1ZBDA

Structural basis of rab effector specificity: crystal structure of the small g protein rab3a complexed with the effector domain of rabphilin-3a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
177
structure length
177
Chain Sequence
SHMFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGLERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags G protein
molecule keywords RABPHILIN-3A
total genus 50
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zbdA00
1TQ2A 3UKDA 1KY3A 4M4SA 4B74A 2QSYA 2YOHA 1N6PA 2Q9AA 5C18A 4FIDA 1ZM7A 5LD2B 1R0YA 1OFTA 4HDQB 2HLDA 4MRVA 2REBA 3TGPA 3NBYC 4BRWA 4QNMA 4D4KA 4DZZA 1F2TA 5KPJA 3ZD7A 4TMWA 1YR9A 2QTHA 1HTWA 2Z83A 3BWDD 4J0QA 2IEYA 2ZR9A 3Q5EA 1WE2A 1AK2A 1R5OA 2H5EA 3PQCA 4A4DA 3PXGA 1TAGA 1WRBA 1CJTC 1ZYUA 3QKTA 3OIUA 4UNSA 5EE5B 4GZMA 2G77B 4UXIA 5TARA 2JCSA 2WPDA 1NSFA 4JBYA 2ZS7A 2BEJA 5K8LA 3RRZA 2QY9A 3U7HB 3EZ7A 1Z6TA 2O8DA 5JWHA 4GT1A 4II7A 3QXJA 4BUJA 1E9DA 1Z63A 4F4IA 2GJAA 1U8ZA 2GVDC 4AI6A 4LUCA 4WZAE 3GLFE 3V4FA 3GLIB 3WRXC 1KI8A 2XSZA 4LDJA 1RFLA 5CDFE 3IIMA 3Q9LA 2WWYA 2MSCB 5K8UA 1WP9A 1ZUNB 4HLUA 4EJSB 2OXCA 1UDXA 3TLXA 3C41J 2CVHA 5DIFA 4B32A 1VCNA 5AWFC 1I4TD 4M9SA 5G53C 4BFXA 3KTAA 3EWAA 2ZPTX 2GCOA 3BH0A 4TLEA 1KSJA 2W6IA 1HV8A 3CNLA 3PEWA 3IUYA 4Z1MD 5F9HA 3B9PA 1XTIA 1RE0A 4IFEA 2CJWA 4W5JA 2AKAB 2DFKB 4U02A 3KKMA 3SFZA 3UIEA 4A2PA 1DO0A 3K0AA 3SN6A 3C14C 5AJZA 5HCIA 2WMOB 4JLKA 4PO1A 4US1R 1N6RA 1NLZA 1US8A 1P3JA 2J45A 4TL7A 1R0ZA 1T3SA 2CMKA 3THYB 1NVVQ 2RGEA 4B2PA 3K70D 2IT1A 2JEOA 4FMDF 1E2HA 2B7CA 2RGAA 2YINC 4DLTA 1JXOA 5B2ZA 4IXNA 2QM7A 2BJVA 4GMXA 4FCWA 3KJIA 3CWZA 4Q4AA 1G3MA 1JR3D 2BCGY 3WBKA 2CHQA 2VSOA 4RZUA 1LY1A 2A5DA 5FPHA 4KLZA 4B34A 5H68A 4A9AA 2QA5A 3ZVNA 4LJYA 4ABYA 3RNLA 1E2KA 4EJSA 5P21A 1OKKD 4G5SA 2NPIA 1I4LD 1UKEA 1S4QA 3MWYW 4DLVA 4DSNA 2XZPA 1ODFA 2QAJA 2GBLA 2IC5A 4MYTA 4M9QA 5AUPB 2GXSA 3LW8A 5GJVC 2ATVA 1RYFA 4IVQA 5JSZB 4Q19A 3P4YA 4BGDA 1E79D 4E09A 2VP2A 5J4HA 2DR3A 2B92A 1XJCA 1DVRA 2KI5A 1R8QA 2ZAMA 4URWR 1AN0A 1N2CE 1SVSA 1OXTA 3GJ6A 2ZYVX 3V00A 2NG1A 4ERNA 4OI0A 3EXAA 3KQLA 3LVQE 1JAIA 3ASYA 2J3EA 3PEVA 4C9BA 1SVKA 1OXVA 4DJTA 1EESA 4JLVA 2PBRA 2YV5A 1OFUX 1ZCBA 2VO1A 4TLCA 2ZJ5A 1UBEA 2O8CA 1C1YA 1SKQA 3H0KA 3AGQA 1IY1A 4B2LA 1Z83A 2V8OA 3MCAA 4B35A 1QG2A 1KZ7B 4M0LA 4N3NA 2BCJQ 5AJYA 1T5IA 3EPLA 5ELXA 1AZTA 1JQLB 3QXSA 3ZQ6A 1E0SA 5HKKD 2EWVA 2JDIA 3EAQA 2N1BA 1NIPA 5GVSA 4WAUA 2J7PA 3M6AA 2LKDA 2C5LA 1E4VA 4LYHA 4CT5A 1X3SA 1TU3A 1ZNZA 1CR4A 1MH1A 1F6BA 3G82C 4GP7A 5KHOC 2NMVA 1GVNB 4ZDJA 1KDTA 1XMIA 3CONA 3ONWA 3I3SR 3WYFA 3PUWA 4GPTA 5HTKA 3MAAC 4GBMA 1VMAA 1TX4B 1YHNA 4YC7A 2JLWA 1W4CA 3QJYA 1E9EA 3UXMA 5CB8A 1ZD1A 3BRWD 4IOJA 5J40A 1QHNA 1KJWA 3VKGA 3B7GA 2KWIA 2ZRCA 4HEJA 3IDQA 4LBWA 4MQBA 5H70A 3V4RA 2ZYWX 2JDID 1VTKA 3SNHA 2ASEA 3SZRA 4D81A 1Q3TA 3IEUA 2WM9B 4EUNA 1W7AA 1GUAA 2AFIE 1M34E 2ZRPA 4H1UA 3FKSA 4KITB 1Z2AA 1NL3A 2WHXA 3QG1A 5A0FA 1V43A 3CF0A 3N2IA 1W49A 3THXA 2VP4A 2PX0A 2ZR0A 1HQYE 3FHOA 2B6HA 2O0KA 2F9LA 4NZYA 1Q44A 2IYYA 2J87A 3R9WA 1TF7A 1FMLA 4BFVA 4BFWA 1CBUA 2IYSA 5HPYB 2ZRGA 1MO6A 3ZLJA 2WIBA 4TLDA 2O8EA 3I8SA 2J0UB 4FI3C 4DCTA 2F43B 1VCMA 2AXNA 2KB0A 3L0IB 3DL0A 3FMOB 2QT1A 1Z08A 1QF9A 3RRYA 1NY6A 5BXQC 3W34A 1AA9A 4R2IA 4HYYA 4H1VA 2CCKA 4TZ0A 2FSFA 4PHTA 1TUEA 5JWRA 2JJ1D 2XJ9A 3EIHA 2ZUBA 1FUKA 1NP6A 3K09A 5HE9A 3O47A 5CDFA 1T4GA 2HXSA 1Z07A 2FZ4A 5JCZA 1ZM4A 4ZKDA 1FZQA 1OKKA 2QM8A 5G3YA 4BLTA 1E9SA 3PV0A 1ETUA 2FSIA 2KBEA 3AEZA 3CRRA 3GEIA 5FBVB 1XPUA 4LRWA 4YDHB 4DEXA 1NBME 5FL7A 1GNRA 2V55B 3OF5A 4W7SA 1J8MF 2R6FA 3A4LA 1HT2E 1SZPA 5HE8A 2OEPA 1W36B 2J5XA 1G8FA 3HWSA 1IJFA 2W2XA 2IWRA 3U3OA 2RCNA 2I3BA 2RHMA 3HYRA 3TK1A 4JL6A 2C9YA 3CIOA 4ZDWA 5CYOA 1G1MA 1MO4A 3RRNA 1P62B 2F1JA 3TBKA 2VF8A 1GTVA 2RGCA 1NVVR 1N0VC 1U8YA 3FKQA 3IKJA 3G0HA 2CJWB 5KDOA 1Z0DA 2HEIA 3QBTA 3HU2A 3MJRA 4NU0A 4XTRA 1IN4A 3NHBA 2IX3A 4PR0A 2OG2A 1P61B 4KYIB 4HUQB 1I2MA 1W44A 2BHRA 1II0A 2NIPA 2H92A 1D6JA 3B9QA 3OEED 2FF7A 3HPQA 4Q47A 2WZQA 5DN6D 1W0KA 2V3CC 4Z8XA 3NG1A 4GFDA 3QIAA 4OK5A 1SXJC 4PSKA 2VQSA 2CDNA 3MFYA 1X8JA 2JATA 3DKVA 4RD2A 3OE7A 1E0KA 3QF4A 4D4MA 2Z4SA 4Q66C 2V7QA 2WWWA 4HB0A 4O2LA 1SVMA 1QHXA 1U0LA 2YJTD 4L4UA 4LCBA 1FQKA 1F2TB 3ZIAD 2SHKA 3C15C 4LWZA 1EFTA 1F2UB 5FPSA 5FOTA 1ZD8A 4GZLA 4HI0E 5KPDA 1OLOA 1KI9A 3KJGA 4E5UA 1NMZA 1OHHD 4JKYA 4DUGD 5L3SB 2JJ1A 4YMVA 621PA 2F6RA 4LHXA 5TDHA 2PJRA 5FUYA 3B1YA 3KB1A 1T9HA 3VU9A 3LNCA 2C2HA 1ZNYA 4JVLA 1J70A 4IVRA 1N5LA 3NIBA 4X8OA 3I5XA 2XEXA 4YMUA 2W58A 1RIFA 4P4UA 2DCUA 5DYGA 2OM2A 5FH9A 1XCPA 4PC1A 3TVTA 1E0AA 2WSSA 2IYTA 4OJQA 5HCNA 1BO6A 1ZCAA 1MRSA 4NDZA 3Q7QA 4TLBA 3W6PA 3GPLA 4LYFA 1XCMA 1ELOA 1Z5ZA 4LHZA 3NBZC 4UJ5A 2GCOB 2JLRA 2QE7D 3N2EA 2QMOA 4NYIQ 5L3QB 1E1QA 1XX6A 3NEJA 1UBCA 1KYIA 3SHWA 4A6XA 3BBPA 3ZJYA 1M8PA 1WBDA 1G21E 1WB9A 4FMBB 4TQ9A 2GEUA 5CITA 4DUGA 5FI0B 4BFTA 5JS8A 1A2BA 2Z0MA 4KBFA 2WWIA 2QAGA 4Q7MB 5TY0A 1KI4A 4NPHA 4XSGA 1JQJC 1R0XA 1HYQA 3FFAA 3GJ3A 1Z0KA 4NCIA 1VHLA 3GLGE 5F3WB 1EFCA 3HR7A 4QJ4A 2FJUA 3ZZUA 