3GJ8A

Crystal structure of human rangdp-nup153znf34 complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
204
structure length
204
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGESEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 70
structure length 204
sequence length 204
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj8A00
4QM6A 4MDEA 3EAQA 2IWHA 3RYTC 2ATVA 1HQYE 2OILA 4TSFD 1R4AA 2ZRAA 3OIVA 3ND9A 4M9QA 4YMSA 5AJYA 2C9YA 1FTNA 2FSGA 2QUZA 5JS7A 2G0TA 2VL7A 1A1VA 4LV6A 3R9WA 4I4LA 5JI2E 2X2FA 4L16A 2FFQA 4JSYA 1VDZA 2XZOA 5C1BA 5FTKA 4Q48A 5EQTA 821PA 3H1TA 3WP1B 2V4ZA 4GSYA 5JWRA 5EUMA 3FGNA 3WNDA 4DCUA 1Y3AA 3W9YA 3TGPA 2MMGA 1N6RA 3NH6A 2CMKA 1F2TA 2DHRA 1D2EA 1S9DA 1PLKA 4Q47A 4OJKA 3UG7A 4A0GA 1NP6A 4CYMA 1YZQA 2HF8A 2P6UA 3ZZTA 1ZNWA 2XX3A 2N46A 1VPLA 4W9MC 2RKOA 1CR0A 1F2TB 1T0HB 5AUOB 4I1UA 3A1SA 2BMFA 2QT1A 1OLOA 3E2IA 4BFTA 3KTAA 1QDEA 2RGAA 1XEXA 5LBIA 4P31A 1JBKA 2HJVA 1Z0FA 4UXHA 3FOZA 4UXIA 3WMEA 4ZV4A 3I5YA 1E0AA 2FX3A 1CLUA 1XEWX 1Q21A 2Q9AA 4MGKR 4DT1B 2W2XA 1OF1A 5H68A 4HAUA 2ZUDA 4HUQB 1L4UA 521PA 3BRWD 2ZRBA 2BV3A 3GLHA 2CL0X 1OXUA 4LHYA 2WWHA 3M1IA 5EE5B 3UATA 2GHIA 4BLRA 2Z0MA 1E2EA 4PTLA 1GVNB 3AF1A 4NCHA 3KFVA 4PPNA 2D62A 1CJKC 3GLHB 1NN5A 2XXAA 2GVDC 2W00A 4D0GA 4HDOB 4ZCLA 3SFZA 4QC2A 3WXMA 3PEWA 5FUVA 3BIFA 4MUAA 4WA7A 2V54A 4FWIB 3AP1A 5CK5A 1GSIA 4A9AA 2BC9A 2XXAB 1G41A 4TT3A 3VR5A 4DKXA 3B2EA 1XWIA 3ZGXA 2Q3HA 1LB1B 3K09A 2WJYA 1OXVA 4HDQB 2AK3A 3TAHA 3WBJA 5DN6D 3C5CA 4FWTA 1E32A 1W36C 4RZUA 1J90A 3TUZC 4AKIA 4C3ZA 4DCTA 4D81A 4Q4LA 3CRQA 5GJBA 5F9FA 4GNKA 5KOYA 1E2MA 3SOPA 2JJ1A 2ORWA 1XMSA 3I62A 1SXJD 2IK8A 3BOSA 4C0KA 1W48A 2GVZC 1FMJA 1E2HA 4OQLA 3TKLA 2O8CA 5AJXA 3GJ5A 1NN1A 4LY6A 3TW8B 3D3QA 3QBTA 1C4OA 1QG2A 1H65A 3I3SR 1ZRHA 4FI3C 1VIAA 2CK3D 2O8CB 5J4YA 1M2OB 2W2VA 2QE7A 4FMDB 3TE6A 4NTZA 1EFTA 3P20A 3K0CA 3RSLA 2JDIA 2GILA 2J0SA 2BJVA 4KFSA 3ZQ6A 2UKDA 1ZD8A 2OM2A 4I81A 5J4HA 1IBRA 3I61A 2B21A 4IJMA 4LV5B 3KUDA 1IQPA 3X1WA 4ZCIA 1LS6A 2FWRA 5FPSA 2IT1A 3OF5A 4HLUA 4TTRA 2QENA 4DZZA 1NKSA 4NYMQ 1ONBA 1Z6GA 3DPUA 3QF4A 2W2TA 5C4GB 1OYYA 4XD7A 2PCLA 221PA 3DL0A 3X1XA 4W7SA 1K5GA 1S96A 3QF4B 4PC1A 5DYGA 5KHOC 2ZRIA 4PSAA 1G5RA 1YHNA 2VHTA 2ZQ5A 2EFGA 3ASYA 4GRAA 4OBEA 2RMKA 1TF5A 3A1UA 1NNEA 4HB3A 4U7DA 3V9PA 1XJ0A 1ZD9A 5TV2A 4DVGA 4YXWD 2EFHB 5K8LA 4GP6A 4XWOA 4ZDJA 4LV8B 2YNMA 3KQHA 4PSVA 3SHWA 5C4MA 4QGFA 1K8RA 1KKLA 2HLDA 3HU2A 3TVTA 3KUCA 3UPUA 1DPFA 3QG1A 5FPKA 1HTWA 3UWKA 2J7PA 1KO8A 5HPYB 2IXGA 3K0AA 3ADCA 4EKDA 4Q9IA 3CPJB 2FGJA 3EG5A 2OXCA 3C15C 3SNHA 1GZSA 3AGPA 1E3MA 1NMYA 2KWIA 3ZVRA 4F93B 3A1TA 5B58C 4PO1A 3ZS9A 4O2LA 4JS0A 4TQUS 5CB6A 1UFQA 2EFCB 1E79D 3K0AB 5JHGB 4TYWA 3MWYW 4G01B 2IUUA 2IS4A 3GLIA 3ECCA 4D0NA 1RYHA 4BZXA 3W90A 3TNFA 4JJZA 3OHMA 4Q02A 3C7KA 2JLUA 3AKYA 3TMKA 2NZJA 3IKJA 3QE0A 4LJ8A 2VHCA 5B64A 3B1ZA 1GNRA 1MABA 3HPQA 2VP4A 2RGNA 2ZROA 4QOSA 2IBMA 2IHYA 2Q9BA 4PHTA 4DB4A 3U2QA 1HA3A 1MABB 1Z6YA 2YWHA 1A82A 5KDLA 4OQXA 2CNWD 2ZRGA 4MRPA 4NL4H 1LY1A 3O8DA 2WJGA 3FWYA 4QRHA 4ABYA 1FMLA 4OHYA 2FFAA 4MRSA 1TF2A 4G5SA 3D7MA 3QKSA 5M04A 3WNCA 3FMPB 1GL9B 2Q6TA 2CXXA 2VIIA 5K8UA 2AFIE 3KL4A 4N3NA 5JHHB 2QT0A 2J41A 1KSFX 2OFXA 1U0LA 2KB0A 1F3OA 4QL3A 4WBSA 3QKSB 1SKQA 1KDRA 5HCNA 4NYJR 2PMKA 1QBKC 2R6FA 4GP7A 1AS3A 1XDBA 5FUXA 3AP3A 4Q4HA 3BWDD 1NRJB 1J70A 4LJ7A 1KDOA 2WWGA 5TVKA 1SVWA 3HU3A 1II8A 3V4RA 2BMDA 2JCSA 1SXJE 1JPJA 1VHTA 2GJAA 3DHWC 4K81B 2OLJA 2KJQA 1NG1A 4Q4HB 4NCNA 4U02A 3ZZUA 4BEBA 1MRNA 4AG5A 1II8B 1ZU5A 3NBZC 2VH5R 5JBQA 3U44B 2D7DA 2N1BA 4LJYA 2JLRA 1IN5A 3SS8A 4HZIA 4Q9KA 4P4TA 2ZI9A 1Z08A 4RCYA 3LQRA 3AVUA 3SDZA 2FSHA 3SZRA 3WYFA 1GFIA 2PL3A 3PITA 1EFRA 2REXB 1YKSA 3MWKA 4JKIA 3CPEA 5FPHA 3PXGA 5BN4A 4QHSA 1M34E 1Q1QA 2IA5A 2VHUA 3N2IA 5E7JA 1MH1A 3GD7A 4AYXA 3L2OB 4BASA 1XEFA 1SGWA 4OHZA 2VBCA 3OZXA 1SVIA 4RD1A 1G5TA 1G64A 2C77A 4PAOA 4P4UA 2ZYTX 1RPZA 4TTPA 4KJZA 5DSZA 2F9LA 2ZSFA 3HU1A 3BS4A 4Q9JA 3EX7C 1P60A 2DYKA 3LBNA 1T91A 2JASA 2V55B 1B0UA 4DSOA 1AN0A 1TUIA 2AD1A 1Z29A 4HB0A 1FW6A 3B9QA 5D3QA 1E9EA 2PZGA 2GDJA 3CR7A 3ZIAA 2XTZA 5LDDC 1EXMA 2PMDA 4QNMA 1KHTA 4ACBA 2NO6A 2WIBA 5AR1A 4CGZA 1UADA 3OAAD 4A2WA 1EFUA 2RGGA 1VYVA 2P6RA 2YZ2A 2F43A 5EE1A 1P73A 4ITRC 2WV9A 5GADl 3QPWA 3K0FA 5HE9A 3RS5A 1D6JA 5F3WB 2FPMA 2GZAA 5EE3A 2ATXA 1G20E 1JR6A 2F43B 4A15A 1JECA 2VYFA 5FOUA 4IOJA 3CR8A 2QP3A 3K0FB 2D7CA 2QAGA 1VG0B 3VKHA 2F6RA 2FG5A 1WMSA 4F92B 2XTNA 2YC2C 3QQ5A 3QUSA 4ZO4A 4RD3A 4C2UA 3IDQA 3O8RA 1WBDA 1DAIA 2IYSA 4PANA 4E5UA 4MKHA 1TMKA 2IEZA 2QAGB 3UG6A 4CIDA 4M53A 1SVSA 3X1DA 2ZAMA 5JCPA 5E3HA 2CL6X 2X77A 2Z43A 1OKKD 2JLWA 3P27A 4TSFA 4J0QA 1EG7A 2BKEA 2JEOA 2A5FA 2CHGA 3U7FB 3RANA 2XITA 4LYFA 2ZE8A 3VMFA 3HDTA 4D82A 3CM0A 1R0XA 1LTQA 1VKJA 4B3FX 4MKIA 1FQKA 2J1LA 1P9RA 1T3SA 5HZHA 4V0ME 1NBMD 2PJZA 1G18A 4PZZA 4QFMA 3RSOA 4M1TA 2VP5A 3EIQA 4WXRA 4GPTA 1W5SA 4ON9A 1RIFA 1HURA 4R2HA 4AKGA 1UDXA 3FHCB 5CLQA 3PUYA 3B7GA 3BB3A 4AY2A 1EFHA 1BKDR 4OI1A 1ZC3A 2YV5A 2QSZA 4UJ3A 4L4UA 3BXZA 3L0SA 