1ZBDA

Structural basis of rab effector specificity: crystal structure of the small g protein rab3a complexed with the effector domain of rabphilin-3a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
177
structure length
177
Chain Sequence
SHMFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGLERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags G protein
molecule keywords RABPHILIN-3A
publication title Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 50
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zbdA00
3VX4A 1Z0FA 4G5RA 4HUQB 4HB0A 2VP5A 4B34A 4PZLA 1TF7A 1Z6GA 3GFPA 4NYMQ 4CYMA 3EIHA 4TYYA 5HTKA 4KFRA 2OCBA 3FB4A 1QZXA 2DYKA 4NE2A 4US1R 1ZMXA 2B92A 1PV4A 1N5KA 4TMZA 4JKIA 3SOPA 2EFEB 4RY2A 5FTLA 4AKGA 4OHVA 4QBGB 1JJVA 3OEEA 3VR6A 4OQFA 3I62A 2BMDA 4HZUA 4X8MA 2QAJA 2IYXA 2YV5A 3I8SA 5C18A 3B8HA 3SYNA 2W00A 3IDQA 4FWIB 4Z54A 5JWOA 4Y0VA 3WHKA 1AS0A 5KO2A 3ZS8A 4LI0A 3NEJA 1VYUA 2WWHA 2LWIA 4LYFA 3FYHA 3ZIAD 5E3HA 3VR1A 2R6DA 3CBQA 5J47A 2VHQA 4WIAA 2RGGA 2AHOA 2GRJA 4QFMA 4P0TA 1GKIA 4HB4A 5BN3A 3EXAA 5F3WB 2GCPA 4QXAA 1KMQA 1MOZA 3V00A 4KFUA 1H65A 4FINA 3BB4A 4HUQA 4CW7A 4NDZA 2DFKB 1WDTA 4IFEA 1XD8A 2NO0A 1JEDA 1CEEA 1MO3A 2IUUA 4KFTA 1NG1A 4Q4AB 4LGMA 4ACBA 5HZKA 2OXCA 5KNBA 4YMTA 1G3IA 2RGNA 2P5TB 3VAAA 2GAAA 2QTFA 2FSHA 2GJKA 3OESA 3SC3A 4DCNA 1IAQA 3NBFA 3QXXA 1O3YA 5AUQA 4E09A 3VKGA 3D7MA 1TAGA 1HY3A 1VTKA 4D2IA 5KYKA 4MUAA 1Q20A 2JJ1A 2VHCA 4NCIA 5CK5A 1VIYA 1XB2A 4XIGS 4PO1A 3U61B 2H17A 4BFZA 2ASEA 3PUWA 2KBEA 1ZM2A 1P72A 1YQTA 1KDPA 4ZPXA 5FUXA 1G6OA 2BM0A 1NI3A 4W5HA 2G6BA 3X1DA 1S3GA 2ONKA 4OI4A 4U5XA 3K70D 1XP8A 1Z63A 1HTWA 4UXJA 1QHGA 2IW3A 1TNDA 4UNSA 4C30A 2OLKA 4C0AC 2PJZA 3JVVA 1E2FA 4XWOA 2YC4C 3TGPA 3W3AA 4EPTA 4U00A 2NOAA 3NXSA 2AX4A 2QE7A 4M4SA 4B35A 1KDRA 4B6FA 2P2LA 4LC0A 3LBNA 3RWMB 4Z1MD 2ZU0C 5DNYB 2GJAA 1A2BA 4NYJR 4DIEA 3KZ1E 3ND8A 1EFRA 3AP2A 1DAHA 3W5JA 1H8HA 1OV4A 721PA 3QI2A 3I5YA 4Q4AA 2FE4A 4DEYA 1MKYA 3KQLA 4DCTA 2GJ9A 2PH1A 2YC2C 4NYIR 4BLPA 3RS7A 4YONB 4UXIA 2A5GA 3KKQA 5L3VA 3U7FB 4ZDWA 2DR3A 2F1HA 4B76A 4QJ4A 4TMWA 3AF1A 4M1YA 2ECKA 2I1VB 2GVDC 2BDTA 3NHBA 4MDFA 3QF4B 5BN5A 1VHTA 4AWXA 3AVTA 4E22A 3HJNA 1RRGA 1TL7C 2R9VA 2HUPA 3AP1A 5EJEA 1A2KC 1XXHB 4H9GA 1KGDA 1VIAA 3LXRA 2J7PD 3QEJA 2ERXA 3N2EA 4Q4JB 4LJYA 4ZO4A 4FWTA 1G7SA 4M1TA 4WXPA 3CUEF 2DFTA 3CRQA 2C9CA 2QMEA 2D74A 3ADKA 5FI0B 3C8UA 1SXJE 2GJSA 4D4MA 5AJZA 1NP6A 2VSOA 3UK6A 4DSOA 1ZCBA 1OB2A 1HUQA 4LUCA 3ZGXA 1OB5A 3RSLA 3AGPA 3U3KA 4HATA 1E9CA 1VMAA 5B64A 5KPDA 2WJIA 3O47A 4K81B 1KI6B 3L0SA 1UADA 3Q7QA 1RYFA 4TZ0A 1T9HA 3VHXA 2O8FB 4JBXA 3MFYA 2GCNA 4M22A 2BCJQ 4HLUC 2GHIA 2JLSA 5AJYA 2X77A 1D9ZA 1CR0A 4BFYA 3CLVA 1AN0A 1E2LA 5AUNB 1NJGA 5EXPA 5L3SB 2WTUA 4A0RA 1FMLA 1L7VC 2DWOA 3E1SA 3A4LA 4X8HA 3AVYA 3BH0A 3HU3A 3QF4A 2NIPA 2QPOA 1TU4A 1IQPA 1EESA 1ZINA 1XXHA 2J5XA 3T35A 2HXYA 4KCGA 4Q4JA 2D3WA 2NPFA 3HYTA 5A4JA 2H1LA 4ZCLA 2ZJOA 1CLUA 3BB1A 3W5IA 2OAQ1 3TRFA 3HWSA 4O25A 2EFDB 4MA4A 5FPHA 1ZNYA 4PAOA 1COWD 2WJGA 4ZDKA 1ZIOA 1SVIA 4EFLA 2QP4A 3DMDA 1E0SA 1TF2A 1KJYA 4KYIB 4U7DA 3DMNA 5CIQA 2NPIA 4B32A 1TQ2A 1BYUA 2GTPA 1OIVA 3F5FA 2OBNA 1KI6A 1KY3A 1E0AA 3IEUA 2O8FA 1G19A 1KI3A 1W49A 3FKSA 3EARA 4YDSA 3SHFA 3UMRA 1T3LA 2NG1A 3WBKA 4DHEA 4M1MA 4S2EA 5L3SA 2FFBA 1KK3A 1SVOA 3T06B 4IFBA 5E4FA 4MRSA 2FZ4A 4TQAA 2VH5R 3U4QB 3LWNA 4OYHA 2QZ4A 4QGGA 3W9YA 3RSOA 4QNRA 3T15A 1OIWA 1UBGA 4BRWA 2UZIR 4Q9JA 4HLUA 1X6VA 2N42A 1NVVQ 3OFND 4BLTA 2QQ0A 5FOTA 2FU5C 2IF0A 4ZKDA 2ANCA 5FL3A 3O8DA 5EXXA 4KVAA 2HCBA 4P31A 2BHRA 5SZKB 4LDJA 3VR2A 1XPUA 2XNSA 3BD9A 1L8QA 3BK7A 4II7A 3NDBB 1R0ZA 3NDPA 4CEIB 2NO7A 2QRZA 5HPYB 3KB1A 3V9PA 4JLVA 4UNNA 3TNFA 3ZLJA 5FOUA 2EYUA 2W0MA 3GJXC 2OZEA 3QF7A 2XOKD 1E2DA 1TPZA 1U90A 1P60A 1U9IC 2ZE5A 3K53A 1R8SA 2EFGA 4OBEA 3IPXA 4L15A 2VHUA 4N0DA 4Q66C 3TAUA 3GLIE 2XSZD 1MO4A 3SQWA 2V8OA 4YLGA 3TW4A 2I1QA 5CLLA 2PBRA 1UJ2A 1MT0A 3I32A 3LVRE 4XD7D 3W3ZB 3TBKA 4QHSA 2ZE8A 5FPSA 2GZAA 5ELXA 3A6PC 1E1QA 2Z4SA 1LW7A 3SJBA 3WY9A 3E2IA 1QRAA 2X8AA 4GOKA 4BLSA 1TQDA 1X86B 4OI2A 2ZRLA 4MH0R 1AGRA 1ZNXA 4TT3D 1OLOA 4C0SA 1L4YA 1GRRA 2EU8A 5C1BA 4BLQA 2ZEJA 4PHHA 3RHFA 4OHXA 1E79D 3VKHA 1MH1A 1IN8A 1II8B 2QM8A 3IIMA 4CEIA 2W6ID 3K70C 4JJKA 1NKTA 3D3QA 4DLRA 4PSKA 2HT6A 2ZREA 3VFDA 3NBYC 2OG2A 1EWRA 4LV6A 1P9NA 1ZM4A 2IWHA 3RRMA 3CW2A 4UJ3A 3QPVA 3PQCA 2B6HA 1EWQA 1MABA 3K70B 1ZU5A 2ZRBA 1W36D 4YQFA 2VQSA 2AN9A 3LBIA 3U7HB 2IXFA 4A36A 1I2MA 1Q21A 5JS8A 1TUEA 4BUJA 1SVWA 3KFXA 1U9IA 2WSSD 1D5CA 2AXNA 2FN4A 2WICA 4GPTA 3KTAB 4P33A 2ZRPA 4B73A 3GFOA 1OYWA 3RDPA 3A1VA 1KI9A 4HDQB 3AEZA 1T5IA 3P20A 1GOTA 4OQMA 4P4UA 3GLFA 1WMSA 1DG3A 1G8GA 4XTRA 3RS4A 2GAOA 2JAQA 3QEOA 2A5JA 2QSZA 1XPRA 1G4AE 4DBLC 5JWRA 1II8A 4C0KA 3ADBA 1JPNA 3RC8A 5F98A 1BYIA 3ZD7A 4TWZA 1E98A 5J4VA 1SVMA 1YRAA 4HYYA 3VTKA 4G1UC 3ZQ6A 3I4LA 1RC8A 3F0TA 3IPYA 2ZRCA 3KXIA 1KSJA 1KNXA 3DPUA 4NBSA 4HZIA 5GJCA 1IN6A 1E9RA 2H57A 4XVUA 4D26A 2F1RA 1VECA 3SR0A 3MCAA 3B6EA 3AVUA 1NKSA 3B60A 1WCV1 5FUVA 3HPRA 1U2RA 1Q1BA 2D2FA 1DEKA 1HE1C 1Z0KA 