2AK2A 5C1BA 2V9PA 3MMPA 3TIFA 2AXPA 5JEDA 1OH7A 1KIMA 4OJKA 5J4KA 1G8GA 3K9NA 2QQEA 4MGYR 2BMDA 4E03A 2F3RA 3AF3A 4P33A 4XWKA 5JCPA 2VH5R 1WXQA 3BJIC 5KNDA 3R8CA 2FG5A 1PLLA 3B2EA 1LB1B 4MKFA 5EE0A 4LZZA 1E2JA 1KMHB 3EA5A 4JJZA 1OFIA 4B43A 5JHHB 1N6OA 5B58C 4Y0VA 3TW8B 4NHOA 5KDDA 3BXZA 4F93B 2QMHA 4AG6A 2FDCA 2ODNA 2CHGA 3GD7A 2D2EA 3LY5A 1BMFD 5TXGA 4AKGA 4L8GA 3IIJA 4TMZA 3DO6A 1XZQA 1E99A 3SR0A 2CVFA 5EXSA 4EPWA 1OE0A 5FUVA 3B6EA 4MRPA 2E1RA 2KJQA 3C4JA 1DAHA 5KYKA 2DFNA 3C7KA 5L8VA 2WMNB 2QP3A 2VPPA 3DVLA 4TTQA 4F4CA 5FTLA 2WAXA 5H1YA 1CKEA 4NCJA 8OHMA 2NOAA 1NN3A 5C46F 3LXRA 4IDPA 2P65A 1XTSA 4Q1CA 3BD9A 2CXXA 3MG9A 1VECA 5JECA 3SE0A 1N5IA 1OJLA 4KV9A 3SS8A 1BYIA 1GL9B 1VG1A 3DKPA 4NYJQ 3RS2A 3FDIA 4DDUA 2P5TB 2JLUA 1ANKA 4FMCF 4RD1A 3CX8A 2R44A 3QXHA 1Z06A 2F9MA 1YJ5A 3ZH9B 3X1WA 1KI2A 4ZO4A 3AP2A 4I1OA 1YZNA 3MWJA 1NVXQ 5CK5A 5E95A 5EXXA 421PA 1RW4A 5CK4A 2OBNA 1S1MA 5BWMA 1E0JA 3BB1A 4PSVA 2XX3A 4JKIA 4BE7B 4S2EA 3K0EA 1Z0AA 3EARA 2ZRNA 1XD8A 3K53A 5FFMA 1T0JB 3JZAA 4PC3A 3AF2A 1YRBA 4CYMA 4AY2A 2BM1A 2C96A 3QY0A 3RC8A 1M6NA 2ZRFA 4KCGA 3QKRA 2ZJYA 3NDBB 4OHWA 5EP2A 1E9CA 1QHSA 4M22A 3FFBA 3TH5A 3FHTA 4HAVA 3THWA 1P9NA 1DG3A 2ZRAA 3KUDA 4HATA 4FN5A 1L7VC 4YMTA 3VHXA 2OHFA 1Z0JA 1DELA 4Q7KA 1E2NA 1G8YA 2BOVA 5J4VA 2RGDA 5JMTA 5CM9C 4L16A 3QXXA 4E07A 2IUTA 2XB2A 3FB4A 1R5BA 1OW3B 1OIXA 2XXAB 4WOPA 4US2R 1AS2A 1KDRA 1T5LA 4BFUA 1IBRA 4YDSA 1LV7A 2B7BA 2VYFA 5BN4A 1V5WA 4P4SA 2ZREA 3KJEA 4JLDA 3W9YA 4HLDA 2Q3MA 4TMTA 1AGRA 1R5NA 1U98A 3PUYA 5AUNB 1FNMA 4D25A 2GXQA 4A92A 4MUAA 2CCJA 1S96A 1GWNA 3B1WA 5BN3A 1G6OA 4TTPA 1F2UA 1XJ0A 2P0EA 1YRAA 2ZI4A 2D7CA 3LX5A 1CLUA 2ZU6A 3JZMA 4AK9A 4F38A 2QBYB 1L2TA 3Q5DA 4B6EA 1KI3A 3LWNA 4L15A 4FD2A 4PPQA 2DFTA 2ZSBA 3AUYA 1NLYA 2ONJA 3ADCA 1HE8B 3W8RA 3W8NA 5G3ZA 1PV4A 2RGNC 3K9HA 4OQLA 4PO9A 4K8OA 3S1AB 1FX0B 1OB2A 3IO3A 1PLKA 2O8DB 1ZAKA 3U7FB 4MRSA 1XXHA 4RFVA 3UWKA 5FOUA 2F55A 5CLQA 1E3MA 1IN6A 1E98A 2G83A 3ASZA 2DY1A 2D62A 4BECA 2BKUA 4C7OB 4A0GA 4KBGA 1SVWA 4RVCA 5AK0A 2ZETA 5EQTA 4QHTA 3X1DA 1JAHA 2VTKA 4QKQA 2WJYA 4EFMA 4YXWD 3OFND 3ADDA 2VHQA 1JXMA 4B76A 2PEZA 5DLQC 3U3MA 3LLMA 5E7IA 3GEHA 4YMSA 1KDOA 1XB2A 2XTNA 4LBZA 4LX0A 5EP4A 1RRFA 5JJLA 4F92B 4XWOA 1RRGA 3ZVMA 2NZ8A 5M04A 3BGWA 4B3BA 1P7CA 2FFAA 3A4NA 3GLHA 4GSYA 1W46A 4Q4HB 4URZR 3LQQA 2FOLA 3QENA 1VYVA 5JWOA 1ZP6A 2H7VA 5KOYA 4KO8A 4U7DA 3E2IA 4Q18A 1EX6A 1VCOA 3UG6A 3O8CA 3PEYA 4IOKA 1ZIOA 3U7GA 2QN6A 4A0RA 2YWFA 3W3ZB 4HLQB 5AJVB 1EK0A 3J81k 4BEJA 2QNRA 4DXAA 1E2IA 2O0JA 4DKXA 1RRPA 5DISB 3EZ6A 2FFQA 1W36C 1KSGA 1BYUA 2VBCA 2WWGA 2CCGA 2IS1A 1RJ9B 3MGCA 4K81B 1CS4C 2WOJA 1C9KA 2B21A 1DEKA 2R6CA 1CRQA 4B75A 3RAPR 1KJYA 4MITA 2BDTA 2RMKA 3FOZA 3MRSA 4S35A 3C5CA 4A8JC 1KI6B 2IYRA 1YR6A 5GVRA 2IF2A 3BAFA 4W5HA 5EUMA 4HZUA 4OQXA 5C4GB 2OT3B 3LAWA 4HAWA 2F3TA 3R20A 4WBSA 2NPFA 4B3DA 1OSNA 4DDVA 2PJZA 4DT1B 5E4FA 3WNCA 2QT0A 4R71A 4JBWA 3K9GA 1MO3A 1NN5A 1QHGA 4M9ZA 2ORWA 2W83A 3R7WA 5J4YA 4C4PA 1P2SA 4NMMA 1DE0A 1DOAA 1K8RA 2FMXA 3KFXA 4DHEA 5EP3A 2NO0A 4RY2A 4ZDIA 4OK3A 2PMDA 1W2HA 2WIAA 3WMGA 1NI3A 2F7SA 2EFEB 3RRMA 2HYDA 4WXPA 1VKJA 4DCUA 2ZJAA 2KE5A 3CWQA 3ECCA 2EVWX 4M8NE 1II8A 2GEVA 2GNOA 4KHZA 4CDGA 1CEEA 3WNBA 1H8HA 5CJPA 2IL1A 2ZRMA 4JS0A 4LV5B 4TQUS 3FPAA 5SZJA 4F7WA 4URXR 3W5IA 3HU1A 2AWNA 2ZROA 4D26A 3EZ2A 4EAQA 4MKHA 4RD0A 1X6VA 3O8RA 3AVPA 1TQ4A 5FOXA 4DLRA 1RC8A 4A1FA 2CE7A 1PLJA 4PHHA 4FMCB 3AVYA 3I4LA 1R8SA 4IRUB 4M1KA 3QNUA 2IHBA 5BW8A 1KK2A 5DSZA 1UEJA 1N5KA 3QOFA 3VR2A 5J5CA 1JI0A 3F5FA 4MA4A 4KODA 1VYUA 4MGZR 4A8JB 4HLCA 4I1UA 4ZKEA 3DOFA 3KKPA 4I1VA 3IPXA 1W36D 1VG8A 5JFGA 3WYGA 3I1FA 5UKDA 1KOFA 1NG1A 1Q12A 1ZM9A 2OFOA 3L43A 3EIEA 5KUTA 4CEIA 2FNAA 3Q3JB 4YQFA 3CPHA 2EU8A 2GETA 3BK7A 3IQXA 2HDNB 4FXPA 2IS4A 3T61A 1P6XA 3EZFA 2GDJA 3NC1C 3WHKA 1JJ7A 3GLFB 5CIQA 2PT7A 1P4SA 3SDZA 4QXAA 2IW3A 3C8UA 2J0SA 4TYYA 5J4LA 1G8HA 1LW7A 4IDNA 3NKVA 4EFLA 2PZEA 5B64A 1AKEA 4ITRC 2WWXA 4N1AA 3U44B 4O0MA 1Z47A 3TVDA 3VFDA 3OZXA 1N6NA 3B78A 3RC3A 3I92A 5FR2A 5DE3A 5A4JA 3CB4A 5E7MA 5IT5A 4P0TA 2VHCA 5DO9A 4A36A 1D2MA 4NE2A 2QRNA 4MH0R 4B44A 3FE2A 2ZM5A 2W6ID 1Z6AA 1E9BA 3BB4A 5KNCA 2DFLA 2FV8A 2PLRA 4B48A 4A82A 3HR8A 4XD7D 4AIIA 4B3GA 2QMEA 1XF9A 2XNSA 3LFUA 4P31A 3WMEA 4DEYA 1X1RA 3KQUA 1YVDA 3FMFA 3KXLA 4PHFA 1W47A 521PA 1S8FA 4FWTA 2VSFA 5CLLA 1F60A 2C8VA 1E94E 4IHQA 3P20A 3RYTC 2GWHA 4PZYA 3P32A 4G01B 4L9SA 4QHYA 1P73A 1ZM3A 1XCGB 1BH2A 5IK2D 1M1YE 1NBMD 1KJZA 1AGPA 2XXAA 1KKMA 2C99A 2XB4A 3D7MA 1UADA 3KZ1E 4IEEA 1S1CA 3I32A 5CYPA 2CL6X 3AB3A 2A5YB 2P2LA 5F2EA 4ZCIA 1CTQA 2OSBA 1G3RA 2G1JA 3L2OB 5L3QA 1AKYA 2V7QD 1ZRHA 5CIWA 1W0JD 4KVGA 5LD2C 1S3SA 4ZI2A 2OCYC 4BLQA 1IN8A 1I2DA 3EC2A 2GBLC 4CEIB 1E2QA 3NBFA 1SKYE 2JA1A 4LI0A 5SZHB 1VDZA 2HCBA 2ZRHA 1GNQA 1KO7A 1QZXA 3TSOA 1XWIA 1HURA 4KYUA 4QJ3A 4NBSA 2VP5A 1FP6A 4U00A 1A5TA 2A3RA 3GJ0A 4Q03A 3W90A 3A8TA 2IHYA 2Q6TA 2QPOA 4LYAA 1LFDB 3E70C 1II8B 3Q72A 2RGGA 4B47A 1N0WA 3KXIA 3UWOA 5JS7A 1TF2A 2QI9C 4EPYA 2ONKA 4KJZA 4C0HA 4ZCLA 1JALA 5FOVA 1Z0FA 2ZI3A 2FEOA 