3GJ8A

Crystal structure of human rangdp-nup153znf34 complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
204
structure length
204
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGESEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 70
structure length 204
sequence length 204
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj8A00
4ACBA 2WWWA 2AR7A 3K9GA 3KXIA 2XB2A 2JDIA 2OV2A 2RGNA 1VIAA 1T0HB 1RW4A 2XZLA 2QSYA 1JEEA 1QHGA 1G8FA 3EX7C 3RVBA 1KKLA 4PX9A 4UQOA 3TKLA 3FKSD 4XWKA 1VECA 1Z47A 1QF9A 2PMKA 1KHTA 4P31A 4ZCMA 2J0VA 1XD9A 1XD8A 4TN1A 4C30A 1A2BA 3GCGA 3Q3JB 3RS4A 1G4AE 1U9IA 5C4GB 4M4SA 2F55A 1JR6A 5FOUA 3J81k 2D4HA 2PBRA 3HJNA 2D62A 1W2HA 4BRWA 2GILA 4U02A 2ASEA 2ZJYA 4NKRA 1FX0B 5JWOA 1X1RA 2JLYA 5HZHA 1TQ6A 5DHFA 4U7DA 1E0AA 1U90A 4P4UA 2JJ2A 2CL7X 1YKSA 2JLUA 2ZRHA 4PANA 1FTSA 5DIFA 5D3MB 3CH5A 3K70C 4KBFA 3FWYA 5EUQB 1PVOA 1NJFA 1OB2A 4PHFA 1XXHA 2GESA 5CM9C 2IYVA 1Z0KA 2C2HA 2J9RA 1X8KA 1YZKA 3SQWA 2KJQA 2ZRAA 5AR1A 3PUYA 1IOZA 1N6RA 2FZLA 2W2TA 4LRWA 1PLJA 5C46F 1OH6A 5JJIA 5BXQC 1W49A 1OIVA 3NBZC 3FTQA 1R2QA 5FOSA 2DWPA 4DDVA 3MJRA 1UAAA 3SBDA 1M74A 2WMOB 3FMIA 4DT1B 2ANCA 2Q3FA 4MYCA 4QJ5A 4QJ3A 1KIMA 3QI2A 4OJQA 1YZUA 4DLRA 3LY5A 2A9KA 1EFRA 1NSFA 1T91A 5ANRB 4DIEA 4PPGA 2BOVA 4PTLA 4R7ZA 4QGFA 3EPJA 4PFSA 4TL6A 1DAEA 5UKDA 3PJRA 3TIFA 2ZANA 3LX5A 4TMKA 2ZS7A 3U3JA 4E22A 2CK3A 2O0KA 1TEVA 4EAQA 1P6XA 1W0JD 1ZD9A 4M22A 5ELXA 1GRQA 1G17A 2IL1A 5DGXA 1T3LA 2JIZD 4TQ9A 1TADA 1N6PA 5DYGA 5SZKB 4CEIA 2F1HA 2EWVA 4II7A 3VR6A 4OYHA 4B48A 4PHTA 4W5WA 4LJ6A 5AUOB 5KDOA 2IUSA 3SE0A 4ARZA 4C0BA 2VP9A 2IYRA 3THXA 1E2LA 1UBFA 3SZRA 2IWHA 4BEJA 4IRUB 2B7CA 4GRAA 2J1LA 3ONWA 5EXTA 4B33A 3FMPB 4Z54A 3WXMA 2JLXA 4HAWA 4DLUA 4DLVA 2OEPA 2EFHB 1Q1QA 1NN0A 1OFTA 5K8LA 2QN6A 5SZJA 2BBTA 1ZMXA 1DO0A 1EK0A 1Z0DA 4CEJA 4DEXA 1JQJC 3CNNA 4AG5A 3B5JA 5L3QA 3SC3A 3KQKA 2CMKA 4PQYA 3RRNA 2FV8A 3LAWA 2C5LA 4QRHA 1QHSA 4IFBA 5EXSA 3OE7D 4JVSB 3OAAD 2FN4A 2ZJBA 3C8UA 2R6FA 4A0FA 1GZSA 1D6JA 2NGRA 4Z8YA 2PJZA 3BH7A 3EC1A 1OLOA 2ZUDA 3B8HA 2VP0A 4C9BA 2BJWA 3ZZUA 1VYUA 1E4VA 1ZC3A 5CK5A 2GZDA 3U2QA 1N6NA 1GOTA 1KJZA 3GLHE 2V7QA 3I3SR 4OHVA 4O2LA 4FD2A 1YVDA 1IJEA 4CT4B 3ZVNA 1COWD 1F3OA 3C14C 4B43A 2HF8A 4NCJA 3A1SA 2QRZA 1WQ1R 1XMJA 4JLMA 2KBFA 4GT1A 1IN4A 1G8GA 2NPIA 2QGZA 4NYMQ 4ZIRA 3QEJA 1GP2A 5TV2A 2WPDA 1RJ9A 2TMKA 2IWRA 3CR7A 1SVLA 2V9PA 3X1DA 1JEDA 4I1SA 2ZRPA 4QL3A 3W3ZB 1RPZA 2PX3A 3R9XA 5KSZA 4MKGA 621PA 4TLCA 1RYFA 5JEEA 4RFSB 2IK8A 2NZJA 3LWNA 3VKHA 4LOAA 1XMVA 2ZTSA 5A0FA 3KB1A 1XRJA 2NO7A 3GFPA 1L4UA 1E99A 2IBMA 4TLEA 1VCMA 1JB1A 2KB0A 1NY6A 2GETA 2PEZA 4TSFA 5JHHB 2A5GA 2Q3HA 2EYQA 2NO6A 4G5SA 1S3SA 1ZJ6A 3I4LA 3QOFA 4DC9A 4MQBA 2J0QA 4KO8A 2QPAA 3AVOA 3K0EA 3TE6A 4Q01A 2O52A 2D7CA 1ZD8A 2LCFA 3IHLA 1X8LA 2QI9C 1K8RA 5E95A 4CRWB 1BKDR 4JL5A 5L8VA 1BMFD 4RCYA 2GXUA 1WP9A 2ZRJA 1AIPA 3SJCA 4EPTA 2V1XA 1E9SA 5B57C 1OB5A 4NHOA 3ECCA 4MRNA 1WDTA 2I3BA 2QAGC 2GF9A 3VKWA 5CIQA 2Q6TA 1ZC4A 1U2RA 4WIAA 3AVXA 2DR3A 2YWHA 3VR5A 2VL7A 1NVWQ 1DELA 4M8NE 2E87A 3DMDA 4C0AC 3KKMA 4KVAA 1RZ3A 2GK7A 4N1AA 2YWGA 1IXSB 4TMXA 3QXCA 3BGWA 3TR0A 2Z5FA 4C2UA 3SU8A 2VP6A 1G41A 2OILA 2FG5A 3KKNA 4B3XA 3NBXX 3BB3A 1UDWA 1P75A 4WZBE 2VHCA 4CEIB 1Q21A 1QG2A 2G77B 2ZRDA 1ZVQA 2J3EA 2JA1A 3QG1A 4ARZB 3U7FB 4MGKR 4JJZA 4OL0A 1SXJB 4LPSA 5E3HA 2CLSA 1DAIA 1Q44A 4UJ5A 5DH9A 4C2TA 3MWKA 1KK0A 4IEIA 1KO1A 1OXUA 1T8TA 3ADDA 2C9CA 2HLDA 3UPUA 4OJKA 1OKKA 5BYJA 2JEOA 4NZYA 3RC3A 2JAQA 1IY2A 4LCBA 3BH6A 2H8KA 4URUR 4TMZA 4XWAA 1IHUA 3DM5A 4LYHA 1E2KA 1DADA 3NHBA 1H8ED 1TMKA 4CEJB 2OCPA 5LB2A 5L3QB 4D4KA 2C9OA 2ODBA 4QBIA 1J8MF 1YZGA 4JLOA 4MGZR 3IUYA 1OXTA 4BPBA 4ZDKA 2BC9A 3TQCA 1CF4A 4GI7A 3GJ3A 1OYYA 2NTYC 3E1SA 2IXEA 4DJTA 1U8AA 4NYIR 2VBCA 5FFMA 1NVVQ 1Z0IA 2EFEB 1D2NA 1SKQA 1GL6A 4BLRA 1ZNZA 4FN5A 4HB3A 3RSLA 3SDZA 3HPRA 3Q8XB 5DLQC 4AD8A 2HT6A 2GCOA 5IK2D 3U4QA 2QP4A 4LV5B 4KITB 5JMTA 4JLJA 4LHZA 3SNHA 2ZI6A 1JAIA 4L8GA 3D3QA 1TF2A 3W90A 1UDXA 1NLZA 2W2XA 3P4YA 2RGEA 5AUPB 4NYMR 3AVTA 4KSCA 2CXXA 4IHQA 1T0JB 2QY9A 3LXRA 2VHJA 3QPUA 1R6BX 3NTUA 2IT1A 2GCPA 4M9QA 2HYDA 2IYZA 4TYNA 2BCGY 4XVQA 2F6RA 1KSJA 3MRSA 4Q1BA 4ZIRB 4DEYA 1A1VA 3CKLA 3TUIC 4ACAA 1KO5A 1RJ9B 4Q66C 4Q9LA 1DEKA 5G3ZA 4FMCB 2ZROA 4AKGA 1CKEA 5JHGB 2LKCA 1G7TA 3ZQJA 3WNDA 1F2TA 3BERA 2FFAA 3BIFA 4ERNA 2DHRA 4Q02A 1E1QD 1JALA 2WJHA 4M9SA 1NY5A 1LF5A 3D8BA 2B6HA 4HB0A 3AKEA 3GFOA 5EXXA 4BFUA 1LF0A 1VTKA 2GXSA 1WF3A 4I4LA 4DKXA 4FWIB 5FBVB 5A4JA 2GJSA 4EPXA 1F2UA 3BB1A 3W3AA 3WP0A 4GZLA 3ZIAA 1JJ7A 2UKDA 1AN0A 2JLWA 5M04A 2QL6A 5JI3E 3DHWC 2W58A 4M21A 1CJKC 4OHWA 4QM7A 1RRCA 3T5GA 1ZM3A 1W2GA 2ZRIA 4KFRA 5L3SA 4B34A 4KFUA 5FL7A 4EFNA 1KY3A 2X19A 2ZM5A 2GZAA 2O5VA 1G5RA 2QEQA 2OM2A 4LV6A 4A8JB 2AD1A 4B32A 3WY9A 2WSSA 2FJUA 4UNNA 1IONA 5KYKA 2ZYTX 2JDID 2Z4SA 3QF4A 1AK2A 4XOIA 4HLUC 3CF6R 1HUQA 3IQXA 1KDRA 2C9YA 4FMDB 2A5JA 4LJ5A 3RANA 4FCTA 1T6NA 2VHUA 2WWGA 4U00A 2AN9A 4BLTA 2D2FA 5A5GA 1CR0A 2CHGA 2GHIA 3BBPA 2WTUA 3K09C 2RGNC 1ESMA 4TL8A 3K70B 1GL9B 