3Q85A 5TB5A 2UZ3A 3C5HA 4JZKA 4B3DA 1CR2A 4D25A 4LV5B 1FMJA 5EZ6B 2AD1A 1Z8FA 4CVNA 2ZRJA 1G4UR 4Z1MA 3KTAA 1EX7A 3MWLA 3QKSB 4D81A 5CDFE 5J4YA 2Z83A 2F6RA 2FZLA 2KJQA 4IXMA 1CRPA 4LJ9A 3ZZTA 2BMJA 4KO8A 1IN7A 2BBTA 2H16A 1GITA 3NG1A 4JVMA 1NL3A 3CF6R 5HKKD 2C9YA 4DXAA 4A0HA 4DCUA 4E03A 3E70C 5G3ZA 2BEKA 5DN6D 1QHYA 3O8BA 2ZE7A 4IDPA 1ZRHA 1Z5ZA 2FGKA 2FSIA 3KJIA 3PG5A 1ZC3A 3OIUA 3PEYA 4D80A 3FGNA 1NJFA 1DOAA 3H1TA 2Q3HA 3K0FB 3WMGA 2J7PA 1DS6A 2GVZC 3WP1B 2ZJ8A 1II9A 2G77B 2QP3A 2V9PA 4P3YA 1U8YA 2ZITA 3SE0A 3WYAA 4HLCA 2Z6VA 5DLQC 5DI3B 5JJKA 2GKSA 4BFUA 3B9QA 4H1UA 1CKEA 4V0ME 3L8YA 1ZM3A 3CR8A 2P6NA 5H8WA 5BWMA 4O3MA 621PA 2VYFA 2YHSA 1E2HA 2ZUCA 5FBQB 4C3ZA 1P7CA 1T6NA 3AUYA 4QHYA 3TSZA 4CT5A 2BJVA 5JFGA 5ANRB 5KNCA 3GJ8A 3VX3A 2OE2A 1DELA 4PR0A 1IONA 1FUKA 1G5PA 2ATXA 2OFWA 5B58C 3FFBA 1G7CA 3VKWA 5TV2A 4MKIA 2ZI5A 4P4SB 3B9PA 2G9NA 4W9MC 4V0KA 4QJ5A 1D2MA 1D8TA 2QMHA 4HLDA 4DCVA 4C7OB 3Q9LA 1GAJA 2E87A 5AUPB 1ONBA 1SXJB 2XNDD 3DO6A 1YZKA 3K0FA 5AUOB 5JEEA 1KZ7B 2A78A 1MO5A 1G3UA 1IM2A 2FV8A 3L82B 1S0UA 1UM8A 1E3MA 4PSAA 2HCJB 1P4SA 4HAUA 5DI3A 4QGHA 2JLVA 1Q1QA 4WZBE 4A15A 1KO1A 2QN6A 3OIWA 1LY1A 1X1SA 3CRW1 1HURA 1JBKA 1M7HA 5F9FA 1COWA 2ZVQX 2IYSA 2AFIE 4GMDA 1FUUA 4TZ6A 2JASA 2J0SA 2FPLA 4AI6A 5JI3E 1GL9B 1M6NA 221PA 1XZPA 4F91B 1GWNA 2CLCX 4PO8A 3REGA 3KXLA 4WXRA 3QQ5A 3WNCA 1QF9A 4YDHB 2OBLA 1NY6A 2OFOA 1W5TA 1S9DA 3BWDD 4TSFA 2YKGA 1Q3TA 4EAQA 5J4KA 3CX6A 4P4SA 4IOKA 1ZD9A 1D2EA 4H1VA 4C7OA 4X8OA 2X1VA 1SKYE 3TR0A 2DPXA 2X19A 4PC7A 2FX3A 2V7QD 3BORA 1KI8A 1FP7A 2ODEA 4NPHA 1X1RA 5DI9A 3DL0A 3OFNA 1N6IA 1Z2AA 5TDHA 3EIQA 1N3BA 2ZAOA 3CZQA 2CL6X 4JIMA 4UKDA 4KSBA 2HF9A 1SGWA 5G40A 1IY2A 1YR9A 4EIWA 1JQJC 1ZAKA 3GJ7A 2JDID 4KU4A 4F4IA 2FWRA 4OQNA 3IHLA 1E2NA 2GZDA 3FHCB 3JVUA 3GPLA 4IDQA 1T3HA 521PA 2CE7A 3NHAA 2XX3A 1P6XA 1CR4A 3IO3A 1W36C 4HB3A 2HLDD 3DKPA 5FOSA 3TQCA 1XMJA 2XOKA 3QKTA 4G3XA 3H86A 1R4AA 1DAEA 3S1AB 2XSZA 4PQYA 3SZRA 3LVQE 3L8ZA 3TR5A 2NGRA 4LYHA 1NIPA 4G5SA 5DISB 1W47A 4XD7A 2DHRA 4BLRA 3RANA 1A4RA 1XTIA 1GKUB 1ESMA 2DBYA 2IUSA 2XJ9A 5JBQA 5KNDA 4EPWA 4GL2A 1E2GA 4M9QA 1IJEA 4B6EA 3SBEA 1C4OA 2ZI4A 3PUZA 1FZQA 4Q1CA 1WP9A 3DKVA 4TT3A 4B3BA 4OHYA 1IOZA 1IHUA 3OHMA 3HR8A 4CEHA 4PQFA 4A2WA 4O2LA 2H5EA 1N6KA 1YZNA 4B43A 1E79A 3KJGA 1OFUX 2GWHA 2PLFA 3PUYA 4LHXA 3GLIB 2AWNA 2H7VA 5JLJA 4PC6A 1LF5A 2ZE6A 2W6IA 4B2IA 2R44A 2ZRKA 1CIPA 3K9HA 1KI2A 1KK1A 4WA7A 4D82A 1YZUA 2OCPA 2GK7A 2CHVA 2IC5A 2W6JA 5HCNA 4A1FA 4KHZA 3MJHA 3CPJB 2XZLA 3S1AA 2UKDA 1HT2E 3PXGA 5CK4A 3EZ6A 4B48A 2PT5A 1P2SA 3VR5A 4ON9A 3KQNA 1WA5A 4LYAA 3K0AA 1T8TA 1U81A 1XD2B 1KO5A 4B2PA 2VRWA 4URUR 3IGFA 4AG6A 1KAGA 3I5XA 2LKCA 4NZYA 5KDLA 3KJHA 2XTNA 4XWKA 3Q5EA 2W2TA 1BS1A 3QBTA 2ZYWX 4IKEA 5KHOC 1CULC 2FDCA 2R6FA 2WSSA 1U8AA 1VDZA 3QOFA 1XU4A 4US0R 4XTCS 1XFAA 2NMVA 4LWZA 3UANA 4DDTA 3LX8A 2CHQA 4KITB 5DO9A 1XTRA 2FG5A 3AVQA 2ZJBA 2MSDB 4PC3A 1OIXA 3AF3A 2OV2A 3D6TB 4TN1A 3GLIA 3H4MA 2SHKA 1S1CA 1P2UA 3QENA 4URXR 1QHHA 1XNJA 4RVCA 5BYKA 2ODWA 2O8EA 3BB3A 2X2FA 1G1MA 3H84A 4KVGA 2QGZA 4BQSA 4DLVA 2ZI7A 3NH6A 1PVOA 2IF2A 4Q18A 1ZBDA 5EQTA 3R8FA 2W2VA 3BIFA 2VF8A 4QL3A 4XVQA 2REBA 1TUIA 2WAXA 4Q48A 4EQ6B 1RZ3A 2ZRMA 4FXPA 1S9HA 3I61A 4B44A 1XD2A 1AKYA 4G01B 5GJVC 1DBSA 4GZMA 3KKMA 4TMTA 4XJXA 2CJWA 2R62A 4HDOB 1UDWA 2IYRA 4LX0A 1CXZA 1XMSA 2R65A 1GNQA 1VHLA 2VP9A 3MWJA 2BOVA 4F93B 2ZI3A 3ONWA 3MG9A 2F1IA 3TKLA 1Z0AA 1RJ9B 2YOFA 3NC1C 2WVJA 2RKOA 1AZTA 3QSYA 1SHZA 4B2LA 4KFSA 5HKKA 3TQFA 4A0GA 2BBOA 5DN6A 5B30A 1N6NA 1Z0DA 2CCJA 4JLJA 2QTHA 1Z6YA 2YYZA 2EVWX 2ZSFA 3T1QA 1GNPA 1U8ZA 2OSBA 4EDHA 2VA8A 2O52A 3MGCA 4LBYA 4NH0A 1PZNA 1KIMA 3FHOA 3WP0A 1R10A 2AFHE 2VEDA 3GLHE 4QKQA 1PUIA 2GF0A 4EQ6A 4GOJA 5FTKA 3A36A 3OAAD 5H68A 3ZZUA 3PEWA 4OQLA 4DCSA 1ZP6A 4NHOA 2N1BA 1E2IA 3PIRA 1E32A 4CRWB 2DWPA 2O8DB 3M6AA 3PUXA 2GXSA 3CF2A 4JLKA 4LC1A 1KZGB 2HJVA 2F43B 2H8KA 4NCKA 1QVRA 2J3EA 1RJ9A 2ZSEA 3BH6A 2XZOA 1G7RA 2AK2A 4ZCIA 8OHMA 3TW8B 5KSOA 3B1ZA 5GADl 1W5SA 4OHWA 4Q4HB 2VL7A 3UWOA 5KSYA 3U3MA 1QHIA 3X1ZA 3SBDA 4BE7B 4BFVA 1BO6A 4JVNA 4Q7KA 1NN1A 4DB4A 5JHGB 3ZDQA 1IY0A 2KB0A 4US2R 4JL8A 3TK1A 2XNDA 4R9UC 5CIWA 1DO0A 3FWYA 1GDDA 4B3CA 3C15C 4CZ2A 2J9RA 3TUJC 1GVNB 3A8TA 1G8PA 4V0LA 5CDFA 2CE2X 1B0UA 1T3SA 1VYTA 1MO6A 3R7WB 3WYGA 3RS5A 4GT1A 3DHWC 2MSEB 1CU1A 1CJVC 2ZS9A 3GJ4A 2JLUA 4LHYA 3QG5A 4URYR 2O8DA 2IEZA 2JLXA 3RABA 3L43A 4GRAA 4KLNA 4F4CA 2HF8A 5KTYA 2F43A 1ETUA 2WIBA 3W6NA 1C9KA 1QG2A 1YZQA 4Q47A 4UJ5A 2ONJA 4Q01A 1TQ6A 4NCJA 4XSGA 1E2PA 4HAVA 5FR2A 4Q4HA 4MDEA 3AKCA 4TYWA 3CH4B 1UKYA 2Q0HA 4JL5A 4DRZA 1Z07A 2DY1A 3TUIC 4B33A 4CGZA 1XTJA 1XTQA 4M2LA 4WZ6A 4OL0A 2WBLC 3FFAA 3MAAC 3CIOA 3PVSA 2AD5A 4V0MA 4AYWA 3SYKA 2V7QA 2RGAA 4YMWA 1N2CE 1WRBA 1KKMA 2CEAA 3RRZA 4V02A 5EE9A 5SZIA 1OT3A 5J4LA 2IWRA 4MKFA 3B5JA 2CL7X 4ITRC 5JJIA 2B21A 1W44A 2J45A 3BH7A 3R7WA 4XVRA 2JDIA 1RFLA 3GLGE 2YZ2A 3HP1A 2F9LA 1F48A 3C41J 5DSZA 2ZI6A 3OE7D 2ZR7A 1F6BA 3AH8A 3OF5A 4KI0A 3TAHA 4TQUS 2GETA 2VP2A 4Y0AA 4DDVA 1HYQA 2HLDA 3PUVA 4RD2A 3W8NA 4IW3B 4RD1A 3J81k 