3FLBA

Rifr - type ii thioesterase from rifamycin nrps/pks biosynthetic pathway - form 2
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
245
structure length
245
Chain Sequence
EAEKWLRRFERAPDARARLVCLPHAGGSASFFFPLAKALAPAVEVLAVQYPGRQDRRHEPPVDSIGGLTNRLLEVLRPFGDRPLALFGHAMGAIIGYELALRMPEAGLPAPVHLFASGRRAPSRYRDDDVRGASDERLVAELRKLGGSDAAMLADPELLAMVLPAIRSDYRAVETYRHEPGRRVDCPVTVFTGDHDPRVSVGEARAWEEHTTGPADLRVLPGGHFFLVDQAAPMIATMTEKLAGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RifR
publication title Structure and Functional Analysis of RifR, the Type II Thioesterase from the Rifamycin Biosynthetic Pathway.
pubmed doi rcsb
source organism Amycolatopsis mediterranei
total genus 89
structure length 245
sequence length 245
ec nomenclature ec 3.1.2.-:
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3flbA00
2ZYIA 5DYTA 2HFKA 3BJRA 2B61A 3AZPA 5ALRA 1QO9A 4KYVA 4W9RA 2CJPA 5K3FA 3K2IA 1M33A 5CBKA 2VJCA 4GWLA 1GPKA 1GPLA 5IVIA 5K3AA 1BEZA 5AKKA 2ZJ6A 1QIKA 5FDFA 4Y2YA 1J06A 3O4JA 4ARAA 1IUNA 3IUMA 3M83A 4X6XA 5BV7A 1J2EA 5JATA 5ALVA 3VVLA 1ZD2P 3AZQA 5I7UA 2G5PA 3PF9A 4Y7DA 4L9AA 1CQWA 4PQEA 2VAVA 2WG1A 5CH8A 1EB8A 1YSCA 4KR0A 1ODTC 2ZJFA 5HKAA 1KU0A 4W1RA 4BTLA 1CIJA 3I2GA 5AI4A 3B12A 2WUFA 3W9BA 3QPDA 5KREA 3FCYA 4U2EA 3W2TA 4B83A 1XZBA 5LKRA 2D0DA 3S8YA 5CH5A 4BZZA 1EDEA 1YASA 4AO7A 1IZ8A 4XJVA 5DYWA 1CRLA 4GECA 2WFLB 4H7JA 3V9AA 5ALIA 2Y1KA 4FWBA 2XUGA 1JJIA 1R9NA 5ALLA 4M0FA 1CUZA 4X97A 5JD4A 1IUPA 1C7IA 2WTNA 4C4ZA 3P2MA 3N2ZB 1BROA 2X5XA 2QKYA 4DM7A 4AN1A 5EHXA 1K6EA 4EUSA 1KU6A 2ACEA 2ZJ7A 3FVTA 1UKBA 3M81A 5A7GA 2CUTA 5EIEA 2XUKA 3VXKA 1THTA 5EHNA 2DR0A 4C01A 3G0IA 4G8BA 1QTIA 4C4XA 1Q0RA 4W1PA 2JGFA 3ICWA 2O2GA 5A2GA 1KEZA 4IH4A 1JMKC 1CUCA 1PFQA 3CN7A 1FFEA 5AM1A 2FJPA 2AJ8A 1DWQA 1OILA 2V98A 1CLEA 4BYMA 4ZI5A 1UK9A 5ALHA 2HU7A 4Y2SA 1TKRA 2I3ZA 4G5XA 5AJHA 2VT6A 1IMJA 4BB0A 3HLKA 4AZ0A 5HF5A 3VDXA 4JEIA 2C7BA 2FUKA 2OGSA 3LIIA 2H7YA 1UOQA 4AO6A 1YS2X 1WPXA 5AKEA 1DINA 2BJHA 1GZ7A 2XMRA 3DD5A 3G8YA 3JWEA 4BVJA 2GBGA 2HHAA 2OQVA 5EHZA 4OUKX 3FNBA 1BCSA 1ACJA 5HF9A 2VJBA 3BF7A 5I8PA 1CUUA 2AJBA 4QE3A 3QPAA 3ZPXA 5CXUA 5A62A 2XUPA 1A8QA 2GZRA 3OURA 2OG1A 4G4GA 2XLBA 4KAAA 3H04A 3KWJA 1SCQA 1UWCA 2J4FA 4H7HA 4JNCA 4KAFA 4MYDA 4CCYA 1MPXA 4WFKA 4JYPA 1XZIA 1AMNA 3ZLVA 3HXKA 1BEEA 2DHEA 3WWOA 1EINA 4MJ3A 4X3CA 3PI6A 1WB6A 3C70A 4C87A 4F0JA 3BWXA 4B6GA 2XUAA 2XT0A 1QIIA 4IHAA 2ZYSA 4Z49A 3PE6A 5K3EA 2J3QA 4DTCA 1EVQA 4OYYA 4S0XA 4U2DA 2PSEA 4QWWA 1XKTA 2XQGA 4CCWA 2WM2A 3WA6A 2HU5A 1QONA 4JH0A 5EIAA 4YX9A 4B82A 3LS2A 5E2IA 3VKFA 2XMZA 3CCBA 1WCYA 4GBGA 4P93A 4X6YA 1ODCA 2HA7A 3WK8A 4ZV7A 1EVEA 3I2KA 3HC7A 3WIBA 1USWA 5FPQA 2AJDA 3HSSA 3H1AA 3KD2A 4BVKA 1N1MA 4J0IA 2VATA 5KWJA 5LYYA 3WK9A 4HXGA 4XX1A 1LBTA 4Y2JA 4YASA 2EDCA 5ALYA 1AC5A 4U2FA 4ZXFA 4DLNA 5SYMA 4GEGA 3WKEA 3GZJA 3WK6A 5T4HA 5EI5A 5JALA 3EF3A 2WIJA 3UUFA 3ESBA 3W04A 2VF2A 2H7XA 1PJAA 4UFPA 2H1IA 1A8UA 1MO2A 3DL4A 2WLSA 5A7FA 4NVRA 1UKCA 5HK9A 1XRMA 3V48A 2H7CA 2YXPX 2JEZA 1FJ2A 1QJ4A 3AFIA 2ACKA 7YASA 2QRUA 3B3QA 3I2FA 2WFMA 4N8DA 3YASA 3STXA 4EY8A 2ONCA 3G9ZA 3K6KA 4BCDA 4F5ZA 1E8NA 4FHZA 5LIPA 4F21A 3WWDA 2VT7A 4X7BA 1FFCA 1NX9A 2X8BA 3WL7A 1LZKA 2PKYX 4C6HA 2R8BA 5EIHA 3MUOA 4NS4A 1CUFA 1UZAA 2YH2A 1MT3A 1EH5A 1K5PA 1TCAA 2BUCA 1CFJA 3PFBA 2XMBA 4W1SA 1YA8A 3NUZA 2OCGA 3VJMA 2PU7A 3ILSA 4N8SA 5CT8A 5E4JA 3GBSA 4L0CA 1FFAA 3QMWA 4A5SA 4BP8A 3TGLA 4Q1VA 2J4CA 2R11A 3QPCA 2QMQA 4E15A 4CIAA 1EX9A 5ALPA 4OB8A 4FFWA 2PSDA 3U0VA 3BIXA 2C58A 4LXIA 5AI0A 4KEAA 1YAHA 5HQ3B 5AM2A 2XMCA 1IUOA 5C8VA 4LYDA 3GUUA 4FOLA 2HA4A 4BC1A 4L3WA 3WLAA 1XKLA 1C7JA 3FYUB 3AINA 4EBBA 5A7HA 1HLGA 3I6YA 1ZGBA 4I19A 3ESAA 2QZPA 5JASA 1MX9A 3QZUA 1GKLA 1MX5A 3FCXA 4E14A 3ANTA 5LP1A 4AZ3A 1MX1A 3WK4A 4H7EA 5JADA 5ALEA 1DT3A 1CUHA 1HKHA 1VA5A 1E8DA 5D7BA 2HRQA 4UHFA 1XZMA 3L1IA 3PFCA 1XZJA 3A2LA 3AILA 4H7DA 1QE3A 3G0GA 4DMFA 1R3DA 4NMWA 1EA5A 5CRIA 2QXUA 1LPMA 4TVKA 4HRYA 2XUFA 5T4EA 4WJLA 4UBOA 5AI9A 5K3BA 3S2ZA 1MNQA 5AICA 2PU5A 4FNGA 4U2BA 2GZSA 2RHWA 4H0CA 1CUAA 4B7ZA 4UHEA 2DSNA 3STYA 3GROA 1YB7A 3D2CA 3R3ZA 2Z5GA 2O2HA 3GA7A 3VJLA 3WL5A 4I4CA 2WG2A 3QBJA 4J03A 2HU8A 1F0PA 1R50A 5T4FA 5AO9A 4C89A 3WZLA 5LZ4A 4GI1A 4YPVA 3STTA 4OCZA 2WILA 3R3XA 3DOIA 1XZDA 4H18A 5FPPA 4KJXA 4UFOA 3C6BA 3R3VA 3WKDA 4LYEA 1QFSA 5J3JA 4G4JA 2XMSA 5T4BA 5AI5A 2PUHA 2CKMA 2HA2A 1VA4A 3GFFA 3LP5A 3FVRA 2QJRA 1BCRA 4MXDA 5HQ3A 5YASA 2OCKA 1A88A 2HA3A 3ED1A 5HK8A 5JZSA 1W4LA 2ROQA 4LXHA 2LIPA 5ALQA 1WM1A 4MEAA 1MJ5A 3ZWQA 1CUDA 3ICVA 3FYUA 2JGIA 3HI4A 2OXEA 4FKBA 5AKGA 4HVTA 1H22A 1RWQA 2WIFA 4X00A 4AXBA 5HF8A 4BCCA 5AK5A 4MQLA 1U65A 4DMHA 1WB4A 5ALFA 1YAJA 4BC0A 4B81A 4CG1A 4Y9SA 3QYJA 2WHQA 1WPRA 4AX4A 4BE4A 5AKZA 3D3NA 5LKAA 1G42A 2DQYA 1DWOA 2V96A 2WUEA 3QMMA 3C5VA 4K6KA 3A2MA 3PUHA 4CCYB 1ZD3A 2Y2UA 4IH9A 3OC0A 1DQYA 4UFNA 3GELA 5AH0A 2PSFA 1ZD4A 2XUJA 2XUDA 3F8SA 1XRPA 4UBLA 5AKYA 3DNMA 4EB0A 2BAGA 5LZ7A 4AMYA 1CUIA 2WHPB 5CXXA 4PV7A 3L1HA 4EY5A 1AZWA 3OTQA 1QIGA 3STWA 3X3HA 4QEKA 2W6CX 3H0CA 4U2GA 4KRXA 1AKNA 4UHBA 4JYMA 2AJLI 3WZMA 4BAGA 4J3JA 