1ZBDA

Structural basis of rab effector specificity: crystal structure of the small g protein rab3a complexed with the effector domain of rabphilin-3a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
177
structure length
177
Chain Sequence
SHMFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGLERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RABPHILIN-3A
publication title Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags G protein
total genus 50
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zbdA00
5BYJA 1JXMA 1F2UA 2OV2A 1W0KA 4NP6A 3RANA 5JI2E 4HATA 4CYMA 4XD7D 4C0LA 1W0JD 4HB2A 1S8FA 2RHDA 2PZGA 3OHMA 3PFIA 2EW1A 4IXMA 5ELXA 2BBWA 3IBYA 1J7KA 2EWWA 4R7ZA 1SHKA 3OZXA 1F5NA 4DLWA 4Q7KA 5IHPA 3TMKA 1W4CA 3QJYA 2IL1A 1DADA 1E2QA 1UDWA 3RSOA 2O0KA 3SOPA 2GESA 3WYFA 2WJIA 1A5TA 1CR1A 2GJ8A 3HDTA 2OILA 2QTVB 2GILA 2KWIA 3U6KA 4N0EA 1OV4A 1RYFA 4M9QA 5JLJA 1YZLA 2QRNA 3LXRA 4MUBA 1OIWA 1G41A 1XFAA 2W6IA 4JVLA 5G3ZA 4XH9B 1W1WA 3GMTA 2JLYA 2PZFA 3M1IA 3VR1A 5JHGB 2FWRA 3GJ6A 4LBZA 3C8UA 1OT3A 2ZEJA 3ZLJA 1HTWA 4TMKA 1FMLA 4TT3A 2ZJ5A 4PPQA 4ZPXA 1BO6A 4Q18A 2BM0A 4K46A 4ERNA 2K5UA 2OXRA 2BBOA 5K8TA 1N6NA 1NLFA 1JECA 3Q7QA 3U7FB 3ZVLA 4JLAA 5KPJA 1DG1G 2FFBA 4AYTA 3U2QA 5DN6A 4B75A 2SHKA 1CJUC 1KKMA 2EYQA 3RRNA 2XOKA 1A82A 1AJEA 2QSYA 5KO2A 1W5SA 3GQBA 3DM9B 3QXCA 1E0KA 2IXEA 3UPUA 1VCNA 3A1VA 1HURA 3A58B 1XB2A 2GZDA 2FG5A 2YC2C 3A4NA 2OBLA 3LAWA 3G82C 5LBIA 1IN4A 4PANA 5C4MA 3U44A 3JZAA 1IJFA 3OAAA 2DB3A 2IYWA 1YRAA 3CKLA 1UADA 4QJ5A 1X8JA 5BW8A 2VTKA 1WDTA 3KJEA 1Z08A 4GDFA 1KSJA 2VL7A 1M34E 2IA5A 3ASYA 1UKVY 2J45A 2QM8A 3BBPA 3QPWA 2VIIA 1HE8B 2AWNA 3AF3A 4BZXA 3TW4A 4YDSA 3TSOA 5FL3A 2OFWA 2TMKA 4C7OA 3NBFA 1D6JA 1IOZA 3GJ3A 5KDLA 3TVDA 1COWD 1G5TA 1OFIA 4Q9IA 1T6NA 3H84A 4GPTA 2BWJA 3NH9A 3SU8A 5B57C 3NKVA 1UFQA 3AKDA 3N2IA 3AVUA 1ZM9A 2IYRA 1ZRHA 2R6DA 2G0TA 2BKEA 2CLCX 4JVSB 3MG9A 1E2DA 2BMFA 4EPTA 1N0VC 3AF1A 1EG7A 5FTMA 3SJCA 3VX4A 1U8ZA 1US8B 4ON9A 2WOJA 2IEZA 4GI7A 4TWZA 2FA9A 1U0JA 3GJXC 4OK6A 3AH8A 5CM8B 2C77A 3UATA 1WP9A 4JL6A 4IVPA 5J5CA 5CB8A 3A1TA 2PLRA 4LJ6A 1NBME 4LI0A 2R65A 3IQWA 4PC7A 5FI0B 1Q22A 1G3RA 3QG1A 3CM0A 3ZVMA 2WJHA 1GDDA 2IEYA 4HAUA 4KYIB 4P4TA 3NIBA 4BE7B 1WMSA 1ZP6A 2IYQA 1CJVC 4GT1A 2WVJA 2KBEA 3BD9A 2BBSA 2C95A 4LJ4A 2GK6A 1OH8A 1KI8A 3ND8A 3NHBA 1KNXA 2VSOA 3EASA 2YOFA 2GEDA 4EUNA 1NN1A 2ZE6A 2A5YB 4TTQA 1WB9A 3CRMA 3TLXA 2QBYA 4NZYA 1XEWX 1KJYA 2F1RA 3HWSA 4Q02A 4RSGA 3UMRA 5FL7A 3ZS9A 3ZD7A 4FCTA 2VA8A 5EXTA 3ZQ6A 2XTNA 3BRWD 4CVNA 4IW3B 1SVMA 4URZR 5JS8A 1TEXA 4E09A 3ZIAD 1HEIA 4CIDA 1Q12A 1NIJA 3MMPA 2J0UB 4ZCMA 2XGJA 3WYAA 2NMVA 1U99A 4WXRA 1P73A 3TAHA 2ERYA 3PUWA 1XCGB 3ASZA 2O8FB 1HH4A 1U0LA 3W5JA 3PEUA 1OF1A 4W5WA 3RABA 1X8KA 4PAMA 1O87A 2JDIA 3I1FA 3P27A 4LV6A 1T9HA 4EPXA 2KI5A 1KIMA 2RGNC 2J5XA 4IRUB 2ZSFA 2GCNA 3N70A 2QGNA 1P7CA 3UMFA 1NF3A 2GEUA 2FFHA 4NDZA 2VP0A 4GOJA 4IFEA 1LS6A 5EZ5A 3EZFA 3DZDA 3TUJC 3OIUA 1PUIA 4WZAE 1NBMA 2ZJBA 4BEBA 1QG2A 3DM5A 2D2FA 2QT0A 4PSAA 5UKDA 1MABA 2FSFA 3OEED 2AN9A 5M04A 1UKYA 2QN6A 3KUDA 2EFDB 4M9XA 2XEXA 4UXJA 3ND9A 2CMKA 4HAVA 5FBWB 1RRCA 5KNCA 4KJZA 3WHLA 3F0TA 3QXHA 4K8OA 1NVVR 4IJMA 1VTKA 2JJ2D 1T3SA 2NO9A 2QORA 1JB1A 3ZS8A 3ZYCA 2H17A 1E6CA 1T5LA 1U90A 2A78A 1HUQA 1SKYB 3PQCA 5KNBA 5EE3A 3TUZC 4KLNA 2QMEA 4IKEA 3B78A 2PMDA 2UKDA 2OESA 1RJ9B 2NG1A 4IEEA 3OIVA 1F6BA 2IW3A 1S96A 3EPJA 3FVQA 3AVOA 1II8A 2ZI4A 3LD9A 2GEVA 4Z8YA 1FFHA 4JLNA 5EXXA 1CXZA 1TQDA 5HPYB 2RGNA 3IUYA 1AQUA 2H5EA 4QJ3A 4M9ZA 5LB4A 3WMFA 2IHBA 1CU1A 3EA5A 1M7GA 5SZHB 4YMUA 1IXSB 1GKUB 3RRZA 1P3JA 3A4LA 3O8DA 1JAIA 3IEVA 4O2LA 2DFNA 4WIAA 4M2LA 2J41A 3FE2A 4DC9A 1E2HA 4KBGA 1IJEA 2QUZA 4TLEA 3VFDA 2IXGA 3C5CA 1OKKA 1E1RD 4JS0A 4PC2A 4O2RA 3CB4A 4Q1CA 2MSCB 5TVKA 2ANBA 5E7JA 3TJZA 2CJWB 4TLAA 2QMUA 2QT1A 1L4YA 1E79A 3X1XA 1CULC 4YXWD 4QBHA 1H8HD 4KVAA 2Q3MA 3CF6R 5EQTA 1RRGA 3P32A 3DZ8A 3LVRE 2ZYWX 4LBYA 2ODEA 2OE2A 1XJCA 2OLKA 1EXMA 2P5SA 1WA5A 2GWHA 2IBMA 5FUXA 1SULA 5KYKA 2N1BA 4FN5A 2EFCB 1ZUNB 3A8TA 4KI0A 5JRJA 3T5DA 1G18A 4A0HA 4YONB 2ZVPX 3PUYA 1A2BA 3ZZTA 1OXTA 4DUGD 4D80A 1WBDA 2VF7A 4KVGA 3AKYA 1XD8A 4Y0AA 2J3EA 5IDVA 2KSQA 2YWFA 1EWQA 1BIFA 4XD7A 3K8YA 5DI3A 1W0JA 5CK5A 5GJVC 2WWGA 1QHYA 1PLJA 4IOMA 4RZ3A 3AKEA 5TV2A 3R9XA 1T0HB 1LV7A 3W6PA 4E07A 3OF5A 2XX3A 4ZIRB 2FMXA 3E1SA 4H9GA 3T1TA 4Q4JA 1XCMA 4URWR 1E2JA 3ZJYA 1KY2A 2YVUA 3AGPA 2CVFA 3BH0A 3UXMA 4WBSA 4LPSA 4EPYA 1UAAA 5EXSA 4BFSA 1E2IA 1EFTA 3EG5A 3P1JA 3TRFA 4YQFA 4IVQA 4TMWA 2DBYA 1W47A 5EUQB 2B7BA 5TARA 3I72A 2VP9A 4FWTA 3W6NA 4B74A 4UJ3A 4MKGA 1FPMA 4V0ME 1W0KD 2P5TB 4FWIB 1Y3AA 4BUJA 5IRCD 1ZIPA 2GAOA 2IS2A 4Y0VA 5DE3A 3A1WA 3QEJA 1NJFA 4Q7MB 1EX6A 1BS1A 3TAUA 4UNQA 1Z29A 4WZBE 2JIZD 4ASUD 3DOFA 4PHHA 1NSFA 1OXXK 6Q21A 1UBCA 2EFEB 1TEVA 2YWEA 4H1VA 2OM2A 2F1HA 3AGQA 3AVVA 4A15A 5EJEA 3K1JA 3NXSA 4G0NA 4KFTA 2XZOA 4HI0E 4LHWA 4PTLA 3BGWA 4DLZA 1KK0A 4GOXA 1UDXA 3NDPA 3B13B 4B3DA 3LDAA 2HXSA 5CJPA 1E2GA 3GFPA 3MCAA 2BJWA 5CITA 3BC1A 4PQRA 2ZU6A 2Q9CA 4Q01A 3K70D 5HE8A 2JLQA 3Q5DA 1XWIA 