3AKYA 3H2YA 1ZCAA 4I81A 1E2MA 1LTQA 2IHYA 4BEBA 2O0KA 4OKSA 4L9WA 2A3RA 4NONA 3MSXA 3NVAA 4PAMA 1KTVA 4TLCA 3NIBA 1VG0B 4DWJA 1MRSA 1I2DA 3K0SA 3ZS9A 2Y8EA 2PEYA 3FKQA 5EE1A 4FI3C 4EUNA 3KFVA 4NKRA 1XD9A 5TXGA 1RIFA 1VCOA 3TIFA 3Q3JB 1XZQA 2PX3A 3A58B 1SZPA 1AJEA 2P6RA 3MWKA 2ERYA 4OK3A 4ABYA 4DDWA 5K8TA 1WB9A 4DZZA 4XH9B 4A6XA 2ZYVX 3DM9B 1NVWQ 3U44B 3AVWA 2EFHB 1LS6A 3K0CC 5K8UA 2ZANA 5J4HA 4Q02A 1X8LA 2GCOA 1NBME 4K8OA 5K8IA 5EUMA 5FTNA 1GKYA 1XCPA 3BGWA 2ZUDA 3FMIA 1SVSA 3IBYA 3FDIA 3BBPA 5BXQC 1IXSB 3EC2A 2OXRA 3LQRA 1CR1A 1G8YA 2WOJA 3QXJA 3LW8A 2NO9A 5B57C 5IK2D 1CTQA 2JLQA 4GP6A 3DM5A 2V6JA 2A5DA 1KJZA 1CJUC 3N5CA 3LBHA 2MMGA 5JRJA 2GBLC 1YVDA 4XSHA 2V54A 4Z51A 1Z29A 1UKVY 4ZI2A 3AVXA 3D8BA 3ZYCA 4MKHA 4UXHA 4FMCB 5KDOA 3O8RA 4O2RA 3EG5A 3U6BA 5G53C 4ILEA 1JI0A 1G3RA 3IUYA 4CDGA 2QM7A 2JLZA 1UEIA 2BKEA 3EA5A 3AF4A 2GF9A 5BN4A 3B13B 3TUZC 3WNDA 3ZJYA 4KJZA 1RYHA 1E9DA 3U44A 4R71A 3KL4A 1MABB 4BFSA 2CHGA 1R5BA 2RHMA 3WRYC 3THWB 1ZU4A 5JS7A 2XAUA 3QPWA 4HAZA 3QVUA 1X8KA 2QA5A 2Q9BA 3KUCA 3LH5A 1UEJA 1Q1EA 5GVSA 3LQQA 2ZR0A 1J7KA 4DSUA 1XJ0A 5FUYA 4DUGD 1P73A 4WW0A 4YMSA 4PPFA 4AIIA 1JALA 3IILA 1HA3A 3GLFB 3AQ4A 4EPRA 1E96A 4NYJQ 4ASUD 3K0CA 4OHZA 2D62A 2VIIA 2XITA 2CBZA 4DLXA 2CMKA 3QUSA 4HI0E 2ZJYA 4CT4B 4NYIQ 2MMCA 4OI0A 1VKJA 4PHFA 1U0JA 3H0KA 4OJKA 4R7ZA 2F55A 4LYJA 4F4JA 2ZUBA 4JT4A 1NBMD 4OI1A 4DLUA 4JLPA 4Q1BA 5D3QA 3CR7A 4DT1B 1HH4A 4B3FX 3ZIAA 3BXZA 2GNOA 3THXB 3REFA 3HU2A 1FQKA 3KDSE 4JLOA 4BFTA 3WNBA 2GBLA 3RLFA 2IS2A 4RD3A 2CLDX 5DHAA 3THWA 1PLKA 1S96A 5EE0A 3LD9A 2RB4A 4HLQB 3WHLA 4B3XA 4Q9HA 1EG7A 4FCWA 4TL6A 5AJVB 6Q21A 3UMSA 2FMXA 1Z28A 3CRMA 3D31A 2IS4A 2CDNA 2IA5A 3C14C 4HDCA 1JJ7A 1N0WA 3ETLA 3L0IB 4ESHA 4E07A 2VP6A 1YR8A 2D06A 4KBFA 2BEJA 4KV9A 5GJBA 3VU9B 2C5LA 3K9GA 2GEVA 2E9SA 5C2JB 4JLAA 1P75A 1US8B 2IEYA 3OAAA 4TMVA 1JAHA 1F60A 2FSFA 3AF0A 1XF9A 4D4LA 2D7DA 1G9XA 2AWOA 3GEEA 1E9BA 4DT1A 1DAKA 3U3OA 5KUTA 1OFTA 3THXA 1G41A 2BIFA 1XWIA 1U99A 4MYCA 2JLYA 4ZDIA 1WBBA 1P2TA 1X3SA 3GEIA 5FBRB 3W34A 2QP9X 4IDHA 4EJSC 1FW6A 1J2JA 3A4MA 4FCVA 5EUQB 1KKLA 4TYQA 2YNMA 1MV5A 3GLHB 2CCGA 2R6CA 5LD2C 2X2EA 1E2QA 3MJRA 3ASZA 3B78A 4PHGA 2YVUA 2O5VA 4RZ3A 4KSCA 2Z4RA 1NLYA 1U0HC 3KB2A 1IN4A 1DAGA 1UDXA 1G8FA 3VNUA 2YWGA 2FNAA 4D4KA 2NZ8A 2GXUA 3VU9A 1Z6AA 2CVHA 2OEPA 2OBMA 4AKHA 5FR1A 2FOLA 5EE3A 1US8A 5LD2B 2FA9A 2P5SA 1IXRC 5A0FA 4B75A 1OH7A 1FPMA 1TEVA 4BZXA 1E2JA 3A37A 3EZ2A 1E4YA 1W4CA 2BBSA 4CF7A 2IX3A 1N6HA 1TTTA 1A82A 3G82C 4OQXA 3ASYA 5D3MB 4W5JA 3PJRA 3Q7PA 3C4JA 3PR1A 2FSGA 1H8ED 4G5GA 3TSOA 1G17A 4BFWA 3Q8XB 1O87A 4F92B 3IO5A 1GG2A 2V1XA 1NF3A 2R6GA 4DJTA 1ELOA 4D4JA 1SVLA 1W7AA 3AM1A 3R9WA 1JR6A 1AKEA 2ZSDA 2ZYUX 2AR7A 4YMVA 1OE0A 3GLHA 3W90A 3G0HA 2ZJAA 2BCGY 1ODFA 3BC1A 4DLYA 2GXQA 3T1OA 1RRPA 3FPAA 3T5GA 4Q00A 1UF9A 1KO4A 4AKIA 2FFQA 3THYB 3EPKA 4QOSA 3QBVA 1IXZA 2F7SA 1XEFA 4EJSA 2XJ4A 5TMPA 5CJ2A 1A5TA 4JJZA 2JA1A 4CEJB 2QRNA 1ZUHA 3EA0A 4HEJA 3MWYW 2ATVA 4FMDF 4JT2A 4NU0A 2FEMA 3VMFA 3ICEA 3L2OB 4I1UA 1Z2CA 1PLJA 4RFVA 1N25A 4IHQA 4PAQA 2QQEA 3OE7A 5D3MA 2RAPA 2HYDA 3A1SA 4AYXA 4P32A 5DYGA 1G5RA 5LB2A 3CRVA 1F3OA 2FH5B 3FVQA 2Z0MA 4I1OA 2YWFA 2IK8A 4NCHA 1MRNA 2BKUA 4NYMR 1GILA 1PLLA 4Q4LA 1G16A 3R9IA 3UKDA 1Z22A 5A5GA 4BASA 1K8RA 1Q22A 4LJ8A 1K5DA 1YZGA 4L5BA 2JGNA 1U98A 2B8WA 2O8BA 1CJTC 4C0LA 2AKAB 3CNLA 3UMFA 1JXOA 1N5JA 5LB4A 2GEDA 2RGCA 2R2AA 3B1XA 4A4DA 4LJ7A 3GLGB 4JSTA 3THYA 1Z6TA 4ZCMA 3PENA 1EFCA 1HV8A 1ZUNB 5E7MA 1J90A 3MLEA 2WJVA 2RGBA 1ZJ6A 2BC9A 4CEJA 3P4YA 3FMPB 1Q3HA 5LBIA 2W2XA 1FTNA 2V55B 5AK0A 2QG6A 4IEIA 4DLTA 2JEOA 4RD6A 2B7BA 2VSXA 2PJRA 4TYNA 1J70A 1VPLA 1ZNWA 2VO1A 2IYUA 5TVKA 4B71A 1IBRA 1EXMA 2GILA 4TLAA 1JEEA 1MR3F 2OAP1 2JIZD 4JVSB 3UPUA 2XXAB 4IRUB 1WXQA 4AKEA 3DVLA 3O8CA 2WZQA 1I4LD 3HPQA 5HCIA 1TF5A 2OFXA 2QROA 4CEHB 1VG8A 2G1KA 3CNNA 3NEYA 5F2EA 3RS2A 5M04A 5IK2A 1TX4B 1P9WA 4IVPA 5FL7D 1XMVA 1EGAA 2G88A 2ANBA 2WV9A 3GQBA 3TVTA 3UIEA 5JZVA 4JLBA 5HE9A 5JECA 1NMYA 4A6PA 2BBWA 3IQWA 5CB8A 4IDNA 3CX8A 4MGYR 1R7RA 3GLGA 1T0JB 4A8JC 2EQBA 1QBKC 3U5ZB 4PO9A 5DE3A 3UXMA 4E5UA 5AJXA 3ICQB 5L3RA 4LJ5A 3I3SR 4J0QA 2ZVPX 1KMHA 3AVVA 1NVUQ 2C77A 1XBTA 2WM9B 3K0AB 2VHTA 2ODNA 2I4IA 1W36B 2O8CB 3CPEA 4ESVA 2QY9A 1KK0A 1VYVA 3SS8A 4A8JB 2BWJA 2PT7A 2ZIAA 3QXSA 5E7IA 5GVRA 4DUGA 5KU1A 2IXGA 2XB4A 2FF7A 4EPXA 2XXAA 1S3SA 4F7WA 1P61B 1N0UA 4Q19A 2O0JA 2ODBA 2QBYB 4AC9A 2WMOB 5HE8A 4XOIA 2FPMA 5HR5A 2JLWA 4ASUA 2ZSBA 4KXFB 3BS4A 1G291 2JCSA 1G21E 2QAGC 4BGDA 2WWGA 1AS2A 1QHHB 3CX7A 2O8EB 1QHNA 3CKLA 3U2QA 4B47A 1FP6A 2RGXA 1RE0A 4OK5A 3AUXA 2G83A 4S35A 3B7GA 1LFDB 1VCIA 1NBMA 1KAOA 2NO6A 5E7JA 4R2IA 5GJWC 4DEXA 1OH5A 1W2HA 5IF9A 3RC3A 1NNEA 4JLDA 1EX6A 3T61A 1Y3AA 2C03A 4BECA 1UFQA 2QAGB 1OW3B 4XWAA 2PEZA 2O8CA 4DSTA 2CJWB 5FTJA 3AKEA 2J0UB 2ORIA 2PZFA 3BAFA 3FTQA 4AY2A 1ESNA 2NO1A 4A8JA 2GA8A 1Z6XA 2BMEA 3RYTC 3I72A 4OJQA 1GNRA 3N70A 4Q1AA 2Z5FA 2OCAA 2PX0A 3P27A 1LNZA 2IYYA 2ZJ5A 3M1IA 4M1SA 1FX0B 5FBVB 1N5IA 2W58A 2QBYA 2V1UA 2DB3A 1VCMA 4TL8A 3THOA 1W48A 1Z3IX 1JXMA 1W4AA 1XPOA 