHYA 4EY4A 4FNMA 5ALTA 2JGKA 5FXMA 1GQRA 4J0KA 2JGJA 2VAVA 3IUJA 1P0MA 1XLUA 1VZ3A 2XMSA 3AILA 3OG9A 2PSJA 5D3ZA 4UFPA 2ORYA 2DHEA 3P2MA 5EGNA 4EY6A 2WTNA 1G42A 3FCXA 4Q1VA 3ZWQA 2WJ4A 4UBNA 3ZLTA 3AIMA 5HKAA 4AXBA 2QTBA 4OPMA 2WUGA 3FLBA 4KRYA 3HABA 4PF1A 3MUOA 5AM4A 3K2IA 3F67A 3VVMA 2WJ3A 3HI4A 4K6GA 3B5EA 4V2IA 5CMLA 4J0IA 4QDTA 3DYIA 3H2JA 3GA7A 4LXHA 1LZLA 2XMRA 3K9BA 1JMKC 1B41A 1K4YA 3M81A 2VTVA 2D5LA 2X76A 3R0VA 4UHDA 4UBKA 4Y2QA 2QKYA 2V96A 1QZ3A 4UBOA 4X93A 4ZRDA 4RE6A 2AJDA 1ZI8A 1K8QA 3U1TA 1E5TA 2JGMA 2ZYSA 4OYYA 3BF7A 1XZGA 5AP9A 2YXPX 4B82A 3G9TA 4IHAA 1BEEA 1P0IA 4A16A 4QDUA 3DYVA 3DJYA 3WQHA 5CT5A 5LZ2A 1E8NA 3PI6A 1DQYA 1SC9A 4YK7A 2Y6VA 2H7YA 1PFQA 4HXFB 3TJMA 2XQIA 3O9VA 2Z8XA 1Z68A 1C7IA 5AKYA 4DSZA 4QZVA 4PSDA 4BDSA 4F21A 1H22A 3HACA 4J0CA 2PUJA 3O95A 1CUXA 2HU5A 2OPHA 3V1LA 1YA8A 2ZJFA 3W05A 4QDXA 2AJ8A 3WI7A 2HADA 5JANA 1UKBA 2XMQA 2VJCA 4JUIA 1BCSA 1XZIA 4IH1A 4HXEB 4UBLA 4CCYB 1XQVA 2GZSA 4Y2JA 3PICA 4GECA 3QM1A 1WHSA 2C5FA 2JGLA 4QEKA 3S2ZA 1XZEA 4U2FA 1GGVA 2QOEA 2XDWA 4LKOA 3Q8WA 2B20A 4M0FA 3M82A 5HK8A 4UHEA 2W6CX 5JIBA 2WU3A 1R3DA 2C0QA 2WHPA 1GKKA 2H9YA 3I2IA 1XZBA 1MAAA 2XI4A 2OGTA 2VT6A 3R3YA 5CRIA 5ALMA 5JAPA 1HQDA 1T2NA 1JJBA 1O6FA 4C88A 4ROTA 4BC0A 4H7DA 3GROA 5DNUA 4AZ0A 2WFMA 4XVCA 4QDZA 1U4NA 1XZDA 5FPQA 2XB6A 5HCUA 1R88A 4AQDA 3DDUA 2GYUA 1EDBA 2RHWA 3JYHA 1XKTA 2BAGA 1PJAA 4XJVA 5HF9A 1QIHA 5EHZA 3QH4A 1YS1X 4AO6A 4DNQA 5AK6A 3I6ZA 4GHWA 3IIIA 4B80A 2PKYX 3UMJA 4FHZA 2XQKA 4EBBA 4JH0A 1FFCA 3G9ZA 3WL5A 3FVTA 2PSEA 3G0BA 1CEXA 5T4EA 1THTA 2WG1A 4ITVA 3STTA 2BGNA 1ZGBA 2QZPA 2LIPA 3WWEA 1YASA 1A7UA 4G8BA 2GBFA 1TCCA 4C4ZA 1XRMA 4N8DA 3DNMA 3C6YA 2Y6UA 3IUNA 3KXPA 1YS2X 4KYVA 2AJCA 3WK8A 4UFNA 1SCQA 3IVMA 4QWWA 4JEIA 3EIOA 1B6GA 2YASA 4ZXFA 2HU8A 5AOCA 1H2ZA 1A8UA 4EA6A 1LNSA 5AM5A 3G0DA 1R9NA 5IVHA 4FBMA 4Y9SA 4X97A 4H35A 4IO0A 3WKEA 1X70A 1UK7A 3FBWA 4MWTA 2HA3A 4H7JA 3V1KA 2QJRA 1CIJA 3HXKA 3D0KA 3F9CA 3JW8A 3C6ZA 4C89A 5AI4A 2XUQA 1H2XA 1H23A 3GUUA 3DCNA 5A6VA 2OQVA 5EHNA 4X90A 1CUJA 3OOSA 1ZI9A 3F96A 5ALRA 5K3FB 5C8XA 5IVKA 2PVSA 4QE3A 4C4XA 1DWOA 1RYYA 3HJUA 4CG2A 2XUOA 4HRXA 5AM3A 3H2HA 1ZD3A 4Y2SA 2ONCA 4KR0A 3WLAA 5T4BA 3MVEA 1IMJA 5AOAA 2Y2UA 3FYUC 3DQZA 1XRQA 4O08A 3H2KA 2OGZA 4KAJA 4HAIA 4ZI5A 3WK6A 4M0MA 1LBTA 1N5RA 4NS4A 1AZWA 3NOXA 2PUHA 1ORVA 3SC2A 1PV1A 1UOPA 3BIWA 3I2JA 3R3VA 4FLMA 1HPLA 5CH8A 4EY8A 5CXUA 5ALGA 3KWFA 5JATA 1GPNA 1FJ2A 1TRHA 4MEAA 1P0QA 1HDEA 2OLEA 5FLKA 4FBLA 1F6WA 1NU8A 3LP5A 1R9MA 2JEZA 1THGA 5JAUA 1UOQA 4UHFA 4UFOA 3JWEA 3R3UA 3A70A 1USWA 2IX9A 2RI6A 4PSUA 4CCWA 7YASA 3IURA 4MQLA 3T4UA 3VKFA 1TQHA 3WK9A 1WOMA 1GQSA 2G4LA 2VT7A 5C8VA 1CUBA 5C7YA 1QONA 3ICVA 3R40A 3I1YA 3WYNA 4DM7A 3BE8A 1EDEA 4WFKA 2PPLA 4RNCA 3I2GA 4MXDA 2VEOA 3PF8A 3PFCA 5AI5A 4KAFA 2AXEA 3WIOA 4MQMA 2C4HA 2QUBA 3N2ZB 3WKAA 1CUIA 1WM1A 3CN9A 1XLVA 5ALVA 4OB6A 3ICWA 2PSFA 3O4IA 2XLBA 5BV7A 2QJWA 1AUOA 2XUDA 2QS9A 4HVTA 1Q83A 3W04A 1UT6A 4OYLA 4AZ3A 2DHDA 5E4JA 2XQJA 1EB8A 5ALYA 5DYTA 3A2LA 1E89A 3O4GA 3AFIA 5ALQA 5AIAA 1OILA 1N8SA 4HS9A 3WJ2A 1TK3A 2ES4A 3WK7A 2QT9A 1JU4A 1LBSA 3WYDA 3QYJA 1BCRA 1H2YA 3WZLA 1CLEA 2WFLB 5HKBA 1AX9A 1IUPA 3O0DA 4MWSA 4AO8A 3FSGA 4QDOA 2I3ZA 1MJ5A 4Y2VA 1UWCA 3C70A 2WIDA 1LPAB 2JIDA 5AM2A 1DWPA 3DOHA 1MPXA 1NX9A 4XWGA 1JKMA 4QNNA 2GZRA 1DQZA 4KRXA 2O7RA 5HF6A 1W75A 2XMCA 6YASA 2CZQA 3HSSA 1FFEA 3DL4A 4NVRA 4EZIA 3R3XA 2HA7A 1A8SA 1DU4A 3NWOA 2I3DA 2HA2A 2D0DA 5CT6A 3FWHA 1QIFA 1WHTA 1VA4A 2HA0A 3I6YA 1U65A 2PL5A 1U2EA 1CR6A 3VDXA 1DT5A 4Y2PA 1RWQA 5KREA 1K63A 4WY8A 3STVA 4I3FA 1ACJA 3FNBA 2RAUA 3GELA 1ODTC 2WIGA 1OCEA 1QTRA 2HFKA 3ESCA 5ESRA 1EVEA 3EQ8A 2WIFA 4FFVA 4H18A 3WL8A 3BL8A 5JD5A 5AM0A 3EF3A 1CQZA 2C5GA 1DX6A 2HA4A 3HRHA 3AINA 5ALDA 1EA5A 3IDAA 5A7HA 3QPAA 2DQYA 3FSGD 3OTQA 4OB8A 5LZ9A 4EY7A 4N5HX 5HQ3B 3AZQA 4I4CA 3V9AA 4LIPD 1XZJA 1WB5A 4G4GA 1DTEA 2QRUA 4DNFA 5T4FA 4AX4A 5AI6A 3EBLA 5EHXA 5AKLA 1XKLA 1WPXA 1TAHA 4G9EA 4IQ4A 3FYTA 3FLEA 4GWLA 1G4HA 1RP1A 2RGUA 2BUCA 2XMZA 5JAOA 4HXGA 1TIBA 5DJ5A 4J0JA 2GYWA 5AK5A 3FYUB 5HF5A 1CUYA 1MX5A 5AM1A 3WA6A 4AMYA 5BWCA 1NU6A 3S8YA 5AKEA 4BZWA 2VQ6A 4ARAA 3EQ7A 3M3DA 3IUMA 4OD0A 3O9MA 2OXEA 4FLEA 3WJ1A 2G5PA 3DKRA 1Q0RA 3O4HA 1YCDA 4C87A 2VJBA 3H2IA 4ARBA 4N8SA 4X6XA 3BJMA 3H0CA 5DTIA 3RARA 4BCBA 5FDFA 1MNAA 3CN7A 5AKHA 4BCCA 3L1JA 5K3FA 5LZ5A 2ZYRA 3WL6A 3G7NA 1QJ4A 4GDMA 4K6HA 3AJAA 3ZI7A 5DYWA 4KE9A 2K2QB 4C01A 3D59A 4PQEA 5ALXA 4W1PA 2VJAA 2WILA 3D2BA 2FJPA 2O2HA 5CH3A 4BBZA 3C8HA 3C8DA 1ODSA 1ZD2P 2GBGA 2P8SA 1U8EA 1L7RA 3RKSA 4B7ZA 4GLBA 1CUWA 1CUSA 4B0OA 4HRYA 5HK9A 3H1BA 4P93A 1MN6A 2HFJA 2HA6A 2QR5A 5AH0A 4Q3KA 2H7XA 4N8EA 4BZZA 4H7EA 3QZUA 1UZAA 3PFBA 1EX9A 5ALUA 5A62A 2HL6A 4MYSA 3WWCA 3KWJA 