5AM0A 4MWSA 2XMGA 4TGLA 1T4MA 2B4KA 5AM3A 2WIGA 3FLEA 1UOOA 4Q34A 1VXOA 3CN9A 3IA2A 1VLQA 1LBSA 5K5EA 1ZJ5A 2JBWA 4G9GA 5ALDA 3DQZA 1RP1A 4PSDA 1X2BA 1XZGA 4J0KA 5HZGA 4BZWA 2WJ3A 1MN6A 1ETHA 2ORYA 4DYHA 1EK2A 4FNMA 2V97A 1UK6A 1B6GA 1ISPA 4WDQA 1XLUA 4DMCA 4X85A 3OPMA 4Y2TA 4IO0A 1WHSA 1L7RA 2QUBA 3QITA 1X2EA 4RNCA 2YASA 4OU4A 1AGYA 3UMJA 1E66A 1MU0A 4BATA 2OGTA 3MUNA 2Y6UA 5EHQA 1ZIYA 1HL7A 1H2YA 5DNUA 1THGA 4EA6A 3C87A 5DWDA 3JYHA 4Y2QA 4B9AA 2QTBA 1CUEA 1G4HA 2QS9A 3WL6A 5HKBA 2HA0A 4FLMA 4Y2PA 3EQ8A 1HQDA 1VJ5A 4K5QA 4BP9A 3BF8A 1LPAB 1XRLA 1QGED 5ALKA 1XQXA 4H7FA 1LPBB 2JGKA 4ROTA 2I03A 3DKKA 4ARBA 1P0PA 2PSHA 4QDZA 2J3DA 3HYSA 2DHCA 3WWCA 3PUIA 1LGYA 5JZ9A 1VKHA 2GYUA 1CUSA 1XZKA 3I6MA 3QMVA 4PSCA 1XRNA 4K6GA 4GHWA 4BAUA 3MVEA 5SYNA 5IVKA 2C5GA 3DYVA 1N5RA 1JJBA 2BGNA 2WHPA 4Q3OA 5ALZA 1ZOIA 5FUMA 3I1YA 4C88A 3EQ7A 4WDRA 2XQJA 3L1JA 4BRZA 4XWGA 4DNQA 3D5EA 3SK0A 3G9TA 1VOTA 4OB7A 3VJKA 4UHHA 4AB1A 2WFZA 2PSJA 5F4ZA 2O7VA 3IB3A 4Y2VA 4QWMA 4B0OA 4ZREA 2VAXA 2VA9A 3WQHA 4N5HX 2HDWA 3TRDA 4PO3X 3F98A 2XMQA 3B5EA 1UFOA 2UZ0A 3DS8A 1LLFA 2QVBA 2WQZA 1E5TA 1JI3A 5ALJA 3SWWA 3WK5A 2X76A 1U8EA 4FMPA 4UBKA 3V1LA 1R88A 2OAGA 4OYLA 4X6UA 4PSUA 1ZJ4A 3AIOA 5ALWA 4K2AA 5D3ZA 3V1KA 5JAHA 1XROA 2RGUA 3R3YA 4F60A 5AK6A 2OGZA 3D0KA 4GXNA 2GBIA 3JW8A 3D59A 1YA4A 5DJ5A 5FRDA 4GDMA 2WIDA 5AM5A 4ZV9A 1S8OA 1LPNA 1ODSA 2HRRA 1JFRA 3EQ9A 1SFRA 2ZVDA 2HIHA 4V2IA 1EDDA 1A8SA 1LPPA 4B84A 1H2XA 1O6GA 1XQYA 3C8DA 4MWTA 1EK1A 3HJUA 3D2BA 1CUGA 1ZI6A 3AZOA 1F8UA 3I2HA 2EDAA 2WIKA 5ALGA 3WWPA 4DNFA 1JJFA 5JIBA 1DTEA 4UBMA 4AN0A 1SCIA 1UKAA 5DNVA 4M0MA 5D6OA 3Q8WA 4KE8A 2G63A 5KBYA 3KXPA 3WL8A 1H23A 3ESDA 1LZLA 4KRYA 4HRXA 1IVYA 3I2JA 2W22A 3DKRA 4BTVA 3CCCA 2QT9A 2OQIA 3O0DA 5DYYA 1NU8A 3N0TA 3RLIA 2C5FA 1W52X 1BRTA 2B9VA 3H2GA 2WUDA 1EXWA 4QNNA 4PNZA 1WB5A 1QFMA 1NU6A 4QLOA 4X92A 1BN6A 4OD0A 2PVSA 5C8XA 3G0CA 5AKHA 1Z68A 3FBWA 2CB9A 4CG3A 4Q3KA 2DCMA 4CIBA 3K9BA 1AQLA 1VE6A 3O4GA 1DX6A 4WY8A 1UXOA 2BCEA 4BDTA 3RM3A 1CUVA 1G66A 4QA9A 3O4IA 1VXRA 1UK7A 4G8DA 4Q05A 2QOEA 3ANSA 3MGAA 1VE7A 1CR6A 2OLEA 1XZCA 3CXUA 1FFBA 2OAEA 4X91A 1AURA 3E3AA 2OPHA 2H9YA 3T52A 4QDUA 1EHYA 4DGQA 2G5TA 3H19A 4Q3LA 2CZQA 2K2QB 4WCVA 4LHEA 5JANA 4OB6A 3DCNA 3UUEA 3PF8A 4HS9A 4BCBA 5FKJA 3O4HA 3A2NA 3WMRA 1HDEA 5ALUA 1XLVA 1Y7IA 2ZSIA 1P0IA 4QDXA 2JEYA 2BFNA 5JAPA 4GW3A 4XIIA 3W06A 3WJ2A 4ZGBA 3RARA 1YB6A 2RHTA 3EIOA 1W6RA 2XUIA 4P9NA 1GKKA 4DIUA 5AK3A 5A6VA 1N5MA 4K6HA 2O7RA 2V9ZA 1C4XA 2HADA 5DLPA 1BE0A 5LZ2A 1AUOA 1TQHA 4KACA 1YS1X 3C45A 4BBZA 1XLWA 1U2EA 1RYYA 1MAAA 4Y2XA 5CT5A 2C0QA 4LIPD 2ZYHA 2QUAA 3G0DA 4BDSA 3A6ZA 1F0NA 1TK3A 4O08A 3V1NA 4J0JA 4UPDA 3SX4A 1ZGCA 3WKBA 2JGJA 5LZ5A 3QH4A 1CQZA 2XQIA 3R3WA 1E3QA 2B20A 1ORVA 4X95A 3IUJA 1K8QA 2BKLA 1HBJA 2VTVA 4TPKA 1CEXA 2PPLA 3LLCA 2YYSA 2HA5A 1UT6A 3H2JA 3Q0TA 3IURA 4Q82A 1XQWA 3VVMA 2WJ6A 1W76A 3FYUC 4UHCA 1GXSA 1R1DA 3BIWA 3QVMA 1BU8A 4CG2A 3WK7A 3F97A 2WU4A 5CT4A 1CUWA 3IUQA 1O6FA 4DMKA 5ISMA 1DWPA 3IVMA 1ORWA 5AIAA 1LPOA 3KSRA 4B80A 2HFJA 3G0BA 2Y6VA 1VZ3A 2Z3WA 2WHRA 3HABA 2JGMA 2DQZA 1A7UA 4HAIA 4G4IA 4KE7A 1QIFA 3BXPA 2DFPA 1K4YA 1VZ2A 3I28A 2FJ0A 4GLBA 4DSZA 2CBGA 5CMLA 3AIMA 1I6WA 5IH7A 1SCKA 2PL5A 3E0XA 5E4TA 3ZI7A 1MAHA 4IH1A 1TAHA 3KOOA 5AIBA 1SC9A 2XE4A 2BUAA 2XMDA 4LKOA 4FLEA 1J1IA 1OXMA 5AKIA 2C0PA 3V1MA 1CVLA 3BE8A 1H2ZA 4WFIA 2DHDA 3R40A 1DT5A 3G7NA 3WYNA 3H2KA 4Y2RA 1CUJA 4B9EA 3O9VA 2GYWA 5AKXA 2WSLA 4PF1A 4RE5A 4W1QA 4B85A 2ZSHA 5AKJA 2PUJA 3FOBA 2VEOA 4G9EA 3WIOA 5K3DA 1WOMA 4MQMA 5E4YA 1Y7HA 4RE6A 3H2IA 3E1GA 2BUBA 3C6ZA 3G02A 4FBMA 2WKWA 1SOMA 1XRRA 3DEAA 4N5IX 4J0DA 1GQSA 1WHTA 1E8MA 4BE9A 1QIMA 3STUA 2CEKA 2WUGA 3ZLTA 5CW2A 3H2HA 4PW0A 1QIEA 3C6XA 1ACLA 2E3JA 2ES4A 5DTJA 5ALOA 5EGNA 3M82A 3O9MA 5DNWA 1QO7A 5ALSA 3R41A 2C4HA 2HL6A 3FAKA 4OSEA 2RONA 4YK7A 5BOVA 4AO8A 4BAZA 4QLAA 3OOSA 3R3UA 3W05A 3KWFA 3I6ZA 3OM8A 3O95A 2NW6A 1W75A 4EY4A 1AX9A 1JU3A 1CUXA 3IBTA 5JD5A 1Y37A 2XDWA 5AHXA 4EHBA 2XQKA 3AUKA 4A23A 5HFNA 4UBIA 4HZGA 5AM4A 2VSQA 1R9MA 1G5FA 3W9UA 3IULA 4J0CA 4EZIA 5IKXA 3HACA 3IUNA 3LCRA 1P0MA 4E46A 1QZ3A 4JUIA 1B41A 4G1FA 3WJ1A 3RK4A 3C43A 1ZICA 1HPLA 1YCDA 1DQZA 3TJMA 4EY7A 2XB6A 3H17A 2Z8XA 4HXFB 4LXGA 2QJWA 3VISA 3FSGD 2WTMA 4RGYA 3TEJA 2WFLA 1QIHA 3EBLA 5AOAA 3I2IA 4CFSA 2VJAA 3SC2A 1JMYA 1PV1A 5BWBA 5C7YA 4CI9A 3M3DA 3FYTA 2AJCA 4MEBA 3F96A 1FSSA 4DSAA 2IITA 4WY5A 4B0PA 2RAUA 1XZLA 4A16A 2VQ6A 3F9CA 4Y2UA 1UOPA 1MTZA 4H7IA 2BGRA 4P92A 4X71A 5LZ8A 5BWCA 5FV4A 4UBNA 5JAOA 2IIVA 1TCBA 1OCEA 5H3HA 1DU4A 3WKAA 4AMZA 1TCCA 4QDOA 1QIDA 2PX6A 5AI8A 4D9JA 5C81A 1TIBA 3FLAA 5LZ9A 1EB9A 4X94A 5CH3A 2GBFA 2IX9A 3C6YA 1XRQA 1XZEA 5LLSA 2GBCA 3FWHA 3ZLUA 3BDIA 1ZIXA 1BS9A 5K3CA 4EY6A 4BRSA 1QLWA 2XUHA 3QM1A 4W63A 3DDUA 2EEPA 3U1TA 4X93A 5C8ZA 2JGEA 1MNAA 3NWOA 3I1IA 1L7QA 3HZOA 4NZZA 5ALMA 1R4ZA 5AP9A 2ZYRA 5AK4A 5KWIA 5D3KA 1XZAA 2RI6A 6YASA 4DNOA 3D7RA 2HA6A 4UBJA 1D07A 1CPYA 5A71A 3A70A 1BN7A 1CUBA 4X90A 1E89A 2HM7A 5JAUA 4DNPA 5FP0A 1ZD5A 3WWEA 4I3FA 2RIPA 1Q84A 1L7AA 4ZRDA 2XQFA 4H77A 1LNSA 3AJAA 3WI7A 2Z8ZA 1EI9A 3NOXA 1U4NA 