3GJ8A

Crystal structure of human rangdp-nup153znf34 complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
204
structure length
204
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGESEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 70
structure length 204
sequence length 204
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj8A00
4LOAA 4PZLA 3SNHA 3QF4B 1GNRA 1R2QA 5FR2A 4DLZA 2WWFA 3M4YA 3OIUA 2XNSA 2FSFA 1Z07A 2W6IA 3CRVA 3D7MA 3S1AB 1W4CA 3FPAA 4CZ2A 2FA9A 1VECA 1YE8A 1NVUQ 3PENA 4LGMA 4A0RA 2XNDD 5IRCD 4WA7A 4KO8A 3IGFA 2AX4A 1E2EA 1G3QA 1KI7A 1YZQA 3AKYA 3CR8A 2AXNA 1W4AA 2RGAA 1CEEA 2O0HA 3MUFA 1A4RA 3U7FB 2G88A 3U6KA 1RJ9A 4DB4A 1NY6A 2XXAB 4Q48A 4URXR 3CF0A 1WQ1R 4TQUS 1F60A 4WOPA 4DVGA 1F6BA 1WRBA 1W4RA 2AR7A 2OSBA 1CLUA 1GSIA 2RHMA 3Q7QA 2O8CB 2EWWA 1SVSA 2ZANA 5EZ6B 2EYUA 3RWOA 3K9GA 5DLQC 3TAUA 1JECA 4XVRA 3W5IA 2V1XA 2H18A 2PBRA 2FH5B 4KFRA 3IUYA 4HAWA 4KFUA 1X1SA 2CK3D 1N6HA 4LJ9A 2ZR7A 4QNRA 2FN4A 4V03A 5JJIA 3CWZA 1OIWA 3WBKA 2GAOA 2ONJA 2AL7A 3I5YA 2F1RA 3PUZA 3CF6R 3D3QA 3P32A 5J40A 3U7HB 2JLRA 2I1QA 4XTRA 1ZD9A 1PZNA 2ZPTX 4BZPA 1KI3A 3A4MA 4D4JA 1OXXK 3GEEA 2HXYA 4DLRA 3NEYA 1R5BA 2BCGY 1W48A 1G5TA 2ATXA 1AN0A 3ZD6A 2D06A 4DDTA 4OKSA 3B60A 1N6NA 2J45A 4A4DA 2IWHA 2ZUDA 1X8JA 3I4LA 3Q3JB 2I4IA 3SJAA 1W0JA 2G0NA 4ZKEA 4JL8A 1YU9A 1A2KC 2JLSA 1K6MA 2CVHA 4XTCS 4HAUA 2ZYUX 2EFEB 3U6BA 1WE2A 3QKRB 4DRZA 2IW3A 1E4YA 1UKEA 1FQJA 4MRNA 3AVWA 5B30A 5FPYA 1E2NA 1SHZA 1PV4A 1W47A 1XEFA 1WBDA 2P5TB 1I2DA 2QP4A 1AA9A 1GOTA 1BH2A 4OQLA 4UNQA 2RGGA 2CL7X 1KI1A 2V4ZA 3KTAA 4X8MA 1E9FA 5IK2D 5EQTA 3P20A 2A5GA 3DOFA 3FMOB 1CULC 2W6JA 1JJ7A 3OE7D 4P4UA 1G9XA 1CR2A 4LJAA 3BC1A 3WP1B 1KHTA 2QNRA 4ESHA 4DT1A 2YWHA 4V0MA 4R71A 5C4MA 2XJ9A 2QUZA 5JJKA 2GXQA 5FL3A 1D8TA 2RGNC 1O87A 3NH6A 2F9LA 4JVSB 3ZVLA 2GXUA 4JLOA 1U9IA 3IILA 4AD8A 3OEHD 2X1VA 4JBYA 2E9SA 1B0UA 2EFCB 4JL6A 1OFTA 1LY1A 3FHOA 4B48A 1S4QA 4F4CA 4KI0A 3ND8A 2VQSA 1W44A 3LLUA 1CR0A 4P4TA 2ZI3A 3QKRA 2RGDA 4RD6A 4RD3A 1UKZA 2G0TA 2H5EA 1SHKA 1R0XA 5FFMA 4PANA 4JKIA 1TU3A 2V54A 5JMTA 2PT5A 1Q20A 1H8ED 2DBYA 3K1JA 5CDFA 4IOMA 4TLAA 3HU3A 2ZSDA 4S2EA 3R9XA 1TNDA 3VNUA 1Z08A 4QBHA 2BDTA 5H68A 3GJ7A 2QP3A 4U7DA 4M0LA 3CWQA 5TVKA 2XJ4A 4RJLA 3FTQA 4TMKA 2ZJ5A 5DNYB 4DLUA 5AK0A 1TQ4A 4KYUA 1GL9B 4TYNA 1R0ZA 2ZJZA 3OIYA 3CUEF 4PHTA 4A8JC 4UJ3A 2FSIA 5FOVA 4C9BA 1MABA 1S9DA 5F2EA 3H2YA 4I99A 2V8OA 1RZ3A 3LBHA 4Z1MA 2BOVA 4DDVA 1GFIA 1L4YA 3V4FA 2NO6A 2ZRCA 1GAJA 3FWYA 2PL3A 1QHIA 2VTKA 1G41A 5SZHB 1KI9A 2GCPA 3CRRA 5ANRB 2GJ9A 4Q4JB 4UXHA 2REXB 621PA 1P2UA 2GJAA 3K09A 5FH9A 3QPUA 2FZLA 4A92A 2XXAA 3U60B 2VF8A 3VR6A 4LSGA 3QJYA 2JLWA 1P72A 2EVWX 1QHHA 2D62A 2P65A 4JKYA 4CEHB 1JAIA 4G5GA 3T12A 5KPJA 4AG6A 3UPUA 3AKEA 1XD2A 4OI4A 4L5BA 4ERNA 521PA 3NKVA 1G1MA 3KKMA 2GXAA 1NJGA 3S1AA 1G3IA 3WP0A 2JCSA 1T4GA 2PJZA 3K53A 2FEOA 3P4YA 4GOKA 3SHFA 5AUPB 2FSGA 3AH8A 4JYCA 1MOZA 4DB2A 1U99A 1OPXA 2ASEA 3D6TB 1VYUA 4IDQA 4DZZA 2UZIR 1IM2A 1WF3A 4JIMA 2CNWD 4RZ3A 5JEEA 2FWRA 2XOKD 2HJVA 3WBJA 2Z43A 2ZRBA 1IAQA 2ZRKA 4DCSA 4EPVA 5JCZA 1WDTA 2CE2X 2J0VA 4Q4JA 2IYWA 3NC0C 4D2IA 2BKUA 2F1IA 4FMDF 2ZJ8A 4JLDA 1Z6TA 1FW6A 3VR4A 1XFAA 2VIIA 3A4NA 3AKDA 1E98A 3VU9A 2O8EA 5JEDA 1HY3A 1N5JA 4D4LA 1Z47A 1TPZA 4LJ4A 2MMCA 2O0JA 4BFXA 3HJNA 2QQ0A 5AJVB 1P2VA 3QY0A 2R9VA 4PSKA 2KSQA 1NVWQ 1LV7A 3AP2A 3L0IB 4HATA 1KOFA 2A9KA 1DAGA 1CJMA 2O8FB 1Z06A 3QXHA 4NBSA 1DAHA 3RS3A 1VMAA 1G8HA 3GJ4A 3U3KA 3CH5A 3VX4A 4B35A 1T0JB 2FFAA 2QPOA 4C3ZA 2GF9A 2CLDX 2XNDA 3K9HA 3ND9A 2O8DB 4XH9B 4WVFA 4D26A 1JR3E 3ECCA 2OCAA 1D9ZA 5DIFA 3MMPA 1ZJ6A 3NVAA 4CW7A 1WCV1 3B13B 2W0MA 4EUNA 2BIFA 3KB1A 5FPTA 1EWQA 1Y3AA 4DSUA 1E1QA 1IQPA 3CR7A 3IBGA 3FYHA 2ZIAA 3IIMA 1VHLA 3EIHA 1II8B 2ZE6A 3TBKA 2O8BA 4G5QA 1CKEA 1FFHA 2QTHA 4YMSA 1X6VA 1X1RA 2IX3A 1E9SA 2WWYA 5EXSA 2CCGA 2R6AA 2FOLA 4H9GA 2ZJAA 4IDPA 4IOJA 4B3BA 4MA4A 4GZLA 3FKQA 4DLVA 3W6PA 2WPDD 1AKEA 3JVVA 2QBYA 1T8UA 1AJEA 4OYHA 4LK2A 1Z22A 5JWHA 4UNSA 2DCUA 1GWNA 1E9BA 1IHUA 1QHGA 1VG9B 3V00A 2R44A 3B9PA 1ZVQA 4IDHA 1NL3A 4KBGA 4M1SA 5L3SB 3G5UA 3BORA 1GKIA 2CL0X 2F9MA 2H16A 4W9MC 3MG9A 2OZEA 4JMPA 4QC2A 4M1KA 5EXTA 4Q00A 2IT1A 3ICEA 4LJ5A 4A9AA 2GJKA 4GZMA 1T3HA 3K0FA 4OHYA 1FNMA 4I1VA 3TR5A 3THWA 3NBXX 4PZZA 1FTNA 1AM4D 1E2IA 2F6RA 1JXOA 2ZE8A 3GJ3A 1N5IA 1YR7A 4LV5B 4X8LA 4W5WA 1JAHA 3CNLA 4RD1A 3MCAA 4HAXA 2ZQ5A 1NSTA 3SYLA 3X1YA 4EJSA 3AUYA 1OF1A 1UFQA 3R20A 1P6XA 2GESA 3E1SA 1KJZA 4YC7A 4EPTA 2ZJBA 2FPKA 1R10A 2QT1A 3CPHA 4B2PA 1KK2A 1N6OA 1XEWX 3PITA 3Q9LA 1E2LA 2XITA 2RGCA 2GTPA 1NBMD 4MRSA 1FTSA 4OK3A 1DTSA 2DYKA 4M9XA 1QZXA 2Q6TA 4P4SB 3K0FB 4B44A 3PUYA 4BZXA 1E2FA 1OYWA 4Q1EA 4HAVA 1N6PA 2NO0A 3ZDQA 3KQKA 1E0KA 3BH6A 3H84A 3I3SR 3F8TA 2AN9A 3RS0A 2X2EA 3OFND 4Q4LA 4B32A 4JS0A 4AKEA 3LX5A 1KAOA 4M9QA 1GDDA 4MGIR 4Q1CA 4RFSB 1XWIA 4TMVA 4UNNA 5E3HA 4C0AC 3SQWA 2O8CA 5AJWA 1OXVA 4TQAA 2XTMA 5B57C 2QA5A 4CEJB 1KSGA 1LF5A 2WIAA 3A58B 1GRQA 4CF7A 2PJRA 3K0AB 2GJ8A 1M7HA 1ZNXA 5JZVA 3DZ8A 2KB0A 4YMWA 2ZSEA 3SYKA 4ON9A 1HE1C 