5JAHA 4KE8A 4G8DA 1ZD4A 2QXTA 1A8QA 3OM8A 1VOTA 1UFOA 1AKNA 3ANTA 4UHCA 1J2EA 1T4MA 4AMZA 2XUGA 4AB1A 1EI9A 3C5WP 4TVKA 5AIBA 2JF0A 4FOLA 5AKXA 5I8PA 3BWXA 4X6UA 4Q3LA 5YASA 4ZREA 4UBJA 3RLIA 1QIEA 3VJKA 2XUIA 3C5VA 3BXPA 4FDMA 5ALOA 3GBSA 1CUVA 1XQXA 3IA2A 3H19A 4Y2RA 2WG0A 1G66A 4E15A 1BROA 1ZD5A 2V9ZA 2WJ6A 4OCZA 3I2KA 4PW0A 4U2BA 5J3JA 1HLGA 2ZSIA 5HZGA 3DS8A 4FMPA 5IVIA 4B6GA 1CUEA 1QTIA 1WCYA 4C6HA 4KE7A 1BN6A 2XMGA 3D2CA 2XUKA 2ROQA 1AURA 4F0JA 5EHQA 5LZ7A 5ALSA 1SCKA 4UPDA 5FPPA 4G4IA 4FFWA 2PSDA 2ZSHA 2O2IA 2GYVA 1Y7HA 5AKGA 5KWJA 4E14A 5EIAA 4DNPA 4D9JA 1VE6A 2WTMA 2ZYHA 2WUEA 3VVLA 1VE7A 4G5XA 3QMVA 2G5TA 1MU0A 1ZIXA 3FVRA 3T52A 2EEPA 3BF8A 5AKZA 5ALWA 4HTAA 1SCIA 4FLFA 2HRQA 4DTCA 3RK4A 5FKJA 4CG3A 1YA4A 5EFZA 4AO7A 1HL7A 1BEZA 3E4DA 3ILSA 3WKBA 3AIKA 1VKHA 2ZJ7A 1FFBA 4J0HA 5BWBA 2CKMA 3BDIA 4L9AA 2FJ0A 3C87A 4Y2YA 1FSSA 3DOIA 3RM3A 5CBKA 2V98A 4P92A 5HF8A 4U2CA 2ACKA 5JALA 1R50A 4W1SA 3VISA 3LIPA 3D2AA 5CW2A 1ODCA 2O2GA 2Z5GA 2HU7A 4X7BA 1VZ2A 5EI5A 3WWDA 5ALEA 3D5EA 4BP9A 3STUA 3OURA 3R41A 5JARA 3QPDA 3OC0A 1JMYA 3TGLA 3KOOA 2PU5A 3WL7A 3MGAA 1Q84A 2XE4A 4GBGA 2WHPB 4QWMA 2DFPA 5DWDA 4Y2UA 2QUAA 2OGSA 5I9IA 5JD6A 3V1MA 1LPPA 3H04A 5JD4A 4FWBA 2DQZA 1F0PA 1QGED 2WHRA 4OU5A 2ZYIA 3G9UA 4BTLA 4DMFA 4B0PA 3ED1A 1W6RA 1QE3A 1K5PA 4EY5A 4P9NA 2OAEA 1LLFA 4BAGA 1ETHA 3WIBA 1EK2A 4PSCA 3E0XA 3ZV7A 1LPOA 3AUKA 2HIHA 2H1IA 1JJIA 3EQ9A 1LPBB 4WDQA 2JBWA 4X00A 4B9EA 1ORWA 2ZJ6A 1CPYA 1QLWA 4WDRA 1CQWA 1YB6A 1N5MA 1LGYA 3WA7A 3DD5A 1UK8A 4UHBA 4Y2TA 4LXIA 5AI8A 1IUNA 4MYDA 3STWA 1LPMA 4BDTA 3G02A 2BUBA 3CCBA 3TRDA 3LIIA 3BJRA 3FYUA 1P0PA 5LKAA 1QFMA 5FV4A 5IVDA 4X91A 5AK4A 2EDCA 5AICA 1UXOA 5DYYA 4FNGA 1EH5A 5EIHA 3UUEA 4W63A 2WIJA 2OCLA 1DINA 4GXNA 1LPSA 1IZ7A 1CFJA 5A71A 3BIXA 5AI0A 2BGRA 2GBIA 3FAKA 2H7CA 4ZGBA 5SYMA 3W9UA 1TCAA 2EDAA 2WQZA 4YASA 4H7IA 2YH2A 1EXWA 4GEGA 2B9VA 4W1QA 1IZ8A 5F4ZA 4ZWNA 5K3EA 3F97A 4DLNA 1YAHA 2JEYA 2WUDA 3I2HA 3OPMA 1BRTA 2PSHA 3VJLA 1LPNA 3I28A 5DNVA 5KBYA 5JZ9A 2BFNA 4CCYA 3H18A 1W52X 2DR0A 1WPRA 1ZIYA 1J1IA 2VAXA 4LYEA 1FFAA 1Y37A 4DGQA 2BKLA 5C8ZA 4QLOA 4BE4A 4ZV9A 1CUHA 2PU7A 4F60A 1MTZA 4KAAA 1UKCA 4B83A 2JGIA 1VA5A 3ESDA 4JYMA 4DMKA 2E3JA 1QIKA 2VATA 3IUQA 1XZCA 2B61A 3GZJA 3H17A 4X95A 4G1FA 4X85A 2XQGA 4CI9A 1JI3A 4JYPA 2WUFA 5HFAA 4NZZA 5ALHA 1F8UA 4H7FA 2XT0A 2XUFA 4EUSA 4X71A 2RHTA 1YAJA 3H2GA 3W2TA 4YPVA 1EK1A 5FRDA 2IITA 5LYYA 1L7AA 3LS2A 5LZ4A 4Q05A 1XQYA 4L3WA 4UHHA 1DWQA 4X92A 3L1IA 4BVLA 5SYNA 5LIPA 1YB7A 4DIUA 4GI1A 1XRLA 2PBLA 3ANSA 1XZLA 5CTAA 2WKWA 1J06A 3IULA 1WB4A 3CXUA 2CUTA 4QLAA 1VXRA 3YASA 2J4FA 1E66A 1ISPA 1TCBA 4J0DA 3KD2A 4WFIA 1ZJ4A 5K3BA 5HFNA 4WY5A 4CIBA 3WKDA 1W76A 3QBJA 2CEKA 2WU4A 4KJXA 4G4JA 2C58A 5FOQA 1VXOA 2CMFA 2OAGA 3G9XA 4W9RA 1XFDA 1ZOIA 2XMDA 3FCYA 4NMWA 4M0EA 2I03A 1QIJA 1XZFA 5ALKA 3QVMA 2J4CA 4BTVA 4B85A 2Q0XA 4Q3OA 4BP8A 1XZKA 3DEAA 4DNOA 3C43A 1W1IA 2DSNA 4BAZA 1CRLA 4MJ3A 5KWIA 3M83A 4OU4A 2C0PA 4H7KA 2HHAA 4PV7A 4AN0A 1C4XA 5AKJA 4QA9A 3DLTA 3U0VA 5CT9A 1ZJ5A 4S0XA 1J07A 5FUMA 1XLWA 5ISMA 4UBMA 1CUFA 3HC7A 5CURA 3C6XA 5A7GA 5DNWA 1Q0ZA 5H3HA 4DMHA 4J3JA 2X8BA 1HBJA 1GPKA 1ACLA 2HM7A 5AI9A 5AKKA 2OCKA 3L1HA 4RE5A 3D7RA 4W1RA 1YR2A 4BVJA 2YYSA 1ZI6A 4K5QA 4Q82A 3NUZA 1R1DA 3DKKA 1C7JA 3W06A 3PUIA 3I1IA 1QOZA 1O6GA 3SX4A 1I6WA 2AJLI 4BAUA 2B4KA 4H0CA 5JZSA 1CUDA 1GZ7A 3WWPA 4C4YA 5CXXA 4UBIA 1AMNA 1F0NA 1M33A 1X2BA 1XZHA 1W4LA 1LZKA 4AN1A 4X3CA 3CCCA 3SK0A 2QVBA 2J3DA 2W22A 3Q0TA 3PDCA 4RPCA 1MO2A 4XX1A 3ZLVA 2WLSA 3LCRA 1BN7A 4BB0A 2JGFA 1CUCA 1XRNA 3AZOA 2AJBA 1SOMA 2HRRA 4BATA 1A88A 4J03A 3WK5A 4DMCA 4X6YA 3STYA 5AO9A 3SWWA 1BU8A 4Y7DA 4FTWA 3D3NA 2WSLA 4FKBA 3UUFA 3ESBA
chains in the Genus database with same CATH superfamily
1M2VB 3HP7A 4N5IX 4AJ1A 1UK6A 1JLSA 2LIVA 1JDSA 4Y6GB 4XWKA 1JS1X 2XF2A 5AWFC 2NZWA 6CHYA 3NYRA 1K6EA 4EABA 4DYHA 1YDHA 2I2CA 4V3BA 4I66A 4NDNE 5CVEA 4Z4QA 1DJOA 1T6XA 4OFZA 3PE6A 1OROA 2ODBA 2OQIA 2DB3A 2XUJA 1UAYA 4KQ1A 3OJLA 4PLHA 2QD1A 3V8NA 1KBOA 3N86A 3NHBA 1L5QA 2IH5A 1FS6A 3JQBC 2IEGA 3GQBA 4ESOA 2F8LA 5HEKA 2BJHA 3CH4B 1FVOA 2ECOA 2ZVPX 3JWGA 3TD6A 4A9AA 4X8OA 2NUTA 3I6MA 3V7FA 5D87A 1PK8A 3ZI0A 4C3UA 3W2FA 4QQ8A 4F2PA 3JWJA 2O4UX 4L5YA 4LWOA 5DHUA 4L76A 5A7FA 5FH9A 4WGGA 2Y3IA 2JIZA 3KSRA 4NAHA 2F9LA 2PH3A 3B6MA 2O0HA 1T2EA 1DXOA 1XYGA 1GNRA 1XMSA 2Y1EA 3TJZA 3AR2A 1Z22A 2QRVB 4NX2A 5CHYA 3CNBA 1C0EA 1EXNA 2Y9PB 2I6QA 2FH5B 3OMWA 4INZA 4P2BA 1LWOA 3G79A 1O5OA 1GZ6A 3HVIA 3RKUA 3S70A 1DBPA 3PPIA 1EVKA 3M0EA 3V2HA 2G7ZA 3LYHA 2JS7A 4ZT6A 1JVBA 3F9RA 1ST2A 1U0RA 3PT9A 4XSHA 2FKAA 2DWPA 4CYMA 3RUFA 5CB8A 5KQRA 4YC7A 4FB4A 3K70C 2G8NA 3BA6A 4MQ4A 4YP7A 4UTVA 3HY6A 1Y7IA 5J63A 1FA9A 2GK6A 4Y67A 5IDQA 2Y8EA 4DHWA 