4N8EA 4L72A 2QR5A 3IIIA 1W1IA 5JYCA 2JGLA 5HFAA 1P0QA 5ESRA 3NGMA 5ALTA 3F67A 3PICA 4HTAA 4UUQA 2O2IA 2AXEA 4H7KA 3DLTA 1J07A 4FDMA 1GT6A 1ZI9A 1CUYA 3WA7A 2D5LA 2XLCA 5IVHA 3LIPA 3ESCA 4BVLA 5FLKA 4U2CA 2VJDA 2OCLA 4QZVA 2I78A 3BDVA 5K3FB 2Y2VA 4UHDA 2WG0A 4RPCA 1JKMA 3H18A 5AOCA 5CTAA 1GGVA 3RKSA 4ETWA 5JZBA 2ECFA 1DX4A 3E4DA 4KE9A 3BJMA 1QIJA 5EFZA 5HF6A 2CMFA 5HCUA 4FLFA 1Q83A 1XFDA 3KDAA 2OCIA 2Z3ZA 3IDAA 2JIDA 3T4UA 5AI6A 3R0VA 3WYDA 3HEAA 4FTWA 4WFJA 3DJYA 1CV2A 4XVCA 2XUOA 5CT9A 1JT2A 4FBLA 2WU3A 3G9XA 4M0EA 5CURA 5ALNA 1QOZA 2QXTA 4ITVA 3C5WP 4FFVA 4KAJA 5IVDA 1JU4A 1XZFA 2P8SA 3H1BA 1XQVA 1X70A 4MYSA 1N8SA 2G4LA 5FOQA 2WJ4A 2JF0A 1GQRA 1YR2A 4HXEB 4E11A 2GYVA 4C4YA 3HRHA 1LPSA 2PBLA 5AOBA 5DTIA 1T2NA 4AQDA 3FLBA 1FFDA 1Q0ZA 4KE6A 3ZV7A 1IZ7A 3DL7A 3OG9A 3DYIA 4G8CA 1EDBA 3C8HA 4H35A 1UK8A 1XZHA 5ALXA 3DOHA 5CT6A 2QM0A 4J7AA 5AKLA 1GPNA 4INZA 3FSGA 2Q0XA 1K63A 4OU5A 4ZWNA 3PDCA 2FX5A 4OPMA 5JARA 1ZI8A 4IQ4A 2XUQA 3D4LA 3STVA 1H2WA 2XI4A 3AIKA 5FXMA 5JD6A 4J0GA 3G9UA 2I3DA 3WKCA 4J0HA 3BL8A 3D2AA 1QTRA 4P08A 4QDTA 1TRHA 2PM8A 5I9IA 1F6WA
chains in the Genus database with same CATH superfamily
4BNXA 1NUSA 4UATA 4C76A 1GO2A 1NR7A 1UBTS 2BM1A 2O3SA 3HA7A 3RGWS 1J1ZA 3RYFA 1O03A 1XI2A 2HFKA 3BJRA 4JIMA 1GQYA 1N25A 3P5BA 3QEKA 1W5FA 4P86A 5HQJA 1XYYA 2C03A 4KYVA 4YRKA 4XDGA 4XIYA 2B2NA 5K3FA 3K2IA 1U04A 4D4GA 3QG1A 3K71B 3PDWA 3GU3A 3UCFA 3EFEA 1O95D 4C43A 4F2DA 1BEZA 2GFHA 1E2GA 1R74A 3DFKA 3MLEA 4QOHA 3WIUA 4F6RB 5B53A 5KHAA 3ZZNA 5CIWA 4BLPA 2ENUA 4Q66C 3AETB 1HI9A 3HKEA 1PT9A 3A6HA 2RGGA 3AW9A 4MW4A 2IC5A 1A97A 5AVJA 2ZM6B 3F5SA 3PK0A 1VPTA 1GUAA 2VPZA 4KFRA 4NENB 2FZLA 2PRSA 4OM7A 1DJOA 4PWZA 1ISSA 4U7WA 3T35A 3VDQA 3DE2X 1J0BA 3Q6IA 2DR2A 1ADGA 4H3KB 4JI3B 4B5LA 3GAZA 4I2NA 2HJRA 4FSHA 4P0QB 3OQVA 2TMGA 3KOZA 3NDIA 4NDAA 3A8TA 4X6XA 3EXEB 2NUBA 5BV7A 4BUCA 5JATA 1YMQA 2IU4A 4XDZA 4F71A 3S8EA 2RH5A 5ALVA 1CJKC 2G88A 4Z4HA 3WISA 3AZQA 5I7UA 4XTRA 5LWHA 4J76A 3AEXA 4C6SA 4GR5A 1Y5MA 4UU1A 4EGFA 5T6MA 1O0CA 2VAVA 3ND7A 5JS8A 3Q12A 5K8IA 3EJWA 2R6GA 4ZVTA 4ILKA 2PL3A 1OA0A 4NG4A 4XWWA 1ST2A 5KNBD 4A0HA 1C8LA 2J41A 1EQUA 2IOFK 2HDOA 2JFOA 2MMGA 2PVCA 3N74A 4WMLA 5CH8A 2Y0DA 3VAZA 1YSCA 2H6EA 4BVAA 3AT1A 4YAIA 2DBQA 4KR0A 4RMJA 1I3OA 2UXDB 1ZWLA 4MV3A 4YJFA 4KLCA 1IHYA 4R5HA 2OYRA 1P0CA 4U39A 2I2XB 1OU4A 2XWQA 3LX5A 3RS7A 4UMDA 3PQEA 4IZOA 5K2MA 2B1QA 4M98A 3VSCA 4LHZA 1M2OA 1X42A 3GJTA 3W2TA 4GMKA 3HUEA 4B83A 4G0YA 4PZCA 2QIPA 3VR4H 3C3PA 3UYLA 2G80A 4UNSA 1A5AB 1R00A 2VPYA 4PGFA 5HZHA 2A14A 4OP1A 4KREA 4P7FA 2YIMA 4GRIA 3GLIA 1YASA 1BTOA 4YJ3F 1IZ8A 1EGMB 1RQ2A 4PYOA 3W8NA 3KR1A 2EQAA 4MLZA 1G5QA 4XJVA 3UH1A 4QYMA 5KQRA 1DQNA 4CEIA 1VPLA 4BV9A 4K3VA 3L0IB 1RAGA 4YP1A 5DN6D 1KO5A 4UTXA 1JEYB 4HDKA 5A9SB 1J21A 2OKCA 2J3LA 4CVNA 2D59A 3O38A 4MRMA 1YHZA 3OFSA 4UVGA 4GPEA 2IS1A 2H4JA 1EG7A 2D1RA 2IUUA 3OO0A 1CR4A 4FWBA 4PZ0A 5DGIA 4CKEA 2OCYC 1K8YB 1KI2A 3QGMA 4DM4A 2QL6A 3QEMA 4JJ6A 1DZ3A 1JJIA 1T3LA 1NQOA 2HCRA 4K9MA 1R9NA 3RJZA 3HVRA 3J7AC 1PJ2A 1UWLA 2YV5A 1Z5WA 5CA0B 1W5SA 4MA5A 4IXMA 1X3SA 4KPGA 4O3FA 2UVQA 2EFYA 1LXCA 1XCLA 4HYEA 3ONNA 2YVAA 1Q0UA 1YRYE 3CNHA 3IKLA 3UKJA 2Y76A 4X1KB 1IZ0A 1O08A 1W4RA 3X44A 5DLYA 1JDBB 2X5XA 2B9EA 1LW6E 3UXYA 4NBUA 4G5GA 3PIDA 4E11A 4DM7A 5EHXA 1KJWA 4S12A 2ODNA 3K4HA 1O6ZA 3HXLA 3EXHC 1K6EA 1KGSA 2WA2A 2ZJ7A 5AQ1A 4IQFA 1WXEA 2Q4BA 3DW1X 5SYAA 3T99A 2J5RA 3DZFA 2NYRA 1T8YA 1AA6A 4IICA 5DOZA 3SDBA 3W5IA 4U00A 5C4MA 2XUKA 2LD4A 4BX9A 5EIEA 5K4GA 2A67A 3CB2A 1CX9B 3JATA 3QLVA 5JC8A 3CRVA 1XTPA 2WB4A 4HAWA 3VXKA 5BWCA 1Y7LA 5FNVB 1TZKA 1WEKA 4LQLA 2W4QA 4C4XA 4DLKA 3TIVA 1YDHA 1ICIA 2V7WA 4WKNA 1UANA 1M73E 2WKRA 3HJBA 1Q0RA 2F90A 2I2BA 2ZTHA 2JGFA 3VH2A 4CKXA 1KEUA 2OVBA 1HE3A 2WT8A 3EG9A 3PRYA 2VDJA 4D9BA 3GV0A 2I5PO 5ADHA 3HJFA 1MEEA 1QVAA 3NVMB 5EHIA 3QWFA 3R6DA 1H9CA 3IP7A 2CWWA 1NWHA 2P30A 3OJEA 1Z35A 4RKWA 2QL5A 3MMNA 4KN9S 1O97C 4CMEC 2BYTA 1V9CA 4F3TA 3BMCA 4NU0A 4BASA 3NBXX 1KERA 3WLQA 5HFJA 3R5FA 4ZI5A 4KPEC 1VI6A 3KYBA 3NRJA 5IK2A 1OHHD 1WIWA 4Y2SA 4BMDA 4QTYA 4H60A 4MB2A 3HLKA 4AZ0A 3KAJA 1J99A 4BB0A 1WUHS 5K6AA 5J2TB 1XFAA 3VZCA 3RT1A 3PHCA 3MB5A 4KXNA 3G1WA 1U3CA 3B6KA 4WZAE 4BNKA 1R0SA 2YQ5A 1RADA 2A33A 1QANA 1TMGE 3I32A 3QHPA 4HSEA 1GZSA 1WETA 1NQXA 4R9UC 4KK3A 4WZBE 5KX5F 1W85B 3WGNA 5FUWA 1GGJA 4R4JA 3U3MA 4AO6A 1ULAA 3FA2A 3UOGA 3L01A 4KZPA 2XTZA 4HWSA 2R47A 1NP6A 2BBSA 3CZQA 3D1LA 5AW2A 2L42A 3L0YA 4ZARA 3E22A 5B36A 2OQ2A 4E70A 2GCOA 2XGJA 2HHAA 1BXZA 1RYBA 2OWDA 1XVUA 2X7HA 3B1YA 3V2UA 1DRUA 3D3WA 4OUKX 1BCSA 1V7CA 3KJXA 2YHIB 1RJEA 3B2EA 4ZIRB 2Y67A 1M7BA 4F6LA 3DBHA 3EZ7A 3Q3VA 1YRQA 5HS4A 3PDJA 4NDZA 3GPBA 1SIUA 1ZNXA 3PTLA 3CIOA 5HG0A 2IYNA 2EW1A 1MC4A 3HCEA 2XEXA 3BF7A 1QH9A 3VOBA 1E9FA 4AKTA 3CG4A 2WTBA 1CUUA 2QT1A 2XBUA 2D6FA 3A25A 1DUIA 4MUAA 2ATIA 3QPAA 4PC6A 1CF4A 4TS9A 1E3IA 4I81A 3ONVA 4BQEA 1CEYA 3NC1C 1Y1PA 3BL6A 1EE2A 3NWPA 4QYSA 4RHXA 1BG6A 1J0XO 5EQJB 5IPFA 1AUXA 2SECE 3SJZA 3KHSA 3A05A 2C7QA 3PQDA 4KWCA 1KZ6A 2C9ZA 2OG1A 3UBMA 1G8HA 4KAAA 3NVKI 1Z0ZA 4CM9D 1UBJS 5D8DA 1IQ0A 1UWCA 2WA1A 