4NTZA 3LDAA 3GLFA 3LW7A 1U90A 1KJWA 2Z4SA 4A8JA 3UWKA 4TYWA 4IVPA 3ZZTA 2QTVB 1IN6A 3QEJA 2QEQA 4DCUA 4E09A 5TDHA 2CNWA 4B47A 3RRYA 2FV8A 4W5HA 4KSCA 4B43A 4UNPA 4TYPA 1AS2A 2VP6A 1AQYA 4IHQA 1XXHB 3OZXA 1PLJA 5KNBA 3SR0A 1QF9A 2RAPA 5TV2A 4NCJA 4M4SA 3LVRE 2LCFA 1IN7A 1JPNA 4B76A 1TQ6A 2DFNA 3MGCA 4Q21A 4YMUA 3BIFA 2ZI5A 1G6OA 2QL6A 3QVVA 4W7SA 1JR3A 3A1TA 1ESNA 1IN8A 3SE0A 4JYBA 4XJXA 1M7BA 2NG1A 3NHBA 1II9A 1Q57A 3QENA 4Q47A 4WW0A 2CLSA 3AGPA 4CGZA 2QG6A 2B8TA 3HYRA 1K5DA 4PC2A 1QDEA 3KKOA 4Q1FA 4FMBB 4PQFA 4QHSA 1Q1EA 2QAGC 2BJWA 5CYPA 3MJRA 2WWXA 2OT3B 5H70A 4MYTA 2LKDA 5C4GB 1NIPA 2J0QA 1RFLA 3QKSB 2DB3A 4DLSA 4MRVA 1W36B 1XJCA 1JEEA 5DHAA 1TF7A 3NIBA 1W2GA 3KKNA 4LX0A 3IIKA 1BMFA 1G20E 3UANA 2SHKA 4TL9A 5J4LA 3Q5DA 4BECA 3IQXA 2CL6X 4MKHA 1R5NA 1A7JA 1E2JA 3C15C 3OFNA 3ADCA 2CDNA 1TL7C 1U8ZA 1XMIA 1P4SA 2V7QA 5SZKB 4PO9A 2ZI9A 4URZR 2DY1A 2JLYA 4JT2A 1NVVR 2VHTA 2IYVA 2J5XA 3AEZA 3BB3A 4Q19A 2P6NA 5EP2A 4BLSA 3GMTA 2OEPA 2XSZD 1E3MA 4GI7A 3AVVA 4TL8A 2BBOA 2IEYA 2YVUA 2Z6VA 1MO6A 4BRWA 1G8FA 3DL0A 3LLMA 1IY2A 2QMOA 4KODA 3LV8A 4BLRA 4EQ6B 3T15A 2JLXA 5KO2A 1S8FA 3X1XA 4POAA 3A6PC 4PC1A 1M7GA 1ZCBA 2HYDA 5CIWA 5DI9A 1JBKA 2QRNA 4NZYA 1FX0A 1N6IA 1OH8A 4CYMA 3LH5A 5FPSA 1BS1A 5L3QB 3KQHA 4Q7KA 4FMCF 2QN6A 4P0TA 5JECA 4HB0A 4CT5A 1IY0A 4LV6A 1JR6A 2RB4A 4OL0A 4Z8XA 4B74A 3ZZUA 1TX4B 1S1MA 2OFWA 4TMTA 1SVWA 2J41A 2OBNA 4JLMA 4DSNA 1P61B 2RHDA 3KXIA 2REOA 3BOSA 4PC7A 4XIGS 3WMEA 1N6KA 1ZM3A 3WY9A 4TSFD 1U98A 1E1QD 4TLBA 1MRSA 5G40A 4ARZB 4YQFA 4US0R 4QGFA 4E07A 4JLJA 4B3CA 4KFSA 2X8AA 3FKSA 3IPYA 5EP1A 1MABB 2YJTD 1YJ5A 3KKQA 4HDQB 4ZV4A 5FTKA 5CLQA 2ECKA 4HLQB 2A7QA 4IXMA 5GJBA 2FG5A 3U7GA 2MSEB 4R2HA 2PX3A 2QPAA 3RNLA 1G7RA 2WPDA 1PUIA 1ZM4A 4GL2A 3W6NA 3Q72A 1XCPA 3B1XA 2IA5A 3Q8XB 1GRRA 1OFHA 1E99A 3NH9A 4JLPA 2RH5A 1A2BA 3LX8A 421PA 3W3ZB 2GHIA 4A8JB 4AKGA 1RE0A 1N2CE 4IXNA 1JJVA 2OFXA 4IOKA 4BFWA 3AVXA 2WJJA 4C7OB 2GZAA 3GFOA 3GP8A 1N5KA 2ZR0A 3QVUA 4OQNA 3K0AA 1M8PA 3A36A 1QHYA 4NYMR 1LTQA 2CHQA 2J87A 1LVGA 2EW1A 2WVJA 2MMGA 1EWRA 2H7VA 2R2AA 1P9RA 1E1RD 3EIEA 4BRUA 2EFGA 4FWTA 1NP6A 4GBMA 2PCJA 1EK0A 1CF4A 2WWHA 1J8YF 3U4QB 2D2EA 1N3BA 2C95A 4TTRA 1OT3A 1QHNA 3AF0A 3DDCA 5LB4A 1R0YA 1A82A 2PEZA 2FEMA 3L2OB 2UKDA 5C2JB 4CRWB 5DGXA 5JWRA 1D2MA 4P4SA 5B2ZA 4Q03A 5J4KA 1S3SA 3UK6A 5GADl 4L4UA 4AG5A 4DJTA 5IF9A 1LB1B 2XGJA 1S96A 3B82A 3DM9B 1SULA 4QJ4A 4YXWD 1G7CA 1E0SA 2QQEA 1OJLA 1N6LA 4MGYR 2ZI7A 3A8TA 2W2XA 5HTKA 2HV8A 3CX6A 4HB2A 3R9WA 1PUJA 1JQJC 4WZ6A 2OILA 1ELOA 3VX3A 1OFUX 1RKBA 1SXJA 3C14C 4QJ3A 3CBQA 1SKYB 2QAJA 5FOTA 2G1JA 1P5ZB 2F3TA 3L0SA 4A1FA 3T1TA 5BXQC 2G77B 1XEXA 1EX7A 4C2TA 4YMVA 2YYZA 2QM7A 3TUJC 3DPUA 2WZQA 4JJZA 1W36C 3O8RA 3LNCA 1M1YE 1WP9A 2QU8A 3A1VA 3BWDD 1LNZA 5FTLA 3P4XA 1VYVA 2WJHA 2FFQA 3NBFA 4KCGA 4FD2A 4MRPA 4QL3A 5CLLA 4DC9A 4QGHA 3ZVMA 1KKLA 4Q4HA 1TADA 1KNQA 2VLIA 3MWJA 4RCZA 1P2SA 1OB2A 4AY2A 4N1AA 1US8A 5TARA 5FL7D 2GF0A 4GFDA 1NMZA 5L3SA 4TZ0A 2VL7A 1XPUA 3SJCA 3QBVA 4F91B 1R5OA 1NI3A 3FMIA 5TMPA 2JLVA 1U9IC 1RIFA 4TWZA 3U3OA 1ZD1A 1OHHD 3BB1A 5FPHA 3W3AA 1ODFA 4U02A 4Q9KA 3HWSA 3GJ5A 4XWOA 2VPPA 4PPFA 5GJWC 2YINC 1TMKA 2DFLA 3OEEA 4Q9LA 1RRPA 1PLKA 1J8MF 1FUKA 4E5UA 3U3MA 3LQRA 1NN0A 3CPJB 1VYTA 1T8TA 2D7CA 4LHZA 2G1KA 4KV9A 1H65A 3A1SA 3QSYA 2NO9A 3FGNA 5EE1A 3NBYC 3NXSA 1FMJA 5CB6A 1AIPA 1PVOA 1MRNA 4NDZA 4O0MA 5JLJA 2C98A 1CJTC 1HV8A 2P6RA 5BW8A 2H8KA 1UBEA 2YWGA 1G8GA 4C0SA 1AZTA 2WHXA 5BN3A 2J46A 2N42A 2VHCA 1W46A 2R8RA 4S35A 1QBKC 1IXZA 1S2MA 3DEFA 2XTNA 5FTNA 2KI5A 3LXRA 1D6JA 1DAEA 1G8YA 3K0CA 2ANBA 3OE7A 4RZXA 4WIAA 1H8EA 1W5TA 4YXWA 2BC9A 1QG2A 1VG0B 1ZYUA 2WAYA 3IHLA 4F38A 3GFTA 2GK6A 1CU1A 3MAAC 1OKKA 2Q9BA 1GUAA 2UVQA 3PEVA 5LBIA 2X19A 3QE0A 3UIEA 3UMSA 1K5GA 2FNAA 2IYZA 1KDTA 5SZJA 1IXSB 4H1UA 4DEYA 3BB4A 3W8NA 1DPFA 2ZRGA 1JB1A 4QFMA 1YZGA 1ZMXA 4EPXA 1XJ0A 2BEJA 3EWAA 3EZ6A 4QBGB 4KXFB 3SFZA 3O8BA 1SZPA 4GMDA 3HR7A 4EPRA 3DMDA 3TVDA 3OEHA 2F1JA 2HF9A 5BYJA 4G01B 1P3JA 1KO5A 1SVLA 2FX3A 1UKYA 3MFYA 5EP3A 3SI7A 2ZS8A 1G18A 3DKPA 2GRJA 5L3QA 5GVRA 2QTFA 2ZYWX 1N0UA 2RMKA 1G8PA 3B6EA 2CHGA 3DMNA 1YRBA 2JIZA 1IJEA 1MT0A 1E32A 2VP5A 3DO6A 2C03A 1XPOA 4YMTA 3KQNA 4A15A 4EQ6A 4BFUA 2ZRIA 4MQBA 4LJ6A 5FI0B 5JWOA 5GJCA 1ZCAA 2IEZA 2PCLA 3TLXA 2NZ8A 4PHGA 4C0HA 2ZYTX 2W83A 3VR2A 2ZITA 4JSYA 1QHHB 2V9PA 4Y0VA 2PMDA 2Q0HA 4CDGA 2CK3A 2UZ3A 3EA5A 1ZNWA 3EASA 4US1R 3VR1A 3REGA 5BWMA 1XD9A 4ZDWA 3PG5A 4BGDA 2ZJYA 4ZIRB 2EYQA 1XD8A 3I72A 5DISB 3AVUA 3C5CA 1IONA 5EJEA 2XX3A 1XU4A 2DHRA 3RABA 2RKOA 2XZOA 1E9RA 4IFBA 1E2MA 2QE7D 3KDSE 2XEXA 4TSFA 3OESA 4YDSA 4BFZA 3VTKA 1TUEA 3D31A 2QORA 2FDCA 2BCJQ 2RGBA 4B6EA 4OJKA 1M6NA 1UM8A 4J0QA 4HUTA 2IYYA 3VMFA 2R6DA 2BMDA 3J81k 2VSXA 3HYTA 1KNXA 4PC3A 4LZZA 4DUGA 3QOFA 1J7KA 1P75A 3WYFA 2IUTA 2ZSFA 2W6ID 2WWGA 4LC0A 3THOA 4AC9A 2NQ2C 2K5UA 3AVQA 2ZRPA 4PPNA 4BLTA 4AKIA 4HYYA 1BYUA 1S9HA 2G6BA 3QKSA 4KAXA 1QG4A 2GILA 4Q4AA 2VP4A 3GLHE 4MKIA 1E2KA 1KKMA 2WSSA 3VQTA 5HZHA 5JHHB 3JZMA 1MO4A 1E2HA 1B23P 3EAQA 1SQ5A 3VR3A 4CVNA 