3QEOA 2ZYUX 4M1TA 3RYTC 1QHHA 2OAP1 2ZVQX 3GD7A 2YNMA 1Z5ZA 4A6PA 4DT1B 4E5UA 3A4MA 4JJZA 1R7RA 2ZAOA 3SJAA 4KV9A 1Z2CA 3TUIC 5CIQA 3T15A 2FPKA 1U81A 5EE0A 1T3LA 1NIPA 5F9HA 3DEFA 1TF7A 4AC9A 1Q1BA 5L8VA 4JLDA 4HUQB 3L2OB 1TADA 1JALA 1QRAA 1FZQA 2ZI7A 3IHLA 4B6FA 2WICA 2XTZA 4V0MA 2ZRAA 1OSNA 1DPFA 4MRPA 1XXHE 4BLPA 2ZE7A 2B92A 1COWA 4KSBA 2PJZA 5E3HA 1XPOA 4UXHA 4WVFA 2PEZA 4B3XA 1R0YA 5B2ZA 2IYXA 1TAGA 2MMGA 4PQFA 3T1OA 4NKRA 4PPNA 1JXOA 1R5BA 1KGDA 2GRJA 3VU9B 2LKCA 4ZV4A 2DPXA 2WIBA 2CVHA 1FX0B 2WOOA 1G3QA 4MRVA 3GLFE 1DARA 4CF7A 4EQ6A 2ZRIA 4B3CA 4TMXA 3GLHB 3IIJA 4LHZA 1ZNZA 4B3BA 3CF2A 4M1WA 2F9MA 2PBRA 4C0AC 4TYWA 1Q57A 1PZNA 3KXLA 4U7DA 4FINA 1JQJC 2F1IA 2ZJZA 3TR0A 5DHAA 1A1VA 2JATA 4NE2A 4AG5A 4YDHB 1GNPA 1G291 4C0HA 4ZDIA 2O8BB 4RJLA 2WWWA 2AWOA 1WF3A 1GNQA 2WIAA 4ACBA 1FW6A 1GRNA 4B33A 3PUXA 4N0DA 5HZHA 1U0HC 2GJ9A 1R5OA 1V5WA 1ZD9A 1ZCBA 2IYLD 2R9VA 5HZKA 5GJCA 1GNRA 1DAMA 4I99A 2JA1A 2ZIAA 1CRPA 3UG6A 3BH7A 2RGBA 1ZMXA 1GM5A 3CO5A 2W2TA 4Z54A 1KSHA 1F2TA 1R4AA 1N6KA 2AL7A 2V1XA 4US1R 2VP6A 1Z2AA 3K9LA 3VAAA 1HQCA 5DSZA 3FOZA 5G53C 4PO1A 3ZIAA 2EFGA 5B64A 4TLCA 3TSZA 1HT2E 2O52A 4KXFB 4P0TA 2VHQA 1JPNA 5ANRB 4EIWA 5BN3A 3X1DA 3FDIA 4JIMA 1ESMA 5FTJA 1FUUA 1AK2A 1N0UA 1U9IC 3D7MA 3QKSB 2ZYVX 5EP1A 1KJZA 2D74A 2Q21A 2WKRA 5AK0A 3GLFA 1G17A 2GXAA 3ETLA 4Q00A 1UPTA 4R2HA 1T8TA 5LD2B 1Z06A 3LLUA 4GP7A 3S1AA 2QQEA 5FL7D 4A0GA 2QTFA 4QBFA 3H4MA 4OQMA 4OQFA 4IDHA 3T12A 2DYKA 3HR8A 1G8GA 5EP2A 5BN4A 3OEEA 4CEJB 2PX3A 2ZXUA 4IOLA 2RKOA 4PZLA 1E0AA 2VEDA 3L43A 2BMDA 4U00A 3RSLA 5FR2A 1Q0UA 3SQXA 1W36D 2H18A 2YOGA 3ZDQA 2REXB 1E1QD 2JJ2A 3EZ6A 2JJ8A 2Z43A 1P2TA 3VHXA 1KZGB 4HEJA 4UNSA 1NKSA 2ZJOA 3LBIA 2BKUA 3OE7A 4D0NA 1OPXA 2ASEA 2CCJA 4CW7A 1R8QA 5CB6A 1R2QA 1Z0JA 4TMZA 3Q7PA 2AK2A 3EIEA 2YWGA 3RWOA 4JT4A 1JQLB 4QBGB 3O47A 1NMXA 3EX7C 4D4LA 2JEOA 1U9IA 2QY9A 4K81B 3IO3A 5TDHA 2VHUA 3CBQA 1CKEA 1XTQA 2C99A 2WAXA 3T06B 2CHGA 2IYYA 1E69A 1QG4A 5TB5A 2PL3A 2HYIC 1ZD8A 3UK6A 2WWIA 3K0FB 4YMTA 3EPLA 4D81A 3O8CA 1AKYA 4D4KA 2VHJA 4FI3C 3LVQE 3B60A 2ZM5A 1GRQA 2ZRHA 1VIYA 5J4HA 3V4RA 2OT3B 1U98A 4BWYA 3AVPA 4B47A 3CWQA 1ZINA 1KKLA 2WSMA 3AVWA 4OHXA 1E1RA 3GLIE 1VYVA 2CHQA 1UBGA 4F93B 5FOTA 1OB5A 1E4YA 3JZMA 3DKVA 3NH6A 2HYDA 4P4SB 4A0FA 5D3QA 4ZI3A 5KDDA 2A2ZA 3OEHD 1JR3D 2HJGA 1AZSC 4YLGA 2W0SA 1G7TA 1EFUA 4RD2A 4JKYA 3QF4A 3B1VA 1DAHA 2ANCA 4NYMR 2CL6X 4GL2A 2UZ3A 4EJSB 1WCV1 3U3JA 3K09C 5JMTA 2QQ0A 1UM8A 1QF9A 4OQNA 2IYVA 4PR0A 4JMPA 1Z28A 1NVWQ 2ZSBA 2ZS7A 1NVUQ 4Q19A 1CRQA 4GNKA 4QRHA 3K0CC 4DSTA 4C0BA 1KO1A 1E9CA 1T0JB 4AKIA 4W7SA 1XEWY 2VP5A 2ZRNA 3MJRA 2XB2A 3KXKA 2J46A 2FV8A 2QM7A 1PUJA 4JBYA 4N3NA 3K0AB 4FMDB 1JPJA 2R6AA 3THXB 3HU1A 4NCIA 1G19A 3SHWA 4HUTA 4Q4HB 2HT6A 4GBMA 1W48A 1ZUIA 2Z4RA 4MKHA 3QF7A 3U7GA 3THYA 1DO2A 1L2TA 2Z4SA 4G3XA 2V9PA 3K70C 2PT7A 2ATVA 4D4JA 3QKTA 2EVWX 1Q3TA 3RC3A 3K9HA 1W7AA 3SE0A 2Q9BA 1KY3A 3BFXA 2ZS9A 3LQQA 4UXIA 4B3GA 4URYR 1ZBDA 1LB1B 3T34A 3EIHA 4B35A 4V0KA 3GFTA 1P5ZB 3GLIA 4US2R 3KTAB 4DLRA 2B7CA 3A1SA 3I62A 4EDHA 1T4GA 2A3RA 4E03A 2IX3A 3GEEA 2JIZA 1LVGA 4ASUA 1P9RA 4KAXA 2QI9C 3HPRA 1SXJB 2MSDB 4HAXA 4TQ9A 3BORA 3K0CA 3K0EA 2G0NA 3WNDA 4LYFA 1OW3B 3FGNA 1G3IA 1J8YF 2ZRCA 1U2RA 1V43A 1KMHA 3E5HA 1AGPA 1J70A 2ECKA 3KQKA 1E94E 1DELA 4MITA 3UG7A 1KI3A 4B48A 1NMZA 4MKIA 4LJ8A 4Q21A 4DCVA 2CL7X 2J7KA 2QL6A 3TR5A 3CLVA 1CLUA 1R0XA 5J4KA 2DWQA 1QHSA 1XJ0A 3CF0A 5E4FA 3ADBA 1FQJA 3VR5A 1G1MA 1OLOA 4UQOA 4ITRC 3I61A 1G4AE 2CBZA 1NVVQ 2OSBA 3NTUA 2YYZA 1MO3A 3U5ZB 1E9AA 2FGKA 2AD5A 4I4LA 2XJ9A 2XXAA 2OHFA 2P6RA 2WKPA 1G5PA 3GLGA 4L8GA 2JLVA 1II9A 4V0OA 1CTQA 1YZUA 1W5TA 2NO7A 2W58A 1DS6A 3DKPA 4IDNA 4ACAA 4MQBA 5IF9A 1TQ2A 4V0NA 2BVNA 5KDOA 1TUEA 4NPHA 1N0WA 4JVMA 1X8LA 5KPDA 3NVAA 3I73A 3KB2A 2J1LA 2V6JA 4RVCA 4A8JB 4WZ6A 3ZZ0A 3VR4A 4C0JA 3DPUA 3TGPA 2OEPA 2NGRA 2GCOB 2VP2A 3C16C 2IK8A 3L0PA 3CZPA 2JLXA 2GK7A 3W8NA 1GRRA 1CF4A 1R5NA 3BK7A 5E95A 2GTPA 4NHOA 3RAPR 3L82B 5AUNB 1UF9A 1EESA 3EPHA 4CT4B 5JCPA 4PX9A 1PV4A 1Y63A 4Q9JA 2GF0A 2O8EA 1N3BA 1NG9A 3RNLA 3PR1A 3AUYA 2ZTSA 2HT1A 2GXUA 5JZVA 4F7WA 3FFAA 1XRJA 3TVTA 5KSYA 1L7VC 2QGZA 1SVIA 2QMOA 3BERA 1CBUA 4C2UA 1XXHB 1Z6TA 4YMWA 2PT5A 1KJWA 2O0HA 3QKRA 1ZD1A 2DCUA 2X8AA 5GVSA 4RFSB 1JEDA 2AKAB 4RFVA 4NONA 4EKDA 4ARZB 5AJXA 1I4DD 4QHSA 2ONKA 1GSIA 4OHVA 5FOXA 2NO0A 4BFYA 2FDCA 1E2NA 1G21E 2QE7D 3AF0A 5F98A 1LW7A 1JEEA 4KITB 3L0IB 4CEIB 3NHAA 2QAGB 4B44A 3F8TA 2ZRGA 1W46A 3LBHA 3PEVA 5FPTA 3EA0A 1W36C 1CJKC 1SVWA 4QNMA 4XIGS 3A37A 5D3MA 1UJ2A 1E2KA 1KK1A 1YU9A 1KTVA 4UNRA 5J4VA 1XEXA 1NLYA 2CDNA 2ZJ2A 4CEHB 2O8CA 3VNUA 3IEUA 3TNFA 3LRPA 2WWHA 4HZIA 4QGFA 4F92B 2IWRA 2C9YA 2VYFA 2R6GA 2RB4A 3E70C 2A5FA 5FBLB 4TYYA 2KB0A 2GZAA 1G9XA 3N5CA 3KKNA 1G6OA 4OK5A 2CK3D 4U02A 4B3FX 1VHTA 3CPJB 3CZQA 1VMAA 2JJ1D 1JBKA 2ZI6A 4F4CA 4URVR 4A4DA 4I1UA 4JZKA 2WWYA 3FFBA 3OESA 1RC8A 4DLSA 1PLKA 1DAEA 2AR7A 1JR3E 3AV0B 4JT2A 3QUSA 4PAQA 3TE6A 2QMHA 3B8HA 4R2IA 1KYIA 4HLQB 4HZUB 1ZJ6A 1Q1QA 1E9RA 1IY0A 4Q66C 3W9YA 1FUKA 4NTZA 5L3QA 4TZ0A 2RGEA 1JJ7A 5L3SB 1XMJA 