5JYCA 2C82A 3N8NA 4OFXA 5CT4A 3E5MA 4B09A 3U80A 1ZC3A 2VR1A 2ZITA 3DNPA 4RKYA 3WNDA 3ZQUA 1AB5A 4HWTA 4RD6A 4RHYA 2HD4A 4RSGA 3G1UA 3WDSA 4LNUB 2QP4A 3DHNA 1VJCA 3V2IA 2ZVJA 4FZ3A 4ALIA 2IHVA 4TL6A 1F7UA 1N5IA 2R47A 2Q8NA 1FP1D 1KAMA 1U2GA 1BJRE 5JJ5A 3B1KA 4KXLA 5MGNA 3BX1A 4MUIA 3BICA 3HBLA 2GTPA 4JUCA 2PUBA 1D6SA 3F6CA 2RCNA 4L5BA 5JDCA 1E9VA 4GKAA 5ANRB 5SZJA 4MIEA 2CXQA 1F6DA 2WVHA 2O1XA 4PX2A 1ZH0A 4M8KA 3DVSX 3PUXA 1J5PA 5FWYB 4N9WA 5T8KA 3A2MA 1AG9A 4ZQEA 1D4OA 1PGQA 1UFVA 1DC8A 1YZ3A 2AQHA 4X84A 1MJGA 5CVVA 4BQOA 5C8DA 2QD5A 5JADA 1Y8RB 4RKQA 4B84A 1HE8B 1E69A 3HVHA 1PR0A 1XX6A 4INOA 1BYUA 1TA4A 3BTUA 2HDWA 3G8BA 4G5GA 4XIGS 5K3AA 1V9LA 1QH0A 4Y2XA 3OX2A 3ICQB 3CZ4A 3H6GA 1MXFA 3HV2A 3ZC3A 4CR7A 2R6GA 3F8SA 4NZ9A 1IM2A 1PFVA 2WYOA 3GIWA 3QPBA 2GB4A 3LFHA 5IBCA 1JE0A 3ZJYA 2IXBA 1OBOA 3G5MA 5DI3B 5L3RA 1L5SA 3OESA 4EMUA 3K6SB 5FNZA 1Y1RA 4Q47A 1AXGA 5TMPA 4ZI7F 1MX1A 2FLWA 2JIZD 1V8PA 1TJPB 1EVQA 3BHNA 5GZ1A 1P2SA 3WRWA 5B6IA 5A0VA 1IOZA 1E0KA 1L4GA 1SURA 3H1AA 3GT7A 3LI2A 5HR5A 5TQ2B 3HCFA 2A0FA 3WDMA 4F3KA 2B30A 2ZI6A 4R2MA 3MMNA 2WG2A 3D3WB 4N54A 4UDOA 5FFFA 2RD2A 1TTPB 3W2GA 1Q0PA 4ZA2A 1QB7A 1GPLA 2BGTA 2JCBA 3CBQA 3VXKA 3GUYA 4IJ5A 3ND7A 4WFQA 3HA2A 3FNRA 3OA2A 2HA5A 3LL4A 1MPTA 5JHHB 6ABPA 1G8HA 1FUIA 3AEQB 1A5BB 4HCJA 2JFHA 4QU0A 5B3JC 1DRUA 1IHYA 3BXZA 4RHFA 1E1LA 2XOXA 2CZCA 4L0QA 1NNLA 4JJ6A 4P7JA 1Q77A 3GFFA 3WLMA 2A86A 2E1PA 2FCRA 4ISCA 4J4TA 3AOGA 3AWDA 5JI3E 2QNBA 3LXXA 5EEGA 1EB9A 1JZTA 4DXAA 3DH0A 2JLSA 2Q3CA 3G23A 2B7LA 5ALJA 1XTSA 2XZPA 3WHPA 2ZRAA 5I8WA 1QG4A 2DUJA 1XRRA 1F38A 3KS9A 5T4HA 3G8AA 2YDXA 3RYFA 4IICA 2YC4C 4PZCA 4Q34A 2M1XA 1U8XX 4RL6A 4BX2A 4RDXA 3CVOA 2NX2A 2HREA 1NG9A 4YBRA 1M8GA 3SPXA 1H0RA 4ONEA 3WYAA 4LNAA 2WHQA 2QTTA 3TECE 2ECKA 4MA0A 3D31A 4JLMA 4KXWA 4F86A 5TQ0B 4M1TA 1UP6A 3PNLA 1IUOA 1YFZA 1NI4B 1Z88A 2W2OA 2YWXA 3OSZA 3SFTA 1AO0A 3HCNA 5ALFA 4RSHA 3SVTA 1RWVA 5GADl 1CF2O 2AFHA 2DWCA 3N6RA 2RJNA 2D00A 3TL3A 1PWHA 3SHQA 4V0RA 3DFKA 4OP1A 3V1TC 4WJZA 1GU7A 4O2AA 1QGZA 4BNKA 3SQWA 3AJEA 3R5XA 1O9GA 5J1SB 3THYB 1CJCA 2PM8A 1A5ZA 1AKRA 3UT5B 2BV3A 3TZQA 5AW0A 2R8EA 4N3AA 1SFRA 1HG1A 3B3QA 2G5GX 3EFHA 5CP8A 3WYEA 5DYIA 1DARA 3ADKA 3ZWXA 3NBUA 2A9JA 3IQEA 1MX9A 2O5RA 4HGRA 3EPJA 5CB6A 1I2AA 1HQYE 2H18A 4UVIA 2ZQYA 2AOUB 1GR1A 1PR4A 1NA5A 3A3YA 3JARA 5BY2A 1JU3A 1BHJA 1UINA 3E3NA 4IG4A 3PD0A 3Q7EA 4EI2A 5D7NA 1TUEA 3NWBA 4TWBA 4HGYA 1PVVA 4IY1A 1T8PA 1V25A 4TTIA 5DTMA 1RXVA 4OLAA 2QLNA 4PCAA 4PFJA 4KGXA 1VRCA 2R11A 3G7UA 3TQTA 4MEBA 5EE3A 3H8JA 1J0BA 2C2KA 1CUZA 3DLAA 3G0CA 3TLGA 4OJQA 1Y63A 1B42A 1LWNA 1TIPA 1TJ5A 3ZVLA 3WLKX 4KGVA 2FR0A 1VM6A 4KKVA 1V39A 3UMRA 2VJOA 1RMQA 4GEKA 4EYSA 4P3YA 2REOA 4PZPA 5IX8A 3HXOA 4L0CA 3RJTA 1D3AA 4RK7A 3ZS8A 1NPYA 1ECPA 4PTYA 3C45A 1I3KA 1YZQA 2R1UA 3HUTA 4AG5A 1G0NA 1Z0KA 3GVHA 3OY7A 1ZK4A 1LNZA 4MR9B 4KQCA 4MVJM 4CE6A 4TWAA 3UV6A 1DHTA 2QPLA 3BM5A 4FI3F 4BN4A 3LQFA 4RNDB 4YO8A 5FPSA 1OYVA 2NVBA 3QTLA 3OTHA 3IC5A 4WN9B 3DKPA 1VPVA 4IH9A 1E3QA 2Q4EA 2W98A 1BHO1 3DAPA 1UKYA 1U1FA 2WI8A 1SY7A 3IB3A 1QQBA 3V4ZA 3P9IA 1IYZA 4EB0A 2BD0A 2RHJA 1BS9A 4TPKA 5CH5A 3RU7A 3W5HA 3KQYA 5I7UA 2Z2KA 4JL6A 2EHDA 3CT6A 3TNYA 1GNQA 1N2SA 4KHZA 4FGZA 3PFIA 4TKZA 4Z86A 5FUYA 3ZK8A 2Q0SA 3M7IA 2FG7C 9LDBA 1M6EX 2B4YA 2X2FA 4JL5A 3SYKA 1G5TA 2BTEA 1NN1A 3CINA 1U2DA 3HLKA 1LK0A 3UKJA 4I7EA 4A26A 5GIPE 1D2MA 2DT5A 3OJCA 1XZAA 1MT3A 3FFBA 3U48A 4F3NA 4DXDA 2BTQB 1Z26A 2EV9A 3TNFA 3ZDCA 3EFOB 1QIDA 2PE5A 1WB6A 1E5DA 3U7FB 1BEUB 3F6SA 3DXYA 4J7AA 4H3VA 1C7ZA 1JIIA 4NG4A 4FB5A 1NJGA 3JPYA 1SVSA 2F43A 2VJDA 4IR7A 3ZGOA 1Y8ZA 2I3BA 5F5NA 1T0JB 1YQWA 1VMKA 4P33A 3F3YA 1KI3A 2HIAA 3RD5A 3WWZA 4OYHA 1PP4A 1Z83A 2AFIB 3IL2A 4I14A 4GW3A 3L0CA 3UW1A 2QRGA 5KYWB 2NYAA 5DMXA 3HCAA 1CXZA 4Q6WA 1HO3A 4WNIA 4ZV7A 4RMIA 2H2AA 4WMLA 2Q3FA 5ALNA 2CVQA 1DT3A 2VUTA 1VKJA 2Y1LA 4DIBA 4XI9A 3W9BA 2Q9BA 2ZJ5A 1GT6A 3IKJA 2O5VA 4LEIA 3TQHA 2FX5A 2QMQA 3HPRA 3KKLA 2YRXA 4HLDA 5EA2A 3T5BA 4A2CA 1RT9A 2FUCA 3GLFA 1OXMA 3D6MA 2DEUA 3CW9A 1NQ5A 4KFRA 2P5UA 4QFBA 1FYWA 2OCPA 4YLGA 1QOPB 3LC1O 4RD0A 1U28C 3NBXX 3UGQA 3UG7A 5KYVA 3QHAA 1L3CA 4BLUA 1CJBA 5JSFA 4RYDA 5K0TA 3V48A 1X1EA 4Q7LA 5A3VA 5LJLA 2ORED 1A69A 2G80A 3I32A 4K9QA 5DBEX 2LCIA 1EVYA 3C6BA 4DABA 3UXHA 1AE1A 4RLSA 3TKYA 3PDUA 4KQFA 4D8XA 3GA5A 3N1UA 2XAUA 5D8DA 4EQ6A 1XV5A 3NH6A 3NGMA 1ADGA 4IH4A 4LXTA 4GL4A 3GEMA 1BE0A 4AX8A 3MERA 3HP1A 4EELA 2RKOA 1FCJA 1GL9B 1RYEA 2YVLA 1PR5A 1WPGA 1E3DA 2WJWA 3SC2B 1YRWA 5CD1A 3GEHA 1ZGGA 4EY4A 4MP6A 1E9FA 4FDTA 3H3XA 2W93A 4GZLA 3CJTA 4CEJA 5ALTA 2QE6A 5T57A 3AF2A 4R8RA 1RQNA 1Y5RA 3PDIA 2COEA 1GQRA 3AFMA 3WQBA 4E4TA 5L3SA 2R6R1 5EKTA 1E94E 5ER9A 5IXJA 3SHFA 2BFBB 2EJWA 3NRJA 1O57A 4B4WA 2HCJB 3EEOA 2Q9AA 