2Q9AA 4GNKA 1YJ5A 3T12A 2RHDA 4BWYA 1Q12A 3IIJA 2Q3FA 2WWWA 3VR4A 4FMDB 4M9ZA 2ZRIA 2O0HA 4IDOA 2ZYTX 4I99A 1N5LA 5AJWA 1KOFA 1RW4A 1XTKA 2C2HA 1FOEB 1M7BA 1SQ5A 2QU8A 3CPHA 3QG1A 4UNPA 5J40A 5CJPA 1T8UA 3U6KA 2G0TA 3SFZA 4AD8A 2XTMA 1NLFA 4KBGA 2AK3A 1NMZA 2QTVB 2PZEA 4A9AA 4I4LA 4MGIR 3RNLA 3N2IA 2QAGA 1OXTA 2DCUA 4QGAA 4MGKR 4RD4A 4DVGA 5JRZA 4YXWD 3SNHA 1E9SA 3GJ0A 2J0UA 3A1WA 4TL9A 1DPFA 2AL7A 1S2MA 4L4UA 4EFNA 1PUJA 4RZXA 5HZHA 1YRBA 3EPJA 2QGNA 3EX7C 1E4VA 2WKQA 3EWAA 4GI7A 4QBFA 1FX0A 3EAQA 4MRVA 4A0FA 1N6OA 3B1YA 4IVRA 4PZYA 2F9MA 3I73A 3LW7A 2GDJA 3SFVA 3SYLA 2KSQA 5IDVA 1AA9A 1E2KA 2WJHA 2ZETA 1QDEA 2BJWA 4I1SA 4W7SA 2QI9C 3SHWA 3AF2A 1IN5A 4PC1A 1J8MF 1OHHD 3MMPA 4IXNA 4Q5IA 1ZNZA 4KYUA 4NCNA 1W0JD 2QT0A 4M0LA 5F9HA 4GBMA 3OIYA 4TLEA 1XRJA 1NN5A 1TMKA 1Z0JA 2EYQA 3VHLB 1H8EA 3X1XA 3QNUA 1NVVR 1QVAA 2IHBA 1KSFX 1E69A 4I1VA 4LK2A 2A9KA 1G3MA 2WAYA 2CL0X 2XZPA 4M53A 1G7TA 1ZIPA 5H70A 4AYTA 1G8HA 5EE5B 3I92A 4FMCF 4Q9IA 2EWWA 2IS6A 2P65A 5IT5A 5SZJA 2HT1A 1UAAA 1E0KA 3LNCA 3A1UA 4AG5A 3EZFA 2IL1A 2KBFA 1ZW6A 1F2TB 1I4DD 1U94A 1G64A 1E99A 1W0KD 3L0PA 4GSYA 3WMFA 2NZJA 3EC1A 3ZVNA 3CO5A 4Q9KA 3NWJA 4TQ9A 1LB1B 1R8QA 2P3SA 1L2TA 4Q1DA 3ZH9B 1Q57A 2VHJA 4D0NA 2OLJA 4WAUA 1BMFD 4DIDA 4DKXA 1G5TA 1UKZA 1II0A 4D6PA 3KKOA 3ZD6A 4BZQA 2YOGA 1J99A 2QL6A 3CWZA 2Q9CA 4D0LB 2HYIC 2IS1A 5UKDA 1RRCA 2V4ZA 5AWFC 1KJWA 3TJZA 2PMKA 1XEXB 4Q9LA 3JZAA 2C95A 2PL3A 1T0HB 3B85A 4M1OA 4QNMA 4NMMA 1UBCA 4GDFA 2J7KA 1M1YE 3CM0A 2VBCA 2ORWA 2J41A 4LHVA 421PA 1PJRA 2LCFA 1F2TA 5FI1B 2R8RA 1GFIA 1KDOA 3OZXA 4D0GA 2ZXUA 1ZUIA 2Q3MA 1K5GA 5JJLA 2GXAA 2ZTSA 4FMBB 4N3NA 4MQBA 2UVQA 3R20A 5LDDC 1JNYA 3QE0A 2PLRA 2CXXA 3QXHA 1NG9A 3LFUA 1UKEA 3LLUA 1OH6A 4X8LA 3C5CA 1R0WA 4C0QC 3UATA 1DTSA 2JIZA 2GZHA 2OUKA 4YMUA 5EP3A 2ZU6A 1AGPA 2A5FA 1JR3E 2P0EA 1XEXA 4IEEA 4C0HA 2AKYA 2CNWD 2IYLD 3RRYA 4LJ6A 2GCOB 2AXPA 2ZAMA 5FL7A 3HYRA 2RH5A 3K1JA 5TY0A 121PA 2GJ8A 4EPVA 3RVBA 3B2EA 3C7KA 4QBIA 3BFKA 1RKBA 4MRNA 4JLMA 4N1AA 3ND9A 1FL9A 1WQ1R 1KSHA 1SKYB 3GMTA 3JZMA 4HAXA 3FMFA 4M1WA 4MGZR 2I3BA 2F3TA 4ERNA 1W46A 2IYZA 3BFXA 2J0QA 1LS1A 3PITA 3A1TA 1HT1E 2XEXA 4UNQA 4RSGA 2YINC 3A4NA 4C4PA 3Q5DA 1YE8A 3LAWA 3RWOA 1W1WA 1TADA 4JL6A 1AQYA 1XCGB 2ZRNA 2WIAA 3BRWD 4GMXA 3NBXX 1Q44A 4C0BA 4JS0A 5FOVA 3EIEA 3VR3A 1TEXA 3QKUA 1BKDR 4M8NE 2F1JA 4A2QA 5BYJA 4M21A 2EWVA 2VSFA 1G3QA 4Q21A 2HJGA 2YOHA 3AVPA 2W83A 5C4GB 3UG7A 2GEUA 1Z0IA 3AV0B 3CRRA 3HU1A 3QIAA 2WJYA 4IOMA 1XX6A 1EFUA 2FJUA 3SJCA 2WPDD 2JJ8A 4MUBA 1W4RA 2PZGA 3DOEA 2KI5A 3W8RA 3BJIC 4F38A 3EWSA 4TL7A 1N6PA 4TSFD 3SQXA 1DAIA 3E5HA 4TTPA 5KSZA 3DDCA 1OXVA 2PMDA 2JLRA 4WVFA 4LBZA 2B8TA 2C98A 2L0XA 5P21A 3TMKA 4AK9A 2VP4A 2C78A 4FD2A 1T4GA 5JEDA 1SXJD 1YKSA 4RZ2A 1ZYUA 5CYPA 1JR3D 1T91A 5CITA 2REXB 1Z08A 4POAA 1GM5A 4ZI3A 2JJ2D 4C0JA 1ZD8A 3IIKA 1RPZA 4LCBA 2RGDA 1AZSC 5B2ZA 2FPKA 1R0YA 4HUTA 3U7EB 3BFVA 3RRNA 1LV7A 2REOA 4QHTA 3X2SA 2C9OA 1FNMA 4FCTA 3SU8A 4P4TA 1FTSA 2ORVA 1P3JA 2FFAA 4L8GA 2OT3B 3KQKA 1KI1A 3NH9A 2FGJA 1WE2A 2WWIA 1R0XA 5DGXA 3GD7A 3U60B 5FBWB 2OILA 1JB1A 2B7CA 4G5QA 2ZPTX 4RKFA 3V4FA 1OH8A 2ZI9A 2RMKA 3WXMA 2G0NA 4GOXA 1CJKC 3X1WA 5DHFA 3PFIA 1NRJB 3QXCA 1KK2A 4NL4H 2CK3D 2VPPA 1EFTA 1E1RD 4Q03A 3CWQA 3QVVA 4PHTA 2VP0A 4PTLA 1OJLA 4FN5A 2ZRDA 5L8VA 3U4QA 2J0VA 1SULA 2ZJZA 1N6LA 4PSVA 1YU9A 4QM7A 5KPJA 5CB6A 1X8JA 1OFHA 1A1VA 1FFHA 4RJLA 1UBFA 2C04A 1FNNA 1HQYE 2K5UA 4JKYA 4YXWA 3B1VA 3QJYA 5AR1A 1JQLB 4ZIRB 1DAMA 4V0NA 3OEHD 4IJMA 3LY5A 1OSNA 1GL7A 1NY5A 4QGFA 1VG9B 4A82A 3KQUA 1KY2A 3LXXA 3LO5A 2ZS8A 3IKJA 1OXSC 4BFXA 5KDDA 3U3JA 1YR6A 2VF7A 4LY6A 2GESA 3BOSA 3K8YA 5G41A 4FIDA 2ZS7A 4K46A 1R6BX 3R8CA 4LHZA 3R9XA 2BVNA 1D6JA 5J5CA 4LHWA 1K6MA 3T1VA 2ZQ5A 4URZR 4HAYA 4DSNA 1P9RA 3CONA 3SDZA 1OHHA 1Z47A 1E94E 1QHXA 2W6JD 3FE2A 1E2EA 3NBZC 4MYHA 5EP4A 5TARA 3VNVA 1OKKD 4OK6A 4Q7LA 4Q1EA 2A5YB 5KOYA 1W0JA 3G5UA 1N6RA 3QKRB 1YHNA 4LRWA 5C46F 2ZR9A 4Z8YA 5EP2A 4LBVA 2OCYC 3KXKA 3U3RA 5FPTA 2YJTD 1NSFA 4PPNA 2HXSA 3C16C 4UQOA 3FOZA 2KWIA 4EPYA 5BW8A 4DC9A 1AIPA 2QPTA 3FMOB 2ZRHA 3AB3A 4JSYA 2XB2A 2XGJA 1AQUA 1LF0A 1GRNA 3ADCA 4C2TA 2BM1A 3SJAA 4QJ3A 4ZIRA 3GJ6A 4RCZA 3AGQA 4RZUA 5FH9A 4W5WA 3K09C 4ACAA 1OF1A 3AP3A 3V4RA 5DH9A 4PXAA 4C2UA 3PCRB 4FW9A 2PCJA 1W0KA 3CZPA 2JATA 3AVOA 1F5NA 4CIDA 1KHTA 1W4BA 2QPAA 5JCZA 4EKDA 1M8PA 1TU3A 4DB2A 4BPBA 1Q0UA 5C4MA 2ZRFA 1CS4C 4ZKEA 1ZVQA 2N46A 2IYTA 2V6IA 1XEWX 2XTZA 1XMIA 1AM4D 1BMFA 1W2GA 2QEQA 3CH5A 2WKRA 4TTRA 4LV8B 1FQJA 2WSMA 4TLDA 3KKNA 1EK0A 3QKRA 1J8YF 2A2ZA 2A30A 3OEED 4EFMA 2VTKA 4EJSB 1L4UA 3TVDA 3GCGA 4R2HA 1OYYA 2OO7A 1CRQA 3BERA 4DLSA 1KSGA 3QY0A 1QHSA 4JYBA 1E0JA 5DYIA 4JBYA 4TYPA 1XTSA 3T5DA 1HQCA 3QPUA 4IOJA 1OXUA 1Q1ZA 2QENA 3F3YA 2QNRA 2IYQA 4M9XA 1GL6A 4KODA 5L3QB 4MKGA 1ZM7A 1GSIA 4QRHA 2WKPA 1XJCA 3ZVMA 4PQRA 4JYCA 1BH2A 2YWHA 2Z43A 3DZ8A 3T34A 1WBDA 1JECA 2E1RA 1EFHA 1C1YA 4WOPA 4M9SA 1RRFA 5FUWA 3VQTA 3NTUA 3K09A 1V5WA 1GIAA 1DE0A 1DG1G 3P1JA 2O8BB 1CP2A 2Q21A 2RCNA 3CF0A 3X1YA 3TLXA 1RVDA 2WWFA 5FPKA 3ECCA 4L9SA 2DFNA 3GP8A 5JMTA 1WF3A 