3CR8A 1OT3A 3C4JA 4D0NA 1ZNYA 1H8HD 4H1VA 1ZBDA 4MGIR 2F7SA 2GAOA 2J0UA 4HUTA 3QXSA 1OXXK 1N5LA 4A4DA 3FFAA 3ZQ6A 4JVMA 4Q9KA 4BGDA 1YQTA 4IXNA 4A0HA 4G3XA 2AWOA 4V0MA 1G64A 3DMNA 1U9IC 4GP7A 4O2RA 3L0OA 3KQNA 1IN7A 2V1UA 2P6RA 2JJ2D 3W9YA 3CIOA 4OQMA 3FMFA 4BLQA 1YR6A 4OK3A 3ZLJA 5JI2E 2C04A 5CDFA 1KSGA 3CO5A 3TK1A 2R2AA 2DFLA 2ZJZA 4I1OA 1UBEA 2HEIA 1GRRA 5AUQA 3VR4A 1UADA 4I1UA 4JSYA 5EZ6B 4PPNA 2QP3A 3SEAA 1S1CA 2QAGA 4PC1A 5EE5B 3ZD7A 2FX3A 1D2MA 2ZQ5A 4CT5A 4OI0A 5FBWB 1NVVR 4TT3D 1S4QA 2QSZA 4MUBA 3IEVA 3OEHA 3RLFA 1VG0B 2AFHE 1SZPA 3KKQA 3NHAA 2GVDC 3MG9A 3OFNA 5DSZA 4KAXA 2IXGA 1UM8A 2XZPA 3C16C 3FFBA 4PC7A 4BFYA 2GCOB 5TXGA 3U4QB 3RSOA 3FVQA 5TB5A 5CJ2A 3Q9LA 2PCJA 1KK2A 2VP5A 3TVTA 2ZRCA 3MD0A 1AS0A 1EFRD 4OQXA 3GJ8A 3SOPA 1AZTA 1N6IA 4BASA 1AS2A 3EZ2A 3F3YA 5G41A 4BECA 4EJSB 4AY2A 1NJGA 4ZI3A 1QHNA 2I4IA 1RRGA 3MJHA 5FTLA 3HP1A 2CDNA 3ZGXA 2CK3D 1TNDA 2CHVA 1XF9A 4I1VA 1JI0A 5KPDA 3Q7QA 1ZINA 5DI3A 3MWYW 4KLZA 1FX0A 1E0KA 1QZXA 2A7QA 3ICEA 2FDCA 3ZZTA 1ZCAA 3UKDA 4PO1A 1F2TB 2SHKA 2O0JA 2XJ9A 4MKIA 1PUIA 4PZYA 5FOWA 3X1WA 3ZS9A 2YV5A 3DZ8A 2EQBA 1E9DA 2BM0A 1CXZA 2X2EA 3E2IA 4B3GA 1LFDB 4RFVA 3TR5A 1EFUA 4QXAA 1OW3B 3UMSA 2BMFA 3PR1A 5JECA 4WBSA 3LFUA 1CIPA 1ZU4A 2ZAOA 2BBOA 4WOPA 1NKSA 1XBTA 3SJAA 3IPYA 4P32A 1UF9A 3GEHA 5EP1A 1UKZA 1HEIA 4DLYA 1SXJC 1F2UB 2DFTA 2K5UA 4Y0AA 5CIWA 1NG1A 4DLSA 1P2VA 2WWIA 3ND8A 4LYJA 4AKEA 2A3RA 1ZCBA 4YDSA 3QKUA 3TVDA 1KZ7B 2B21A 3CBQA 1GM5A 1EWRA 2OAP1 4LUCA 5JWHA 2Q3MA 2NMVA 5JCZA 3LBIA 1WXQA 4POAA 3QEOA 5L3SB 3KQLA 1MR3F 5DHAA 2P67A 3PUXA 4CEHA 1XPOA 3KJEA 3LXXA 5DE3A 1G8YA 4RD1A 4DCNA 1N0VC 3NBFA 121PA 3LNCA 4X8HA 4ASUA 3B9PA 4LJ8A 3ZVLA 1S9HA 3QF4B 2YINC 5AJXA 4DSNA 3T1OA 2ZAMA 3UMFA 4BZXA 5J4HA 4IVPA 1NSTA 2V7QD 2QTHA 3KQUA 1U0LA 3QVVA 4NCKA 3L0SA 1VPLA 3R9IA 1JPNA 1E2EA 1RKBA 2PZFA 4UNQA 3WBJA 5BN4A 2XAUA 1JR3D 3CX8A 2AK2A 4RVCA 1NN3A 3BB4A 1TL7C 2GF0A 4MYUA 3PEYA 2KSQA 1RYHA 4RD0A 2OCAA 3IHWA 3LW7A 1ZUNB 2J0UB 2IF2A 3AF1A 3AVQA 1HE1C 1FTNA 2JLZA 4AI6A 3MUFA 1XCMA 4F92B 2DCUA 5IHPA 3Q72A 4BLPA 4G1UC 3AM1A 2W6JA 1BYUA 1CP2A 1CR4A 2VIIA 1HY3A 5B58C 3FOZA 4LPKA 5FR1A 1SKYB 3JVUA 3GJXC 1Z6YA 2ATVA 2ODNA 2R8RA 3ZVRA 3HU3A 4JBWA 4NYJQ 1J90A 2OUKA 2XJ4A 5JWRA 2JCSA 3PUZA 3B6EA 3I5YA 3U7GA 1MOZA 2PCLA 2OE2A 3WYAA 2QTVB 3B78A 3KJIA 2NO0A 2WWXA 4GOJA 4PR0A 3S1AA 2P65A 1N5KA 5EQTA 1E2HA 2HJGA 1VYVA 2IHYA 2XNDA 4WXRA 2PEYA 3QXHA 1NMZA 3R8FA 2ZU6A 1M7BA 2ZJ2A 5C1BA 1E1RD 4O0MA 3U61B 3K09A 3Q5EA 4Q7LA 3GLIE 3U3KA 2I1VB 3B2EA 3GLGE 4TTPA 2LWIA 4GOXA 4B75A 4DCUA 1GNPA 5J4YA 2ZVPX 3U5ZB 3KKOA 3LH5A 4ZKDA 2Z6VA 4AYWA 3E5HA 2WWFA 4TMWA 2X77A 1E9BA 4XTCS 3DEFA 3L0IB 3OIYA 4A8JC 4TLDA 2AKYA 1XJCA 2FGJA 5TDHA 1FP7A 2CLCX 1NLYA 2WMNB 3DKPA 3K70D 2ZJ8A 1E2IA 3NC1C 2XSZA 4D25A 1J99A 1X8JA 2GKSA 5DI3B 2QG6A 4JT4A 5KU1A 5KSPA 2JLVA 1BOFA 2G1JA 3PEWA 2J87A 1RFLA 3CX7A 5AJWA 4RFSA 1HH4A 3LA6A 1LV7A 5GVRA 2R6CA 1E96A 4GMXA 4BFSA 3IBGA 4YMSA 4OI2A 4IDQA 3UK6A 4DUGA 5CITA 1G291 3THWA 4F93B 4V03A 4DBLC 1TX4B 4F38A 1U98A 3SN6A 2HLDD 1NVUQ 2ZRKA 3L0PA 1W0KA 4M9XA 1E9RA 2FH5B 1LVGA 2WOOA 3EARA 3GJ4A 3P4XA 3G82C 1CLUA 1T8UA 2YVUA 3AH8A 3MMPA 2RCNA 3AF3A 2VH5R 2YJTD 1VYTA 2GEUA 2JLRA 4NE2A 2GEVA 1NRJB 3AVVA 3FKQA 4DCTA 1QG4A 3GLFB 1G20E 2IYTA 5FI1B 3QXJA 1N2CE 1OIWA 3CH4B 1YZLA 2QT0A 3CZPA 4M1MA 3UMRA 1Q12A 2ZETA 1M1YE 1UKEA 1VHLA 3UATA 2HUPA 221PA 1N6OA 3OEEA 4FXPA 1M2OB 4CEHB 1VKJA 3RC8A 1E94E 3K0CA 3SBEA 4IJMA 1ZUIA 2VF8A 4QHYA 4FMCF 4R2HA 1Z2AA 4X8LA 2MMCA 4JMPA 2J7KA 2ATXA 1XWIA 4C0QC 1EFCA 3B82A 1CRPA 4LK2A 4GPTA 2NG1A 1TQ4A 2OAQ1 1YZQA 4ZCLA 5H8WA 3CNLA 3FYHA 2CEAA 2ZR9A 2CCGA 4URVR 4MKHA 3VU9A 2WJVA 3RDPA 4XWOA 2C77A 1E2PA 2CNWD 2HJVA 4Q48A 2PMDA 4A92A 2HT1A 1KI3A 4EJSC 3KFVA 3QPWA 1XXHE 3EZ7A 1G18A 4IDOA 1SHZA 1SXJA 3TUZC 4LI0A 3NC0C 4PZLA 2AFIE 5JFGA 5JSZA 4NYJR 2DWQA 1YRAA 2EWWA 3PV0A 1W47A 3IIMA 3U3MA 1FQKA 2A5DA 4Z1MA 4ZPXA 4DSTA 2ZPTX 2WJJA 3B1XA 2VQSA 4W9MC 2WWYA 4J0QA 1NKTA 2BVNA 4Q9IA 3W5JA 4L15A 4LSGA 4MH0R 5E7IA 3LDAA 1W4CA 3QKSB 4V0OA 2XB4A 4NTZA 4IEEA 2Q0HA 2W0SA 4YXWA 2HYIC 1CEEA 3SI7A 5H68A 4TQUS 5CLLA 3S1AB 1X6VA 3ZIAD 5BWMA 2JJ1A 1XP8A 1U81A 2ZSFA 4FMDF 3EWAA 4LHYA 2QROA 2WBLC 2W6ID 2IYYA 2QTFA 5GADl 2OFWA 1R5BA 1TQ2A 4D2IA 2ZYVX 4F91B 4EFMA 4IFEA 4NYIQ 1SHKA 2WSSD 2P3SA 2IEYA 4TZ6A 3CPHA 4XH9B 3DDCA 3QPVA 3EWSA 2J5XA 4UXIA 1VHTA 1AQYA 4MGYR 3UANA 4BEBA 2AK3A 5EE0A 1P2SA 3WNBA 3AGQA 4IW3B 3AKDA 2YZ2A 3LVRE 3PEUA 5D3QA 4EPVA 3K1JA 1JAHA 4HYYA 4IOKA 3AP3A 2VF7A 3GP8A 1TEXA 2FPLA 1UBCA 1KNQA 1SVKA 2BBSA 2ZYUX 3CW2A 3DO6A 4UNRA 2G6BA 4RZUA 3DPUA 1ZD1A 4HI0E 4ESHA 1FMLA 1Z07A 4HZUB 3EASA 4BE7B 1P7CA 1ZUHA 4CYMA 2JATA 4EFLA 1DAFA 1U8YA 2KBEA 4US1R 4AYTA 5LPNA 2O8BA 1A2KC 1US8A 3CF2A 2NQ2C 3QKRA 3THWB 2B8TA 3CRRA 3SHWA 1KI6A 1JNYA 6Q21A 4QGHA 2BEJA 4BFXA 1BS1A 4BFVA 3FMOB 5E7MA 3ASYA 1Z0FA 4V02A 3NIBA 1KI9A 5EP4A 1FP6A 3WYGA 1U8ZA 2LKDA 4WW0A 3X1YA 3AVWA 1P73A 2P5SA 3M1IA 4TWZA 4NONA 1M7HA 3GJ6A 2NO9A 3KDSE 2DFKB 3CM0A 4WZAE 2PZGA 4DB2A 1XJ0A 1Z6AA 2G1KA 3GFTA 1X3SA 3HR7A 