1BYIA 4Q48A 3SHFA 2EQBA 5JJIA 1GITA 3AVTA 4G01B 4HLDA 4LPKA 1LF5A 3K0SA 3AEZA 1NG1A 1E98A 1KDRA 3CPHA 5JSZA 1LY1A 1E1QA 5DIFA 3SQWA 3QPUA 2ZE8A 3RS4A 4XVQA 1E2EA 2J0QA 2ZSDA 1JI0A 3CONA 4QG7A 1NRJB 2H8KA 3GEHA 3KKMA 3FWYA 1KI2A 3H0KA 5LD2C 2BIFA 3U3RA 3Q72A 2FSHA 1GKYA 2VP4A 1N6HA 4JSYA 4EPVA 1E9SA 4C2TA 3PENA 1R10A 1IBRA 4FCWA 4BZQA 2RGDA 3P4YA 2OUKA 4PSKA 3FMFA 2P3SA 1B0UA 1NSTA 1SVLA 2C78A 4QKQA 2NO6A 4ZO4A 3CH5A 4GZLA 4QGHA 4JVNA 4M22A 1GWNA 3EZ9A 5KSPA 4D2IA 4DKXA 4G5GA 4PC3A 4TLBA 1KDTA 3OE7D 1XZPA 1OXSC 4DCNA 2FH5B 3TQFA 1JJVA 3WXMA 5FUYA 4D6PA 1Z6XA 4A36A 1ODFA 1OXVA 3U4QA 2F3RA 3LWNA 3V4FA 3R7WB 3OFND 2YV5A 1E9DA 1FOEB 3MD0A 3OEHA 1JR3A 3THWA 1FMJA 3D8BA 2G1JA 3DOEA 4XWKA 4RZ2A 2ZYTX 1N25A 1Z0FA 2R44A 4F4IA 1S9HA 4HLCA 2OXCA 2V7QD 1IM2A 3LW8A 3JVUA 4IXNA 1FNNA 1E2LA 1OIXA 3B2EA 4GRAA 1YHNA 5CM9C 4NMMA 1IY2A 2O8DB 1G3MA 3KQNA 1GL9B 2QAJA 4BFXA 1F2UB 2YZ2A 5CLQA 2X2FA 2DFTA 4EPWA 2WJJA 2GBLC 5GJBA 1YKSA 1VHLA 2RGCA 4A1FA 3QVUA 4I1SA 3VR3A 2VPPA 4M1KA 5FOSA 5G3YA 1KI6A 1NKTA 3QXJA 4LZZA 4LSGA 1GOTA 1UKEA 3P4XA 1E9EA 4OBEA 4TL8A 2DFKB 3ZZUA 2AKYA 3BFKA 1VG8A 2V1UA 3U3OA 3NC1C 3SS8A 1KO5A 3QE0A 4V03A 4JYBA 4FCVA 4C0SA 3IKJA 1NN0A 2ZANA 4EJSC 4MUAA 1WQ1R 1IQPA 2HF8A 3WRXC 2RGAA 1PLLA 1MT0A 3GP8A 4JJKA 2C5LA 4Q9LA 4GMDA 2DWPA 1G8YA 3LLMA 5C18A 4X8LA 2A5JA 2F43A 4V02A 3ZD6A 3VKHA 2GAAA 1VCMA 3FPAA 1U8AA 2JLRA 4KO8A 1Q1ZA 4KLZA 2WM9B 5JWHA 4CT5A 4DHEA 2QG6A 4URUR 1YR7A 3LBNA 1T91A 2PLFA 3CIOA 5JFGA 4EFLA 4Q4AA 2G83A 4QGGA 4JLOA 1XD2A 2GBLA 4XSHA 4KFSA 4X8OA 1DBSA 5JRZA 4DBLC 3KJGA 2ZUDA 4KHZA 2D62A 1Z6AA 3SDZA 2V4ZA 4OK3A 1E9BA 4Q1BA 5A4JA 2OBMA 3R8CA 5L3RA 1E2MA 3GJ7A 4FW9A 2HV8A 4OJQA 1CR2A 3PUVA 4Z8XA 5EP3A 1ZUHA 4OQLA 4DJTA 1MV5A 4EFNA 3ECCA 2Y8EA 4RZUA 3U44B 2BJVA 1CJTC 2WZQA 2YJTD 4JLJA 4TTPA 1KK3A 1IXZA 2GNOA 4L5BA 1M74A 4DCUA 2HXYA 2YOHA 3NEYA 2D4HA 2GXSA 4W5HA 1QDEA 2IS1A 2Z0MA 4WXPA 1SXJC 2BV3A 2ZSEA 2RMKA 2WAYA 1EFRD 3REFA 2DWOA 2ZR7A 3VQTA 1DO0A 3KKQA 5CIWA 4C7OB 3TK1A 1N6RA 1FP7A 1S0UA 2EU8A 3FYHA 1QHXA 3IPXA 3MRSA 4U5XA 2ONJA 1UBFA 4LHVA 4TYNA 5KTYA 5JS7A 5C1BA 3AVYA 1DAIA 3OIWA 3PG5A 2N46A 2W0MA 4Q4LA 4AWXA 1P9WA 1X1RA 1OIVA 2CNWD 2XSZD 4MGKR 1P72A 4BLQA 1NL3A 2GF9A 3QG5A 5FBRB 3R9WA 1LTQA 4UNPA 1I2DA 2HEIA 4C0QC 1F3OA 1Z3IX 2OCPA 1ZU4A 2Q6TA 2QPTA 3BXZA 5FBQB 3BOSA 3GJ0A 3QKUA 2PCJA 3NG1A 1G4UR 2WMOB 3KJHA 4HDOB 2AFIE 3L0OA 4L4UA 3EZ2A 1QZXA 3I4LA 1K6MA 4IOKA 721PA 2X19A 2ZRBA 5FUVA 5J47A 1QVAA 3SR0A 1KO8A 1VDZA 1M2OB 2P6UA 1KI9A 4NYMQ 4BFTA 2PZEA 1CJMA 3B1YA 2NTYC 3A36A 1YRBA 3ADCA 2R2AA 1O3YA 3CWZA 2KJQA 3PJRA 1XPRA 4HAYA 5AJYA 2A5DA 4LGMA 4C0KA 1Z0DA 2GKSA 4HB4A 4MRRA 2QE7A 2QBYB 4QGAA 4B73A 3U60B 3CNLA 521PA 2L0XA 3N2EA 4LJ5A 3WHKA 1ZC3A 2JCSA 4LC1A 2FEMA 2ZRDA 1OJLA 2J7PD 3WBJA 1ZCAA 1XF9A 4A2WA 4OHYA 2ZRMA 4DEYA 2QPAA 1Z6GA 3NBXX 1IHUA 3SJBA 3CR8A 3BWDD 4GFDA 4P31A 2BMJA 3CNOA 5AJVB 4ZCIA 1R8SA 3NDBB 4LUCA 1XZQA 2R8RA 1T8UA 1NN3A 4URXR 4PPFA 2IC5A 4W5JA 1U94A 2ZITA 3LXXA 1EFCA 4ZKEA 5HR5A 4TL7A 5HKKD 3QOFA 4PQYA 4ILEA 1TPZA 2I3BA 5AWFC 1KAGA 5F9FA 2CK3A 1GG2A 4MRSA 3HYTA 1TTTA 2C98A 4L15A 2Q0HA 5A5GA 5KUTA 2JJ1A 4AG6A 2AK3A 1IAQA 2LCFA 1HQYE 3BS4A 4LV8B 1MABB 4NL4H 5LB2A 3C5HA 3CR7A 1ZYUA 2PH1A 4KFRA 5DYIA 3RHFA 1SVKA 1FTSA 1TNDA 4LK2A 1R6BX 1GIAA 4DLTA 4YMSA 1ZAKA 3IHWA 1Q3HA 2OCYC 4B6EA 4MRNA 1XTSA 4Q1AA 4ZDKA 2NPIA 3BE4A 3LX5A 3QBTA 4RCZA 1XTRA 1MO6A 2OFXA 1P2UA 3PITA 1JR6A 1G20E 1KZ7B 1W4AA 1N5IA 1KOFA 3T1VA 2XAUA 1F48A 1M1YE 5FH9A 1YZNA 1QHNA 4TL9A 4D0LB 3T61A 3EAQA 4L16A 1N5LA 3BIFA 621PA 2H92A 2GA8A 2QRZA 2X77A 3ICQB 5JECA 4AYXA 1II8B 2JAQA 1YJ5A 3CRRA 1U8YA 3D31A 3UMSA 2JLWA 2IWHA 3TW8B 4GOKA 5FI1B 1XCPA 4OJKA 2IUTA 2WJYA 3NBZC 1US8A 2QU8A 4BPBA 2YKGA 4AKGA 2F7SA 2FE4A 4LYAA 2PEYA 3LV8A 1H8ED 2H7VA 5JHHB 4IVRA 1KI1A 1RIFA 3EWAA 3T1QA 2XZPA 4AI6A 4POAA 3EIQA 5BQ5A 5KHOC 5JCZA 2I1VB 2OCAA 2BHRA 3BFVA 1GVNB 1TL7C 2OBNA 1LNZA 2RAPA 1E2PA 3BB4A 3VR2A 3EW9A 2Q3FA 4LOAA 2F55A 2JLSA 2KBFA 2CCKA 3OIYA 4C3ZA 1RW4A 3OFNA 3DL0A 1RPZA 1G7RA 2B6HA 4XOIA 2REOA 4F38A 1YQTA 3ZQJA 4AD8A 4EFMA 3I32A 3KJIA 1MH1A 3PVSA 4UNNA 3LY5A 2WV9A 1BKDR 3AP1A 4F91B 2ZR0A 8OHMA 1E3MA 4GMXA 2V7QA 3B1ZA 3HR7A 1GL7A 1AN0A 4DLYA 4DEXA 5P21A 4IDOA 2FPMA 2ZREA 121PA 5AJZA 2ZU0C 2PJRA 1SKYE 3KXIA 1NJGA 1XMSA 3Q5EA 1XJQA 3QBVA 3IO5A 1N2CE 1SKQA 5C4GB 3MJHA 5DI3B 3KDSE 3CRQA 4IOJA 1QBKC 4KODA 3W8RA 221PA 1GFIA 3NEJA 2J0UA 1ZM2A 1IY1A 4Q4JB 4QBIA 5B30A 5CK4A 1WBBA 4AKHA 3C41J 2G6BA 4D25A 2IUUA 1A7JA 5SZKB 2O8FA 1MKYA 4FMCF 4B76A 2ODBA 2IS4A 5DISB 3B6EA 4ZDJA 3SYLA 1AIPA 1HE1C 1GKIA 1YZGA 2ORWA 1VYUA 5H1YA 2ZAMA 4HYYA 4LC0A 2ZRFA 3FHOA 2J9RA 1ZVQA 1G3UA 4NYJR 3EC2A 4CZ2A 2W6JD 2E9SA 1W4RA 3F3YA 1VYTA 4A82A 3RC8A 2QP4A 1VKJA 4RY2A 3SZRA 5CLLA 4GP6A 2A5GA 2V8OA 1DVRA 3B1XA 3WMGA 1VCIA 2FZ4A 4X8MA 3L8YA 2REBA 1X1SA 2ZUCA 1AKEA 2BM1A 3CUEF 2AD1A 5AJWA 2JLZA 3GFOA 2HCBA 2NZJA 4G5SA 1RZ3A 1EGAA 1H65A 2HF9A 4GSYA 4HAWA 5GJWC 3HYRA 5EE9A 4OHZA 4C30A 3SNHA 2W2XA 3QI2A 3GLGE 1TU3A 1N6PA 2XB4A 1G7SA 4M21A 1YZQA 1HA3A 1RE0A 2Q3HA 5EE1A 1K8RA 2QPOA 