4LYJA 4FN5A 1HH4A 2O0KA 4PHHA 1E9DA 1ZNZA 4R98A 1A1VA 1E9EA 4DLYA 3TQFA 1UEJA 4FCTA 2B6HA 2ZR9A 1P9WA 3OHMA 3RHFA 1XXHA 8OHMA 1NRJB 4M8NE 1TEXA 1XMVA 4BFVA 1KGDA 3K0SA 3G0HA 2VA8A 4HEJA 2AFHE 3X1ZA 3MWLA 4D4KA 5FUXA 5C46F 5HPYB 1UDWA 4DKXA 4US2R 3GLGB 4QOSA 5FL7A 1FPMA 2CVFA 1YRAA 2WJGA 4DCTA 1U0LA 2CHVA 1N6RA 1DO2A 1T5LA 1VCOA 3EG5A 3I73A 4Q7LA 4AIIA 3E70C 4YDHB 5J4HA 2B8WA 4LBZA 2Q9AA 3KZ1E 2D74A 5KSPA 2ZS7A 3W9YA 4Z1MD 1EFTA 1TTTA 1DG3A 1YZLA 1I4TD 3EZ9A 4TYQA 5CJPA 2J9RA 4LBWA 3A4LA 2ZROA 3KTAB 1OIXA 4RFSA 4WZBE 4PTLA 1E79D 3R8CA 4B3XA 1S3GA 2DWPA 4AYWA 1P2TA 4WBSA 2QSYA 3U44A 5FI1B 5CM8B 4V0OA 2V1UA 4RZUA 4LJ8A 1JR3D 4AI6A 1KY3A 1S1CA 2CCJA 4OHWA 2VF7A 4LHXA 1HUQA 1U0HC 3B1YA 4BFSA 1OXSC 1P62B 2J0UB 2F7SA 4EFMA 4RD2A 1YR6A 3KJGA 2BBSA 5KPDA 2FFBA 1W4BA 4KHZA 4ZI3A 3ASYA 3EZ7A 4M9ZA 4XVQA 5FUYA 3PV0A 5DI3A 2ATVA 3SBDA 3U3JA 5K8LA 4B2LA 1RYFA 1Z2CA 5JS7A 4JVMA 3ICQB 4PQRA 1XP8A 3PUVA 3BFVA 3OF5A 3PCRB 1DARA 4F7WA 2VHQA 4B71A 5LD2B 1SVKA 3DZDA 2DFKB 2ZVPX 3CNNA 3GD7A 4NYIQ 3R7WA 1KMQA 4ACAA 2IWRA 1E94E 2JGNA 4W5JA 3TQCA 5KDOA 4ABYA 2G9NA 1E69A 4L8GA 4D0NA 3FVQA 3MRSA 4LBVA 4B3FX 3IDQA 3C16C 5EE5B 4HDCA 3O47A 3PUXA 5CK4A 1ZD8A 3PEWA 4OK6A 1US8B 2Q3MA 2O52A 4NYMQ 4JJKA 4CEIB 4Q1AA 1T6NA 2GEDA 1GP2A 1CP2A 2QP9X 5CM9C 3IQWA 3PXGA 4Q4HB 5E7JA 2IHYA 4DLWA 3THXB 4BLPA 3RS5A 4DIEA 2BMEA 2NZJA 4MITA 1U94A 2DWOA 1K8RA 4I81A 1QHSA 3F0TA 3I61A 5IK2A 1U8AA 4OI0A 5JFGA 3MSXA 4EFNA 1G3UA 3QIAA 2H1LA 2BEKA 3NHAA 3HDTA 2KE5A 1OKKD 4QM6A 2B7BA 2Q3HA 1MV5A 1RYHA 3SN6A 3U2QA 2ZUBA 4HAYA 1ZU5A 3TK1A 4KFTA 1EESA 2AFIE 2C04A 4D82A 4JSTA 3QF4A 3HU2A 2AXPA 2HDNB 5HCIA 2O8BB 3L43A 1NLZA 1MO3A 1Z0IA 4IDOA 4NH0A 4XD7A 1KZGB 1AGPA 2ZAOA 1VKJA 4M53A 1W36D 4FI3C 5HR5A 1AGRA 4O3MA 5AJYA 4AYXA 3FB4A 1ZP6A 4Q18A 4M1YA 3AVPA 5SZIA 2E87A 4UJ5A 1II8A 3CX8A 4HAZA 1CR4A 1DAIA 4OJQA 2ZEJA 4TMWA 2O8DA 2XOKA 3MWYW 3HU1A 2ODBA 4PZYA 4G3XA 1IN5A 5KOYA 3PEYA 3HR8A 1TQ2A 1JXMA 4KBFA 4Q66C 2IUUA 5FOUA 2BVNA 2HT6A 4X8OA 4JBWA 2JLQA 3PUWA 4NCHA 3R8FA 3QNUA 5KSOA 3REFA 3OEED 1W0KD 2FJUA 1Q1QA 2REBA 4JLBA 5DN6A 1YQTA 3BXZA 1F2TA 1GNPA 1G64A 2ANCA 2PT7A 1Z3IX 4JBXA 3K0CC 4ZPXA 3QPVA 5EP4A 1N0WA 1GTVA 3HPQA 3ADBA 4LJYA 2OCPA 3X1DA 3VU9B 3EWSA 1G4UR 5EE3A 4A2QA 1HURA 3M1IA 3LD9A 5JCPA 4A6XA 4MRRA 2KBFA 1BYIA 4LHYA 2IYSA 4BASA 5JJLA 2HCJB 3GLIE 3PIRA 3IIJA 4KU4A 3SBEA 5DYIA 2W00A 2Q9CA 4A0HA 4FXPA 4GSYA 3UMRA 1Q21A 2G83A 2IK8A 4XSHA 1Z8FA 1NN3A 1ZUIA 3WYGA 4P3YA 1TEVA 4ACBA 1XRJA 1C4OA 4PR0A 4MDEA 4DSOA 1FL9A 2XZPA 1DS6A 2ZAMA 4ARZA 4D25A 3AP3A 3ETLA 3JZAA 3AKCA 2IYUA 2VP9A 2AD5A 1HYQA 1BO6A 4BFTA 4JVLA 1GITA 4KLNA 2CEAA 4Q02A 3AF3A 3BRWD 3L8ZA 3AQ4A 4DIDA 2GCOB 2V55B 2ZVQX 1ANKA 1RRGA 2X2FA 3I8SA 1S0UA 3JVUA 1NVVQ 3LAWA 3VKHA 2I1VB 3K0EA 3U7EB 1WXQA 4B6FA 1XB2A 3B78A 4M1TA 1E0AA 1OSNA 1ZIPA 3T1QA 1FX0B 2C8VA 3KJHA 1OHHA 4L15A 3OIVA 4CIDA 1KO4A 3QPWA 2PH1A 2ZETA 3F3YA 2BBTA 5IT5A 2C9CA 1OH7A 1NG9A 4Q9IA 5IHPA 5E95A 1U2RA 2A5YB 2A78A 3EARA 4I1OA 1G21E 5J5CA 1F2UB 3V4RA 2WKRA 1DAKA 3N5CA 3AF1A 5CJ2A 4FCWA 4MKFA 5E7MA 1VPLA 3IBYA 3GLGE 4M1WA 3LA6A 4L16A 2AHOA 4TTQA 1R8QA 1CRPA 1AQUA 2EFDB 2ERXA 2YZ2A 4RZ2A 2FU5C 2YKGA 4KYIB 4XSGA 3RC8A 4C30A 1NNEA 1NJFA 1J2JA 4TQ9A 5HE9A 3GCGA 4TL6A 2E1RA 1QHXA 2WJVA 3SEAA 2FFHA 3W8RA 1DOAA 1XMJA 5KNDA 4E22A 2GXSA 3ZH9B 3P27A 1JEDA 3NC1C 821PA 2EU8A 3TRFA 4PAOA 5KYKA 4FWIB 2ZSAA 4V0KA 2GWHA 2V6JA 4HUQA 2NMVA 1H8HD 4TLDA 1D9XA 4DLXA 3AGQA 2V3CC 2IF2A 3T34A 2IXEA 4LBYA 1SXJC 2C5LA 1DO0A 1KYIA 1T91A 3B85A 1BIFA 4IW3B 2ORIA 2C9OA 2OE2A 1VG1A 2A30A 1YR9A 2QENA 4WXRA 5H1YA 5AJZA 3B9QA 3ZZ0A 3O8CA 3BERA 2J0SA 3L0OA 3QEOA 2GCNA 4Q01A 5A0FA 5FOXA 1W5SA 3CNOA 4NKRA 2PZFA 2AWOA 1YR8A 4RD4A 3QF7A 4R9UC 1OYYA 3TIFA 3PQCA 3T1VA 3GJ8A 5EXPA 4D6PA 5GVSA 1UEIA 4LRWA 2I3BA 1HT2E 1ZC3A 2Q3FA 2ODEA 1GNQA 2XZLA 5A4JA 4AWXA 2KJQA 3BH0A 1SGWA 2ZS9A 2HUPA 1LW7A 1UBFA 2GZDA 3FE2A 3K70D 4C0KA 3CZQA 2VSOA 1T0HB 3GFPA 3SS8A 2CLCX 3RANA 1NVXQ 3OAAD 4D4MA 2ZJ2A 3AVOA 3KUDA 2DR3A 2JJ2D 1FUUA 4RY2A 1UBGA 2ZRAA 2ZYVX 4DCNA 2R6CA 4JLNA 4QBIA 1FOEB 1G4AE 1KZ7B 1TQDA 5BN4A 5LB2A 1A5TA 3FDIA 2VSFA 4PPGA 2QSZA 3LBNA 5FUVA 2GVZC 1Q44A 3FHCB 2CXXA 2JJ1D 3N2EA 1W0KA 5KUTA 1ZUNB 2IUSA 1UPTA 2J7KA 4OHZA 1IOZA 4O25A 2GNOA 4M1MA 3CPEA 1XF9A 1NMYA 1J99A 3CRW1 1GKUB 3HP1A 4TT3D 1SXJE 4A6PA 4O2RA 2HT1A 2PEYA 2XSZA 3BFXA 2ORWA 1GIAA 1YZTA 4Q7MB 4L9WA 4RKFA 4ZO4A 1ZAKA 4HI0E 3ZVNA 3KUCA 2QT0A 1ZU4A 2AK3A 4D81A 3VFDA 3AVTA 2RGEA 5G41A 2OHFA 5L3VA 4MUBA 3TNFA 4MGKR 3R7WB 2JJ2A 4Z54A 3ZD7A 4YLGA 3UKDA 3B1VA 4JT4A 2NPFA 1E79A 4A2PA 3SJBA 4XD7D 3CX7A 4P32A 5KSZA 1XEXB 2YOFA 2EWVA 5F98A 4HB4A 3H4MA 5CYOA 1EFHA 1W2HA 4HUQB 1OLOA 2WSMA 3K8YA 1OB5A 5J4VA 4ZCIA 5IDVA 4F4JA 2W6JD 1MH1A 1OFIA 1Z0DA 2D2FA 3K70B 3B5JA 2C96A 2BMJA 5ELXA 5HCNA 2HF8A 2IYXA 2J1LA 1IJFA 3BAFA 2QGZA 3TW4A 1G19A 1XCGB 3E5HA 2L0XA 1XBTA 4LHVA 4HLUA 4RCYA 1RJ9B 4UXJA 1ESMA 1PJRA 2IS1A 3ADKA 1VCMA 4JZKA 5CITA 3RSLA 2J7PA 2J59A 3IO5A 4IRUB 4LC1A 3DKVA 3ONWA 2VRWA 4QJ5A 1XTJA 1P7CA 1F48A 1KK0A 1CXZA 1COWD 4K8OA 1WA5A 