3MUEA 3OSUA 1ONNA 2ZU0C 1GGFA 3DE5X 2L18A 4WKOA 1AVTA 2XMSA 2DWQA 3IOEA 4RPIA 1LSOA 3EPPA 1TM7E 4J29A 3GP8A 4W9MC 3QG5A 1Y4SA 1KDRA 5E6SB 4DRXA 4UMFA 2Q4RA 3U7EB 2PSJA 4REOA 1R8YA 1MB4A 2F17A 2GM9A 1YHZA 2ORYA 5CU7A 3O9ZA 4LMRA 4OK5A 1D2NA 4X44A 4ZDIA 1T2UA 5HKKA 1JFFA 1A8IA 3IR6A 4KOAA 1VE9A 3WNBA 2G04A 1G8SA 4EFLA 1VBNA 3ODGA 4PPQA 1WTCA 1WXDA 3M5CA 1ZMBA 3Q6NA 2VDVE 2VF5X 2HT1A 4TYNA 3VO2A 2F8MA 3AY7A 2LKCA 3C1TA 4DLBA 2X0EA 3NDJA 5HKAA 4TLAA 2E21A 2OE2A 4ITUA 4W99A 5F23A 4L8WB 1CBUA 4RHXA 2PFSA 3VFDA 4MLPA 1UPUA 3FLBA 3PGXA 1KEVA 1OPRA 4GNKA 4KRYA 4KFUA 1YNOA 4LZJA 5AK0A 1W35A 4DRYA 2WE8A 3CH7A 2O3JA 1ADFA 3E5NA 1Z6GA 3BSFA 1L5OA 3F67A 1VKRA 1CT9A 4QODA 3T94A 4O5AA 2JD2A 1JEJA 1W30A 3WMWA 3LL7A 4R8SA 2PGLA 4U7TB 3HM9A 3UJ6A 5JG7A 1FSGA 1FFHA 4QDTA 1U9IC 1RMYA 4R1TA 4EJ2A 5IH3A 1JIVA 1USVA 1LD3A 3PD7A 3H5WA 4QJBA 4YPOA 3BJIC 3NHJA 4OXIA 5AHKA 1LZLA 2DHRA 5M29A 3LO5A 1CHNA 3MQ4A 1B41A 2J3MA 1K4YA 1PNRA 4HG2A 2J0UB 1ATZA 3DE6X 3G85A 1YMUA 3SQNA 1F17A 5HGXA 3R0VA 5BYBA 3M49A 2P30A 1GUZA 4B33A 1S3IA 2NTYC 4M0KA 1VG0B 2QKYA 5FA8A 5C3UA 4MUAA 2YFKA 3NFYA 3NVAA 1GFIA 4YGYA 4JQCA 3BKWA 2HC9A 3M8KA 1NLUA 3C3MA 2NM0A 3WLHA 4ZRDA 2CHUA 4RE6A 1H0SA 5F2KA 1REQB 3I39X 3ZNNA 1NY5A 2FHPA 2LDXA 4C14A 2G1UA 1V16A 3E58A 3DBLA 3MBOA 4N0PA 4CNBA 4BLWA 2BZ0A 2BBOA 3EIHA 1XVTA 2ZYSA 5BSUA 2I87A 4QTTB 4TN1A 4TKUB 3BF7A 2E18A 2IEDA 1XZGA 2W0MA 1TZ2A 2OGWA 4INAA 1I2CA 2BFEB 4WKCA 3B7WA 3Q5GA 1WNTA 4IS3A 3WB9A 3A1DA 3DC7A 2W83A 2HMSA 2J48A 3AFOA 3WQHA 3W3AA 2RSLA 5A5GA 1XMPA 2G67A 5LZ2A 2HHLA 2PJDA 3EGEA 5CNMA 5IAJA 3NBYC 4E33A 3NIWA 5EUMA 1TM4E 5JI2E 1NQWA 3T99A 3I62A 2YNMC 1T4BA 3LVRE 4IW3B 4YK7A 2HK8A 5HKKD 2H7YA 1CF9A 2B2CA 1PFQA 2ERXA 3JYLA 2GPTA 1N78A 4CHGA 2HF8A 4ZHQB 2ZT8A 3TOCA 2GA9A 2TECE 1CY6A 2XQIA 2XD4A 3RUDA 5IXSA 1Q11A 3O21A 3RF6A 2PT7A 1NC3A 1T9GS 2HMYB 3L7JA 3ZW8A 1MG5A 2GFHA 5DIFA 4CUKA 1KQ3A 3KYBA 1V7QA 5FO0A 4URFA 3RASA 2WLTA 2PUJA 1QFXA 3D1LA 5KTNA 3O95A 1GRNA 4V0QA 1DAIA 3PD1A 4G0MA 5EP2A 4RK5A 1ZN2A 4QOGA 5I7WA 3UAGA 3V1LA 2FLVA 2RHBA 3K2EA 2W43A 3W05A 2Q3JA 4R1UA 2IP2A 3TBHA 4EHNA 5BN1A 1ZIPA 1EKXA 3E9RA 4NFSA 3RFTA 2XVXA 1KRXA 1TU3A 3GJZA 1Q2UA 2CXRA 3EDOA 3LUFA 1F8XA 3NHZA 1LB1B 4JUIA 2BFPA 4P3KA 5ERYA 3OD5A 2REXB 1USKA 3SC3A 1UDXA 3OJXA 4DC9A 1BTOA 1L5ZA 1PTJC 2LCFA 1JXQA 1I9GA 3HWWA 4Y2JA 4AY5A 3MJ4A 4EB6A 2IEAA 3PNOA 4W7SA 4M46A 1GRRA 4Q93A 2VSOA 4QEKA 3UKDA 4I8DA 1AZLA 4ZAGA 5BNTA 1NAIA 2C20A 3IIKA 4U2FA 4D3SA 5GWXA 4EW1A 1ZDMA 4KR9A 1MH1A 3AVPA 4G26A 3UQYS 3TXXA 3VU3A 1R3DA 1F4VA 1SIBE 2DX7A 3CKLA 3K9GA 1A9TA 1T24A 3TCXB 4X7MA 4JIGA 4WOKA 1DS6A 3CQ9A 4ZJZA 1QKJA 2WHPA 2ZETA 1TX4B 3CS3A 3MD9A 2J87A 4EVIA 5K7SA 4R9UC 4D97A 3I2IA 4N40A 5KNCH 1D4ZA 3IDQA 3VPAA 1P1RA 1Q7RA 1UP4A 1YQUA 2XI4A 4OXRA 2BFOA 3AR7A 4HDQB 3WNCA 3U4IA 1DV2A 4WTOA 2VT6A 2B1QA 2HBYA 4IXTA 4BV8A 3EVBA 1JH9A 4O33A 2C3MA 4MGKR 1JR6A 1ZD8A 2K4MA 5KJ1A 1T2NA 2JZCA 1TQ2A 1H5QA 4O25A 4C88A 1GUAA 3U4QA 1K0UA 2ZWPA 3VV3A 3W3AD 3OZAA 1Z4QA 2ZJ8A 4H7DA 3A2KA 3UF0A 1I4OA 3V8QA 3A04A 4CMHA 2GAFA 1H8HA 1NMQA 1RSZA 3L6UA 3SQDA 4AZ0A 4B2LA 1CE8B 3QEMB 5L3VA 2WFMA 5HCIA 3BXEA 3H13A 3KJNA 4Z54A 5LR6A 3OTIA 3E7PA 3AJDA 1E60A 4Q4JA 5JS6A 4GYYA 1C50A 2ZBVA 1X14A 3GB9A 4AYTA 3F5MA 4TT3D 1W96A 2XH8A 1RXCA 1Z7BA 3OQPA 4HZUA 4YRJA 1I3NA 2AKAB 1PNVA 3OEYA 5EQFA 3MNFA 3PQDA 4DA8A 3E81A 3WL4A 2C9OA 1ZUHA 2UXDB 3QVJA 5AVXA 4E12A 4URXR 2BELA 3VTAA 2EGHA 1NQTA 3AJ9A 3RJMA 2NADA 4KXQA 3UT0A 5JNVA 2BY4A 3H84A 4LFCB 4BBPA 5KOJA 1Q7EA 1IDOA 2IEZA 4XJVA 2OV4A 1GADO 3A3OA 5HF9A 3T7AA 4CDRA 2HJGA 1N8NA 4H15A 4EFMA 3QH4A 3UICA 1P4AA 3H9EO 2QDXA 3AVQA 1GSIA 4OJTA 1G6Q1 4RA6A 2N1BA 3T1YB 5K01A 4E2YA 4GHWA 2H4JA 1OH6A 3FGZA 4TV8F 3G68A 4LVCA 4Z4EA 2IY7A 3T3HA 4G36A 2Y1OA 3O8QB 4MUXA 1A4XA 4D9HA 2Y1DA 2KHZA 3CGWA 2Z43A 2GHTA 2INGX 4FHZA 5C34B 3NTXA 3L7AA 4JH0A 5A0TA 4EG6A 1FFCA 4PAWA 2ZUTA 1YA6A 3EZ6A 3WP0A 1P2DA 3WL5A 1M2EA 3RBAA 2FE4A 1GQ2A 2VCEA 2Q9UA 3FVTA 2PSEA 4Y9UA 2H2HA 4OH1A 2IXAA 4A0RA 4YAIA 4D8YA 1KFKB 1AGRA 1D0SA 4JUAA 5T4EA 3RVNA 4CGYA 5JJBA 5ENDA 3O82A 3RC8A 3KTAA 3COZA 3OICA 4HEA1 4DJ5X 5TF0A 4ETMA 5C2JB 2ZVQX 4B7CA 2IS6A 1B6TA 3BBPA 3ORSA 2K87A 4HPWA 4MRNA 2H7VA 4URUR 2BGNA 1ZGBA 3L7OA 2HZBA 2LIPA 5JPDA 5CLLA 1RD4A 2XTJA 1SHKA 3A6HA 3WWEA 1CG6A 2Q1XA 2CLEB 3KSZO 4ER0A 1WKCA 1FZQA 1YASA 3W7AA 4BLQA 3KAQA 3ONNA 4L51A 3U81A 1A04A 1XDGA 1YRHA 2W2KA 4C4ZA 1DZIA 4HMOA 4BQNA 1IOVA 1E1RD 1SU7A 2CDBA 2I1LA 3EFBA 2PUFA 1ZIOA 5HRUA 1QGUA 1DWUA 1WKBA 2NTEA 2XMPA 4DN6A 4CN8A 1DFGA 1POXA 3ANNA 1N5OX 3EGXA 1JN0A 3G2JA 2KBEA 2R84A 3I04M 5FADA 4ZD6A 4R0MA 3O3CA 4G6ZA 1NUAA 1C4OA 2IZ5A 1QRTA 1CERA 3QLTA 1Y1TA 2ZIVB 1SKBA 3HB4X 3JQEA 1ZWLA 5BV2P 2QR3A 3DDWA 1HE1C 3MXOA 4Z4HA 2BMWA 2ZAYA 4ZXFA 2CJWA 