2X19A 3H84A 3U3RA 3AVVA 4NONA 3RVBA 2HT1A 3OFNA 2J0VA 1KGDA 1B0UA 3QI2A 5EZ5A 2ANBA 1AQUA 5D3QA 2WWFA 1MO5A 1T6NA 3D8BA 1YQTA 1FFHA 1RPZA 4Q48A 3VR1A 1CJUC 1IXRC 3AM1A 2QZ4A 1M2OB 5L3SA 2RGNA 3V9PA 1F5NA 5KSZA 1FL9A 4PHGA 3CNNA 1FUUA 1EWQA 4PQYA 3T34A 5FR1A 2WJHA 4QHSA 2IS2A 5KSYA 3GP8A 2OESA 1AS0A 1QDEA 3AKDA 1GL6A 2W2TA 3VNUA 3VNVA 2EFHB 2BMFA 4PZZA 4R98A 1T8TA 2GF0A 2JIZA 2UKDA 5FTJA 2WJVA 5FUWA 5TMPA 2D06A 2ZU0C 5FI1B 3VR5A 3TUIC 2OBLA 3MWKA 1NMYA 3K09C 3MSXA 3CLVA 4KFTA 3EA0A 3T15A 4D0LB 3MUFA 4BLRA 1S3GA 3H86A 5B57C 4XSHA 3G5UA 2CLSA 1EWRA 2GJSA 2REOA 1FTNA 4Q1EA 3QSYA 2XOKD 2AX4A 2IS6A 2YZ2A 2ZJBA 1SKYB 2H17A 2YKGA 1XD2A 1TQDA 1JECA 1K6MA 3BC1A 1E2GA 3WNDA 3WRYC 2KSQA 4Q4LA 5FPTA 3GLHB 1P9WA 5FL3A 1CP2A 3SFVA 3CRQA 2ZSAA 1UKVY 4UNRA 2JLXA 1UEIA 4RCZA 3ICEA 4KFSA 1NN0A 3QPVA 3AF4A 4LJ7A 5DI9A 2QRZA 1E1QD 4U5XA 1KNQA 2I4IA 3IPYA 1DAIA 1LF0A 4CF7A 3I61A 3DOEA 4Z1MA 5HZHA 2WSMA 2C04A 4RKEA 3BH6A 2A78A 3SC3A 4A2QA 1ZU5A 2L0XA 2V54A 1ZU4A 4QFMA 4URYR 5AJWA 3EPHA 2BBWA 2WSSD 721PA 2O8BA 1P72A 2ERYA 1R2QA 4DCNA 1NG9A 4CEJB 3VR3A 1NKSA 2OLKA 4KFRA 1DBSA 2GJ9A 4DIDA 4DWJA 3A58B 3ZIAA 3B8HA 3GFTA 2NTYC 4V0NA 2FWRA 2EFDB 1A4RA 5D3MA 4CIDA 2ZE6A 1U9IC 3UK6A 1US8B 2GRJA 2ZXUA 3AVWA 3U6KA 3E5HA 2BMJA 2OCPA 1T3LA 3I62A 1ZC4A 3F8TA 2O0HA 1VG9B 1H65A 2IYZA 1HA3A 2Y8EA 2IYXA 1O3YA 4WVFA 5JEEA 1AIPA 2WWHA 5CB6A 3Q85A 1SQ5A 1IQPA 4NTZA 5IRCD 3T1QA 4LHWA 1QBKC 4Q01A 2YC2C 2VA8A 4L9WA 3W6NA 3FMIA 3K0FB 1ONBA 2WOOA 3REFA 2GCNA 4BRUA 4Y0AA 2LCFA 2NO6A 4IFBA 2WPDD 4XVUA 2RAPA 1P2UA 2CEAA 4NYMQ 3RDPA 4FINA 1U99A 2UVQA 1YKSA 3EX7C 4GP6A 2FZLA 4D80A 3UMFA 2Z5FA 1M7BA 3GEEA 2ZUCA 5JHGB 2IXFA 4CZ2A 3BFXA 4Q9KA 1NVWQ 5FBQB 4DSTA 4RD6A 3AH8A 1UFQA 3CRVA 1KZGB 1YZTA 4NP6A 2X1VA 5JLJA 1K5DA 1GP2A 1HT1E 1F3OA 1Q22A 1SULA 1IAQA 5JRZA 3U60B 1HY3A 1S9HA 2OFXA 3CF6R 3CX6A 2J59A 4PAMA 4A8JA 4O25A 2W0SA 1COWA 1U0HC 3BH7A 2YOFA 4A2WA 3L0PA 4KVAA 1SVOA 1ZD9A 3LXXA 1R10A 4LYJA 4PX9A 1GSIA 4TN1A 1UJ2A 5EXPA 4LBYA 2ZSDA 4QGHA 3PITA 1FPMA 3KL4A 4CEHA 2E9SA 3P26A 1GAJA 2GEDA 2PEYA 2ZJOA 3KB2A 2C77A 3DZDA 1KAOA 4GDFA 2JLYA 4DCVA 1EFRA 2ZRJA 5F98A 1XEXA 3GLGB 3A1WA 3FHCB 1XMVA 3EPJA 4FW9A 5IDVA 1FTSA 4NCKA 1IXSB 4GMDA 4LV6A 1TTTA 4LJAA 1QHHB 2N46A 3B5JA 3AKYA 4KSBA 1IN5A 1U0JA 4Q4HA 1E2FA 1YR7A 2ZI5A 2IF0A 3TAUA 4DIEA 4IJMA 2AWOA 4HB2A 4UQOA 5G41A 4PTLA 1JEDA 1OYWA 4HZIA 1UDWA 5IK2A 4Q9IA 1ZUIA 5EP1A 4Q7LA 2ZVQX 4FMDB 2BV3A 3LV8A 1FMJA 4M1WA 4DSUA 2LWIA 1YZUA 5IF9A 2ATXA 1RRCA 2ZYUX 3K1JA 5ANRB 4GI7A 5C4MA 3ADKA 2AD1A 1GFIA 1UF9A 3TMKA 1TUIA 4TZ6A 1NJGA 4PPGA 2IXGA 1G4AE 3PUZA 4ZDKA 3CX7A 1FX0A 1Z6GA 2XSZD 1KAGA 4IKEA 1VG0B 4HLUC 2OCBA 1VYTA 1EXMA 2RGBA 2GJ8A 2QAGC 2ZJ2A 4C3ZA 1UM8A 4LGMA 3EWSA 3THXB 1KKLA 1TMKA 3CKLA 1AZSC 2OV2A 2V1UA 3RWMB 5JRJA 1CRPA 2MSDB 3AGPA 2XOKA 1NNEA 2Q21A 4BLSA 4M9XA 2E87A 1R7RA 3FKSD 2QL6A 4OI4A 3GCGA 2ZRDA 1NJFA 4MDFA 1KNXA 1Q20A 1Z2CA 2PLFA 5DYIA 4DC9A 3NH6A 3RS5A 1G3QA 1G5TA 4JSTA 4TTRA 1Z29A 3S1AA 3GFOA 2ERXA 1D5CA 3O8DA 3TW4A 4A15A 2ZRIA 1NRJB 4OK6A 2G1KA 2P6NA 2VHTA 3GFPA 5JJKA 1SHKA 4MGIR 3ZZTA 2DYKA 3U4QB 3T5DA 5DI3A 2ORVA 3KQHA 3KTAB 2OAP1 5CJ2A 5FOWA 1I4DD 4X8MA 4PPNA 1XMSA 3I5YA 4QL3A 5FUXA 1Q1ZA 2BBOA 4HAXA 3LVRE 4X8LA 1YZQA 3CRMA 1RKBA 3ETLA 4LV8B 1WA5A 5JJIA 4G3XA 3AF1A 3T1TA 3QUSA 1W0KD 1TADA 2IA5A 2RB4A 1X8LA 4M1TA 5LB2A 3TUZC 2QUZA 1MKYA 5HKKA 4V0LA 2GAOA 1OXSC 1XPRA 1LVGA 2GVZC 1DADA 1KK1A 2FN4A 1W4AA 2YWHA 2IYWA 2XNDA 3K0SA 3ZDQA 1RJ9A 2ZRBA 1GL7A 3PUXA 3KDSE 1N6LA 4RJLA 4ACBA 1NMXA 1K5GA 4QGGA 1JJVA 4D0GA 1JBKA 3Q7PA 4BWYA 3DMDA 5AUOB 3I72A 3M4YA 1OYYA 4DLZA 2QORA 3T35A 3VMFA 3QKRB 1UKYA 3DM9B 2YC4C 3AQ4A 4QJ5A 2Q3HA 4BASA 2QTFA 4PFSA 3QG5A 3LBIA 4HSEA 4K46A 4Q9JA 1FW6A 1N5JA 1NIJA 3U61B 6Q21A 3UG7A 1OH8A 2R8RA 4OHVA 4TYQA 4Q1AA 4CW7A 1EX7A 4R7ZA 2JJ2A 2YWEA 1KO1A 4Q4JA 2CK3D 2OCAA 3WY9A 2QQ0A 4XIGS 3QEOA 4DLUA 1EFUA 1DO2A 2H18A 3T5GA 1GZSA 4IDHA 2XZOA 1AS3A 1R4AA 3U5ZB 3HPRA 3AKEA 5GJWC 3ZYCA 1Z3IX 5A5GA 1CIPA 1G4UR 2GTPA 2QPAA 2YYZA 1KO5A 1Q57A 4HAZA 1XXHE 5FBLB 4EPVA 1U90A 1NBMA 3Q8XB 2FX3A 1KO4A 4D2IA 2HV8A 4XVRA 3U44A 4RZXA 2XTMA 2VEDA 2D4HA 2AFHE 1CULC 2ZS9A 4DVGA 1Q3HA 2YVUA 1EGAA 4M2LA 4TSFD 1TF5A 3MWLA 3PEUA 2QU8A 3BOSA 3X1YA 3KFVA 2FEMA 4URVR 1E9FA 3DPUA 3RHFA 4D82A 4C0SA 1E6CA 2VL7A 2R65A 3FMPB 1A7JA 2PL3A 4IDQA 1AJEA 4Q1FA 4EPTA 1OHHA 3N5CA 1XNJA 2ZEJA 4EKDA 1D9ZA 2FU5C 5DGXA 1CJMA 1BS1A 1TEXA 4TMXA 1N25A 5BYKA 3C16C 1XMJA 2WKPA 4BZQA 3FWYA 5D3MB 2VIIA 3R9XA 3ADBA 2ZI7A 4ZI3A 1OIVA 5EE1A 1E2MA 3K70C 4BZXA 1R0WA 3RS4A 1N6HA 3AVXA 3JVUA 3IEVA 2NO7A 3QPUA 2O8BB 3QE0A 3RSOA 2AN9A 3B1ZA 3ND9A 2UZ3A 4BLOA 2ZRKA 1Y63A 3TNFA 2OXRA 1P9RA 4X8HA 1T91A 4Z51A 1EG7A 2J0UA 4Z54A 1ZMXA 5KNBA 4QOSA 4KI0A 1U9IA 3AVTA 4RSGA 4BFYA 4WA7A 1P2TA 1EFRD 2QAGB 3A36A 3B1VA 3L8ZA 2NQ2C 3HDTA 3K0FA 4XOIA 4BFSA 3CRW1 1OFHA 4C0LA 1JR6A 5DN6A 2FPLA 4JT4A 4EQ6B 3B82A 3CZQA 1JR3E 1ZNWA 2DWQA 2OE2A 2IUUA 3N70A 4AC9A 3PUVA 2D3WA 2W0MA 3K0CC 2REXB 4MYUA 1P5ZB 3L0SA 3K0CA 2A7QA 2RKOA 3ICQB 4JIMA 1GDDA 2YWGA 3CZPA 4BZPA 3BFVA 5FOSA 4OL0A 1LS1A 