2BM1A 1CIPA 1F2UA 4Q7JB 5LPNA 3U61B 4R2IA 1ETUA 5TB5A 1FP7A 1PLLA 4CT4B 1H8HA 1HQCA 5DN6D 5EXXA 4GPTA 1LFDB 1UJ2A 1ZM7A 3BGWA 4IKEA 2QBYB 4B3DA 1GVNB 2AKAB 4Y0AA 2GBLC 2OLJA 4JLAA 2P67A 4PC6A 3BJIC 1XXHE 4I1SA 3ZGXA 1KMHA 2C99A 2WIBA 2GCOA 3CLVA 4N0DA 1U81A 3C7KA 5KU1A 2ZUCA 3I32A 2HLDA 3KX2A 2P6UA 4NP6A 3VAAA 2G3YA 2GK7A 2Y8EA 3P1JA 3EPKA 3KXKA 4F93B 1L7VC 2W58A 4DUGD 3SOPA 4M22A 1OV4A 2OV2A 2NOAA 1FNNA 2DFTA 4KSBA 5KDLA 5L3RA 4TLEA 5EZ5A 1UBCA 1YHNA 1FP6A 4Q9JA 3VNVA 1ZM9A 1ZM2A 4QHTA 2RCNA 1GILA 4G5OA 2FF7A 3RRMA 4FCVA 1KDRA 3IKJA 1Q3TA 3NTUA 1R0WA 5DH9A 1RPZA 2QE7A 2QROA 1T3LA 4NCNA 1NLFA 2WAXA 5G3YA 4MYHA 4D0LB 3EXAA 1NKSA 6Q21A 2Z5FA 2YWEA 2P5SA 4TTPA 5M04A 2OM2A 3O8DA 4QNMA 5CDFE 1HA3A 3EZ2A 4NCKA 3EPJA 5BQ5A 2HYIC 3B2EA 3WMGA 3I1FA 4XWKA 5K8TA 5D3MB 4NYJR 4NMMA 4BLQA 1SVIA 2BV3A 1E4VA 3LO5A 3UWOA 5P21A 1DG1G 1FZQA 1N0VC 2LKCA 4DXAA 3SYNA 4C0JA 1F2TB 2FSHA 4URVR 1EFRA 1KI6B 2BBWA 3DHWC 3ZQJA 1XEWY 4RKEA 2O8FA 1XX6A 2PX0A 1EFCA 4MKGA 3C5HA 3MJHA 1T9HA 1ZNYA 3CH4B 2OO7A 3R9IA 2JDID 4TZ6A 1KK3A 1XCMA 1IN4A 5KNCA 2NO7A 2R62A 4HZIA 4K81B 3WNBA 2JIZD 4Q5IA 1XTRA 4I1UA 2YC4C 2YOGA 4BLOA 3TVTA 2WWWA 3ADDA 2IC5A 2VYFA 3KQLA 1XPRA 4OHVA 2JEOA 2CBZA 1CTQA 2BKEA 1NIJA 3TAHA 2ZTSA 1KMHB 2AD1A 5AUQA 3GLIB 5D3QA 5E7IA 1XNJA 2ZRHA 2ZU0C 4LUCA 2GA8A 5C18A 1NF3A 1JNYA 2OBLA 4LPSA 1ZINA 1Q1BA 1KO1A 4G5SA 3B7GA 2WMNB 3N70A 1R4AA 4WZAE 1W49A 3H1TA 4IDNA 2WICA 2GJSA 3RS7A 1CJKC 3PEUA 2W2VA 2EFHB 3KB2A 2B92A 3TW8B 5HKKA 1VG8A 2ZRJA 2ZRDA 3W5JA 1OE0A 3AM1A 4ZDIA 3T5DA 3ZJYA 1Z2AA 4CEHA 4DBLC 1D2NA 2CCKA 3RLFA 3K70C 3EW9A 1L2TA 1GKYA 4LYFA 4N3NA 1KDPA 1TF2A 5JBQA 5KHOC 4U5XA 4HLCA 3THXA 1KO7A 3C41J 3MLEA 1VDZA 1EX6A 2XAUA 3UG6A 5BYKA 1VTKA 2ORVA 1MKYA 1Q0UA 1XMSA 1JI0A 2BJVA 2H92A 3WYAA 1RRCA 4HB3A 2AWNA 3WNDA 3GQBA 1OH5A 1SVMA 3GPLA 1OXTA 1DADA 1RC8A 3ASZA 1LF0A 3A37A 3C8UA 4G5RA 4MUAA 2CJWA 1E0JA 4EPYA 3DM5A 1G7TA 2W2TA 4WXPA 2GKSA 4JL5A 1NLYA 1N25A 1EG7A 1T3SA 3ZQ6A 1G3RA 1RVDA 2IS4A 3D8BA 3EC2A 2NPIA 4OI2A 2ZE5A 1Y63A 3RS4A 4PHFA 4C0BA 5AUOB 3QXJA 4QGGA 2OCYC 2V6IA 1AS0A 4AKHA 3W6OA 3CW2A 1W0JD 4IEEA 5JSZB 2C78A 3GLFB 4C2UA 3N2IA 4NONA 1N5LA 2FE4A 3X1WA 5B58C 3VKGA 4AYTA 1BMFD 4EKDA 4A0GA 1KK1A 2OLKA 4DSTA 2VBCA 1AKYA 2W0SA 1WB9A 4C0QC 2F1HA 4QGAA 3LW8A 4GOJA 1GRNA 3CKLA 2WKPA 3U44B 4FIDA 4PX9A 3B1ZA 2EQBA 4HZUA 2B21A 2WKQA 1ONBA 4IEIA 4K46A 4OBEA 1NN1A 4M21A 2H57A 2IBMA 5KTYA 2Q21A 2ZREA 1Q3HA 1EFRD 1E2GA 2D4HA 2C77A 1UAAA 4JVNA 4ZDKA 4Q1DA 3SHWA 4E03A 1NN5A 1HQYE 3TE6A 1KI8A 1NMXA 2CE7A 2VH5R 3RC3A 3AUXA 2Z83A 5FBWB 5JS8A 2A2ZA 3AF4A 2CJWB 1BOFA 1SXJD 4GP6A 3GLGA 5FR1A 1U0JA 3TSOA 2PLFA 4NE2A 3ZS9A 3AV0B 2J7PD 2A5DA 4BE7B 2A5JA 3KJIA 4FMCB 2FPMA 1D5CA 1KAGA 4R7ZA 4HLUC 4PFSA 3IO3A 5DE3A 1SKYE 3K09C 1VCNA 1Q22A 2WM9B 3NG1A 2OUKA 1DELA 5HZKA 3LVQE 4EIWA 5FOWA 4PAMA 4C4PA 4F92B 2OAP1 3I92A 1X86B 2NO1A 2QY9A 3CRQA 3QQ5A 4G0NA 1RW4A 4WAUA 2DWQA 4ASUA 1UADA 2GAAA 5FBLB 1M74A 1EXMA 4II7A 1E1RA 2OG2A 1AZSC 1Z63A 4XOIA 2ZRMA 1SXJB 4KJZA 1G291 2R6GA 4FINA 3UMFA 4URUR 2F43A 2XB2A 2H17A 1Z0FA 1G16A 4GMXA 2ZRNA 4NYIR 4GOXA 4DDUA 4F4IA 4A2WA 1TAGA 4RFVA 1JPJA 2JLZA 1IY1A 2ZI6A 3VR5A 3GLIA 5TY0A 1NSFA 3AB3A 2B7CA 1I4LD 1HT1E 1XJQA 3IPXA 1XZPA 1YZUA 5C1BA 4GNKA 1KSJA 4FW9A 1GL6A 5FUWA 5F9FA 5J47A 3GJXC 2WMOB 1NBMA 2VO1A 3F5FA 3E2IA 3CM0A 2WOOA 3KL4A 2R6FA 1II0A 3T06B 1FQKA 2GETA 4ZIRA 3LRPA 4BUJA 5KSYA 3TR0A 2PZGA 1V43A 2VP0A 4UKDA 1KI2A 2BM0A 3FHTA 1ZC4A 1X8KA 2VHUA 4ASUD 1E2PA 4OHXA 3TJZA 4ITRC 3L82B 4OI1A 4UNRA 4C7OA 4URWR 3I62A 3KFXA 4PQYA 5JRZA 3GLFE 1Z0JA 4B33A 4EPWA 5FBQB 1UKVY 3CO5A 1XDBA 2VP2A 1HEIA 1DEKA 4IJMA 1QRAA 2D3WA 2WWIA 1QVRA 2BWJA 1CJVC 2QAGB 3EC1A 4URYR 1E6CA 3BK7A 5DYGA 4D80A 3RWMB 3KQUA 3DOEA 5D3MA 4V02A 3TGPA 3QKUA 2P2LA 1FMLA 5EE9A 4QG7A 2HCBA 1P9NA 1XTKA 4U00A 4GP7A 1WBBA 2PMKA 1J90A 4UXIA 4XWAA 3WRYC 1TUIA 2QI9C 5JI2E 3ZS8A 4G1UC 2ZRLA 4ZCLA 1KSHA 4EAQA 4TT3A 3EPHA 3UG7A 3KKPA 1Z28A 1M34E 4NU0A 3CZPA 2QRZA 3TUZC 4RSGA 4LI0A 4NPHA 1JALA 2NTYC 1OXUA 2IYTA 2OFOA 2IHBA 3KJEA 4TMZA 4ZDJA 1R7RA 1SVOA 3PJRA 3UXMA 3QBTA 5HE8A 3K9NA 2QAGA 5CB8A 1GM5A 3CF2A 2QGNA 4M2LA 5AJXA 2KBEA 1GL7A 2JAQA 2PZEA 2P0EA 2GVDC 4XVUA 4QBFA 1OH6A 5KDDA 2J3EA 1Z0AA 3WXMA 221PA 3OAAA 4EJSC 1YVDA 4D0GA 2QMHA 2YWFA 3G82C 2HEIA 1MR3F 2ODNA 2JA1A 3SFVA 2C2HA 5GJVC 4O2LA 2YOHA 4LCBA 3SJZA 4PPQA 1MO5A 5FPKA 3FMFA 1Z0KA 3LFUA 4PSVA 3CB4A 4QM7A 2VHJA 1XD2B 2JASA 4NL4H 1HTWA 1AS3A 1Q1ZA 1C1YA 4FMDB 5FTJA 3A1WA 1KTVA 4UQOA 3BBPA 2XB4A 3UATA 1M2OB 4LV8B 3W34A 4PXAA 1G17A 5E4FA 4MYUA 1Z6YA 5L8VA 1KY2A 1SKQA 1V5WA 3C4JA 3SZRA 1R6BX 4YONB 3SQXA 2C9YA 1W7AA 3L0PA 2LWIA 2R65A 4B73A 4ZCMA 3FFAA 2OCBA 3M6AA 3OIWA 4P33A 1VHTA 2FPLA 2GBLA 1I4DD 3QXXA 2DPXA 4HDOB 4LJ7A 3RRNA 3SC3A 4EFLA 4QHYA 5F9HA 3EZFA 3FOZA 4IOLA 1E9CA 1GG2A 1KO8A 2ONKA 3QXCA 3RSOA 4A82A 4BFYA 3THYB 2IYQA 1CBUA 3H0KA 1F3OA 1WMSA 3KXLA 1BKDR 3NWJA 2F43B 4BZQA 3NEJA 3CIOA 1G3MA 1KSFX 3GJ6A 721PA 2IF0A 5EE0A 2VEDA 4PO8A 4DCVA 4CEIA 4LPKA 1KDOA 3Q5EA 3CONA 2IYLD 4HLDA 4LDJA 3RYTC 2WBLC 4OK5A 