5KCMA 1X7GA 1OI2A 2ID9A 2HCTA 4BO4A 1H8HD 1E6EA 1QR2A 4OF4A 4CKZA 3FR7A 1T3LA 1MX3A 1EM6A 1PT5A 2NZJA 1KA9H 4CEHB 3WL3A 1HTBA 3UJDA 1E4EA 3UO8B 3ZGXA 4B87A 1JE1A 2ZTHA 3KQVA 4GPEA 4DT1A 4JVNA 3WKCA 4FBMA 1OAOA 1IU9A 2GVDC 1T3HA 3AP3A 1KEEA 2IHYA 2AGVA 2QR2A 3KVYA 1X70A 1UK7A 3QWFA 3FBWA 3DBRA 1SBHA 4MWTA 1IWOA 1LLCA 1SULA 1SCNE 2YOFA 2B8EA 1NRIA 3V1KA 1ZUD1 3RT7A 1YL6A 1O1YA 3NW9A 3F9CA 2VBGA 4FJ0A 1E1YA 2QK4A 5CDFE 3U6KA 1X80B 5K03A 2O8FA 2N42A 1C7FA 3C6ZA 1GQFA 1NVTA 5AI4A 5K6TA 3BXHA 1G63A 2F3RA 3LCCA 5FUMA 3DOEA 1Z4LA 1YR3A 2OFXA 1GKIA 3GLGA 3CUYA 4J9UE 5EWLB 4KYUA 3GMSA 5JRDS 1NBHA 3B89A 3R6GA 4C2BA 4DG5A 2I8AA 3IHKA 4EWLA 4W5JA 4CODB 5I01A 3KQLA 4MVJG 1XE3A 1CS4C 2EWWA 3D8RA 5TMEA 3TTYA 3PDHA 3RSGA 4LRYA 1XMQB 1YOVB 3G3EA 3I9KA 2IGTA 3K0KA 3EG9A 5DTRA 4BJ1A 4HX5A 1RWPA 1XDUA 3URKA 1ZI9A 1GR0A 1YGYA 2C2XA 5ALRA 5K3FB 3RVMA 4WE3A 3WSTA 2PS9A 1SKYB 4WZAA 3RS9A 5A03A 2PVSA 4G5SA 2ECQA 4L2IA 1RRCA 4PG5A 2D5AA 4RTNA 1PGJA 3UV3A 1KERA 4OQNA 4LK3A 3CRZA 1ZUNA 1YZTA 2PEZA 3HJUA 3SMQA 3U7JA 1EG2A 1IHDA 4E7PA 1CZHA 5DP2A 1R2QA 3HB1A 4AWBA 2OY0A 3T1OA 2B7BA 3X2SA 3H2HA 3LT5A 3OMXA 2F4VB 3QHPA 2ONCA 1QF7A 4KR0A 3DEZA 1DKNA 3QQPA 5T4BA 1A9RA 1SVWA 3AY3A 2PDAA 2GZ2A 3F6PA 3G13A 4F56A 2QTWB 2FE1A 1P7VA 3FCOA 5KVAA 1WZ2A 3O3NB 3SSNA 1M1YA 1BVUA 1WU7A 2W4IA 3K96A 3PPXA 2YFQA 4Y2GA 5AOAA 3VU9B 5K0FA 2WM3A 2UXBB 3FYUC 3UK7A 1E3WB 1UADA 4DB4A 5BQ3A 3L0BA 4J3NA 3JS5A 2NVWA 3DQZA 3VZRA 1MQSA 2X3UA 4O08A 3P27A 3WQRA 1NWHA 2I2AA 2X23A 1XF1A 4B75A 3EZXA 4KAJA 2PMWB 3WK6A 3CGGA 4V2UA 1Z4MA 4YP9A 3DBIA 1I3OA 1KZ7B 4P5DA 4A73A 4B48A 4BKPA 1KO8A 5KPDA 2Q1SA 2VP4A 4NDZA 4BMZA 3F73A 5LQNA 4JHLA 1NSYA 2B1RA 1NZFA 3RQSA 4RZSA 5FNVF 5I9MA 2FB9A 4W6QA 2FPIA 3ZR4B 4ZTUB 4TQAA 3BIWA 3NM4A 3GZNA 4B6RA 1MVNA 1FUEA 4ZZIA 3U19A 2YJ6A 2G7MC 1G17A 3L92A 2X7HA 1YJ5A 3S81A 2R8XA 4QGSA 1KS9A 4LV5B 1Q3HA 5JATA 1YZNA 3H1PA 1FJ2A 4JSRA 2C42A 2QBYA 3A25A 2OLJA 1ZJ6A 4MEAA 4LXUA 5E8RA 2ID4A 2DR3A 5FLKA 2C77A 5LQUA 1Q17A 4FBLA 1N2HA 2GPYA 3M4NA 1U6KA 1F6WA 3DM5A 4GAEA 1NU8A 3LP5A 4OQYA 4ADSG 1D8AA 3EGOA 5K8UA 1RYBA 2PMDA 2V6GA 4ENRA 2JEZA 3D8UA 3IQHX 4M0PA 2GQ0A 1THGA 4P0TA 5CYPA 5KWVA 1LTHR 1UOQA 2PWPA 3A6DA 3TW8A 4F96A 4EA9A 1H5UA 2VTDA 5BOSB 1NVGA 3OI7A 4NJMB 3NHPA 4RBNA 2QUHA 3B1ZA 1SOUA 1QTNA 3O84A 3M33A 4PSUA 3W79A 4CCWA 4QGBA 2ZUBA 1G19A 3IURA 1AHPA 4TTTS 3RSFA 1T9ZA 1GAEO 4H59A 3OFNA 1T9CA 1JEEA 1USGA 3WR5A 4KXVA 4R3NA 4HK4A 2C9BA 4JBGA 2ZSUA 1W25A 1VI5A 2IOQA 1MOQA 2O2XA 4IV5A 1Y3IA 4Q6BA 5FQOA 5LBTA 3Q10A 3IP1A 4LXXA 2UU9B 3QWAA 2PV7A 2VT7A 3ONFA 4R0NA 4WOCA 2UKDA 4MW6A 5DDIP 5C8VA 1CUBA 1J33A 3F4KA 5KYUB 5C7YA 1QONA 1H2AS 1JDPA 3ICVA 4RVUA 3CVVA 3F2IA 3BEDA 2GM4A 3WYNA 1GV1A 5JCZA 2P7HA 3E61A 4L75A 1QPZA 3E2IA 3PKIA 4DM7A 2HQRA 2Q62A 3K9CA 2NUAA 3OPYB 5SZHB 4DLZA 1PLKA 4F06A 5BW5A 3CNEA 3EPKA 1MLDA 2PPLA 2JLXA 1KH1A 1DZ3A 2A5DA 2Q45A 3I2GA 4MXDA 1L5LA 3PF8A 2Q5OA 3ZGYA 5EIFA 3W6PA 2AXEA 1WSWA 2XA1A 4TKVB 1KWKA 2FW0A 1L4YA 2BEVA 3UA4A 3R9XB 2C4HA 1P74A 2H2GA 1SKAA 3Q72A 3HJTA 3WIEA 1IY2A 4B79A 5CEFA 5EJEA 5CVUA 4K86A 3T5GA 3A1FA 3N05A 4L16A 1A2OA 1Z0ZA 2UZ1B 4XCXA 4BHTA 2BFWA 4OI0A 2ZYDA 5GQSA 1M6HA 2EBFX 5JC1A 5JQGF 1J2RA 2IYZA 3H83A 1X0XA 1BXZA 4Z7QB 1OH8A 4OB6A 3ICWA 4F11A 4IFIA 1U2QA 4LOLA 3B3JA 4YECA 2OCAA 5FUWA 5ILQA 4HGZA 2AN9A 4CMJA 1LBQA 2H54A 3P9RA 5BV7A 4DIEA 4DWOA 5EP4A 1XRSB 1T26A 3KKNA 1AUOA 5G4KA 5CB0A 1IPEA 1K86A 3E27A 3O8LA 1KFCB 4PZZA 1PEAA 2QS9A 4E2FA 3KSDO 3BRCA 1WDLA 4EVRA 4KBGA 3CVUA 3TQRA 2R8RA 2ZJ2A 4ESEA 5DT2A 3KQMA 4RWZA 3SJAA 2FMFA 3C3DA 4NECA 2Z08A 3AU8A 1KPHA 2H08A 1XU4A 2A35A 3P8ZA 4NYJQ 1IJFA 4ZYUA 1JEQA 4HQNA 3UC5A 3ZHZA 3RVDA 3EF0A 1I1NA 1WDWB 1Q0UA 1KZYC 2FXVA 2WBLC 4G25A 4GXTA 4IOKA 1YE5A 1YR6A 3KO8A 3NQ41 2DQ4A 2DHDA 1VIYA 2BPOA 4AWXA 3GQBB 2VPQA 4LV6A 3A32A 5H5JA 1OZAA 3G2HA 2NUTB 4L50A 1YWGO 4BJ6A 1D2GA 5A5FA 1KMCA 2G4CA 1O8CA 2IP4A 3ZXSA 4CQLA 1M0WA 4DAOA 4HDNA 2AVNA 4MVJE 1VSUA 1GZ5A 5ALYA 4YONB 1M7BA 1V5EA 3LRXA 3GV0A 1BGXT 3R6LA 1LSUA 4YQYA 2RC5A 1E89A 4RZUA 1ZH8A 2PUVA 4KFSA 3R5HA 4YUVA 4QFDA 3OFND 3U2QA 3UV7A 4QGGA 5B3JA 3I9NA 3AR8A 1I2MA 4R40A 5CBPA 3U4CA 3W4IA 4PONA 3U13A 4OHVA 3MBKA 1U0JA 1P2BA 4HB3A 3QPVA 4H1VA 2R4UA 1XTVA 3L93A 4ZCLA 3T9BA 3V4SA 2ES4A 4DUGA 5JFOA 1ACMA 1M7HA 3GL9A 1W85A 5EJ4A 5LVAA 4EJSA 3KG2A 3SJCA 1LBSA 4H6XA 3D6UA 1SBNE 2MINA 5JS1A 1R6UA 2DU8A 1UJ2A 3S28A 2OC4A 3KLPX 1ZEJA 1XMVA 1CLEA 1AX9A 1AZSC 1XWFA 3U5ZB 3O0DA 2A9KA 2AD1A 4MWSA 5FI1B 3TW4A 1AKUA 1LQUA 4KNYA 4O4IF 4II2A 4ZK2A 3KPYA 3E1SA 3KBOA 1FUUA 2A4KA 4JKOA 5TX7A 4AS2A 4M53A 1Y5LA 3TMAA 1MIHA 1C4WA 4XWTA 4Y2VA 4Q19A 2QORA 3OZGA 4Y1FA 6AT1A 1BIFA 1XNGA 1EQ2A 1OA1A 1NBMA 2IDKA 2JIDA 1ZFNA 2GWHA 2ZG6A 1G2QA 4W8HA 4IDQA 5AM2A 3FG9A 2O2DA 2PL9A 