4LDJA 5D3MA 5G53C 5JJLA 3T61A 2N42A 2A30A 621PA 3SC3A 1J8YF 2JIZD 3T1QA 1Z28A 3FKQA 5D3MB 1OH7A 3LNCA 2A5YB 1QG4A 3MWJA 1ZVQA 3QEOA 3EZFA 3CB4A 1G17A 4HUTA 5DH9A 1R5OA 3DMDA 5TB5A 5KDDA 4Q7JB 4A2QA 2A5JA 4H9GA 3PFIA 4OQMA 3GJ0A 4QG7A 5SZJA 2FF7A 2ZRPA 4F4IA 5L3VA 1KO4A 2DR3A 3U60B 1VECA 2LCFA 3ASZA 2ZI5A 3BFVA 2R62A 4PPGA 2O5VA 1KNXA 3Q7QA 3P4XA 4WZ6A 3TW4A 1TQDA 2RGNC 1SVOA 2MSCB 3HYTA 4PR0A 4NYIR 4BPBA 3B6EA 4MRVA 1L2TA 1KTVA 1NVXQ 3EPKA 2OBMA 4O2RA 4ARZB 2CVHA 1FZQA 1S4QA 2YINC 1IJFA 4BZPA 2WHXA 1Z06A 1P61B 4Y0VA 1L7VC 5DNYB 2FEMA 1XMVA 3MFYA 4UNRA 1XX6A 1A4RA 2GJSA 3TUIC 4KI0A 4DB2A 4YLGA 2JA1A 3LV8A 4JZKA 1P4SA 2AWOA 3IPYA 3SFVA 4B48A 2FPKA 1KK2A 3IO3A 3SEAA 4B76A 1QHHB 3FFAA 3GJ3A 3PEYA 2NTYC 2IXFA 1DAKA 5DN6A 5EXSA 4NDZA 5SZKB 5CDFE 4RZ3A 2PLFA 3H86A 4KBFA 1Z8FA 2RHDA 4B6FA 4KFRA 2J7KA 3KDSE 3NH9A 2FFBA 2NO1A 5GVRA 2BWJA 1QHGA 2ZU0C 4UNNA 1PVOA 2QI9C 3WNBA 1XTIA 3C41J 4PXAA 4B32A 1FX0A 4DWJA 4C0BA 2YWGA 4KHZA 1NVVR 2J45A 2VP2A 4LOAA 3W34A 2I1VB 2VA8A 2Q3MA 1SVMA 4EJSA 4QBGB 3VR1A 1FX0B 1UF9A 1FP6A 2CK3A 3B9PA 5FUYA 3VX4A 1P9NA 1N0UA 3RABA 3JZMA 1EESA 3TR0A 5BN5A 4XJXA 4JYCA 5TMPA 2ZITA 4A2PA 4BEJA 4EJSB 3CONA 2JATA 4EPTA 4RCZA 3I73A 1XFAA 3PCRB 2DBYA 2DFNA 1D2MA 2Q21A 3B1XA 3RS0A 3NEJA 3L0IB 2ZRDA 1TTTA 4X8MA 1XRJA 2XAUA 3CPHA 4LUCA 1Z0AA 3CKLA 5IHPA 1Z07A 1OB2A 4AC9A 1AQYA 1E9BA 4I1VA 1AA9A 4F4CA 5JSZA 1Q3TA 3BBPA 3EPJA 2HEIA 4PHFA 2HXYA 4LGMA 2V1UA 3PUXA 4JT4A 3IUYA 2VHQA 1G4AE 2C98A 2J0UA 3LW8A 4KFUA 4RKEA 3QSYA 3W5IA 2BJWA 3SN6A 1S8FA 4OI2A 3FHOA 1F5NA 3VU9A 1G4UR 4YXWA 3IEUA 2P6NA 3KJGA 1KI2A 3JVVA 5IF9A 2OFOA 2WM9B 2J0UB 3BGWA 2JJ2D 2ODEA 4NCKA 3LD9A 3VU9B 3QNUA 2ZJBA 3AB3A 2IUTA 1QHSA 1AJEA 2REOA 1WDTA 4R9UC 2Z5FA 3RS7A 2VP0A 3LVQE 1Z3IX 4POAA 3EA5A 4DLZA 1DVRA 4MGIR 2R9VA 2ZU6A 2QPOA 2DCUA 3RLFA 2ZSDA 1I4LD 4Q1BA 1U2RA 1DAEA 2O8FA 2GF9A 4M9ZA 1E1QD 1FNNA 1G8YA 2AWNA 2O0HA 1M7BA 2FFHA 1R8QA 3ZLJA 3LFUA 1TADA 4MRNA 4DSTA 4DLYA 4ZIRB 5CIQA 1T8UA 1KJYA 2QAGC 2UZ3A 3H84A 3NVAA 4V0LA 3HWSA 3QF7A 5CLLA 5G40A 3REFA 3T1VA 3CO5A 1KJWA 1VCMA 2H92A 2XNDD 4V0KA 4Q9HA 4EIWA 1Q12A 1YZGA 3GQBA 4CEHA 4HAXA 4WAUA 2WPDA 3PUZA 4CF7A 2NPFA 3K70B 1XBTA 3AF3A 4MGYR 2C95A 5BW8A 5J40A 1G1MA 4HLQB 3NC0C 3SJAA 3VAAA 5HKKD 1NLYA 4CEHB 4TZ6A 2GAAA 1KZGB 4E03A 5EUQB 2J5XA 5A4JA 2V6JA 4KYIB 3VTKA 3GCGA 4ILEA 3GLGA 4CW7A 1KK3A 2O8BA 3TSZA 5F98A 2BMEA 3VR2A 2L0XA 1KDPA 3NDPA 1N25A 4N0EA 4EQ6A 2ZRCA 4KXFB 1X8KA 4GOKA 4IOLA 5KO2A 2YKGA 3CZPA 3B82A 1XPRA 2QMHA 3A36A 4GT1A 5CB8A 1PUJA 1G3MA 1Z0IA 4FMCF 4LK2A 5TDHA 3BB1A 3RS2A 2IC5A 2ZI7A 3SHFA 5CM9C 4EQ6B 4PQFA 1NKTA 1PLLA 2B8WA 3IQWA 5F2EA 1KYIA 1YRAA 3EARA 2RCNA 2QTFA 1YR8A 1N5LA 2NO7A 1PJRA 4BECA 4ZCMA 2VP9A 3GFOA 4FINA 4KSCA 2WJIA 4LRWA 1N5JA 1ZC4A 3SYLA 4BFXA 2H18A 2F7SA 1E0KA 3T5DA 1V43A 4O3MA 3PENA 4EFMA 3BD9A 3H0KA 1ZYUA 1C9KA 3A6PC 4C7OA 1XTQA 4B6EA 1AQUA 4F7WA 3KQUA 2G0NA 3QENA 5IRCD 5JRZA 2ORVA 1Z6TA 4B2PA 4C7OB 1P72A 1R8SA 1B23P 2DY1A 2YHSA 3KTAB 3Q72A 2GEDA 4M9XA 1XEXB 4HB4A 3P4YA 8OHMA 1KKMA 1E2QA 1XXHE 5GJWC 1GKYA 3AUYA 3LLUA 1U0JA 5L8VA 4EPWA 4DLUA 2AXNA 4FCVA 2XZLA 2GJ9A 2P2LA 4PSKA 3U3RA 3ETLA 1WQ1R 5J4VA 4Z1MA 4B35A 2XJ9A 4L5BA 2WWYA 2PX0A 4N1AA 1MR3F 1DAGA 2QM7A 4AURA 4B3CA 1RC8A 3OE7A 2AN9A 4Q1EA 5DO9A 1UEJA 3DDCA 4CT4B 3JVUA 2OBLA 3A58B 4KLZA 3AEZA 4LJAA 1MO6A 4XIGS 3L0OA 1KI6A 1E4VA 2XGJA 4A36A 2SHKA 2R65A 3FB4A 4TLCA 1XPOA 2CL7X 2ZANA 5JWHA 4PFSA 4EPXA 2ZR7A 3U6KA 2E87A 4HAVA 4TLDA 3SQWA 3KFXA 3LO5A 5H8WA 2F1IA 3F5FA 1FQJA 4UJ5A 1E2KA 2QNRA 3OAAA 3K9HA 4L8GA 3KB1A 1E98A 4B73A 4GOXA 3BFXA 4Y0AA 4A8JA 1EX7A 3IBYA 1FNMA 5JEDA 4PHGA 1M74A 3BORA 4EJSC 2QSYA 2ZS7A 4A8JB 4ZDIA 4LHZA 1UDWA 1EX6A 2BIFA 4QHTA 4DUGD 1PV4A 3QVUA 3PJRA 2OO7A 5FH9A 3THOA 4R98A 5BWMA 2F3TA 4YMWA 4G5OA 2OAQ1 3GFTA 3TAUA 3W8RA 2EYQA 1PLJA 2V7QA 4D4JA 4CEJA 4DRZA 4NCIA 1CU1A 3M6AA 1HE1C 2ZSEA 2D2EA 1MO4A 3ICEA 1EWQA 2IYWA 5CITA 5E7MA 2GCNA 5JRJA 2GEVA 3Q8XB 3ZYCA 1R5NA 5ELXA 2HT6A 3QIAA 4QJ3A 4UNSA 3L43A 4CEJB 1Z83A 1G291 3T15A 1RW4A 4QXAA 4TN1A 5H1YA 3WHLA 1X8LA 4TMKA 3KQLA 1U99A 3UXMA 4V02A 3QXJA 4NCJA 3QPUA 1QHYA 1WXQA 3VHXA 1D5CA 3GPLA 2P5SA 2C78A 4MUBA 3QY0A 4EDHA 1O87A 1ZNXA 4HAWA 3IQXA 4AK9A 1XZPA 3R8FA 3FKSA 5FL3A 3CNNA 1NBMA 1M8PA 2O8EA 1U94A 1W2HA 3Q5EA 4D4LA 1OE0A 1HH4A 3GJ7A 3ZS8A 3H2YA 4NH0A 1JQLB 1VTKA 2QEQA 3LW7A 4ASUD 2AR7A 2O8EB 1KAGA 3ZVLA 1KSJA 1JAHA 3UANA 1MV5A 2RHMA 2J0VA 1TAGA 3KXKA 3SJZA 4D25A 2RB4A 4G5RA 2GNOA 4JVSB 2LKDA 3L82B 1TX4B 1LNZA 2GETA 1DAHA 1KJZA 2D3WA 2EYUA 2JIZA 2WMNB 3H4MA 3TLXA 4G5GA 3K8YA 2LWIA 4KBGA 3PG5A 3BAFA 2RGDA 1MO5A 2W6ID 5FBVB 3KKQA 1E1RD 1VMAA 2K5UA 3DEFA 3U7EB 1VG8A 2ZRLA 4M9SA 1E2LA 1YQTA 2JGNA 5FBRB 4C2TA 1GWNA 3PUWA 5KU1A 5EZ5A 5HE8A 1LS1A 3AVVA 1DELA 1KSHA 3GJ4A 4PZYA 3KKNA 1A5TA 3K70C 4KYUA 1XTRA 1R7RA 1NY5A 3GJXC 1E69A 5J4KA 2G3YA 3PEUA 5FBQB 1Q1EA 4E22A 4E07A 3AVOA 3UKDA 2ZUBA 1FOEB 2P3SA 1UKZA 2HJGA 5JLJA 4PC6A 3GLFE 1JR3E 2W58A 3HPRA 3KXLA 3GLIB 3VNVA 2XOKA 2QTVB 2BVNA 4OK3A 1P6XA 3SJBA 2KI5A 3Q7PA 4X8OA 1DS6A 4D4KA 1COWD 1QZXA 