2WKRA 3SBEA 4QBIA 2AHOA 1SHZA 1AM4D 2BKEA 4ILEA 5E7JA 3GLHE 3KKQA 2ZI9A 5J47A 4NL4H 4MUBA 1DG1G 2ODWA 5FBRB 4Q21A 4Q5IA 1ZJ6A 2F1IA 3DMNA 2ANCA 3BORA 4UNQA 1JB1A 5FL7D 2OZEA 3MD0A 1OIWA 1U8AA 2H8KA 4BPBA 1G5RA 2BM0A 4R9UC 4AYTA 4CEHB 2WJIA 1LNZA 1IHUA 2HF9A 4AYXA 3OAAD 4LJ6A 1XPOA 4ARZA 1KTVA 2ZE5A 3TJZA 3R8FA 4UXHA 2PCLA 2BBTA 1SVIA 4LJ8A 2QPTA 1GM5A 1KI6A 4DBLC 2ZIAA 3O8BA 4V02A 4LJ4A 3L82B 2BC9A 4B73A 1QRAA 3QVVA 4JLAA 2DHRA 3AP1A 5BQ5A 1SVLA 3W5JA 3BB3A 4JYBA 1H8EA 4PQRA 4LPKA 3FGNA 4DLYA 3RANA 1G8PA 1M74A 4POAA 4PQFA 5DNYB 1CF4A 1X8KA 4HB4A 1PUJA 4UKDA 2VHUA 4TLAA 4B71A 2IK8A 2EYUA 1KSHA 1XBTA 4FWIB 1XEFA 4Q02A 4JVMA 1NF3A 1E2EA 3D6TB 2XGJA 3P4XA 2P67A 5TV2A 1UPTA 4M1SA 2GXUA 2UZIR 4KAXA 4O2RA 4OI2A 1QVAA 1DAMA 1CXZA 4G5QA 1O87A 5H8WA 1A1VA 2Q3FA 4OHXA 3QQ5A 4KU4A 1KO8A 3VX4A 4PC6A 4MKGA 1DS6A 2TMKA 4RD3A 4OBEA 2WV9A 3A37A 3THWB 3RS0A 2G88A 4HDCA 4DSOA 3EC1A 1IY2A 4XH9B 5AUQA 5JSZA 1GRQA 3KX2A 2BBSA 5C2JB 3I8XA 2DBYA 2Z4RA 4C7OA 3X1ZA 3VR6A 2VRWA 4JYCA 4QGAA 4XTCS 4TYWA 3CNOA 4IOLA 121PA 4EIWA 1ZINA 2JLVA 3GQBA 3B1XA 2C03A 1VCIA 3PENA 2J7PD 3SOPA 3VU9B 3U6BA 3VX3A 4JJKA 1W0JA 4OYHA 4G5OA 5DHFA 5GJBA 5KO2A 2FGKA 3K8YA 4H9GA 2I1QA 2EW1A 4FCVA 3WXMA 3W3AA 4TQAA 3SBDA 2JIZD 2OBMA 2C9OA 1W4BA 1D8TA 2J9RA 4ACAA 3UATA 1LS6A 4P32A 2ZTSA 3QKSA 3CH5A 1P60A 1KSFX 3QBVA 3T1VA 4A6PA 4B33A 4WZ6A 1NVUQ 2FE4A 4DDWA 3H2YA 3GJ5A 3P27A 4M1YA 4JT2A 3U4QA 3VKHA 1XTRA 2ODBA 1GRNA 2A30A 3GJXC 5KU1A 1YZGA 1XJQA 5LPNA 2R2AA 4XD7A 5TVKA 3IO5A 5EE9A 1N6IA 2BIFA 1ZIPA 1WCV1 3OEEA 1E4YA 1E79A 1Z22A 2FSHA 4D4JA 2HUPA 1G3UA 1G16A 4QG7A 1OPXA 3ZVRA 4PANA 1ZUHA 1ZNXA 4MDEA 3UMSA 4NH0A 5KSPA 3PG5A 2WICA 3VKWA 1DAKA 4HUTA 5AJXA 3EPKA 1MOZA 3RS7A 4XJXA 2NGRA 1XTQA 2RGXA 1G18A 2JLQA 3GJ4A 2A9KA 2VP6A 5HR5A 3OEHD 2A2ZA 5K8TA 5LDDC 3HP1A 4LHYA 1XD9A 2IYUA 4JSYA 2O8FA 3AF0A 4TT3D 3D3QA 3AVOA 4OI1A 3UPUA 2CBZA 2ODEA 1TEVA 2DWOA 3ND8A 2ZYTX 4HAUA 2OLJA 1GNPA 5EUQB 4Z8YA 5BYJA 2ZJZA 1RYHA 1T0HB 2QMUA 4AD8A 2ZS8A 4RKFA 4TYPA 4QBGB 2PT5A 3LBNA 1IN7A 2ZVPX 4C0KA 4LPSA 4EFNA 2O8EB 1IXZA 3VR4A 2G9NA 3OESA 1XP8A 2F43A 4BFZA 1M7HA 2J46A 2QE7A 2PZFA 2GK6A 3D31A 2NO9A 2HJVA 1COWD 3L0OA 4Q4JB 1TPZA 1G291 4HB3A 2JJ8A 3WP0A 4AYWA 2GZHA 4NYMR 1TNDA 5B30A 221PA 1XEWX 1U2RA 1DPFA 1S9DA 2OUKA 3CM0A 4ZCMA 1E9AA 1JNYA 2O5VA 1QHIA 3A4MA 3F3YA 1G7TA 3KJHA 4JLNA 4WZBE 1Q21A 4F91B 4ASUD 1E96A 1E2DA 4PAOA 2OO7A 2R6DA 3SEAA 1CR2A 1GRRA 4JLMA 3GJ7A 4PXAA 4C2TA 1X1SA 2BVNA 2K5UA 2W6JA 4MKIA 2GXAA 3KKNA 1E2LA 4WXRA 4AWXA 1E1RD 1SXJE 1XFAA 1FQJA 2HXYA 1PJRA 3OIWA 3R9IA 2DB3A 3MLEA 4FCTA 4IVPA 4A0FA 2CNWD 4MGKR 1HEIA 5JBQA 3F0TA 4EJSC 3HYTA 2ORIA 4TWZA 3TKLA 3GJ8A 3QXCA 1DTSA 1NKTA 3IQWA 2AL7A 3RABA 1S2MA 1AQYA 2XITA 1IM2A 1W4RA 3LD9A 2ZAOA 5FPKA 4AKHA 2IBMA 4GNKA 2EFGA 2VF7A 4LY6A 1Y3AA 5SZKB 3OE7D 1FP7A 1JPJA 1N0UA 1DARA 3B85A 3QVUA 4MYCA 3KQKA 2QENA 3A1VA 2IUSA 3RS3A 5CM8B 1C4OA 4G5GA 2X77A 3H1TA 3DM5A 3ZZ0A 3IIKA 3OIYA 2G0NA 3CR7A 4L5BA 4Q9HA 4WIAA 4HAYA 4TMKA 2P6UA 3DEFA 1G7CA 3K70B 3KKOA 4PZLA 2AR7A 2H57A 4A0HA 2W2VA 3WBJA 4B2IA 2XZLA 4P4TA 5L3VA 4AKIA 2XAUA 4NKRA 4D0NA 3P1JA 2HLDD 1J90A 4LHVA 2QTVB 2W00A 3AV0B 3QKSB 4I99A 3M1IA 3H4MA 2GHIA 5AR1A 4Q1DA 4JBXA 1MV5A 1NY5A 2AD5A 3BFKA 3R7WB 5KTYA 3PFIA 1YE8A 1ZVQA 1E2PA 2YHSA 2N42A 4ON9A 3GLGA 3SQWA 3ZS8A 2D2FA 3THYA 1NLFA 4EQ6A 2B8WA 2PCJA 2QGNA 1Q1QA 1XDBA 3EASA 4OQNA 3EW9A 3TUJC 1DAGA 1GKIA 1Z8FA 2IXEA 5EE3A 3B13B 2A5FA 4GOJA 4M1MA 3UMRA 3QPWA 1QHHA 3VAAA 3W6OA 2NO1A 3ZS9A 2CK3A 4OQFA 4URUR 4OHZA 2HJGA 1SXJA 4D6PA 1MR3F 2JASA 1HUQA 2R62A 1NSTA 2QG6A 4AURA 3CPEA 3QKUA 4C0QC 1WBBA 2LKCA 2GZAA 3I73A 5KSOA 3BE4A 3NVAA 4Q9LA 4KSCA 3AVUA 4KLNA 3SYLA 4PSAA 3TRFA 2QBYA 1VIAA 1GITA 2WKQA 1E32A 4LC1A 4IDOA 3U7EB 1XZPA 1RZ3A 4NCNA 2OFWA 2GA8A 3C5HA 4QC2A 4C0BA 4ESHA 1N3BA 1D2NA 5LB4A 4DLSA 4DB4A 2ZITA 4M1OA 4OQMA 3A1UA 1XEWY 2X2FA 4UJ3A 4JLJA 1IONA 3SJAA 2I1VB 4CRWB 1SGWA 2QP4A 1G9XA 4EDHA 2BWJA 2XJ4A 2GILA 3UANA 4GL2A 4ZPXA 4ARZB 1XU4A 3TSZA 1OB5A 2ZSEA 3EIQA 4QGFA 3THOA 3NHAA 3FTQA 2WBLC 5JI3E 2JAQA 1ESNA 2YOGA 4ZV4A 3DZ8A 4JLPA 5FTKA 4TL6A 2ZJ8A 2GKSA 4JVSB 4PPFA 3NH9A 4TL8A 3TR5A 1R6BX 3CPJB 2G0TA 2O8CB 2ZE8A 3IILA 1UAAA 3LA6A 1BOFA 1QG4A 4IW3B 4UXJA 1G20E 2ZQ5A 4V0OA 5KDLA 2PH1A 1G6HA 4E22A 3A1SA 3IGFA 1L4YA 2FPMA 4JVNA 5DI3B 4YONB 4O3MA 4M53A 3A6PC 1PVOA 1EFHA 4QM7A 4DLWA 2QP9X 1Z0IA 2HYIC 2Z6VA 1CR0A 1XTKA 3IBGA 4W5WA 3LDAA 1G64A 2C78A 2JGNA 2Q0HA 3LQRA 4OKSA 4Q7JB 1D2EA 1CU1A 3CBQA 3X1XA 2IWHA 1QHYA 4YLGA 2F1RA 4QBHA 5GJCA 1CJKC 3SJCA 1N6KA 1ESMA 3EG5A 1S0UA 1W2GA 1W5SA 1G41A 4EPRA 4UNNA 4NYIR 2FPKA 1YR8A 3PIRA 1FNNA 2VP0A 1UBGA 2ZE7A 2EWWA 4F4JA 3PR1A 4IOMA 2GESA 5JZVA 2DPXA 2CHVA 3TAHA 2P6RA 3WHLA 4ZIRA 1E9RA 2ECKA 1GOTA 5EJEA 2W6JD 4TYNA 1KK0A 1DAFA 1G17A 3WMFA 4G5RA 4IEIA 4RCYA 2R9VA 2IYLD 4ASUA 4DRZA 1L8QA 3IHWA 1X86B 2R6GA 3NTUA 3VQTA 4JL8A 1ZC3A 1MT0A 2ZSFA 3RLFA 1T3HA 1WDTA 1FOEB 4KXFB 4RFSA 4US0R 1U94A 2H1LA 2ZRLA 4C2UA 2G6BA 2CNWA 4W9MC 2ZUDA 3AVQA 1XEXB 2IYQA 2NZJA 3HJNA 1E1RA 3HU3A 3SJZA 2FH5B 1P75A 4I81A 1XD2B 4HUQA 4LC0A 