3QQ5A 4DSUA 4DZZA 4PO8A 4DB4A 1XTJA 2J59A 1Z0KA 2FPLA 4LRWA 1RJ9A 4LJYA 1CR0A 4J0QA 3H86A 1IN5A 3RS5A 4BFWA 3BB3A 4B43A 4ESVA 2CHVA 4B32A 4RKEA 5LPNA 2QROA 1QHHB 2VHTA 5KNDA 3O8RA 3K09A 5KOYA 3G0HA 4M1YA 5FBVB 1TMKA 3WP1B 4AK9A 1AQYA 4RD3A 3EPKA 5CYPA 3U7HB 2P6NA 1A2KC 1TQ6A 1BH2A 1OFHA 4S2EA 2BDTA 4JBXA 4LCBA 1G8PA 2O5VA 5FTKA 1FTNA 3E2IA 3AP3A 4UJ5A 4TL6A 4WA7A 3WRYC 4PHGA 2CL0X 4YC7A 2RCNA 5F2EA 2WWFA 1OH5A 1UKZA 1EFRA 2YHSA 1EWRA 1KDOA 1E0JA 4RD1A 3FMIA 4L9SA 4RZXA 2YINC 3U6BA 2CLSA 3MSXA 5GADl 4AKEA 3FHCB 4NCHA 4PZYA 2CJWA 1J8MF 1D2EA 2BEKA 1N6OA 4O25A 3GJ4A 2QP3A 3MWJA 4NCJA 3SBEA 4MDEA 2C03A 4NYIR 2CNWA 2XSZA 1OB2A 1ZC4A 3F5FA 4G5RA 4US0R 4KSCA 1MOZA 2HCJB 4DDTA 4II7A 1DG3A 3KQLA 5EZ6B 2FGJA 3X1ZA 5J4LA 4EQ6B 3MLEA 1BOFA 1AZTA 4LHYA 1OFUX 4Q5IA 2WJVA 4S35A 1EX7A 3GEIA 5DGXA 2J0SA 5BN5A 2ODNA 2AXPA 2IXFA 2ZRJA 4QHYA 4DCSA 4KYUA 2G88A 1E9FA 4OI4A 3CW2A 2ODWA 4Q9HA 2VQSA 1X6VA 3BAFA 5FOUA 4OQXA 1W2HA 4JLBA 1W2GA 3Q3JB 4ZIRA 2R62A 4XJXA 2AHOA 5FOVA 3R20A 2FSGA 2J87A 2E1RA 4TYQA 3PUZA 4B71A 4QM7A 2O0JA 2FEOA 2BC9A 5G40A 1SHZA 2EFHB 1GP2A 3A6PC 1EFHA 2HJVA 1CS4C 1F2TB 4XWOA 1M8PA 3BB1A 1S3SA 1ZW6A 4PAOA 2J7PA 1OXUA 3I92A 3IIMA 4OI2A 2ZI3A 4QOSA 3FKSD 4L9WA 2W83A 3HPQA 1R0ZA 1UEIA 3SFVA 2IYUA 3MWKA 2QP9X 5FPHA 4M0LA 1JNYA 4JLKA 1TUIA 2AX4A 1FL9A 2P65A 2V54A 2X2EA 2OO7A 3KKOA 4JLVA 4RD4A 4D0GA 3FHTA 3D6TB 1SXJD 3REGA 5BYKA 3HP1A 1TX4B 3K53A 5KSZA 5JEEA 2AFHE 3R9IA 3M6AA 2C9CA 3U3KA 1HY3A 3B5JA 5HKKA 3GLFB 2BOVA 4AYWA 3GLHE 1G6HA 3IDQA 3PEYA 3QVVA 1IN6A 1SVOA 3S1AB 1UBEA 4KFUA 1J90A 3KFXA 1P62B 4B34A 4I1VA 2BEJA 2IT1A 5K8IA 3CH4B 2MSEB 4FXPA 4A6XA 1P2SA 4V0LA 4MA4A 4HB0A 1OYWA 3VHLB 3WNCA 4Z1MD 3ADKA 3IILA 4NCKA 1ZM4A 5JEDA 3ONWA 4TSFD 4A2QA 4Z51A 4NBSA 3HJNA 2ZROA 1NNEA 4DT1A 4LYHA 1DAFA 2RH5A 4A2PA 3KB1A 3W3AA 2HLDD 4HAZA 4NU0A 3SI7A 3VNVA 1GAJA 5TMPA 2WMNB 1NLZA 2YWHA 4ESHA 1DAKA 4Q7LA 4EAQA 3M0EA 1RVDA 2A30A 2NOAA 1KHTA 4HUQA 3PXGA 4Q1EA 3IBGA 3MFYA 4Q1FA 5LDDC 1NP6A 3KL4A 3AP2A 1IN8A 3MAAC 1Q20A 3DVLA 5DNYB 3PEWA 4QFMA 3DHWC 3IQXA 1VG0B 3MWYW 3ADDA 1PVOA 3FB4A 4LV5B 1ZM7A 2XZLA 4JSTA 4HLUC 4TMVA 2RGXA 1YE8A 5DO9A 4CDGA 4O3MA 1YZKA 2FU5C 1LFDB 1XTIA 3I8XA 3RRYA 3VU9A 2HUPA 1Z0AA 5H68A 5SZJA 1FX0A 5FTNA 1H8EA 3K9GA 3GLHA 1GL6A 3VTKA 1KK2A 3WBKA 2LWIA 5DH9A 3UWKA 1A4RA 2IF2A 3KUCA 4D26A 1SVSA 1MO5A 1YVDA 1XD9A 1E2FA 1MRNA 1W49A 3VMFA 5HCIA 2ZJYA 2V6IA 5SZIA 2WTUA 4QXAA 2O8BA 4BECA 1R0WA 1YR8A 1HV8A 1E99A 3B85A 3TKLA 3WY9A 4B2PA 3QF4B 1ZM3A 5DLQC 4E22A 2HDNB 3LO5A 5IK2D 1XNJA 2CLDX 2OZEA 3U7EB 2C9OA 5B58C 2B21A 3QY0A 4I1OA 4Q7JB 3MUFA 4DB2A 5DYGA 4RD0A 2WPDD 3ZVNA 4Q47A 3HU2A 3KFVA 4LDJA 2GJKA 4ABYA 3UIEA 2BMEA 5KU1A 2JGNA 3T35A 4HLUA 4MGZR 3AF2A 2VO1A 5HTKA 4Q03A 1E96A 4CRWB 2PX0A 3THYB 4PZZA 2B8TA 4OI1A 2ZS8A 2Z6VA 4QL3A 2RHMA 2GCPA 2ZPTX 4MYUA 1SGWA 1NVXQ 4M53A 3AUXA 3DMDA 4M9SA 3ZVRA 4C4PA 2BCJQ 3U61B 3QKSA 1TF2A 1OE0A 2CE7A 2F6RA 2FFQA 3I5XA 5EP4A 2ZSAA 3KX2A 3AQ4A 1ELOA 4M8NE 3GLIB 3QNUA 3AVXA 4NCNA 4PSVA 4DXAA 1XBTA 4PXAA 1QHGA 4P33A 2W6JA 3U3MA 4CGZA 1K5DA 3RWMB 3X1WA 1WXQA 1KSFX 2P67A 4CEJA 1ZNWA 3EWSA 3V9PA 3WMEA 2IUSA 2LKDA 2P2LA 421PA 4UKDA 4TN1A 2GHIA 1C1YA 1RFLA 1D2NA 2B8WA 5JWRA 4JLMA 4RCYA 1CR4A 1RRPA 2ZJAA 5C2JB 5EUMA 1ZIOA 2H57A 1KMHB 4LYJA 4ZKDA 4XVUA 2WSSD 2ZRPA 2QSZA 3I5YA 2ERXA 1XU4A 2FZLA 3IIKA 3C15C 1OHHD 4X8HA 4EPRA 4OKSA 4C9BA 2A7QA 4ZCLA 2XNDD 3DDCA 5FFMA 4TMTA 3K70B 1N6LA 1II0A 4IHQA 3J81k 2NIPA 3UWOA 2ZETA 5K8LA 1XMVA 2QNRA 4XTRA 5EXPA 1RRFA 3VKWA 2UVQA 2IYZA 3H2YA 3SJZA 1HT1E 2ZQ5A 3EARA 4I81A 1Q1EA 3LH5A 2XXAB 1QVRA 3GLGB 2D7CA 1BMFD 3K0FA 4JL5A 4MGYR 2JLUA 4M1SA 2G9NA 3B9QA 3CRVA 1M7HA 3W6OA 3B1WA 2GVZC 3SC3A 2JASA 1VIAA 3BH6A 3EZ7A 5HE9A 3P20A 3Q85A 4G1UC 1TF5A 1KMQA 5EE5B 1IONA 4PO9A 4BRWA 5JI3E 3MWLA 2DR3A 1D2MA 2WHXA 1GUAA 3AB3A 4LBVA 4BLTA 2C96A 3GCGA 3V00A 2Q9AA 2V3CC 1S1MA 4O0MA 4P4SA 2X1VA 3A1UA 5JJKA 4DLUA 1L8QA 2FX3A 2VF8A 4JKIA 3JVVA 1CIPA 1SXJE 3FMPB 4PC6A 5AR1A 5FR1A 5H70A 5H8WA 1J99A 2IYSA 4EJSA 4FIDA 3DO6A 1XPUA 4TQUS 4BRUA 2O8EB 3TBKA 5J40A 4JBWA 2N42A 5FOWA 2I1QA 1S1CA 1MR3F 3P26A 3PV0A 3RVBA 1NN5A 2ZE5A 4Q9KA 1K5GA 1ETUA 821PA 3K0AA 2VH5R 1ZU5A 1IN7A 3QKRB 2MMCA 2GVDC 1XMIA 3NWJA 1FNMA 3THXA 2V55B 2E87A 3AVQA 2NQ2C 3RLFA 3PCRB 4PC1A 4Q4HA 3Q8XB 4BLRA 4D82A 1F60A 4QC2A 1N5JA 3HU3A 1XP8A 2C04A 4DCTA 1P2VA 4XSGA 4MDFA 3FTQA 3W34A 1Z83A 3TH5A 1KO7A 3MGCA 3EXAA 1Z47A 3AF4A 4WOPA 3K9NA 3KKPA 1G8FA 3GJ5A 2CE2X 2W6ID 5AUQA 1VECA 3LNCA 3X1YA 4BQSA 2GXQA 1DOAA 4PHTA 2F3TA 4MGIR 5D3MB 3FKSA 2D3WA 3KTAA 1GZSA 1NMYA 3RDPA 4DSNA 2F9LA 2CEAA 1XEXB 3Q9LA 1BYUA 2O8CB 4TT3D 4YMVA 1T5IA 4KU4A 2YC4C 1B23P 4TLDA 1DAGA 2VBCA 1SXJA 2W2VA 4A8JC 4KCGA 4G5OA 3WYGA 1XX6A 3CX7A 4M1OA 1KO4A 1S3GA 3UANA 3W90A 1C9KA 1E0SA 1QHIA 4HSEA 4LX0A 2G1KA 1YR6A 1CP2A 1AGRA 4NYJQ 5DN6D 1LS1A 4MKFA 3L8ZA 4BLSA 1GTVA 5AUPB 2XOKD 2PCLA 3G5UA 5BWMA 2F1JA 4TQAA 4JL8A 1YR9A 4LY6A 1AS3A 1TQ4A 4DIDA 1XTKA 1ZNXA 3RRMA 4Z1MA 2FN4A 3OAAD 1J2JA 4RD6A 4TSFA 5L3QB 2IF0A 2DY1A 4MYTA 4DVGA 3FMOB 1G64A 4PPGA 2A9KA 2HLDA 2C8VA 2J0VA 2ORVA 