2BEJA 4WW0A 1EFCA 4QBIA 2XZPA 5DLQC 2CHVA 3D8BA 2FH5B 2WSSD 4XVQA 3AVYA 1D9ZA 1VCOA 3Q5DA 3RRZA 1N6OA 2CHQA 4HSEA 1W7AA 2J0QA 2R2AA 3AH8A 3BERA 1GKUB 2FN4A 2NIPA 3ZJYA 4CEIA 2FJUA 3LRPA 1JI0A 3NHAA 4CVNA 3ND8A 4OI4A 2BMJA 1DEKA 3FFBA 3A37A 4B34A 3CF0A 4HI0E 4H1UA 3G5UA 5FI1B 3N2EA 4CEIB 1IN6A 4URWR 3O8CA 1CF4A 3RRYA 2EFDB 5K8TA 2IYYA 4MKFA 4LHWA 1OH8A 3KB2A 1QVRA 2P5TB 3PR1A 1OXTA 2ODNA 4Q4AA 4YC7A 1CRQA 1IXSB 1H8EA 4DHEA 3LY5A 5C18A 4GDFA 5EXXA 3ICQB 2C9OA 3CUEF 1HQCA 4C0JA 2O52A 3TH5A 2OZEA 1AGRA 4JLVA 4OQFA 4Q4AB 5AJWA 1E2PA 3X1YA 3ZH9B 1XXHA 2P67A 2KBEA 3DZ8A 1ETUA 3IO5A 2V8OA 1CJVC 1SKYE 5J47A 1G3IA 1SHKA 4RZ2A 1CP2A 1NVWQ 4LZZA 1NN3A 1U8AA 2VPPA 4JVMA 4G0NA 3OEED 2ZEJA 4ERNA 3ZVMA 3CBQA 3TIFA 3KXIA 1H8HD 3NEYA 2OE2A 1OH6A 2PZEA 1TU3A 2ZI6A 3LX5A 2Q9CA 3M4YA 2GCOA 1HY3A 1UBEA 2J87A 2CCKA 2WJHA 2ZJ8A 1W0KD 2HYDA 5FTLA 2G9NA 3AGQA 2FV8A 1Q3HA 5EE9A 3CX6A 4L15A 1HT2E 3CX8A 4KCGA 5TXGA 1FFHA 5EE0A 2GK7A 3U5ZB 2GEUA 2GCOB 1Z22A 2Q3FA 2ZJZA 2YWEA 3P32A 4QGHA 2JJ2A 2ZJYA 2YYZA 4WVFA 4Z8YA 3BH0A 1GNPA 1QRAA 3CZQA 1ZCBA 4W5JA 5HCIA 4HLCA 2VF7A 3K09C 5JCZA 3UK6A 5FL7D 3GEHA 2REBA 5CK4A 4U00A 1YVDA 4A8JC 3OIYA 4QM7A 2AHOA 3IILA 3C4JA 4HAYA 4GZMA 5LPNA 2PZFA 1VG9B 4UNQA 2VTKA 1X8JA 2H17A 4Q1FA 4DLSA 1E1QA 1KI9A 2QROA 1N6NA 3QEJA 3IHWA 2CCGA 3QG5A 1P2VA 5FR1A 3J81k 3SE0A 2GK6A 2ZIAA 3Q85A 3E70C 1G3UA 2ZSAA 3QOFA 4CZ2A 1XEWY 2FOLA 2XNDA 1UKVY 2QM8A 3T35A 3NXSA 2B7CA 1R0WA 4KVGA 4MYUA 2GJKA 2DFTA 5J5CA 1I2MA 1OHHD 2DB3A 1L4YA 3K0CC 1XJCA 4I99A 4QGAA 4PO8A 4BE7B 3TQCA 5HKKA 2ZUCA 3IIJA 3CLVA 2GBLA 2ANCA 4GL2A 3WYAA 4NYJQ 3FMIA 5FFMA 2IS2A 5CYPA 1OFIA 2H8KA 4B71A 1DOAA 2EW1A 4OJQA 3IEVA 4YDSA 2QGZA 4DCVA 3BFKA 3A1WA 4DLXA 2GTPA 4HLUC 1E9CA 1OPXA 1GILA 2R6GA 3T06B 4PX9A 2X19A 4XTRA 1LFDB 2CVFA 2QQEA 1ZINA 3VR4A 4KITB 2CJWA 3U7GA 3THYA 4JLDA 1ZNYA 2PT5A 2HXSA 2QQ0A 4C0QC 2J9RA 4QHYA 3K9NA 1CR1A 3EA0A 1Z63A 2CJWB 3THYB 4DCNA 1Z0DA 3VR6A 1BYIA 1KI8A 2OUKA 1IONA 1NMZA 2OFWA 1TQ2A 4TMWA 4X8LA 1ZM9A 1T3LA 2R6AA 4AWXA 3W3AA 3MRSA 3LAWA 2RGBA 5E7IA 5FTNA 3B1WA 5KNBA 1MRSA 2OESA 2R8RA 4BFUA 1LW7A 4MGZR 2OLKA 3L8YA 2ZRHA 1UJ2A 4Q1CA 2QMEA 1OFUX 4EFNA 1SULA 3HR7A 4LJ9A 4Q1AA 3Q9LA 1A2KC 1R6BX 1N6PA 1XJQA 2NPIA 2BEKA 3V4FA 5TY0A 3FE2A 4RVCA 1A7JA 4XD7D 4B3BA 2P0EA 4KLNA 4A6XA 4XVUA 2ODWA 4H1VA 5LB4A 5DHAA 3R9IA 1ZCAA 3AF0A 4PC3A 3MLEA 2G88A 4BLSA 4IXNA 4C30A 2EQBA 4E09A 1O3YA 2QY9A 1GNQA 3RWOA 1G7SA 1ZUIA 1E2JA 2D4HA 1GITA 4P3YA 3BB4A 3SR0A 1SVLA 2ZJ5A 2F9MA 1AK2A 3F8TA 1E99A 4JKYA 4JL6A 2CE7A 4Q4JA 4BLTA 3ZD6A 4GZLA 1YU9A 2J7PD 1XD2A 1EGAA 4IDQA 3K0EA 4XOIA 2C03A 4C9BA 4O25A 2ZM5A 1AZSC 4IVPA 4B3DA 1NJGA 4BQSA 2FGKA 4A82A 2QORA 5EP4A 2QRZA 2VLIA 2BCGY 1VG1A 2WOJA 4D80A 4YMVA 2IL1A 3OEHD 1XD2B 3RRNA 3X1ZA 1NY6A 2R6DA 2R6CA 2YOGA 1TQ6A 3EASA 4HB2A 3A8TA 4IXMA 1IHUA 3ADDA 2OCBA 1ZNZA 1TPZA 4P4SA 4DLTA 3U3JA 5FR2A 2WZQA 2ZE7A 2A2ZA 1MKYA 1S0UA 421PA 2FEOA 1VYUA 3LX8A 4P4SB 5FPYA 2H5EA 1E9SA 1ZW6A 1YZNA 4B2IA 5GVSA 4RD4A 2BBOA 2ZRMA 4LCBA 1Q44A 2HCBA 1G7TA 1SXJA 3GLHE 3KJHA 3W5JA 1E0SA 1N5IA 4IRUB 4DSNA 1GAJA 2GZDA 1OSNA 4DUGA 4DXAA 4HZUA 1M7HA 2BHRA 4IOMA 3AF4A 1JJ7A 1SXJB 1G3RA 2HDNB 4IKEA 1QHNA 3AVTA 3U4QA 1E9FA 4JLJA 5L3SA 1U9IA 4XWKA 4C0LA 2D74A 3CWZA 2FPLA 3PVSA 2VEDA 3EWSA 1OXSC 4HZUB 3RAPR 4BFWA 3AKCA 4MYTA 1SZPA 1WF3A 1FUKA 2EVWX 2ZYUX 1ZM7A 4LJ4A 2WJJA 3NBFA 4KSBA 3BC1A 2X1VA 1RKBA 1BS1A 1G3QA 1RJ9A 2AD5A 2IYQA 4MYHA 4A6PA 1HEIA 2ECKA 1UM8A 4UKDA 4W5WA 1Z2AA 3AKEA 3A4LA 4BLQA 2ZXUA 1CIPA 1G19A 2WKQA 2C5LA 1RJ9B 3I4LA 5BYJA 3QKTA 4YMTA 1CS4C 2X2EA 2PCJA 1N3BA 5EP2A 5DI3A 1JXMA 2QU8A 4JLNA 4FN5A 2C04A 2RGCA 4PAMA 5B30A 1VHLA 3FHTA 4MRRA 1SQ5A 3BH6A 4JBYA 4M1MA 2EWVA 1BMFD 2BOVA 2ZRFA 3M0EA 1NI3A 2R44A 3N70A 4JL5A 4WZAE 1MT0A 3AP2A 5CJPA 5DI3B 5HTKA 4GMDA 2CLSA 4QJ5A 4TMXA 4WZBE 5JSZB 3O47A 3SU8A 1AGPA 4FXPA 2RAPA 3EWAA 4NPHA 3RRMA 3W3ZB 5JJKA 5DGXA 1ZUNB 1Q57A 3ADKA 2LKCA 1EFRD 1UBGA 2IYZA 2QTHA 1E6CA 4JVNA 4NYIQ 2B7BA 2A78A 2W6IA 3QJYA 5IDVA 1YJ5A 1G6HA 4RY2A 1EK0A 1OIVA 2BCJQ 5L3QA 1E2DA 3DVLA 2G1KA 2ZSBA 2RGXA 4G5QA 2WIAA 3U7HB 2QA5A 1CBUA 2ZVPX 1F60A 2RGEA 2FMXA 3I5XA 4AI6A 4URVR 3K9LA 3EXAA 3Q3JB 3LXXA 4KODA 2G77B 1E79A 4FMDF 3AF2A 4P0TA 1HV8A 3OFND 3GEIA 4GI7A 2QP4A 3SYKA 5G41A 2O8FB 5L3RA 1RE0A 4JJKA 1N6IA 1Z5ZA 3VR3A 1WP9A 1TEXA 2ASEA 2W6JD 4DJTA 5AJZA 3LWNA 4TYNA 3RDPA 4WXPA 3BK7A 2KBFA 3QPVA 4GBMA 1D2NA 4HYYA 1Z0KA 2GWHA 4LBZA 4D4MA 5HR5A 2OCPA 2AK2A 2PBRA 4M8NE 1COWA 1N2CE 4IDOA 1GRNA 1IXZA 3RC3A 3SQXA 1NJFA 2GCPA 3TJZA 3C5HA 1W2GA 2C2HA 4MKGA 1W4AA 1YE8A 2EU8A 4K8OA 4M1WA 1RZ3A 2CNWA 5JWOA 1K6MA 1S2MA 4TZ0A 121PA 2GKSA 3AVQA 4V0MA 2AXPA 4L9WA 4KU4A 4M2LA 2HYIC 2JLZA 2XNSA 1W0JD 3GLGB 2O8BB 2ODBA 4C0AC 5C46F 2WMOB 5FBLB 1BIFA 2FE4A 2YOFA 1NSTA 1AS2A 1WE2A 4IEEA 4NZYA 3GLIE 1ZP6A 4PPFA 4O0MA 1V5WA 4EFLA 5B57C 2IX3A 1ZU4A 3ZZ0A 1E9RA 2HUPA 1OIWA 2E1RA 2JLSA 5TARA 4I1OA 2CDNA 1JJVA 1CEEA 4LX0A 3HYRA 1WCV1 3IBGA 3KKMA 2JAQA 4G3XA 2FU5C 4JLBA 3QVVA 4A1FA 4Q00A 4LBYA 3AVPA 1MO3A 2A3RA 2ZI4A 1UPTA 3WMGA 4KO8A 2OCYC 3THWA 