5JI3E 1E2DA 1VIYA 4NYJQ 3QUSA 5B64A 3SU8A 4I4LA 1OIVA 2YV5A 4V0ME 4DLTA 1L4UA 2ZSBA 3X2SA 1O3YA 3AP1A 2IL1A 4TL7A 5UKDA 4DDWA 1G5PA 3AVYA 1XTQA 4MDFA 2V7QD 4C0LA 3I5XA 2YC2C 4Q1BA 3QXSA 2RGNA 5FTMA 1X3SA 3IHWA 3PFIA 1GZSA 4B34A 2JLUA 3RRZA 5LD2C 2IS6A 1Z83A 3FFBA 2QPTA 5DI3B 2ZI4A 2GZHA 2O5VA 4EDHA 1KJYA 2OXRA 3GEHA 3TH5A 4BEJA 4ESVA 3B8HA 3VHLB 4B3GA 3TMKA 3I8XA 4LHWA 1F5NA 3TKLA 2ZE7A 2JDIA 4BPBA 3NDBB 4DT1B 1DBSA 2J0UA 3Q7PA 1UDXA 4Q9HA 3ZIAD 5FBVB 2D7DA 2BMFA 3GJ0A 3T1OA 4CEJA 4KVAA 1CR1A 4ILEA 1OW3B 5EUQB 3U3RA 4PAQA 3PVSA 5K8UA 2WJIA 3U4QA 3B1WA 5DO9A 1YZKA 2IXGA 2ZJOA 2QZ4A 3SDZA 5JRJA 4HZUB 4QKQA 4A36A 5H8WA 4GRAA 2OESA 4LWZA 5J4YA 2N1BA 4BEBA 2P3SA 1Z29A 2PLRA 1D2EA 4V0NA 3IEVA 2WV9A 1IXRC 4Z51A 1LS6A 4QXAA 4ZI2A 2ZM5A 1HE8B 1TU4A 1DE0A 1EFUA 4N0EA 2QM8A 5JSZA 2WOJA 3QKTA 2KWIA 3NBZC 5G3ZA 1J70A 3V9PA 4IVQA 5G53C 4TMXA 1Z5ZA 3RVBA 4KLZA 3TUIC 1U8YA 4BQSA 1NY5A 3RS2A 4EJSB 3CRMA 3M0EA 2ZRFA 1XZQA 2FMXA 4QRHA 2HLDD 5JHGB 2Z0MA 1ZRHA 3U5ZB 5BN5A 4IFEA 4TYYA 2IXFA 4RD0A 1EGAA 3HPRA 1VIAA 3T35A 2ERYA 2AK2A 3THWB 2YHSA 4NCIA 1DAFA 2A3RA 3KFVA 3VKWA 5K8IA 4B75A 1ZBDA 1CRQA 4L9SA 1KIMA 3LQQA 3LY5A 5AUNB 3QG1A 3BFKA 5DSZA 2WJYA 2QMUA 1G5RA 4Q4AB 1Z6XA 1IBRA 2F55A 5AR1A 1UF9A 3A1UA 2JJ8A 1COWA 1YKSA 3MWKA 3RAPR 3WRXC 2OXCA 3QG5A 3EA0A 1XTIA 1I2MA 1CJUC 2XTZA 2FGJA 4DHEA 4LY6A 1YZNA 2MSDB 2GEVA 3FMPB 1RRFA 3PR1A 4M1OA 2MSCB 3L8YA 5LDDC 3THYA 1NBME 5FBRB 2X77A 4JLKA 3TSWA 5TXGA 1XTSA 5DHFA 5A5GA 4ZKDA 2Z4RA 1CS4C 3BD9A 1ZIOA 2JATA 1R8SA 2FGKA 2AKYA 3FKSD 1JQLB 1NG1A 3TSZA 1P73A 2HXSA 3WHLA 3ZVRA 4LYAA 1Z6GA 3GEIA 4P31A 1KI4A 1ZW6A 3LWNA 2GDJA 4KVGA 4KITB 3ZYCA 2A5FA 1ZUHA 3BH7A 4BWYA 3Q85A 2QMEA 1DVRA 2N46A 5CK5A 1DAMA 1VCIA 3WNCA 1P60A 2TMKA 5EUMA 3VHXA 4DEXA 3BE4A 2CMKA 1LS1A 1C9KA 1TF5A 1QVAA 2HJGA 4PO1A 3K9LA 3RDPA 3GLHA 121PA 1T5IA 2NGRA 4OQFA 5HKKD 3EX7C 4GDFA 4RVCA 2IS2A 4DWJA 3LBIA 5CIQA 1AK2A 3P26A 3BS4A 3WHKA 2ODWA 4AK9A 2BHRA 3EIQA 3LXXA 3DVLA 5FOSA 4IVRA 1KI6A 4MH0R 4Z8YA 1G6HA 2JJ1A 1Z6AA 2YNMA 4MYCA 5AWFC 4OQXA 4HSEA 2ZU6A 3MD0A 2OBMA 3NDPA 2NIPA 3GLHB 3H86A 1E96A 1E9AA 1W1WA 3W90A 1NKTA 5F3WB 2O8EB 4V0LA 2ZXUA 3ZLJA 2F3RA 1E2QA 4TN1A 3QI2A 4X8HA 3IEUA 4AURA 4TLCA 4B2IA 3WMFA 1Q12A 3AF2A 3T61A 1L8QA 2OAQ1 2WSSD 2GEUA 2WTUA 3EPLA 1G7SA 4MGZR 2FZ4A 2RGXA 3T5GA 4PSAA 4JLVA 4GT1A 4NHOA 4OQMA 3ZIAA 2IYRA 4A0FA 4LYHA 4H1VA 4M9SA 1X8LA
chains in the Genus database with same CATH superfamily
4LOAA 3SNHA 1QQ7A 1XF1A 2YIVX 3QF4B 1GNRA 2X9QA 4TUYF 5FR2A 2XEDA 3M4YA 1A76A 2BEUA 2FSFA 2IP2A 3GT7A 3AR8A 3IMEA 4NMWA 3NBQA 3C6MA 1FU7A 3VPSA 4A6DA 3EMBA 1L4MA 2R8YA 3PHIA 5IKXA 3D3JA 4HQFA 3HA2A 4Q6BA 4A0RA 1PNTA 3BMNB 3A70A 3URMA 1CUFA 1E2EA 2R86A 1WQ4A 2PH5A 2XDAA 3L6UA 3VU1A 3ROMA 2DOKA 2X5KO 3TFQA 1A9OA 2A94A 3G85A 1QYVA 1X7XA 2CLHB 2BKAA 3EPRA 1IOVA 2TMYA 2V96A 4Q3EA 3I28A 5AM2A 1NYTA 1HYEA 4C6RA 3U7QA 4AJIA 3F90A 5KVCA 2O8CB 4YX9A 2EYUA 4O2AA 4LXYA 4O1IA 2ZYRA 2XOEA 1U63A 1XDSA 4RZHA 2V1XA 3HCCA 3WIEA 4KNYA 2FH5B 4HPJB 3IAUA 1W6RA 4HAWA 1BJKA 2D3TA 2YASA 3USES 1AK9A 2FN4A 2RARA 2I76A 2ZPAA 3CWZA 3H97A 3HZOA 3QX3A 5F1OA 1MDFA 2EZ8A 4WGGA 1FNCA 3WA7A 3L02A 4NV0A 1V7PC 4EF4A 1SD1A 3CF6R 3D3QA 3TSCA 2JLRA 2I1QA 4MWZA 1PZNA 4KBYA 2Z8YM 4BZPA 3I64A 3KD2A 3MIIA 1IHPA 1C0IA 3A4MA 2UVPB 1GYQA 1OXXK 5CXQA 1TUBB 2QQ5A 2Y1FA 4J4HA 4KSYA 2HXYA 4L51A 4HF7A 3NEYA 2MDTA 4HMOA 1W30A 4GX0A 3BXPA 3ZD6A 2NZWA 4G0QA 4C7VA 1AK1A 1DJOA 5JH7B 3KSMA 5H3HA 4EMSA 4WXEA 5ETJA 1BG6A 2KYRA 2J6HA 3B60A 3CRNA 4KIJA 4A4DA 4R9RA 4RXMA 1AB5A 16PKA 1NHGA 1M0SA 3HZRA 5INTA 2C4KA 3PA6A 4O33A 1W0JA 2G0NA 4JL8A 3LGAA 3QJ5A 1K6MA 2CVHA 2WD8A 2ZYUX 2XGOA 3O8QA 3PK0A 3N05A 5DWQA 1HSOA 1JSLA 1WE2A 2XDWA 1RVV1 3OM9A 4DRZA 4TXLA 3FCXA 4ARBA 4MWSA 5IJWA 2ZBRA 3H13A 1FQJA 4CTNA 2OCLA 1XALA 3SXUB 4YCAA 3FYDA 1F0KA 1IBCA 3FPJA 3PX7A 1E2NA 1ENOA 1EWYA 1J42A 4S0ZA 2HHHB 4L2IA 3G0CA 5BVHB 5KQRA 5CG1A 5CNJA 2CL7X 3KTAA 1Z3CA 4KRYA 5LN1A 4CQJA 1BMDA 1V5GA 3FF4A 3ME5A 3DOFA 5HRAA 2W6JA 4UC0A 3OE7D 2REQA 4NAVA 4P4UA 4CM8B 1CR2A 3GLVA 4S0XA 4CHGA 1T36B 4FR5A 5ED4A 3WBFA 4IGFA 2ZIZA 4ESHA 1R66A 4WASA 4Q24A 1UWVA 2FLVA 4GM0A 5C4MA 1PKEA 3HI6A 2VAXA 3G0BA 4QARA 1Y6JA 3SIRA 1P29A 5LJLA 2R3SA 4Y2GA 2JAPA 1XNGA 1T3TA 2UZ1B 4YDRA 4DOMA 2Z2XA 3PXDA 3C1TA 4KQKA 3NJ8A 1HEUA 3QBJA 1NLMA 3EEFA 5ALNA 4EMBA 4JLOA 3OZDA 2J30A 1VKZA 2YFQA 3AO0B 3VI4B 4RY0A 1Y89A 2E9SA 3ZIUA 1B0UA 1OBOA 2EFCB 2PAAA 2QYSA 4FQ5A 1OFTA 4B48A 5KWJA 1M0EA 3A9SA 1O94D 3KDAA 4AJNA 1RYDA 1GNSA 1O6BA 1R8JA 4K3VA 4MSUA 3SXUA 3R2JA 2AFIA 3UK0A 4RC9A 4YAIA 4D9GA 1B8NA 3CEHA 2GZ3A 4RD3A 2OZKA 3R6DA 1UKZA 2H5EA 1R0XA 2Z1NA 3VPFA 1Z36A 1JS1X 4UBOA 4Z7JA 4JKIA 2V65A 3BWXA 2V54A 3KO8A 1VGQA 3K1JA 4FFNA 4PSCA 4QFBA 1XOIA 2HSJA 3U9SA 4KXYA 1VSUA 3S2EA 4YRDA 1E5VA 4FEEA 4N0MA 4ZHQF 1EXWA 5F4BA 1ZXLA 3LC0A 4ONEA 3VNUA 1YA8A 2C1ZA 5A3JA 3NNSA 1DWQA 1Y8RB 5H68A 4MHOA 2QP3A 1VJ5A 5H9WA 4B6QA 3HZZA 4INZA 2HA4A 2I34A 5GTDA 5DXJA 3DTNA 3UUFA 5DNYB 2ZJ5A 1TM7E 3OD1A 4J0CA 4ROTA 4O4LB 4TYNA 1R0ZA 4UTNA 3RT7A 3NQ41 5CGQB 1Z5VA 