3LLUA 4DCSA 2C95A 1Z83A 4LY6A 2CVFA 2FSIA 3RRYA 3OEHD 4A8JA 4TL9A 1FW6A 1JR3E 2ONKA 3KJGA 1AKEA 4NCNA 1ZIOA 1CULC 1KK3A 2OZEA 4Q7JB 1YJ5A 5FPHA 3EG5A 2QM7A 3LQRA 2QZ4A 1T3HA 1ZM4A 5G3YA 4YMVA 1S1MA 4RCZA 4NCHA 2FNAA 4NL4H 4GNKA 5CJPA 3P20A 1MO4A 1UEJA 2VHTA 3TAUA 3P1JA 3TLXA 3SYKA 5KO2A 2Q9CA 2A5YB 4CIDA 3OIWA 1MKYA 2ZE7A 3MAAC 1GTVA 1SVSA 3ADKA 3T1VA 2IA5A 4PC6A 1ZIPA 4V0NA 1EXMA 3VU9B 3KQHA 1AZSC 2WZQA 4M1YA 1Z2CA 4PPFA 3SR0A 1E79A 4Q7MB 2RKOA 2NO1A 2IYLD 1L2TA 2GWHA 2H18A 2OCYC 4HSEA 1FZQA 4Q4LA 2FGKA 5L3VA 1Q3HA 4FMBB 2VHQA 2EYUA 4TYPA 1P2TA 5JSZB 4MUAA 1GG2A 1KO7A 1ODFA 1HQCA 3N2EA 3K53A 3NXSA 4IOJA 3TH5A 4C0SA 2UVQA 1M8PA 2ZRNA 1R0XA 1CJMA 4ZDIA 1TUEA 4G0NA 1CBUA 1U99A 3EAQA 3ZZ0A 3LRPA 4GP6A 3ZD6A 3GLHB 2O8DA 5J4LA 5G53C 4US0R 1A7JA 5GJWC 3M6AA 2WJGA 2ZREA 4Q03A 3PFIA 4M53A 2ZEJA 1AJEA 2ZITA 3FHCB 3NDBB 4M0LA 2VO1A 3I32A 5F3WB 1I2MA 2KI5A 1FUUA 4PHGA 3DZDA 5EZ5A 3I92A 4TQAA 4DWJA 3EPKA 1LS6A 4H9GA 4EKDA 1Q1BA 2O8FB 1AGRA 3Q7PA 4OI1A 4HLQB 1KJYA 4BLSA 1II9A 5AWFC 5FPKA 4JL8A 5FL3A 3VNVA 3PG5A 2EW1A 1W44A 4MITA 4XTRA 4RY2A 1ZNXA 2R62A 1GKUB 1Z8FA 3K9HA 1CR1A 1V43A 2FFBA 3A4LA 1BIFA 2R65A 4YMWA 2OXRA 1N0WA 4KFSA 1Z08A 2V4ZA 3EA0A 3VFDA 2N1BA 2ORWA 1FUKA 1XZQA 4TLAA 4OK5A 2G88A 1QHIA 4I81A 4EJSA 3UXMA 5B2ZA 1OHHD 1I4TD 1HE8B 1G8PA 3REFA 4M2LA 1XD2B 2OXCA 3QKTA 2GJAA 2REBA 5BQ5A 5HCNA 5K8IA 1NIPA 5JJLA 1HTWA 3UWKA 3P32A 4OHXA 4Q1CA 1L4YA 1ZM9A 3W8RA 3MWLA 1Z0AA 5FOVA 4MDFA 1DAGA 3NKVA 4S35A 4GFDA 4HB2A 4F4IA 3JZMA 3LV8A 5CYOA 1D9ZA 1I2DA 2WV9A 4HAXA 3L8ZA 4N0EA 4X8MA 4MYTA 2W6JD 4CF7A 2OCBA 2OSBA 4M1KA 2HV8A 1OPXA 3H84A 1NP6A 4PAMA 2O8BB 4Y0VA 1US8B 4BWYA 3QKRB 5KNDA 1W36B 3FHOA 1N6HA 1KI6B 4MRSA 4C0KA 4R2IA 2IYSA 3T1QA 1TF5A 1CJTC 2QNRA 2FPMA 1RVDA 4QBGB 3QQ5A 3M4YA 1NLFA 3HYTA 3I1FA 3RYTC 3U44A 1XEWY 1YHNA 4LBWA 4KI0A 4LYAA 3H2YA 4P3YA 3A36A 3AP1A 3HR8A 3KX2A 4HAUA 3CRQA 3GEIA 3U6KA 1HYQA 4QOSA 1II8A 4UNPA 2PJRA 1KI8A 3QF7A 1VCOA 4KSBA 4HUQA 4ZDWA 5JCPA 4O25A 3RRZA 3A58B 2ZS8A 3BJIC 3HDTA 4JBXA 1H65A 4LJ9A 4RJLA 3BFKA 4UXHA 4I99A 5EUMA 5EE3A 3RS3A 5K8UA 1Z3IX 2YWEA 2JJ8A 4OKSA 3O8BA 4WAUA 4KYIB 3WMEA 1IN5A 2O8EA 3IPXA 2OFOA 2W00A 4TMVA 3A6PC 1E2JA 3SHFA 5DN6A 1UPTA 2ZS9A 721PA 1G5PA 1ZW6A 2CVHA 4QNMA 3KTAA 2V54A 3CRVA 3T5DA 2J46A 2MSCB 4LJ4A 5FTMA 1UEIA 1KYIA 1YRBA 1A82A 4ILEA 1N5JA 3G0HA 2PT5A 4Q7KA 2YWFA 3VMFA 4KU4A 2YC4C 2XNSA 3TRFA 1G3IA 3V4FA 1XU4A 5EJEA 1DS6A 4HATA 4JL6A 1TUIA 3PIRA 1R7RA 2KE5A 1XMSA 2XTZA 3VR3A 3QNUA 4A0GA 1R0YA 2YOFA 4QJ4A 4H1UA 4B35A 1G6HA 1COWA 3TBKA 1KDTA 1P4SA 3BAFA 4FCVA 2VLIA 4D4JA 1SULA 1WMSA 2PH1A 1A5TA 4NP6A 1IXZA 1DAKA 3NEYA 2ZXUA 2NIPA 1Q0UA 2A5FA 3V4RA 3DVLA 4OQLA 2IS2A 2GNOA 1UBGA 4EPRA 2E9SA 5F9HA 4PSAA 1NIJA 1NMYA 1EX6A 1PLKA 3LQQA 4RD2A 3T15A 1W0KD 2EFCB 3B13B 2O8DB 4MRRA 3Q85A 2QQ0A 3BE4A 2ZRBA 3BK7A 3FDIA 5F2EA 4YONB 3SQXA 4HDOB 3VX4A 3BFVA 1JXMA 1J70A 1GNQA 3NVAA 3AP2A 1GDDA 2CE7A 3IKJA 4QNRA 3R9WA 2H16A 2XTMA 4C0JA 3OIVA 3U3OA 5FUYA 2D2EA 1T9HA 2ZUCA 5FBLB 1Z5ZA 2WOJA 1OF1A 4HAVA 3RS7A 4JVNA 1L8QA 2YOGA 4GDFA 4CZ2A 3CUEF 5DO9A 2XOKA 3I5XA 4V0KA 4XSGA 3OEED 4ON9A 2ZRMA 4LBVA 4EDHA 1S3GA 4IKEA 2ZSBA 5JBQA 2CCJA 2QBYB 2XZOA 5KPJA 3SJZA 3I61A 4NPHA 2F43A 4LJYA 3H4MA 2IYQA 2WM9B 3VNUA 3DKVA 4V0ME 1DTSA 2E1RA 4W7SA 3AB3A 4NDZA 1AGPA 2X2FA 3CLVA 1SVIA 2JGNA 3K0CC 2DPXA 4HDQB 2GEDA 5KOYA 1G16A 3RHFA 4B44A 1O87A 5BN5A 3N70A 4JLKA 3DM9B 1N0UA 2PZEA 3AV0B 4HEJA 3W6OA 1P72A 4PC2A 3LW8A 3CWQA 1XTKA 1IN6A 1B23P 1NN5A 2QRNA 1SXJD 5HZKA 3AF0A 1KO8A 3QG5A 2OESA 1KSFX 1NF3A 5AJZA 3RWMB 1SQ5A 2WIBA 1UKVY 2JASA 2X8AA 2CLDX 3L2OB 1N5IA 4G5GA 4Z1MD 1U0HC 2ZJAA 4UKDA 4LC1A 1QDEA 4MDEA 1WE2A 2BWJA 4HLDA 1R8SA 5J4KA 4KODA 3BC1A 1JECA 2VA8A 2IYXA 5BN3A 4BFZA 4L5BA 4UJ3A 3LD9A 3EA5A 3GLFA 4TYWA 3U44B 3NH9A 1N6LA 4YXWD 1D9XA 3SJBA 4FW9A 4LBZA 2QM8A 5C18A 1II8B 4K81B 5LBIA 2QMOA 3R20A 4HUQB 5FPTA 4XVRA 5FI0B 1G3RA 2ORVA 2XGJA 1P3JA 2RGBA 421PA 5EE9A 821PA 2D74A 2F9MA 1Q1EA 2FZ4A 4Q4AA 2O8EB 1M7GA 5JEDA 4KV9A 4QC2A 5CK4A 3EIQA 1Z6GA 2FSFA 4DLZA 5KSOA 3KB2A 4US2R 2RGCA 3A1WA 1EX7A 2J0SA 2WKPA 2ZRGA 3L82B 1Z28A 3KTAB 5HTKA 3K9NA 1JBKA 3BXZA 2XXAA 3PQCA 5CM8B 5E4FA 1D2EA 2V6IA 3AUYA 5KTYA 1R5OA 3NG1A 1Q3TA 5J5CA 3RS5A 1NBMA 3OESA 2WPDD 3NDPA 1GIAA 3MWJA 2G0NA 2BEKA 5G40A 1JJVA 1LW7A 4QGGA 2J7PA 3K0AB 3IILA 3VQTA 4TZ0A 1HURA 2Y8EA 1TQDA 2A2ZA 4DRZA 4Q1AA 2FMXA 1KI1A 4ZCIA 1W4BA 2B7BA 3I8XA 1HQYE 1GILA 2H7VA 3GD7A 3QXXA 1K5DA 1VG1A 5AJYA 1GRNA 1QBKC 4DXAA 2GBLC 1ETUA 1QVAA 2EFDB 2F9LA 4LHVA 4URXR 3CNOA 2GXQA 1M34E 2XTNA 4XD7A 4JKIA 4KBGA 3QKSA 2ZE5A 1ANKA 4KLNA 4G01B 5EE1A 2OLKA 3FB4A 2VP2A 1G7CA 4TSFD 1E69A 4L4UA 1GWNA 1EGAA 2BMDA 1XCPA 1XX6A 4XJXA 3MFYA 3RS0A 3AVUA 1R0ZA 3T34A 4JLPA 4MA4A 1KI2A 1W36C 2C98A 2QPOA 2W2VA 3BFXA 1DG1G 4LYFA 3JZAA 4CGZA 3I8SA 4URZR 1T3SA 2CCKA 2RGXA 2Z43A 3EXAA 4IDHA 2GZHA 3G5UA 2PX0A 2JLQA 1C1YA 5KNCA 4WVFA 3TNFA 4JT2A 5E7JA 4CDGA 4FWTA 4Q5IA 4L9WA 2QP9X 1W46A 1L7VC 4TMTA 4Z51A 3KFXA 5LB4A 2RB4A 3A8TA 2D06A 4RZXA 5GVSA 5KSYA 2ECKA 4DLWA 2G9NA 3K0SA 2BHRA 3KXLA 