3GJ8A

Crystal structure of human rangdp-nup153znf34 complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
204
structure length
204
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGESEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 70
structure length 204
sequence length 204
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj8A00
3H0KA 1XCGB 1SXJE 3GQBA 3IHLA 4D6PA 2IX3A 3R9WA 3X1XA 2R62A 1TUEA 3G82C 3EIHA 2C95A 4HAXA 3KL4A 1Q57A 1JB1A 1FQJA 3CLVA 4YMWA 3AP3A 5DLQC 2WWFA 2GXAA 5AJYA 3ZQJA 3DEFA 1U8ZA 1TAGA 4OK5A 3GLIB 1XMSA 1GFIA 1XFAA 2VP9A 2PT5A 2WKRA 3PXGA 4L9WA 1RRPA 1VDZA 2J7PD 1Z0KA 2V6IA 2GCOA 4ZIRB 5L3SA 2X77A 1JI0A 1Z83A 1VG8A 2BBTA 1F5NA 1JQLB 1KDPA 2GVZC 3L2OB 3LLUA 3UK6A 4DDVA 2ZE6A 2GJ9A 2ZRPA 3VNVA 1W2HA 4Z1MA 4C9BA 1VHLA 4X8MA 5B58C 3BOSA 2X19A 4V0LA 1U9IC 4R2IA 1GL9B 5H8WA 3GLIA 1COWD 2QTFA 4RD6A 4AK9A 1G21E 5G3YA 1HH4A 8OHMA 3TW4A 2E9SA 3QENA 1IAQA 4BUJA 4AKGA 3CH4B 5AJZA 2ZR7A 1T9HA 2IWRA 5JCZA 1DAFA 2ZS8A 4A9AA 3GLGA 2VHTA 2W6JA 4OBEA 2WSSA 1EESA 4PSVA 3ONWA 3D6TB 1YQTA 2G9NA 4F4CA 2QRNA 4FXPA 4US1R 4K8OA 4M1MA 4B3FX 1YZKA 3QEJA 2CLSA 3VU9A 1ZYUA 2DFKB 1T3SA 1Q3TA 3KKOA 4DCTA 5BYKA 4PHHA 2FEOA 1ZNZA 2CCJA 1IXZA 2JLSA 3SI7A 4DLRA 4OI2A 2IYSA 5KSOA 2F1RA 1P75A 1DO0A 4TTRA 5FOWA 2FF7A 3UMFA 3W5JA 2W00A 1P73A 2OUKA 1A4RA 2RGBA 2W2VA 1A7JA 3BORA 4TT3A 3BH7A 2VBCA 2KSQA 2GJSA 2ZJZA 3AKEA 4Q1DA 2P3SA 2DWQA 3PEVA 3BXZA 1GILA 3ZVRA 5KSYA 1N6IA 2ZAMA 4E5UA 4CGZA 4DLWA 1ZCBA 3GLFB 1CRQA 4JBWA 4LJ4A 3U5ZB 3SQWA 3V9PA 3EG5A 2C99A 3SJAA 3PEWA 1A1VA 3TUJC 5KTYA 4KSBA 1T8UA 3HJNA 4FCWA 1JXMA 4RD2A 2AR7A 2J46A 3GJ3A 5GJBA 3TE6A 4EJSB 1A2BA 2AD5A 2WM9B 3LA6A 4ON9A 4OQFA 2GBLC 3K09A 2EWVA 3KKPA 4UNSA 2KJQA 5K8TA 3NTUA 4DT1A 3VR3A 1VCIA 2UVQA 4JYCA 5EE0A 2GDJA 4C0AC 1ETUA 2ZRGA 3GFOA 1FNMA 3DO6A 3GD7A 4R71A 5F98A 1OW3B 1G291 2HXYA 2W6ID 5BQ5A 2VRWA 3QBTA 3SJBA 2B7CA 4B48A 1YZGA 5KSZA 3TMKA 3PVSA 3K9HA 4O2LA 5C4GB 2JLUA 4Q1EA 3QPWA 2PZEA 2D2FA 3DM5A 1LB1B 2A3RA 3PFIA 1XTQA 1PLJA 5CM9C 1ZU5A 1EFRA 3FE2A 2ZITA 4IVQA 1CJMA 1L7VC 4Q01A 3SEAA 3IKJA 2ZJOA 4O25A 3WYFA 4ZDIA 1GDDA 3OIWA 2XEXA 2RKOA 2UZIR 1F6BA 3KXKA 4PSAA 