1WXHA 3RT1A 3SBEA 1PT8A 2B5VA 4PG8A 3ZE0B 4ALJA 4QNNA 3W6OA 5MDHA 5I9TA 2PUCA 1GCAA 3R5SA 4BP1A 2O7RA 3OOHA 2B9EA 2G09A 4WASA 1W75A 2Q27A 2VZ9A 2O8CA 1PSZA 1FFEA 3EVTA 3L5OA 3HL4A 1NW9B 5IDWA 1OZ0A 3FDXA 4TXHA 4EYOA 2WWYA 3K1JA 5SY9A 4B2PA 1ZX1A 3R3XA 1ZH2A 4MWOA 2HCBA 3NWOA 1C4KA 4I0WB 5IM4F 1CULC 1UZNA 3BRQA 5DNEA 3L6OO 4TKMA 5E6UB 3R75A 1GQOA 3U61B 1P4GA 4R1QA 4DIOA 4LVNA 3ANMA 4PAQA 1WHTA 3ZNOA 1TF2A 4ZPJA 1Q16A 4YRRA 3ILHA 3I6YA 1PWEA 3CR3C 1Z6QA 2PKRA 4U5QA 2DFNA 3PXDA 3W78A 4DWVA 5I48A 3RNOA 4QL3A 1KGSA 1ST3A 1FP6A 2OESA 2PT6A 3DEJA 1GRCA 3RSLA 1FJGB 5G3YA 1F60A 1ZMRA 3HJFA 1PKXA 2YL2A 4R68A 2NZ2A 3I3SR 4PE5B 4N3CA 2G1PA 3UTDA 3KOZA 2EJCA 3FFXA 4LPSA 4DR4B 1PEKE 1TF5A 5ECGC 5K0LA 1A82A 1GKUB 2QTMA 2X1MA 3HL0A 3QJGA 4PLVA 1NN5A 1AQNA 1TMGE 3MA0A 4UU0A 3RS2A 1HDYA 1FLDA 1I7QB 1WJGA 1ODTC 4RV4A 1OCEA 1QTRA 3ESCA 3NV9A 2BHSA 5EQTA 3U3MA 4ZCTA 4WI1A 3HCRA 5F64A 2R1ZA 1KFJB 4FFVA 5AJUA 1I94B 1FP4A 3Q9SA 1L4BA 4ZEOA 4DUGD 1MQ9A 3JQ8A 3BL8A 1P62B 4CL8A 1Z29A 4HGQA 2C5GA 1AO3A 1OXTA 4BLRA 1NQUA 2R1TA 4BLTA 2CXPA 4KXXA 1PWZA 2H9IA 2JFOA 4YP0A 2EKQA 3MGCA 1XPOA 4HDSA 3UXEA 3IDAA 4DR2B 1NLFA 2FWBA 2IC5A 3IOMA 2ID8A 2R5WA 2Y67A 4LNHA 3ROTA 3TLKA 5DNDA 4OB8A 5JYEA 1SKUA 4OEHA 3V3KA 2ZZKA 4FFLA 3M6UA 4DMRA 5LZ9A 3CLVA 5TT0A 4RY8A 2IX3A 4FPXA 1OV4A 1IJEA 3RYFB 4ASUA 4BMSA 3TEFA 3V9AA 1E79A 4LIPD 1NBMD 4Q9KA 1MB0A 1Z5NA 2GEFA 1TJ4A 3DEHA 1A77A 3BB3A 2QA5A 3E6AA 4EPRA 2HCRA 3T4XA 5HHTA 3TWOA 3OQBA 4I3GA 4DNFA 5T4FA 1NATA 1Z28A 1XELA 4CJXA 4MR8A 4AX4A 3E84A 3QG1A 4ZT4A 2IHJA 3E23A 5U1PA 3IP3A 3DZHA 3WBJA 5AI6A 3C7CB 4IJ6A 4W9NC 5JCOC 4MLDA 3TCKA 2AFHB 5KTSA 4F72A 2GO1A 2KSQA 4GPBA 3F6EX 1JGTA 1RHQA 1HDZA 4ALLA 4IQ4A 3CUVA 4KZPA 4YJHB 4PEVA 2B92A 1BMDA 1DBVO 2N47A 4GWLA 3SZMA 4NBLA 1R0LA 2WJPA 4TMVA 5JE8A 1RP1A 3S5UA 1P7CA 3ZNQA 2Z4RA 4HMQA 2O5CA 1HL3A 4N6GA 4K9PA 3B78A 4RXMA 4D7AA 5JAOA 3F3KA 3WHIA 3CUKA 4P32A 4DV2B 4C4TA 2I7XA 3IDFA 2DPGA 1T3TA 2JK0A 1XD2A 2OV2A 2UUPA 3JARB 1U28A 4PNHA 5BR7A 3EMKA 3OZCA 5HS4A 1SBZA 3TGPA 2GYWA 5AK5A 4PZUA 5H68A 5GVSA 3NBQA 1ABFA 1MB2A 3WLSA 3K8OE 5FAXA 1U5AA 1HSOA 1L4EA 3JALB 5BWCA 1BFDA 1FNNA 3PHLA 1EWKA 4IYJA 3S8YA 3D8HA 4AMBA 3G49A 5HJ7A 5L53A 5TGDA 1WDMA 4L4ZA 4K8RB 3UH0A 4LF4B 4NU8X 4Y1RA 3TLGB 2D06A 3WO0A 1VGRA 3OPQA 4FYHA 4NOLA 1QUFA 3EQ7A 1S2GA 3IUMA 3M3DA 4E07A 4TTJA 3DLIA 1I7LA 5JC8A 1CP3A 2B69A 5F33A 3ZKWB 2OXEA 2QEQA 2HMWA 3CF0A 1VGVA 4ZJUA 3OLZA 2F9FA 2EGGA 1YCDA 3L41A 3U4HA 4C87A 1KRHA 5HKLA 4YREA 1YNSA 5F98A 5FAKA 3EMDA 5EHGA 3WLNA 4EEZA 2WOOA 4P4UA 1OTHA 4UM8B 3T7DA 3I05A 5FTWA 1S1MA 4HWRA 3PB3A 1N3BA 1NZJA 1JG1A 2D1FA 4N8SA 3WGMA 2H4WA 4TL8A 3BJMA 3OECA 5J2UF 3WIDA 1N5DA 3RCBA 4G89A 3K20A 3Q2KA 2EW2A 4ASUD 1Z4OA 1E79D 4HNTA 3KQKA 4XDYA 4XEUA 3L9XA 1NQVA 2JA2A 3GG2A 3PGKA 4BO1A 1HNXB 2ZYRA 4HSGA 1G98A 1G7RA 4JOSA 3WL6A 1XMXA 3PC6A 4QJ5A 5KSOA 4O5OA 3REQA 2GAOA 2GEBA 5K3SA 1ZAYA 4EMBA 4KE9A 1KZ9A 2DWUA 1D7OA 3UHAA 1SU8A 1JQ3A 4MRMA 2YRFA 1X1CA 1YR1A 2FJPA 5CH3A 3O1JC 4MP3A 3WICA 2FEMA 2IYNA 4D56A 4XUGB 1HZJA 4OBBA 3W5SA 3GDHA 1EFHA 3WV5A 3UBTA 1UAAA 2F43B 1U8EA 1MEOA 1VLZA 3A1WA 3UMVA 2XCSB 4C30A 2ON6A 4QPDA 5ENVA 4NMLA 3IEKA 4HVCA 5KX5A 3GFGA 3B6IA 1SXJB 3ZD8A 4B7ZA 2QJOA 2FQXA 3OIVA 3R4VA 4NKRA 4EDHA 1MA0A 2E4XA 3G6KA 4NCAA 1US8A 3WFJA 4GLBA 1JG3A 3VDRA 3HCCA 1CUSA 1LI4A 2VAWA 2XY4A 4Q3NA 3RFUA 2XDQA 5HK9A 1MMFB 2HFJA 1JIUA 2WZBA 4FGKA 1TE2A 5AQ1A 1HEYA 4DUYB 1XZPA 3SHWA 3G1TA 2C2GA 4BLVA 1UIMA 1U9IA 1Z5WA 1VIMA 2I67A 3MMXA 3DQPA 1WP4A 4G5RA 4N8EA 1G291 1Y33E 4CW7A 4DA7A 4OXQA 3GLFB 4H7EA 3QZUA 1UZAA 1IQUA 3AHGA 3GLHA 5KDLA 4RH0A 5KNLA 5KU7A 5ALUA 1IQPA 2JDIA 3WE7A 1AUXA 1PT9A 4AW9A 1EZ4A 3OZIA 3I4FA 4ZZ0A 4MYSA 3WWCA 5DHFA 1EE1A 2YMPA 2CNOA 3KWJA 4YRTA 1DBQA 2P9ZA 4KE8A 2FAXA 4E2WA 3GIDA 4PRZA 1JXAA 3BWCA 1A95A 4C2TA 1VOTA 3PQ6A 2Q2WA 2QUKA 5EUQB 5I3CA 2X22A 4YI3A 4FFPA 1ISRA 1W93A 2JATA 1KYWA 3HXQA 1O4WA 4AMZA 3U09A 2CXTA 5JFTA 2DJIA 5IN4A 2JCGA 3C5WP 4HQRA 4R9SA 2JRLA 4ICIA 1YUBA 1PJLA 4DDWA 3PCRB 1FFSA 5B3KA 2G6TA 5AIBA 2JF0A 3IPAA 2IXEA 4YUAA 5LLDA 5AQEA 1OTXA 1KMHB 2D74A 3DVRX 1N7IA 5JSZA 4JR2A 4CEJB 5EIXA 3ZOKA 3O83A 1HG0A 4RDCA 3BWXA 1PL8A 3PDIB 4C08A 5L3SB 1U4SA 2WB2A 1M73E 4JD5A 5F52A 2IJGX 2IRWA 4CIWA 2BFMA 2BDUA 3PXCX 4DBLE 1YBVA 3EYWA 4HNUA 1UPCA 4FP9A 4HD8A 3HB7A 2V8OA 4WT7A 2YNMA 1BXRA 2R3SA 1IULA 3IQGX 3TAUA 3WGTA 3MTJA 1O0CA 4Q4AA 1E0SA 3G82C 3JZMA 3ECSA 2VPTA 5DF1A 2XUIA 3C5VA 4YJ3A 2J7KA 3AKCA 1GG8A 3OUTA 2QVLA 5ALOA 1QH1A 1S8AA 4J1NA 1XQXA 1WQ3A 4WECA 1JFFB 4RY0A 1HLDA 3H19A 5M04A 1Z0SA 2B35A 3H7IA 2WWFA 4Y2RA 4CM5A 2VCHA 4XIYA 5E38A 5I7EA 3SOPA 4PU0A 3I01M 3FYSA 3VH1A 2FZWA 1WUTA 3O2SB 1TPZA 4PYQA 4MCIA 1DPFA 4KH1A 4DBLC 4MROA 2GTHA 3TFWA 4V0ME 3RBZA 2DVMA 1XB2A 