4MR9B 2JZNA 4KAFA 4HR7A 4FOPA 5JVDF 2R3SA 1VHQA 4R81A 2B8NA 2CMDA 4GPZA 5KDOA 1H5UA 1AMNA 3ZLVA 1CY7A 3CVVA 4PN7A 4BQRA 4QREA 1VI2A 3HXKA 3K9HA 3MOSA 4YRBA 1BEEA 3QE4A 3QF4A 5JNWA 1VCHA 3EVAA 4DFDA 2PA0A 3SU8A 1M2VB 1TU3A 3EULA 4LCEA 4X3PA 3V33A 1WB6A 1JP7A 4L51A 3BWXA 3KZNA 5FWNA 3LXUX 4BMPB 4OJKA 2AG8A 2Q1TA 5DV9A 2ZYSA 4FVTA 3P1JA 3PE6A 1YZUA 4YRCA 3ZNPA 3WB2A 1EVQA 1N77A 5GAJA 1R37A 1XK6A 4P5PA 5BSKA 1TCUA 3EIUA 3KOUA 3WAJA 2B8JA 1ZS9A 3G88A 4Q1CA 5A6SA 5BMVF 4N5LA 3K9LA 4CCWA 4AY5A 1RABA 2ENWA 2H06A 2WM2A 2OSVA 4IM7A 1PIWA 2WTAA 1E2HA 3VNSA 1A4UA 3DAPA 2VH5R 3B7PA 2H1VA 5J59A 5EIAA 1U0EA 4DBVO 4JUBA 4K8OA 1XQ6A 2GLTA 4HUQB 4A8JA 1RM3A 5AVTA 1YDMA 3VKFA 2WHYA 1RWMA 2XMZA 4ZVNA 3RSFA 5FWXB 2ZI7A 3SYRA 4OLAA 2ZRPA 4M2LA 3KQMA 1O2DA 2GOYA 2X2PA 1NKSA 2YWEA 1SN7A 3GARA 4MINA 4G1CA 4B34A 5LP6A 2ZZMA 4DR6B 4MK4A 4ND1A 4OKIA 3SZUA 2HA7A 2PBFA 4UDXX 4Z1MA 3L84A 2BI7A 1Y82A 3QUQA 2JFUA 1ZSNA 4XLLA 4HEA6 2R1VA 2H31A 3RYHB 1IOVA 2QENA 3H8WA 3V5NA 2FZKA 2IHBA 2YWJA 2GEVA 2W2VA 1BJKA 4IHJB 2WSIA 4JCOA 3WIBA 2QI9F 4EMSA 1TZ2A 1H3FA 2XECA 5HJ2A 1W4AA 4UKDA 2XH8A 3VH1A 2QYTA 1EG2A 2AQKA 3HUUA 4C9BA 1RFLA 5F33A 3E9ZA 4MUYA 4NJEB 4P3OA 3H1AA 1E5VA 4GH5A 5JSZA 3I8SA 2D8MA 3SM3A 3SXJA 4MV9A 4FSDA 1SU7A 2JLRA 3RVKA 4U7TB 3B5IA 1ITZA 5BYKA 3UYKA 1JPJA 4XJSA 5I8WA 4BVKA 1EFKA 2H92A 4J6EA 4BNGA 3ZV4A 4KSYA 1MZVA 1V6CA 3L40A 3ESXA 4R2IA 3KEOA 2C4MA 2PKWA 1DLJA 1J5EB 1TEHA 3H4IA 4XVQA 3NV9A 5KVSA 2FRXA 2GD1O 4LF8B 2VAWA 5C7IO 2MR5A 1SUPA 3N2LA 4G63A 2JFYA 3K1AB 4FJ1A 3GEPA 4U2FA 5G1OA 4V0LA 3FKSA 3ZWAA 4DLNA 5SYMA 1D1TA 4NP6A 3RLFA 3VR3A 2HY7A 4C07A 1ORHA 5INTA 3GZJA 3AF1A 3OFNA 2B2XA 2HWUA 1KRHA 4Y6GB 5AXAA 3WK6A 3QW2A 1OT3A 5T4HA 4D9HA 4YUAA 4QXMA 5JOQA 4YLYA 1ECGA 1SXQA 3TG8A 2ZYVX 4ALJA 5JALA 2FR8C 2W2NA 4HB0A 2XCOA 3KEQA 3IBYA 1FU7A 5FWYB 5LMUB 3UUFA 2ORIA 2HRBA 4R2LA 1XKQA 3ESBA 3PNBA 4TL6A 2X6RA 1C1HA 3MT9A 4L4SA 3I9V1 3PFKA 4QXQA 4YLEA 4REQA 2J6HA 4ZYZA 1KH3A 3DBLA 4K1LA 3QXJA 4J1TA 4Q7KA 4X64B 5HZKA 4DV1B 4DR1B 3TUJC 1G3MA 3R7WA 4UFPA 3R1IA 3DL4A 5G0TA 1JBQA 2LDBA 3LOQA 1TPZA 3DYBA 4BFLA 1U0HC 1WXXA 4NVRA 4R5MA 2F8SA 2H7CA 2NQTA 1UXIA 3DV0A 4DSTA 5DXAA 2YRFA 1ORRA 4OXRA 3FYSA 5BVHB 3HK2A 3UJNA 2Q3HA 1N2EA 2YXPX 4ZU6X 2Q0QA 4ZQIA 1SC1A 2G06A 2JEZA 3GHYA 4JY7A 4BQOA 2BFBB 4II2A 4LS3A 3U16A 4P4SA 2ACKA 1J0CA 1EFPB 1JHUA 2QX7A 1G3RA 3I2FA 4XYMA 3J81A 3N6XA 1RBYA 4TQGA 1XJWA 3D7MA 2Z1NA 1GG9A 4IEIA 2ZU6A 4WZAA 1JDVA 1WMSA 5A5EA 1XR3A 3PR3A 3ZHBA 1J8FA 1U7WA 2VWGA 5A3VA 3VGPA 4BCDA 4F5ZA 1UAAA 1E8NA 1Z4OA 4MJLA 4EHHA 4A5OA 3WWDA 2P90A 1J49A 4FFBA 2BZ1A 1FP1D 3NBMA 4Y98A 3TKAA 1JA9A 5HIKA 1C1YA 1P1CA 3CSDA 5JS1A 3A7DA 2W2LA 2V45A 1KE2A 4CV1A 2X8BA 2FWRA 1W9MA 2XDQB 5E4FA 4FS8A 1LLQA 1NM5A 1LZKA 3ENQA 3ZWVA 3BXXA 3C5EA 1FNSA 4PAQA 3KXLA 1U0OC 1EVIA 3MUOA 5EIHA 3OJXA 4URWR 5I45A 4NS4A 4YMGA 2B5VA 4ZJPA 2W48A 2YH2A 3T3MB 1G20E 1WW8A 1CNMA 3RS2A 4I7EA 1RE0A 2QLBA 4Z0NA 1TCAA 2W70A 2BUCA 4C06A 4DPLA 4F3KA 4MVJE 2GN2A 1FXUA 2XMBA 3CJRA 3NUZA 4OI1A 2HT6A 1OLSB 4KODA 1JIKA 3WB0A 3T15A 3WRWA 3OZUA 1RC8A 4EK9A 5A3RA 2H9IA 2PU7A 4B1FA 3LSTA 4G84A 4RJLA 4E2YA 3P52A 4I5IA 2PWBA 3FB4A 4GX5A 5DTEA 1ZG3A 3VGJA 3OIWA 4COOA 2DMRA 3TUZC 5IDVA 3BIJA 3GBSA 4O2AF 1GFZA 3H4TA 1ULBA 3TGLA 1KQ3A 2O20A 1J6UA 1J8QA 3OUUA 2J4CA 4ZMBA 1I4TD 1PJ4A 2C88A 2ZT8A 4E15A 3IX7A 1EUCA 2W42A 5ALPA 4BVEA 4W99A 4BLVA 4JC8A 1OLXA 3TXYA 1ZRHA 4RMIA 3ZTTA 1R18A 4FFWA 1CHDA 2PSDA 5FTMA 2NAFA 3RTAA 3BIXA 3ZW7A 5JISA 4KRGA 4A8HA 4IFBA 2YCLA 4LQ4A 2CJXA 2RKBA 1T36A 3HNRA 5BMOA 3FCCA 2ECQA 2NU7B 2SKEA 3DLIA 5AM2A 2HT1A 2XXBA 2XBMA 2XMCA 3OJLA 5C8VA 2X5NA 2GERA 3GUUA 4FOLA 2AN1A 1Z5OA 3MGKA 1NUAA 1RYMA 1A0OA 4B2IA 5A3SA 4X60A 2H2WA 2QVYX 2ZIFA 4JA2A 3W5UA 4KN6A 2HKIA 4OQPA 1XKLA 5EIFA 3PFGA 4X66B 2DRIA 4EBBA 5A7HA 2NO5A 1MO3A 5DEIA 4FWTA 2X0JA 4I19A 4QJIA 3ZOKA 3ESAA 3DLHA 3H9EO 4HS4A 5EZYB 4BLWA 2GA9A 4J1NA 2EQBA 1KK3A 3JPWA 1Q77A 1VMAA 5G0UA 4DCNA 5FAXA 4Z9BA 1KMCA 4O2BF 3WLLA 4R2KA 1DPGA 1GKLA 4QOJA 5DBFA 1U2PA 3B9BA 1JLHA 2IEYA 2E1PA 1MX5A 2KI5A 2LBPA 4HK4A 4Q3NA 1FDRA 2C97A 4FINA 2A0WA 5IJ9A 1IIRA 4YH1A 5LP1A 4ZOLB 4NPHA 2ILVA 2IZ5A 3E58A 2GJ8A 4CTJA 4KXXA 4HQRA 4G56A 3IOEA 2ZR9A 4Y2HA 5JADA 1ZK0A 2LZ0A 1DT3A 1NSTA 4PG7A 2IXFA 1HKHA 2A7XA 3JRNA 3CNQS 4G8JA 1TZBA 1XEWY 1XNGA 3RSQA 4UHFA 4ZHQB 2WVJA 1XZMA 4KWIA 4WI1A 1DAGA 4WESA 5JBQA 3CUTA 5A06A 1WMEA 4BP3A 1PFGA 3BXZA 2YL2A 3CJQA 1L5QA 3Q88A 4H7DA 2DF8A 4DMUB 1B8NA 1QE3A 3FI0A 4O4HB 4BKRA 1FBNA 1Y9EA 1SXJD 2HEIA 3EWSA 3QKUA 4F8JA 3QA3E 1YE3A 4UXJA 3G0GA 5M34A 3AXTA 3C3BA 2X14A 3LW8A 3EPKA 1NJ2A 1R3DA 3NHBA 3O75A 1E7SA 3A06A 2GTHA 5KOHA 3OLZA 4DLZA 4A0GA 2BDEA 2H2DA 5KOIA 2QXUA 1GPMA 2ZGVA 1LPMA 2AR7A 2PMCA 1KO7A 1N8TA 1JG1A 2PMBA 2VTDA 2XUFA 4HRYA 4MNTA 2ZUTA 4KB5A 3V3KA 4ITUA 4MWCA 1GP2A 3LDHA 1NVMB 5DB4A 3LWNA 2GWHA 4YVFA 1YBMA 1YJ5A 2GB4A 4R8LA 2NX2A 1K8XB 1S2NA 2P1RA 2WJZB 2X8LA 1A2OA 2A3RA 3IR7A 5DK6A 3S2ZA 3NATA 4KOAA 2Z4SA 1PZFA 1M67A 2PU5A 4U7PB 3V7WA 1TRKA 4K6OA 1JQAA 1R6TA 1ZW6A 3DP7A 3M5WA 3V32A 2GZSA 3GRAA 4I1IA 4BNWA 2ZTLA 2B30A 2BR3A 1L5VA 4IJKA 3FNIA 2Y8EA 3AEQA 