1CJUC 2FFHA 5KNBA 4B3FX 2F43B 2FSHA 4Q18A 4YMTA 2KWIA 1UKYA 5CLQA 4RD6A 2CL0X 2GJKA 1G5TA 2Z83A 1XPRA 1UJ2A 2RGDA 1G21E 3VHXA 3MSXA 5FTNA 3WRYC 4NCIA 2ZUBA 1OXSC 4BQSA 2P2LA 1KAOA 4JS0A 5H1YA 4A6PA 1E79D 1V5WA 2WVJA 2QQEA 4HZUA 4F4CA 4M1SA 2DBYA 3A37A 1CS4C 2GCNA 2N42A 1GAJA 1QHXA 2QT1A 2QGNA 1NI3A 4XVUA 3F5FA 3VKGA 1K6MA 1FOEB 3RS2A 3FPAA 1PV4A 4ZI2A 4ITRC 4KYUA 4V0LA 1E9FA 4YMUA 2IS1A 1KI4A 3OIUA 1HT2E 2XEXA 3B1VA 1H8HA 1KDOA 1XTSA 4B76A 1Y3AA 1OKKD 4BZPA 3A4MA 4DHEA 2YKGA 2QENA 1EWQA 3O8CA 4PXAA 4B3CA 4JBYA 3HYRA 1ZM2A 3CRMA 5AK0A 2ERYA 1F5NA 3K9LA 1RRFA 4HZIA 3IIJA 1PJRA 1KTVA 4PQRA 3ZH9B 1MRSA 3TAHA 4QHTA 2WKQA 1OIXA 4KXFB 4D81A 2A30A 1QVRA 1Y63A 1ZAKA 3BS4A 3AKYA 3KL4A 4W5JA 4C7OA 4D0GA 1OFIA 2FFQA 2OO7A 3IO5A 4A0RA 1J7KA 2BM1A 3CONA 3SYNA 5HE8A 2JLSA 1GVNB 2J41A 5HCIA 2DWOA 3U60B 3TMKA 1D8TA 2VTKA 1NL3A 4E07A 4TT3A 2NPFA 4Q4AB 2ZI7A 5JZVA 1MRNA 3EZFA 3C41J 4GBMA 2FU5C 1XCGB 3GEEA 4Q9JA 5BW8A 1HT1E 4YLGA 3VHLB 1E2MA 2XXAB 1ZU5A 3R7WA 3T12A 2IS4A 2VYFA 1RIFA 1XTQA 4Q19A 4M9ZA 3AEZA 3K0FA 4B71A 3WMGA 1XEXA 5AJVB 3IDQA 1YU9A 4G5RA 4WA7A 2P0EA 4Q4JB 1Q1ZA 2F3TA 4TYQA 5HKKA 2J45A 3GLIB 1PZNA 3GLGB 1E98A 4WXPA 4QG7A 5TVKA 4A2QA 1II0A 2ZSDA 1E32A 4FIDA 2YOHA 3C7KA 3W6NA 5SZIA 2IUUA 5C2JB 3GLHA 2MSDB 1T5LA 5FUXA 3L8YA 1N3BA 1O3YA 5FPYA 5SZHB 8OHMA 2IX3A 1F60A 1XFAA 2C8VA 3GJ7A 2YNMA 3AGPA 4PO8A 5EXPA 1W5SA 4AKHA 5AUNB 5IRCD 3AF2A 2O8FA 3VAAA 1KMHB 3N5CA 3QE0A 4PAQA 3W8NA 4DDWA 2CJWA 4EQ6A 2ZI3A 4PAOA 1E0JA 4AIIA 3U7EB 1E0SA 4NBSA 1IJFA 3O8DA 5FL7D 1Z63A 1MV5A 4B6FA 3KZ1E 1QRAA 3SYLA 3RNLA 1W5TA 2B8WA 1AM4D 3TSZA 2QA5A 3RABA 4JLVA 1EG7A 2RAPA 5TARA 1C4OA 3RWOA 4LJAA 5B64A 3QJYA 4S2EA 4P33A 2DFNA 1VDZA 2QE7A 1GKYA 2OBLA 5DN6D 1J2JA 3B85A 1XD2A 5GJVC 1DVRA 1SXJE 3VR1A 3VTKA 3UWOA 1KKMA 1T4GA 4AG6A 3B7GA 4A36A 4GMDA 1QHYA 2GBLA 4YC7A 3VR2A 2BBWA 2OBMA 1P62B 3WRXC 3KKPA 3FE2A 2H5EA 4M1WA 3WBKA 3EIHA 3IGFA 4LHXA 4LC0A 3LX8A 4TTQA 3W5IA 1XZPA 1JPJA 5CYPA 1UFQA 5HR5A 3QBTA 4DIDA 5JRJA 1YR7A 1XTIA 3JVVA 3LLMA 1JR3A 4IVQA 1WB9A 3IBYA 3UG7A 4P0TA 4AYXA 2O8CA 5FUVA 1C9KA 3PVSA 4QBHA 5CB6A 4FI3C 4JJKA 2CBZA 1KZGB 1E2FA 2EU8A 1BYIA 1Q22A 1OE0A 1DBSA 1XTRA 1YR8A 2RMKA 2VEDA 2ZI4A 1FNNA 4IOLA 4Q1DA 4PSVA 2FSGA 4TLBA 5C4MA 4B47A 1KOFA 3U7HB 1J8YF 3A1VA 3TUJC 1ZRHA 2FOLA 3CF0A 3MGCA 1QHHA 2VP4A 1IM2A 4HB4A 5DI9A 3THOA 2DB3A 3QUSA 4D0LB 4JYBA 1YR9A 1CR2A 2ZSAA 1Z6XA 3PUVA 1KAGA 1WRBA 4AWXA 2GK6A 4UNSA 3GJ0A 4JZKA 4KFTA 2V3CC 4C7OB 3W6PA 2P6UA 3DL0A 4KVGA 1RC8A 4Q47A 1IXRC 1N6KA 2A78A 3HU1A 1XXHB 2GAAA 3ZDQA 3OFND 1E9EA 5JJKA 2XOKD 2G83A 3IQWA 3ZJYA 4A6XA 3BRWD 1U94A 3GQBA 2IYWA 4HDCA 1X1SA 3BH0A 4JYCA 1Z06A 2QPTA 2BV3A 3C15C 3OHMA 2HXYA 5BYKA 4MKFA 5IDVA 2C03A 2IC5A 1LY1A 4HLCA 2QMUA 5GJBA 3DOEA 1GUAA 1DPFA 1S96A 2YHSA 1XJQA 1E1RA 1WBBA 5CB8A 1R5NA 2WAYA 3ADBA 4RSGA 2N46A 3GMTA 1E9AA 2RHMA 1IN8A 2Q9BA 4RD3A 4D6PA 2ZRFA 3R7WB 1WCV1 1FL9A 3FKSA 4MRVA 2WAXA 2WICA 4DZZA 1MO3A 1E2NA 1MT0A 2G3YA 2GJ8A 1I4DD 5KDDA 1GSIA 4BFWA 3K0FB 1DE0A 1XEXB 1XDBA 1KMQA 2WWHA 4LX0A 5FTKA 4OHYA 3WHKA 1LB1B 4RKFA 3QVUA 3CWZA 1Z6TA 1NN1A 3A1TA 5FBRB 1TPZA 4P4SA 4BRUA 2HF9A 2Q9AA 3VX3A 1HA3A 3ND9A 3B60A 2CE2X 2QAJA 4GOKA 4A2PA 1E2GA 1JQLB 1YZTA 4D4LA 2R6GA 4OBEA 4EUNA 3D7MA 1HV8A 1LNZA 3UIEA 4M1OA 1IQPA 3W34A 3THXB 1MO5A 1DAMA 4DDUA 5FPSA 4MYHA 4K46A 3NBYC 3H1TA 4CW7A 2AKAB 3F0TA 3AQ4A 4RZ2A 3THYA 5F9FA 2CJWB 4EQ6B 1XEWX 4C0LA 1W48A 2OBNA 3X2SA 2F1IA 1FNMA 1PUJA 2ODWA 1A4RA 4U5XA 1Z22A 4HAZA 1JXOA 2ZRLA 2GXAA 4PQFA 1ELOA 3U6BA 2QBYA 2OHFA 4IOMA 1ZYUA 4ASUD 4PZZA 1P2UA 4ABYA 1NMXA 2ZJOA 1OJLA 2BJVA 3RRMA 4C3ZA 1FMJA 4JKYA 4IDPA 4Q1EA 3TJZA 1KK1A 1CTQA 1VG8A 3HU2A 3SS8A 4O3MA 1TAGA 2PL3A 4DLTA 4DLXA 5LD2B 5FTJA 2ANBA 1ZP6A 3H0KA 3EW9A 5IT5A 3AKCA 1DAHA 3TQFA 3L43A 3T1TA 1G9XA 1AQUA 2BKEA 1U0JA 3UG6A 2FF7A 1B0UA 2IW3A 3SFZA 1KY2A 1SVWA 1T5IA 1NBMD 2FEOA 2G0TA 3BOSA 4JIMA 4D80A 3RAPR 1G19A 4QKQA 2NOAA 1MH1A 4LDJA 1F48A 5DISB 4BLOA 2O0HA 2AX4A 3P26A 2J7PD 3Q5DA 1LS1A 3X1XA 1W0JA 2QORA 2CL6X 3U3RA 2D7DA 4A1FA 4ZKEA 2CNWA 2O8CB 3D31A 2JIZA 2QUZA 2YYZA 5DNYB 2VSOA 4KJZA 3I62A 3AVYA 2WJYA 1N25A 5HE9A 4XD7D 2AL7A 1EESA 3WYFA 4JLNA 2ERXA 1FQJA 3V9PA 2VSFA 3BORA 1FFHA 1TU4A 4KCGA 4EIWA 4FCWA 4IXMA 4YQFA 3CZQA 3V00A 2B92A 3CPJB 4ZO4A 2GTPA 3GJ5A 3WHLA 2RGAA 4A15A 2AXPA 1QHHB 2REOA 4PPQA 2H17A 5KUTA 1OFUX 4B3BA 4QHSA 1E9CA 1P61B 1SVMA 1KO4A 4GZMA 4JSTA 4R71A 1Q57A 2XNDD 1FPMA 1W4RA 2Z4RA 3CRW1 1R10A 4DSUA 5IF9A 2UZ3A 3D6TB 2V6JA 4N3NA 5DYIA 1E6CA 1DO2A 3H86A 3HWSA 3QENA 1YE8A 2EFGA 2AXNA 3N2IA 1WBDA 3IEUA 4CVNA 1YZNA 2I1QA 3OE7A 3OAAA 3LVQE 1VG9B 1S9DA 1OSNA 2W6IA 1WA5A 4YDHB 3HPQA 1NVXQ 5EP3A 2RHDA 2ORIA 1RE0A 3PENA 3QY0A 4RZ3A 4BFTA 3TGPA 2R6DA 4Q4HA 3ICQB 2MMGA 4OQNA 2ZE8A 1OV4A 4JLAA 1G7SA 4QGAA 4UXJA 3WNCA 1OFHA 2D3WA 1PLLA 5HPYB 5H70A 3EPLA 2XSZD 4PC3A 4D26A 4G5OA 3K0AA 5FBQB 5J40A 2QMEA 2FEMA 2J59A 4NU0A 4DDTA 4ZV4A 2BDTA 4B74A 2QU8A 2GJ9A 3TW4A 1G6OA 3OF5A 4DSOA 5B30A 2L0XA 4E09A 1G1MA 2ZE6A 3QBVA 4PHHA 3K8YA 2OFXA 4K8OA 4P4SB 5JRZA 4DUGD 521PA 1W4AA 4A9AA 