4DDVA 1J99A 2IW3A 4Q01A 4LJ6A 4P33A 2ZETA 3IGFA 2XEXA 4R71A 3THWB 1I2DA 3B5JA 3K53A 2QMOA 4JSTA 3OEEA 4IDHA 1DO2A 1XCPA 4JLMA 1NIJA 5C2JB 1H8HA 1KMQA 3EZ6A 4K46A 4B74A 4MYCA 2WWIA 4DSUA 1X1RA 1VIYA 1ELOA 3NKVA 1W49A 4DC9A 4C4PA 1JR3D 1JQJC 2IYXA 1KGDA 2XSZD 4R7ZA 3C16C 3LA6A 3QXXA 1OXXK 1TU4A 1KIMA 1W0KA 3AKDA 3IIKA 3AQ4A 4NYMR 3VX3A 4D2IA 2KE5A 3QKRA 1WRBA 5FTJA 4DT1A 3MJHA 4US1R 4KVAA 5EP3A 4BRWA 2VF8A 2D06A 2WVJA 3QXSA 1XTKA 2ERYA 2F1HA 4IFBA 2AFHE 1F6BA 1KI3A 2HCJB 4HUQA 4B44A 1ZIOA 3QKRB 4C0SA 1IN7A 1JXOA 5UKDA 4LJ5A 5CDFA 1BYUA 4LYAA 3TUJC 4YDHB 1OT3A 3C8UA 2GRJA 1KK0A 3LQQA 1P3JA 1XMJA 3MMPA 721PA 1GM5A 2DWOA 5FL7A 4DDWA 3L8ZA 5CM8B 1X3SA 4PO9A 4BLPA 3LDAA 2GXUA 1AIPA 1ZJ6A 4II7A 4W5HA 1KNQA 1N5KA 3MWLA 1CR4A 1KI6B 4URUR 3KQNA 5F9HA 1P5ZB 1WBBA 2WWXA 3DM5A 4Q66C 1SXJC 1W46A 4BWYA 4ZI2A 1AKYA 4JVLA 4YONB 1G6OA 1KY2A 1Q1ZA 2ANBA 2BM0A 4NBSA 4PZLA 5DISB 3F0TA 1TUEA 2QRNA 4TMZA 1ANKA 4TYYA 1Q22A 4NMMA 3U3OA 2WTUA 2IUSA 2ZREA 4N0DA 5EP1A 2W0SA 1UBFA 2WOOA 2YC4C 1U9IC 2NG1A 3CNLA 5LD2B 1Q0UA 4ZPXA 3B60A 4C0HA 1OHHA 4QBFA 3VKGA 2DWPA 4TQAA 3AVWA 1X6VA 3IIMA 1P2SA 1RRGA 2PT7A 3NHBA 1FUUA 4QBHA 1CKEA 1R0YA 3F3YA 4G1UC 4TYQA 1J7KA 2WKPA 5EXTA 3KX2A 4XH9B 2ZYVX 2Z4SA 1M7GA 5BXQC 3LBHA 1NIPA 3ZQJA 4DDTA 1IJEA 4JLAA 1GL6A 1G9XA 1P9WA 1GG2A 1OKKA 4OKSA 2VSFA 3D6TB 1AS0A 2VQSA 4IDPA 1W36D 1ZD1A 1S1MA 1S3SA 3A4MA 4DLRA 2BKUA 1G8HA 1W4CA 2WJVA 2MMCA 5KSPA 4TL7A 2WWWA 5FOTA 5JFGA 3CX7A 1KSGA 5HZKA 4NP6A 4YMUA 4ZI3A 3DZDA 4URXR 4NU0A 5KNCA 3N5CA 3T34A 2HT1A 1VYTA 1KO5A 5KSZA 5KTYA 2NO9A 2VO1A 5FOWA 1W44A 5AUNB 3SYNA 4BRUA 4TL9A 2DWQA 2ZRNA 2IYTA 5KPDA 3U3KA 4QJ4A 2A5DA 1DE0A 4DEXA 1JAIA 1RRFA 5FOSA 5KSYA 3TBKA 2JLYA 1YR9A 3W6NA 4EPYA 3TSOA 2NGRA 3L0PA 1PZNA 3MCAA 1L8QA 1T5IA 1T6NA 1X1SA 2YOHA 3EC1A 1NLZA 1OJLA 2VHJA 1T4GA 4LPSA 3EPLA 2PJRA 3PUVA 4KV9A 3AVXA 5SZHB 5JMTA 2PEZA 3TK1A 2ZTSA 4B75A 2ZJ2A 2WWFA 3VNUA 1T5LA 3DMNA 2B8TA 3GMTA 4BFSA 2RH5A 3NC1C 1KZ7B 1M6NA 1BO6A 4OHWA 4DLWA 1YZTA 4TQ9A 3KKOA 1ZBDA 4EUNA 2O8DA 3FVQA 3I32A 3IHLA 3OIUA 4LPKA 3SI7A 4Q18A 4FMCB 1P2UA 3DKPA 1QF9A 3SJCA 4AG6A 3T12A 4JLOA 5DIFA 1HE8B 2O8DB 1LVGA 3TRFA 4HDCA 3AUXA 3ONWA 3NWJA 4AD8A 1QHIA 1CRPA 2G1JA 1E2NA 2WAXA 2ZI3A 3WBKA 2ZS9A 4LWZA 4WIAA 4OK5A 2QAJA 5FUWA 5IK2D 1E96A 1US8A 3BJIC 3U6BA 2C8VA 3NDBB 2CLDX 1G8FA 3OEHA 1NSFA 1NL3A 4PC7A 4MDFA 3BH7A 3WY9A 1E4YA 1OW3B 4TMVA 3CIOA 4B33A 3T5GA 4Z51A 3EW9A 4JMPA 1R2QA 1US8B 4HEJA 4DIDA 1IY0A 4AKHA 4OL0A 4A0HA 1ODFA 2H7VA 2OV2A 3TSWA 3I8XA 1U8YA 2WICA 4JBXA 1DAFA 2JLXA 1CULC 5CJ2A 4JLPA 3K70D 1WB9A 2NMVA 1TL7C 4NKRA 3B1YA 2GJ8A 1TQ4A 4JBWA 3KQKA 4ZKDA 1XB2A 4LSGA 2Y8EA 1ZMXA 4US0R 1IN4A 1Z6AA 2WPDD 3JZAA 4AKEA 1DG3A 2FDCA 2NZ8A 5DE3A 2V1XA 4DEYA 5JECA 1GTVA 2J59A 2OHFA 2AKAB 2IF2A 1P2TA 4NHOA 3DOEA 1KDTA 2X8AA 4BFYA 1I4TD 2A9KA 3PQCA 1VCIA 4NE2A 1JPNA 4M4SA 2H57A 1Q1BA 2AX4A 1A2BA 2ORIA 2F55A 1S1CA 4M0LA 2YVUA 3NBYC 4ACAA 2UZIR 3A4NA 3UIEA 1N0VC 2GXQA 1E94E 2WSMA 3LBIA 4QKQA 3U3MA 2I1QA 3NBXX 5DI9A 2IWRA 4PQRA 3WYGA 1W5TA 3RWMB 2OEPA 3QXCA 4LC0A 4RFVA 1U90A 1E2GA 2ZE6A 2B6HA 3TR5A 1FL9A 3WMFA 4IFEA 4HAZA 4TLAA 2ZYWX 5G3YA 2HV8A 1CTQA 3EZ7A 4BZQA 1KI1A 3I92A 5E95A 2VSOA 3SBDA 3ADBA 1XXHB 3W8NA 3R20A 4GMXA 1KAOA 1OB5A 1HUQA 1XMIA 1T0JB 5H70A 3TVDA 2GZHA 4TWZA 4F91B 1XTSA 3BE4A 4IOKA 3U61B 1VCNA 2WAYA 4IDNA 4LI0A 2FNAA 1BMFA 5LB2A 3NIBA 2G83A 3CF2A 2JJ8A 1G7RA 4FCWA 2QBYA 4PQYA 3HP1A 4LBVA 3T1TA 2QZ4A 3THXA 3FMFA 3LH5A 4Q03A 1N6KA 2OG2A 4OQNA 1FP7A 4L9SA 2QBYB 2IS1A 1G16A 4ZDWA 4MA4A 3UMSA 2BDTA 1Z6XA 3GJ8A 4IHQA 3I72A 4JIMA 4XSGA 3CRMA 4X8HA 1NF3A 1TF7A 4ESVA 3THXB 2W0MA 3MG9A 3WRXC 4CDGA 2CCJA 1XCGB 3FYHA 3GP8A 5AWFC 4D0LB 3ZVNA 2IHBA 1GUAA 5LD2C 2PEYA 2QL6A 5K8IA 1IXRC 4Z1MD 4B3GA 4CT5A 3ZD7A 1KO7A 2IEYA 1OYWA 4RSGA 1AZTA 3OFNA 1HT1E 2OAP1 2PLRA 3KZ1E 3OE7D 2UVQA 3NG1A 5AUQA 3AV0B 2CBZA 4F38A 5BYKA 3CH4B 4AIIA 3MGCA 3VHLB 2VSXA 4V0OA 4D6PA 2F3RA 2PH1A 4I1SA 1MOZA 3K9GA 3MUFA 1CJMA 2QGNA 2W6JA 4BFZA 1SVKA 2ZPTX 2QP9X 4TT3D 5JS8A 1UAAA 4WOPA 2E9SA 2YJTD 2WBLC 1KOFA 4MITA 3VKWA 4XVRA 2P65A 4FMBB 2J46A 1RRPA 4MQBA 1GKIA 2BBTA 4A4DA 4JL8A 4UQOA 1FTSA 2ZVQX 2NO0A 6Q21A 1XD8A 4OYHA 4TL6A 1XZQA 3WP0A 2JJ1D 5A5GA 1OIXA 1AM4D 3E1SA 4MH0R 5JZVA 1W0JA 3RC8A 4QNRA 3PIRA 4IVQA 4TLBA 1P62B 1S9HA 5AUPB 4V0NA 2ONJA 3MD0A 1R0ZA 5KPJA 3R9XA 2QG6A 5DYIA 1G21E 2V7QD 5FTMA 2ZRKA 1OFTA 1W1WA 4LYJA 4U5XA 1R10A 4F4JA 2QE7D 3MJRA 4AYWA 2ZRJA 4RD6A 2W83A 3GFPA 2GAOA 2ZS8A 2BBWA 2JDID 1ZUHA 5JI3E 3EC2A 1YZLA 3QXHA 1JEDA 5IT5A 2H1LA 1OH5A 1DO0A 1KI7A 1YZUA 1KK1A 5SZIA 3VQTA 1DADA 4A92A 1UKYA 1YR7A 2QMUA 4TMTA 4XSHA 3GJ6A 2ERXA 4ESHA 3P26A 1U8ZA 1BOFA 3OIWA 4V03A 3DO6A 3SBEA 3WHKA 2C99A 4BUJA 1RVDA 1N6LA 1ZM2A 4B43A 3GLGE 1TNDA 4A0RA 4DBLC 1PUIA 3FKSD 3X2SA 4A0FA 1IY2A 1G5PA 3CNOA 4Q5IA 4Q21A 4B47A 3RVBA 4JLKA 2C9CA 1W4BA 4FIDA 3U44A 2FSIA 4ZKEA 2MSDB 2AKYA 1XF9A 3T1OA 3GEEA 1KO1A 1X86B 4JYBA 5FPTA 1NVUQ 1YZKA 3GLFA 1JR3A 2NQ2C 2XSZA 1JNYA 3CH5A 1GRRA 4IVRA 3B8HA 1U0HC 2BBSA 4YQFA 2CE2X 2PX3A 1IOZA 3R8CA 1ESNA 5BN3A 4M1SA 