3BC1A 4QM6A 2JLWA 4BQSA 1HYQA 4P4TA 1AQUA 3MWKA 5LDDC 3AVWA 1N5IA 1SVMA 1ZM2A 1E9AA 3GLFA 3AVOA 2QSYA 2ZYWX 3A1VA 4JLMA 2C96A 4MYTA 2ZJ5A 1RJ9B 1KYIA 2QI9C 2QUZA 2ZI4A 4TL7A 3THWA 1AJEA 1HQYE 2VP2A 5DISB 3ZQ6A 3UG7A 3LW7A 2DWPA 3OESA 4HLCA 2VF8A 2XITA 3UG6A 2QMOA 4AWXA 5J4KA 1OJLA 3B5JA 2XB2A 2H7VA 4LPKA 1EK0A 3T5GA 2OV2A 4BFYA 3OEHA 1XCPA 3LX8A 5BW8A 4IW3B 2FEMA 4KITB 2F43B 1NSFA 4JLKA 3AKYA 4X8LA 3CX8A 4C2UA 3AKCA 3ZYCA 5KDOA 4BRUA 1GNQA 1K5GA 1IN6A 4PO8A 1SXJB 2IW3A 1AM4D 1LF5A 4OJKA 2GXQA 2YYZA 4BRWA 1ESMA 4IDNA 1RZ3A 3NBFA 2O8EA 1E2JA 3VHLB 1GNRA 3GP8A 3P4YA 4QHTA 4HAZA 1NVVR 2J7PA 4NKRA 4Q21A 2IT1A 3VKWA 1OSNA 5KNBA 4JZKA 4OHZA 3U3JA 1R0WA 2JLVA 1UADA 3PV0A 3HYRA 4YC7A 4A2WA 2X8AA 3K1JA 2GKSA 4V03A 1FQKA 3ND8A 1WMSA 1II8B 3A1SA 3EWSA 3GLGE 3TQCA 1GSIA 1E9RA 3K0SA 3SHWA 2GF0A 2PCJA 1ZIOA 2AKYA 3SBEA 2EYUA 2Z5FA 4MGKR 1E2KA 1YR8A 4W5HA 1LNZA 4HLQB 1NBMA 5C46F 2J0QA 4B35A 4LC1A 2WKPA 2ZVPX 4XOIA 4XVRA 3TUZC 1S0UA 1P9RA 2LCFA 3B2EA 5C1BA 1W7AA 2FOLA 4E09A 3FHTA 4I81A 1COWA 3BD9A 1DOAA 3ZS8A 2OBMA 4FIDA 3KZ1E 1FTNA 1T8TA 3C14C 1G17A 2FFAA 3RS7A 2W6JD 4NHOA 4XVQA 5EXPA 1TMKA 1GNPA 1FX0B 1OHHA 2P65A 4Y0AA 3QKUA 3DKPA 4P4UA 3CF0A 2RGEA 4D25A 1A82A 3ZD6A 1Y63A 2OE2A 5G3ZA 3EPLA 3ZH9B 4HLUC 4I99A 3CRVA 3AKDA 2NO7A 1KHTA 4QNMA 4CEHA 1G5PA 4Z1MD 2ODWA 3ZJYA 3NBYC 1K5DA 4IDPA 4F93B 3R8FA 1HT1E 3TKLA 2ZSBA 4MQBA 1Z6TA 4A6XA 2AHOA 1KDOA 4IXNA 4W5WA 1GOTA 3FGNA 1KI9A 1U8AA 1OKKD 1II9A 1W44A 4EPXA 3ADBA 3OE7A 2F55A 1DBSA 4HAVA 1T3LA 4LV8B 3V4RA 1GL7A 4GL2A 4ERNA 2IYTA 5EP4A 2VSXA 1JECA 4NONA 4HDQB 3VFDA 2VEDA 4BEBA 1A5TA 1DAGA 2I1VB 4M1TA 1KMHA 2Q3HA 3OIYA 3UPUA 2P5SA 2JLQA 2OAP1 2Q3MA 3VX4A 3THXB 2Z0MA 2ZRFA 4V0NA 3CRRA 1U0LA 2EYQA 4Q7JB 3KDSE 3KQKA 3VNUA 1P72A 1WQ1R 5IRCD 4MKGA 2V1UA 1IY2A 2OAQ1 3TAHA 2ZRCA 3QJYA 2FNAA 4HB0A 2QT1A 1XXHA 4L16A 4TYYA 1KZGB 2PLFA 4HLDA 4PQFA 5G41A 2PH1A 4B33A 3VKGA 1DELA 3F3YA 2OXRA 4PQYA 3TR5A 1KY3A 2AN9A 2IXEA 2CJWA 3CRW1 1U81A 1ZAKA 2WV9A 1Q21A 3Q7PA 2DBYA 4RD4A 1R0ZA 2XB4A 2CE2X 3UWOA 3KXLA 1WRBA 5AJXA 1TQ2A 1CU1A 1GKYA 3AGPA 1G3QA 3X2SA 3MD0A 3FTQA 1NL3A 2XNSA 4NU0A 1P9NA 4BFXA 1XJ0A 2PBRA 2OILA 4JL8A 