3EPLA 2WWXA 1V43A 2WHXA 1VCNA 2JJ1D 3EZ7A 2NTYC 3WRXC 2WWYA 3TE6A 2CCKA 4Z8XA 1A7JA 5EXSA 3EZ9A 5EXTA 2HEIA 4KAXA 4AURA 2CNWA 4ARZB 1F2UB 3Q72A 3HDTA 3K0EA 2RGEA 4G0NA 3QKSA 4RCYA 5FBLB 5JCPA 2J46A 1KYIA 1P2VA 1S1MA 3LX5A 4NTZA 5KSPA 1SXJC 1S4QA 2D4HA 3W6OA 3UG6A 4UNRA 5LPNA 5FFMA 5L3QA 3GFTA 4N0EA 4MYTA 2WJJA 4M1KA 4JMPA 1XXHE 1LVGA 4LOAA 4A92A 3M0EA 1IJFA 2QE7D 2IXEA 4LBWA 1DARA 3EW9A 2F3RA 3IHWA 1ZD1A 4Q7JB 5JSZB 3KQHA 4LJ4A 1P62B 1R5NA 1EFRD 1OXXK 1H8HD 2Q6TA 5EP1A 1Z06A 2VLIA 1E9FA 4WZAE 2DWQA 3OIVA 821PA 4URVR 1ZM9A 4LSGA 3KX2A 3EPHA 1KO8A 1NN3A 1TQ4A 4HAWA 5CM9C 3PEUA 2V3CC 3SN6A 3NC0C 1DO2A 1UBEA 4RFSB 1DADA 3KKPA 1KMHB 4LZZA 4R98A 2QSYA 2R6AA 3SEAA 5K8LA 3BE4A 4ARZA 3IEVA 1F2UA 1JPJA 1SVKA 4KLZA 2C96A 1G18A 3F8TA 1AK2A 4PZZA 1G20E 2WPDA 2BMFA 1XJQA 4V03A 2ZROA 4PFSA 1NMXA 1SHKA 4O0MA 1R5OA 3L0OA 3P32A 3U7GA 1OPXA 3I8XA 2QT1A 5DIFA 4GZLA 1T5LA 3SJZA 3ZVRA 1JAIA 1CJMA 4QBHA 5JSZA 3HR7A 4BRUA 2IT1A 3IBGA 2OHFA 1E9AA 1GTVA 2IYWA 1DVRA 3DOFA 3LRPA 5E95A 3LLMA 1CBUA 4URWR 1GRQA 1YZTA 3RS3A 1SXJA 2KE5A 4DLWA 1JR3A 3RS0A 3PEVA 4Q7MB 5FPYA 1M2OB 2JJ2A 3M4YA 4TTQA 4PANA 1U0LA 1BIFA 3KUDA 1XDBA 1UPTA 1Y63A 4RD0A 4L16A 4RFSA 3P4XA 2DFLA 3CNOA 4GFDA 3K9NA 2OM2A 2EW1A 3I1FA 1NLZA 4GP7A 2MSCB 2ZRAA 4PPQA 1QG4A 3B1WA 2IUTA 4QM6A 2OESA 3DZDA 1M34E 4YC7A 2J87A 1M7GA 3ZQJA 2CLSA 2QMUA 3IQXA 1KO7A 3P26A 1E9EA 1D2NA 5FTMA 3EASA 2CK3A 5FOXA 3ZVLA 2QUZA 3PV0A 1E1RA 4TMXA 3LA6A 1HE8B 2D2EA 4C9BA 1BOFA 1E6CA 1YZLA 5BQ5A 1KDTA 1VG1A 2IBMA 4IOLA 1OFIA 4BLOA 1HEIA 4JBWA 3FKSD 4HSEA 3GJ3A 2FEOA 4BEJA 5JHHB 2QMOA 4BZPA 1XEWY 1GUAA 1P5ZB 4MITA 2P67A 4LPKA 3OEHA 2WOOA 4PPGA 2P6UA 2HDNB 3ZZ0A 2A7QA 5CM8B 3WYFA 3NKVA 2H18A 2WMNB 4HB2A 5JWHA 2J59A 4LJAA 4PC2A 4Q1FA 4IVQA 3B82A 3GEHA 4MRRA 5IRCD 4TMKA 2LKDA 1D9XA 3LDAA 4MRPA 5IHPA 2GK6A 3ADDA 3W6PA 1GZSA 1S8FA 1YR7A 4QG7A 1M74A 4LPSA 2EFCB 1DAFA 1KI7A 2ZSAA 1ANKA 3AKDA 4QC2A 3CB4A 2C99A 4WBSA 5CYOA 2C8VA 1AS3A 4RKEA 2HV8A 1NIJA 3DEFA 1OKKA 2H92A 3MUFA 1B23P 1GP2A 2ZM5A 4ZDJA 2G1JA 2J1LA 4MYUA 4A2PA 2G3YA 2W0SA 1NN0A 3MD0A 5FOWA 5H1YA 2BV3A 2D7CA 3SI7A 4HZUB 5CLQA 3WMEA 3T1TA 2NQ2C 3RAPR 1G6HA 2ZRGA 3GLFE 1NVXQ 4NP6A 4TLBA 3WBJA 1KI4A 4DDUA 1NSTA 3TSWA 3LV8A 2FFHA 4U02A 1SKQA 3GJ5A 3K9LA 4PX9A 5EZ5A 4DLZA 5JI2E 1N0VC 3TH5A 1KNQA 3KJEA 1CF4A 2PCLA 1I4TD 5G3YA 4V0OA 2CVFA 2IYVA 4B74A 2YWEA 4JLNA 1R2QA 3MRSA 4G5OA 4JVLA 3UWKA 4ZV4A 4B3GA 2ZJ2A 2RGNC 5SZHB 1IY1A 1XCMA 2QORA 2TMKA 1E1QD 1Z83A 3FHTA 1ZC4A
chains in the Genus database with same CATH superfamily
1BNCA 1W6RA 3DL2A 3IXLA 3QJ5A 5ES4B 4XFDA 3VPAA 4B34A 4PZLA 4AZSA 4CYMA 2IHUA 5JU6A 3EIHA 3SHQA 4YT4A 5HTKA 2EJTA 1VSTA 4NE2A 4WXMA 2PR2A 3DE0X 1L3CA 3VDMA 1ZMXA 3CN7A 4CHTA 4ENWA 1PV4A 4W8HA 4XGRA 4TMZA 1PSWA 2EFEB 3QX7A 3WK6A 4OHVA 1MJHA 4QUIA 3JQBA 1TIBA 2BMDA 1Z7BA 5E4YA 2FSUA 3TAHA 1PL8A 2QAJA 3BEDA 5JC1A 3HJTA 3GRCA 3SYNA 1I1HA 3EH2A 1TM7E 2YQ4A 4FWIB 3DYIA 2B9VA 2A7XA 2HXGA 3VOTA 2NUTA 4ZHQF 3GLRA 4I8DA 2RE8A 2EZTA 4LI0A 1JHPA 1T13A 2Z04A 5DCLA 4Z4EA 2WWHA 4NBTA 5J47A 2JIRA 4QSHA 5BORA 4WIAA 2PUJA 4QYXA 1ZLYA 1I3LA 2AEJA 2GRJA 4D9IA 4O1HA 1IXYA 3LUDA 1L5WA 2YJZA 3ZR4B 3LKZA 4D79A 4P6VF 4QUBA 4JI4B 2ZTMA 1L4MA 4UHKA 5F3WB 3B9BA 5EC8A 4RF3A 3N8NA 1EXNA 2C0PA 4YHHB 3T3PB 1UBMS 3DE5X 4IFEA 4XKJA 4HGNA 4HWKA 3PC6A 3NZEA 1S2NA 1KP9A 1JEDA 4ZVMA 3SG0A 3R3UA 4KFTA 5DTIA 1CQIA 1QS0B 2NVUA 2IHVA 1NJ5A 4F9GA 4GECA 4OM8A 2RGNA 3LLCA 4WINA 1BVYF 1YSCA 2P5TB 4IJ5A 3VAAA 4YP1A 4NABA 4XUEA 4KQ1A 3WHPA 1IAQA 1U7UA 3QXXA 1O3YA 4HN9A 4J2OA 4KQWA 4MQ5A 5AUQA 4DMUB 4E09A 4BP9A 2H7YA 1TAGA 1VTKA 3GZTB 2R5FA 3KO8A 5KYKA 4MUAA 1Q20A 3OQVA 5FXMA 2ZIGA 1JBQA 1VIYA 2BGRA 3BDAA 3U61B 2UV8A 3FUXA 4YJ2A 3DNPA 3A1FA 3PGLA 5I7RA 1Y3DE 3T6KA 1UOOA 1UFVA 3KBBA 3GDHA 3NWBA 3I9LA 1NX6A 3QFSA 3DOOA 4IPTA 3WKBA 3JQ9C 2JGFA 3W77A 2BM0A 4I8XA 2NN3C 3X1DA 1Z63A 1Z2DA 3K70D 3ESBA 1YVUA 1ODKA 4YVFA 1QHGA 4ENUA 4HOYA 1KPHA 3QE9Y 4UNSA 4C2UA 5TR9A 2OLKA 3N0XA 2DBVO 4PRYA 3W3AA 1Z75A 2NXCA 3QY9A 4M4SA 2AX4A 2QE7A 4JI6B 5CB0A 1KDRA 3DZBA 4QLBA 1E1YA 4LC0A 5DTQA 2QJOA 3IURA 4EL5A 1HEYA 2L2QA 4OUDA 2BE7A 1ABBA 1O97C 2NU7B 4QWWA 4NATA 2F1OA 5KI6A 4EITA 3EBOA 1EFRA 3AP2A 1DAHA 2YXEA 4WKOA 5EFOA 4CF4A 1F1JA 4P9NA 3HKDA 3QI2A 4DN6A 2EHJA 4YP5A 2EKZA 2FE4A 3PC7A 4FYJA 5L9AA 4M46A 3I5YA 3KQLA 2GJ9A 4IHAA 5HS4A 3GRVA 4JX8A 4G24A 3ESDA 1CE8B 1ECFA 3BUSA 2P2YA 3KKQA 1FFGA 3NJ4A 3R41A 1PYDA 2HFJA 4RHYA 5CURA 5L3VA 1BJKA 4OFXA 5A3VA 1LI7A 1XHFA 1YGYA 4UU1A 3CW8X 4QJ4A 4B76A 2I6UA 4IX9A 2BDTA 1UPXA 1WAMA 1Y7TA 3AVTA 2R9VA 1DDOA 5G2OA 1J23A 2I4MA 3IPRA 3JYPA 5HJEA 4D9EA 1E1DA 4Q4JB 1THMA 4EA9A 1JX6A 1R66A 1ECCA 3HB0A 2KQUA 4JOQA 2JFXA 4XEUA 4BXOB 2B35A 4RS3A 3FNIA 1KYQA 2AQKA 3T99A 3PWZA 5FOQA 1MP0A 2ZB3A 3REQB 4ZPJA 3S2EA 3UWPA 1ATIA 3V55A 3HBAA 2GJSA 5B6JA 2P30A 4D4MA 4OH1A 1NP6A 1PFKA 2VSOA 3HJBA 1DLJA 5A6VA 1OB2A 1HUQA 2BF4A 3TO5A 1I2ZA 5EWLA 4QYMA 1VMAA 4MIYA 5BSTA 3CNBA 3IB6A 1U3VA 3A9WA 3JQ9A 3L0SA 1UADA 4K81B 4NRDA 3HA7A 5EXDA 3HVIA 3JWEA 1VGRA 5JTTA 4FPXA 3VHXA 5FLKA 1GNLA 4JBXA 5COAA 4WCFB 3L1HA 4HLUC 