3KJIA 4PPQA 2ZJOA 3EPHA 2HLDD 1DAMA 3GLFB 3IPXA 4RD2A 4DDUA 5J4LA 3I1FA 1WA5A 1OFHA 2QPTA 1F2UA 2FSFA 1IY1A 3G0HA 1N0WA 4TLEA 1Q20A 4M22A 1S3GA 2ZR9A 4Q4JB 5P21A 4TL8A 2I4IA 4Q7MB 5KSOA 1ZM3A 1LV7A 1F2UB 2FZLA 2ZE5A 4AYTA 4Q19A 1J8MF 1F48A 5A0FA 2FA9A 4ARZA 4DCSA 1XD9A 1G7CA 3DM9B 2AL7A 3MSXA 4GFDA 4PC2A 4Q7LA 4RZXA 4UXJA 2XB2A 1ESMA 1IAQA 5KDOA 1BH2A 4Q9LA 1I4DD 3A1VA 1CJTC 1II9A 1XTJA 2D2FA 3KJEA 4LHVA 2XTMA 4S35A 1W47A 1XP8A 4XTCS 2OSBA 3PV0A 2XOKD 4EAQA 2IYUA 4LBWA 1YRBA 2OCAA 2MSEB 1CXZA 1QHHA 4M1KA 2Z83A 5G3ZA 2F1RA 5EJEA 4NONA 4XWAA 5AJVB 1GL7A 4ZDKA 2Z4RA 3LLMA 4M1OA 1D8TA 1Z0JA 2IYLD 1EWRA 3EIHA 3LVRE 4QGGA 5KYKA 4FD2A 3RS3A 2WKRA 1T8TA 4OK6A 1D9XA 2IYVA 4Q1DA 5FBWB 5BQ5A 2GESA 2CLCX 4GOJA 4JT2A 4RD0A 2Z6VA 3W6PA 1XPUA 4PAQA 1OV4A 1P7CA 1E2FA 3CRRA 3U4QB 1SKYB 4URYR 1GDDA 5L3SB 4M1YA 4R2IA 3REGA 2A7QA 1E9AA 1GRQA 4DLVA 4TTQA 1W4RA 1E2IA 4CRWB 4OHXA 1CR2A 3RS4A 2OXRA 2XJ4A 3RHFA 3CRVA 2C96A 1W36B 4BGDA 4LHXA 3CRW1 4DIEA 4HLDA 4KAXA 5KNDA 3O8BA 3FDIA 1Z47A 3S1AA 2OBNA 2XB4A 4FCTA 1U98A 1ZAKA 3EZ2A 1NG9A 1H8ED 3CWQA 2IYRA 3QKUA 2O0KA 1IN8A 1GP2A 2DFKB 3OESA 1GIAA 3S1AB 1KI4A 1Z2CA 3P1JA 3C14C 4ASUA 4UNPA 1M1YE 2NOAA 1DTSA 3D31A 5CYOA 3B85A 1Y63A 2TMKA 5KUTA 1IM2A 3QI2A 3HJNA 2CEAA 1AKEA 1E9DA 2A5GA 3TQFA 1ZM4A 1C1YA 5FI0B 2GXSA 1UBCA 1JALA 3ZDQA 1YR6A 4LC1A 5JJIA 1DARA 1E1RA 4IEIA 2GA8A 2F1JA 5GJVC 2JLQA 5FOXA 1UEIA 3V00A 3CF6R 1DBSA 1HYQA 1KMHA 1KY3A 1G8PA 3DKVA 2J3EA 5FOVA 3UWOA 3K1JA 1N6HA 3MAAC 5L3QB 1JEEA 1LF5A 3UMFA 4RFSA 1NBME 2QN6A 1KMHB 2VRWA 4US2R 3PEVA 4URZR 3K0SA 1T3HA 1SHZA 3EZ9A 5GJCA 2Q0HA 1NLFA 5EZ6B 3FTQA 4RJLA 3AM1A 2G6BA 5E4FA 2EWWA 2O0JA 1II0A 4RFSB 2B92A 4IW3B 2V9PA 3B13B 4B3XA 1U81A 4M21A 5CIWA 1RRCA 1TEVA 2GBLC 3RNLA 5IK2A 3CW2A 1CJUC 4P32A 4HATA 1K5DA 1QVAA 1RFLA 2EFEB 1ZIPA 2QPAA 3FMOB 2IXEA 5EXPA 1XNJA 2DPXA 3ZIAD 4D26A 2GF0A 2I3BA 5DHFA 2ONKA 5JEEA 4ZIRA 2DFLA 3EIEA 1XCMA 3NTUA 1NVVQ 2FZ4A 3R7WA 1LF0A 2GXAA 4EPVA 2V3CC 3VFDA 3E5HA 4LYHA 4BLOA 2WSSA 2JLVA 2V6IA 3B78A 4FW9A 3W6OA 2ZJAA 3FPAA 3DOFA 1UKEA 2YWFA 2OT3B 3R7WB 1G8GA 4RKFA 3WRYC 5ANRB 2IS6A 3I8SA 4BFVA 4Q7KA 3LXRA 2ZAOA 4Z8XA 1FPMA 1RYFA 2IF0A 1NMXA 4TYPA 1P75A 3G82C 4Z54A 1JB1A 4S2EA 4B2LA 4EPRA 4OI0A 2BM1A 1T9HA 1NN0A 1GOTA 2H16A 1E0JA 3KKPA 1XU4A 4PHHA 5AK0A 3HR8A 5B2ZA 3UMRA 1DG1G 2ZR0A 1J2JA 2VP6A 2KSQA 3B1VA 2HF9A 1QHXA 3QBVA 4KFTA 1R5BA 4OHVA
chains in the Genus database with same CATH superfamily
5LP6B 1UMBA 2CBXA 4CHTA 3NW9A 3RYTC 1NC1A 4DA8A 5SY9A 3NHLA 1CY1A 3NNSA 2Q5JA 2XUFA 5K3FA 3L7IA 3EDQA 4WLNA 2AQHA 1M6YA 1U11A 3C6BA 1Q92A 4M9QA 5AJYA 2I7DA 1UMBB 4JIGA 3LPNA 5JS7A 1EUZA 2WWVD 3THRA 4LV6A 3TIIA 4HGNA 1HZJA 1M9NA 4YUXA 2X2FA 4HDKA 5JI2E 4I5GA 1MZPA 4QUEA 1ACLA 2P3LA 2QRGA 5C1BA 4Q48A 5EQTA 1E7QA 3RREA 2RAUA 4JFAA 1LK7A 3C3KA 2TMDA 3H1TA 4Q3AA 4RM2A 4RYLA 5DN9A 3UMCA 5LXTA 4KMOA 1QU2A 5JWRA 4PINA 2PJUA 3CNQS 1GG8A 3TTUA 2WHQA 3NH6A 4HDKB 2H11A 2NN3C 3P9CA 1AUPA 4NZMA 3DNMA 1WKCA 4UEKA 2HDOA 1PYGA 4Q47A 1PQWA 3ENWA 3UAGA 1OX4A 4FYMA 1NP6A 3TEMA 1FX1A 1YZQA 2I0FA 3ZZTA 3TWOA 4CIVA 4CYMA 4LF4B 4ER6A 3U1TA 4YH1A 3ZY6A 2BISA 1UIRA 2WD7B 3LX4A 2RKOA 2WVHA 3IVAA 1V7CA 4I5EA 3SK0A 1CR0A 3VZCA 1WUIS 2ECFA 2Y0EA 1D2RA 3B3AA 3H4VA 3A1SA 1OX4B 3GT7A 5DOVA 5ALGA 4F0JA 2QD1A 3E2IA 3KSMA 1XR3A 2GBGA 4DYHA 2B99A 1DZ3A 4P31A 1KMIY 1JBKA 2HJVA 1WBJB 4P7KA 5G0VA 1ZA1A 4UXHA 1QYIA 2FW0A 2FWBA 3MS2A 3FOZA 4MPJA 4MS3A 4KQXA 3D5QA 3WGGA 4PVCA 2W42A 4K0KB 1R15A 1TVMA 4LSWA 2CJPA 1XEWX 1KORA 1Q21A 1SBHA 2D1TA 2VXYA 2W2XA 1OF1A 3GN1A 1EP2B 1W76A 3B6KA 4LYDA 2APJA 2JL1A 5A2GA 2WF7A 1EWTA 4MS3B 5DV9A 2ZUDA 2IX9A 2QYOA 4LRTB 5AHKA 5EMHA 2GLXA 1IJBA 4J0GA 4LHYA 1SUIA 2C2YA 1GFSA 2FPSA 4BLRA 1X94A 3AB8A 1JIIA 1EXNA 3L6CA 1IMJA 1JEAA 1PJ2A 1SUBA 3AF1A 4NNPA 1KDZA 4JHXA 4PPNA 3ZGYA 1E8NA 2PE5A 2OD7A 2ILTA 1VE6A 1UBOS 2PA0A 3EBOA 4NECA 5DBIA 4N8EA 5DLYA 4ALJA 4F6LA 1DKLA 2AJ8A 4IINA 3EEBA 3U16A 2BZGA 4CMHA 2CW5A 4CQLA 3PEWA 5C8YA 5EGNA 4JYPA 3BIFA 4L3OA 4L27A 2V54A 3TI7A 3AP1A 5CK5A 1LDYA 4K9OA 3VR5A 1I2ZA 2ZAIA 1G8KA 1SK8A 3ZGXA 2G9QA 2O3JA 5C8YB 3BXPA 3PE4A 4UREA 1QHEA 1PK9A 2Q3HA 2XEDA 3KLBA 4FGZA 3ESBA 2PS0A 3K09A 5HUJA 2AK3A 1Z6PA 1UFKA 3C5CA 1W36C 1E32A 1EFPA 4RZUA 4Z4EA 4C3ZA 3FCCA 4HSGA 1N33B 5FORA 1KP2A 1N2GA 3SOPA 3K16A 3B3FA 3M6FA 2ORWA 4FT4A 4UEOA 2O3UA 1XMSA 3Q98A 3BOSA 4FCCA 1Z6ZA 3OTOB 4C0KA 1E2HA 4JELA 2O8CA 4JMLA 1NN1A 1SOUA 2YV3A 3K0KA 4XASA 4DKJA 2NXNA 1PG2A 2YXEA 1SOAA 3F5MA 5EKSA 2QTZA 3H8SA 4Q3BA 1BWRA 1C8KA 1RI5A 3E61A 3FVWA 3L7DA 3OOHA 4FI3C 5CT5A 2O8CB 3AT1A 1YOBA 1RQGA 4RO0A 4WZBA 4WCDA 4LOJA 2IPNA 4BIIA 2OWEA 3GJZA 3IHKA 1C81A 3NOQA 1EXVA 3OZWA 2GILA 5F2OA 4BX9A 1X9IA 1K9SA 4WZBB 3IPCA 5AOBA 1Y1PA 1OI4A 1WHSA 3DDZX 1IBRA 1JTEA 2B21A 4IJMA 1FS6A 1U8EA 1C8LA 2IYFA 4KZKA 4RWEA 5IJWA 1CK4A 3X1WA 4ZCIA 1LS6A 3H04A 2QL7A 4OLHA 3NBMA 2IT1A 2YMPA 2Z1MA 2QL5A 1JYSA 4HLUA 4IH9A 4MQUA 4QWMA 1D2AA 1VB5A 1Z6GA 4RJKA 1K4YA 1WHSB 3O90A 2JVJA 3DH0A 3KVOA 5A03A 3EXIA 3G5LA 5HUHA 4DPMA 1OYYA 3DEAA 1BU8A 2VHEA 4TV8F 5JO0A 1GDHA 