2KB0A 4D0NA 4D26A 2O8CA 2OFOA 1SULA 4LYHA 3GPLA 1JJ7A 3OFNA 2QG6A 2ANCA 1NBMD 3FHCB 3IIKA 1KIMA 4P4SB 1O87A 1Z0DA 4LHZA 2J0SA 2XNDD 2IYVA 5EP1A 2FSGA 3CF2A 4XTRA 4Q9IA 2V9PA 4YXWA 1DAIA 1SXJD 1QHXA 1Z6AA 2KE5A 1PUJA 5JEEA 4CEJB 1QHSA 2CHVA 1ZU4A 3BWDD 4ARZA 5SZKB 1MRSA 1T0HB 4TL9A 4G0NA 1L4YA 4YDHB 3IQXA 1XMVA 3J81k 2YINC 3K0FA 2IHYA 1UAAA 4MUBA 2ATVA 1FUKA 2IK8A 4F91B 4JKIA 2HF9A 3CZPA 2YZ2A 4X8OA 1Z28A 2FX3A 2AD1A 4ACBA 1Q3HA 2ZSFA 1UKZA 1N6OA 1KI4A 2J3EA 5B57C 1XXHB 4P3YA 4OI1A 1E2HA 5JCPA 1Z3IX 2DPXA 3NH6A 1XWIA 3IQWA 1P3JA 2GEUA 3LX5A 4QJ3A 4A0HA 3LW8A 3OE7D 5CITA 5FOUA 5SZJA 1R5OA 1TTTA 1UPTA 2O8DA 1Q20A 1KDRA 1GUAA 1E96A 3THYA 1W4RA 1SVOA 2GK6A 1DE0A 3CRMA 3ECCA 4MKFA 3RDPA 1E9BA 1DAKA 1W0KD 2BJVA 2VIIA 1ZIPA 1KO4A 2OLJA 2VH5R 1YR7A 1M7GA 2WMNB 5JMTA 4J0QA 1G7TA 4XSHA 2IHBA 3PENA 3P32A 2IL1A 4Q7LA 4U7DA 1QHYA 4EJSA 5AJVB 1QG2A 1Z0AA 2IYYA 2O8FB 1N6LA 1W47A 4GOXA 2ZETA 3IHWA 3B13B 4JT2A 2I3BA 4PPGA 4XIGS 2HEIA 4AD8A 5DI9A 2ZM5A 1R0YA 3M4YA 3QEOA 1GRQA 2NO1A 4TMTA 4TLBA 4PHFA 4FINA 2YWFA 3BE4A 5FOVA 2IS1A 3RS3A 1E99A 3BB1A 4MRNA 1FX0A 1OH8A 4QFMA 2VLIA 4GDFA 4B2PA 3MG9A 4TMKA 4DUGA 2HLDD 1XDBA 5DNYB 1RW4A 5HCIA 3A37A 3T1TA 4BFTA 3QXJA 2QP9X 1ONBA 2FV8A 4MGIR 2ZR0A 2JLXA 3ZGXA 1XRJA 1MKYA 3PUVA 2FZ4A 2GZHA 2RGNC 4BFSA 2J0VA 1KI2A 4EQ6B 1G1MA 2NZJA 3RANA 3WP0A 4XTCS 1TF2A 4HI0E 2ZRAA 2BMDA 4EUNA 1BKDR 4W7SA 5FTKA 2QQ0A 2R6DA 1UKVY 3RWMB 4F4IA 1TU4A 3GJ8A 2PMDA 2F1HA 2VQSA 4ABYA 2FZLA 3B78A 4QBHA 2ZS9A 1WB9A 2R6FA 3IGFA 721PA 5JHGB 2ZXUA 1FMJA 3I8XA 5L3QB 2BMJA 1KMQA 2NOAA 1RPZA 4M0LA 1IM2A 3CWQA 1PVOA 5JRZA 2QAGC 4CVNA 3ETLA 5H1YA 1E2FA 2ZSDA 4C7OB 1W36D 1OIVA 1M2OB 4KJZA 1RIFA 2RGGA 2AXNA 4WBSA 3GLIE 4JVSB 4QBFA 4NBSA 1S4QA 2EQBA 3ASZA 3DPUA 4B32A 4YONB 5KHOC 2DY1A 3X1DA 1E69A 1F48A 3IILA 2CBZA 3GLHA 3IPXA 4MRSA 4LHYA 3VMFA 3SDZA 2LKCA 4F92B 1OB2A 2RHMA 4Z54A 2G77B 4EFLA 4UNRA 5LD2C 2CK3A 3QF7A 1FNNA 5IK2A 4IFEA 1OE0A 4RCYA 1YKSA 1TF7A 2V6JA 2PL3A 5EJEA 2DFNA 1XEFA 5CLQA 4FWTA 5CM8B 1A2KC 2RCNA 4NCHA 5M04A 2ZRNA 4DCNA 5DIFA 1JJVA 2ZRLA 2E1RA 4MRPA 1CR2A 1CJKC 4CRWB 2JLZA 4ZPXA 4JVMA 2W0SA 3NWJA 821PA 3AB3A 4S2EA 4YXWD 3NHBA 