5KAPA 3U3RA 2P4EA 3ZLBA 4GBMA 4HTFA 4PW0A 4X64B 2D4AA 5COAA 5JXHA 1TT5A 3IAAA 3BMCA 5DE3A 4D80A 1P5HA 2ZSIA 4U7PB 3SQLA 1O08A 3D6JA 1NW6A 3KYDA 5KKCA 2X0JA 4QVIA 3KR1A 1X6VA 3GCGA 4UOEA 1M2KA 4NYMQ 1PTJA 2RHLA 1NL3A 3GVPA 4N48A 1C3VA 1EA7A 4B3FX 4BKRA 5CDGA 5GONB 4DR7B 5EUBA 1O97C 1G5RA 4L5CA 2JDID 1E64A 3CZQA 3UFBA 4JJ4A 3PTAA 4JWKA 4MYCA 3D6VA 5KVVA 1OLUA 5HM6A 2G06A 3GGGA 4NU5A 1NVDA 3BWDD 3ZHVA 5EHQA 5HJEA 3ZDXB 1QQTA 3HMKA 3MTDA 3QOYA 2OZVA 1OXXK 2I7CA 1DDOA 5LZ7A 2ZUFA 4URVR 5ALSA 3S1LA 1KY2A 4KIUA 5FPPA 3JSXA 3U26A 4G0WA 1N75A 4FFWA 2PSDA 4AL4A 2CLHB 5D1NA 2FW1A 3PQFA 1Y7HA 2BC9A 13PKA 3SIPA 2GPBA 2XAAA 1U8YA 2GZDA 3GMDA 2CLMB 3AB3A 4GC5A 4QBFA 3WXBA 5J40A 1L1QA 2PR7A 2P90A 2PXHA 2QT1A 3TLYA 4ER6A 1P29A 1V16B 5FT9A 3DBLB 3N53A 3UMSA 1WXQA 5KPJA 4M9XA 3F2VA 2JAHA 4LRQA 3BZBA 5TIIA 1LLDA 3PRHA 4I99A 4HNGA 2YJ4A 4G5XA 3O03A 1ZXXA 4A10A 1Q92A 3E9MA 2PRJA 3UQZA 1GDDA 3DMYA 5IKPA 2YNMD 1X1TA 3FRJA 1S2IA 3FVRA 4WRRA 1RIFA 1WLSA 2QROA 3T52A 4LMPA 5JCXA 3BF8A 1ESCA 4MA4A 3A6KA 1COWA 1E5QA 3R7SA 2X0IA 4FLFA 2NZYA 2ZRFA 3C4JA 4MHOA 5LYJA 1YZGA 1SXIA 3TH5A 3P2OA 1GTG1 1SO8A 2J6CA 4F93B 4FOSA 4LAFA 5FKJA 2Y0CA 4CG3A 1P2VA 1YA4A 3GR6A 1PJ3A 4AO7A 4AY4A 1P1JA 1WY7A 3W5JA 2HYDA 1J1UA 3ILSA 2PPVA 4DR6B 4YY3B 3AXTA 1VKHA 2FPOA 3NR2A 4BGIA 3ESQA 2LGJA 3EH1A 3DE3X 1DKUA 2ATVA 1JXOA 2SECE 3C3EA 2ZJ7A 2GCNA 4PAOA 2GPJA 2GN9A 2WTEA 3VSBA 2BYTA 1PVOA 4QQFA 1RLTA 4AFNA 4IDPA 1I2DA 4IQ0A 3WDLA 1SD1A 3LC7O 2RC6A 2HQOA 4HC4A 4BN0A 1FSSA 5DHSA 1SPXA 3A6JA 2ZE5A 4MUBA 2V98A 4G2TA 4J7XA 2GZMA 1U0NA 3VZCA 2V0GA 1E7SA 1FDUA 1AV7A 5HF8A 3TPFA 4P81A 1P2UA 4A0GA 4U2CA 4TQUS 1YJQA 1NNUA 3NM6B 3VPDA 3WV4A 1W2HA 3DR3A 3LUDA 3ENNA 3M1IA 3QSGA 3T5MA 1BYIA 3VISA 2WF9A 4H3SA 2CDRA 3D2AA 3HNOA 3I5XA 3CVYA 3V5NA 3UIEA 2Y4NA 4MJXA 4O4JA 1OJ7A 4K28A 4MJLA 4WD3A 3JQAA 3ZWAA 1TJNA 2QZJA 1KVRA 1VZ2A 1PHRA 3NC4A 2BI4A 3MB5A 1HNZB 3HKBA 2YWBA 3C3WA 1I7NA 2BHNA 4KSCA 3KE9A 5LJIA 3KSMA 5C53B 3WLRA 3EPRA 5EJGA 3CX8A 5I7OA 4BP9A 3NHKA 3OLQA 3STUA 4KFCA 4H4CA 3SZ3A 2BBWA 5JARA 1JHUA 3WJAA 3CF2A 4IINA 5E9JA 4IILA 1E7WA 3U3DA 3ZEIA 1P4JA 2PU5A 1SBYA 3DV2A 3EIUA 3NC1C 4GBGA 3LUBA 4IOJA 2WHPB 4KX5A 4TS1A 3FROA 4PINA 3ZU5A 2CYCA 3HBAA 2WT8A 5TXGA 2GD1O 1ARZA 3IV6A 4WKGA 1CRPA 1H2EA 1CFZA 2OSVA 1A27A 3FM9A 3V1MA 4F1WA 1YZHA 4H1WA 1PW7A 2PLNA 3TE6A 4PLYA 5JAIA 4G0YA 1LPPA 3OZWA 2V0CA 2N3ZA 2QTNA 2AG0A 4XGKA 3LZ6A 4FWBA 4JLPA 4XAQA 5DWQA 4N9QA 4Z51A 1LS6A 2I71A 1Y4DE 3UM9A 3NNSA 1NXXA 4HO1X 3U4QB 1IDN1 2FWIA 1QGED 3KSAC 2H2DA 4LE2A 4BQEA 3S68A 3F6RA 3I1JA 1COWD 4KL8S 3VNRA 2B8NA 1JB1A 1OHHA 2QL7A 4AZ0B 4GI2A 3ZHRA 1I36A 3Q5DA 3MQFA 5FR2A 5TR9A 5REQA 4ZYXA 4YMGA 5GOTA 5IT9A 3TRHA 3OQMA 3EDCA 4KMRA 3CJRA 1QG6A 4Q4JB 3DTTA 3L18A 4I55F 2IS4A 3R9KA 2ZBGA 3QOFA 1E2PA 3ED1A 1XDDA 1QK5A 4HZUB 5HM8A 4NC9A 4Q12A 4RL4A 2R62A 3AF1A 1DBWA 2PQ6A 2O9JA 1T2CA 2YIMA 2OAEA 4HATA 4IV8A 2H51A 4P9NA 5CVJA 4DA6A 1I24A 4X1IA 3IGFA 3CSSA 3ID6C 1WXFA 4P38A 4TMKA 5BRNA 5KOJB 3N2KA 1GNPA 1LNQA 3DAHA 4LHYA 3SX2A 2PZ8A 1U0SY 2CW5A 3PR2B 4WN3A 4UZEA 5ULLA 2VDPB 3GEPA 3NRCA 5T6MA 2IIQA 3SEAA 3BTOA 5A05A 1DOZA 1JBKA 4QULA 1PLLA 1NFQA 4RA6B 4L4YA 2YIDA 3AUKA 1NG1A 5DCWA 5GINE 2FP3A 2VF8A 5JS2A 2C7VA 2GNOA 4YRLA 1ITZA 4I1PA 1C0PA 1JJIA 1SWVA 5JR3A 1HGXA 4GR9A 4TL9A 1RJ9A 1S2DA 2EKLA 4ZO9A 4UM9B 4UNSA 4YAEA 2DE0X 2YXNA 5CDFA 5IAOA 3I9OA 1KI8A 1FLVA 1CDDA 2EXXA 1T9HA 3PXUA 1ORDA 1ORWA 4FK8A 4K9SA 3V4PB 2CHEA 3TVDA 4B9EA 3JQAD 1OGJA 1D2RA 2CUNA 2MWMA 2QLJA 4WDRA 5AW3A 4FVTA 3CSDA 5I7SA 1N5MA 1SIOA 1RQXA 2XYHA 3RWBA 5BSKA 3AI7A 3L05A 4R8VA 3KTAB 5DGHA 2AUMA 1EUDA 3KWMA 1YIAA 2NSYA 3GLIE 1JNXX 3STWA 4G1VA 3TRIA 2BMVA 5A4AA 4BDTA 3AQIA 3A9UA 3B38A 2YN4A 4E31A 1B43A 5FLYA 3UJ3X 2VQDA 4RHUA 3JTEA 1C3EA 4LZZA 5JNTA 3BJRA 1RHKA 4MI3A 5IASA 3FYUA 1NUPA 2RH8A 3CRNA 2RKWA 2W2KB 4BX9A 2AXQA 3F6BX 1IBSA 3BE5A 1UT5A 1QQ6A 4MP8A 1SVMA 1JHOA 3DEKA 4NTZA 5FV4A 2WKPA 1QGUB 3AF0A 5IVDA 1K5HA 2X5OA 2FUNB 3EGXB 3P7MA 1GUDA 3QLEA 5K99A 1XTIA 2JAUA 2QNIA 4PS0A 5AICA 3PNKA 2MSDB 4D4JA 3CZCA 4IXWA 4QSMA 3INYA 3O73A 4XA8A 2ZPAA 4H1TA 5DCLA 5EIHA 1IXKA 2PAFA 5HIMA 1Z2OX 1K7YA 1U1GA 1UWKA 2PYDA 4QX6A 3T1TA 2WIJA 1OHHD 1X15A 1GHTA 1T9KA 3OX1A 3WLFA 2SBTA 2AK3A 2D1QA 3A7EA 3OQ1A 1W49A 2GPSA 4RY9A 1GGKA 3T9FA 2GPAA 2WRZA 1X86B 2XRMA 4HEQA 4JBIA 1E4EB 4O4LA 4TSFA 5FO1A 5HDBB 5ILGA 4LF9B 1XHLA 1Q0LA 1GYPA 3VC3A 3BIXA 3WBFA 1KEEB 1RRKA 2BGRA 4JFRA 1N1GA 4NULA 1ZKDA 4S0ZA 2HX1A 1K8ZB 1EWYA 3GMIA 3OEEA 3D4OA 4TV9A 2XIJA 4YALA 1XA0A 3W9UA 3BD9A 3NBAA 2EDAA 2WQZA 1TAGA 5IARA 4D42A 5CTJA 1HETA 2BBSA 2AR9A 2IDZA 4CNQA 3W7BA 4RM2A 4W1QA 2C1EA 2PUEA 5K3EA 4JQOA 1V8OA 4IVRA 4BO9A 4DLNA 3ZY5A 2C5SA 3NAZA 4BFLA 4L8YA 3VJLA 1CY4A 1V45E 3W2EA 2EZUA 3WRXC 1U9JA 4EHFA 