3NC0C 1W36B 3VR6A 3RS0A 5JSZB 2G77B 5CDFE 2BBTA 4ZDWA 1XEFA 4BZPA 5JBQA 4HDQB 2PMKA 4WAUA 2XTMA 3CRW1 3CX8A 3IGFA 4A92A 3VKGA 4JLPA 1NI3A 4LJAA 2WBLC 4IFBA 4LJ9A 2BCGY 5FTLA 5J4YA 4DDUA 1W44A 5A0FA 1KI4A 1D9XA 1I2MA 2QAGC 2ZI5A 3C7KA 1Z8FA 4IDPA 3GPLA 2NZ8A 4A8JA 2D7DA 3PIRA 2D2EA 1RYHA 4XVRA 4M4SA 4OHWA 2GCOA 4A9AA 4ZI2A 2G3YA 1AA9A 2IYTA 4KBFA 1Q44A 4A0RA 3O8BA 1G7CA 5BXQC 4G5QA 3CNNA 4LJ7A 2CXXA 2GJAA 3KQUA 5CYOA 4N1AA 2RGGA 4P32A 4F4JA 3LW7A 1X86B 1RKBA 2QTHA 3DMNA 3ZH9B 1DTSA 2NO1A 1ONBA 2QEQA 2WWXA 4PFSA 4BEJA 1XXHA 5FPSA 3WNBA 5KSOA 1AM4D 3CPEA 1TU4A 3CX6A 4NYIQ 3U4QB 2GETA 1KNQA 2Z83A 2UZIR 1T3HA 2VSXA 4RFSA 3SYNA 4ARZA 2FNAA 5HCNA 3THWB 3SN6A 4P4UA 2ZJ8A 4XTCS 4AURA 3QPVA 4W9MC 5GVRA 1E32A 1GILA 5IK2A 1KAOA 1W4BA 4MYCA 1ESNA 3I3SR 4QNRA 3SYKA 3THOA 1AS2A 2OLJA 5CDFA 4B2IA 4CEIA 2QAGA 1D8TA 2WPDA 3AKCA 4OL0A 2ZR9A 1I4LD 4R98A 4AIIA 4GZMA 1OYYA 3AM1A 3RS3A 1Z0IA 1EK0A 3L0SA 1KSGA 2FF7A 1KI6B 1P60A 2ATXA 5C46F 4AY2A 5FUWA 3EC1A 4CEHA 4OYHA 4QHTA 2VRWA 4RKFA 3ZGXA 3UKDA 2WJGA 3GJ8A 2WKQA 4DDWA 4QM6A 3W5IA 2GZHA 4FD2A 1DEKA 2GJSA 5TY0A 2D06A 1Q21A 2R6FA 4DSOA 4MH0R 2JDID 4JYCA 3R8FA 3I8SA 1XDBA 1ANKA 1P61B 2EWVA 4DLVA 1YZTA 2GDJA 1LF0A 5IT5A 1N6IA 4M1MA 4TZ6A 3FKQA 5F3WB 1ZNYA 2XNSA 5FPKA 1NBMD 4BFZA 4BLOA 2QENA 2F43B 4FMCB 4R71A 4WW0A 1P75A 4QJ4A 1Z22A 3QXSA 1Z63A 4DIEA 5E7IA 1MRSA 1C4OA 1P6XA 2IHYA 1P9NA 3RS7A 3C4JA 2OCBA 5DHFA 4HZUA 1NY5A 4BASA 2OG2A 5L3SA 1Z07A 4Q4AB 2QZ4A 5DI9A 1M6NA 4D4MA 4OI0A 2NPFA 3TQCA 4DDVA 1XD2B 2FJUA 2W00A 5K8UA 1UEJA 1NY6A 2DHRA 2VSFA 3QSYA 4H1UA 2WSSA 2H1LA 4Q1DA 5G41A 1WRBA 1Z6YA 2Z5FA 2ZRKA 2XITA 3WP0A 4BFVA 1FQKA 2ORIA 3D3QA 4HB3A 4LBWA 2P0EA 1OH7A 3QIAA 1OHHA 4IEIA 1VCOA 1L4UA 3C14C 2XNDA 4BFUA 3QENA 4YXWA 3KQHA 1H8HA 3ICEA 1P4SA 4BGDA 4XWAA 4P3YA 4B2LA 5AUOB 4HDCA 1DE0A 4IDQA 4LWZA 3LX8A 1G5RA 3LQRA 4TTRA 2AXNA 3SFZA 2ZUBA 2QA5A 1X3SA 3KZ1E 1S2MA 1CEEA 3TSWA 5TXGA 1VG9B 1FP6A 2ZRLA 3M4YA 1BMFA 2CCGA 5E7MA 1S9DA 4R9UC 1M7BA 3X2SA 4DWJA 3B82A 5L3VA 1VG1A 4DUGA 3LA6A 1IXRC 3QXXA 4PHFA 1OKKD 1OH6A 1VPLA 4NH0A 4LHXA 2KE5A 2IS6A 1AS0A 3VX3A 4DRZA 2XJ4A 2VLIA 2OAQ1 3NBYC 1S4QA 2DFLA 1E79D 4FMBB 2OFOA 1D5CA 3R7WA 1PJRA 3B7GA 1D9ZA 3RS2A 3SEAA 2VHCA 3LFUA 5CJ2A 4TYPA 1I4TD 3W3ZB 4DLXA 1WE2A 3IPYA 5FPYA 3B9PA 2ZI9A 3TIFA 1JAHA 1OFTA 2EYUA 3H1TA 1G8HA 1KDPA 2C2HA 2FFAA 4FMDF 1E4VA 3SBDA 5JWOA 1SQ5A 2R6CA 1SZPA 3BJIC 3T5GA 1HYQA 4MYHA 1G16A 1MO4A 1KI7A 2H16A 5JJLA 2FSIA 1N5KA 2FOLA 2O8DA 2I4IA
chains in the Genus database with same CATH superfamily
3N2LA 4YRNA 2VDMB 4IBOA 3PK0A 1O03A 1RPNA 4XD7D 1C9DB 4MEAA 1DBIA 3JQFC 1PL0A 4F9GA 4II2A 4P82A 1PSDA 4K87A 3IBYA 5LP6B 2XCUA 4CFZA 2IQ5A 3KR2A 4R7ZA 1BJTA 1F5NA 3H5RA 3LCCA 2QSUA 3U26A 3V5NA 1K2WA 1L5HB 1EGVB 1OXBB 4BDSA 3EZXA 2C0CA 1ZOOA 1ORWA 1QF7A 4IXDA 1TA0A 3HKCA 3RSOA 1W4ZA 3NNDA 4J0FA 1UC5B 3GMIA 1W25A 2OPHA 1CR1A 4PRZA 4ZO6A 5IKEA 1C7QA 2GJ8A 4DLNA 1M2VA 1BCRB 4L27A 5DHRA 1OC2A 5JDCC 2DHDA 2NAFA 3D3EA 4E5KA 3U6KA 2NU9B 4N0EA 1TLFA 5KEIA 2Z5LA 5JLJA 1NXOA 1W581 1YZLA 3HVRA 3STVA 3FN4A 1RI4A 2HIHA 4J4TA 1G41A 1JU3A 1NNI1 4I8XA 2W6IA 3GUCA 2XUZA 5G3ZA 4XH9B 1W1WA 2V9CA 2J3QA 1UDAA 4WNAB 3GJ6A 4NU8X 1ONPA 4H7FA 4IIGA 5DTRA 1B6SA 1QJCA 2A14A 4AY5A 1GKLA 2Q3DA 5IWCA 1PKXA 2NAPA 4TT3A 1P1HA 3TTXA 1W93A 1EHYA 2BM0A 4I4TB 4K46A 4IDGA 1TA9A 3I05A 1FK8A 5KX5F 2ZJ3A 1NLFA 1PE0A 1UPBA 1GHTA 1EK6A 2O57A 3D8UA 4UCFA 3U7FB 1KP9A 4TXLA 1JQBA 3EXHB 3WMEA 3ZVLA 1WQ4A 1DOHA 1ZKMA 4AYTA 1F2VA 1FUYB 3F7MA 4B75A 4ME6A 1EXWA 1H3EA 3HDGA 1FBTA 1SU4A 3G89A 1CJUC 1QCZA 4MVJH 1KKMA 1GA4A 2EYQA 4INZA 4RVFA 1I2BA 5ELMA 2GYYA 3O94A 3IALA 3TS1A 3WIBA 4B45A 1AJEA 1LBHA 3GQBA 5AK4A 1E0KA 2XXJA 4FFMA 4G37A 2GKGA 1VCNA 3A58B 1HURA 4QUBA 3GX1A 2DU8A 4N7JA 1TZCA 1LCIA 2H3HA 3A4NA 1JKJA 1Z15A 3L5KA 2OBLA 3LAWA 3G82C 1CUWA 1IN4A 5AKZA 2PX6A 5K8VA 1X38A 3JZAA 3ZWKA 5THXA 4EO4A 2DB3A 5LLTA 3FDJA 5LA6B 5BW8A 2VZ9A 2ZULA 3VKVA 4GDFA 1H2AS 3QYJA 1SNYA 1WSDA 3OZAA 1S4MA 3P2IA 3T3OA 1RYBA 2J45A 1EEXB 4MUJA 2J5BA 2JLUA 2AWNA 1ZGGA 2FWNA 5KAPA 2QUJA 5JZ9A 1FTYA 1DTWA 4F4HA 3L01A 1FDIA 5KMGA 1W52X 1XNGA 1IOZA 1C0IA 1HSZA 5EHQA 5KDLA 2IYPA 1COWD 1C41A 1G5TA 1NC3A 1OFIA 1U2TA 4GH5A 4KPUA 5EJ8A 2JB9A 2XF2A 2BTQB 3A27A 3SU8A 3DGEC 1WNFA 1UFQA 3RROA 4HYTA 1EA7A 4UTXA 4DMFA 2R6R1 1IEQA 3HL4A 3N2IA 3AVUA 1N2HA 2ORED 2VCEA 3M6MD 2BKEA 2CLCX 4IF6A 4UULA 3LOUA 2BMFA 1AO0A 4CCYB 1EG7A 1NT2A 1U8ZA 4WMLA 3CXUA 4YRFA 3V4SA 4R0VA 1T4CB 2IEZA 4G5HA 4YACA 1O7JA 2XUGA 1S7CA 3AH8A 1Z68A 2C77A 1EEHA 2M6SA 2QMQA 5U1PA 1DJMA 4GQBA 1T2CA 4H16A 3NWPA 5CB8A 3MGGA 3PNPA 1DAOA 2IH2A 3WDSA 1ESZA 2C4UA 1NBME 1VMDA 2YXPX 3UCEA 3IQWA 3V4LA 5JDIA 4HDRA 4N0PA 3S2GA 2OP1A 3UUWA 2I7TA 1XN4A 2EL9A 3CM0A 1V39A 3H1EA 1PAUA 4R3NA 3HK2A 4GLBA 4DHWA 4HAUA 4BGIA 1MJGA 2OL4A 1XRRA 3HADA 3P5SA 2R4TA 3WWEA 4HMPA 4JH0A 1CJVC 5FPPA 5TLSA 2WVJA 1D8AA 1XZBA 3RTAA 1H0KA 4BV9A 2XRYA 3C8DA 1I51A 3ANLA 1F4LA 3EASA 1EUCA 1TCUA 3KQWA 1GGEA 1KFKB 1WB9A 4TTQA 1APBA 1M34A 1ODIA 4X61A 4ZARA 3TM4A 4NZYA 1T9KA 3LYLA 1I5RA 1G20B 1J56A 1BX0A 4LXTA 1L7XA 2BMWA 