5EP3A 4DLYA 1XJQA 1Q1BA 2ODEA 4BASA 3EA0A 3NDPA 3EC2A 3NDBB 3P26A 2MSEB 1CTQA 4C0SA 5CB8A 3IIJA 1EXMA 4LWZA 3VHXA 1UJ2A 4FMCF 5JWRA 4TSFD 1N3BA 4LDJA 4DUGD 1TEXA 2QORA 2JJ1D 1WE2A 5FOXA 3RRMA 5K8IA 3P20A 2NQ2C 3SU8A 4M1KA 3GJ0A 5LBIA 2RMKA 3MRSA 2ZI3A 3GJ5A 4BECA 2ZANA 4WZAE 1N6RA 2JLRA 2R2AA 3A8TA 1HE1C 4QHYA 2KWIA 4LRWA 4AYTA 2V7QD 4U00A 3GLHB 3FFAA 2O8CB 2WOJA 3JZMA 1E2PA 3GFTA 3FYHA 5CK4A 1CEEA 3KTAA 1TF5A 1PV4A 1H65A 2ZI6A 4H1UA 1EX7A 3T5DA 4ZV4A 1AK2A 4LJ5A 4RVCA 4B71A 1JXOA 2V3CC 4D2IA 1D8TA 4TZ6A 1ZNXA 1M74A 2B6HA 5L8VA 3E5HA 4XD7D 2MSCB 3UMRA 3KJIA 2IA5A 1KJYA 1NKTA 5AWFC 2ORIA 2XTMA 3NXSA 4CT5A 4EIWA 4M53A 5HKKA 3DHWC 1AGPA 4K81B 5DO9A 2ZI9A 1K8RA 4JLPA 4L15A 2X2FA 3G5UA 4TYWA 1NMZA 1LTQA 1QHHB 2OG2A 1IY0A 3LBNA 4HDOB 5FL7A 5L3SB 5DYGA 3TJZA 1KKMA 2Q9BA 4JLJA 4HZUB 2GWHA 4L8GA 3RABA 4AYWA 1HA3A 5LB4A 4Z8XA 5HE8A 5IK2D 4TN1A 2R8RA 4NE2A 2CLDX 3G0HA 1P5ZB 2R6GA 2VTKA 2YHSA 3L43A 5P21A 4DBLC 2EWWA 4GP7A 3B85A 4V0ME 3DM9B 1OXUA 2ZQ5A 1IJEA 2DHRA 4US0R 4DCUA 3HR8A 1KSHA 2OHFA 2WZQA 3SJCA 1YRBA 3CBQA 3N2EA 4YMUA 1QVRA 2Q21A 4JLNA 1GP2A 4DSTA 4LYFA 4DIEA 2FA9A 1CXZA 1E2DA 3QBVA 1QBKC 1CKEA 2C5LA 1E0JA 2EFEB 4PZYA 4DHEA 2HLDA 1NJFA 2ERXA 2CHGA 2O52A 4UXJA 3EIEA 3OIUA 4NTZA 2O5VA 4HUTA 5B30A 4YMSA 4PXAA 3IIMA 4QGAA 3BBPA 5E95A 1G7SA 5JJLA 2YWHA 3AVPA 4IOMA 4U02A 4ESHA 5HZHA 1X86B 4WXPA 2GRJA 4N3NA 2EVWX 5JS8A 1MH1A 3EIQA 1MOZA 1SXJC 1GITA 3CIOA 2IS2A 3U44B 1LY1A 2BV3A 3AV0B 1N2CE 3CNOA 4P4SA 3QUSA 4JLAA 4DSNA 1YRAA 1HE8B 4KLZA 4PC6A 1DAHA 1W5TA 4KHZA 4ZO4A 3I61A 1NN0A 2FPMA 2REXB 1ODFA 3FPAA 3QNUA 5L3RA 3U7FB 1I4DD 2QENA 4C2TA 2ZE5A 3FKSD 5CJ2A 2WSMA 4KFUA 5EUMA 4XVUA 3A36A 2O8DB 1D9XA 3PG5A 5CIWA 4BWYA 4JL5A 4HLUA 2HT1A 4LV6A 2JJ2A 3OF5A 5FR2A 4Q9JA 1W49A 2CJWB 4QL3A 1R5BA 1I4LD 4QNRA 1GAJA 3W5IA 1H8HD 1UDXA 1VCMA 1RFLA 3PITA 1GZSA 2F1IA 2W83A 4KSCA 3DZDA 3LLMA 4OQXA 4DDWA 2WTUA 2PEYA 2HXSA 4JJKA 1KI8A 2FGJA 4B2IA 2G83A 5JS7A 3RVBA 5HTKA 2WWHA 2W2XA 3AVTA 3B1YA 5J40A 4Q9HA 1OXSC 1XX6A 5GJCA 1JR3D 4GNKA 4AYXA 2BBOA 3GJ6A 1WBDA 4OHVA 5L3VA 1JR6A 3NBXX 5DN6A 2DCUA 2J7KA 1KSJA 4MRRA 2DYKA 1D5CA 3B9QA 1TADA 4Q47A 3BIFA 3LBIA 3TSOA 1NVXQ 