4A2WA 4ESVA 2QMHA 2WJIA 3LBHA 3R8CA 1ZNWA 2BMEA 2ONJA 2H92A 3EIEA 4N0DA 4B3DA 1AKYA 1EFTA 4BUJA 1TU3A 4F4JA 3QSYA 1TTTA 1OH5A 3ZS8A 1S0UA 4C0HA 1DOAA 5FUWA 2REXB 1XNJA 2GVZC 1MO6A 2R9VA 2ZI5A 2AHOA 1NG9A 5J47A 2W83A 3E70C 3THYB 4Q9HA 1K5GA 2P6NA 3DOFA 3FHTA 5LDDC 2C99A 2HDNB 2YC2C 2DYKA 3BD9A 4WZ6A 4LV8B 3C5HA 1NNEA 1XTJA 2GRJA 2UZIR 2W0MA 5K8TA 4LZZA 1KSHA 1VCNA 3ZYCA 4R9UC 2WKRA 2RGGA 2WHXA 4TL7A 3AF4A 1G4UR 2H1LA 3FGNA 4IVRA 1IBRA 4EPWA 1BO6A 4XSHA 2IYUA 4TYYA 2EVWX 2ZVQX 4P4TA 2RH5A 3T61A 1LTQA 3T06B 1P9RA 2XX3A 1BMFA 1KJWA 1MABA 2AD5A 4AK9A 3IO3A 2IXFA 5KHOC 4DVGA 3KUDA 1SKYE 1W7AA 2CHQA 3C5CA 3LBNA 5FOTA 4LBYA 4W5HA 4DCVA 4B2IA 4B6EA 4B2LA 5CDFE 4R98A 3NEJA 3P27A 4C4PA 1DG3A 4LHWA 2DY1A 1BH2A 5P21A 4AC9A 1G3QA 4NH0A 3B1ZA 1G3UA 2X1VA 4FINA 3WP1B 4E5UA 1OYWA 4MRPA 4URWR 3EPHA 2PT7A 5J4VA 5JS7A 2ZR0A 1SVOA 1VMAA 4G5QA 4QFMA 1E2QA 4RD4A 1P5ZB 3KUCA 1G3MA 5HKKD 3X1ZA 4OK6A 1VIYA 4X8OA 2OT3B 3CX6A 5FH9A 1GITA 3QIAA 4AURA 2IS6A 2F1RA 4LJ7A 4E03A 2ODEA 4LGMA 5FOXA 4XIGS 3EZ9A 2V55B 3PUWA 1GKIA 5GJCA 1OXVA 3AUXA 2VSXA 3O47A 2BIFA 3ASZA 5F98A 5D3MA 3B1WA 3REGA 2JJ1D 2IUTA 3PEVA 5EP2A 1P60A 5TY0A 3TSOA 3A1UA 2IEZA 3OZXA 1AS3A 3I72A 1H8EA 4Q21A 2ZIAA 1RRPA 2Q21A 2WSMA 3PCRB 4OHZA 3LO5A 1Z0JA 1E4YA 4L9SA 4BZQA 1S8FA 4LWZA 1R0WA 2FWRA 1KDPA 1S2MA 2ZU0C 2ZYWX 3PITA 5FR2A 4JLBA 4PO9A 1CJVC 2P5TB 2H57A 4D82A 3ADCA 1TF7A 1ONBA 2VRWA 1KGDA 3B1YA 4RKEA 4B73A 1KNXA 4OI4A 2GDJA 1D5CA 3EC2A 3O8RA 2QE7D 3NH6A 4DT1A 2HCBA 1SGWA 2VPPA 5IK2A 2BKUA 1IY1A 4Q4HB 3ZVMA 2V8OA 2F1JA 3EZ6A 3GPLA 4KHZA 4Q1FA 1OH8A 2Z0MA 4HAYA 2ZR7A 2ZJ5A 3TSWA 4NMMA 3WMFA 4M1TA 1GL7A 1OHHA 4ZDJA 4A82A 3NWJA 1Q20A 1IY0A 1CRQA 1GNRA 2XITA 3KXKA 2PLFA 4Q4JA 5LD2C 4GL2A 3A4NA 4DB4A 1CU1A 2C78A 1G8HA 2HXSA 3GLIA 3GLFE 1EFHA 4PSKA 3GLGA 1XMIA 1R8QA 3CPEA 4Q00A 1XPUA 1X86B 3AVPA 3CB4A 2NZ8A 2AWNA 1W36D 2BCJQ 4OQFA 1AA9A 2IHBA 5KDLA 2BMJA 5JS8A 4IDNA 1GFIA 3PXGA 1E2DA 4EPYA 1R4AA 3ETLA 1E1QA 1P9WA 1VCIA 3BWDD 3MLEA 4L16A 2FPKA 3B9QA 4Z8XA 2IF0A 4JLDA 1ZM7A 1OH7A 1W1WA 2F3RA 5L3RA 4F7WA 1KMHA 3KJHA 4AKIA 3MCAA 1I4LD 1XB2A 2OLJA 2GA8A 1KI7A 2C96A 3T35A 1ESNA 2FE4A 3IIKA 3M0EA 2R44A 2HCJB 4TTRA 3SFVA 5JLJA 4QBFA 1P9NA 1M6NA 2R6AA 1F6BA 4JVLA 4QM6A 1Z29A 1NBME 2QAGB 4HLUA 2WIAA 2OG2A 4D4MA 1XEFA 2ZSEA 1E3MA 5TMPA 3F8TA 3I73A 4GSYA 1IAQA 2FA9A 1G7RA 4B2PA 2PLRA 2ZI9A 1MABB 1DARA 2MSEB 3TW8B 4URYR
chains in the Genus database with same CATH superfamily
1JILA 5EJMA 4ACBA 1YAJA 2AR7A 2XB2A 3KTOA 1B6SA 4U7FA 2OV2A 2RJOA 1D2RA 3G17A 5JBIA 2QSYA 2XR1A 2AMJA 1KKLA 4UHEA 5AKXA 2Z6UA 5JMWA 4KPFC 1N2CA 1Y1QA 2OD2A 3PPXA 4IDAA 4TSKA 5TJHA 4XWKA 1QF9A 4TKMA 1U3UA 1VJRA 3EZXA 4M0KA 1KHTA 1NW5A 5E0OA 4CM7A 1NYLA 3GFQA 4K6OA 4ZCMA 4PNHA 1YMVA 4B4DA 1A2BA 1Q77A 4LIPD 3OBIA 3LKVA 4JASB 3ZV3A 1K89A 4OQZA 3AESB 2BGKA 2Y71A 4M4SA 4PS1A 3VVBA 2DG2A 3WJAA 5FOUA 2EOAA 2F55A 2D4HA 2JNWA 3HJNA 4YJGA 2C4NA 4QRDA 4PFKA 2X22A 5I8ZA 3K2BA 3LX6A 3SC4A 2PUHA 2GILA 1XTZA 3O73A 1LRLA 5JWOA 1J33A 2JLYA 4I0WB 1TQ6A 4W6ZA 5DHFA 5CYGA 4U7DA 3GLFB 4M8IA 4UAVA 4MB0A 1E0AA 4ZT4A 4HJXA 2IGBA 5LN1A 1AT1A 2JJ2A 4BCBA 1MD9A 3R6GA 3LHDA 1TJNA 3K9QO 4CMGA 2JFNA 4QTZA 4UMVA 5D3MB 2WAOA 2C7RA 4KBFA 3FWYA 4ZHSA 2XKKA 1SMKA 1EBBA 1KPHA 2AX3A 2H07A 2G5GX 2P30A 4WCVA 4Y2VA 4DPKA 1PVOA 4LYYA 1ADBA 2NSDA 1V1MB 1Z0KA 4LFBB 1WHTB 5DEOA 1Z75A 3SXPA 3QU7A 3LA8A 3ZXUB 2AFIA 4K6KA 3ZNOA 1QH0A 1QQTA 2R6HA 4DG8A 1N6RA 2FZLA 1EUDA 3O91A 4Y9DA 4YJ3A 2IZOA 1NVDA 4JGBA 4M9RA 5I9BA 2C8KA 1W9MA 3PUHA 4WK4B 1HNWB 1QAMA 1R2QA 2Y76A 1K0FA 3G7UA 2O2SA 1HDGO 3TE7A 4YYEA 3DNFA 1QYRA 4PICA 2WMOB 2NUAB 1TPYA 3FCXA 5CLGA 1UPBA 1ARZA 2JGKA 2C2BA 4MYCA 1CDZA 3A1CA 5CVTA 1A98A 1LJUA 3NIDB 3O94A 4QJ3A 1KIMA 3QI2A 4J16A 1YZUA 1IZZA 2A9KA 3O1LA 4ARAA 4JT8A 4DMFA 4MV9A 4NEGA 1Z4PX 3N0VA 1JTEA 2IFTA 1V2HE 2BP7A 2O3QA 2NSYA 3A70A 3HBFA 3PUJA 3B2NA 3ZJ5A 4YVFA 2VRBA 3KT6A 3I58A 1XSEA 1ZGJA 3LL7A 2JIQA 2OO5A 3PZRA 1I2CA 2O0KA 2R8PA 1TEVA 4PGHA 1ZD9A 3SXJA 1IJKA 1DPGA 1YOVA 3ZBUA 3I6YA 2WZDA 3RK0A 4J0IA 1T3LA 4KRFA 2JIZD 1SURA 1LX7A 4GAEA 3NAMA 2LPMA 3TX6A 4CEIA 1JT2A 3NFYA 3T4XA 4OYHA 2NACA 3VR6A 1GDTA 4LJ6A 2H51A 2IUSA 4C0BA 1DINA 2VP9A 1SM4A 4JJEA 1QP0A 1E2LA 2BT4A 2YDXA 4ZALA 4OHPA 2DAPA 2NZUG 4KWEA 5GPBA 3WLKX 4IIDA 4IRUB 1DQNA 2ZB2A 1DTEA 4FHDA 4B33A 3H9EO 3MWEA 4DLVA 5FUMA 2A0UA 1GAEO 1XMXA 2B5OA 1BC5A 3WLOA 1NN0A 3SHOA 4DG9A 1EK0A 2X8JA 5IULC 2C57A 3HN6A 1OTYA 4RU1A 3NONA 1NHGA 3CNNA 3QVGA 4JXJA 3RVLA 2DU8A 1X14A 3WRVA 3UGKA 2X1LA 1MB3A 2FV8A 4XIIA 3RRNA 4WN9B 2WSYB 5IAKA 1UOQA 1FSFA 1PWZA 1FSZA 1VL5A 4YRRA 4I50F 4MRAA 4LXYA 1XAIA 4WLEA 5AKHA 3KLMX 1AD2A 1D1TA 1AZLA 2AJDA 2V7TA 3OE7D 3GH3A 3C8UA 3HRIA 4MYRA 4A0FA 1GZSA 4B4OA 4QDKA 2B8JA 3B1JA 1KVSA 3UK0A 3BH7A 4HNHA 5ERGB 3IP8A 2DPYA 3NPAA 4QOJA 2ZUDA 2AYYA 2VP0A 1W73A 3NOOA 4C9BA 10MHA 3K8ZA 2GPJA 5D84A 2X76A 2J48A 1R6VA 1VYUA 1E4VA 2C4MA 3P9NA 4NARA 4OP2A 4RXTA 1ZJYA 2PTHA 3RVJA 3FCCA 3GXBA 3JQAB 1N6NA 3C5EA 5CT6A 2GM3A 1NJ5A 3GLHE 4WZAA 2V7QA 2H4JA 1AB5A 1EK2A 2OBFA 2P2NA 3E2PA 5TS2A 1T2DA 