3AERA 4OQXA 4K2HA 3UZUA 9MHTA 1U9JA 1EIZA 1QS0B 2Y4OA 1BW9A 4G24A 1ONOA 3O03A 1B4DA 1L1FA 4LY3A 3V8BA 4CDGA 3ZVMA 3MQ2A 4M53A 3NAQA 5KU7A 3JS5A 2SNIE 2HJWA 3K8OE 2Y68A 3WBJA 1I51A 3HR4A 3TR6A 4BXOB 1YB7A 3H1GA 1AS2A 1B8OA 1II8A 3NT2A 1A82A 3W1WA 3S44A 3AGPA 2C0CA 2QU8A 3EUEA 3WB1A 4LJ6A 3G79A 3E4CA 4Q4JA 1UKVY 4Q1FA 4FUTA 1RQNA 1Z37A 2WG2A 3T61A 1TT5A 4HZIA 4AVYA 3ZV6A 1NR1A 3PGKA 3VO1A 3BM5A 3KJZA 5IVPA 5AO9A 4C89A 4DDUA 5CBPB 5LZ4A 2AHRA 1XYVA 1KYYA 5I3ZA 4D3SA 3CSSA 4KP7A 3HU3A 4XXHA 3TSCA 2ZCVA 1ZMTA 1T2FA 2HIAA 3STTA 3AESB 1LF0A 1US8A 3THYB 2CNWA 4OCZA 1L4HA 3QUBA 1P4HA 3R3XA 4TUYF 1OZFA 4L6CA 4H18A 5EP1A 1C1XA 4GXRA 2EZ4A 5I7OA 2FPIA 4EJMA 1YDWA 3FM9A 3ZWOA 4BO5A 5BPFA 1V8DA 3ECSA 1GLNA 4LDRA 1I2BA 1HNZB 2IS4A 1G9TA 2REQB 3S7ZA 3ZYZA 3WKDA 4LYEA 1QFSA 5CG2A 2HR1A 1KA9H 3Q7PA 4AC9A 2JFZA 3HWWA 3K35A 4XUEA 4PZPA 1XWFA 2NZ8A 4Y2PA 2N3ZA 1ZITA 4R6XA 3TZCA 3WDSA 1XLTA 4G4JA 4LDPA 2ADMA 4LJAA 2O3UA 3UFXB 3TLMA 1Y0BA 2Z56A 4JODA 1PG0A 2VYVA 3BT7A 1I2ZA 4N5NA 2CKMA 1RVDA 2C42A 2HA2A 3TQHA 4GM4A 2RIRA 1FDVA 1OXBB 4BPRA 1MO6A 3OLWA 4XB2A 5K09A 3CLUC 4HXYA 1YUMA 1URPA 2UZ3A 2IPNA 1NVVQ 1RRVA 1WHSB 2EFEB 1PDVA 2C29D 1E1RD 1A88A 2OCKA 4X65B 2IZZA 1ZN7A 5CB0A 3HNPA 1ZJZA 1IMOA 2B98A 3RASA 1AE1A 4N6NA 3WYAA 1HSZA 3VR3D 1LY1A 1MJ5A 3NHZA 1V41E 3EVEA 1DV1A 1CUDA 5TSDA 1DKOA 1UR5A 2D5CA 1E1KA 3EFBA 3ICVA 1G20A 2IXTA 1ENZA 1WLSA 3HA3A 1M9NA 3FYUA 4RK6A 3ZI4A 2GJKA 2VOJA 2HWYA 3F46A 3FDIA 3K7EA 3P32A 4MW6A 4YIHA 2ODBA 2FEAA 4PGAA 4Q3DA 3B3AA 4FKBA 4MVJA 4C4OA 1WPQA 4HGNA 1ZONA 1H22A 1T15A 3P71T 1Y4SA 3X1WA 2WIFA 2ZK7A 3BZBA 3NOQA 5CX1B 4JHLA 4AXBA 5IWAB 1Z73A 3Q5DA 1Z6YA 2EBFX 1FDOA 4NL4H 2H59A 3AFMA 1NXWA 1KI6B 4EJFA 3N8HA 4D41A 2UYHA 1DIAA 3VKGA 2MYNA 3K96A 4D6YA 3IAM6 4NMMA 2O50A 3BXOA 2HHLA 2PKRA 4I9UA 1YBHA 2E21A 4XQCA 5HIMA 4QM6A 2H4FA 3V4LA 3W79A 2BN4A 3DL0A 1NXOA 3OCXA 3TZEA 1QCDA 2QUKA 1GNSA 4V39A 1U2ZA 4U02A 5SZHB 4EA9A 3JAKB 4RADA 2O19A 1O94D 4CG1A 1XALA 3ROGA 2O1XA 2EKZA 1Z0KA 3WNDA 4N39A 2JFFA 4IQ0A 1I4OA 4WCFC 4BE4A 2F1HA 4MIYA 5F9HA 1JXOA 4TLCA 3SZRA 1FYFA 4DRZA 3O7MA 3MINA 3RQIA 4ENVA 1IG0A 2GBPA 5DE3A 3ZYCA 2GPNA 2JASA 4LHVA 2A1TR 3D8BA 1NQUA 2DQYA 3DOCA 2DJIA 2WUEA 4KQIA 3BERA 1INLA 1ZC4A 2PWZA 5K51A 4A10A 3B52X 5JEDA 2F1RA 1IHXA 4B6JA 4YCNA 1P33A 1ID1A 3PUHA 2D7CA 5COQA 5NLLA 3ZHXA 4DNXA 2CDNA 1NW7A 1K8RA 2IYQA 2OZLB 1X0XA 1WMDA 4HN4B 4FXPA 2RGCA 5EZQA 4GGPA 2DOKA 4DW8A 2QGZA 3C2QA 3GELA 4MGKR 3QVVA 2VQFB 1ZD4A 4ID3A 3L8ZA 2BR5A 2XUJA 3IKVA 2XUDA 1A95A 2F1OA 4FHGA 2NTYC 4NOJA 3U4CA 1Z63A 1XRPA 4FILA 2OAQ1 2Q2VA 2P9HA 2H2FA 2FN9A 3L3BA 1X1SA 2A86A 1LRKA 1FMJA 3TFOA 3R3JA 2BAGA 4RQBA 4YJGB 4JITA 2P9CA 3VPSA 3VTKA 1G19A 1V39A 2RCNA 4UZFA 3QPUA 2H08A 2V6MA 1CUIA 2WHPB 4MP8A 5A4JA 2E9SA 3CRZA 1XAIA 4G5HA 4L4RA 1LI7A 2CGEA 1AZWA 3KPWA 3OTQA 1FFXB 3CUUA 4NX2A 3I4FA 1JV2B 3ZU3A 1MEOA 2AOXA 1G4AE 1JQKA 2AFIE 4G5FA 5LM3A 4TYYA 1B2RA 2I3GA 4ZODA 3ICOA 2W6CX 2GNOA 1AS3A 2AI2A 2HSDA 4U2GA 1AKNA 4LXQA 4WLNA 5EUCA 4B6FA 3IKTA 1MW9X 3G1TA 1YL7A 4JYMA 3W6OA 1T2UA 1Z7YA 3L8DA 5FPYA 4R2MA 3JQCA 5HCNA 4YXFA 5JV5A 2QD1A 2PWYA 2VFAA 3E5NA 3C3YA 4BJ6A 4GSLA 5KVCA 3L4KA 3AVWA 2FW6A 4KG7A 2XNHA 4ACBA 5KYKA 3MWGA 2IKQA 1C7EA 1BKYA 1RI5A 2IHZA 1ZVQA 3O74A 3EMDA 4D44A 3INGA 2XMGA 3PFNA 3NR2A 3C41J 1ZM7A 2NZ2A 2PZBA 3OZEA 4TGLA 1T4MA 3IPAA 2RBKA 4CR7A 1NVKA 3MJRA 4AWXA 2Q5FA 1CT9A 4B3FX 4CLEA 1ZVMA 2PKQO 1PJ3A 1Z4IA 2Q9CA 1Z2NX 3L7IA 4GOKA 4DC0A 4YN3A 3TTTA 5KTOA 3W2GA 3IQWA 4HDRB 1OZAA 2EEZA 1FQOA 2FTKE 2FPMA 3NG1A 3PIRA 1U7XA 3NFRA 1U8FO 3IA2A 3W3AD 1J33A 3H2YA 3PRKE 2JLXA 4CV3A 2JBWA 4G9GA 1GFSA 3JD1A 1EWTA 1LS1A 1XEXA 1JSRA 1RAEA 1Z5UA 4PSDA 3MXOA 4J0EA 1ZO8A 1DC3A 4HB2A 3TEFA 4EB3A 2VHTA 3N2NA 1KBQA 4J0KA 3VFDA 3FZNA 1ODIA 2I6TA 1XN4A 1IATA 2ORYA 3HDJA 3H84A 5TQ0A 1WKCA 2GZHA 2RHGB 4G5QA 4ISBA 1HXHA 1Z62A 1TUGA 1TK2A 4IV0A 3E48A 1UK6A 1MJGM 3B3GA 3NRCA 4JLSA 3BGWA 5F7OA 4YHHB 4X85A 4E0BA 3HP7A 4TKLA 4W7IA 3WY9A 4YY3B 2QUBA 1P5HA 1VIAA 3UWSA 1K6XA 1KEEA 3FHTA 2WK1A 4BL5A 3K0FB 3H4MA 3OM0A 1E58A 3OCCA 2D0OB 1BFUA 4RNCA 4HNGA 3JX9A 4LSWA 4MR7B 1ILWA 2IQIA 5L3RA 2XB4A 1XCPA 4OU4A 3ELWA 3UMJA 3HJTA 1NIPA 3X1YA 4R71A 1U0BB 1CZNA 1MU0A 1XVAA 3NEPX 1SURA 4BQNA 2CDBA 5AQEA 2QMYA 2XZDA 4AQYB 1QH8A 4RIIA 2Y6UA 2DTDA 3BWCA 1SJ9A 3IE0A 3NGXA 4O1HA 3ZQUA 3FHCB 3PNSA 3VOAA 5EHQA 1ZIYA 4L4UA 1H2YA 3NTVA 4TSFA 4UAUA 5CFLA 2GRAA 3FF1A 1I24A 2FZWA 5AT1A 1ZVKA 3JYHA 1FVOA 3DZDA 2QTHA 3EHDA 1CUEA 1G4HA 2MDTA 1E2JA 2VO1A 3HKBB 3KSUA 4UEQA 3WL6A 1NV8A 3N5CA 2JBAB 4Q4LA 3EYWA 3AY0A 3W8DA 3DE6X 2AL7A 3F5DA 3BKXA 2V9PA 3AVPA 3CLKA 1XL1A 2Y4NA 3LXMA 4JKOA 4LKRA 4Z0PA 1QK3A 2RHHA 4ZO8A 3BF8A 2P41A 1A71A 1V8ZA 3RS4A 1RKVA 2QSUA 1LJUA 1YR3A 2WJVA 1LPAB 1XRLA 4TTJA 2A9VA 1F4VA 3VZQA 5B2ZA 5EJ9A 4OJYA 2HMVA 4CMEA 4JB0A 2CF5A 3VYWA 4LJSA 1BS1A 2I03A 3GUCA 1G16A 1ESMA 4MQ4A 1P0PA 2AEFA 2J3DA 2E87A 1XMOB 1SPBS 1H1LB 3G1UA 4Q1EA 2FX2A 4DUGA 2DHCA 3BWVA 3OPVA 4R98A 3WWCA 4C20A 3IR6A 3ONWA 1X15A 2F00A 2W8BA 4D8TA 1JEDA 5C35A 3E7DA 3EEIA 3VR6A 1E1DA 1QNLA 4QU8A 1UL1X 1WG8A 2EJTA 3DJFA 4J1QA 4HFNA 4L3VA 2BM0A 1LGYA 3A4VA 