4YMTA 1X6VA 3KQLA 3A4NA 2IUUA 3TSWA 3KB2A 1IXRC 4G5QA 1IY1A 2PCLA 3ZS9A 4PX9A 1VCNA 3LY5A 1GIAA 1NSTA 5BN3A 5BWMA 4JT4A 2C2HA 2OCYC 5HCNA 1JEDA 3K9GA 2EFGA 3PUYA 5DHAA 3I1FA 3NKVA 5FI1B 3U4QB 1W36B 3WP1B 2IYWA 2CL6X 1Y3AA 3ZZTA 2HV8A 1NF3A 3QG5A 5EE5B 3MWLA 3NVAA 2GF9A 3HU1A 4A82A 4EPVA 1OFIA 5DE3A 1Z0JA 4Q03A 5EP2A 4QBGB 4TYNA 3AF4A 2GJ8A 1E98A 4G1UC 4OQNA 1E2EA 2JEOA 1NI3A 1VYTA 3MGCA 1EFHA 4GZMA 1G3IA 3W3ZB 2H92A 3B8HA 3WNBA 4LUCA 4EDHA 3I3SR 1QG4A 4QJ4A 1XXHE 5AR1A 1G7RA 1E2MA 2BKUA 2OCAA 1S3SA 2Z4RA 1XF9A 2A2ZA 1SKYE 2ZAOA 3A4LA 1QZXA 2CL7X 2D3WA 2OFWA 2IUSA 4DLSA 3QKSB 1HUQA 1XPRA 2D4HA 4URYR 3QPVA 4MRVA 4GZLA 2QAGB 4AG6A 4CIDA 3IPYA 2AKAB 2QBYA 5F3WB 4B6EA 4FCTA 2ZTSA 2V55B 3OZXA 3E2IA 3U6BA 4DDTA 4RKEA 3TLXA 4RKFA 2WVJA 1I4TD 1KI7A 4LHWA 5FUWA 5JEDA 2ZUDA 3REGA 3W9YA 1SVLA 2Z43A 4PO9A 1KI3A 3RRYA 2D7CA 4KODA 3TQFA 4EPTA 3C16C 4W9MC 1KMHB 4G5OA 3KQUA 2N1BA 2ORWA 2JIZA 3K0AA 1FZQA 4C30A 3U61B 3AF3A 3VAAA 3WMFA 5JFGA 2TMKA 1XTJA 4D0GA 2A5FA 4FMCB 3V4FA 4LC0A 3LAWA 2QMHA 4AY2A 1DAEA 5TMPA 3RC3A 5CLLA 1R8SA 1NIPA 3AP2A 4GT1A 1U9IA 5FUVA 2C98A 3RHFA 2F9LA 1CJVC 1KI1A 4Q4LA 3K0AB 1VG0B 2OLKA 4JIMA 3CWZA 5KOYA 3QKTA 2F43A 1Z0IA 1F2UA 2ZREA 5TVKA 3SN6A 4P32A 4A8JB 3C15C 4PSKA 1XCMA 1IN5A 4RY2A 1KAGA 4CT4B 4YLGA 2B21A 4IDQA 2EFHB 5DN6D 2PLRA 4AKEA 1Q12A 4DLUA 2JLYA 1J2JA 3R9XA 3SYKA 3H2YA 4B73A 1QDEA 2YV5A 4TLAA 4PC2A 2GTPA 3A1UA 2QAGA 2VP5A 2H17A 1XTIA 5FI0B 1KAOA 2IYUA 4OI0A 2IWHA 1XP8A 4C0HA 1KGDA 4QOSA 2KI5A 4ZI2A 2ZRIA 1P2SA 5CIQA 2FPKA 3D8BA 2Y8EA 4TQAA 3A1WA 4FCVA 3SYNA 1E9DA 4A2PA 1YHNA 1E94E 5A5GA 4MDFA 3FHOA 3KJHA 2WWGA 1XZPA 4C3ZA 3MMPA 4DIDA 4HDCA 3FDIA 3FKSA 1R6BX 2QY9A 3SYLA 3X1ZA 3RC8A 1E9FA 4BFUA 2ZROA 2WBLC 3BFXA 3QF4A 3QKRA 1OIXA 3W6NA 2JJ2D 1Z6GA 1ELOA 1M8PA 1N0VC 2FN4A 4RD1A 3F5FA 2NO6A 5D3MB 1OH6A 3TVDA 3K70D 3HPRA 3AF1A 5JZVA 4KYUA 5FPHA 1SGWA 2R6CA 3VX3A 4CW7A 3TRFA 5JSZA 2XTNA 2YOFA 3Q8XB 4M9QA 2QSZA 2YWGA 1MABA 4Q9KA 1G20E 1N0UA 3TW8B 3RLFA 2KBEA 2PMKA 1MO6A 3QOFA 1NY6A 1SXJA 4IHQA 2A30A 3TUIC 4LHVA 3VR2A 3Q9LA 1QVAA 3WYAA 3EXAA 3REFA 4BLOA 4HB2A 3NC0C 3I92A 4FI3C 2P67A 4CEIB 4OKSA 3HU3A 3ZIAD 1E0AA 4PANA 