3Q4GA 1VLQA 4PHTA 5MF6A 3R7FA 3AK4A 1QNFA 3PGMA 2HAEA 2PGLA 4RVDA 1S9DA 2DHDA 5F2EA 2ADOA 2DC1A 3LDHA 4HL6A 3KSBC 2BGIA 4A0QA 2DTXA 2O3QA 3NALA 2PAFA 3WGJA 1BHSA 3HYSA 1R15A 1MEJA 2C4NA 5FYQA 5SZHB 4M38A 4B6JA 3R3YA 4DM4A 4EY5A 4RM3A 3CRRA 1TAHA 4Q4JB 4TWBA 5NLLA 1A9TA 1USWA 4AZ3A 2WV7A 4X0EA 1SKUA 1MP0A 1FDSA 1Z37A 1ZUWA 3OU6A 3T4PA 3V6MA 1U0RA 4RDXA 4KQ1A 3T4UA 2Y2VA 4GQIA 2WUVA 3QJYA 2JLWA 4HQOA 3LUCA 3QTTA 3T12A 1RWBA 4AG6A 5IDQA 2YHAA 3UPUA 4JP5A 3LYAA 3B20A 2QDKA 3DBLB 3L8MA 5T57A 5AHWA 1NWHA 1W96A 3KLMX 2R8BA 4MMZB 4OI4A 4ERNA 3FPCA 3NKVA 5JD6A 3PP8A 2GXAA 2AOUB 5E9AA 1LJUA 3WP0A 1U7ZA 1H2YA 1IZ8A 2PJZA 1GLNA 2HN9A 3G5LA 3K53A 2NYAA 4X7MA 1EP1B 1Z82A 5CFQA 5AUPB 1CY7A 1EK2A 2HMTA 3D54D 2JIDA 4DB2A 1VYUA 1JAZA 4IDQA 4X90A 5JOQA 1DOHA 4RZ3A 5JEEA 3E5RA 1YE5A 4V1CI 1WUTA 2XOKD 4X91A 3JAMA 2HJVA 5EI5A 4U7JA 1M6WA 1IAQA 4EUSA 1GHTA 4DCSA 4E2YA 1J56A 3GRYA 4DLAA 2CE2X 2XWBF 4Q4JA 1QYIA 2RIPA 2PL1A 4XOUA 3PFWO 1EEHA 4JLDA 2BL4A 3D2AA 2VIIA 1L5NA 1TFRA 3LRXA 3F5DA 5KX5B 4FHDA 4QO8A 5KVSA 3JVDA 4W5QA 1CIJA 1TPZA 3D5TA 2DPHA 2NZVG 4BN0A 2EGUA 2MMCA 2O0JA 4X6YA 4I5IA 3AI2A 1PAUA 3ONDA 3TJMA 2XB8A 3PDJA 1P2VA 1C7QA 3PFGA 1J21A 4GGMX 4RPLA 5FXMA 3T7CA 4RTMA 4BNMA 1CCWA 1DAGA 3D02A 1Z06A 4IX1A 3WYCA 3RS3A 1DAOA 3MPOA 2P69A 2PD4A 1VKNA 2VPQA 1F51E 1Y8RA 2CEKA 3CH5A 1X74A 2GBGA 2J6IA 2QPOA 1FXSA 1YBHA 2GF9A 2CLDX 2OD9A 2R25B 3K9HA 3ND9A 2GHTA 2JAUA 4HDMB 4UZFA 1P9LA 4BV2A 7GPBA 4CIYA 1L5GB 2QIOA 2NYUA 4RF3A 3ZOKA 2R1TB 3ECCA 5TRTA 4J76A 8GPBA 4Z4EA 2VOEA 4G97A 3Q5GA 4NENA 1ZJ6A 1GTMA 4MZDA 3MYYA 3VHXB 5AHKA 3NVAA 3ZQUA 4AWAA 4CNQA 2IDMA 3B13B 5CTJA 3EE6A 5FPTA 3L01A 1KBOA 4M9RA 3RSZA 2GAFA 3IVCA 1XZFA 4CM7A 1BEUB 1E1QA 1QCCA 3IMFA 5K0CA 5E3IA 1EPUA 4EZEA 2X14A 3EIHA 3AFGA 2QUJA 2EBWA 2C57A 2B20A 4RM2A 3IXMA 5EKSA 2P2NA 1X6VA 1S8NA 3D2BA 4YO7A 1X1RA 3U48A 1XRRA 4AMVA 2IX3A 2IDZA 3R0XA 5JTUA 3FOEC 1H0HA 3WIBA 5EXSA 1KORA 2FOLA 4IDPA 4KAFA 2QVXX 4D99A 4EATA 1X70A 4BUCA 5BPFA 1CD5A 2ASVA 4O0LA 1YZYA 3FKQA 4Z0TA 3GFGA 1C3LA 3F73A 4W4TA 5K8JB 3O8NA 1NXVA 1Q7CA 1CNMA 3F9CA 3K0HA 4L0CA 1L7QA 2XD4A 3G0DA 1Z22A 2A0KA 4PN3A 4YCSA 4GZ6A 1E6MA 4DYHA 1GWNA 1VG9B 1XLTC 1RPJA 2BHNA 4PYNA 4QUAA 2R44A 4Z7NB 1WHSB 1SKMA 3HKBA 1QMPA 3A1EA 4M1SA 5L3SB 2BEVB 3IS3A 1M8FA 2CL0X 4LOKA 5BOVA 3TX6A 1IQRA 4R84A 3PQ8A 4W9MC 3EXG2 1NXWA 2XODA 4JMPA 4M1KA 3QX8A 2Q50A 4OBBA 5ALFA 5EXTA 5FJJA 3K6SB 3OJWA 4YK7A 4NK4A 4WBNA 3VMMA 3DAFA 2GJKA 1EZ1A 2I4NA 2NO4A 4PM4A 3E58A 3S3TA 3NBXX 3F74A 2F6RA 2ZE8A 2NTNA 3GJ3A 2H06A 1AQJA 4N54A 1F20A 1TTPB 1ZN2A 2BFBB 2EQ5A 1M9NA 3B5EA 3EDCA 1A5BB 1LNQA 1JAHA 1PR0A 4X8LA 2CUTA 3ABOB 4WFJA 2VCYA 2VDUE 2WHPA 5H59A 3MCAA 4K1XA 5ARCA 2UXCB 1NSTA 5M34A 4QDUA 3N2KA 3OLXA 3EA4A 4WVLA 2GA9A 2LPMA 4EEXA 3RADC 4Z9BA 3FOFC 2OBFA 3V32A 1U3UA 3E1SA 1N8KA 3HVJA 1KJZA 4MIOA 4ND6A 1CVRA 2WM2A 1NU8A 4G25A 5DCUA 4IRMA 3U9LA 1O7JA 4B2PA 3HP4A 2I29A 4DBVO 3ZXUB 4ETNA 1YVRA 3PITA 2PGDA 4W8HA 1L4EA 3BGSA 1RFGE 3L7BA 4AMBA 5LM3A 1E2LA 3CZ5A 3FCOA 3UT0A 4OQDA 5CNMA 3SC2B 4MRSA 2C3OA 3OETA 3TRDA 1DTSA 2OKCA 3WJ2A 4EGSA 1QWOA 4M9XA 2Q6TA 1LPNA 1U28A 4ZGWA 4YJ3B 3GCDA 2QUIA 1IG3A 3QTBA 4LAFA 4BJ1A 2OHXA 1V6AA 3DF9A 1N6PA 4HAVA 2ID9A 3RFTA 4RPKA 4UD6A 4CODB 4N0QA 4UOZA 3OG9A 1E1NA 4KO2S 5I8WA 2CMGA 4DMCA 5BW4A 3S27A 4O2AB 1XWIA 4ZYZA 5REQB 3SQWA 4MJXA 4Y2VA 1KHHA 1STOA 5LMCA 1KSGA 2C1EA 5E1OA 2HNBA 2WIAA 3KQMA 4QVKA 4JOQA 4M0CA 4CF7A 3K0AB 1X7XB 2A9FA 1J0XO 1M7HA 2H8GA 3A11A 4P98A 3C6KA 2ZSEA 3SYKA 2GZSA 2FEPA 2OPHA 1RAEA 3JQ9A 4TZKA 4IIJF 2R8XA 3LW7A 1XG5A 2X6RA 4RA9A 5HRUA 4BO3A 2RGRA 1DDIA 1Y37A 2XIJA 3AJRA 3JV7A 4IHJF 2QTVB 1IN6A 4IVPA 4LDAA 2VNSA 5IVIA 2QEQA 4H7PA 3U39A 2E3JA 3WK5A 5CCBA 4OEHA 3WNQA 2JJYA 1PT8A 2BI7A 2VLBA 2FV8A 1NPTO 1U2ZA 4UOEA 4B43A 2EEZA 2O5RA 2RGWA 4UNPA 1AS2A 1KFBB 1TKRA 2IXAA 1SC4A 1Z9BA 2HK8A 5CW2A 2WHRA 4B6SA 5CYGA 1QFYA 3OZXA 3EEIA 3MFQA 5I9SA 3GDGA 2J09A 3OLZA 2PM8A 3OCVA 1SD5A 1MIOA 3SP1A 3VO2A 1V7ZA 4NCJA 3MGGA 3LVRE 3E8SA 1P4GA 1XKXA 2DFNA 1D6NA 3KZXA 4Q21A 3LBYA 1EX9A 3B6ZA 3AR7A 1H23A 1JR3A 2BTOA 3BL5A 3A05A 4RMIA 5DTIA 5IC6A 4E14A 1PK9A 4KH1A 3HY6A 4JYBA 4HDNB 3CZMA 1IRIA 1BN6A 2LXNA 1L9XA 1A5AB 3QENA 3ZDZB 1XZGA 1BVHA 3FFWA 5FQNA 3CEJA 1Q0LA 2RAUA 1KBQA 2QRQA 3V3TA 3G7SA 3BGIA 2PGNA 3OZIA 3FTFA 1YB5A 1XRMA 2R00C 2Y67A 1QDEA 5JBNA 3OIFA 1EUCB 1CC1S 3WSWA 3BQ9A 1Q1EA 4DTCA 5CVVA 4QSHA 4M54A 3A4IA 4MYTA 2LKDA 3X3HA 3G23A 1MGPA 3Q3EA 4J1TC 3AJEA 3UWPA 1ORDA 4RGQA 3QKSB 4Q39A 1KE1A 1Y9EA 1CUDA 3PHCA 4L28A 3E53A 3WR5A 4A26A 1P1CA 4B4UA 2JD2A 4Z53A 1V47A 1JEEA 2P4UA 3DAOA 3EFBA 3ZWDA 1TF7A 3ACCA 3KVRA 5KVQA 2BR5A 4ER3A 1A95A 2IOYA 3IIKA 3LPMA 5CH5A 3UANA 1QK4A 3CEPB 2FWJA 5CPFA 2Y71A 3Q5DA 1DKPA 2HRQA 4MKHA 3LX4A 4E70A 1Z4IA 1U1FA 1E2JA 4KOAA 3NHFA 3ADCA 2JIOA 2ZI9A 1PJ2A 2DY1A 4YP6A 3AFIA 3CUKA 3TTXA 1Z38A 4UAUA 1CY6A 2J5XA 2B8JA 4BJ5A 2O1XA 2XTAA 2HMAA 5ECWA 3GMTA 4CKBB 1E3MA 2FQQA 2IEYA 3FPKA 4NS1A 4EJ2A 3DW1X 4IV0A 3KT3A 3Q15C 4JC4A 3NV9A 3LLMA 4H27A 1JIXA 1IY2A 1C9EA 3WLKX 2A67A 3H2SA 1BHQ1 3LV8A 4BLRA 