1DX9A 3PXBA 3ROXA 3UJAA 2B6NA 3JZIA 4LF9B 1JKIA 1TVMA 2E7ZA 1RR6A 3N6XA 3PD1A 3AONB 3CLVA 4J0GA 4Q6WA 4WUTA 3UJCA 3IBTA 1NJGA 2R47A 1B16A 1HL3A 2QRHA 3RRJA 2FW8A 1IZ0A 5CM2Z 3QMVA 5G4LA 3RC1A 4A0RA 2GN1A 4PLZA 3AVYA 3AYZB 3IOEA 3DF7A 2BFCB 5KYXA 1V5FA 1TU4A 1IQPA 1KAEA 2A4MA 3MBOA 4FLEA 1ORIA 1ZINA 4I36A 1XXHA 5LMUB 2AKEA 2HXYA 4ZZ1A 2REQA 1VMKA 4ZCTA 2IOFK 1EGMB 3N75A 4D9BA 3HYTA 3Q3HA 4ZCLA 2WFLB 4X7PA 1H5QA 2OAQ1 3E9ZA 3AIOA 4MS3B 1NW3A 1EFPA 1X87A 1YZ3A 1GFWA 2MU1A 5AMXA 1T3GA 1M6HA 4MA4A 3D81A 4ZYYA 1SU4A 1DV2A 1DOZA 1ZNYA 2O0MA 2P6PA 4PAOA 4N49A 1G5IA 4QVGA 1COWD 1N0IA 1NSYA 3VYRB 4F9FA 4ND4A 2HH9A 2QN9A 1NVKA 5CH8A 1KJYA 1X9HA 4UUMA 5TX7A 4F86A 4U7DA 3MGBA 2NPIA 1JDJA 3I8OA 3P52A 5AHKA 1BYUA 2Z5VA 3UUWA 5IX8A 4EHNA 4S1OA 1PZEA 2OBNA 2IHJA 1Q2UA 1E0AA 1W25A 1G19A 3BN3A 3VM6A 4TKMA 1PGJA 3EARA 5FAKA 4LQ4A 2G08A 2XLCA 3GEBA 3UMRA 3X1JA 2OV4A 3LRTA 1J0BA 3OJCA 2W11A 3WBKA 1U0RA 4FYXA 2FFBA 4CKEB 1VDMA 2HHLA 3HUTA 5JAOA 2FUEA 4H17A 5HKLA 4GS5A 1PT9A 2VH5R 2ZIXA 3GARA 1X39A 3U4QB 3LCCA 4OYHA 1A5AB 3I04M 4QNRA 2GD6A 4G9GA 2GMWA 5JADA 5G4KA 3W5SA 1UBGA 1RQ2A 1YL5A 5FLYA 3MMXA 2AG6A 4HLUA 2VZ0A 1FVHA 3RTDA 3PRYA 2N42A 3T3EA 2TMGA 4LRTB 2QQ0A 3PHGA 4IRXA 4ALKA 4M49A 4CM1A 4EATA 4ZKDA 1SZJG 4M9UA 2GM9A 4BATA 5I7HA 2HCBA 1CETA 4HNVA 3UTDA 1XPUA 1CFZA 2W4MA 4AVYA 5T3UA 4N6OA 3EVFA 3BK7A 3KQMA 3T7KA 3FCAA 1Q6ZA 1R0ZA 1A4IA 2OBFA 3NDPA 4XFJA 2QRZA 3V9PA 4FB4A 5I8PA 3BMCA 2X23A 2XQIA 2BY4A 3KQSA 1GLNA 2XE7A 3ROPA 5FOUA 4WESA 2W0MA 2OZEA 3AV3A 2XOKD 4NJMB 4MVJF 1TPZA 1E4EB 2ZE5A 1R8SA 1RWBA 3JQFC 4MWDA 4L15A 2VHUA 2YRXA 3GLIE 3DAPA 1EZZA 3U62A 1MO4A 3D1VA 2B94A 2V8OA 4MROA 2I1QA 4KIGA 4KZPA 5HF6A 1EHYA 1UJ2A 1ZK4A 3ZV7A 2Y3IA 3WIOA 5KOHB 4IMJB 1R88A 3LVRE 3VC2A 4I4CA 4XD7D 1M34A 4HDSB 2IHTA 4ZEVA 2ZE8A 2GZAA 3HXLA 3A6PC 3RUEA 3PHJA 2Z4SA 3VPSA 3GRPA 4BNIA 2G70A 5ALWA 1QRAA 1C3LA 4BLSA 1X86B 3ANMA 1A7UA 2WUFA 1P6QA 2JAUA 4X63A 1DCFA 5HF9A 3QNWA 1XKTA 3SZLA 4DA6A 4D41A 2NM0A 4P3NA 3Q41A 2Q4OA 3WKEA 4F9TA 1L4YA 5L40A 2IW1A 5ESDA 1JQAA 3OI7A 2ZEJA 3GG2A 4O4IF 4AU1A 2NYUA 1Z2NX 4LFAB 1QORA 2LDXA 2RHLA 2ZUSA 1FXSA 1WSDA 1IQRA 3H17A 1MH1A 4FFBB 3IIMA 3RV4A 1F12A 2H1HA 1FP2A 2FLKA 1NKTA 2E4VA 2ODQA 1EKXA 2RI1A 2YY7A 3I2JA 3H19A 2HT6A 2DFVA 2ZREA 3K1AA 3MCWA 4FFOA 2QR5A 3VFDA 2CKMA 1EWRA 1EXWA 1R50A 4I50B 2FG6C 3WL3A 5AW4A 3UMCA 2VLBA 2ONCA 1JIXA 1NZJA 4FSHA 3IDOA 4PIMA 4JBNA 3QPVA 1LK7A 1V35A 4F3RA 4WT7A 2E49A 4LXTA 1ORWA 1RQPA 1ZU5A 3MUNA 3K70B 3HO1A 4L75A 4OOFA 1EQAA 5AO9A 4AROA 3HACA 5AW2A 3IAS6 1AKTA 3BWYA 4E6PA 4KLCA 3OOHA 1DBQA 4DCOA 4OQEA 1D5CA 1XAIA 2H4JA 3JQFA 4P33A 4UVDA 3ZHOA 1N1EA 4U2KA 3GFOA 1OYWA 3A1VA 1KI9A 3FY4A 4X20A 1FLDA 1VBNA 1T5IA 1GOTA 1U8FO 3AU9A 2G40A 2WT9A 3IT2A 4UM9B 4K7JA 5ABPA 1G8GA 3HGQA 4XTRA 2GAOA 1SXGA 2YICA 1YRYE 2WZCA 3EF3A 2JAQA 5EIBC 5A3RA 3GT7A 5LA6B 5I5EA 1QE5A 3DLAA 1TUBA 4E5KA 1OYVA 3WWEA 2I99A 1YDWA 4L51A 5M5BA 1HFEL 3H9EO 1MA0A 3T5PA 3QUTA 5CXQA 3SEQA 3TTXA 2ZT8A 3ZQ6A 2M98A 2BFOA 5IT0A 1P1RA 1E62A 4Z7JA 3R3XA 4XIYA 2P2NA 1K2WA 4R69A 2HCRA 5HUQA 3GA7A 3H2KA 3DW1X 3IAXA 3QEMA 4R2KA 1QKKA 5K1ZA 4RY9A 4D26A 2F1RA 5JVDF 4BLWA 1VECA 1ZN8A 2BLLA 2R86A 4C01A 5BOSA 3AVUA 4BWVA 1AXEA 4TPKA 1WCV1 5EMKA 2COUA 5FUVA 2D2FA 2IXAA 2IYFA 4OLBA 4ZC8A 1J5EB 1HE1C 1IQUA 1Z0KA 3RSCA 1BEZA 3I45A 2Y2UA 3UAVA 1RCTE 4NHEA 4BMOB 5BW5A 3SHOA 2QF7A 2XDQB 1DKMA 2AD1A 4F85A 4ROSA 1FFEA 1RLJA 1NV9A 1SOUA 1VP9A 1XQ6A 1Z8FA 4M1QA 3KTAA 1MTZA 1EX7A 2DT8A 5FWDA 3QEAZ 4JB3A 4ZO9A 4D81A 3O95A 4R9SA 4UEOA 2O54A 1ULUA 4EARA 2BMWA 4HNGA 4H08A 4IQ0A 1XMPA 3M5PA 3FTPA 2BMJA 1YB7A 1IN7A 2Z8ZA 1WXWA 2BBTA 3G88A 4V1CI 1ZN7A 2XT6A 4ZI5A 1HDGO 1VSUA 1EDEA 2G8NA 3IQIX 4J1SA 4WLUA 3LS2A 4X3CA 3KYDA 4ZQFA 5DN6D 4CLRA 4Z7NB 1QHYA 1KP3A 2PH5A 2QR2A 1XK7A 2NX2A 2PGNA 2WNIA 1A9XB 1PNOA 4ID3A 2UUOA 3UPTA 4JC4A 3TLJA 3G59A 4L1KA 3PG5A 3OIUA 5BXYA 2W2OA 1JZSA 5KAPA 3WMGA 2J7PA 3NGXA 1PNRA 3KVNA 3LYUA 2G77B 2QP3A 3E84A 2ZITA 3BGOS 3SE0A 3TPCA 1GV0A 4HLCA 3G8DA 4WMLA 1NNLA 5DLQC 5DI3B 5JJ5A 2C7RA 3URMA 2WYVA 1JXQA 5LBUA 4BFUA 4QTXA 1NXSA 4NMXB 3FOAA 3OQNA 1Z2EA 1G5HA 4V0ME 3GVIA 2X8BA 2A67A 2WTNA 4M7PA 4PONA 4CMEC 1H3NA 4B3GA 4BAZA 3EUWA 4FGJA 2VWQA 4CF5A 2JHFA 5JY6A 4O3MA 4AZ3A 2JVIA 2YHSA 3S2FA 3ZE6A 2ZUCA 2Q28A 1T9KA 2GERA 2J3DA 4S1NA 4QHYA 5BSUA 1TJYA 2BJVA 2V3WA 2AMVA 4C7JA 4ZYUA 5JFGA 5KNCA 3PNOA 3GJ8A 4O2AB 2UUCB 1XDZA 4FDAA 5AW5A 2BTQA 3ANNA 1FUKA 1G5PA 2PUHA 1CZKA 2QTNA 3FFBA 3NRCA 4MKIA 3DEJA 5BO5A 3TRHA 1GPWB 4YAEA 2XR1A 4OGLA 4WLVA 4F1KA 5JV5A 4HLDA 1DOHA 4W9MC 4R1LA 1K5PA 5KQLA 4MW7A 4FTWA 1HEUA 1PIWA 1XA4A 5AOVA 1AKNA 1YZKA 4G41A 5CCDA 5JEEA 2AOVA 3ICOA 3WDLA 1K06A 1MO5A 1FU8A 2FV8A 3HRHA 4MUIA 1S0UA 2QMYA 3AINA 3FYSA 5FFFA 3FSEA 1RAHA 2GPWA 2IRWA 3OO1A 4Y6QA 3WK7A 3LZDA 1H0RA 3QVJA 2IELA 1N1GA 3K0BA 4WZBE 2QN6A 4KRXA 4XB6B 3L6UA 1UMCB 3OIWA 2UU9B 4IV8A 4EY5A 1HURA 3OT4A 5C8YB 3R0VA 2AFIE 2DVMA 3LZCA 2FPLA 5L4SA 4AI6A 1AUVA 4ZCSA 221PA 4RAQA 5LQJA 4YJ2F 3BCUA 3CNEA 2I80A 4LYEA 4ETIA 2EIXA 5F4BA 2X7XA 3AI3A 1ORTA 1Q0LA 1X3LA 3G0BA 3VC3A 3WJ7A 1RM4A 