5F9FA 1W4CA 4HSEA 1VIAA 4JBYA 1ZC3A 1E79D 1FFHA 2WAYA 1Z2CA 4GP6A 1J8MF 1H8ED 1JNYA 2IEZA 3THOA 4BGDA 1UBGA 1YZLA 1TQ4A 1E9CA 4WXRA 4EFNA 1VG9B 4M22A 1VPLA 2ZYVX 3U44A 4OHWA 5AUPB 2FDCA 2QPAA 3THXA 2IF0A 1S1MA 2RGCA 3QXXA 2CNWA 3PQCA 4B3GA 4ESVA 1JALA 2ZJYA 2XOKA 4Q00A 3M6AA 2PEZA 1VIYA 1W4BA 3PEUA 1E2QA 1NY5A 3QY0A 4LJYA 1JR3A 1U94A 1R2QA 2G0TA 1WDTA 1UBFA 3W3AA 4R98A 5KPDA 1OH7A 2XGJA 1TQ6A 5GJWC 2OFXA 1G19A 2Q9CA 2GETA 3C8UA 2HDNB 4BLTA 1XMIA 2O0HA 1EWRA 1Q22A 2EU8A 5A4JA 3BRWD 2IC5A 3U6KA 1RRGA 1G8YA 2BDTA 4NP6A 2WHXA 2OO7A 4JS0A 1JAIA 1E0SA 2IEYA 3LV8A 3CX7A 4M4SA 4PHTA 2QPTA 5LB2A 1OXTA 2ZRKA 3QF4B 1IBRA 4Q4HA 1GRNA 2WWXA 1E1QA 3DOFA 3NC1C 4TYQA 3U3OA 4GPTA 3BB4A 1AN0A 1E4VA 1HY3A 2ONJA 4A15A 2ZUCA 1OIWA 1MV5A 2MMCA 2QTHA 2REOA 4NCJA 1MO3A 4CEIA 4KLNA 1U90A 4B44A 4TQ9A 1RE0A 1AZSC 3QXCA 3CM0A 4KVGA 4NCNA 2FSHA 4AG5A 2XJ9A 3T61A 4ZI3A 2XNDA 4LJ9A 1EFTA 2R6AA 1X1SA 3FVQA 3O47A 5JJIA 1X8JA 1NMXA 5FOSA 4OHXA 2E87A 1P2UA 4S35A 3IDQA 2Q9AA 4QJ5A 4TWZA 4LOAA 3WNDA 4URXR 3MUFA 2FFQA 3T06B 3NEYA 4IVPA 2WWYA 1LFDB 1DG1G 5TDHA 2R44A 4IRUB 3VKHA 3K53A 3KFXA 4B6FA 3PEYA 1CBUA 3L0PA 1JPNA 4M9XA 3EASA 2FU5C 3C41J 1ZUHA 2BMEA 4QGHA 3KKNA 1G41A 3D31A 3DZ8A 2WAXA 1M1YE 2CVHA 5BN4A 4QGGA 4Q5IA 3GEHA 1QHHA 4NYIR 2QMEA 4TT3D 4DDUA 5FH9A 2XZOA 3B1WA 4DT1B 4YDSA 1BIFA 1IXSB 3L8YA 1X8LA 2P5TB 5EUQB 3FB4A 3KQNA 4Q66C 1IN4A 3EAQA 1F2UB 2NIPA 3A4MA 2IS4A 1OFUX 4AURA 3ZDQA 4LV5B 5BYJA 4D4JA 3DVLA 3VR5A 1Z0FA 4US2R 1RRCA 3NHAA 2WKQA 3BFKA 4MGYR 3SFVA 2EFCB 1CR0A 5DSZA 2OXCA 4MYCA 3H86A 1YZNA 3GLFE 1XU4A 3E70C 5CJPA 1KO7A 4M9SA 3TAUA 2V8OA 3LQQA 3ZVMA 3DOEA 3QQ5A 5D3QA 5AK0A 3GLHE 3QVUA 1VCOA 4DSUA 3KKQA 4HEJA 2GCOB 3QVVA 4ZIRA 3EPKA 1VYUA 1ZM9A 2GESA 2N46A 4OQMA 2O0JA 1P6XA 3BB3A 2OM2A 3Q7QA 2HT6A 3NEJA 2ZYUX 5FUXA 4A2QA 4DKXA 4GOJA 1BS1A 1XJCA 1MRNA 2FFHA 3U3RA 4GMXA 4P31A 1HV8A 1N6KA 2VHCA 1R5NA 1KK2A 4RZ2A 1G8GA 3AEZA 3CPHA 3QKRB 1WCV1 3RSLA 1ZC4A 3IO3A 1G7CA 2Z6VA 1J99A 4EFMA 1E2IA 3S1AB 1AQYA 1ESNA 3KJEA 4DXAA 4G5RA 1QHNA 5B2ZA 2QMUA 1BMFA 4PFSA 2V4ZA 5JHHB 1X3SA 3EZ6A 4TYPA 2YC4C 2BMFA 3H84A 5CYPA 5FUYA 3TH5A 4DCSA 5FPKA 3MCAA 1WF3A 3JVVA 1KTVA 