5E6RB 5EIBD 3DL0A 4UTZA 4IZOA 1K5GA 4WY8A 4F3NA 1L4HA 4KRGA 5C5DA 1Q0QA 1YRQA 2JH8A 5FAXA 4ZC1A 3EXIB 2WT8A 2ZRIA 4YFYA 5SYAA 4YAUA 1G5RA 1BD3A 1YHNA 3E8SA 2LNDA 3QPCA 2EFGA 4O4IF 4YQFA 3M4NA 3CC8A 3A1UA 1NNEA 2FKAA 1C1XA 1W75A 3L7JA 5HQ3A 1TKAA 1XJ0A 3V9PA 1N1DA 2EFHB 1B2RA 2J5QA 4H4CA 4EF5A 3GLQA 5E9AA 1PYDA 1JE0A 1WD7A 2YNMA 4HRYA 4LFCB 3T7KA 1KKLA 2ZJ1A 4AKSA 3KUCA 1VMIA 1C1XB 1X7GA 3WDKA 1F3LA 4MVJH 5K3DA 2JAPA 5HQ3B 1HTWA 4YB8A 2X9GA 5T4FA 4G1BA 2G7MC 3BX1A 2A88A 4BMYA 4E33A 1DBVO 5E9WA 2OB2A 3AR2A 2NYRA 3QU2A 5F52A 1QZ3A 2FGJA 2WM2A 4OFWA 4LVCA 1L8LA 3EG5A 4B7CA 2IPAB 5KAPA 1E3MA 3AGPA 4WDQA 1NMYA 2ZWAA 2PJDA 1VKNA 2ROQA 4CLOB 4YAIA 1V3VA 5CGZA 4MW1A 3T3GA 1IEXA 4OLAA 2IS4A 4D0NA 1RYHA 3BVPA 3W9BA 3W90A 3TNFA 4JJZA 1XK7A 1QCYA 1S8OA 3C7KA 2WHPA 2JLUA 5LYJA 3RUFA 2RHBA 5CAEA 2XMCA 1MX3A 4EY7A 1U2DA 1TTQB 3L41A 4MQ5A 2G36A 3GA5A 1TQ8A 4MB0A 1P8JA 3K1AB 4KQGA 2Z9BA 3UAYA 4UHDA 4OM8A 2WHPB 1I01A 2B98A 3QA3E 3VRHA 5LYJB 5HNKA 4G8JA 4H0NA 1WLYA 4JSRA 5REQA 1HA3A 4JNKA 4DR3B 3EVFA 3FHJA 3ZW8A 3N7UA 3R7NA 1QX4A 5T4BA 1P9OA 4YRAA 1SUEA 5D00A 4OQXA 4D8TA 1HBJA 4MRPA 4PX5A 4UZFA 1H9AA 1TJ5A 3FWYA 3IHTA 4QRHA 5REQB 4D9FA 3VMMA 3CF4A 4MWEA 1GA6A 2GUWA 2WLTA 3IXMA 1CJSA 2Y77A 4PCLA 2FFAA 4U7HA 4DXHA 4G5SA 5KOHB 4MS4A 3D7MA 1CUFA 3QKSA 4PS0A 5M04A 1W30A 1QE5A 4RTKA 4J4BA 3OLWA 3FMPB 3Q3CA 3WHPA 2CXXA 3X1JA 3ZQUA 3D8RA 5JHHB 4BVJA 4LDAA 4ZEWA 1SK9A 2RB5A 2OFXA 1JHZA 3HE3A 3QKSB 2EKBA 1S2GA 1YJ8A 2NXCA 1SKQA 3DZKA 4EG5A 2GDZA 3DBIA 4GR9A 4NYJR 1TEHA 1QQTA 3TXAA 1FDRA 3NGXA 4NARA 4GP7A 1U3DA 2B1GA 3AP3A 2I2FA 4Q4HA 5LMUB 4XIIA 1J70A 5EPEA 2WWGA 3R3WA 5TVKA 5TGDA 2D54A 2O3TA 4UVHA 2L69A 3D3WA 2BMDA 5T3UA 3V4RA 3D3KA 5ES4B 2KJQA 1NG1A 2PWZA 3A04A 4Q4HB 4AWBA 4U02A 4BEBA 3NPMA 3B7WA 4OP2A 1FFDA 1ZQ1A 4OU4A 4ZOQI 3N9IA 4AG5A 2FRVA 4AN4A 4DMUB 1XKLA 1ZU5A 3D3WB 2VH5R 5FLKA 5IEBA 4LJYA 4EGFA 1CZNA 2JLRA 5BWNA 5KQLA 4OFBA 2RH8A 5SYMA 4ZV7A 4BP1A 3SZ3A 3F9RA 4P4TA 4Q93A 3ZHBA 4WZZA 2BFPA 3LQRA 3AVUA 1CUUA 2FSHA 3SZRA 4OJYA 1MJ5A 2W98A 1GFIA 3TL6A 1Q7RA 3NJRA 1EFRA 2I5PO 2ID8A 3ACDA 4GOMD 1YKSA 4J6FA 4JKIA 5FPHA 4CMGA 4D4IA 4C4OA 1Y9DA 2DMRA 2IA5A 1WXGA 3FPLA 2HIAA 2VHUA 3N2IA 4H27A 4L0MA 4UM7A 3WWZA 1BTOA 2BGGA 3QVTA 3L2OB 1XEFA 1DJOA 1A7UA 1D1TA 1CQZA 3QWAA 4RD1A 4LKOA 1UOEA 2H59A 1VP9A 4YIHA 5K45A 2CV2A 3QJGA 4PGHA 1FRNA 2YZMA 2VH1A 2ZSFA 5JZBA 1F1BA 4Q3CA 4MPTA 1EFAA 3EOZA 3BS4A 4Q9JA 4AIRA 3T3HA 1A9QA 4L72A 1RXEA 1P60A 3NR2A 3CVWA 3LBNA 3NTQA 3U1VA 4RH3A 1TMYA 4BKUA 2A0KA 2CNDA 4MWBA 4IP0A 3G5TA 4K88A 4X60A 1RPJA 1VPTA 2DHCA 1TUIA 4ZEMA 3WZ2A 1J1IA 1TLFA 5DRYA 1LSJA 1PJZA 1Z29A 3V7UA 5KKCA 4PLVA 4L2IA 1FW6A 3R75A 2YIMA 3ER9A 2EG9A 4M7OA 1UDRA 3UWSA 1O6ZA 2JFVA 4HQRA 3PJGA 3G2JA 4CMEC 3MS4A 3CLRC 4L7QA 2NO6A 1WTCA 3CF4G 5TC4A 3RVDA 1J23A 4XWWA 1JV2B 2YS6A 4JYAB 4Q82A 1Y8AA 1TVEA 1GPJA 4PQEA 4A2WA 1EFUA 3M70A 3ONFA 2ZZKA 2YZ2A 2ZIZA 5DPMA 4AJ1A 4ZVNA 4RL4A 4R31A 4P86A 4C5BA 3IXQA 2VI5A 3OZFA 5AKHA 5DLDA 2PD3A 5F3WB 3FIJA 1E4OA 2ID7A 4UBMA 2AZMA 2ATXA 2E4YA 1JECA 3DPIA 4JITA 3DQPA 5CNIA 2Z30A 1VL0A 4FEYA 4LGVA 2TMYA 4R6WA 1CUVA 3TD9A 2PVSA 4O1IA 4IRMA 5IASA 3FZNA 2VUUA 1GUFA 1EB9A 1WCXA 4FYJA 2FG5A 1WMSA 1XTVA 2O0LA 2XUHA 2YC2C 1QK5A 3QQ5A 4LY3A 4Q9AA 4RD3A 3IDQA 3MWGA 3P71T 3O8RA 2WR8A 4E5UA 1QQ7A 1TMKA 2DU8A 5FJJA 2J4CA 1A7KA 4M53A 3DAYA 2P9YA 4TTVA 3HQ4O 3KQMA 5B3JA 2YJNA 4YUZA 1VXRA 2AW3A 3OOEA 4XA8A 3A3NA 3BJRA 3DUWA 3KXPA 3P27A 2JLWA 2C4WA 1FP2A 2JEOA 3NHRA 2A5FA 3U7FB 1GZ4A 2VAPA 3KEFA 1AD2A 1NE2A 3JQRA 5IG2A 4DUZB 3T9CA 3ZXXA 3HDTA 3CM0A 4OOEA 5A9RA 1O1YA 4ZTZB 3JAMA 1VKJA 4FLFA 5DX0A 1O58A 4UUQA 5EGSA 5HZHA 5BSRA 1XNGA 1ZH0A 1FEZA 2PJZA 3AUJB 3RSOA 4BN4A 4B9AA 3KQSA 3OJXA 4I6JA 3ZI0A 3V6MA 3AEKA 2FDRA 1UZNA 1RQLA 2C92A 5B2FA 4K86A 4B3GA 4R2HA 3JZFA 4N76A 1UDXA 1AH2A 2ZATA 1LSOA 1PSWA 4OX9B 3WB1A 2YV5A 1KH3A 1BXGA 3E82A 3EDRA 4L4UA 4UJ3A 4E1BA 4ZU3A 4KN8A 4YASA 5ALWA 5EY5B 4X5OA 1ST3A 3BXZA 3EF1A 1MLDA 3T61A 1ECCA 1T4BA 2A30A 4R1TA 1OA1A 2FHPA 2VJDA 3LUBA 1BXGB 4Z9FA 3KR1A 3UFXA 4YRZA 1J8YF 2XA2A 3R3HA 3KDPA 3T1QA 3WL8A 4EAAA 5LP1A 3RSCA 1WTAA 3ANXA 2E82A 3C85A 4MWZA 3CX3A 2VRCA 4YT8A 2B94A 3AR5A 1OH7A 2Y71A 3BMCA 3N7AA 5AVQA 2A5YB 2E37A 1IOLA 2WTNA 4RHXA 1QG4A 3PI7A 4H3KB 3QEOA 3EZFA 4D42A 2ZVDA 3OFVA 5H80A 5TT1A 4Z9XA 4HUTA 5K4HA 1MXFA 4A2QA 2OORC 2W93A 3DJYA 3GJ0A 3AINA 1BFUA 1E1YA 2FF7A 3BIOA 4PZDA 3F3KA 3U60B 3BRWA 2D0PB 1VECA 1BVYF 2BEUA 1U9JA 3G9ZA 3L6UA 2R62A 1AKUA 2O5VA 4OFXA 4QU0A 1KNXA 3Q7QA 2O7SA 4KAAA 1A96A 4CM1A 2XGOA 1U0NA 1AQIA 3RARA 3SZLA 2PUWA 2RGNC 2V7UA 2IXTA 3L0DA 2VNKA 1V8FA 4FVTA 1P31A 4GI2A 4J90A 2BEUB 4BPBA 1SCJA 4AW9A 3H5AA 1KTVA 2AN1A 5AM5A 2OBMA 4DJFC 4EECA 3EPKA 4DV5B 2XZTA 1XP5A 2C97A 4KGXA 1S4QA 5CFZA 1IJFA 1NZJA 4U39A 4BZPA 3FTFA 1JHYA 1WV0A 1Z06A 1EJ6A 1YQEA 1U8FO 3D6AA 1HYEA 3KQQA 3PUJA 3ZXIA 4Y0VA 2CFRA 4E4RA 1N8TA 3AHHA 3THXB 3FG9A 4EHJA 3TUIC 5IBPA 1M67A 5ENZA 3F6PA 3IPYA 3E7XA 4GPD1 1QR6A 8LDHA 1UT5A 4YMGA 1XKXA 1CC1S 4U9HS 4IIHA 1JKIA 3CT6A 4M38A 2WZCA 2IXFA 4NABA 5EXSA 4NDZA 