5KO2A 2PBLA 1W85B 3X1XA 4ZJPA 4POAA 3A6PC 3FCYA 4YRAA 3HYCA 4RXTA 1JBKA 2QRNA 4CM4B 3KYCB 1J9EA 1EK1A 2GNPA 1G8SA 4NNJA 3ETNA 2EGHA 4R2JA 4ALJA 2Q45A 1KYYA 4MUEA 1RLMA 3KQHA 4FMCF 3A2NA 1FXWF 4HWKA 2AOVA 2PXHA 2VJMB 3KR2A 4HB0A 1SPXA 4P0TA 3JYQA 4X6UA 4GLBA 3U19A 1UH5A 4LV6A 4RDIA 5JD5A 2RB4A 4HDAA 3MF4A 1WB4A 2BAGA 5GGXA 1MOQA 2WYOA 1TT5B 1CZLA 1TX4B 3HDQA 1Z34A 4HKTA 4PTYA 5LDHA 3G8BA 2RK3A 1SVWA 2OBNA 3UJHA 3WLIA 5B7GA 2LRHA 1IL0A 4TM7A 1MMFB 3IPAA 4MPJA 2OAEA 3MWGA 4PC7A 4E0BA 5E7QA 1ZD5A 1IZ9A 2PZAA 4JU8A 1MRSA 4FCCA 1ZGGA 4ARZB 1WNFA 4US0R 4QGFA 1FDVA 1ZL0A 4UVEA 4EGJA 3JARB 2E37A 2JJMA 4QUEA 4B3CA 1M2EA 1B0ZA 1H42A 3WLHA 1YJ5A 2HJSA 1B74A 3KKQA 3TF5A 3FDZB 1HLGA 5A3RA 5CLQA 1E6KA 5GV7A 1QYDA 3STHA 4DR2B 1QGUB 3RUHA 2MSEB 1VBNA 4JD5A 1LTKA 4MICA 1PS0A 2QPAA 5IKPA 2DBQA 3H11B 3RNLA 1G7RA 2P7HA 4I1RA 4OA8A 2EP7A 2OQRA 2QRGA 4OV6B 1A8QA 2VHXA 2CLLB 4I2VA 2QN7A 3Q72A 3B1XA 3KU4A 3R0ZA 3B2NA 5I51A 1FLVA 2PKRA 2O1WA 2VNIA 2X0IA 3IBFA 3NH9A 3AKZA 2RH5A 1A2BA 1ND5A 3L7MA 4A8JB 5LP1A 5I3ZA 1JWAB 3FYUA 4EG3A 1NZJA 1V8PA 3WLAA 2RONA 1PSWA 2C7GA 1OROA 1JQEA 1YK0A 3D4OA 1LDBA 2A1IA 4LSZA 3G0HA 3GFVA 3O26A 3LGSA 3K0AA 1H2ZA 3CF4A 1QR2A 4MUMA 5EGNA 1QHYA 3E48A 1XEAA 2OY0A 2P9QA 2Z58A 3DP7A 3K92A 4YCCA 3CBGA 2MMGA 4RTPA 4RXUA 3BEDA 5HIKA 4WXYB 3N3BC 1CB0A 1LBQA 3GI1A 4DMGA 2J9XB 1MORA 1RDFA 3ER6A 5ABPA 1ZR2A 1OT3A 3SSOA 4EOGA 4PYMA 5DSTA 3DDCA 5CA1F 1R0YA 1A82A 2PEZA 3B5IA 3GH1A 3GP3A 1VMIA 2UKDA 4YA6A 4CRWB 5DGXA 3L6EA 2O50A 5DASA 5ALMA 3CE9A 1S3SA 3ET4A 6REQA 5EFZA 2RHOA 4L4UA 5JSUA 1LB1B 2XGJA 3B82A 1H6CA 5KYGA 3NLLA 4QTZA 1D4FA 3P9XA 1GD1O 1XK7A 3HVUA 3FVRA 4BJ6A 4WLEA 1E0SA 1IH8A 4YJ2B 4B3JA 3PUKA 4RKWA 4ZWNA 1K66A 2B3TA 4BKUA 2FWBA 3A8TA 4N9QA 5A62A 5F5NA 2HV8A 1WTCA 1QP8A 1LZLA 1KOLA 1QKIA 4WZ6A 5FX2A 4GEGA 3FYTA 1OFUX 1SXJA 2Q1WA 3C14C 2QVCA 1RAGA 2HPAA 3AT1A 3C0KA 2QAJA 4ILKA 3SEFA 3A1CA 3S44A 1EX7A 4F97A 1TTQB 1DU4A 2YYZA 4A1OA 1C1XA 2K87A 2D7JA 2SICE 2Z6AA 1EQ2A 3PT5A 5GM2A 2FOXA 3OZGA 1UP7A 3QLUA 1IWPB 4IV8A 5TPWB 2IV2X 2ZPUA 1VYVA 2Z98A 4XYMA 1LVUA 1ISPA 3GPCA 3NBFA 4DCPA 3CJTA 2VSNA 3C3KA 1UPFA 1H5NA 1U80A 1QF7A 4MVJA 3WGZA 3K6SA 3BTSA 2VPIA 2QS9A 1CQJB 1KNQA 2VLIA 3MWJA 1UIRA 1P2SA 1YB4A 1EVKA 1NP3A 4EJFA 2BEVA 5EEGA 2W6PA 5FL7D 3T5AA 4F3YA 3MOSA 3KVNA 1FNBA 4CQMD 5A1TA 3QBVA 3CNBA 1FC0A 3NWEA 4TYMA 3LLVA 2W71A 4H1HA 2OQ2A 4DNXA 4LF7B 3ZXXA 1RIFA 3FAKA 4TWZA 5F12A 2GI4A 1Y4ZA 2I8LA 1NF2A 1J2UA 2ZYSA 4QE3A 1J2TA 4UU0A 5KX5A 1OHHD 2VHVA 3QYFA 4LF4B 4BNXA 3ENZA 3R74A 1LPSA 3H42B 4U02A 1ODFA 1T2EA 2XF2A 4Q9KA 3GJ5A 4L8YA 2Q99A 5TF0A 2YN0A 4CMHA 5H02A 4XWWA 2BHLA 4K9QA 1LPPA 2OXTA 5U9CA 1T25A 2Z6QA 1SO8A 1Q7BA 2ZQZA 2YJZA 3BIXA 3AYXB 3AL3A 3DR5A 1K7XB 3UCEA 3VVBA 4E5UA 3UJ6A 3X1KA 1XZJA 1IDN1 2GPBA 3HA5A 1NN0A 4Y9RA 4EWLA 1VYTA 3SQNA 3P0FA 4B31A 2B8EA 1FRZA 2D7CA 4KV9A 5CA0B 1K97A 2AOWA 3A1SA 4HSGA 1L7NA 2BZ0A 2BFWA 3B7WA 3NBYC 4EB8A 3CLKA 5CB6A 1YRYE 2IITA 2BGKA 2G06A 4XGRA 3F2VA 2LR0A 2W98A 2XF8A 1CDDA 1PR6A 2FHPA 2I6UA 5KJFA 4AJHA 2WF7A 4C4SA 1HV8A 1Y7IA 1RXWA 1YASA 5IJXA 2EJVA 1JW9B 1IMJA 2VCEA 4DSZA 5L7YA 1U6KA 4HDMA 3T54A 1URPA 2H8KA 4F3CA 3NHPA 3TFOA 3QE2A 1VE1A 3M1LA 4S24A 1UKAA 1I7NA 2J3DA 3PSAA 1VOTA 2OBBA 5TPZA 3LPNA 4DGSA 1AZTA 3DMTA 5BN3A 2VHCA 2IEGA 4S35A 3WQRA 2F00A 3NYWA 5CX4A 1IXZA 1S2MA 3HP7A 4OP1A 3V8RA 5ADHA 2WQ6A 4DR5B 3W8FA 3CNEA 3GGOA 3OM8A 1QXSA 1UBHS 2IVFA 1RJGA 1G9SA 1H8EA 1W5TA 3HUTA 2BC9A 4ETIA 5KOHB 3R5XA 3KOUA 1OKKA 2OM6A 2Q9BA 2UVQA 4ZAVA 5F3DA 1NTOA 3HY3A 3SM9A 1Z68A 3L6DA 4KLAA 4NV3A 4PW0A 4UDNA 3UIEA 1CDOA 2CNNA 2IYZA 5CA0F 3CC8A 3IOYA 3C7AA 4LE2A 3OKFA 4H1UA 1EUQA 1JKIA 1JB1A 1CS0B 2Z2JA 3STWA 1LLCA 2BEJA 3K5HA 5A1JA 4QBGB 1S5PA 4D44A 4ND1A 2WZDA 1CG6A 4FD3A 2BUBA 2P3QA 3RVRA 1ZEMA 2GRAA 3K72B 2X42A 2P75A 3HR7A 4MUIA 4RV4A 3DMDA 3OEHA 3IVAA 4X61A 1P3JA 1EJ2A 1KO5A 3E9EA 3NRBA 3OUUA 1IBSA 4Q9DA 4BNLA 4Y2YA 3SI7A 2PJUA 1EXDA 1J97A 4M0EA 2QTFA 2ZYWX 1N0UA 5CLIA 3P2MA 2K2WA 3RFXA 3Q7RA 2KW5A 2DPLA 2VP5A 1WETA 4YMTA 3DDWA 5HG0A 4A15A 1JFRA 3B3FA 1L3CA 3BQMB 3CFYA 4U7TB 4DSAA 3DAYA 4MQBA 5ALUA 3DE3X 2G72A 2HTFA 2X1MA 2Y0BA 3UT5B 3V1YA 2Y4NA 3N0RA 2P2SA 4L75A 5HF8A 3DEJA 4JSYA 2V9PA 4Y0VA 2Q0HA 1XA4A 4KWIA 4MP3A 2UZ3A 5FBKA 2EJUA 1AUOA 5EIBD 2E55A 3VR1A 4FGUA 4AZSA 1WUHS 2O2SA 4G85A 2CW5A 1XJ5A 4HBZA 4ZDWA 4HAOA 3NZEA 3U80A 2ZJYA 4MR8A 2EYQA 1XD8A 4H6XA 4NU8X 1FVFA 3G2QA 3JQEA 2YXPX 4FN4A 4KC0A 2DH5A 3JWEA 1XU4A 2DHRA 3B8EA 4G8CA 3S70A 2XZOA 4ABTA 4QA9A 2KLBA 3S99A 4R40A 4ZYVA 4Q12A 2Q5CA 1N3YA 1TUEA 3D31A 3L9WA 4HDSB 1JEYB 2YXNA 2O19A 4JI5B 3UAYA 2TYSB 3ID6C 4HUTA 5ITWA 4TT8A 1BSVA 2IYYA 1XVVA 2R6DA 5L45A 1NR7A 3HYTA 3HXTA 1KNXA 4PC3A 5BSGA 1MJGA 1JLLA 4RNDB 2HSGA 3L8HA 1EUCA 2BSXA 3N2LA 1MG5A 4DCMA 3FTPA 3VJLA 1QIHA 1DMSA 2ZJ7A 3QA9A 2A9VA 5D8DA 5C4IA 4LC0A 2QRJA 3TNYA 4AC9A 2FW8A 1IPHA 3MSCA 2JBHA 5EINA 2K5UA 2ZRPA 4PPNA 4BLTA 5JNRA 1SVUA 4HYYA 4L07A 2Z4TA 2GPJA 4PONA 2GILA 1DX9A 3TIVA 3T7EA 3VA7A 3GLHE 5FA5A 3MNFA 4F1KA 1J0BA 3MQ4A 5B1EA 4DLBA 3BWBA 4OXYA 4D79A 2D54A 4GYJA 