3WNCA 4AO6A 3CNQS 3JYOA 5THXA 5A4IS 1S9DA 5AW7A 2PXXA 2PANA 4EAQA 1YZYA 5J4KA 3CX6A 3SX4A 2MSWA 4LZJA 3PFWO 4CMEA 3E18A 4JH0A 1PO7A 1TC2A 2GPAA 2MYUA 4IOKA 4LS3A 1ZD9A 1R16A 1DFHA 1NTRA 2ILTA 3FCCA 4H1VA 2X40A 4CI9A 5D00A 1Z2PX 1ZITA 1G6KA 1DQPA 1G8KA 3CU5A 3QEBZ 1AHIA 1IY8A 4PC7A 5FBHA 2XWJI 4Z2AA 1X74A 1L8LA 3O3NB 4FNGA 4PQEA 2GASA 3B1KA 4R68A 5DI9A 2GB4A 1LQ2A 3WWPA 2VS1A 1NRIA 1N6IA 1Z2AA 3OFNA 2CVPA 1N3BA 3D8NA 4OL9A 4NLLA 2NADA 3EQ7A 1SGWA 5G40A 3I34X 2G28A 1FB5A 2AOWA 2FW0A 3GJ7A 3UFXB 1F06A 3FVTA 4KU4A 1RTKA 2A3NA 2BSAA 3WAGA 5BQXA 1QPGA 4HNRA 1E2NA 3K8ZA 3ZWCA 4IDQA 4PX2A 5TGDA 4MA5A 3OKFA 5LXTB 1BOOA 2A1TR 4HY3A 1W36C 4HGPA 5DGIA 4PYOA 4WPGA 1IBKB 2LTAA 5EFZA 1KRXA 4XYEA 3FCSB 4MUHA 3WISA 2JRCA 2WTBA 4JY7A 2XSZA 2YDYA 3N2KA 4N0MA 1VL0A 3L8ZA 1E59A 1ZMBA 2LIPA 1P5RA 1XR3A 3FSGA 2HK9A 3K31A 3C1OA 4LYHA 4RJTA 5E9WA 1KH3A 1VPTA 3GT3A 1W47A 2BM8A 4IINA 4UHBA 2YHAA 5GV8A 3RANA 5EOVA 1XZIA 1ESMA 2DBYA 4G1FA 4G1VA 3USZA 1AZLA 1DPGA 3EHEA 3MS7A 2WVGA 4L5YA 3B7WA 5BUCA 3F73A 5B1YA 1G8AA 5PNTA 1IJEA 4B6EA 5HSGA 2RHGB 1SKMA 2NU6B 3SBEA 3HXOA 3PUZA 1FZQA 2Y77A 2UYGA 4B3BA 3ZWYA 2ACKA 2B34A 3ND6A 1IHUA 1E3TA 2B36A 3OHMA 1KERA 2HK7A 1AQJA 3CUWA 1T6BY 4CEHA 3SC2B 4MV7A 2QVCA 2ETXA 4PQFA 2EBWA 4A2WA 2Q5CA 1NYQA 2HNBA 4BJ5A 1YZNA 3OT1A 1U7DA 3VTAA 1E79A 3KJGA 1OFUX 2GWHA 3PUYA 4PW0A 4PTYA 1X7WA 1GSOA 2AWNA 2H7VA 2JGDA 4YAFA 3PTAA 5F78A 2E82A 1WKVA 3NTOA 1HE3A 1L4HA 2W2MA 2ZRKA 1RYBA 4KEAA 1JHOA 1C9NA 1UXIA 5JCJA 3RT1A 2GK7A 2IC5A 4JT8A 4RF4A 5HCNA 3V2UA 1RHJA 2G9UA 2SKDA 3HJUA 5KTKA 1O54A 1XRRA 4TKUA 1HT2E 2N1MA 3BL5A 2XWQA 3DZCA 3EZ6A 1TCAA 4NG5A 5CK4A 3DOHA 3HB9A 1TD9A 4NEHB 4YMIA 4EYEA 5LQRA 4IHKA 1QOZA 2QL5A 2C2XA 3PXXA 4LYAA 4Z9BA 3TEJA 1KO5A 4B2PA 3SLRA 3TOXA 4AG6A 5CD9A 1YL6A 1STOA 2LKCA 3GZ4A 3KJHA 5KDLA 3VH3A 3AT1A 1L5QA 4UW9A 3WG9A 4YCLA 3LNTA 2DETA 1BS1A 1K4MA 3ZDBA 2ZYWX 1RI1A 4K6FA 3KT6A 1MRZA 1CB0A 1VI5A 4PFQA 2WSSA 1U8AA 3PPYA 3QOFA 1PGQA 1XU4A 4GSKA 4RESA 2P40A 4LWZA 2WU4A 1UBTS 4WXYB 5EIEA 5EJ9A 4LZLA 1TD1A 5ULLA 4DDTA 1ADBA 2HWUA 2H7CA 5DO9A 2ZFUA 1PI3A 2ZKLA 3E7FA 4YO8A 1NVMB 1YB4A 2X5KO 2LW7A 2XMCA 3COPA 3D6TB 3UK2A 4BLUA 3GLIA 1JKXA 1UBHS 4HNAA 2SHKA 1S1CA 1P2UA 4LXQA 2A4KA 1HMPA 4LZOA 3VUEA 5IHXA 1E2BA 1Z0SA 2O8EA 3ED5A 3BB3A 2XYVA 3F6BX 1C9YA 2KW5A 1G1MA 1ID1A 4KVGA 2FQ1A 5LP6B 2QGZA 4BIMA 3BRSA 4DV0B 1PVOA 3KB8A 4Q18A 1LSSA 4HMPA 3WIDA 4G2NA 1XE3A 2P69A 2VF8A 3TSAA 4AN1A 4J0HA 1R0CA 4G0VA 1JDBB 3TOVA 2YMLA 2FP4B 2WAXA 2YJ5A 2XA9A 4H1HA 3LUGA 1U63A 5G1PA 2AGVA 4D3XA 4FXPA 2P3OA 3I61A 1NXTA 2YQZA 3K94A 1P0FA 3GGPA 5GJVC 5KX5A 4IM7A 4TYMA 3V7WA 3NONA 4XJXA 4JSRA 4B83A 5ITWA 4Y1RB 2IYRA 3IA7A 2ZDGA 3VDRA 4M7WA 2PKXA 4XLZA 1SHLA 4ZANA 1XMSA 2R65A 4MR9B 2R6JA 5HM6A 3AR3A 1P77A 2Q2NA 4F93B 2ZI3A 1P6UA 1CS0B 4QRDA 4RX1A 3L84A 1QP8A 3EIUA 3IRVA 3MOSA 1P0IA 1AY0A 1GAEO 2WUDA 3UJ3X 4MLDA 4RLSA 5ICCA 3CVYA 2FY8A 4FYWA 1JIJA 3NT5A 4OHFA 3RYCB 3CUVA 3A6KA 3QSYA 2HHCA 1S8OA 5HKKA 4QDTA 1PR3A 4A0GA 4C4RA 5B30A 3LO8A 1MUUA 3ROEA 5KINB 3OUZA 4WN3A 3V33A 4MWBA 4XYGA 3T1QA 1Y1QA 3MGCA 3OPMA 2OZVA 3ZWKA 4REOA 3GFRA 1GAQA 1KIMA 1Q7EA 5GIOE 4RK6A 4CM4A 5I4KA 1PUIA 1VPDA 4IDAA 3WDMA 4MEJA 3NWPA 5AHOA 1CD5A 2XXJA 3G2OA 3HJRA 1PX0A 1LSUA 3PQ5A 1DHRA 1KR5A 3OY7A 3A36A 4JJIA 4KJXA 4PLWA 1T3TA 3MTJA 4KI7A 4N7RA 5DYYA 3ZZUA 5EMJA 3PEWA 3VU1A 3V7NA 2JAXA 4ZHSA 4BRZA 1I7PA 2IODA 4GRIA 2PWZA 2R68A 1U5CA 4QOJA 1NBOA 3SCZA 2DWPA 3UGQA 4EFKA 3OPVA 4AJHA 5HJ7A 2DT5A 3M6AA 3PUXA 3CF2A 4LC1A 3MTIA 4AFNA 1B8NA 1A9ZA 2F43B 4ALMA 3A2LA 2GBCA 4V0SA 4MHOA 1JT2A 1PVVA 5DRYA 2BN4A 2J3EA 4RZIA 3NORA 5JYCA 2NV2B 3LTNC 3A2MA 4KHPB 2VZLA 3PL5A 1RVV1 3FROA 1IOVA 5D1HA 4YMLA 3OTQA 2YY6A 4B09A 1SKUA 2XLBA 3EYAA 5JAQA 1C4KA 5EIXA 1MGOA 2VL7A 3UWOA 1UC4B 2F3QA 4BP8A 1QHIA 4N82A 5KYWB 3LIIA 2K2WA 4BFVA 4BE7B 2Q6OA 1J4AA 3C4QA 3ESRA 2UZ1B 1NN1A 2QVXX 4Q7KA 4DB4A 2BSXA 4R5MA 2ORYA 3BSWA 5GQSA 1IY0A 3ZDQA 1ZR2A 1ZO8A 1JU9A 2XNDA 3JCZA 3PX3A 5DVZA 5IBCA 4HDRA 5CIWA 3EGCA 5B37A 1F7VA 1TM4E 1KWGA 4RPKA 1GDDA 2PKEA 4B3CA 1FRVA 3JYQA 3O38A 2INGX 5IKPA 1GCGA 4GLBA 1GVNB 4INOA 4Y2SA 4V0LA 1G8PA 1XRQA 5T4BA 3E9MA 3PHBE 4CU5A 4F11A 3P9XA 4GT1A 5TGTA 4EI8A 5JQGB 3TXAA 1EM6A 1ZRMA 1CJVC 3M4ZA 3UAYA 5IT9A 4OLAA 2PIDA 3BICA 1PT7A 2XMQA 1XKLA 3OQIA 1DKPA 4NQRA 4URYR 4D9MA 5K6TA 4WWHA 4KLNA 3L8GA 4F4CA 2VOEA 2IEBA 2JVJA 3NANA 4J7XA 3ST7A 4U8HA 2FYTA 4WX2B 5LJIA 3RKRA 2AJLI 5DM0A 4Z4HA 1JDUA 3QU5A 4PG4A 4NNPA 3TW8A 2PKRA 4KPGA 4JYZA 2L42A 2DUUA 2WM2A 3AJEA 3L7IA 1B6SA 5E4JA 4MVYA 1HRDA 1UQTA 2QHXA 3CH4B 1D0SA 3K4QA 3IELA 3Q0IA 4JL5A 4DRZA 1WTCA 1L4BA 2P9JA 3TUIC 1NASA 4ENSA 1W88B 2GJ4A 4LDZA 1XTQA 3PQ3A 2WFZA 4M2LA 3TIVA 4DYVA 1YVEI 2GX6A 2WWRA 3T5MA 4V0MA 3CIOA 2FE1A 3K0HA 3TD2A 4EWLA 1N2CE 1WRBA 1KKMA 5AW6A 2AS0A 3IALA 2D8AA 4V02A 4TM7A 1A9OA 5SZIA 1OT3A 3P9ZA 3O0TA 2ZVDA 3P9KA 1BVUA 2CL7X 4X84A 3VZDA 4G0ZA 1W44A 1Z82A 3MYRA 3BGVA 4WSOA 1FE8A 3DMGA 2JI6A 1GUBA 3TECE 3IKLA 1QC5A 3R76A 3GLGE 5HDBB 5C1DA 3DE2X 4RDHA 1KY5A 4FCCA 2F9LA 5F35A 3PWKA 1U0FA 3AJAA 3OE7D 2YWBA 2ZR7A 1F6BA 3AH8A 