3O7WA 4C7JA 4O2LA 5KVSA 4FD2A 1IJEA 5EVJA 1IHOA 4H27A 4HXFB 3ZQ4A 1HK7A 1Z17A 1COWD 1F3OA 2CMFA 2JK0A 1ISSA 3C14C 3F4BA 3K35A 3EY4A 1ISIA 5ESWA 4RWEA 1WQ1R 2BFFA 1I2ZA 4N3GA 2HOQA 4GT1A 5DTJA 5I7EA 1TZMA 2GTIA 3DWGA 1IDOA 2ZB7A 1IN4A 3AIIA 2QGZA 4ZIRA 3K1YA 1JQKA 2JFOA 3GRVA 1X9HA 2WA1A 4BKPA 3PC7A 2ZZMA 2G1UA 4EZBA 1GRCA 1E7MA 5T4FA 4EA7A 8AT1A 1SVLA 4P0PB 1B14A 2PZLA 5FWXA 5JDCA 5KQLA 4RDHA 3W3ZB 4QL3A 3HB4X 1Z7GA 1ZPDA 1Q0PA 4C5BA 1BCRB 3UO8B 4FR5A 4IYJA 4DIUA 2D3TA 4TLCA 3FYUA 3G2PA 1ZG3A 5ALFA 4FYVA 1JR4A 3TLGA 2IK8A 2NZJA 1CD5A 1W1UA 2EZ9A 2ZFUA 3LWNA 4LZOA 4BTEA 3U6KA 2V97A 3E22B 5FT9A 1K97A 1V5GA 4NE9A 4C78A 1DFIA 3KB1A 2IZ1A 3CVUA 4HNTA 1NWHA 4GWLA 2HLPA 2XMQA 8ABPA 2XYGA 3N2GA 1L4FA 1YI8A 3G2LA 3MIZA 3RJMA 2E5WA 4AJEA 5JHHB 2GBGA 2Q3HA 2H1CA 2JGLA 4N18A 1S8AA 4XAQA 3FDXA 4X93A 1RMQA 3QOFA 4DC9A 2H63A 2GASA 2J9FB 2PL1A 2QPAA 3VBEA 1CPYA 1TM3E 2NXCA 4MS4A 4PG5A 2P9TA 3RVRA 3ENZA 3UNXA 2LCFA 4D4GA 4F84A 1XLTA 1X8LA 4HFJA 2EP5A 2H9IA 3UPDA 4CRWB 1SAYA 4H77A 1Q1AA 4G09A 1X1EA 1BKDR 1FC0A 5EIEA 3LO8A 4N39A 4CV0A 4RCYA 3PR2B 2GXUA 2EF1A 4B3RB 2NU6B 3IQZA 1C0PA 1UKBA 5B3JC 3QTLA 5K3OA 3GHYA 2ODQA 2PGJA 4Q6BA 5H0IA 1E9SA 4YCJA 1AX9A 4U0JA 4NHOA 4YS6A 3PYLA 1NVAA 1NPTO 3HYNA 5DK4A 4Z9YA 3BWCA 5F5LA 7REQA 4GSLA 3CLSD 1SN7A 2NVUA 1EVJA 3R76A 4JI1B 1ZC4A 3F7MA 5JRDS 3I9NA 1USWA 3WLEA 4FZJA 4PLGA 4YUVA 4DB2A 3JYNA 2PT9A 3D3KA 3V2HA 1DIAA 2FQXA 3NCTA 4N8DA 4JQOA 1FFDA 3EDQA 1G2IA 1O8BA 3T5PA 4TMXA 3OKAA 1JQAA 3TR0A 2AZXA 1JLMA 1J0EA 1TZKA 4QIHA 3DDUA 1H4TA 2CDRA 2FG5A 5FNZA 4K28A 3KKNA 1NJ2A 1AE1A 2D0PB 1SIUA 4POOA 5T41A 1EVEA 1NW6A 3BQMB 1QG2A 3GX1A 2ZRDA 1VRWA 4W7IA 5AK5A 1ZVQA 2IOYA 2J3EA 5AVRA 4ARZB 1L5SA 1JE0A 1SXJB 4XJVA 5B2EA 5DH9A 4DSAA 4HR7A 4W9NC 4HDNB 3TKAA 4FEEA 3O6VA 4TKUB 4CETA 3ADDA 5EUBA 2H2GA 3RHSA 4QYSA 3RC3A 1IY2A 2P4QA 1JG7A 3BH6A 1PV1A 4KW7A 2BM8A 1D1SA 1IHUA 2DTXA 4LYHA 4RABA 3WL8A 4MZXA 4Z1OA 4LYDA 2VR1A 3A4TA 1DKQA 5T3UA 4CEJB 2VOJA 3I28A 3D5EA 4AAYA 5L3QB 3CFYA 4Z4HA 1ZSVA 3UVEA 3MB8A 4D4KA 5L4NA 4MGZR 3PB3A 1WU7A 1EJ2A 2BC9A 4IS2A 4G8DA 5E2AA 3GJ3A 2HDOA 2GYVA 2Q5QA 2AOTB 2NTYC 3PA6A 3EMVA 2X6TA 2CV1A 4TKLA 4NYIR 5FFMA 4DDKA 3CJRA 2GAIA 3AM3A 4R41A 2HIMA 1SKQA 2FDXA 3A3YA 4IGFA 5FOQA 2C8LA 4HRVA 1OI2A 3K5WA 2QP4A 3IOMA 4LE2A 2ZI6A 1MA3A 4HQLA 3D3QA 2AT1A 1S2IA 2G72A 3I12A 3JVDA 3OM9A 1BMTA 3KEMA 3FTNA 3P4YA 3DO8A 1GU7A 3V8PA 3N07A 1WQ3A 3AUAA 1LKZA 3G7SA 1T0JB 3FF1A 4PO3X 2VHJA 3QPUA 4Q05A 4CDMA 3KPWA 4H2DA 3FNHA 1R6BX 3NTUA 1CDEA 3U48A 2GCPA 3G2NA 2X23A 1ULTA 2IYZA 2YCLA 3I5UA 3RVKA 1FFXB 1JJAA 2BCGY 1KSJA 1CUSA 1NC1A 2OAEA 3C87A 3ID6C 5DM1A 3CKLA 2W48A 3TUIC 1A1VA 4GKBA 4ACAA 1RJ9B 1JHDA 2FETA 2ZROA 3D3JA 1CQIA 1YJCA 5JHGB 2RBKA 2LKCA 2I22A 3BE6A 2OMEA 3BIFA 3PQFA 4TVBA 4TV9A 4MOWA 4D4HA 1E1QD 1OVMA 2WJHA 3HI6A 3L6CA 1NY5A 1LF5A 4ZOQI 1E7SA 2ZSJA 1P1HA 3RT9A 2IUFA 1P5RA 3AKEA 3GFOA 3PNPA 1HC7A 3K1AB 1L5ZA 2HSZA 2JAHA 2XGGA 3NNDA 4YO7A 5AHWA 6NULA 1WMBA 2QAIA 4BFUA 2WTMA 4QUBA 3KYDA 2HA4A 1KEUA 2BR3A 2GERA 2M98A 3BE8A 4HQFA 1P9OA 1WF3A 3I9JA 1VIDA 4UD6A 3VSBA 1M0TA 1K06A 1PZHA 2PO7A 4CM9D 3NHYA 3GLKA 4DKXA 1QZZA 4XA8A 2J0EA 1JHVA 2GJSA 4KXQA 5EZYA 3ZY5A 1DRUA 1EA5A 3AI3A 1M1XB 2YZNA 3HKEB 3W3AA 1X7XA 3LUBA 3ZIAA 3JW8A 1Y6ZA 3RJTA 1YK1A 4QDJA 3CN7A 1W59A 2QL6A 4D6YA 2Q2OA 3HLKA 1RWQA 3DE5X 3FIJA 1E4OA 1EVZA 2OK8A 3GLSA 3T5GA 1AK1A 4UE3S 5JNTA 2XGJA 3WGTA 1DUSA 2FPIB 2OVBA 1F8UA 3OTGA 3EUWA 4KYTA 4EFNA 5KNBD 3IVGA 4C4ZA 4L74A 2RHOA 4H59A 4RCVA 5IFLA 2AD1A 2MSNA 3IP3A 3SZOA 3D8TA 3V7YA 3THRA 4E94A 1IONA 5KYKA 1PD1A 3T5AA 1OLSA 5ALXA 1Y3HA 2G08A 1Z73A 1AK2A 1GRVA 3DW3X 4XOIA 3M4ZA 2IV3A 2M6KA 1C1DB 4BP8A 2IP4A 4MUIA 2PGXA 4JZYA 1WLSA 1KDRA 1QYWA 4R1LA 2A5JA 4LJ5A 2J67A 5K6RA 2I6XA 2X5XA 5AVWA 5BSEA 2Q1TA 2VHUA 1RRVA 2WWRA 3NR2A 4UTOA 1IUKA 5D7NA 3EYAA 4JB0A 2FEWB 1UFRA 4HMOA 3WGZA 3KCQA 4WGFA 1VGVA 1W0CA 2CHGA 2H7XA 3R4VA 3YASA 4D9IA 5A5GA 1WCIB 1TZ2A 1K5PA 2GEKA 4FP9A 3HVRA 2RGNC 1Q2XA 3GGPA 2Q7DA 3SIXA 1R1DA 4F2PA 4YRLA 1GL9B 3CR8A 1OT3A 1W88B 2VT2A 3UMBA 3K70B 5LMNB 3VYTB 1KTIA 1XC7A 1OXXK 2CBXA 4ZYVA 4JI4B 1PT9A 1N5LA 4O4JA 3FFAA 4MIKA 1IY8A 5E9WA 3I8OA 1YQTA 1PTJA 3QFHA 2ZOSA 2QTLA 3AR3A 4MIYA 4G3XA 2AWOA 4RKRA 2OHHA 1KFCB 2WU1A 3DB1A 2CLIB 1I30A 3OZEA 5EPEA 3M3DA 4CNQA 2V1UA 4NESA 1IN7A 3DLCA 3KJQA 3R3UA 2W2NA 4GPZA 4N7BA 4MVJM 3W9YA 3CIOA 3V1YA 2CXTA 1OV6A 3LC1O 2I6QA 1A4IA 2CEKA 1S8OA 2W2OA 3CJTA 4OK3A 3ZLJA 3ZZNA 1N8NA 1VLMA 3ZY2A 1R4NA 2R2AA 2LD4A 3U13A 4KRYA 3AHDA 1OGIA 3UXHA 1MXHA 4I9UA 1T8PA 4KQEA 1DRVA 1BJKA 4MX8A 5AUQA 16PKA 3BHNA 3VR4A 2AZDA 5HXAA 5JW6A 4JSYA 2AOVA 3UHAA 2QP3A 4MEJA 3GZNB 4P3NA 4ZAXA 2QRQA 1P1RA 1S1CA 4JWTA 2QAGA 4RIEA 2XQJA 4RBNA 1V37A 1TGVA 4YEDA 1D2MA 3ZKWB 4A03A 5HSGA 1G5FA 4CT5A 4OI0A 3GFGA 5NLLA 3PVCA 1NVVR 3GEPA 1S4QA 4E33A 4JOBA 3B9RA 1ZK3A 2RCYA 4BB5A 1C0EA 4MVJH 4CM1A 4P84A 3G9UA 2AFHE 1ZZGA 1RYBA 5A6SA 1OWOA 1PU2A 4KXYA 1JYSA 1PWEA 2WIDA 2FR0A 4KAXA 5HF8A 3DFKA 2IXGA 4QDTA 2Z08A 2IOFA 2XZPA 2LIPA 1LW6E 2ZIFA 2A0YA 2ZSIA 2OK7A 3IVAA 3P2EA 3Q3VA 