3BDAA 4MQFB 4CVNA 2WWRA 4YV2A 1SCNE 2XAAA 2UYGA 5BUQA 4PNEA 1NOKA 3UV6A 3K4QA 3L6OO 3N7TA 1HH4A 2FR8C 1QH8A 2Q62A 2X5XA 3AHDA 4PRZA 1UP6A 3GFBA 4YQEA 3OZWA 1K4MA 2ZBFA 3GPDG 3H8WA 2ZR9A 2IU6A 2J5KA 3TJRA 3LY8A 5E8JA 2GEKA 1QWSA 1MW8X 1DCTA 3HK2A 1L5OA 4L5AA 5A5DA 4M8NE 1W88A 5F23A 4MEJA 3NB0A 4NBWA 3UPTA 3QMVA 1O0CA 3EIWA 5E2IA 5FAXA 2AFHE 3CG0A 1KOGA 5JPCA 2PUAA 3WHIA 4DS3A 4YVFA 4CCAA 2DKNA 4HVLA 2C3UA 2PX8A 4QOSA 1L9KA 3Q1LA 4BNZA 4G09A 1AKUA 1MENA 4EVSA 1XROA 4DCTA 5FPYA 4H18A 3G17A 3OFVA 2EAUA 4RK7A 3MYRA 1SELA 4IP0A 5KKAA 4HFRA 2FMTA 1CEYA 5ILGA 4PHCA 4LTMA 4LBZA 2Q9AA 5KSPA 2W6MA 3IP6A 4AQDA 2ZS7A 3W9YA 4R9VA 4RLSA 5IDXA 4Y1FA 3LSYA 4PWYA 3MMSA 4IDEA 3CMMA 4ZYLA 1RXYA 3IT3A 5CJPA 5BYAA 1QLWA 9LDBA 5KZMB 3FYSA 4WZBE 4R2WA 4PTLA 4RPHA 5BWBA 1E79D 3N8HA 3SDBA 2B69A 1B3BA 4N5NA 1FBNA 1TXGA 3ESYA 4B3XA 3QVSA 3ZVKA 4BBPA 4WBSA 2O0LA 1D4ZA 3DNMA 1OX6A 1ZXBA 3CZAA 1I32A 5CUQA 4RZUA 3TCXB 4AI6A 1JR3D 3V46A 2PYZA 1HFEL 1S1CA 2CCJA 1K3FA 4Z99A 4LHXA 1HUQA 1KY5A 1U0HC 2OHVA 3B1YA 2HSEA 3ENNA 5JDCC 3VHRA 4BFSA 2F7SA 4EFMA 2PFSA 2ZDQA 3TQOA 3V1UA 4RD2A 3I12A 5FPPA 1E7SA 1DG9A 3N6VA 2B1IA 2FFBA 1P5JA 4KHZA 3S68A 7REQB 4FFRA 3NJ4A 3T9EA 1RQPA 4EKGA 3VOBA 4XVQA 1TFUA 3CZ9A 5JE8A 2I91A 4ROSA 4ZAZA 4B2LA 5IVPA 3RREA 2WG0A 1KFKB 4MIYA 4RHUA 1P7WA 5JS7A 3OLYA 1XP8A 5FNVF 5CEFA 3HO6A 2JGAA 4P7JA 4KNVA 1S7GA 5JCJA 1Q5PA 3T06B 3VR2D 4RHCA 1GT6A 2WHPB 1VE6A 3AFHA 3AQIA 3VUFA 4B71A 3TKAA 1RLUA 3R6LA 2QM0A 2DFKB 4MO2A 3L8DA 2EIHA 1V8FA 3GD7A 4FYWA 4NYIQ 3R7WA 1KMQA 3UMBA 5AW2A 2HO5A 4ZOLF 2JGNA 5KDOA 4JQOA 4UHDA 2K4MA 1E69A 4L8GA 4RVHA 5BNFA 4D0NA 1NULA 3ONVA 4LBVA 4CG2A 2VT7A 4ER5A 4HDCA 4C78A 4UTPA 5CK4A 2B1QA 4CETA 3PEWA 3FZQA 4AUEA 3KK0A 2W2NA 5LNK1 5CFLA 4JJKA 4Z3OA 1SUWA 4X54A 1MF7A 5HK9A 2H3HA 5DW0A 1PEKE 5E7JA 2IHYA 2YJ5A 1TVEA 1ZHFA 4TKZA 2VF4X 3RS5A 4YP5A 2B82A 4ZZ1A 4K6OA 1WO8A 2C4MA 1R9MA 1NNI1 4MITA 4PVCA 1DV1A 4LGYA 5E4JA 1QHSA 3F0TA 5IK2A 3C8DA 3KHTA 4OI0A 4D9IA 3MSXA 5JFGA 1SN7A 1ABEA 2H1LA 2BEKA 4L8VA 1P7PA 3NHAA 3GNTA 4O8ZA 1E58A 2Y76A 1XZAA 1JDZA 4QM6A 1EFPB 1XLUA 2Q3HA 2WYHA 4D56A 4AL4A 2ZUBA 1YI0A 4KR0A 3OZUA 2BEUB 1UUFA 2HIAA 3PNOA 4CPDA 5IZCC 1YS2X 3QF4A 3FSEA 2O3SA 5BNZA 2AXPA 2HDNB 2SBTA 1NLZA 4DG5A 1JE0A 3KE9A 3JQFC 1YR2A 1SUAA 3HL4A 2HGZA 4B3RB 1GQFA 4HEHA 1MO3A 4ZTUB 1BDHA 3PI6A 2R6HA 1KZGB 3O6VA 3OZEA 2G07A 3AONB 3BMXA 4L4ZA 1IC6A 4NH4A 3J7TA 4XWYA 2VEOA 1YJCA 5K6RA 3ENVA 5AJYA 5DGDA 4YR7A 3MCWA 3LP6A 5D5HA 5IDWA 4UFNA 3FW1A 3Q9NA 2V5UA 3UH0A 1AGXA 1M5TA 2FZEA 4ZPJA 1P8AA 1Y5IA 4D7AA 4WBNF 2QD1A 2OWEA 4FZJA 1CR4A 3BTVA 1LSOA 1XQVA 3BHMA 4HAZA 4C5AA 4K28A 1KPIA 1WBJB 3KRTA 3WFIA 4IGAA 2C84A 2ODBA 3OECA 4PZYA 4D9FA 2ORED 4EUKA 2E89A 3RIHA 1IN5A 6YASA 3PEYA 3HR8A 4JBHA 3TZHA 5HWSA 1FDTA 4KBFA 4GMHA 4HLNA 3KQTA 1WD7A 3EWNA 2HSDA 3B1JA 4KN6A 2AVNA 4JBWA 4II2A 3V42A 2JLQA 4C14A 3P2OA 5BSVA 1OWOA 4KIWA 4RKQA 4RK5A 3IDOA 5GQSA 5KWVA 1T2CA 2H1RA 3BXZA 3HJRA 1GNPA 4Y2UA 2ANCA 1QLJA 4JBXA 1FFAA 1HDGO 1K8QA 1Z12A 2ISCA 3HJFA 4ZPXA 3NWOA 2CYAA 3NFYA 1EVJA 2F90A 1MU0A 2I4OA 1OBVA 4LJYA 3VU9B 1GNVA 1XZMA 3EWSA 1XT6A 3P0EA 1WP4A 3PGVA 3QITA 4ZVOA 1C30A 5KJEA 3P5SA 3M1IA 3W5BA 1IB6A 5B7NA 2VUIB 1BYIA 4CXMA 2F8SA 2AUTA 2VH2A 4NBTA 4P93A 4Z6KA 1CHNA 4LHEA 3PIRA 1CSEE 4KU4A 2H63A 3E3LA 1CZUA 2VHZA 2Q9CA 2RIRA 4KW7A 4Q3OA 4CMEC 3UJCA 4E88A 3TD6A 2CV2A 3H75A 1R3DA 2IK8A 4XSHA 2GEJA 3K4HA 2J9FA 4LZLA 1YR1A 1TEVA 4BGUA 2JB9A 3DVQX 1C4OA 4FYVA 2IPAB 2X2OA 3IOEA 3EG9A 1FL9A 2IHVA 3OCCA 5HDBB 3VXKA 1PJBA 1DS6A 5JD3A 5JO0A 5LZ2A 3JZAA 2VP9A 2AD5A 2Q8QA 1J00A 2VCHA 2JFVA 4BFTA 4KQHA 1AGNA 2E82A 3FCEA 2DPYA 2QL7A 4Y2XA 1PS8A 5MN6A 2G9UA 4TVSA 3C85A 5HQTA 1QCZA 1EVQA 4DIDA 4KGZA 5DCYA 5DISB 5IU6A 1ZMTA 3RC9A 1KERA 2NUBA 3ZXYA 4D4GA 3H2ZA 1DBWA 4PGMA 2FDXA 1HOTA 1MVOA 3LC2O 5FB3A 4XSVA 1IE3A 3CUSA 5T3UA 4JI4B 5FNZA 1Q0SA 1ZIPA 3W3AD 4JLUA 4B8ZA 2FPIA 4C22A 3PFHA 1OHHA 3GVCA 3OIVA 3QPWA 3PIDA 3WQSB 4LRXA 2PTHA 1JG6A 3W79A 4WLVA 1ZKDA 2VH1A 1SCAA 1T0UA 2PZKA 5JZOA 3QWHA 4JY7A 1UANA 2AV6A 4W8OA 5ULLA 3WLQA 3H6GA 3L0CA 3AF1A 4IQFA 4MKFA 3AJ8A 4OUKX 5E7MA 3UHAA 5M2QA 3O7MA 3HFRA 3MHPA 4NF2A 3UW1A 3SHOA 4Y6LA 3TBHA 1TE2A 3EODA 3GA5A 3UFXB 3ZNOA 4Z4QA 4TTQA 3WLNA 1R8QA 5CVEA 5AW1A 1F14A 5E38A 4ZAYA 1GJRA 3NP7A 4K88A 3LX6A 1XYVA 3M4ZA 3PQFA 4J0KA 3ZBPA 2CLIB 1NNEA 3HDVA 2VKTA 4BFLA 1LPAB 3FZNA 4ER6A 3RUEA 3SEQA 3GUHA 4LWOA 1W94A 2WB2A 2FFHA 1KKUA 3DHVA 1A98A 4N9WA 3I04M 4DXHA 2X6TA 2JFXA 3LXUX 4TMFA 2RK6A 3P27A 4ZGBA 3QU5A 3IYLW 4EG6A 4Z86A 3NC1C 5BV1A 3RFUA 3TZ6A 2XUAA 2HF2A 4HTFA 1FEZA 2VYVA 2LD4A 3L40A 4N7JA 2GWHA 3D4NA 5AESA 4JGIA 1T34A 1QGAA 3GBPA 2CFRA 2GN9A 3OMLA 1H8HD 4D3FA 4TVOA 4DV1B 3RUAA 3REQB 4LWPA 3OJ0A 2IXEA 1SWWA 2M6LA 1D3AA 4WTOA 3VPAA 3GG2A 2ZIXA 1O4VA 1UBJS 3R6WA 3JZDA 2C9OA 4BV9A 2QD5A 2A58A 1YR9A 2ID4A 2DQKA 3CSUA 4PSDA 1Y6QA 2PV0A 4QU8A 1ADJA 1K86A 3V4OA 1PZGA 3M3DA 1PI3A 1BQEA 4MS1A 4BXOB 4MWBA 5A0FA 3A3PA 1ICEA 1PJLA 1GUZA 2H2GA 3M5WA 4LXUA 4QOHA 3D6UA 5G1OA 3NDIA 5COBA 3B6KA 1Q19A 3RTAA 4HG2A 4II3A 1O5OA 3K71B