5SZKB 4X64B 3OOSA 2RG7A 4KBFA 2PU5A 3L7YA 3WXBA 2EDAA 4AJJA 3S8EA 5A1TA 1RJDA 3EGOA 4KFRA 5GVRA 1ATIA 2NO1A 2ZWPA 2BWJA 4EL5A 4UNNA 1SUDA 2B8NA 2WI8A 1Y7PA 3TYXA 1SA0A 1OGIA 1XTIA 4PXAA 4YBZA 4HXEB 1YVPA 1CFZA 4WFQA 1PVDA 3T7DA 2J45A 1CV2A 2VA8A 2Q3MA 3DA8A 2GN9A 4JI3B 3G8BA 4D8WA 1MW8X 2Q99A 5FUYA 1FP6A 1WAMA 3D5EA 2R1VA 1V1RA 4O08A 4FYYA 1LBEA 2WFAA 4PLFA 1EESA 4KXNA 4UQPA 3TR0A 5BN5A 4XJXA 4EO7A 4JYCA 2R4QA 5FFFA 3U7JA 4G24A 5TMPA 4A2PA 3ORFA 5M2QA 1K7CA 1JDBB 2CFIA 2C7PA 2AYYA 1DGQA 4KPEC 1V1RB 5IX8A 4BNLA 4GO1A 1K98A 1XFAA 5FUBA 4EUKA 1HL7A 2PA3A 4WFKA 1AQ6A 3NHYA 4RANA 5BN5B 3IP1A 4F72A 4YQYA 2J5KA 2UUAB 4KAJA 4E2WA 1TTTA 3W06A 5A7HA 1HDCA 3EHEA 3HKEA 2E7ZA 2C2ZA 3CPHA 4LUCA 1Z0AA 3CKLA 3CXUA 4ZAGA 1SCBA 3ND6A 1HSOA 1V16A 2QWXA 4HH0A 5IHPA 3V1TC 2F64A 4KVFA 5H16A 1YNOA 1EVYA 3LCMA 1LV8A 5CB4A 4FE7A 2NO4A 3OP4A 2H2GA 2PQ6A 4F8JA 5I4IA 1AQYA 2UVDA 1M10A 5L4LA 1V16B 1P6QA 3MN1A 4WDRA 2OGSA 4PCAA 2XGGA 1OBCA 4XOUA 5H3LA 4M0EA 2Q62A 3PUXA 3IEIA 3BRCA 1CZKA 1ZUNA 2H5IA 2VHQA 3O82A 4RELA 2NSYA 1RAEA 4RKEA 4ZARA 4BNDA 5C7OO 4X7RA 1S8FA 2Z09A 4X45A 2VBFA 4I46A 3QE3A 3VU9A 4G81A 1KFCB 4YXWA 4LMAA 3ZK7A 3IEUA 5IF9A 3KHKA 3EUWA 1Z0ZA 1K63A 3EMVA 3BGWA 2ID9A 4BNDB 4LGCA 4NCKA 4JP8A 3H6GA 3VU9B 1WDWB 2ZJBA 4G0MA 4YT4A 1J39A 1QHSA 4H18A 3U4CA 1RE1A 4R9UC 5H59A 1R4ZA 3RTGA 1YTLA 2FMTA 4KQHA 2ZCJA 4UTNA 3LVQE 1QDUA 4POAA 4QDXA 1Q0PA 2JRLA 2DR0A 4PFQA 5KIAA 3W5VA 1G98A 2PRYA 4AY3A 4CNBA 2ETXA 1FJGB 1TAHA 1R9NA 5JLAA 1I4LD 3IERA 4OEHA 1I9CA 1J06A 3MQFA 2O8FA 4M9ZA 3HM2A 4KLAA 3LK6A 4RJ2A 1PL6A 1U1DA 5FYQA 4HVCA 5LMNB 2I6SA 3MEQA 2XNHA 1V71A 1M75A 1XQVA 3NOVA 2FFHA 1G21A 2W71A 5AVOA 3L0ZA 2ZULA 4DLYA 4MQ4A 1PFGA 1VE3A 2HEGA 2P79A 2QVCA 3NVAA 4MZDA 4V0LA 5CIQA 3IDAA 3UWMA 3ZLVA 5BR4A 5L7TA 4LXHA 1XQWA 1F0PA 4LE2A 1J9ZA 1Q12A 3GQBA 4CEHA 1G21B 3STUA 4DW8A 1WG8A 4WAUA 4CF7A 2JFYA 4KN6A 2NPFA 2X0NA 3ZHCA 3CUSA 4CM9D 3ZNQA 3EAGA 3K70B 3H5LA 2CD9A 4FFVA 1WULS 3N2LA 3GQBB 5HKKD 4CEHB 3OPYA 2GAAA 1KJNA 1KZGB 3JU3A 1SCUB 4TZ6A 5EIFA 3P5BA 1XCJA 1U02A 5A4JA 3GLGA 4GQAA 6PFKA 4MPDA 5EQDA 1SQFA 4KE7A 2O8BA 5F98A 1TIKA 4REOA 1SD1A 2P2ZA 3NDPA 1XLTC 2HMVA 2ZRCA 3QTTA 1X8KA 4IOLA 1I6MA 2MSLA 4V2UA 4X3CA 1XPRA 1H05A 2WYUA 3NV7A 1XNHA 4ENVA 4IO1A 4EFKA 1G3MA 5BWLA 4FMCF 3HRKA 3BB1A 4RXUA 1L7XA 5DNYB 2P9FA 2X6QA 1GPAA 4UMVA 3PC2A 2H7YA 2EIHA 1YRAA 4DSZA 1XMXA 1QH0A 4QLBA 4N40A 3Q8LA 4ZCMA 4A03A 3B3GA 1EHIA 1ZXBA 1U2GA 4QEDA 2AB0A 2RD2A 4PLHA 3GFQA 1ULUA 1U7HA 4LRWA 3S7TA 1N5JA 4RTRA 3SYLA 4FDTA 3NAZA 3W3AD 4BAZA 2F7SA 1H9BA 1C7IA 1NF8A 1V43A 3JAKA 1HYHA 1R4NA 2BE9A 4GP9A 4PX3A 4WNIA 5AK6A 4EFMA 1O95A 1P5JA 4QTXA 1ZYUA 5ELMA 5FCDA 5EJ7A 4XCXA 3A6PC 4C7OA 1Y82A 1ZN8A 4F11A 3JAKB 1L7RA 1PR4A 4HWTA 4W63A 3DLBA 1R4NB 3GNTA 1CUYA 5CT8A 9MHTA 4OQEA 2GBIA 4Y1RA 3MELA 5I7EA 1Z6TA 4LZAA 4B2PA 3MHTA 2GKOA 4C7OB 2HBQA 3K9QO 1ZH8A 3O4GA 4C05A 4CR8A 2DY1A 2GX6A 4IUDS 4P6VF 3KTAB 3UGTA 5JPCA 3BDIA 4M9XA 2QL9A 4FDUA 3UH1A 4HQKA 4B7AA 3KHTA 2QX7A 1I80A 1Y5LA 2R751 1XXHE 3AUYA 3MWDB 4FONA 5L8VA 1IH8A 4EPWA 3WQRA 5FA8A 2AXNA 3ESAA 1OXKB 1QE3A 2X9VA 4JP5A 4EYQA 4TKLA 3SX2A 1TJPB 4MVJE 5IPFA 1W93A 1E5DA 3ONDA 1ESCA 4N1AA 5L4SA 4AURA 5HF6A 4MW4A 3RUEA 3OE7A 2AN9A 5DO9A 4NY1A 3SICE 4YCAA 4KLZA 1V11A 1VMKA 4YACA 3O2NA 4P7JA 4ENPA 1Y6GA 1PIWA 4HGPA 4PEVA 4BN5A 1MO6A 4KB5A 3N3BC 2W2KA 3LECA 3R6DA 4RJIA 1KI6A 2FR8A 3DR5A 2OCDA 1RHKA 1RQ7A 4M1EA 1H4VB 1P81A 4PZ9A 1XPOA 3U6KA 1KYTA 5E4TA 2W2KB 5IUKC 2P91A 5AW0A 2Q4DA 1FQJA 3BWXA 4IIYA 4XYEA 4MUXA 1E2KA 2BI4A 3ZY4A 4AB1A 4L8GA 3KB1A 4G5YA 1BRTA 1E98A 3GFRA 1TMOA 1M8FA 4K1LA 4MVJF 3OEWA 2ZUFA 5C8VA 3A6LA 1RFGE 2PU7A 4S0ZA 2C4TA 4H77A 5JEDA 1SB8A 2G9ZA 3PBKA 4ZALA 1C7FA 1VL1A 1G38A 3L4EA 2ZS7A 1R0KA 4MV5A 4X6LA 5DGTA 4GLBA 4PYOA 2BTEA 1E5TA 3IP7A 2BIFA 2VYCA 3KVYA 1B26A 1VE7A 4LE0A 1EM8A 2WEKA 2BEWB 3RRJA 2H08A 2F3TA 2P41A 3DGFC 2X8LA 3ODGA 2WF6A 3G9QA 4JDPA 2I62A 5B6JA 3TKAA 2PLNA 2EYQA 1C9DB 4KLRA 2C3YA 4V2IA 1V95A 1X7DA 3AW9A 5FNZA 3UB2A 4NK4A 1QIJA 2HNBA 4ZQBA 2HHHB 3CEHA 1EM8B 4LECA 3ICEA 1KPIA 2H52A 2RAFA 3CU5A 5ELXA 2HT6A 4UNSA 2OAEA 1J2UA 3A3YA 3EVTA 3RG2A 3CRZA 2A0WA 4N9QA 3PPWA 2HSGA 5H1YA 5CD1A 3KBBA 1YV9A 4TMKA 4OSPA 3KQLA 4V02A 3QPUA 3O4JA 2P5SA 4MUBA 3QY0A 4BBAA 1O87A 2GKGA 1ZNXA 2WHRA 3PQ6A 4KGDA 5KNDD 4Z53A 3CMCO 4I8XA 2EBFX 1NBMA 3NANA 3RBVA 3TE7A 3NZEA 4BB0A 5CA1A 5HWSA 3DDSA 2O8EA 1J00A 3P9XA 1U94A 2AF3C 1W2HA 2E4ZA 2P11A 2ZB4A 3GRKA 3Q5EA 1OE0A 3TTWA 2HGZA 3LK7A 4LX8A 2H63A 5JVDA 5BUCA 3K05A 3GJ7A 3TI9A 1Q74A 1GGFA 1JQLB 2DT8A 3S3TA 4M0UA 4Q7QA 1SKAA 2OV6A 3KOOA 4KGVA 3MGAA 2AR7A 2GEBA 4WOBA 3AZOA 4ZZ1A 2O8EB 1KSJA 1JAHA 3IMCA 1FUYB 2CVQA 4BQRA 3V97A 4DR1B 3VYSB 3SJZA 2XR1A 1MAAA 5KWSA 4GM1A 2RI1A 1ACJA 4R9SA 1DAHA 1ENOA 1T2DA 4WVLA 1Q7TA 2WMNB 2EYUA 2MTBA 3NVDA 2C3MA 4G5GA 3UJCA 1VE5A 5IJ0A 1YAHA 4J2HA 1NFRA 4JI0B 2NU6B 2VS1A 4TLMB 3RRXA 1TAUA 1JR6A 1RXYA 1U3UA 4A0QA 5DFAA 5FBVB 1ZZEA 4DIOA 2XB9A 4LQCA 4R2WA 1E1RD 2G5TA 3GVPA 4WXEA 2K5UA 3VUEA 2RGYA 3SC2A 1GUDA 1R6AA 2YXDA 3H5IA 1E2LA 4GX2A 5AOCA 