4DB2A 4WW0A 5EXTA 1Z6YA 3LW7A 1LTQA 2YNMA 5E3HA 2VHJA 3L8YA 4N0DA 4TSFA 4V03A 4YMWA 3KUCA 4GOXA 1YZKA 1ZM2A 1VPLA 2R6AA 4LSGA 1OXXK 1QVRA 4MYHA 3ZGXA 1A2KC 1L4UA 1GILA 3M0EA 3TQFA 3NWJA 1H8ED 1U81A 1A82A 3ZVLA 1IJEA 2J7KA 5K8IA 1VIYA 2CLDX 1P2VA 1SXJB 3B60A 3BIFA 1JPNA 3QF4B 1F48A 4DLXA 2RH5A 1TL7C 3LX8A 4XVQA 3TE6A 4ZIRB 2CLCX 1WMSA 2GK7A 4TL9A 3A1TA 4Q4AB 1DAEA 1HE1C 1D9XA 1T8UA 2C95A 2CL7X 2KBFA 2VLIA 5BN5A 2WVJA 4C0JA 2EQBA 2F1HA 4QNRA 3DDCA 1Z28A 3T12A 1JR3A 1II9A 2FFBA 1G7RA 2WAYA 3SU8A 4B3FX 4BEBA 4V0MA 3GLIE 4Q1BA 1MABB 3RSLA 3KXKA 4LBVA 3TQCA 3PVSA 2FFHA 4GRAA 3E1SA 1UBFA 2JJ2D 2VSXA 1GKUB 4R2HA 4TMVA 3VHLB 2O8FB 3NDPA 3CO5A 3EZ9A 3MJHA 2Z43A 1BIFA 1KHTA 3OEHA 2IYVA 3AP3A 3ZD6A 4QM6A 2EYQA 3CW2A 4BQSA 4DCSA 2QROA 1GG2A 1OT3A 4RFSB 3TR0A 2GCPA 4QBFA 4PC7A 3GLFA 1HH4A 2XNDD 4P4SB 4Q00A 3LBHA 4BLPA 3SYKA 4B6FA 1YZLA 4DT1A 3WP1B 4DDTA 3QEJA 4MRRA 5FTNA 3LRPA 1J8YF 5G40A 2C9CA 2XTZA 4C30A 3K0AB 1W5TA 3NEYA 2PX3A 5JI2E 3LO5A 3SI7A 1J2JA 4JLBA 1W48A 1OF1A 2PMKA 3DHWC 2V4ZA 5DH9A 1OH6A 4AKEA 5HZKA 3KQNA 1Q1BA 2P5SA 4N0EA 2J41A 1M7GA 2A5GA 4LJ9A 1Q1EA 2QEQA 3K9LA 1G19A 1H8HD 2MMGA 4NYJR 3FVQA 1PUIA 1PZNA 3QF7A 4LJ5A 3LLUA 1TU4A 1Z6XA 2VP9A 4MRNA 1KY2A 2MMCA 3SQXA 5FBWB 3ZQJA 4RZ2A 5DHAA 3JVVA 2QGZA 5GADl 2WJJA 5FTMA 2IEZA 2V6JA 4PO8A 1JEEA 1TQ6A 1OXUA 2GAAA 2WJGA 4V0ME 3GLIA 5LBIA 2CL0X 4LOAA 4EPXA 2P3SA 821PA 1OH5A 2B8TA 1XXHB 4AG5A 3U2QA 5EZ6B 2A5JA 1CR1A 1G5PA 1G7SA 1OV4A 4JZKA 1YU9A 1KK3A 1ZW6A 3NBXX 3WYAA 4P3YA 3PCRB 5FPYA 4C0AC 2OILA 4I1SA 3BERA 3NC0C 3U3KA 2ZI6A 4V0KA 4G1UC 2HT6A 2BMEA 3CF2A 2FGJA 4KFUA 4CEJA 2BEKA 1J7KA 4B3CA 4XWAA 2GF9A 1GKYA 2DWPA 3AKCA 2G3YA 2EFCB 3IHLA 4LK2A 4UNPA 2D7DA 2JLSA 2Q9CA 4OHYA 1BMFA 1Q0UA 1WF3A 2FSGA 4D4LA 3X2SA 3OHMA 3LH5A 3U3JA 1G3IA 4CVNA 4QRHA 3PJRA 1XRJA 2J0QA 1VHTA 2GZDA 2WTUA 1KDPA 1NN1A 1KI7A 2AK3A 1B23P 4RD4A 1IY0A 4CGZA 1RVDA 3SYNA 3T06B 2C98A 2ZANA 1ZBDA 3GMTA 1XTJA 3AUXA 3RWOA 3TSWA 4PC2A 4G0NA 4JLOA 3NXSA 1KI1A 1BKDR 2QSZA 5TB5A 2O52A 3FYHA 4JL5A 2HCJB 1J99A 2BJWA 3REGA 1W1WA 3BS4A 4JMPA 3CR8A 2AKYA 3OAAA 2X8AA 2H16A 4IXMA 3SHFA 1CJVC 4M21A 2OAQ1 2HF8A 4NCHA 3T1OA 1SXJD 1UKZA 1WQ1R 2MSEB 4RZ3A 1MRNA 2GJKA 4GOKA 2J1LA 3OIVA 5F9FA 4TT3A 4PAQA 2RHDA 5SZIA 1LF5A 1KMHA 2ZR7A 3VTKA 3SJBA 1MABA 2V1XA 4HDOB 2CE2X 4HZUB 2Q9BA 2D74A 1E69A 1GIAA 1KMQA 1IOZA 3CUEF 3CH4B 4CT4B 5IHPA 2V6IA 2X2EA 4YXWA 4I4LA 5L3RA 1HQCA 4B3XA 2JLZA 3IBYA 2PZGA 4ESVA 2FA9A
chains in the Genus database with same CATH superfamily
4MR8B 5FWXA 3AW8A 2PA0A 4LQDA 1N6PA 1FDSA 5C18A 3I01A 1O0CA 1JQ5A 1LDNA 4WLFA 1DO8A 4RLFA 2HREA 1R0SA 2X4LA 3OM0A 1T2EA 2HLDA 4MRVA 4BRWA 2VTBB 4UAVA 4NIMA 1G42A 4O4LA 1QFSA 5KAMA 3WGKA 2YNMD 1MPTA 5KPJA 3HSKA 5HM6A 1Z3CA 3E3OA 4UDYX 1GPDG 1WE2A 1VLZA 3CQ9A 2VF4X 3GZJA 3LMKA 4UZFA 2RC5A 1GUFA 3PQCA 2Z1MA 4ZQGA 4DABA 5AVKA 2ZIGA 2JH8A 3M5WA 3OIUA 4UBNA 4XQEA 4GZMA 5EE5B 2G77B 1SCAA 4UXIA 2FXIA 4F3TA 2ZS7A 2BEJA 5K8LA 3QX7A 3R24A 3D3WA 4A10A 1YA8A 4RTKA 1VL1A 3C5EA 5JLAA 1U8TA 3SS7X 2WIKA 3TR6A 3W2FA 4II7A 4IR7A 3WOHA 2HSDA 4WERA 5CJJA 1E9DA 4BNJA 4YRGA 5LOVF 2JGRA 1MAUA 1NNUA 5K45A 4DQUA 4K0KB 2JAUA 4AI6A 1D6NA 2QX8A 4LUCA 5J2TB 5D5PA 3GLIB 1AUPA 3JV7A 2ECPA 4UHCA 3DW1X 2YVAA 4R69A 2EOAA 2XSZA 3A14A 1P7YA 4ZHQF 4YBRA 2WWYA 3WYCA 4JBHA 5AOVA 4C03A 4GYJA 1XLTA 4B32A 5ALOA 2YL2A 4YP0A 1CB7A 4NPAA 5AVVA 1GFSA 1WXFA 4G97A 4R1OA 2A4MA 1KSJA 1SKUA 5JD4A 4FE3A 1QRRA 5CNKA 4PLTA 2FPIA 3IUYA 1MQAA 1L6IA 1XTIA 3BF8A 2VTBA 2NVWA 1RE0A 4KXMA 3LK6A 4G41A 5BW5A 1HL3A 3O4HA 2P2DA 1MMFB 1X7YB 3INTA 1KDYA 4A2PA 2Q99A 2H4FA 1V1MB 1JKXA 2FZVA 5AI4A 4ROSA 1NLZA 4JI6B 1TCBA 4PS0A 4RFLA 3RYFB 1AZLA 2HK6A 4J9VA 2WU0A 5ENVA 4U9UA 4XPZA 3V7YA 5LMUB 3ZHBA 5KS2A 1TYBE 1CQWA 1R0ZA 2CMKA 2D0OB 3A4TA 1TQ8A 4W4TA 2OKCA 3TCKA 5KTNA 3DTTA 2PLNA 1UKCA 3BG5A 1U2SA 5ALTA 4NARA 4DV0B 3N53A 4LOIA 3FZQA 2WWVD 3EAGA 1JXOA 4DLTA 3OHPA 1F4PA 3UA3A 4IXNA 2I66A 4S1VA 5BR7A 5JATA 5B1DA 1ENZA 1KORA 3KJIA 3CWZA 1PGJA 1GU1A 4RKQA 1OPRA 5B55A 3JQBA 1TM3E 2COKA 2QE6A 2Q8PA 3GY0A 4CL8A 1MOSA 3FYDA 4JLWA 4ZOEA 2FW8A 4JR1A 4I8XA 5H68A 1ZVVA 4A9AA 3H7IA 3ROZA 2WTBA 4LJYA 3WYNA 4Y2QA 1ZRNA 1RLJA 4MEAA 5CP8A 5E1MA 1IZ9A 3D4LA 1OKKD 3KOOA 3PNVA 4S24A 4KDEA 4YCAA 2DC1A 5P21A 1UKEA 2ZTLA 3KB6A 3NAGA 4MWZA 2XZPA 4DLVA 4DSNA 3UJ7A 4CLOA 4YHHB 2ATVA 1FTQA 1UBUS 4P0PB 2Z5VA 2FF5A 2DTXA 4BGDA 3OZWA 2CSXA 2FN9A 2DR3A 2VK4A 3FNIA 4MWSA 3S8MA 1KFEB 1J0AA 1H3NA 1DVRA 4L8LA 1OAOC 4J0IA 5E8JA 3RUAA 4DRXB 2ICAA 3GJ6A 2X58A 1RMQA 2NG1A 2XA2A 3V4LA 3GQBB 3MEQA 4OI0A 4E14A 1GLGA 3LVQE 4C9BA 1SVKA 1V7PC 1CF2O 1ZN9A 3NT2A 2QW1A 4HBZA 3RU9A 3I01M 3WICA 4ZMBA 5EIFA 4JLVA 4AJHA 1OBFO 5LA6B 2YV5A 1ZCBA 2VTVA 3RIHA 1DQSA 4CTNA 1DKUA 3S4YA 5HUQA 3NLLA 4LMAA 1UBEA 1XJWA 4OMFG 2O8CA 4AF8A 4MLPA 1SKQA 3H0KA 1JWBB 4B2LA 3Q2IA 3FPBA 2BLNA 5FO0A 4B35A 5GONB 1QG2A 3GRRA 2R87A 4ZHQA 2J3DA 1A9YA 3TD6A 7MDHA 3EPLA 3M82A 4ATNA 1AV7A 1T4BA 4C76A 1TUBA 4UCFA 3ZE9A 1JQLB 2GAIA 4BVBA 1K8QA 5C37A 2OECA 5HKKD 1M83A 3QNWA 5CD1A 4LKOA 1LPPA 2C2MA 2J7PA 3ICVA 2PZAA 5FLKA 2PNFA 2LKDA 