5L7TA 3GLGB 1PNQA 4LJLA 5KBYA 4MVJP 4NNJA 2GD2A 1QP8A 2BFNA 5JVDF 1CNEA 3H18A 1ONPA 1PQWA 3BXFA 5FL3A 2DR0A 3I58A 3I09A 2B1JA 4RV9A 5IMBA 1YJAA 1Q0QA 1MG0A 1V0JA 1WQ4A 3IALA 4B6OA 3EG9B 4DQXA 1OIVA 1SUCA 3I5UA 1GPWB 1HDCA 4LYEA 3ZWBA 1RR6A 3HFRA 1G7SA 3ZK9A 4BNYA 2FQWA 1G20E 3GLSA 3ZZMA 1H3NA 4WZAB 1ZM2A 4MW4A 4L2IB 1HFJA 5JYBA 4DGQA 2BKLA 5F7ZA 3D6TB 3MSCA 3D64A 4QLOA 4ZQBA 3SKXA 1NTRA 4KO1S 5C8ZA 1ZUNB 2E4AA 1KHTA 2WV7A 4Q18A 2PU7A 1NIPA 3MTGA 4ZV9A 3T4PA 1Q20A 4D9FA 4H31A 3E8SA 1FX1A 1Q57A 3DF7A 4JODA 1ZP6A 3W6UA 5DYGA 1M8PA 2YY7A 4KMSA 2H0RA 5H3CA 1YV9A 2RAFA 3K7EA 1E1MA 2WF6A 2VP5A 3A26A 1OX5A 1EFUA 2GXUA 2JHPA 1PEDA 2E3JA 2B1GA 4RMJA 5ED0A 1U8CB 3O1HB 1M1YB 3IUQA 1OYYA 2NV2B 3BFPA 3LH5A 3VX4A 2MR6A 4X95A 1TTTA 1FTQA 4G1FA 3BE6A 5CK5A 1JDJA 2NSHA 4Z6KA 2XQGA 1Z82A 1G7CA 1TXGA 2ZXEA 1PFGA 4LQDA 4MQ6A 3ZDZB 2WUFA 4PHHA 2OMKA 3OU7A 4PGMA 3W8NA 2AEEA 1C9NA 2ZRIA 3PHJA 4LSGA 4RVOA 4B3GA 4IKPA 2JIRA 4N5MA 4TSFD 4DOMA 5K05A 2RE8A 3LQ4A 1HV8A 4B7UA 4V0KA 2NSLA 2OO5C 2QY9A 3AXSA 4X71A 4LJ8A 3PFWO 2X0DA 1N33B 1R6TA 1II8A 3MFQA 1R4MA 2FPIB 2R44A 3W5DA 4KQEA 3OEED 3HBNA 3VR4H 4YPVA 4G23A 1Y98A 2QUJA 1WA5A 4RFVA 5KVCA 1GZUA 1NBIA 2X2EA 2RGNC 2FWMX 3CF4G 3JYQA 3ZHTA 4B3JA 5CA0F 5JV5A 5AT1A 4GQIA 3LS2A 4Q05A 1ISSA 1MQ8B 3PQ2A 3R7LA 3FHOA 1V9SA 5DLDA 1FU4A 2QBYB 1I6MA 1LFAA 3DBHB 1U7HA 5LUBA 4JLJA 4C1NA 2ZSEA 4LFBB 3L01A 3OLYA 3CE9A 3QELA 4BVLA 2ZJ4A 1YB7A 1MW8X 2VJLA 4OHYA 4ILEA 2HPHA 4DIUA 4ZAZA 1W9MA 3IEMA 4L6CA 1FRFS 4FCTA 1B16A 4XB6B 1VG8A 3MT0A 2PLWA 2Y0BA 2SKDA 1WZIA 3NKVA 1A3CA 3PNYA 4LHSA 1WB4A 3TIFA 3C3KA 5CVDA 4F4HA 5ADVA 4Y1EA 2WWVD 3RRZA 4DCNA 2GERA 4I50F 4E5NA 1G2PA 1N5KA 3PL1A 4A8JC 3QX3A 1AQYA 1VXRA 3QYPA 1TVEA 4R0VA 1KVTA 2C8JA 1H69A 4RIEA 1V1JA 2XJ4A 1YU9A 3GFVA 1ZJ4A 5HFNA 1DAPA 1AA6A 1AV6A 1Z6PA 1MAWA 2C4UA 2ZS7A 3JAKA 4CIBA 4KKXB 1P31A 4GPIB 1G21E 4G9BA 3QF7A 4BIIA 4RTJA 5HCNA 2ZYTX 3JV7A 5L3ZA 4CM4A 4BXOA 2AF4C 2F67A 4PTZA 1QGYA 2WTBA 3BKXA 3I0ZA 4XB2A 5BSFA 4G8JA 3NS7A 4R9RA 4TTVA 3NX4A 1URPA 2CEKA 2AR7A 1Z4IA 2FXIA 1HORA 2BEVB 2CFRA 1N3IA 2E4WA 3FUTA 1CRQA 3QOWA 1RXEA 3MYRA 2C83A 4G4JA 5TT1A 4R51A 1QGAA 3P2JA 3ONVA 4FEAA 4U39A 3TO5A 1SD2A 2H1WA 3OQVA 5DX8A 1KAEA 1R6XA 1Z0DA 2O3SA 3AHJA 3PCTA 5AVUA 1OLXA 1PK9A 2R87A 4BWGA 1N7GA 3O2JA 1IJKA 5CW1A 3ZGLA 2O7NA 2XMDA 2WF7A 4AZSA 5LA6B 4WNAA 3FCYA 3ZBPA 5G4KB 2N75A 4JXZA 3T4EA 1UC8A 3H4IA 3SZLA 1GTSA 1C8LA 4XVRA 2X4IA 1KYVA 2FWJA 4IGAA 2IU4A 4Y6OA 5EXXA 2AOXA 3JWHA 2DLNA 5TPWB 5BWNA 4B4OA 2C3PA 2R7LA 1FDTA 2IUEA 2I03A 4ID3A 1N2CE 2GXAA 2QSJA 2PS0A 1WETA 1B3RA 2WMDA 3C6QA 3PQ4A 4NONA 5EE5B 4B85A 4WZ6A 1Q1BA 3GX1A 2YVAA 2ZI5A 5LU8A 2W2VA 3IS3A 1F3LA 1OU4A 1JKJA 4FQ8A 4DPMA 3DEAA 2HMTA 4RENA 4XYEA 1YBMA 5GAJA 2M6KA 4NHEA 1I6LA 3I12A 5CVCA 2DSNA 2HPAA 2Q3HA 2I34A 4CFZA 4CQJA 1R0BA 1SZCA 3N2LA 4ETIA 3ZQKA 2I55A 3QKTA 2DFDA 4YAKA 4HAOA 5C37A 1E2QA 1KOGA 1RBMA 1DKLA 2J3HA 1VE5A 1QLJA 1NOKA 1R27A 2AMVA 3JVDA 3LV8A 3QBVA 4OU4A 4YAJA 1YH3A 4H7KA 4DGSA 4PV7A 1QDUA 4AN0A 3D2LA 1C4XA 1VQ1A 1VRWA 2G1JA 2YWHA 2ZJ0A 3DEYX 3SY8A 4BNHA 5GV8A 5CBPB 1GGEA 4RKEA 4H0FA 2XRYA 3W6ZA 3OLWA 3TZLA 1H6BA 1ZJ5A 2P3SA 1GY8A 2WT4A 2VQSA 3ADOA 4J0FA 4JR1A 3JQ7A 4K46A 4Z9BA 1KJ9A 3TSZA 2IUTA 4HNQA 3ASVA 4ZYWA 4UBMA 1W85B 1YBHA 4X0EA 2ZUEA 4EJSB 4RCYA 3V8PA 2MYTA 1XAIA 3DHWC 5BQPA 3ZGVA 2YMMA 1RYNA 5HOQA 3WFIA 2MINB 5LNK6 4QUAA 3B9RA 5IYZF 2YOGA 3C6XA 3N74A 3ZCPA 3AM1A 1NMYA 3KJEA 4MEJA 5A7GA 4CT5A 1GTZA 1M2OA 4HH1A 4EDFA 4TLDA 5B53A 2UUCB 4M9UA 3ND5A 1YS9A 2HKIA 1KORA 3QENA 5H3HA 4DMHA 1ZEMA 4HLCA 2WK1A 4ZVMA 2CDNA 3HJBA 4HEHA 2YHAA 1SQGA 3PI7A 5EC8A 1YVUA 2VHWA 2X8BA 5ERGB 1AKTA 1HBJA 4JLBA 1RWMA 5F5XA 3PX7A 4TYYA 1G9XA 3EJ6A 3IRVA 3F90A 1RCUA 4F4CA 2EZ4A 3EAQA 1PK7A 5H1YA 3M9WA 1GZ3A 2BHTA 1WR8A 1EUCA 1SUAA 1L5FA 3ZJVA 3RIEA 1DRKA 4W9NA 5JCOA 2IUUA 1FMLA 4YQFA 3PVCA 1CS0A 3DULA 4G5HA 3IBFA 1MOPA 3BGOS 3L1HA 4FINA 2C7QA 2C54A 1C7RA 3CX6A 1WIWA 2O48X 2RB5A 3D7RA 3KKPA 2XBLA 4ZJPA 2RJOA 1FRZA 5CFLA 2O8CB 2FSPA 4M7WA 4M1KA 2RHCA 1CR1A 1E2MA 1L4MA 4WK4B 4BVJA 2ZWVA 2W8BA 4GYJA 2YV4A 3NPMA 1EK0A 1U2ZA 1UDCA 4DR5B 1IVSA 2WP0A 3F3MA 4M1QA 5KNDH 3IAUA 2GAJA 5FTLA 3NV7A 3KAJA 4Q82A 3IJRA 3AUXA 3KV1A 3RKRA 3K9FC 1R1DA 2DKFA 1WHTB 5FD8A 1U1DA 4UUPA 2DYKA 5E7JA 4BB9A 2PV0A 4RPKA 2WJZB 5JMOA 1QOZA 4FZ5A 3KIPA 3SI7A 2GM5A 4NV3A 1AN9A 3PGLA 4DDHA 3MS4A 3RTDA 2W6OA 5FOVA 4RU1A 1V4BA 1C3OA 5C5EA 2QDKA 1LF5A 1Z6TA 3RRNA 4DL9A 4YMIA 1S4MA 4AXXA 2IS2A 4D6XA 1J8FA 4BMDA 1GZ7A 1EIZA 1UIRA 1FK8A 4URWR 4L27A 1LCIA 4FFBA 4C0LA 1YI8A 1H0HA 2AJTA 4HFMA 1ICIA 2ZRHA 3TQSA 5LBUA 4UBIA 4C4OA 1PR9A 1AMNA 2UAGA 4A91A 4ARZA 1ZSYA 1M33A 4ESHA 2AVDA 1SPBS 2PIAA 4K87A 4ZAWA 1W4LA 3GUVA 1LZKA 3O8BA 4Y8VA 5DBFA 2SNIE 4NI5A 4AN1A 5I5EA 1Z06A