3QUBA 4XSVA 5TXGA 4PVDA 5ITWA 3FVQA 1IEQA 2C54A 2PCJA 2VP5A 2YXLA 4MVJG 2VWHA 4MI3A 2X3UA 1LZLA 3LT2A 2AEFA 3DFUA 1O0BA 3F3YA 1JLLB 1VMDA 3TLJA 4ZI3A 3PDCA 3TTUA 2CMHA 3K32A 1CNFA 1EGMB 2XYVA 2OYCA 3MT9A 4Y2TA 3MMSA 4G1BA 4D9KA 4I7EA 3UJNA 2EFYA 2FRDC 2CK3D 1NFQA 1TNDA 2R4UA 2XUIA 1NF9A 2CHVA 2C3OA 2WU3A 2XCQA 1K0UA 4RPIA 3HEBA 2JFWA 4TV8B 1XKXA 5JSYA 3MWYW 1A71A 5DYTA 2NT4A 4WL0A 5AHRA 1SOVA 2SKEA 3ICEA 3GRUA 4NAUA 4F1JA 3AONB 1FYDA 4KR0A 4FOPA 1NVMB 2HBZA 3UKDA 4DL9A 4V0SA 4GVXA 2HB6A 2Y67A 1F51E 1PUIA 4PZYA 3X1WA 1GPAA 3BDAA 4EVQA 1ULBA 1Z6PA 1E9DA 2XUOA 1YHYA 2FMIA 3DBIA 4B3GA 2H1WA 3OCJA 1EDDA 1T6XA 1EFUA 4L72A 4R8SA 4RFVA 1KOGA 3ONDA 1OW3B 4QODA 3N59A 4J0GA 5JSHA 5JECA 2P8SA 5HDBB 2X9NA 1PJBA 1V1MA 3SEQA 1WHTA 2W8ZA 3DV0B 4DILA 4RQTA 3DTTA 3O3NB 3SQMA 3GGGA 1UKZA 1UK9A 1HEIA 2ZT6A 3PIIA 2GM9A 2P11A 4CE6A 3KUXA 4O2BF 4Y0AA 2Q4DA 1NG1A 2WFLA 1T0UA 3MYRA 2PO5A 2GAFA 4AKEA 2A3RA 1OAOA 2JL1A 2NVOA 1AGNA 3DHNA 1QIEA 3IV9A 4YDSA 3QKUA 2GRAA 1R15A 4P4NA 1DIGA 1KZ7B 1XA4A 1GM5A 4V2IA 4XX0B 3SR4A 4EYEA 5GAJA 4WKGA 4WFJA 2CVQA 1H0KA 4MQLA 1ONPA 2OO3A 3LBIA 4MR9A 1C1XA 4ZEMA 5JCZA 3R23A 5KTNA 5L3SB 2P67A 3GV0A 3PUXA 5E8RA 4CEHA 3KJEA 3LXXA 4F86A 3U4CA 4RD1A 1WX1A 2RGYA 4PX2A 4AZSA 3EVAA 1UQUA 3UH0A 4QOGA 1YZHA 1TRHA 1WXWA 3CVWA 3G2OA 1HEYA 4BX9A 1LU9A 2YINC 4O8ZA 3E9ZA 2ZAMA 1UP4A 3OZAA 1SC4A 1ULAA 3P0RA 2C4UA 5TMEA 2JFPA 2OHGA 2XUPA 2QTHA 3DO5A 3KQUA 5F1YA 1TMYA 2FEAA 3L0SA 4RXUA 4XE5A 4YT2A 2VDOB 4UNQA 3WBJA 5BN4A 1HBJA 4YMGA 5I8WA 1OC2A 4FD3A 2FFJA 1GSOA 2FZ5A 3IAAA 4MYUA 1YXMA 1AXGA 3JD2A 1X8XA 2PUJA 1T43A 3KOUA 2FW9A 5IMSA 1FFSA 1GR0A 2OCAA 2P2GA 3B7PA 3ED5A 3LZCA 3MF4A 2F62A 3HC7A 3QW4B 4J4TA 4B6RA 3N9IA 1FTNA 2JLZA 1NW7A 3BTSA 1XCMA 3O8QA 4HGYA 1CS0B 1ECLA 1GFWA 2WJWA 2R6JA 1TM7E 4G1UC 4BLPA 4C5CA 1H4VB 1BYUA 1CP2A 2OBYA 2QD4A 3FF4A 1AZWA 2VJNA 1V8DA 4TX1A 2ZBVA 4RDXA 5J2TB 4G1MB 1TC1A 1RM5A 1G21A 4KDRA 4RK7A 1L5RA 1VJ0A 3COPA 2P6PA 3I23A 3P0EA 3JVUA 2MSWA 1KFKB 3PFKA 1OGYA 4RKYA 4A2CA 3OHPA 1Z6YA 2ATVA 2ODNA 2R8RA 2VCYA 3IHKA 2OGWA 4JBWA 5D7BA 5CNJA 2OUKA 1T6YA 2XJ4A 3HDJA 4R1TA 3K7EA 4KOEC 4EJ0A 4K9NA 3NJRA 4Z4QA 1MOZA 3A6KA 1K7YA 2OE2A 4Q1VA 5ADVA 4E2WA 3WYAA 2QTWB 2VAVA 1FDRA 1SELA 4AF6A 2NO0A 1RRMA 4GOJA 4PR0A 3A26A 4XUCA 4I55F 3BDVA 3HXKA 2P65A 5HMLA 2C1XA 1I3OA 1M8JA 2W93A 3CMCO 3PJDA 2F8MA 2J3KA 4OGKA 5HQ3B 1FVXA 1XEAA 4E5YA 1HPLA 1Z4OA 4R54A 4ND3A 3FVRA 5TMBA 1YR2A 2ZU6A 3FCAA 1L8OA 4JHXA 4BP1A 3IE0A 4CG0A 4F1WA 2ZJ2A 2HWXA 1E1RD 1WG8A 2GOYA 3U61B 3K09A 5HUJA 2YY5A 3GLIE 4BS9A 1B1AA 3ZWAA 4PYKA 5ILQA 3JQAA 4UPVA 3LUGA 4HVCA 5I6DA 3E0QA 2BEUB 4CQMD 4EUFA 3KKOA 1R0KA 3KEOA 4ZKDA 3R75A 1V41E 3WGQA 2PAFA 3VR5D 5LMUB 5LQMA 3NWOA 3L0IB 5TQ2A 2NZVG 4TLDA 2AKYA 1XJCA 5TDHA 2CLCX 1I4WA 2AOWA 1PJCA 4KO4S 3FRJA 3G5LA 3LVFO 1NP3A 1VZ3A 2XAAA 1C7QA 2WMNB 1I5RA 3BSYA 4HUJA 3MUOA 2JLCA 1QOQB 3NC1C 5IDXA 1X8JA 1SA0B 2GKSA 5DI3B 2REQB 4K7JA 3AYXB 1UJBA 5KSPA 1BCRA 1X13A 2J9XB 3HA5A 3LMKA 4F1KA 2J87A 1G42A 3AW9A 1OX6A 5AJWA 5JAHA 4ZVKA 5TMDA 1RAAA 4BQRA 4WPGA 4QLBA 1SWWA 3KYIB 3TZLA 4MA5A 1PFKA 1OB2A 1N9KA 1IC6A 3IBGA 4OI2A 4YMSA 1G291 1SXHA 2O3SA 2QDKA 2UYYA 4XWTA 5K0FA 4H6WA 1U98A 2Q7OE 5D8DA 1CNMA 2ZRKA 1GPLA 2HWUA 1PRYA 3C43A 3D4NA 1VE6A 3HGMA 1AB6A 3L0PA 3ABQB 4O4IB 2C5AA 3F8WA 4KXVA 2LDXA 4YP1A 3ESXA 1LVGA 2WOOA 3GJ4A 3B1FA 2AMFA 1VHDA 4GM0A 3ZGYA 3G82C 4LAFA 4ZMRA 1CLUA 1UQRA 3LI2A 4OM7A 3HUEA 5DGHA 1O5TA 2VUHB 3DA8A 3GG2A 3H1AA 2JLRA 2BZ0A 4OHRA 2GEVA 3WYEA 4OLJA 1PNRA 1FF9A 1G38A 1G20E 2ID8A 3EXEB 2E49A 2VJMB 2X7XA 3QXJA 4M38A 4DR3B 1FX1A 1YZLA 3CH6A 3MJDA 2BTEA 3CZPA 4M1MA 5CVCA 5DHUA 2A7XA 5A9TA 5P21A 3UMRA 4ZZ2A 2Q6KA 2I3ZA 2ZETA 1AU9A 5BNFA 2H4FA 1UKEA 1VHLA 4H7EA 5IFKA 5A4FS 1N6OA 2JGAA 2NU6A 3TCNA 3W5HA 1M2OB 3MUNA 2DQSA 3ZV5A 3QJ5A 3SBEA 4IJMA 5KBYA 1KE2A 1ZUIA 4YJ2F 2IHTA 2CDBA 3JQ7A 2VHYA 3R1IA 3QX9A 3PNMA 4I4CA 4QDOA 2QN8A 4QHYA 1L6RA 4AZ0B 3D4BA 2GZMA 2RSLA 3WYCA 5HM6A 3VSAA 5IH7A 2CHFA 1IMJA 3SC2A 4ZJUA 1UMDB 3B82A 3EMBA 3HO8A 3M3PA 4LK2A 2L18A 1KZYC 4D9FA 1TAQA 3JZIA 4GZ5A 3JY6A 3A2KA 2H1RA 1UKCA 2CVPA 4YWHA 2WD7B 4IH4A 1IVYA 2CEAA 2GEBA 3DC2A 2CSXA 1J5PA 3IXLA 3B12A 3VU9A 3D7SA 3RDPA 4D43A 4XWOA 1E2PA 4UEWA 3NDRA 4N3CA 4Q48A 4KQCA 4LTDA 5GZ3A 3AI2A 3S7ZA 4MAAA 4EJSC 2A0FA 5IVPA 3CZ9A 3QPWA 4IAOA 1JWLA 3FPLA 1SHZA 4X00A 1SXJA 4DQXA 3ZJTA 3UKOA 3BAZA 4KIFA 3T7SA 3INRA 3TS1A 1PNQA 2OQVA 2JVJA 1JB9A 1QV7A 1XPJA 1R18A 5GV8A 1CVLA 4CL3A 4PN7A 4IQFA 1W47A 4R4JA 2OGSA 4TMYA 1FQKA 3ASUA 1R66A 3T6KA 4IZIA 2PFGA 2WJJA 1C3OB 1VL8A 3B1XA 3JSAA 3MA0A 4HEA6 3U3DA 4W9MC 4J0QA 1AH2A 1TYZA 2VDKB 5LOVB 2R00A 1NKTA 4Q9IA 4L15A 4WKPA 4EG1A 5AICA 1O96B 3BHJA 3OLCX 3QKSB 4MCAA 1LWNA 4PY2A 3PFHA 3C6YA 2JGDA 2QTNA 1RPTA 3JQEA 4NNPA 2V98A 4NTZA 4OMCA 5FA6A 2UUAB 5DFAA 5LLDA 2VDQB 1CEEA 1K86A 3AETB 3SI7A 5I7UA 1IZ8A 2C5GA 2CYCA 1JLSA 1X6VA 2CMGA 2ZYIA 5BWMA 1UZNA 2AOTA 3OOYA 1MTOA 2EKLA 1QPGA 2ZSFA 3KR9A 1G98A 2JHAA 2UYOA 1BE0A 4JVOA 4AO8A 1XMPA 4A8TA 4R8MA 4HK4A 4F3KA 4BNIA 4EY3A 4DWOA 4F91B 5DX1A 2IEIA 3STXA 4L28A 