4HFJA 2C5LA 4RNCA 2PGOA 4CT5A 3P2JA 3R4VA 3TNLA 2ZTVA 3SQMA 5ARCA 1BWRA 4RTLA 4GP7A 2CT8A 2ZBUA 3MT9A 1YR2A 2E5WA 2BGTA 1QUFA 4S1NA 5A4FS 4ENTA 1KDTA 1P6QA 2LRHA 3CONA 4QPPA 1U3VA 1C0KA 3I3SR 3WYFA 4GPTA 5HRAA 5U9CA 3WL4A 2GBFA 4BRZA 2LD4A 1TX4B 1YHNA 3UWDA 4Z3KA 1W4CA 4KP7A 3VR6D 1Y8QA 4PHCA 3O75A 3UXMA 5IMBA 3VR3D 1DSSG 3OT1B 3ODPA 4FDMA 4IOJA 3QVGA 4MS4A 4LYYA 4QASA 5J40A 3T95A 1WSAA 5J5AA 1F0YA 1KJWA 2IDZA 3LZ6A 5BVHA 2KWIA 2WG0A 1ZLXA 3IDQA 4HQ6A 1SNYA 2YW2A 4MQBA 4PBSA 2ZYWX 3U1TA 3V4RA 4YJ2F 3UJ8A 3VYRB 2ASEA 3SZRA 1Q3TA 4J1TC 1UXHA 4X90A 4XIIA 2CFSA 1X7HA 4H1UA 2B3DA 3W2EA 5JZ9A 2IZOA 3NVMB 1DEXA 4MWEA 1GEEA 4QUEA 3WA6A 3ZIUA 4KITB 4K5QA 1GPAA 1J8FA 1Z2AA 1NL3A 2WHXA 1MGPA 1B3BA 4LNHA 3D8SA 2ZUWA 1QIIA 2IEAA 4JY7A 1I0IA 2A1UA 4MJ3A 1O96A 2HD4A 2O0KA 3ECSA 2F9LA 3KT6A 2JCBA 1L5VA 1R6VA 2PKEA 2EKDA 4IGFA 4QOIA 2AX3A 4BFWA 1ORVA 1EXDA 2YRXA 3L6OO 3L1HA 3BSFA 5HPYB 5EXDA 1MO6A 3IVMA 2WIBA 2XDAA 4TLDA 4Z86A 4OIMA 3I8SA 3I1JA 3NVDA 4RJIA 3NTRA 4FEYA 2NU6B 2YCLA 1XLTC 4AJJA 2PAAA 3TIXB 2QT1A 2HKIA 5IVPA 2H5JA 1NY6A 2C4KA 3EK2A 5LP1A 1EE9A 2Q6OA 4ETWA 3WGVA 1L8XA 1ORIA 3CZCA 2FSFA 5CVTA 1JEQA 3P19A 3IP6A 4KYVA 4FQ8A 2ZUBA 4F85A 1AHPA 1NP6A 1NV8A 5G0WA 2HXSA 5KKCA 1Z07A 2WAOA 1VSQA 3ZEIA 2AEJA 2DH5A 2HA4A 4WASA 3E7FA 1CY6A 4ZKDA 2QM8A 3TXXA 3H2BA 1ZK0A 1E9SA 2CWWA 3LUJA 3R0XA 2EDCA 2NZ2A 1IXKA 1ULBA 3AEZA 3B52X 3E9CA 3H2JA 3WSTA 3EODA 3OJEA 4C4AA 1H9CA 3JQ6A 4LXTA 4WZBB 1A98A 1IPFA 4MAFA 1J2TA 1GGJA 3TZLA 3WGOA 2IXBA 4YJFA 1XK6A 4W7SA 4BE9A 3BREA 4HDRA 2JAWA 1YK0A 1W36B 1RJDA 4F8JA 1OGIA 3E3LA 2ADMA 3HJBA 3QOWA 3QVKA 5K4HA 5EJFA 4YLYA 1O95A 5K0NA 3VU1A 2NV0A 1CS0A 1UJ4A 5JD5A 1FMTA 2MTBA 5D01A 3V8BA 3OMWA 1QV7A 2BDEA 2C9YA 5K1ZA 1IN1A 5CYOA 5K0TA 3M4JA 3Q5GA 2P79A 2N75A 4CMKA 5HDQA 2NU7A 2FWJA 1BTOA 5ALIA 5KHAA 3FKQA 5EJ4A 1U8YA 1TCVA 3E3NA 4QFCA 3HKCB 2Q5EA 1R8JA 2CJWB 4JROA 4NOJA 5FLXA 1JSCA 3KPUA 3QBTA 1TM1E 2GPYA 3HU2A 2OP0A 2VOEA 1IRXA 4AMVA 3FXAA 3KJQA 2IX3A 1DBVO 4G6ZA 1E3JA 5I9LA 3VH4A 4D44A 3N05A 1T1RA 4OD0A 5E38A 4C01A 2I8LA 2AI2A 1PEDA 4HUQB 1I2MA 1CUUA 3OBBA 2YJZA 1N3LA 2BHRA 4EGSA 5TIIA 3UY4A 1LUAA 1KC3A 4RL4A 5BUSA 4MR8A 1W9HA 2RH8A 5IYZB 2Q49A 1CEXA 3K4QA 3D7KA 2Y0DA 4HGYA 4BS9A 1GU0A 3QIAA 4HN4B 4KRXA 4O2AB 1WXDA 1EB9A 3E9QA 3KQVA 4MRMB 4ZAFA 2DFDA 3F4BA 1UXOA 3DKVA 1PFQA 2EX0A 2FPRA 1E0KA 1W581 4D4MA 3UXHA 3Q2OA 4JJ6A 2V7QA 3T15A 1U0LA 4L4UA 2Q29A 3NI2A 5A03A 1OLUA 1F2TB 1JXQA 1NVTA 2I4LA 4U1RA 2W8BA 1A8HA 4EB6B 4RK7A 4PGGA 1GO2A 2AZDA 2GUWA 2PGLA 3H18A 1FLVA 2EIHA 3I45A 3MS7A 4OHRA 3VJRA 1KI9A 1Z56C 2UZAA 3SM3A 1OHHD 4FBMA 4DUGD 3KTFA 2EG9A 1E1CA 3EWIA 4U6NA 3E5MA 1Y9DA 4B0OA 5T57A 4L0QA 1T9HA 3LNCA 3MGBA 2HXGA 2VAPA 4MMYB 1TPYA 2C2HA 4N0MA 3TIGA 3ZC3A 5JSUA 1FRFS 3ACCA 5BYBA 1I2AA 1RYEA 2Z6UA 4EI9A 4BNDA 4NX2A 2FLWA 1N5LA 3MTQA 1ACMA 2I4OA 1U7UA 3BXXA 4YMUA 4DG9A 2IU3A 5I9BA 3R0VA 4PGMA 4PX5A 1T15A 1JDPA 2DCUA 2YW9A 3G9TA 3PPIA 5H16A 4ZZ1A 1YS1X 3EVGA 4G9GA 3QSGA 3TVTA 4B7AA 2OB1A 3R7LA 4OJQA 4BATA 1K6JA 1YTUA 3L04A 5FD8A 1MRSA 1SXIA 4NDZA 4TLBA 3W6PA 1RP7A 4I6JA 4JENA 1DRUA 3ZGNA 3G9ZA 3LQYA 1XCMA 4P6VF 2ZIZA 1B42A 4NNOA 1R4NB 2Z8YM 2Q6VA 3NBZC 2I4RA 2GCOB 1E5DA 2JARA 1MN6A 3G85A 4Y6SA 1DFIA 1SUIA 4I3FA 1E1QA 4YFVA 1V2GA 3JWJA 5HF8A 1XX6A 5A1TA 4C4OA 3SHWA 1WXIA 3MGKA 3VR5H 2CMDA 3B7WA 4L8YA 3IEKA 1G21E 2Y66A 2WU3A 4D57A 3F5QA 3GG2A 2GEUA 3L92A 4I50A 1D5WA 1PL0A 2QXTA 3L1IA 3W9BA 4FM9A 3LPLA 5JS8A 2RHJA 3IBSA 1A2BA 1IZ7A 2P6MA 2X41A 4UHJA 3AR9A 4HJRA 4IV8A 5TY0A 1GQOA 3H1FA 1XRSB 3IB6A 1VB5A 4NPHA 5EJ9A 3K6SB 5B2FA 1JQJC 3ESBA 3GJ3A 2PUEA 1J33A 3MJ4A 1U8EA 4KV7A 2MHCA 4KQWA 3WJ2A 4YIHA 3GLGE 3OURA 3MA0A 4HXFB 2A35A 1BE6A 4ZO9A 3URMA 4U3JA 3MMPA 1N1DA 2X8JA 3EAFA 5DW0A 3I58A 1JH8A 4G1VA 1D1TA 3OT5A 3WTBA 1E6MA 4H0CA 1NYRA 1R0CA 3C3XA 4P83A 4OJKA 5HRCA 3QKWA 5J4KA 1TZMA 3FAKA 2QQEA 2BMDA 3BWBA 2F3RA 5AM1A 3AF3A 10MHA 2OCXA 1JAZA 3IAS1 2JANA 2IP2A 2W6CX 3HYLA 4UUBA 3VDMA 2VH5R 3QYJA 1WO8A 3V8RA 1WXQA 2Z2XA 3BJIC 3C1TA 5KNDA 2FG5A 1TTPB 4BIIA 4EKIA 4EZIA 3OM8A 1H66A 4DILA 3P9YA 2VNIA 2HMAA 1P31A 3RBZA 1KMHB 3NAQA 3EA5A 4GECA 4R1PA 2QUHA 1Y4ZA 3F5DA 3NHPA 1KHHA 1Z0SA 3LQFA 4HFMA 4XUCA 4AO8A 2QV7A 3CLTC 1U0FA 1C9EA 3L84A 3H3JA 3WL8A 2MYUA 4OMDA 2H2AA 5EWMB 2ASVA 3HM2A 3N2GB 5TR9A 3LDHA 1VL8A 2HQOA 5HKLA 4BCDA 2Y67A 2CHGA 3GD7A 3LY5A 2MSNA 2FDCA 4WA8A 2G5GX 2I6UA 1L5OA 2OO5C 5KOHA 3IIJA 3WL7A 4OF4A 4TMZA 3OO0A 4O1HA 2RJ3A 2H1SA 5EXSA 2PPLA 3RFCA 1V6AA 1EWTA 1L7NA 1LTKA 2BW0A 2ZT8A 3S70A 2OGTA 4MRPA 1I5RA 1E5VA 1G4HA 2E1RA 3KP1A 3VSCA 4JOSA 1DAHA 2DFNA 1V1RB 3C7KA 3GPCA 1X2BA 2VPPA 4TTQA 3DAPA 3UFXB 4X7RA 2WAXA 3KZCA 1K27A 4WUTA 2NOAA 2VDWA 2O2ZA 5IJWA 4MWTA 4RGQA 2D54A 3R1IA 3LXRA 3LQ4A 2PWAA 3EBOA 2GNPA 4Q1CA 2CXXA 2JBWA 1UPFA 3T41A 3ZHSA 1B93A 1CB0A 1GL9B 3DKPA 3RS2A 3LL7A 1XVLA 1LLQA 1ZGZA 2F3UA 2X42A 3OPNA 1A9ZA 4FMCF 1C4WA 5D00A 5EOVA 1AHIA 3C3CA 4RD1A 2ZT7A 1UM9A 3KBBA 4N47A 3G59A 3HRHA 4EW3A 1Z06A 4B80A 1YJ5A 3IDZA 3I12A 1UMDB 1USIA 2GPBA 3VO9A 1KI2A 2IUEA 2XEDA 2WQZA 1BXZA 1C7ZA 2XVAA 4ZU3A 3RG2A 1U7HA 