5FBRB 5FD8A 3U7EB 2Z6UA 2C2XA 1DQYA 4YS6A 2BDUA 2YRWA 1DBWA 1L1QA 2BFCB 3BCHA 1RMTA 5DWVA 1LS1A 5HE8A 1KTIA 3M9XA 1DELA 4G5HA 2OQIA 1KSHA 2WTAA 3WI7A 2IBSA 4CG3A 3I30X 2WB2A 3SC2B 1A50B 1VSVA 1A9YA 1B8VA 2FVXA 2JK1A 4LSZA 1R7RA 1YBMA 3ABRB 4G97A 3QMVA 2G9UA 3TG2A 1XI2A 1ZRNA 2G3YA 2IHNA 2VDVE 1LLCA 3BXHA 2EATA 1Z7BA 3SLKA 3L8FA 4E22A 1GNLA 3VI3B 5JDCC 2Q0QA 2ZUBA 4Q16A 2Z08A 3VVMA 2C8KA 1W1IA 2EC5A 3RKSA 1Z4LA 1R4MB 1UKZA 4RTPA 2YDXA 1KQNA 2HJGA 2Z4TA 3IURA 3ANYB 1JFSA 2NV6A 1UKAA 2CKDA 4PC6A 3B6ZA 3VR3D 2W58A 3HPRA 4CLDA 5HJ5A 3HSYA 3KLMX 4A23A 3DFMA 1P6XA 3SJBA 3NTLA 1CUBA 5H83A 4O29A 1CZRA 4W9RA 2VF4X 4DUPA 1QZXA 2BFFA 4BV2A 4ZYWA 3IQIX 2BEJA 4AJ9A 1YCDA 1KFKB 4WW0A 2ALJA 2IOHA 1NHWA 1X1TA 1LVUA 1SU4A 3MVEA 2CHVA 1V9SA 3D8BA 1V6AA 3OZCA 2WSSD 3P0FA 5B6PA 2V0CA 3U4HA 1J0DA 4N5MA 2J0QA 3HJHA 1TK3A 2C1EA 2BRUA 3C43A 4MVCA 3BERA 1JQAA 1JA9A 4HEQA 4G0ZA 1TAQA 4O2AF 3ZJYA 4CEIA 4H6PA 3ETEA 1WSWA 2NZWA 3AW8A 3O26A 4I9HA 4W1PA 3ND8A 5JS1A 1UBHS 3ED5A 3FFBA 3JSXA 4LVUA 3EK2A 3ZXUB 3KSZO 3UV7A 1IN6A 3O8CA 3Q9UA 2ZDGA 1AHPA 4CEIB 2CB0A 1D7OA 5DTQA 1JUDA 4OKNA 2IYYA 3LUDA 1GDTA 3I1YA 3WKDA 3L1JA 3KB2A 4EJ6A 4JWKA 3VPFA 1QVRA 2OCXA 3M81A 3FH0A 4MLPA 1OXTA 2RC5A 4K3VA 4E08A 2Q7XA 4CMJA 1QR2A 4L8LA 1PTJA 4YC7A 4BGIA 5EJ4A 5IFKA 1IXSB 1ML4A 5FDFA 3ETHA 3OBBA 3UTDA 1QVWA 3PA6A 4DM3A 3ICQB 2XYPA 1WQ3A 4IIVA 5I45A 1P77A 3H6KA 2GWRA 3QLVA 4QULA 1ST2A 2MCFA 1O8CA 1EDZA 3FFTA 4U7PB 4BAUA 1ETUA 3L07A 1SKYE 2AUTA 4EUHA 5G02A 4RVSA 1D3AA 5ELLA 2X41A 1KR2A 3GG9A 1JLMA 4LZZA 4OBWA 5D7BA 3OPYI 4I9UA 5IBQA 1K2VN 1T4CA 3UXEA 3TIFA 1G6KA 3AHFA 2PYDA 1OU0A 1H8HD 2H7CA 2HQSA 5IVKA 1OH6A 4OATA 3WKCA 2BI8A 2H1HA 2PZEA 5LMCA 1QP4A 2ZI6A 3OTHA 3NORA 3QY9A 3T95A 2V03A 3IDOA 3OF2A 1T4CB 1GRVA 1MTZA 1KYZA 4GS5A 3UOWA 3O2QB 3W5DA 3VBCA 4QRDA 5AM1A 1PSDA 2WJHA 4L73A 1ZOOA 2HYDA 3EGDA 1LX7A 3LWDA 2WPNA 1XOIA 1UWCA 1Q3HA 2FV8A 2QLTA 3GEBA 3CX6A 4L15A 1LH0A 2HI0A 3CX8A 5EE9A 2HLNA 4NHEA 5DW3A 3H9GA 3PUIA 5KREA 1Y3CE 5KTKA 2GEUA 2RHJA 4UE2A 4G0VA 3HEAA 1XTBA 4G89A 1O5TA 1AF7A 3EGDB 3OZGA 3LPMA 3OTWA 2I67A 2UZAA 1JQKA 2YYZA 4CGYA 1PT7A 3NUGA 5CM2Z 2BMAA 4WVFA 3P9QA 4DA7A 2WG1A 3V2UA 1ZCBA 3KWFA 2R84A 5GOZA 1LI4A 2PX6A 4CJXA 1CDOA 3MJFA 3GGPA 4HNVA 3A1DA 5BMOA 4ND7A 5IYZA 3GEHA 1UZAA 2REBA 3HDVA 1AQJA 1FYFA 2IDKA 1YIAA 4V1CA 4I9FA 5GTDA 4QM7A 1XDGA 5L51A 1EZZA 1J0AA 1KEWA 5HF8A 1X8JA 2FFRA 2H17A 2GPNA 3AUKA 3HYCA 4Q1FA 3S6JA 3VC3A 5SY4A 1YE5A 2WHEA 1FLDA 2HPAA 4O4JF 3J80A 3FF4A 1P2VA 4N5IX 5FR1A 2OFFA 4BWGA 4M36A 1KBQA 4QGBA 4UM9D 1XCBA 4PAWA 4MI1A 5H3CA 3ES9A 2R1TB 1SUWA 2DG2A 4CU5A 3T1HB 1DCKA 4CZ2A 2Y0BA 5AXCA 4TV8B 1ZNQO 2XUGA 1UKVY 3GV0A 3L18A 4O4IA 1H2WA 1R0WA 2AIRA 4KVGA 4OHFA 1Q6ZA 1G0NA 4XGQA 1XGKA 1QLJA 1YDMA 3MXOA 5J5CA 2CHUA 1OHHD 1QANA 2DB3A 1QG0A 2XT6A 1H69A 3K0CC 4I99A 4XM2A 4Z0PA 4PO8A 3RV4A 1DJPA 1O94D 3QWFA 2HDWA 3TQCA 2ZUCA 3D6NB 4UTRA 2NT3A 3ZDEA 2ZUWA 2WFZA 3G2KA 3P9IA 4HMOA 2YN0A 3CW8X 5KVQA 4OJQA 3SEFA 3OKFA 4JB0A 4YDSA 1CY6A 3JYNA 4O4HF 3WE7A 2O14A 1YZVA 1N7IA 3B6IA 2M6LA 1OPXA 3O8NA 2JGMA 4HEA6 2R6GA 1H2YA 1K92A 2HRQA 4PX9A 4B87A 2X19A 1L7NA 1LFDB 3MTEA 1U5AA 1FTWA 5KHLB 1W8IA 3VR4A 1U0TA 3K92A 4KITB 2LE0A 3V2GA 1ONNA 5EIHA 2NV0A 5JTTA 2VUTA 3D2AA 4JLDA 3THYA 2HU7A 5CDUA 3TXYA 5HDBB 1A71A 4X6UA 1N4DA 2PSSA 2QMYA 2ENUA 3K9NA 3EA0A 6YASA 5IABA 4PWZA 3OQ6A 5DP2A 5EJFA 5K0GA 3LA8A 4URHA 1XDZA 3RFXA 4DDHA 4FBLA 3THYB 2LZ0A 4DCNA 1Z0DA 3IQZA 3VR6A 4KR9A 3HVIA 3M6XA 2C8LA 1K0FA 2IP2A 1P91A 1QONA 2OFWA 3IOYA 5F12A 4TMWA 5NULA 1W29A 1LLUA 4EKEA 2OGUA 4KXYA 4NG4A 1E8DA 1FE8A 1C7EA 5LWQA 1GZ5A 1VJ5A 1VRCA 1XL1A 2J3MA 4IIXA 5FTNA 3MGGA 5BV0A 3CZ5A 4B7UA 3JZIA 4MGZR 2OLKA 3F49S 3N1UA 1G66A 4LQLA 3SP1A 5A2QA 1YFLA 2QMEA 4BTEA 1OFUX 2G82A 3TPZA 3M4JA 4GX1A 4Q1AA 1FJ2A 1M0SA 3R3ZA 1N6PA 5CXUA 3FE2A 1A7JA 5TMBA 3HHPA 4P3KA 4KLNA 3JTEA 3A28A 4JQCA 1YK1A 2C4NA 2WUVA 3PDHA 2Q0SA 5LB4A 1QE0A 2XB8A 1UCFA 4RTQA 3MLEA 3SF0A 2G88A 5MF6A 4BLSA 2GD1O 5FI3A 2V7EA 2EQBA 1CWUA 3HHEA 4LRYA 4E09A 4RQTA 3EGWA 1U0BB 4S1VA 1RLJA 1RC1A 4UUBA 1C1HA 1Z8DA 2ZUVA 3BB4A 1OPRA 1FS4A 1TZBA 5IW8A 5HFNA 5LUAA 3WMRA 4RY0A 4PONA 1Q5PA 3ROQA 4N5LA 2BL4A 4EOGA 3I9FA 4JKYA 1RQNA 4BX0A 2OLEA 3GLKA 4IQ8A 2JCGA 4HAOA 1QVVA 2ZR8A 1XWWA 5C9ZA 4DIKA 1EGAA 1YQUA 2F3UA 1VMDA 3K0EA 4XOIA 3D0OA 5CLJA 4L95C 2B1RA 3NMUF 4IVPA 4B3DA 5EP4A 2QRZA 2P77A 2BCGY 1SURA 4S3MA 3GJSA 1KXZA 3OEHD 1NQXA 2Q1YA 4RA9A 1Y42X 3G7NA 1K06A 3SG0A 2O54A 1WDMA 3AK4A 4PBTA 4W9NA 4Y1EA 4IH1A 1NY6A 3RYHB 3X1ZA 4N9WA 2R6CA 5HTOA 3CLSD 5E1OA 1C0EA 5FKJA 4IXMA 4KXQA 4PXYA 5HX7A 3ADDA 3AIKA 2O1SA 1U2SA 1TPZA 4RA9B 1KP9A 1JRLA 3ENVA 3FYCA 4BXOB 3TW6A 3NBQA 2EP8A 2YFHA 1ILEA 4NQRA 1Z4IA 4KE8A 1IXKA 4DM4A 4U6QA 4FUTA 1F1JA 4ETNA 4BKMA 2CNOA 3ZI4A 4QSMA 2Q6LA 2VATA 1ADCA 1JAZA 2PPVA 3CTPA 4JCCA 1MC5A 4KLCA 4LMBA 4KQMA 1ISMA 5D5PA 5FPYA 5GVSA 2BBOA 1JMVA 2JKVA 2HCBA 2ZRMA 1G7TA 3GLHE 4QUAA 4DSNA 1CUZA 2JGEA 4UUMA 4F3RA 2ZB2A 1GSOA 2C5SA 1WOMA 4DUGA 1RBZA 3CKMA 2MYTA 2Q5FA 1WOYA 2XNKA 4HZUA 1KMMA 1M7HA 4DXAA 4IOMA 1B0AA