4P7BA 1JDBC 4J29A 2A1IA 4LK3A 1OFUA 3E9MA 4TWAA 4PS1A 5CEEA 3RVBA 1TVKA 2C8VA 3NB0A 4WACA 3EF0A 3OZGA 4JHXA 1VKHA 3WGGA 2PV7A 1QSGA 3K0KA 2BBTA 2PO7A 3I6MA 1IFXA 3QMVA 4G09A 4KTVE 4K26A 5G40A 4K0RA 5DHTA 4MMXB 1U8ZA 4IEEA 2XTAA 1L4LA 4YMHA 1S3FA 3GJ4A 3ZZUA 5JW6A 3FUVA 2ZJ8A 3JASB 2NVUB 2A6PA 3MVEA 4PLTA 1C9DB 2QD5A 4QPCA 3WGZA 4QXOA 4YDRA 3N2IA 2CNOA 5GWXA 3HL4A 2JS7A 2QTWB 4ND3A 3CNNA 2O9JA 5HCIA 3ZQJA 1M1NA 1IN8A 4M0DA 3WBBA 3IIKA 5LQRA 3L7CA 3NRBA 4MTLA 4CF7A 4EQ6B 2QV7A 4OLBA 1MDFA 1P9LA 1FYDA 4NLLA 5FUMA 1JDNA 1E79D 2FLKA 3MXTA 1CEQA 3A9CA 3ZCPA 5KYXA 1EBUA 2GF9A 3LCMA 4WDRA 1C4OA 3ER8A 2QV0A 4IUDS 2V9CA 3QG5A 4Q4AA 3AYZB 3OE7D 1W1UA 4YMWA 4BRZA 2VF8A 2BP7A 1HZJA 3BZUA 4GC9A 4DNQA 2BI4A 1YUBA 4RHTA 1HGXA 3R5TA 2CD9A 3SQXA 2BW0A 4G0NA 1FW6A 1ZH0A 4TV8A 1K7SN 1R5BA 3SK0A 1KI8A 4MUBA 1Q0LA 1QHGA 1VOTA 5CPBA 1GLVA 2FEKA 4NXMB 1C2YA 1P39A 4K9DA 1V71A 4GO1A 4AB1A 2WFZA 2XF8A 3HCAA 4RMGA 3RTBA 4AIRA 2PSJA 1JHQA 4LHSA 3KV1A 4U2KA 1B3RA 3WWYA 4Y2VA 5ILGA 3WRYA 2GCPA 4I1UA 2JIZA 3GD7A 5EIBD 3U5ZB 3ZCVA 1UQRA 1SIOA 3AM5A 4YDHB 3VR0A 5BWOA 2HJHA 2PEYA 3PFFA 1ZCAA 4UCXA 1T5SA 4GMDA 5EE1A 1XC7A 1Z0DA 2JCBA 3VO2A 4WWHA 3NIGB 2Y71A 3WQHA 2QR2A 1LNQA 3HGTA 2DQKA 3CF4G 3DE7X 3T5MA 4PC3A 2P0EA 2OM2A 1OBVA 3GJ6A 4HH1A 4ZTZB 1YQUA 4LE2A 4YBZA 3ZW9A 1LBQA 2LGJA 1LLFA 1SBNE 2AZXA 3VMMA 1KTVA 5JQGB 2J4DA 5J4KA 2NO0A 3GLTA 2WQZA 2G9VA 2VP5A 3LUGA 1XTTA 3ZXSA 5TGDA 3KALA 4V0NA 3TW4A 2X76A 2AFIA 3GZNB 5B6PA 2IYFA 4HGPA 3RTEA 1LK0A 1LTKA 1YTUA 4LOJA 2EW8A 3O2NA 4JS0A 1R88A 1FZQA 4X6UA 1SXIA 5KTPA 5ITSA 4U3JB 4UULA 4Y0NA 3F8WA 5EE9A 1O5OA 1ZL0A 1HV8A 2C8LA 2F43A 3M70A 3A3KA 4QRHA 3P4XA 4TVOA 5AUPB 5JWOA 3R3YA 4F60A 1N92A 1FDIA 5AK6A 3D0KA 3LC2O 2V4ZA 2GO1A 3SVTA 1AQYA 1L5FA 3D59A 5FRDA 4UAJA 5DJ5A 3SZOA 3HVKA 1GSAA 4D9MA 3R9WA 4OXYA 5GADl 2FQYA 2HRRA 2WZQA 5A0FA 2PUGA 3OIFA 3C39A 1I3LA 5EA2A 1I10A 2HF8A 4ZZ2A 4MJXA 3HCPA 1N75A 4ZN6A 1E9EA 1OI2A 3EDMA 3W5CA 4J4HA 1KSGA 3EGDB 3BRWA 4HNQA 1DGQA 4V2IA 4YB8A 1A5TA 1GQ2A 4H59A 1KI7A 2HBQA 1LPPA 3ZDEA 1T0HB 5KYNA 2IUEA 4RGVA 2YY5A 4J07A 4R1TA 1XJ5A 3C8DA 3JD0A 4EUNA 3HU1A 2YUTA 1NVGA 1XBTA 3RUDA 2WKQA 3DDHA 2PJRA 1E6UA 5B37A 4DDKA 4KGXA 2YHSA 1F9EA 3ZD6A 2ZIVB 5DGTA 1CUGA 2Y92A 4ZKDA 1VL6A 4KUGA 4KIFA 5TPZA 2AKEA 4LOHA 1XZ8A 4O4JB 3E9YA 4QPPA 1BDIA 4ZPXA 2YKGA 2V6JA 4DNFA 1JJFA 3GC6A 1M2KA 2O4UX 3IC5A 4KW7A 4QDKA 1DTEA 1U5AA 3GUYA 2CV1A 2QRNA 1V8OA 3CR8A 2KX7A 4WNAB 2W43A 1UKEA 3QKWA 4B46A 5DNVA 2E4YA 4HCJA 3GNQA 3ZGZA 2Q50A 3F6SA 1VI5A 2C9BA 4JBLA 3KEMA 3UT5A 1WTCA 2XGGA 3OZWA 3TRFA 2Q9BA 4XWYA 4L95C 1H94A 4DBZA 1K3TA 2BGKA 4NCKA 1LZLA 4MPRA 1M5UA 4JEHA 5F2NA 1QAQA 1YZQA 5JUWA 3PGVA 4FE3A 1TD9A 1Q1EA 2W22A 1EM8B 4BTVA 3ROFA 1Z4PX 3I9FA 1RZRD 3KEGA 5AUNB 3ND5A 2OQIA 3DTNA 5DYYA 3A4LA 5LA6F 2G8NA 2GTIA 3N0TA 4WE3A 1W52X 1QH1A 3QWBA 4D5EA 1TC1A 4MARA 1PK9A 1A8IA 3S1AA 3TIXB 3RT9A 2ERYA 4MYTA 2P6PA 1QFMA 5FX2A 2VBGA 2V3CC 1PRYA 1X38A 5MGBA 3MWJA 1IK4A 2VF7A 4U9IS 5HPYB 2IV2X 2KBFA 4RAQA 5CJJA 3Q40A 4X92A 1BN6A 1OYVA 4KMRA 4M9UA 3WAKA 4DXDA 2C3MA 4KI7A 5GIPE 3HU2A 2C84A 4BFSA 1X94A 4BNUA 3CNLA 5C8XA 3ZWMA 1X7XB 3ODPA 1QWSA 3O1LA 4A1FA 7REQA 5JZMA 3OM9A 2C4WA 3IV7A 4MV7A 1T3GA 3SZMA 1VLLA 1RXWA 3V2HA 5DXFA 3SXUB 4B6SA 3MWDB 4K9OA 5TQ2B 3HXPA 1X8LA 2VJKA 4CDRA 5FLYA 3L82B 1OT5A 3IV9A 3KOYA 3O4GA 3OJWA 2FE4A 1GG2A 5CVUA 5F7JA 2VLBA 3Q10A 1OLOA 1G5RA 3EVZA 5DYNA 5FOSA 1RQXA 3K0CC 3HDTA 2BHTA 1SCUA 5H83A 5U4QA 1GDDA 1A77A 4DQVA 1CUVA 1G66A 1HOTA 2PZFA 2X15A 5TARA 2E18A 2WW8A 1UK7A 1K8ZB 5ICEA 4QU5A 4AP9A 2QMHA 5F7XA 3HA5A 5DI9A 1B8VA 4MVJI 4AF6A 4BKMA 5MN4A 2ONYA 3PZRA 1XKXA 3SHWA 5F4BA 1CR6A 3KBBA 2OECA 2FHSA 1ULZA 3CXUA 4G37A 1FFBA 3BIOA 4LV8B 4NWIA 1AURA 3E3AA 5GONF 3VX4A 2I4LA 3IALA 2FPKA 1JQBA 3KWLA 2R4UA 3ECCA 2QN1A 3ESYA 4FCTA 3CIFA 1SAYA 2Q5CA 3H19A 4PONA 3HCRA 3B6JA 4Q3LA 5DULA 3SE7A 1IVSA 1V48A 3Q2IA 3PC8C 4ADSG 1VL0A 2JFBA 2HI0A 2VH1A 3QXXA 1K3UB 1P7CA 5JANA 1KI4A 2W6PA 5C37A 3IJ5A 2ZCJA 1KMHA 1H3EA 1TIKA 3PF8A 4BE7B 4ZEMA 4GX0A 4BCBA 5FKJA 5C0OE 3REQA 3SC4A 3SJAA 4JYZA 2G17A 4JU9A 1L1QA 2OXCA 1CZHA 3G85A 1A98A 3OPYI 4BZXA 4QKQA 2VP2A 4HLCA 4NJMA 5FEMA 3CUSA 2ZWMA 1EUDA 4ZYXA 2AG6A 3GFTA 1MXFA 2X9QA 1C4KA 1UEJA 2JJ2D 2VJPA 3QWHA 1G64A 1WP9A 2GH1A 3QKSB 3O6VA 5ESXA 1JXQA 5EERA 4AURA 3A9WA 2I1LA 5IW8A 1BQ4A 2YJ6A 5EKXA 3UPDA 2CXOA 4QATA 2JH3A 4TS4A 3W06A 1X8JA 3SLKA 3I72A 1Y1RA 3ICCA 3L4BC 2XVYA 2XKJE 4EW6A 1O87A 3RARA 4KBYA 2XTJA 3LBYA 4F1JA 3W5BA 1BU5A 3CZCA 3PLNA 5DSTA 4WX2B 2W2QA 3WNVA 1JIIA 3A9SA 5DISB 1I0ZA 3O21A 1HT3A 3EDQA 4ZVSA 3PLAE 1ADJA 2UZ4A 5FYQA 4FU0A 1BXGB 4IEFB 4JLNA 3ZC3A 1P6UA 4IS2A 5AK3A 2AIRA 3QFRA 1A9XB 4HDSB 2R6DA 1MIOA 1Z13A 2IXAA 2CMKA 2V9ZA 4XR4A 4HEQA 4CBVA 4H4DA 5DLPA 4QXAA 3BRSA 2WAOA 4AD8A 4US2R 4XSGA 3C45A 2HIGA 4FYHA 5ITZB 5IYZF 2J48A 3OBIA 1YIAA 1TUBB 2H4ZA 1H4SA 3PUZA 4PNHA 1CW2B 1U2EA 4FK8A 4IIFA 5ICGA 3RU3A 4Y2XA 3KTFA 1E9SA 4NBKA 3GMTA 5CT5A 5E9WA 1GPYA 1J70A 1CCWA 1J5XA 3NXKA 1JR3D 1T4GA 3OJ0A 4GM1A 2ZYHA 4IJUA 3N7UA 4UE6A 4Y6RA 5CFPA 3BFXA 5BMVA 1CR1A 1FMCA 3W5AA 1KVRA 3G0DA 2FOXA 3D8UA 3AYXB 2BMJA 