5EXXA 5EJMA 421PA 3HVRA 5CGQB 1AMOA 3E7PA 5BWMA 4PSVA 4FR2A 1XQYA 1JG6A 4QWMA 5HZMA 1P0PA 3UJNA 2IHNA 1ESDA 3K15A 1Z0AA 3FTPA 3EMKA 3V32A 2LXNA 3K53A 4P86A 4PC3A 2FN8A 1YRBA 2IHVA 3AF2A 2V5UA 2WZDA 3EUFA 3GFBA 3WYDA 4AP5A 1N2CA 1OWOA 4MV3A 3MILA 1Q74A 4DLPA 4Z5XA 4XCXA 2V0GA 3FPGA 1NPDA 4OHWA 5EP2A 4NJEA 1GVHA 4M22A 1CQJA 4XD2A 2O50A 1WW2A 1DG3A 3KUDA 3V6MA 4M88A 1OCEA 1NVMB 2J9ZB 4HATA 3HHPA 3VC2A 4HDNA 4J6EA 3VHXA 2OHFA 3F6RA 5KYWB 3ENNA 4Q7KA 2EARA 1EG2A 1G8YA 1NGSA 1MG0A 2RGDA 4JNCA 2AB0A 3BX1A 4MP8A 4DBLE 4HX9A 2IUTA 5EXEA 2XB2A 2M32A 1OIXA 4UMDA 5KYNA 4WOPA 3VRHA 2IHZA 1KDRA 4YDSA 4DIFA 1JG4A 4P4SA 4Q4DA 2WT4A 1W85B 1XZJA 5CBPA 3LYLA 2C83A 3ONDA 5CM2Z 5ICGA 4C7MA 1UM9B 2QIOA 1DC3A 4ML3A 2I7DA 1T8WA 1UH5A 2PY6A 3ZWKA 1JDVA 5AUNB 2FQWA 1RAIA 2GXQA 5D5QA 4B7XA 4OKNA 3ZDCA 3B1WA 2W2KB 1J22A 2VF5X 2YVKA 1CIJA 1VLQA 3H5RA 3JQ9A 3PFWO 4RJKA 3R7DA 3UCEA 3WE7A 5BN3A 4TTPA 1F2UA 4AZ3B 3RC9A 5L95A 3N2KB 5EJ2A 1OFVA 1I1QB 3LX5A 3JZMA 4RH0A 4FDVA 4BX9A 1L2TA 2Q3BA 3LWNA 1L8OA 1W5EA 2G9UA 4JDUA 4CM8B 3E23A 5H4HA 2YJ6A 3CVWA 3C4VA 1HPLA 2ZSBA 2GM9A 2ONJA 5BT8A 2R68A 3FBTA 4NMHA 3Q3IA 2GB4A 3RT7A 4YEDA 3MJTA 4AZWA 3K9HA 3RHTA 5CH5A 4TKZA 3VOAA 1G8KA 1QGOA 4LIPD 1FYFA 3QEMA 1R5JA 4UEWA 4CMAA 1Q19A 4ZZ0A 1DPGA 3L4BA 1GL3A 3SBXA 5J63A 3U7FB 4MRSA 1QIMA 3UUGA 1M6VB 5HKBA 5EZSA 2J4FA 1KEKA 1LQ2A 1RYYA 1YJBA 2X2OA 3U5TA 5LQCA 3DA8A 2CBXA 1ZX1A 3BTOA 1T6BY 4R1MA 4RETA 4OPMA 2J30A 2ZETA 4QHTA 4QSMA 2Y05A 2WJYA 4UFPA 4I66A 1Z12A 2QLMA 2IOHA 4X6YA 3ZD8A 5H82A 3BT7A 2PEZA 2FE1A 2BKXA 5FFFA 3U3MA 5B4UA 4AO7A 4KBYA 1OU0A 4HO1X 3RTBA 1XQ1A 1ZZEA 3M4ZA 1PG2A 1HDYA 2E49A 3F6PA 3MCUA 1ZOLA 4XWGA 1KWGA 4LX0A 4CGYA 2WZCA 1H2FA 4EKGA 1T2FA 3FPFA 1SUEA 3FROA 1JQ3A 5ILGA 1RRGA 2C2OA 1DXHA 4L1KA 4YAFA 4XWOA 3OE5A 3UWPA 1LTHR 4LMBA 1X1TA 3T0FA 5EJ7A 4I9FA 2PUAA 3COZA 2PS3A 3Q3VA 3FG9A 1I4OA 4Q4HB 3G89A 4URZR 2VK2A 3QHAA 1RXCA 4NU6A 1XYGA 4B9AA 3AY0A 5C1DA 4N7RA 3TLYA 1VYVA 2V97A 1XDSA 1EGVB 2HJRA 2GZRA 2PYZA 2RAFA 2CLLB 4WMLA 4Q18A 5ERXA 1VCOA 5EWJB 3UG6A 3O8CA 3PEYA 3OF2A 1SC3A 1A9RA 1T5HX 3FR8A 5BR4A 2QD4A 1HG0A 4R6WA 4Z3DA 1UDAA 4PSDA 4BEJA 2QNRA 2AA3A 2ZP1A 2Y1LA 4M7PA 4AJPA 1NNLA 3DPSA 4PFJA 2RHOA 3EVFA 3EZ6A 5IM4F 5JSHA 3PHJA 5K8VA 2PA3A 4UHDA 1KPHA 5AJHA 2H1RA 3PSHA 4TVKA 5CURA 1KSGA 2N3ZA 3L7KA 3MGCA 4MVYA 4CF6A 4K81B 2WNSA 5JH7F 1C9KA 5EWLA 2A1IA 3GCWA 1DEKA 3FD8A 5A9SA 3QVSA 2VPTA 3GGCA 1WXWA 1KJYA 3GVPA 3HHEA 4B75A 2BDTA 1RIIA 3A2LA 4HRYA 4GMKA 4QATA 3IAM1 1Z35A 1EZZA 4CT0A 3VYTB 3WFIA 2IYRA 5GVRA 3SYMA 1PV2A 2HSZA 4LWQA 3EVNA 2QT9A 5CXSA 3AL0C 4HAWA 1FFCA 1N2ZA 4ZPJA 3R20A 3ZHXA 4RTMA 2NPFA 3LRXA 4B3DA 4YAKA 2BHSA 2FI1A 1SZCA 3DUWA 4EWLA 1Z4IA 5CDHA 3HNRA 2JFYA 4D9GA 2HK8A 1H1LB 5EAIA 1GLNA 5J1SB 5KBYA 3K9GA 3ZDZB 2HFKA 4HL6A 1QHGA 4L8WB 4MWOA 1C1DB 1CUHA 5JAUA 4AF6A 4F6RA 1VL6A 4C4PA 3T1HB 1DE0A 2VSQA 2QIPA 1K8RA 1KVRA 1GCIA 2OGZA 3LYUA 5E6SA 3U3XA 4DHEA 2NO0A 4RY2A 5BURA 2JAOA 3SDSA 4OK3A 1W2HA 1X1CA 2DOKA 5LQKA 5K6AA 1QGAA 2AQKA 3KYCB 1CHNA 5THQA 2QTAA 1V95A 3RRMA 2HYDA 3D8HA 3HB0A 4WXPA 3KAKA 2XB9A 1LK0A 1VKJA 4DCUA 2A1TR 2Q4EA 2NVOA 3ZYZA 2ZG6A 4LFCB 1CEEA 3DOCA 3ISTA 4N5DA 2E1PA 1H8HA 1P0MA 4BUCA 2G9ZA 2PGJA 1FJ2A 4PAGA 1IH8A 4H7PA 4JS0A 5CA1B 3O8LA 5JYBA 5SZJA 4BX3A 1NR1A 2X23A 2A67A 3OMXA 1QE3A 3W5IA 2DSTA 5A06A 5JNUA 1PVDA 5L9AA 2ZROA 1GY8A 4BXOA 2NXWA 4H18A 5KVAA 5TQJA 3O31A 2V7TA 1I7PA 4Z4QA 4Z2AA 1JJFA 1M10A 4EAQA 1LDMA 3EGXB 3IOMA 4MKHA 5CEFA 1CDEA 1X6VA 3ZBTA 3LY8A 3O8RA 4M98A 2PGXA 4A6EA 2GGSA 2IJGX 1CRZA 2X0NA 3SIPA 3P9XA 4JGGA 1TM5E 4EJMA 1PLJA 4FB4A 1T0IA 4PHHA 2WC1A 4ZVTA 1EINA 4L5YA 2PD3A 4F9GA 3AVYA 3QNUA 4H7HA 1ZG3A 3I9V1 5BW8A 2V65A 1L4LA 1KK2A 3DAGA 1C1DA 1XHFA 3HFGA 4KR6A 3FCOA 5EWMA 4EKNB 3BK1A 3VR4D 5LVAA 4MVJG 5IDQA 3N58A 1LC0A 1GAQA 1VYUA 5IM4A 4HLCA 5AICA 3HXPA 3ZKAA 3V4PB 1X42A 3OQNA 1EQ2A 4V0QA 5ICMA 3R7AA 3RBAA 1QG6A 5AKEA 1Q6YA 2ZYGA 2PX6A 1WAMA 3Q3JB 3AIKA 4YQFA 1C8VB 2EU8A 3OPYA 3T0GA 3BK7A 9LDBA 4UVEA 1MAVA 3HO6A 4RPHA 3LTNC 2D2IA 1BOOA 4QVGA 5HFAA 4FDUA 3Q8LA 1ORRA 4KN5A 1M9NA 3RYFA 1A4XA 1BE8A 1G21B 1NA5A 1M2VB 2E4XA 3AB8A 4GQBA 5EL0A 5FNVA 3GRUA 3NU1A 3QTBA 4K1LA 5AYVA 1QPGA 1MCZA 3SXUB 1G8HA 4BP8A 4ARCA 5AI9A 4CL3A 3NKVA 4Z0TA 2PZEA 2J3QA 4ITRC 5P8WA 1I6MA 4O0MA 2A0WA 2D5CA 3VFDA 5C32A 1MEOA 1N6NA 3B78A 5MN5A 3UKJA 1TEHA 4MPRA 2XOXA 1F06A 4MPTA 3DS8A 2VHCA 5DO9A 2WYWA 1PJ2A 1XDGA 3MTGA 3E2PA 2W6ID 1MW9X 5F76A 3K35A 5JZOA 4JWTA 4RE5A 2NUPB 3R3SA 3RK4A 1Z6AA 4WNAA 5KNCA 4ABTA 3K9FC 1Z16A 1AKMA 1WX1A 3D7LA 1HE2A 1C3OA 3STYA 4BJ1A 2O23A 1FVXA 2PLRA 4B48A 3HR8A 4ROTA 1V7CA 1IFXA 2Q2NA 2ZYDA 1XF9A 4P31A 1V8ZA 1KYTA 2P9YA 3LFUA 5B37A 4E11A 1S2IA 3UM9A 3KQUA 4YY3B 5I9IA 4PYIA 2B4TO 3V8PA 1S8FA 1ZUWA 2Y9PB 2QRLA 3BICA 3R3JA 1F60A 4DMLA 1F12A 4IHQA 3P20A 3RYTC 5ADWA 1C3XA 1GKLA 1QANA 1BVHA 1I2CA 2GBIA 4RAOA 1WHSA 1J20A 2C7BA 4RADA 1JFFA 1RWQA 1XCGB 3CLUC 4ZVLA 1M1YE 3DF7A 1KJZA 3IP1A 3T0IA 2XXAA 1TC2A 2RGWA 4D3DA 2V7VA 4YJKA 5GGYA 5HQ3B 2QSJA 3JZDA 3M6UA 1XIVA 4IEEA 5HW0A 1PR3A 1TT7A 3M6WA 3AB3A 4OQ4A 4OBBA 2A5YB 