1QZ3A 4NYIQ 5AVQA 1IBLB 4J7CA 2R1TA 1Q7CA 2P3SA 3WOVA 4TRMA 3CVJA 4BV8A 1QQBA 3QPVA 2GZ1A 1P2FA 1OTXA 1AF7A 2B8EA 2LGJA 3BL8A 5BW5A 4MGYR 3UANA 5F3RA 2AK3A 1DKRA 2HBYA 2IDMA 5EE0A 1HZJA 4KR9A 2XT6A 4AN1A 3AGQA 3H5TA 3LVRE 2E6UX 2P9CA 2D1TA 2G0AA 3MBKA 4G4IA 4RGYA 3L4JA 1F1BA 4MYSA 5JCOA 2SKCA 3L7CA 2D5IA 4OHOA 3W05A 4DY4A 1UWVA 3MLBA 1RCFA 3AP3A 2RI1A 1PKEA 3NM5A 5DBHX 3RAJA 4EHFA 3VHXB 3CGWA 1WUYA 4KOAA 5K8CA 2PHZA 1UBCA 2J85A 1SVKA 2ZYUX 4RZQA 4UTNA 1NHWA 1PWXA 4FYMA 2G6BA 4RZUA 3DPUA 2FPWA 2JARA 1D4FA 3EW7A 1UBUS 1FMLA 5LZ2A 4ZI7A 4OL9A 1SZCA 3O8NA 4ESOA 3RRXA 3S40A 1P7CA 1R6TA 4WVLA 4ZTUB 1X3LA 3AG5A 3UB2A 1NONA 1DAFA 1MNQA 2YVKA 1U8YA 2EZTA 3AILA 3HGTA 3R40A 4G9EA 4KPUA 4Y1EA 5AW3A 1E6LA 3DAHA 5LWQA 4KE6A 2E85A 3CF2A 2LCQA 1BCSB 2JB9A 2NQ2C 4IH9A 4KPEC 2XCUA 1U3GA 3HVIA 3TW0A 1P7ZA 2ZDQA 1GUZA 2I7CA 4QGHA 2ZIEA 3TLAA 4RMGA 2R1VB 4BFXA 1T4CA 4BFVA 4MWTA 5J43A 2JFYA 4U3JA 1XVVA 1KI9A 1I7SB 4LF7B 4YUAA 3FYSA 3H5VA 5TPZA 1X15A 1QQAA 1G5HA 2JI7A 3R5KA 4M76B 1Q0SA 3N7UA 1M7HA 4PFJA 2XUFA 2A1TS 2NO9A 1H2AS 4TS4A 3KDSE 2DFKB 3CM0A 3CE9A 3LS2A 3OX4A 2PSHA 1XJ0A 2WT9A 1K3FA 2FZKA 3HO6A 4FJ0A 5E3JA 5K3CA 3HR7A 3LLUA 5BUZA 2YICA 1RQNA 4W6QA 3C6QA 2ONKA 2HV9A 4PEVA 2B78A 4CMBA 1KK3A 2OZEA 1O08A 1W8DA 4UCQA 1R64A 4Q7JB 1N2JA 3GAFA 3NTLA 3RSFA 5FPHA 3EG5A 3SF0A 3SP1A 3SSOA 2PLAA 1VGRA 2QM7A 3MUEA 5G3YA 2CFOA 3EDOA 3ZW7A 2WP8J 2JAUA 4RCZA 3UT5A 4F9EA 5A3RA 3NEPX 4RHCA 3SVTA 4NCHA 2WC1A 4NL4H 4G1VA 4GNKA 3UTDA 4MHTA 1MO4A 2VHTA 3K16A 3QMVA 3MCZA 3P1JA 1W19A 4FU0A 4V1CA 1SKAA 2RHRA 3OIWA 2BELA 1RC1A 2ZE7A 3PRHA 5EINA 1WVMA 1C7JA 2I78A 2HWYA 2IHJA 3O3CA 3PC4A 3NTRA 4J0KA 1NNI1 4PLFA 4PC6A 4EY8A 1ZESA 4X65B 1ZIPA 3DL2A 2D8AA 5IVKA 2EQAA 3R7LA 3GLUA 4M1YA 5KREA 1ZGGA 1Z2CA 3SR0A 3WLSA 4R2WA 1U0RA 3KHKA 5DX0A 1L2TA 2IYLD 1OBCA 2OCYC 2GZSA 1KS9A 3K9BA 1FY2A 1PEKE 2ZJ3A 5B6JA 1SUDA 1Q3HA 3HNRA 3ZD8A 4E6PA 3F5DA 4XYGA 2EYUA 5IAEA 3L84A 4A5OA 3DAYA 3SZUA 5JSZB 2TS1A 1KO7A 1ODFA 1IOLA 3QW2A 3TCXB 4PNPA 3RFCA 4EG7A 1P7PA 2W71A 2UVQA 3BGOS 3PFFA 4KDCA 4L0QA 4QJBA 1WCYA 4DNPA 3ILHA 4G0NA 2WU8A 3ESAA 3HDHA 4D9CA 5JH7A 5FAKA 5TR9A 3ZZ0A 1CZUA 4GP6A 3GLHB 4M98A 5J4LA 5G53C 5GONB 3M6AA 1URPA 4Q03A 5I51A 2Z8XA 4QQNA 3WQSB 3DEKA 5AVVA 2PK3A 1YFLA 4ZJPA 5HCUA 3F9CA 3PDUA 2IU0A 1IEXA 3DNMA 3LHKA 1SKMA 3FTFA 4LVNA 4PHGA 5MFZA 1PVVA 3DZDA 4NLLA 3OU2A 4TQAA 1J9EA 2DC1A 3IXQA 5ED0A 1QU2A 1XZNA 5CH5A 4H9GA 1FXWA 4Z7NB 1E1LA 4LQCA 4BNKA 4XXHA 2J5QA 3NUGA 4QYWA 3I76A 1AGRA 1ACMA 2AJCA 5LA6B 1II9A 5AWFC 1Q7RA 3NNSA 4JL8A 3A6FA 5C3UA 2GZ2A 2WE8A 3HWRA 3IMGA 3LX4A 3PG5A 1LQTA 4KQ6A 5FL3A 1ZNXA 1V0JA 1GKUB 1UPCA 5CLIA 1UMBA 2VJQA 1VL0A 3RU3A 1LJ8A 4CL2A 4L8WB 1Z38A 1XDZA 3KQQA 5E4JA 3E3OA 4TRRA 5JO9A 2ORWA 2YJ5A 3H3XA 1FUKA 4X1YA 3VFDA 5KX5F 1XZQA 4AS3A 4TLAA 4WNIA 4I81A 2VH2A 2E48A 3WWZA 1B0ZA 4BZZA 5J1SB 1I4TD 1IUPA 2HGSA 3C7TA 3V33A 4R9NA 5K20A 1G8PA 3REFA 4N5DA 4TS9A 3AINA 5CCBA 4BN0A 5JZBA 1N2GA 1D6SA 2RKBA 1UBOS 4HH3C 3ZDAA 1NAHA 2EWMA 2AW3A 3KVRA 1KFEB 1AVTA 1P77A 2W5UA 3N8GA 4RPJA 5EKSA 3PRJA 1HEUA 1H9BA 4N4AA 1EP3B 1HTWA 3UWKA 1OX4B 3Q7EA 3TRJA 3P32A 3TXXA 2PUAA 4Q1CA 5CH3A 4F85A 1BRTA 3CCBA 2JFBA 3FZNA 2VBIA 3OCZA 1H4SA 3MWLA 4KHPB 2HA5A 4P22A 5LJLA 3M6WA 2C31A 4PWZA 1TAUA 1DAGA 2PY6A 4JK3A 1EFLA 3LLVA 3NKVA 5IKMA 1QU3A 5J2UB 4F4IA 3JZMA 1TVEA 4LZLA 3MQ4A 3NRJA 5EMNA 3L8ZA 2Q2QA 1V48A 2P41A 1RLJA 1PJAA 4RE5A 4JI3B 4EELA 2OCBA 3FUTA 4KAFA 1GD1O 2APJA 2D0DA 4PAMA 4HRAA 2O8BB 3JQ9C 2XKAA 4Y0VA 3ILVA 2V3VA 2QXUA 3H2GA 1DOHA 2GN4A 3EEOA 1V9CA 3QKRB 1TCUA 1W36B 5ARCA 4YRGA 4C0KA 4UVEA 3BRSA 5A7GA 1VSVA 4FFRA 5I9NA 2B8NA 5LIPA 3E6AA 1CUWA 1CJTC 1FLAA 4RX1A 5L7WA 5MFPA 3DJYA 3LCCA 4LF6B 4J1QA 4E7OA 3QQ5A 3M4YA 1Y8QB 3G0IA 4YAEA 4ZAVA 4F5DA 5GZ1A 2B4YA 3EODA 4UTXA 3LZ6A 1ABBA 4FC7A 3AP1A 3O3OB 3CRQA 4QOSA 5G4KA 5KWVA 2VAWA 2ZK7A 1L5MA 2C2YA 1KI8A 4NFYA 4NZZA 3CZ4A 5DYYA 4BGIA 3Q88A 3S0JA 1JFTA 4ZDWA 1CQWA 4AZ3B 2EW2A 4RTQA 4B4UA 1X70A 1VB3A 3HDTA 3FUWA 1VKRA 2HC9A 3IP5A 2VXBA 2J3IA 5EUMA 3O8LA 4HDRB 3SSAA 3LBYA 3TRDA 2OYSA 2YY6A 3ZCSA 4X44A 2O8EA 2BDEA 2XNHA 2WG1A 2MOKA 3W5CA 1AMUA 1E2JA 3GY0A 5DHSA 1POXA 1UPTA 3IVCA 2DUMA 1G5PA 5REQA 3W2TA 4EYQA 1MAUA 3CRVA 3WQQA 2J46A 4IDDA 5DU2A 1TJ5A 1A82A 1N5JA 2X6QA 3DOHA 4ND2A 1MT3A 1WCXA 3DG9A 3GUCA 2PT5A 3FTDA 4MUGA 4Q7KA 3G0HA 3WK6A 1H05A 3VMFA 1O97D 1WBJB 1UBKS 3RYHA 4BNJA 1XU4A 1DS6A 4HATA 1GLGA 3ROKA 1Z5UA 4C3UA 2KE5A 1XMSA 3FJ1A 3P4UA 4GQIA 3VO2A 1R88A 2E4YA 3VVLA 2H2IA 1R0YA 1CS0A 1O9GA 6PFKA 3WIBA 1COWA 3TBKA 3TXYA 1P4SA 2ZTVA 3HZOA 3BAFA 1DSSG 1NRIA 3KT0A 1EAMA 1SULA 4P3KA 4D4JA 1WMSA 4NP6A 4RSMA 3GPBA 4B83A 4OQQA 1OBHA 4IV5A 1RE1A 1SUCA 2FUEA 2NIPA 3H2HA 4KIWA 4QFBA 4U7GA 5J63A 5TGZA 5B3KA 4UARA 1H4QA 4ZODA 2IS2A 3DXYA 4MULA 3KYJB 1Q0RA 1PR3A 1NBEA 5AJHA 2XTAA 5AHOA 1EE1A 1NMYA 1PLKA 2CJPA 1GLVA 1NFFA 2OBXA 1CUEA 3PNLA 3T15A 1WY7A 3W2EA 3U56A 1E63A 2ZJ0A 4Z4EA 2O8DB 4UM7A 5F2EA 5K9ZA 5CUQA 1Y8RB 1ZI6A 4J2TA 4O4HB 3VX4A 3ECSA 1JXMA 1J70A 1ZGCA 1P0PA 3G0CA 2CE7A 3IKJA 4MQMA 4QNRA 3BEOA 4UBJA 1HRDA