3UMRA 5FL7A 3HCBA 5EXTA 2XTNA 3BRWD 3WL3A 1F1BA 4G07A 1BW9B 5K03A 1SVMA 2CMHA 5CDFE 4HS4A 3ZIAD 1HEIA 1PS8A 1Q12A 1XA4A 1NIJA 4AG6A 4ZCMA 1UBSB 2Y0PA 4P7JA 4BO1A 4XDYA 3L7MA 3W5VA 3WYAA 1O4VA 4AMZA 4M0DA 4BGVA 3HWRA 1C29B 4MWGA 1SC4A 3ASZA 3L6RA 4RQTA 2O8FB 1R0LA 1RWPA 4GYJA 3PEUA 1CY0A 1ZK1A 1T8RA 4IXTA 4QQNA 5ARCA 1OF1A 4C2BA 1X8KA 3KVVA 2R7NA 4O08A 2JDIA 1TW2A 4LCEA 1T9HA 4C7VA 3CT4A 4YJFB 3ZDZB 4YQYA 3FCOA 4XZ3A 2QYSA 2CHEA 3BYZA 1ZRMA 4CJXA 2NPOA 2J3IA 1X7YB 4I6EA 4J9UE 2GEUA 3AZQA 2HUNA 2ZZKA 3FTPA 3DVSX 3E3OA 4HDSA 2Y0DA 5IH7A 1EFAA 2D2FA 2QT0A 4D4HA 3D6VA 1MABA 2FSFA 1TC1A 4OLAA 1GYRA 2AN9A 5M04A 5I7AA 5K0LA 3ZU3A 4BNDA 4ND4A 4RTLA 1A8QA 2G9VA 4QARA 1A4UA 1K5HA 1W73A 3ND9A 1SOUA 4IH4A 4O1IA 4UXJA 3RH0A 3TLJA 3ZI7A 4D1YA 5LZ5A 1N7IA 2X6RA 1L5FA 1ZJ5A 3DHEA 4M9CA 4DGQA 4UZFA 4RPIA 5CA0F 2WIKA 1NVVR 2A35A 2XRMA 1A8HA 1T3SA 1REQA 4PXYA 5EVCA 1FVXA 1J33A 1IE3A 5JAPA 1N5OX 2A78A 1CP3A 3SR4A 1HUQA 2DPYA 3BGSA 3WFIA 5BXYA 3RM3A 2EZ4A 1FYWA 2RG7A 2QMEA 2XRFA 4IKEA 2BFCB 2QB5A 3B78A 1ZD4A 2WFLB 2H2HA 3FBWA 2NG1A 2XLCA 4GX2A 1KYXA 3LECA 4E5NA 1F6BA 1FP4A 1S96A 1QX4A 1UK6A 2O2JA 3EZGA 3RD5A 2ZJ1A 4X63A 2HJRA 3AVOA 2UUAB 1YIDA 4IDCA 4U7HA 5IJAA 3H2KA 3LD9A 3QWIA 2PM8A 1U3DA 1XCBA 1FFHA 4JNCA 3WLHA 1TQDA 5DM70 2VUUA 5F12A 2RGNA 4FJ1A 4G6ZA 4QJ3A 2H5EA 5LB4A 2YQ5A 3WGNA 4R8RA 4XRRA 1ZESA 1CU1A 3WMFA 5SZHB 4LF9B 4N5IX 4HXEB 1EB8A 5DNWA 1P3JA 4FDLA 2GSDA 1DPGA 2C4TA 2W2OA 1CNEA 3G9TA 2C58A 3LPAA 3BE6A 4HTFB 4O2LA 5D85A 3ZY5A 1U7HA 2BGMA 4PN3A 5KQGA 4MQMA 4DC9A 3FE2A 4X6XA 1U02A 1LLCA 4GSLA 2QUZA 4KBGA 4JX8A 5CX1A 3M3PA 3OJEA 1STOA 1E1RD 4BNMA 1MW8X 1P4JA 4HR7A 4A8TA 3VU0A 2EIXA 5K6RA 4N5NA 1DV1A 1B4DA 2C20A 3QK7A 3TJZA 4FK8A 2NNWB 2QT1A 5I8PA 1ZOSA 4H7IA 3I42A 1A5ZA 4C05A 1N0IA 3X44A 2VT6A 4PY2A 4UUPA 4CTNA 2GN2A 2QHXA 4YXWD 4QBHA 1H8HD 1QS0B 5F23A 3CF6R 2C5BA 2HMAA 3KSDO 2CVQA 1RRGA 2FR8C 3ODPA 1EP2B 4B82A 4DA6A 4KP7A 3G0GA 2MIIA 2ZYWX 5ADWA 2ODEA 3ZV6A 3T5AA 5JJCA 3PXCX 1LNQA 1JFLA 1M1NB 1EXMA 2P5SA 2VJOA 3I9JA 4KIFA 4LOLA 4GPEA 1H1LA 3HJTA 1LBEA 4PTYA 2PBLA 3CUKA 4XWYA 3WLRA 1EVJA 4RORA 2RHHA 2EFCB 3BXOA 3KHTA 4MPJA 5IVIA 4I55A 1DCFA 1G18A 3T5DA 1OCEA 5K3BA 3WB1A 4UMVA 4KR7A 3RVQA 3ZZTA 2VQFB 5ECWA 2VZ8A 1XD8A 1MP0A 4MB0A 5IDVA 4QVIA 3UXHA 3SZGA 1EK5A 1XELA 4LKRA 4RKWA 5DI3A 4PG6A 3PR2B 2HBQA 5GJVC 2V6MA 4RJ2A 3COYA 5TV2A 3F47A 1C3OB 1T9BA 5ALKA 5IW8A 1NU6A 3TZBA 3UT6A 2IOFK 3U40A 1M6VB 3WK8A 2ZTUA 4ZIRB 1NP7A 3HFRA 4H9GA 4Q4JA 2CHUA 2IU6A 2RHLA 4P5EA 3ZJYA 1FA9A 2YVUA 2CVFA 2CKMA 1Y1QA 4XKJA 4OJYA 5A71A 5JYDA 5DNEA 4HNAA 4G0ZA 4QYIB 1R1DA 3FHJA 1BHO1 1J8QA 2X4IA 3H4TA 2P78A 3RSGA 3WDKA 3EG5A 1DCTA 2R3SA 3EISA 3KT0A 4TMWA 3UOWA 1PYDA 2LPMA 3ILHA 5TARA 1WP4A 3I72A 5T6BA 1U8TA 3A3PA 2EJBA 3AR5A 1M2EA 1WNTA 1G6KA 1HM5A 2DTXA 4HQKA 3W7BA 3H5WA 3EVCA 4FWIB 4BUJA 4YV1A 5GINE 2AMVA 1ZIPA 4FYMA 2IS2A 4WACA 1IH8A 2C5AA 3X0DA 3K2EA 1SXGA 4V2IA 1FFAA 1OBHA 4M8IA 1BS1A 1R9MA 1P3Y1 1MH9A 1Z29A 2Y3IA 4G4GA 4MIEA 4UU0A 4E7OA 1KZ9A 1POXA 1NSFA 3RBAA 4REQA 3VJMA 4YRGA 1U1EA 4UEJA 3E9ZA 4W63A 1TEVA 5CDSA 3I5MA 4H1VA 2OM2A 5JVDA 4KPGA 2H00A 3TLAA 3VPGA 5K0GA 3K1JA 3OP1A 4GVPA 3I53A 5DPMA 3DOHA 3ZWXA 5I4IA 2HCTA 2BZGA 4IIYA 1U65A 4FYIA 1C2YA 3BGWA 3LT2A 5AVTA 2NT4A 3B6KA 3ZDYB 5IAEA 3SC6A 3K20A 3ZNQA 2JC3A 4B3DA 1YMQA 1E2GA 2EJTA 2VF2A 2J67A 2VJDA 3M4JA 3QWHA 4MUXA 1TO6A 4GM4A 4WERA 2OCKA 3DONA 4UBMA 5CITA 2C2YA 5IDQA 2GAFA 3AG5A 2IVZA 3DZKA 3F6BX 4KH1A 1FJXA 1DL5A 3A7DA 3R6DA 4R05A 1Y9JA 4PZ9A 3F6EX 3SYTA 4M1TA 1MUUA 1BWPA 4ETMA 3AUAA 4KDRA 3WZLA 5DB4A 2ZVQX 2PZLA 2YNMA 3GD7A 4NFSA 3DH0A 3CEPB 3DVRX 4JJZA 3CRZA 5C8XA 1R7RA 3G2NA 1JEQB 1SPXA 1T13A 2ZAOA 4P5DA 1TKBA 4MUGA 1KZHA 3SJAA 3WK7A 2R1TA 1U81A 3GRYA 3H3XA 5EE0A 1T3LA 1ZD5A 4DKJA 3DEFA 4ZYXA 3IP6A 4AC9A 5I9LA 2IXBA 3MINA 4JOQA 2Y27A 3L2OB 3ONNA 1T4MA 3IHLA 3HI6A 3RGWS 1UKAA 3ZU6A 4B6FA 5HQ3B 2OGWA 2I6TA 4II3A 3HFJA 1NX6A 1OSNA 1DPFA 2ZRAA 5JH7B 3NBAA 2I91A 2DUWA 2OWEA 4BLWA 3CS3A 3JALA 4HEHA 1ZI8A 4NBTA 4KSBA 4UBIA 3T7AA 1XPOA 4KUEA 2FLVA 1QRTA 3EHDA 1UR5A 3DE3X 4TN5A 5A7FA 2GERA 3F4KA 2RJ3A 2ZXEA 3ONVA 4QQFA 1SKBA 3LT4A 1NBEA 4K86A 2IYXA 1V2GA 1GV0A 2MMGA 4UHCA 2O3TA 3T1OA 2PFGA 4NHEA 3TWOA 2Q0QA 2GRJA 1O97C 3CTPA 3M1YA 2AFHB 2Z2IA 2WIBA 4EAAA 1Y33E 4MWOA 3RVPA 2B78A 3NGXA 3PR3A 1C50A 2R84A 1KHHA 5KC8A 3W4JA 4BB5A 4EQ6A 3GLFE 3CLUC 4B3CA 1LX6A 1QONA 2A0FA 3AHJA 4TMXA 4CMIB 3HTXA 2COEA 4LX8A 2F9MA 2PBRA 4OHRA 4PX2A 2CW5A 4C0AC 5JROA 2BDUA 1Q57A 5IKMA 3KXLA 5SYAA 1VJCA 1JQJC 1LPPA 1KMMA 4N49A 3ZWCA 1F06A 1JT9A 3TR0A 1J00A 2CXPA 2HO4A 4R7TA 3FDZB 3C4QA 1G291 3AWIA 3VJKA 5AI5A 4E2YA 2JZCA 4RJLA 4ZDIA 3PFWO 2O8BB 3PF9A 3PRJA 3O2SB 2EKPA 3EGDA 1X1CA 3H5NA 3O8OA 2WIAA 4TPKA 3DFIA 5P8WA 1J8VA 3PXDA 3GGJA 4N0DA 5JG7A 3TRHA 4B33A 5HZHA 1E2UA 1U0HC 2HMWA 4TTVA 1VHQA 2PZJA 4LISA 1R5OA 1V5WA 2FZGA 4NZOA 4RHEA 3RIHA 4DRXB 5A4AA 2HU8A 5HZKA 2JA1A 2ZIAA 2OBXA 5KMGB 3UG6A 3NCTA 2CFRA 3PWZA 1KS9A 1SIBE 3X1MA 4F6LA 1Y81A 2VRCD 4CLRA 3WFZA 2W2TA 2Q0XA 1Z33A 4KXWA 1KEZA 4X97A 2GA9A 2WU1A 3P0RA 1N6KA 5KJ1A 4H60A 4FVTA 