2FETA 4YCMA 2B4QA 2IBSA 1WY7A 1FPQA 2QRQA 1T1IA 2E1RA 4CLOA 4W9NC 3G68A 1P4AA 4L3OA 2EARA 2WWGA 2EJVA 4XB6B 3V1NA 2HQRA 4D9GA 3WNQA 1GN9A 5E1OA 1GAEO 1ZUD1 1Y1TA 1EUZA 1ZGCA 4OQDA 2J85A 2L18A 3WKBA 2X86A 3R9KA 2JGJA 3P97A 4TYMA 3GIDA 1XTKA 2D74A 1UXJA 3S8MA 4FFRA 2IZOA 2ZBEA 2P5SA 4FHFA 3WXMA 4RULA 3PTZA 1E3QA 4RTJA 2FXVA 2I3AA 4BTEA 3G7SA 3IUJA 5C5DA 3V1YA 5KQPA 1WUIS 5T6BA 1DIHA 1KEPA 1SY7A 2VTVA 2YZ2A 3GRZA 4OQLA 4S2EA 1W7AA 1GTZA 3N2GA 4IRUB 4O2LA 1J0DA 2DH5A 3EZ6A 3WLEA 1X19A 3NP9A 1ICEA 4Q6BA 3ZJ4A 1IN7A 1X1BA 2JHFA 2VP3A 1XDGA 3LPLA 4A8TA 4BO1A 2AOUA 1Z17A 4QYWA 1V16B 2WJ6A 1W76A 3PBKA 2RHMA 1ZK4A 1Q5PA 4UHCA 2VH2A 3LHDA 4JJZA 4J2TA 4B6QA 1HFWA 1A9YA 1P7YA 2EC5A 4QVGA 3RC3A 4EPTA 1QV9A 2ETXA 4AW9A 4PVCA 3QVMA 1BU8A 4L8GA 1JHMA 3F97A 3PXBA 3WK7A 2QYOA 1KZ9A 3OVMA 4ED9A 3BHNA 2QG6A 2VHYA 4N9QA 1W5AA 3IQDB 5CFOA 4IWXA 1LB1B 3JYLA 2BFDA 4O6VA 5DH9A 4ND4A 1OIWA 1V11A 2DETA 3EPHA 1VLVA 2BRUA 2JLSA 1O6FA 1XVTA 3SAJA 4DMKA 5L3QB 2XVAA 4OQZA 3UT0A 1NYLA 1Y6QA 2PT6A 2Q4EA 4LE0A 1ORWA 4RGQA 3FNRA 2OD2A 5BWMA 2C2YA 4GR4A 4Z99A 1LPOA 2CCGA 5KCMA 1CY1A 1PFWA 3L7NA 2ZATA 4TTRA 5K4AA 4C78A 4GVLA 2CXUA 4BB5A 4BNLA 4V1CA 3U5TA 1S8AA 2EJUA 1I4DD 2IQ5A 2YMPA 3HCWA 3QE0A 4XOUA 4D7AA 2Z3WA 4XIJA 2QG4A 4HGOA 2QP4A 1M8GA 5H5JA 1SUIA 1IN4A 4YP0A 1LSJA 2MT9A 3KELA 3AR5A 3U39A 1QKKA 4Q48A 3BRWD 4YGYA 4G4IA 5D84A 1Q16A 2WABA 1J2RA 1Z2OX 4XCQA 4B79A 4NNJA 3RGGA 2HPVA 3D9QX 2VEDA 4F91B 3ZUGA 2XJ9A 1IBCA 3S4YA 1ODFA 1JWAB 5J9FA 1TU0A 3W4IA 1P2VA 3QK7A 4AWAA 5JDCC 4KQKA 1Z82A 4MAAA 3R7BA 1RKUA 2IOQA 3B9QA 3LBHA 3T1NA 4EYOA 5B64A 5IU6A 2PGLA 1QX4A 3E1KA 1KWKA 5EMMA 3UBTA 1G18A 2FLVA 5LXTB 4RTRA 5LOVA 4BGIA 1UJ5A 1A9RA 3BEDA 1R5OA 1I6WA 1Y4ZA 2HOQA 2XW6A 4L07A 3ZXIA 5IUNC 3UMBA 4H31A 4JBYA 1XNHA 4FW8A 4KXMA 1SBTA 1SCKA 2QRKA 5E4TA 3TMYA 1MAHA 3ZI7A 1DKPA 2IY8A 1A96A 2GNPA 1QHFA 4BGDA 2ZB8A 3ON5A 1M72A 1RPJA 1K08A 1CRPA 3CF2A 4PG4A 1M2EA 1SC9A 4F96A 2KE5A 2XE4A 2BUAA 4LKOA 4ND5A 2QQEA 2CHUA 5DYGA 3N28A 3NIWA 4AUNA 2OORA 1WQ4A 1JEQA 1G8PA 1KYXA 1O77A 3H5LA 3ILVA 1E1MA 4NECA 4C0LA 5C18A 2EGHA 2PL1A 4KXVA 4NZPA 3HB9A 4ZCSA 1SZCA 4HAUA 3V1MA 1OD6A 1T24A 2ZRHA 2I6GA 4MI1A 1RLTA 2R60A 3LC7O 4OYRA 2R1TB 2DERA 1AKEA 4FZVA 3WLMA 1MAUA 2P8JA 1EVLA 2DHDA 3A3PA 3R6WA 1DAKA 5HGJA 4YYZA 4Z3KA 4BQIA 2FLWA 3U3KA 4XSVA 3F6YA 2WWYA 3A37A 3EZ2A 1J8DA 3CT4A 3E7FA 1EFAA 4JI4B 1WXWA 2ATXA 1N34B 2X7JA 1JXMA 4HFRA 2WYUA 4RZSA 1IJFA 1CUJA 1PSDA 4IV5A 2J30A 3O9VA 3IQGX 4GM0A 5FA6A 2BSQA 2GYWA 4ZAZA 5EKTA 3GVCA 1DV2A 2WSLA 3BGIA 4DY4A 5B4VA 2O52A 5EJFA 1N8NA 2EATA 2PH7A 3PB3A 4WCFA 4B85A 1Y7TA 4E7OA 1P62B 2EV9A 3QI7A 3QPWA 4HWGA 1MZPA 5FH9A 4KOEC 3IQEA 1C1DA 4C0KA 4YMSA 1N2GA 3K53A 1ZSVA 3WICA 2GHIA 2BHNA 3WIOA 4JJEA 4FBGA 3JRXA 4GGMX 4JVSB 5COAA 2OYCA 4P4LA 3DMGA 4ZK6A 1DIOB 1O54A 3MD9A 2R6ZA 2ZTSA 2LV8A 5I47A 2RH9B 4DKJA 4NKRA 4MQMA 5E4YA 2QE6A 5JCXA 3TXXA 2AW3A 3VPBA 1WDKA 3DB1A 2OWEA 4UW9A 1Z5GA 3BK7A 1N2OA 3G02A 3U7FB 1W0CA 1VCOA 3VC1A 5ADVA 3R8FA 3R44A 1ZNZA 4N41A 5KNLA 4FBMA 3L6OO 5L45A 1Q7RA 3OH8A 4YAFA 1VIVA 1SOMA 1OVGA 1QRSA 1QU2A 2FZ5A 3RHZA 3M1LA 2P35A 1WHTA 1E8MA 2IL1A 3H5RA 2EJCA 3Q1KA 2PMEA 3I09A 1E69A 1VP9A 4EKYA 5JH7B 5FI5A 1O6BA 2ALJA 3JARB 4ZDIA 1QAOA 5ECDA 4DVJA 2OHVA 1M8FA 1QIMA 2R751 1FVHA 3DTVB 3K0AB 2I2FA 2PT7A 3DCJA 4MROA 3T34A 1CQPA 1Z7GA 3KZKA 4V0RA 5FPSA 2YN2A 3LBIA 1CZUA 3IRUA 3P9XA 4IGAA 2QD2A 1QIEA 4YJ2F 1ACLA 2O3JA 2PZEA 3AI2A 3KKNA 4KAXA 4N7MA 4B76A 3FVWA 5ALOA 3SC6A 3D6FA 5C8YB 1OPXA 2DPMA 3TLGB 2CXPA 2X5KO 3LX8A 3GLQA 1FUYB 1XVIA 2OD9A 3O9MA 3OE4A 4ROSA 2C82A 3MTEA 1FNBA 1QO7A 5ALSA 3R41A 5TMPA 2FUCA 4BMZA 2C4HA 2HL6A 5HP4A 3FAKA 2QTGA 3ILHA 3U0BA 5H70A 1T9GS 3L2OB 5BOVA 4F6RA 3A6FA 2DLNA 3FRJA 5AW3A 2ISQA 3OOSA 2OFOA 4FC7A 3K1YA 3A0UA 3DGEC 1TGVA 3AETA 1PQ4A 3PENA 4DJJA 1GNLA 2JAOA 5B30A 4U7JA 3W5VA 1DOAA 2Y1LA 3NTRA 1G4UR 2F9LA 2AOTB 1N9ZA 3DT6A 2Q9AA 4R16A 1D4OA 3OT4A 1W75A 2FW7A 1S1MA 1M5RA 4MP3A 5KAPA 1PI3A 2BE7A 1FB5A 1JU3A 1P2FA 1NSFA 1SPXA 3E3NA 4KH1A 5I9TA 4DLVA 1Z74A 2C77A 3PJFA 1MC5A 3SF8A 3EXEA 2WJIA 5DOVA 3RUPA 1FRVA 2J3JA 2Z8YM 1K9SA 3CTMA 4WA7A 2QE7A 4Z7OB 2D3TA 1L7PA 2XDWA 1E3JA 4X8LA 3OSZA 1CJVC 1YR7A 5AHXA 2H1FA 1IK6A 3AUKA 5EP4A 4CL8A 5AM4A 1ZMRA 1RJDA 2E5WA 3KO8A 3AP2A 5B2EA 2HLDA 1R9MA 2OO5C 5LSAA 1HDIA 3DAOA 1XXHE 2PYDA 3GN1A 5LU8A 2ESRA 4DILA 2FN4A 4FGZA 5EMNA 2W6NA 1ZM4A 1SD1A 1JN0A 3ACCA 3P0JA 4QUAA 2CYCA 3VNVA 3MMPA 3L4JA 5DNEA 2JIPA 4ATNA 5SV2A 4DARA 5CA1B 4INOA 4EZIA 3ITDA 3DM9B 3JZAA 4OBBA 3V6LA 3KYDB 2OV6A 4INAA 2IS2A 3URKA 2O0KA 3ZVNA 3O2QB 2BCGY 1I0IA 1B41A 1PAUA 4G1FA 2FEXA 4JP5A 4JUIA 3T4XA 4KH0A 5I7SA 2IE0A 4R2XA 5LDDC 1CC1S 1NMEA 2O6HA 2OEPA 2ZSJA 4NBVA 4PINA 1GTL1 1P7WA 1JTEA 3PL1A 1H5QA 1OV4A 1DQZA 2O2CA 3UJBA 4KR2A 4GU5A 1XPOA 4RSRA 3Q4GA 3AHFA 1N33B 5KJEA 5CFQA 5ES3A 2VR1A 2X2EA 3TDNA 1NZJA 2VYQA 1BVUA 2PZMA 4IRXA 4ZQCB 2C9OA 4X9XA 4QO8A 4HH4A 2P91A 2PZ8A 2QJWA 3VR5D 5K3OA 3FSGD 1TAUA 1CS4C 2WTMA 3COVA 4NEQA 4EUKA 3CX6A 3DXXA 4RW0A 5T64A 3EW7A 4GZLA 1RACA 2WE7A 3QVXA 3AR8A 4ACAA 2JCGA 5JZOA 3LFUA 3TLCA 5A9SA 1UEXC 5I01A 3K9NA 1KQFA 2CL7X 2CNKA 