5CA0F 4WECA 1GPJA 1WKVA 1YBFA 2BY4A 2R4UA 1E63A 2H4YA 2G1JA 4P5DA 4CMGA 1OYVA 3GHYA 1ZK1A 3TRHA 5IJZA 3K31A 1C8LA 4KVGA 5LD2C 3S1LA 4KIGA 5IASA 1PKXA 1SUWA 3CTPA 3JD4A 3EC2A 2GBLC 1BMTA 3W6ZA 2W9XA 3RU7A 4P3OA 1ORWA 1T5DX 4LWPA 1JEYA 2AFHB 3PQ4A 1GNQA 1X1EA 2F1KA 2P1RA 4WX2B 1KO7A 3VZQA 4PN7A 5AVSA 3ETEA 5FX2A 4QJ3A 3OFKA 3IE0A 1JHDA 3EGOA 4U00A 3DGEC 3JXEA 1Y8CA 2DVMA 4N8DA 4ZXPA 3AEUA 1SQGA 1BCRB 2FEWB 1QYDA 4DF3A 3A04A 2Z1NA 4AJ9A 2OV8A 2VRBA 4GVXA 1II8B 1L5GB 2OORC 2ZKIA 2E0IA 3Q72A 4JWKA 3RRJA 5AW3A 3U7IA 5AW4A 3KXIA 2NO5A 1TF2A 1VMDA 2G6TA 2QI9C 2ONKA 3NIWA 4EPYA 5C5DA 3KPWA 2GX6A 4XB6B 3Q10A 3K4PA 3WDSA 1JALA 1NSYA 3AFHA 1WXHA 3LS2A 4AMBA 4C0HA 2XQKA 3OQIA 5TVGA 1XA4A 3HWX1 4LYEA 2X19A 1KIFA 3V46A 2ZCUA 4YCDA 2VN8A 1A7UA 1RAFA 4NONA 3RVBA 5HSGA 4IWXA 3CJRA 4WLEA 1KGDA 3QA9A 2P3QA 3QI2A 4IJUA 1HYHA 2OXFA 3DDZX 2ANBA 3QX9A 5J5VA 4KIUA 5FWYA 3Q3CA 4ZQBA 2FDRA 2G1AA 1DAPA 1Z7WA 2PH3A 5HP4A 1WF6A 3PDJA 4TXJA 4RKWA 5DN9A 2C3OA 3G68A 3ICOA 1YQTA 2PV7A 4ID9A 2C29D 2UUPA 2VRCD 3VR1A 4RENA 5GGXA 2JBAA 4LWOA 1MJGM 2WDPA 3D43A 3KWFA 4Y2TA 1HC7A 2O3TA 1GTSA 1F5NA 2CZCA 1JTEA 1EWQA 3GAAA 4Y2UA 3STTA 2VATA 3JAKB 5FR1A 3DR3A 2IS2A 5F2KA 3C3YA 5DBFA 1I1HA 7REQA 3DZFA 4Y6QA 4NVRA 3VNUA 2BMFA 4MR7B 1JHPA 2UVDA 4MVJA 2JIZA 3DL2A 2YWXA 3EDMA 4O33A 2ZU0C 1WM1A 1FY2A 4L0MA 3TUIC 3EOAI 4RQTA 2OBLA 4UCQA 1ONNA 3JARA 3MSXA 4KFTA 1Z15A 3MUFA 4BLRA 1S3GA 3H86A 2X9LA 3IE1A 5GMOA 4LX8A 3HJFA 5ERGB 2GJ4A 1EWRA 3K5PA 4UU0A 4RMHA 2B69A 2GJSA 3OQIB 2REOA 1FTNA 4RJJA 4DLBA 4Q1EA 2XOKD 3V42A 2AX4A 3IQGX 1KVUA 2JFPA 3KVYA 2CVZA 2MT9A 1EIZA 4ZYUA 1QNLA 2AI1A 2YKGA 4UUAA 3U4IA 3VR6H 2FOIA 2VQFB 5KTPA 3KYIB 5BMVF 1E2GA 5EIAA 3WNDA 2JK1A 4WCFC 4Q4LA 5AVZA 5IC4A 5FI3A 3SFVA 2JLXA 5FCDA 3RYCB 4RCZA 1Q0RA 3SY8A 2HPZA 4KR3A 1J8VA 3B70A 3D0QA 4IFTA 2QRZA 1MG5A 1W94A 4J0HA 4NESA 3RS9A 3X1MA 1E1QD 3QRWA 5DM4A 1KNQA 1TO2E 4L4SA 3IPYA 4BJHB 4D9JA 1QAMA 2V6BA 1Z5WA 1PWEA 1QSGA 3MF4A 4RKEA 2G1PA 3DV2A 3OJ0A 3SC3A 1ZU5A 2V54A 4AXXA 3H2IA 5LIRA 2IVFA 1HRKA 5AKHA 4TLLB 721PA 2O8BA 2ERYA 2WD9A 4UD6A 2AG6A 3VR3A 2NU7B 1LLUA 1RMTA 4JOBA 4DIDA 2W4QA 4DWJA 4GG1A 1MOQA 1YACA 3B8HA 3GFTA 4UATA 3ZJVA 1T10A 1Z4OA 2EFDB 1B7GO 1K3FA 2ESRA 2H29A 2M6RA 1E6UA 2WHEA 4OL9A 2FPGA 1QUEA 3TXAA 1SUAA 2PWZA 2E18A 3WYBA 4UU8A 1O08A 2ZE6A 2HV9A 4CV1A 1US8B 5K6RA 3AR3A 3GGPA 4HNRA 3LDUA 4R3UC 5AVOA 4M0FA 4E5DA 3AVWA 1FFEA 2IDMA 4XQ9A 2D59A 1K08A 4GL4A 2OCPA 1CQZA 1T3LA 2WLTA 3P5SA 4X45A 3I62A 1PIWA 4HQKA 3CEAA 5U4XA 1SU8A 4F8YA 2IYXA 3M9XA 1U0SY 2WWHA 1LBTA 2G72A 1M8KA 4WVFA 4NTZA 1NVFA 1TIKA 3EGVA 4K88A 1G20B 2C42A 3LT2A 3WNVA 4NLLA 3TBFA 4GF5A 5FB3A 3REFA 2GCNA 4A73A 4BRUA 4NE7A 4O59O 1ZCFA 4XR9A 3I4FA 4DA9A 1U99A 1L4HA 3QKIA 1YKSA 3WLNA 1NVGA 1PQ4A 4D43A 5EMNA 3UMFA 4G4GA 1OLUB 3QHPA 5ITVA 2FR8A 4MOWA 2J9GA 1PO7A 3DE4X 4EUKA 4XAQA 4PYKA 5SYMA 3H3FA 4CZ2A 1NXTA 3BFXA 4Q9KA 4ZHSA 1H5UA 3H9QA 5DULA 4GKBA 3UGKA 4DUYB 1TJPB 1U7PA 2IH2A 3CRVA 1KZGB 3S2IA 2X1VA 2VDPB 1JQAA 4K2AA 2VH1A 1Q22A 1QP7A 1SULA 1O9GA 2G9VA 4MWCA 1F8XA 2BFOA 1PN3A 1RHJA 1S9HA 2PL1A 4A8JA 3T9BA 1F38A 1JHOA 2P41A 3NHZA 3FFWA 3S29A 2W0SA 1COWA 1C50A 4QXQA 5DTIA 3H8SA 4KIFA 4A2WA 4TN1A 4LYJA 1SVOA 1ZD9A 2QR5A 2QTBA 3CLRD 2C5EA 4E94A 4EG6A 1GNLA 2NXJA 5EXPA 3TQHA 3WJ1A 1ZFNA 3NBAA 1ISHA 1VPEA 2QRVA 5AVRA 3KQQA 2R2GA 3PITA 3KL4A 4UPEA 4CEHA 1IC6A 1GAJA 4MVJH 2C77A 1DAOA 3DZDA 2PRKA 4U7WA 3U1BA 2JZNA 1PZFA 4YT5A 1EFRA 5CHYA 3GEBA 2JCVA 4TV9B 3JAWA 2ZRJA 1BX0A 1MB2A 3H17A 1XEXA 3IV6A 3PLAE 1DJOA 1YB1A 3ITEA 2VYQA 2WPNA 1MX5A 5L4SA 5CB4A 2AMLA 3LHKA 4AJLA 5CR9A 5ALLA 1Y4UA 3KZXA 4JT9A 5EUCA 5FBZA 5GV7A 2MSLA 3R6LA 3B5JA 4KSBA 4KZKA 4EB8A 4I4TB 4X7BA 2AVDA 3OE1A 5EPUA 1DU4A 1YR7A 2GFIA 5ALXA 2E6UX 3L5KA 3QVOA 4DIEA 2BGKA 1USKA 2AWOA 5JPCA 3DEAA 5G41A 2VPXA 3SE7A 3IUQA 1JEDA 1OYWA 3DB2A 3LK7A 3HRKA 1UDWA 1CY2A 2GFQA 3EHEA 2XHZA 1Y4AE 4HZIA 4NULA 4CF3A 1ZUIA 1WZ2A 2HEGA 2E82A 3GAMA 5D87A 5B4VA 3GNSA 4OGKA 5K03A 2FSSA 3LJKA 4Z6KA 2VCHA 4M1WA 3G23A 2LWIA 4AS3A 1H94A 4YR9A 2P2CA 1X7ZA 1JRLA 2AD1A 1GFIA 3BQMB 1TUIA 4TZ6A 2E4ZA 1NJGA 5EKXA 4PPGA 3UB2A 3DLIA 2VWHA 1G4AE 4JEHA 4ZDKA 2OHHA 1UEXC 3CX7A 4U0JA 1FX0A 1NQVA 1R0LA 3JQFA 4YAWA 1YA6A 1QV9A 1MORA 5K8JB 4B87A 1U2GA 4IKEA 3WIDA 3IAXA 1EXMA 4FCCA 3DLTA 3TRKA 4C3ZA 5EKUA 3OT1A 4MS4B 4F1JA 4YYZA 2XUAA 5DNWA 2FB9A 2V1UA 1Y81A 2UZ4A 3GX1A 4TTJA 1CRPA 2GO1A 3ANYB 1B0ZA 2Q21A 1KOLA 4BLSA 4M9XA 2IXAA 1WXXA 2RGUA 3GVXA 5EIBC 4HDMB 1KNXA 3CBGA 4EMSA 5B3JC 4FOPA 3NH6A 3FVVA 3I9FA 4EO7A 3O8DA 4NZMA 1D5CA 5T3YA 4EEXA 4DA7A 1XOIA 2ZRIA 3LYHA 4OK6A 3ZQ4A 4EBBA 2GLTA 1IOWA 2CYAA 2P6NA 2PZ8A 4WOBA 2W98A 5T64A 3PQ2A 1SHKA 4WKNA 3MWGA 3PXXA 4MVJD 4ER7A 3PWKA 4LF6B 1A9TA 2HA3A 2VFAA 5DASA 4RDCA 2NAPA 3RAJA 3KQHA 2VHVA 1A3CA 3AYXB 2FXVA 3KTAB 1RLMA 5FOWA 2GN4A 3MOGA 2O48X 4MI6A 4Y9RA 5CIYA 4YK7A 4QUIA 5JFOA 2OR3A 1RLOA 4QL3A 4RW0A 2R7KA 5FUXA 3F4KA 5JY1A 1VPDA 1O6ZA 3HFJA 3HBFA 4Q4CA 4Z0HO 4L07A 4D8UA 3ETLA 1EDBA 1XI2A 3GRKA 4OV6B 4RV5A 3L7BA 3IV7A 4G3XA 4K9NA 3QUSA 3GUVA 1TADA 3PJDA 4RVOA 1X8LA 1GYRA 1DIBA