2XUIA 2VP6A 1IZ8A 1H22A 1Y3FE 4BO7A 4UU7A 4GC9A 5DSZA 1DKPA 3TCXB 2ZBVA 1E7QA 1JHRA 4AP9A 4NAUA 3L8CA 5DBFA 4LDPA 3WKDA 3W2HA 5JCOC 3DZHA 2WF6A 4FJ0A 4KXFB 5HKOA 1I33A 4ER7A 1JPNA 1Q7RA 3EMBA 4EIWA 2MYNA 3AUFA 4MW2A 4G25A 1D1QA 4GS5A 3KYIB 1ESMA 4RTRA 4CR6A 1FUUA 3V1TC 5DJ5A 3WGMA 1QOPB 5EP1A 1BE8A 2GXAA 3ETLA 3GRKA 3M2PA 4Q00A 3E1GA 4IJWA 2HDOA 4GP7A 4NMLA 2QQEA 4IIJA 3WKBA 1C1DB 3HXOA 1KVRA 2QTFA 2WYWA 4JEHA 3H4MA 1QGUA 1N75A 2P9FA 4FFVA 2ZJ7A 3KSMA 4CEJB 1TLTA 2AQIA 2B0CA 2V5UA 4R69A 5ILGA 3OOJA 2X41A 1EZ1A 3REQA 1PD0A 3L8DA 4BATA 3AEKA 1E0AA 4Z99A 2GBPA 1GAEO 1C5KA 2QG4A 1SMKA 3L43A 4OHCA 3UAZA 3OPYA 4RPGA 3RSLA 4M0PA 5FFFA 2YOGA 4YIKA 3YASA 1H2HA 4B80A 1FRQA 1K8XB 1TKRA 2EJWA 2JJ2A 3IDFA 3EZ6A 4PLGA 4TXNA 3W78A 4CLDA 4IMRA 4AL4A 1GR1A 2BGGA 3I9V6 4HEJA 1TEZA 3KEFA 2FPWA 4FOOA 4MPDA 4IJ6A 3RRXA 1ONOA 5J23A 3OE7A 3PTAA 3AMVA 4UPDA 3RBVA 1RYDA 5CLJA 1U3UA 1ZIDA 2CCJA 4I50F 1E4OA 5E6UB 2I8CA 2RK4A 3P94A 3Q7PA 2PGOA 3HYNA 4XJTA 4GPBA 4D4IA 2WIDA 4QBGB 4L78A 1ACJA 4G23A 1RAFA 2GZ1A 5A9RA 2BUBA 1N9GA 5AICA 4WBNB 4N3CA 1U9IA 2QY9A 3EAGA 3S3TA 1Y6ZA 5T8KA 3I6MA 4FSXA 4BB6A 4KE7A 2Q5IA 2P9ZA 4LCJA 4YR7A 2AN1A 1ZHOA 1P91A 4YMTA 3EPLA 1CQWA 1XYGA 3H0CA 3SKVA 4I2NA 1B26A 3ZX4A 1W88A 3GDOA 3FTNA 3OH8A 1GGJA 2QJRA 5JO0A 1ZH2A 1PNOA 1GRQA 2ZRHA 4IG9A 5J4HA 3F6YA 3QE3A 2UVPA 4FDTA 5EJMA 4CIXA 4B47A 1PW5A 1ZINA 1E9VA 1XK7A 4OHXA 2C3OA 2X5XA 2YZ7A 2CHQA 3JQAA 4F93B 4UQLA 1DQPA 2UDPA 4YRAA 1OB5A 4XGKA 4GU5A 3DKVA 3NH6A 1JSCA 4LSMA 3OQ1A 1PBTA 2HSJA 4ZI3A 5KDDA 5IF3A 4MLDA 4ZRNA 1CY6A 3WLTA 3WLNA 4QUJA 3IUMA 4HNQA 2IPAB 4JUFA 4UEQA 2YZGA 3QF4A 2DKNA 3O3NB 5A0TA 1QPBA 3A3NA 3DMYA 4NYMR 2CL6X 4FDAA 1WWKA 1ZX1A 1YS6A 5E1MA 4EJSB 3IL2A 4GL2A 2WB2A 1QF9A 1XCJA 4CHGA 4PR0A 4JMPA 2OQRA 1E59A 1QOQB 2XVXA 4PCLA 4PZDA 4BLVA 2YN4A 2Q4EA 3GGPA 4E4TA 1ZW1A 3GCXA 3QQPA 1PR1A 3K0CC 4DSTA 3PLNA 4CLOA 1CQXA 1T0JB 2H2IA 2ZIWB 4AKIA 4UMEA 2VP5A 3R5JA 4O4LB 1ECFA 2XB2A 1K06A 2FV8A 4AWBA 3I76A 1DFGA 3K0AB 4DLLA 3SE7A 5GOZA 3AZOA 2R6AA 2PSFA 2VDWA 4IQ4A 3G2HA 1Z9BA 5EERA 1XDGA 3VR3D 2A4KA 1CQJA 3BWYA 3HJUA 3HU1A 3O4HA 1D4FA 1K8ZB 1RZRA 3ZQKA 1YBAA 1ZUIA 4MKHA 2EF1A 3I09A 1ZH4A 5BR4A 3U7GA 3THYA 1L2TA 4MUYA 4D79A 5CFMA 5JPCA 3EEFA 3C1AA 2Z4SA 1A96A 2NP6A 3OMXA 4IZIA 2EL7A 1IG3A 3UM9A 3BEOA 1U8UA 4O8CA 2C4VA 1NBHA 2WF8A 5JD6A 5EKUA 3K9HA 3TSYA 4E13A 2WW8A 2IH4A 2Z09A 2O2EA 1XV5A 1KY3A 1L8LA 2QUHA 1NKVA 2ZS9A 3ELYA 4BQEA 4B4KA 5HKBA 4B3GA 5JVDF 1ZBDA 4G85A 1Z2DA 2RI0A 5HM6A 1LQ2A 4OYYA 3AJEA 5JXGA 4US2R 3MT0A 4MRAA 3KTAB 3MLBA 5C51B 1N2SA 1YSCA 4EDHA 1DAPA 5BWBA 3GVXA 1LVGA 1VCHA 2VWHA 4GD3Q 1DXQA 4ASUA 3MJTA 4KAXA 4S0ZA 2R00A 4IQGA 1YFLA 3HPRA 1QM5A 1T5TA 3ESXA 4ZQHA 4C6HA 4EVQA 5CCDA 1DJLA 2BFAA 2X2PA 2XB9A 3JR7A 4PICA 4C7BA 1Y8RB 2BF4A 4IGIA 2ZRCA 1U2RA 1V43A 3EK2A 5F1PA 3HHEA 2HL6A 2P4EA 3B6MA 3E5HA 1AGPA 1J70A 1QV6A 1XEAA 2B2NA 5LBUA 4OG2A 1G0OA 5CP8A 1JBEA 3UG7A 3GLQA 3HCAA 4Q21A 1ACLA 5THKA 2J7KA 1BGWA 2NQ8A 2JK1A 3TR5A 1SBZA 2RC5A 4J49A 5J4KA 5KX5B 3LLSA 5FKJA 1QH9A 1X9IA 1YKFA 3K16A 3K30A 1DZIA 5E4FA 1I3KA 1QOZA 3AIOA 3Q2OA 4DCCA 1A97A 4EYGA 1RQLA 4XASA 3OO1A 1C8LA 4X6UA 2O54A 4L9RA 1Z26A 2Y9MB 5C9ZA 1B8NA 3NTUA 4NE7A 1U6KA 4W8HA 5HW0A 4JC4A 2WG1A 3FZNA 3RC1A 2NZ2A 4B09A 1PR5A 3IEIA 1N2OA 2XJ9A 1C3VA 2OHFA 3M49A 2P6RA 1N4DA 1UP7A 5EJIA 3C39A 3FFXA 3F4LA 3GG9A 1WCIB 2ECQA 3DR5A 3UC9A 2WU0A 3EXIB 3W5DA 3NAZA 4W5TA 2JLVA 2XT6A 2COKA 1XA0A 3PPVA 4ZAYA 4ETNA 4MCJA 2QX4A 1DS6A 4NWIA 4BMPB 1U0FA 4CL8A 1P2FA 2CYCA 2GKOA 1H05A 1ORRA 4F3TA 4GL4A 3AYZB 4EQZA 1ZSNA 1W4LA 3E27A 1X8LA 3SS9X 1N9ZA 3I73A 4NU5A 1KQ3A 2KQUA 1H5UA 4P92A 5EPUA 3TQHA 5HCUA 4GBGA 4JUAA 5E1DA 2VJMB 4YJHA 2ODPA 3DPUA 2VP2A 3L0PA 3SEFA 1KIFA 1BXRB 1Y6QA 2GK7A 5IM5A 3C8HA 1T8WA 1GRRA 4AUEA 4EG1A 1A1SA 2H5IA 1PFUA 3T3IA 1A5AB 1KORA 1ZH8A 4KQFA 3SXUA 2EW8A 4Y2PA 3OQOA 3H2GA 2FZCA 3PNSA 3DE7X 5BT9A 4IS3A 1SD2A 2F90A 3JU3A 3AFGA 4JJ7A 1N3BA 3D0RA 3AUYA 1R6DA 2ZTSA 2HT1A 5KOIA 2IKQA 4Z4EA 2D5AA 3PXBA 5KYWA 5KSYA 3RRJA 2KX7A 2QMOA 2QTZA 3MILA 3TOSA 4B3IA 1V41E 1A8UA 1XYYA 1Z6TA 2JIDA 2KS6A 2O4CA 1KJWA 2F17A 2FLWA 3R6GA 1VL0A 3I39X 4NBRA 2O0HA 2BFEB 2XAAA 3QKRA 5K05A 4G09A 3X1KA 2A1TR 3F46A 5K3CA 4EKDA 3A04A 3HJRA 4N5HX 1HE3A 2J31A 4D6YA 4WJLA 2ONKA 1GSIA 4OHVA 4EG4A 1K7YA 2WT9A 2NO0A 3L0BA 5IABA 2DLCX 2QE7D 2H5JA 1ORVA 3G6WA 4UEWA 2XZDA 4CEIB 1QAQA 5KYTA 4GI2A 2IZ5A 3RTGA 2XE7A 3CN9A 4MEBA 2YVKA 3LBHA 3BGIA 3BQMB 1L5OA 1EG2A 2RH4A 1SVWA 4D96A 1R88A 2AUNA 3PUIA 4K6OA 4QNMA 4DQDA 1CLEA 3A37A 5D3MA 3C45A 2C4KA 1E2KA 1KK1A 3GEMA 5J4VA 1NR5A 1ZWKA 4Y6RA 3EW7A 1P77A 1CERA 1O5OA 2AIRA 2A57A 2V65A 4WOCA 1XHFA 2O8CA 1CUGA 4NZ9A 3IEUA 3TNFA 5ARBA 3VNUA 1CHNA 4FE3A 3E7PA 4IIJF 2C9YA 1NR1A 3RK0A 4U6NA 1QIFA 4DLPA 5BV1A 3P97A 2FHPA 3KEGA 3GDHA 4TYYA 4BX3A 1ZVVA 1GQSA 3N5CA 1EUDB 5DM4A 3KKNA 1NXXA 1DMSA 1U04A 2I7CA 5HJ7A 1U4NA 4RV4A 5DEIA 1WDKA 4XX0B 5DGTA 3P19A 1XZ8A 4IS2A 3CPJB 3IESA 1CSEE 7YASA 5A9SA 1UZUA 3ZVKA 1DTEA 4CQLB 3V2IA 3L1JA 1L7OA 4F4CA 4HX2A 4UPEA 4JZKA 1PJCA 3OESA 3RJMA 5JNUA 3MMSA 4CKEB 2DAPA 1JFVA 5T6MA 