4TWZA 4ES6A 4EUFA 1UBUS 2EG5A 2EWMA 3DZHA 4WOCA 2GZDA 1OBHA 5AMXA 2PKXA 4UEOA 1PQPA 4XDHA 2B1JA 2FQXA 4C3ZA 4EUEA 5BSVA 5DP1A 3KR9A 1A1SA 1RTKA 3M3DA 4LC0A 2X5OA 1TQ6A 1KDYA 4JJFA 1CXZA 4NZMA 1ZLXA 1I1OA 2R2GA 3D3KA 1EFTA 4B0PA 3TINA 4OEHA 4DY6A 4Z0TA 4A16A 5DX8A 2XZOA 4X1KA 3QIVA 1DAFA 4H7IA 4P92A 3WNBA 2HDHA 2VZLA 4Y1GA 4PC1A 3ISJA 4HWOA 4YAEA 3L0ZA 2QTAA 4LN1A 5MFZA 1MGPA 1SM4A 3BWBA 3ZDBA 4EYEA 2JJMA 1HYEA 1Z5PA 3V4VB 2FZGA 2ZPAA 3VPFA 4FFPA 5J4YA 4EARA 3EG5A 4KL8S 5HUJA 1QIDA 2QBYB 1GOTA 4CE6A 1HO3A 4QUJA 1F60A 1TIBA 4C3UA 4KLNA 1KMMA 5E7IA 1VSBA 2V7PA 3V4FA 2L82A 3DNFA 3PYLA 1EB9A 5IT5A 4MQ6A 2IGBA 4G0WA 4ESHA 5CYGA 1E5LA 3KTDA 1XRJA 4UMFA 1HG1A 3VH4A 3U1BA 3D8SA 3SSAA 3C6YA 2YW2A 3KC2A 1T6XA 1E4VA 1XRQA 2AXPA 3II6X 2CKDA 3M5PA 3PD7A 1F20A 1QQTA 5EXPA 2GBCA 2I6XA 3L8GA 4DWWA 5LNK1 5JNSA 4MTCA 4IFTA 4JT2A 4WXEA 3ND8A 2B36A 3R0XA 1PO7A 4MB0A 4B6OA 5LQKA 2PAFA 3BDIA 1JRLA 4UHJA 4UEKA 2AFHB 3DKVA 1K06A 1X1TA 3BWEA 3OMLA 3SFTA 2IY9A 2ZI3A 3WGYA 2GCNA 4MGZR 1BS9A 1S89A 1QQ5A 3ASZA 2QAIA 3RK1A 4FGJA 3O1IC 1QZUA 4RDXA 4XLTA 2J9GA 3QM1A 4MPDA 1MO5A 1T25A 1I6LA 2NSHA 1WSDA 4M7WA 4WTOA 5DLEA 4UOEA 4ZCIA 3TN7A 1Z5NA 3LMKA 1RWXA 4RIHA 2X2OA 5GZ6A 1PUXA 5JY6A 3CG0A 4IVPA 4JC0A 4M9ZA 4HADA 4P7KA 4XPZA 2QPOA 2PUDA 4LRQA 3LWBA 1FRQA 2UYGA 4N3NA 4N3AA 1PR2A 2NSYA 4JASB 1NJ8A 3GLGE 2PFKA 4RCVA 2FWNA 1BXKA 1C0EA 3WDMA 1R4MB 1T2AA 1DLIA 2QN6A 1L7QA 1FSZA 3L5KA 4IIGA 4URXR 2XSZD 5HOQA 2DXIA 1NV9A 5F3WB 5T3YA 1IM2A 1J00A 2PGOA 4QPDA 1HFJA 3PHIA 5K4HA 2PRKA 4LBVA 5D3KA 2YN4A 1U9ZA 2ODPA 4CZ2A 1OQAA 5GV7A 3FUXA 1XZAA 2F4NA 2XWPA 3MCVA 1OYWA 3NHJA 2H7VA 2HA6A 2ZJYA 3ZUPA 3R0QA 4CN9A 4U7DA 3VPCA 1D07A 1YVUA 3FBTA 3KE8A 3PHJA 4ZIRA 5IC4A 5A71A 1Z4LA 3KT8A 4M49A 4KMOA 3H9JA 5IJ0B 1BN7A 2H5LA 1SIWA 1IXSB 1CUBA 2ECOA 1DP4A 3GFQA 4LJ7A 4LTMA 3KZMA 4MR8B 1SOVA 3QFCA 1Y8AA 4A3SA 4B3SB 3UK6A 1AY0A 1IBKB 5LYJB 3VBEA 1JJVA 1X1CA 4ZV4A 5FP0A 5BOSA 1N4DA 4LBWA 4QPZA 1WA5A 5DN9A 1ZD5A 3OEEA 3WL3A 3PQ4A 3RC8A 2VTKA 5JBNA 1LSOA 1JSZA 1F3LA 4KIJA 3UUWA 4M1YA 1WDMA 3UG7A 1JB9A 3MTQA 2IZ6A 4H0FA 4G67A 1AGXA 1PD0A 2G9UA 4JQOA 4KIUA 4ZK2A 1DO2A 2IPLA 2RGDA 5ARCA 4MSUA 3MLAA 4JFAA 1LRJA 3ASUA 3TCXB 2XQFA 1U2QA 1HQYE 2H1LA 1OV6A 3UJ8A 1LNSA 3HUTA 3WI7A 2Z8ZA 4O02B 1Y8QB 4CMIA 3NOXA 5ICSA 3MGCA 3GFPA 1TYDE 4MX8A 1I2DA 2KWIA 3Q2KA 3U9SA 1RT9A 4IIEA 4DEYA 3CH6A 2IYRA 4HQNA 2V6FA 3QX8A 3BL5A 2P1DA 4O0LA 1M2VA 2NAPA 3IIIA 4E12A 2ZRAA 1E2LA 5E8RA 1WB9A 4D3YA 4G0UA 2GLXA 1XXHA 1EGQA 2ATCA 2CLMB 3B3JA 2Y1CA 2JGLA 4JJIA 4NRDA 5JYCA 3TECE 1Q6ZA 1VG8A 1YI0A 2XKAA 2E6UX 4LG1A 5L7TA 1OROA 3NGMA 3C1TA 4FDVA 5J5CA 4BNDB 2R6R1 1FTQA 1UBCA 4UUQA 1YI1A 3C3WA 1UDAA 3E3LA 2FN7A 3LJKA 4GOND 3DLTA 2OA0A 3RVDA 1PW7A 1YI8A 5F78A 5HEKA 1ZD1A 4Q16A 1J07A 16PKA 1ISGA 1FC0A 2FWMX 3RUCA 3TD6A 3N3BC 6LDHA 1M8JA 2YXNA 1GT6A 2Q27A 3BYZA 4Q4DA 4JI6B 3S55A 1JLSA 3ZWYA 1E94E 7ABPA 4HUQA 1CUYA 3LHFA 3L06A 3WA7A 2QJTA 2VZ8A 4V1CI 1EX1A 2XLCA 4CT0A 3LIPA 5FWXA 1ECLA 2H4WA 4ZVKA 3RYCB 5IVHA 3BCUA 4BFVA 1WQ3A 3TIGA 4DLRA 5JRDS 3RYFB 1RWNA 3SSNA 2Z6VA 2HXYA 5COBA 2N1MA 3A1UA 3ELYA 4PLCA 1SHKA 1W93A 2ZREA 2X0FA 1LBHA 3O9ZA 4QBHA 3GXBA 5I9MA 4ENWA 2I78A 2ISSD 1PNTA 2XYQA 2Z83A 4OMUA 4PFQA 4H9GA 1IWOA 2Y2VA 5K3FB 3ZE2B 3U3XA 4PHGA 1KO4A 2OUKA 3EFHA 5G3YA 3PXXA 2O0HA 3WP1B 3ACBA 1L9KA 4ZDWA 1FU4A 1NGSA 5CTAA 1J22A 3IVRA 1L4YA 1T26A 1RI3A 3OU6A 4RKFA 1SR8A 2WM9B 4R9RA 1U2RA 2DKNA 2P9YA 3HKEB 4MYHA 2GHRA 5KNDD 3WGVA 3E4DA 3ZEIA 4TM8A 2OBBA 1YIOA 2GYYA 2NUPA 3OC6A 2WE8A 1LF5A 4I1OA 1YZKA 1PSWA 3KDAA 4MICA 3TLYA 3ZGLA 1TW2A 1XMXA 4BB6A 4F38A 2JIDA 3OICA 1IPEA 3KAPA 5AI6A 3R0VA 3ER6A 4GPAA 4BBJA 1QKIA 2JGNA 3FDZA 3JQQA 2I6QA 5CLJA 3DJYA 4OAPA 1X1QA 3CBQA 2EZTA 3MRVA 1PFYA 3B1ZA 3CEMA 1HUQA 4RBNA 2F64A 2CVFA 1PEKE 4DCPA 3E9QA 4AF7A 5KQGA 3U9LA 1CV2A 3G2LA 1KZ4A 2YZMA 3K0CA 4G2TA 2XUOA 5FHRA 4ALIA 4XVCA 3MTDA 5CT9A 3T5AA 2VBFA 2Q3CA 4LRWA 4MA0A 3O5AA 1T9KA 1T8TA 4DREA 1TJ3A 2N46A 2BGIA 3G9XA 4M0EA 1Q3KA 5E9AA 4MWBA 4AJOA 2VPXA 3BXGA 2FYTA 1Q3HA 3S68A 3G59A 3TXAA 3ZV3A 5HM8A 1C3OB 5ILOA 4YJFB 1DEAA 3C5WP 2E85A 4MQEB 5D3QA 1GDTA 1RPTA 5EAIA 5FWYA 1S8NA 1X92A 1XDBA 3K72B 4ZO6A 3HADA 1GPWB 3WHKA 2VRCA 3ANYB 2OFWA 5H4GA 3RE1A 3RW9A 2WPDA 5AXBA 5LL6P 1XQVA 1M2OB 4INJA 2W6JA 5JCOC 2JF0A 1KPHA 4JL8A 1LDBA 2JIBA 2I34A 4JMLA 2DY0A 3F7TA 1E2MA 1QHHA 2DWPA 3EEQA 3PC8A 1ZIOA 4GMXA 2RCYA 4HXEB 3EQ6A 2F3SA 2CY0A 1G291 4ZO7A 3HRHA 3VR1A 4Y6PA 2R9VA 1JKJB 3MHPA 3A58B 3RIMA 1T2NA 1X7DA 4AQDA 3GLIB 3FLBA 2NXCA 4TVSA 1BRMA 1FFDA 3NX4A 1WZIA 1T8WA 2G0TA 2I2AA 3DL7A 1QDLB 3EUWA 2IXDA 3QWIA 5E1DA 3TTWA 5BVHA 2ZJ5A 4KBGA 2FDXA 3C8HA 1UK8A 3EZNA 3CUVA 4X8HA 2ZRFA 1DJNA 2YBDA 3BGSA 4HDKB 5JMPA 3Q8LA 2COEA 1I4WA 3NIFB 4MRMB 3H0EA 5CNKA 3PGMA 5MN6A 1SIBE 5CT6A 3CGGA 1XB2A 2GM4A 1ZRNA 1NQ5A 1SQFA 1J0AA 3ORYA 2ZIGA 3QXHA 4GQAA 5AKLA 3M4XA 2M6LA 3W2EA 1IH8A 3FSEA 3DHYA 4ZYUA 4KVGA 1SK9A 1GFIA 4INZA 3GLGA 4OM8A 1ZWKA 1GILA 4E2FA 4IIYA 1R0ZA 1UJCA 2Q4RA 3D0QA 3PC2A 2DFKB 3TJZA 1YL5A 3CZRA 1Q14A 4FM9A 4K05A 4OO3A 4EG3A 5K01A 3TPFA 3HVUA 3JVDA 1T5LA 3JWJA 3PDCA 3INTA 3RFUA 1ZI8A 3JQ9C 2AHOA