2OESA 4R9UC 4LBZA 3CF6R 3K9LA 1ZVQA 2GXUA 1E3MA 2ZI5A 3RS2A 4GI7A 3U2QA 2UZ3A 4II7A 3T34A 3N2IA 3GCGA 2VSFA 2Q3FA 2GZDA 1US8B 4CEJA 4BLSA 2ONKA 2QU8A 4MKIA 3IEUA 3FOZA 2GBLA 3SFZA 1SQ5A 2F9MA 5BXQC 2AK3A 1XTRA 1N6PA 3ADDA 3GJ4A 3SS8A 2VP0A 1ANKA 3I62A 2CNWD 2BBSA 3AF2A 4AI6A 1G8FA 5E4FA 3AVYA 2GEDA 2ZRMA 1XD8A 3PUXA 4L5BA 3IBGA 2P2LA 2G88A 4D80A 3UWKA 1X8KA 2W6IA 3SHFA 4JL6A 5UKDA 5CB6A 4I1UA 2QE7D 3B7GA 3EW9A 1SKYB 1W5SA 2CLCX 2CK3D 4WVFA 1J8YF 3UANA 2QNRA 1W0JA 3VTKA 4JMPA 2FE4A 1X1RA 1XTKA 2C77A 2BEJA 2DWOA 2IBMA 4JYBA 3U3MA 3WY9A 1Q44A 4BZXA 4G5GA 1DS6A 1NRJB 3EZ7A 4X8HA 2ZU6A 2FGKA 1Q1ZA 1T3HA 1U98A 5J47A 3U60B 4PPFA 4A0FA 1S2MA 4UKDA 2NPIA 1NMYA 4NCIA 5EQTA 1E1QD 2ZE8A 4PPQA 4DLZA 4BZQA 1CJUC 3ZD7A 1PJRA 2IXGA 1T5LA 2O8BB 1EG7A 2VSOA 4Q1BA 1S8FA 1UFQA 4LBYA 2BEKA 4DWJA 4Z51A 1G6HA 4LYAA 1AS0A 4WZ6A 1G4UR 4OHYA 2ZJ8A 1OFTA 1DADA 3CPEA 2PT7A 1CS4C 3KUDA 3ICEA 1QHGA 2ZSEA 3CX6A 2XJ4A 3EA5A 4TSFA 3EWAA 5TXGA 4FMBB 2QQEA 2VPPA 2G6BA 4GOKA 5E7JA 421PA 2GNOA 4OL0A 4DCVA 4CF7A 3K70C 4NYIQ 4RFVA 2ECKA 3NIBA 2BCGY 1U99A 2Z4SA 1LF0A 2ZRDA 3AUYA 4B34A 1N5KA 1U0HC 3LO5A 1YE8A 3PCRB 3KJGA 4IOJA 3U4QA 3EPHA 3LQRA 4URUR 2WICA 3OAAA 2XSZD 4URVR 2CMKA 2ATXA 5FBWB 4GMDA 521PA 3CONA 4OK3A 4C7OA 1R8QA 3B1XA 3IO5A 4E03A 4NH0A 1GWNA 5CYOA 1F2TA 1FOEB 4KI0A 4FW9A 1N6NA 2JATA 2V54A 2WMOB 5J4LA 2BOVA 1N25A 1UEJA 4EJSC 2H18A 4ILEA 1S1CA 1RRFA 3WHKA 4A1FA 2HYDA 4JLDA 4F7WA 4ZDWA 4IJMA 4XD7A 4LZZA 3RSOA 1GKUB 5E7MA 4NDZA 4Q4JB 2A5JA 3K0CC 4A4DA 2PX0A 2A9KA 3W90A 4PAQA 2HCJB 3D3QA 4JVLA 1E1RD 3RWOA 1U8YA 3ZVNA 1LW7A 1P9WA 3GFPA 3IUYA 4F38A 5F9HA 3Q72A 3UIEA 1JQJC 1UKEA 2CXXA 2YOGA 1N5LA 4P33A 1U2RA 4Q9LA 4JJZA 1CR1A 3NBZC 4I1SA 4D4KA 3WBJA 3VU9B 2IYZA 3TNFA 2WOOA 1RC8A 2GVDC 4OK6A 2C78A 2QT0A 3WXMA 1Z5ZA 1TPZA 5AJWA 4FMDF 1R7RA 5TY0A 4O0MA 3ZZUA 5GADl 3BK7A 1G3UA 1EX6A 1ZW6A 1D6JA 1DEKA 2J59A 1S96A 4N0DA 2DFTA 5FBQB 3T1QA 4MDEA 1G8PA 1LV7A 2QE7A 4C0JA 2IS6A 3LDAA 3RRZA 5KPJA 1Z08A 1NBME 2SHKA 1OFHA 2LKDA 2JDIA 2GJKA 2ZE7A 1NLFA 4Z8YA 1SVWA 1LS6A 1Z29A 1BH2A 1Z6XA 3K9NA 1FP6A 4WA7A 4QGFA 4XWKA 4IVRA 1R10A 3VR6A 1BYUA 4KBGA 2QRZA 1TEVA 1KY2A 4LCBA 3SQXA 3F0TA 