4O8ZA 4F56A 4ZYLA 4FHGA 4KI0A 1SUIA 2ZYRA 3GUUA 3Q12A 2XNHA 2VF5X 4JK3A 4TQUS 5ERGB 1HYQA 2I7DA 4DDVA 4YP9A 2NU8A 1AC5A 3IMEA 4IW3B 4RD1A 4QOIA 3R77A 1E2MA 4ZOEA 1GYRA 4RK7A 4RHEA 1PD1A 4C3UA 1F6DA 4L9WA 1WVIA 1NTOA 1YS1X 2IVFA 4AF6A 2MHCA 3KTFA 4PU0A 2UZ4A 4TLCA 5BV1A 1MXFA 3F4BA 2MYPA 4DTCA 2PD3A 4MQEA 1V7CA 4R8LA 1XJWA 5L3ZA 4WZBA 2UXDB 4WRRA 5EE1A 2E48A 4FI3C 4JI1B 1T24A 5TE9A 4NKRA 2WYIA 1J97A 1XD9A 3D59A 2WG2A 4M6WB 3TIFA 3PUKA 1ZEJA 2AFIA 3DYBA 4ETNA 1XZQA 2ZCUA 4X0EA 3A58B 2WFMA 3UOAB 3D6JA 5DIZA 4HBGA 4YAKA 2QXYA 3DBHA 3JZDA 2ERYA 4OK3A 4C08A 4YACA 2X41A 4DDWA 1WB9A 3SIWA 4I8IA 5KTSA 2PBZA 4KO2S 4XH9B 1NVWQ 3AVWA 3ZDFA 2EFHB 4Y2YA 1DRVA 4BNMA 3VGJA 3ZZMA 1PKXA 3FZYA 5KNLA 4K87A 4R51A 5K8IA 5EUMA 1XNHA 4NV0A 4LKRA 1GKYA 1P1JA 3DB1A 4LRUA 4LRYA 3HWWA 5LWQA 2PUDA 2GUWA 1Q5PA 3R4VA 3N7UA 3URKA 4PWYA 1N9GB 2Y1GA 4RIIA 1IVNA 2VBFA 3IBYA 3N74A 3FDIA 1JWBB 1CQXA 4KUEA 5FQOA 1KQNA 2XD9A 1I3NA 5GZ6A 4RGVA 1HX7A 2DSTA 4O4HA 2OXRA 4LOJA 1CR1A 1G8YA 3L8FA 3TE7A 3QXJA 5B57C 2H11A 2NO9A 5IK2D 1CTQA 3GB9A 4G8JA 4GP6A 3LP6A 2V6JA 3PWTA 1NVAA 4HRYA 2A5DA 3H1PA 3SS9X 3LBHA 2B2XA 2HKIA 3IOBA 3AR9A 2CYAA 1ZX1A 4DA9A 2FVYA 4OP2A 4O3FA 5FV7A 2J3QA 5HUJA 1I13A 3N7TA 4ZI2A 3GMSA 3EXFA 5DNAA 4E11A 1GGMA 3DR3A 2BGIA 4UXHA 5AK4A 4ZQGA 4B7XA 3EGOA 3O4GA 4HRAA 1F38A 4CDGA 4DMLA 2QM7A 3BRQA 2BKEA 5IJAA 2X0RA 4WDRA 3CNHA 1X7DA 3B52X 3QU2A 1E9DA 1KKUA 2P4EA 1P91A 4D9KA 5CDTA 3UHPA 2ZWMA 1JTFA 2WYHA 1R5BA 1K6EA 4NESA 4BAGA 4LXIA 2M1ZA 3CF4G 3CZAA 1XMOB 3QPWA 2JARA 1HSOA 3GL9A 1KVRA 3HFRA 2Q9BA 3KUCA 4O63O 1UEJA 5KU7A 1NBEA 2PNFA 1OREA 1GVHA 3VAYA 2CNNA 2Z30A 2OXEA 1DLIA 4I2VA 3QVGA 1X7ZA 3PDHA 4WW0A 4PPFA 1JALA 1TB4A 1TKRA 4W4TA 3KC2A 1PZGA 1QGDA 1W8IA 1XA3A 1DL5A 1UDCA 2EDAA 1H9CA 5BMVA 1MNAA 5EQJB 3TGWA 2XITA 1NFFA 2CBZA 4NZNA 3DWGA 4WOJA 1Q19A 4KOAA 5HEKA 2EW2A 3QUSA 2Z95A 3VDNB 4FOTA 3IH5A 4O33A 4CT4B 4OI0A 4PHFA 2EGGA 1U0JA 1XCOA 3H0KA 5DW3A 1J1IA 1EIZA 3UMJA 5KYYA 6LDHA 5CTAA 3JTMA 5TQ0B 5LU9A 2ZUBA 5IAAA 4PRLA 3DNMA 2GN9A 4YMGA 3R44A 4OI1A 5FA8A 3MC1A 1S8AA 4DLUA 4UVGA 1KQOA 3EUFA 4DT1B 4C6HA 2JANA 3ZIAA 3GIWA 3PU6A 1PWEA 2ZGVA 2Q5OA 4UHCA 1SRQA 4KXQA 3HU2A 5G1NA 1WWKA 3REFA 4BFTA 4JYAB 3IYLW 4L0DA 1ZMOA 4C0XA 5K2OA 2DM6A 4UMFA 2JRLA 4L3VA 1EI9A 2CLDX 2QD2A 4M87A 4RD3A 5LWHA 4OO3A 2G7ZA 2UZ0A 2PQ2A 2CKDA 2Q07A 2RHRA 5ER9A 4HUJA 3CLRD 5K3BA 4B3XA 5IYZA 2WSYB 2P35A 1GUDA 4MV4A 1R9NA 4Q9HA 3T3OA 1WY5A 3O92A 5BSWA 3FFXA 3UMSA 4AUNA 1OC2A 2FMXA 4MGHA 5KNBH 1GQFA 1F9AA 2JZCA 2ZCVA 3CRMA 5A9RA 3M6MD 4AJPA 1P9OA 4XWTA 4EKNB 5REQB 3P0RA 4HDCA 5B3LA 1N0WA 1T43A 1S2LA 2BKVA 1EA5A 2G82A 3HCRA 5HJ2A 4PSUA 1HG0A 3HE3A 1EQUA 2ECFA 2VP6A 4HXFB 4Z99A 2D06A 5L53A 3EFOA 4IIJA 4DMFA 4RMHA 2X1LA 1BCRA 3UK7A 3VU9B 4EYKA 3WBFA 2BZGA 5GJBA 1K7YA 1FTQA 2ZULA 3AFIA 3E81A 2O6LA 3KOZA 4BZWA 2POQX 3FWHA 1J07A 4BVHA 5TT1A 3E6AA 2H2IA 3DVAA 4Z2YA 3GNLA 4TMVA 1ZJZA 1Z74A 4Q3DA 1JAHA 1KE1A 1FNCA 4IP0A 4TT8A 4YRLA 3OC6A 4MPJA 1S01A 4JASB 4CN8A 2AWOA 1E9BA 2JI4A 3LE8A 4R84A 1FDOA 3U3OA 4LGVA 5IG2A 3THXA 3OLQA 3OJEA 2C5SA 2OQ2A 4PBTA 1V8OA 2BTOA 2JLYA 5CT6A 3PNBA 4NE9A 4XSVA 4D46A 2HD4A 1INLA 3LK6A 5GAJA 3W34A 4EJSC 1Q77A 1V2HE 1KGSA 3U9TA 4TYQA 3DT6A 1MV5A 1WW3A 2QYOA 3GLHB 4B6JA 1A5SB 1QWOA 2R6CA 5LD2C 3ASZA 1JV2B 1O95C 5D84A 2XMDA 3ZNOA 1Z0ZA 2EX0A 2YVUA 3MRVA 3L79A 3RIHA 3RYIA 5HQ3A 2IE0A 4CHGA 4RZ3A 2YUIA 3DULA 1U0HC 1YKGA 3KB2A 4ND7A 1IN4A 2ZAIA 3FRIA 3IQZA 3ESXA 5F2EA 2H1IA 4PXYA 1TRKA 3AIKA 2RG1A 2VZEA 3PE3A 4IUBS 1CY6A 4D4KA 1A9RA 5HFNA 5THQA 1N2HA 5KOJB 2IGBA 2WTMA 3WFIA 1LBIA 1RBMA 3BXEA 3KR1A 4GGMX 4LA4A 2WSBA 3ZKWA 4AKHA 2FOLA 1US8A 2W6PA 3FB1A 3GHHA 4EABA 3GDFA 1VLHA 1GQSA 3F71A 2WP8J 3CKKA 1HR0B 3NHJA 1OH7A 3EZ2A 1TCVA 2YN2A 5JAMA 4JI2B 5BUQA 3P2JA 5D3MB 3ASYA 1O94D 2VATA 3Q7PA 1Y3FE 5AQ1A 4RTLA 1NXOA 2FSGA 3FHLA 1C9MA 5AM4A 2UYQA 4G5GA 4QPZA 1E4OA 1CZNA 1OT5A 5AK6A 2HF7A 3ADOA 3PVZA 4ZC1A 2V1XA 2ZJFA 2R6GA 2A35A 2WD7A 2C7PA 3FXAA 1U0OC 3P2KA 5A05A 4UC0A 1K92A 2EX1A 2ZYUX 1ONOA 4ML3A 4WN9A 4YMVA 4WCVA 5KX5F 1Y4ZA 1L7DA 5LKAA 1ODFA 1TCUA 4DLYA 1WCXA 4B8ZA 3WGTA 5CGQB 2Z1MA 4F7DA 5K0LA 3KP1A 1ZI6A 4GMKA 4Q00A 2I0FA 3RU3A 3ZWMA 3KZXA 2PSDA 1FTYA 4Q9DA 1DJLA 5LDGA 3ABZA 3UJPA 3WQSB 5KZMB 3FGZA 3PRJA 4AJNA 2R1TB 4YFVA 2B3DA 2HX1A 1GT6A 2MR6A 4LDQA 4EJSA 5TMPA 3HY4A 1USVA 2JA1A 3HS3A 3L0ZA 1NVFA 1EE9A 3EA0A 4LJKA 3UT6A 1DIAA 1C8KA 3MWYW 4MWCA 4NU0A 1O95A 2G7MC 3KM0A 2FEMA 4H60A 5J5VA 4I1UA 4ZYWA 3MTEA 1A5BB 1RJWA 3OZ7A 3K73O 4HAIA 4RFVA 4F6RB 3HLTA 3C7AA 5L4LA 2BHTA 4NV1A 2PG3A 2QQEA 1SXHA 2FW7A 1EUYA 3UJDA 2P41A 4X65B 4ARIA 1QQ7A 2HYDA 1P7YA 3QUAA 4OVKA 3WSTA 5IABA 1Q7CA 4NG4A 3BZBA 3SBOA 4AMZA 3GWZA 4U7FA 4I1OA 1F3OA 4RPLA 5AKKA 2Z0MA 2D0OB 1YULA 2YWFA 4NYMR 4EB6A 1C30B 1L4NA 3IERA 5C1BA 3R9IA 1CUYA 1T5TA 3ANSA 1OJ7A 2GAIA 1LWNA 1JS1X 4YJDA 3STXA 1F5SA 4L5BA 1JH9A 2YJNA 1VLLA 2CUKA 2HU2A 3D0KA 1QMPA 2BR4A 2GEDA 4P98A 2AN4A 4LJ7A 3AOGA 1ZLXA 2B5WA 1Z6TA 3THYA 1V5EA 2OPBA 2XVZA 1V45E 3GOHA 2IEDA 3PENA 4F38A 5KC9A 1M67A 3QV1A 5LR6A 4DBVO 3ZWVA 5E7MA 1GRCA 1J90A 3MLEA 2XWSA