1RC8A 3JQ8A 2VOEA 3U7JA 4DLSA 1SVNA 1DAEA 3BJZA 3FAZA 4WJZA 4JT2A 5FCDA 1O97D 1EVLA 3I9OA 1RC1A 4PAQA 4V24A 5I7VA 1KYIA 2GZRA 3FR7A 1E9RA 4RK4A 3VTAA 1PZEA 3A6HA 1YS9A 3OQJA 3ZCSA 3CLUD 4Q48A 1OREA 2PD4A 4PX3A 1LDEA 4O4IB 5LFAA 5JJIA 2DHQA 4AF7A 4P7GA 5HRAA 1EMDA 3DT8A 4G01B 4LPKA 2FMUA 2R1VA 1J21A 1E98A 3IVAA 3K5WA 1U0SY 4XFJA 3EVTA 1E1QA 1H3FA 3RYHA 1WW3A 2G9QA 1BCSB 2AI1A 1JPVA 3LSTA 4KNYA 3DVAB 1A77A 2ZCUA 3I04M 4QUEA 3QLVC 4XVQA 1E2EA 1DKLA 1KBQA 3AKZA 2ZSDA 4YVFA 2YYSA 4N9WA 1MVNA 3B12A 2P30A 3RTEA 2O5EA 1A9SA 2VNAA 3R7AA 1OBVA 3DP9A 2BIFA 4OATA 3O0TA 4YP5A 2QM0A 1GNTA 3IAS1 3Q72A 2FSHA 4JSYA 5AKYA 3V4VB 4C89A 4EB0A 1Q92A 5DDIP 5AVKA 1IBRA 5AT1A 1QC5B 3N0RA 1BA2A 1GG8A 3P4YA 3BPSA 4P81A 4XJSA 2DM6A 1OZ0A 3OJFA 3GELA 3NTOA 4GR4A 5JZSA 2C78A 2GBCA 4PWYA 2RG1A 3CH5A 3QOXA 4Y6QA 2AG0A 2BTEA 4RKQA 4M22A 2WKSA 4OLFA 4I9HA 3TL2A 1NVKA 2JFHA 2PTGA 4J16C 2X5NA 3K8QA 5CFQA 1LSUA 4QXOA 3T3HA 4I1PA 1Y6JA 4PC3A 5FHQA 5TPZD 4A0SA 1I32A 4Q7QA 5E1BA 4QLBA 4YUXA 3P9YA 1KDTA 2SCUB 4PZ0A 1K3UB 3HKBA 4WUVA 1XQXA 1IOVA 1OXSC 3GN2A 4O5AA 5C80A 5A7HA 5DCUA 3FCEA 4D6PA 2IZ1A 2YTZA 4UAJA 2F3RA 5GM2A 3V4FA 3PEEA 3U4QA 2A0UA 2JH3A 2QL7A 4GR9A 1RT9A 2C4WA 3LPDA 1MORA 4OB6A 1RU3A 3OFND 5GGXA 2ISSD 1E9DA 3GA5A 4ERXA 4TV8A 3Q2KA 5AK3A 2ZXFA 3R0XA 3OBBA 3ZDEA 4EW6A 2I33A 4RZ2A 5CVUA 5IUNC 4MAFA 1ECPA 1IEVA 3DAOA 3O5AA 4CKBA 1G9TA 4BJHB 3IDSA 2G76A 1L5YA 4UVGA 1YVPA 1X92A 3JVUA 1FNNA 1E2LA 1OIXA 4YP9A 2Q2WA 4GRDA 1YHNA 4Z2AA 3DT9A 1EPUA 4JC5A 1AZLA 1YL6A 2YZ2A 4IIVA 4ECAA 2DFTA 4WEQA 4EPWA 2GBLC 3RUDA 4RCVA 3PFHA 3TOXA 5GJBA 4JI3B 3IKTA 1TYBE 3C4VA 5CT4A 3AW8A 2IEIA 5HK8A 2VPPA 5DTEA 1BEZA 2Y67A 5G3YA 3IVGA 3B6IA 2HSEA 3KTDA 1KI6A 1NKTA 3QI7A 4J0IA 3V8QA 4FEEA 1KRHA 3OLXA 3A06A 3ZJ4A 4PAGA 2VXOA 3MD9A 1UZMA 5IARA 1TJ5A 3D1LA 1PGOA 2I66A 1JMYA 3HKCB 3I4CA 1Q15A 2WF9A 1IZ0A 2P90A 3ZZUA 3BFKA 4W1SA 4HPXB 2JIPA 1ZVKA 1FDWA 1KO5A 1M2VB 1LPSA 1HLGA 3HB5X 2Q9UA 3ZU2A 1VP3A 2ZANA 4MUAA 5CRIA 1IQPA 4MAAA 3FFTA 1GQ2A 1PLLA 2Q5EA 4UEOA 4YAIA 1VB5A 1O95C 4Q9LA 2FW9A 4CG1A 2ALJA 5K4GA 1FLAA 3D7SA 1S5PA 4C87A 1I3OA 3AJDA 2GAAA 2IXDA 2P0YA 3ELDA 3NV9A 3Q7IA 4KJXA 4Q05A 4R1NA 3DBHA 4U2CA 1KY5A 5JWHA 4CT5A 4XR4A 1YR7A 3BWBA 1OROA 4NMXB 1DBQA 3CIOA 3D8RA 3DLPX 5JFGA 2MHCA 4Q4AA 5DP1A 3RSCA 3U19A 1ORIA 3S4YA 2XMDA 3WGJA 2XADA 1HTBA 4XSHA 1RHUA 1L5SA 3KLBA 2B35A 4DCJA 1AMUA 1GL3A 4BX9A 4D9BA 4G1VA 3TDKA 1QF6A 1E9BA 2R8XA 4QUAA 4UE2A 4FYYA 3MRVA 3U4AA 4FW9A 1SB8A 4UUQA 3D5QA 3FR8A 3FSRA 3GQBB 3VHQA 3PUVA 5AKLA 4ZAWA 3R7FA 5EP3A 1O4WA 1T2FA 1ZUHA 3GC6A 1NDHA 4OQLA 5FJIA 4YUZA 3C24A 1JKJB 4N3GA 1SQSA 1U1DA 5FWYA 2NYUA 1CZUA 1QUFA 1CD5A 2C5EA 1QJ4A 1M74A 3WGLA 4LTDA 4DCUA 2HXYA 3S44A 3DKIA 1SU7A 1FDRA 2B4AA 2D4HA 2YOHA 1JDJA 3NEYA 3LIIA 5LP6C 2QX9A 3ZQUA 3VOTA 3PKZA 1Y6RA 5DFAA 1I3LA 1SXJC 3ME5A 1EFDN 2IITA 2R7LA 3WBBA 3R6LA 2ZWOA 4A5OA 1EFRD 1F3LA 1W9HA 1P2DA 3JQ9C 3ZDCA 3IIEA 2ZR7A 1ADCA 3KKQA 2J33A 1MU0A 1DTWB 1XAHA 2D8MA 3VTFA 1N6RA 1FP7A 1S0UA 1VLMA 3IPXA 3MRSA 4QE3A 1XAIA 5CVVA 4OHKA 5HFJA 2QJFA 3K4HA 4HVCA 5KTYA 4KPUB 3AVYA 4ZCQA 4HWGA 4EF5A 2YASA 1CWUA 1DAIA 2VAMA 3OIWA 1CVIA 3TPFA 2W0MA 3KHSA 3ZY6A 6LDHA 8LDHA 4F6RA 4O8ZA 2R87A 3AHEA 1OIVA 1WXDA 1WZEA 1GRVA 4TM8A 2VAPA 4ZMBA 2D0OB 4MGKR 1P31A 4DLBA 2GF9A 1M0TA 1DINA 3EFHA 4MV3A 5D6NA 4H6WA 1I1HA 1VJDA 2JZOA 2C00A 3GGSA 4CM9D 2J5KA 2L42A 1NONA 3O03A 1F3OA 2XD4A 2Q6TA 3U7RA 4F11A 3PE3A 1GYQA 2BFFA 3ZIDA 5JXJA 3RC9A 1G4UR 3AY0A 3L7BA 4JI6B 5BNTA 2FX5A 4LXHA 4X71A 1EDBA 3L0OA 4AJOA 2OO3A 3EZ2A 1PL8A 3OKCA 4IOKA 3EXHC 4HDRB 5A4IS 3B3AA 1OI4A 2EZ9A 4DAOA 5G2OA 1ORHA 4KRGA 4GMKA 1VDZA 1YE3A 2YDYA 2P6UA 1P6UA 5A7GA 4ARVA 4R8MA 2BHTA 2NTYC 1XVVA 1YRBA 5EIEA 3LKDA 3DWGA 4OGLA 1PJSA 4PV7A 3E23A 1GRCA 2ZIVB 3AM3A 4HDMA 5EMHA 3UJCA 4B79A 4BNTA 8ABPA 1L5NA 1EUCB 2A5DA 1Z0DA 2OBYA 2IOQA 5IFLA 1M34B 4DA0A 4J43A 3OX4A 1Y1KE 4RZQA 4HPJB 2GX6A 521PA 3WQHA 1LBTA 2PH3A 3N2EA 4LJ5A 2JCSA 3SVTA 3LVFO 1NPYA 3P2OA 2QR2A 2GD6A 2VUSA 4PBTA 1OZGA 1DWOA 4KW7A 1OAOA 4TTSA 3MGKA 1A5SB 2ILTA 3WBJA 1N8TA 1LNSA 1Z6GA 2VWGA 3FCSB 1JW9B 1GT6A 2GPAA 3BWDD 1QPGA 5C7YA 2HFJA 5CTJA 1YI1A 2B8NA 4HK4A 4CCSA 4UE6A 3M81A 2XDWA 4IIFA 4MLCA 2BCEA 1RAAA 3OD1A 4PYOA 3WLOA 1PDVA 2OENG 3VDMA 3T7KA 1AMNA 1EDZA 1VKRA 4C3OB 2YJ5A 2E89A 2R8RA 5FUMA 3KFLA 1NVDA 3LBYA 3NM4A 1GZ7A 1NN3A 1N2XA 2ZAGA 1FFSA 2FW6A 4URXR 1PYGA 1TVEA 1ZWLA 5DLYA 3WMWA 4DM3A 4Y6OA 2IUEA 4ZKEA 2QSJA 5DULA 1Z5GA 4LSZA 3QOFA 4ILEA 3ICQB 2I3BA 2CK3A 2HRQA 3OCWA 4MRSA 5FP0A 5AVOA 2JLAA 2AFIA 2OV1A 5KUTA 2UUBB 2LCFA 3RFFA 2C31A 2GN4A 1KYVA 3GGCA 3MMXA 1HQYE 3BS4A 4HDSB 4L8LA 3L7AA 3TD9A 1QFMA 1MABB 1GZ4A 1P17A 2F62A 3EF0A 1JA0A 1JJIA 1Z39A 2WI8A 4BNDB 4ZQBA 1NTRA 3OM8A 2PH1A 1O94C 2GNAA 1TNDA 3GAFA 1MEJA 3NFYA 1E62A 1I0LA 4GM0A 2PGDA 4RVUA 3RVOA 3WGGA 4CFYA 4AF8A 5LSAA 4L1KA 3QEBZ 3W3AD 3AUKA 1T3GA 3UO8B 4Q1AA 4BKQA 5ES4B 4TKUA 4MI3A 2PUJA 2TMGA 3K0BA 1L3IA 2X76A 3QBTA 4RCZA 1REQB 1Y48E 4OO3A 4HXFB 1JR6A 2O4UX 4CKWA 2VKQA 3DE6X 2NUAA 1KOFA 1XKLA 1IK4A 1GO2A 2QG9A 4RHFA 2GLUA 1PK7A 2HIGA 7MDHA 4TL9A 1QHNA