3K0EA 2DR3A 3LH5A 4HUQB 4W5JA 1OXVA 4UQOA 4P0TA 1VKJA 2AL7A 1KKLA 3W34A 1FMLA 4KAXA 4E07A 1SZPA 4RZXA 1NNEA 3ZLJA 4I1OA 4M21A 4C0KA 1NKSA 4NYJQ 3MFYA 4Q1CA 4AKHA 2BJWA 2RGDA 3AGQA 4IOLA 2JASA 3X1YA 2F7SA 1FL9A 4ARZB 2DFLA 1K6MA 1IONA 1MABB 1ZD1A 4PC7A 2J87A 4JLVA 2QM7A 4L4UA 4LI0A 4NYMR 4MYHA 2J0UB 2W58A 3HYTA 3V00A 3KX2A 4NMMA 1CLUA 4BFWA 2WJJA 1YVDA 2QA5A 3CH5A 1VMAA 2IYLD 3GEEA 5IF9A 4C0QC 1W1WA 1SVIA 3WMEA 3B9PA 3OAAD 1NP6A 4EKDA 3H1TA 3HDTA 3QSYA 4UJ3A 4LPSA 1G3RA 1NG1A 1OF1A 1TU3A 3LXRA 1Z07A 5FPTA 1AS3A 2H5EA 2VYFA 1XPUA 3ZZ0A 1ZRHA 1G16A 1WA5A 4ZDKA 2P6RA 3R9IA 3AVXA 4TZ0A 3NG1A 2F1JA 4NZYA 4PO1A 1DVRA 3EARA 4GRAA 1T6NA 2CHQA 1E6CA 2A5DA 3FMPB 1XMJA 2BHRA 5K8UA 1E2NA 2R9VA 2QP3A 3AUXA 5AUOB 4AIIA 1GM5A 2QN6A 3BH6A 2QP4A 1YR6A 5BN5A 3C4JA 1KZ7B 2JAQA 4Q19A 2AWOA 3DMNA 4RZUA 1NG9A 4JSTA 2JIZD 2HUPA 4H9GA 5EXTA 2HCBA 3FMIA 4L9SA 3TVTA 5F2EA 1XPOA 1OPXA 3OEED 4PC3A 1BMFD 3B1ZA 2H16A 4XWAA 4UNQA 1ZP6A 1TNDA 1LS1A 5JECA 2BIFA 5L3QA 1UBEA 3EZ9A 4M1WA 3HPQA 2ZU0C 1KSGA 3WYGA 1SVKA 3HP1A 3L8ZA 4LJ8A 2WJVA 4KU4A 1EFUA 2GAAA 1N0WA 3QXHA 4ZKDA 1P60A 1OYYA 2VP6A 2GJAA 4NL4H 3KTAB 1HEIA 1KO5A 5HR5A 3MWYW 3CW2A 3BFVA 1W36C 5K8LA 3Q5DA 2FH5B 4ASUA 3F8TA 4C0BA 2NGRA 1XEWY 4RFSB 1MT0A 2REBA 1AKYA 1KOFA 4HYYA 2Q0HA 1P4SA 1VTKA 2FJUA 4DJTA 4ZDJA 1Q1EA 3FMOB 5FFMA 3U7EB 2VHJA 3K8YA 2H8KA 2QBYB 2FG5A 4PPNA 2JJ1A 1W46A 4Q4AB 4EPWA 1DARA 2RB4A 1W0JD 1XEXB 1I2MA 1GVNB 1DAMA 1PLLA 1W0KA 2BWJA 2PX3A 1FP7A 2WWWA 1G5TA 3AP1A 2P6UA 3L82B 5GVSA 3U7GA 1NVWQ 1VHTA 1ZNYA 1KSFX 2GILA 3TK1A 3VR4A 4IDHA 4RD0A 4URWR 5G40A 5JRJA 4PZLA 4TTQA 5KDDA 3K0CA 1F60A 1AA9A 4G5SA 2XZLA 2NO0A 4R7ZA 1KJWA 5TV2A 1KK1A 4EAQA 4QKQA 5J5CA 4WW0A 4KFSA 2L0XA 4QXAA 1US8A 3LBHA 2NTYC 4WIAA 1RVDA 4B43A 4GBMA 3WRXC 2GXSA 2QEQA 1UF9A 1XBTA 2GCNA 3P4XA 1KNQA 4TQUS 4WAUA 4IKEA 1AZTA 3LXXA 2A78A 2PJZA 2QROA 1XD2B 4LJAA 5E3HA 4JLOA 1O3YA 3L0IB 3OIVA 3H4MA 3ASYA 3TGPA 1YR9A 2YKGA 2GAOA 4IXMA 2C9OA 5EZ6B 5HE9A 1M7HA 4ZCMA 1II8A 1KO1A 3CR7A 3FKQA 1NN1A 5DYIA 3TIFA 4BLRA 3I32A 5SZHB 3C7KA 3WRYC 3D7MA 3EX7C 3RS0A 2YJTD 1TUIA 1EFCA 1CJTC 3TSZA 2F6RA 1B23P 1BYIA 1Q0UA 1XD2A 1IN7A 2UKDA 2XSZA 1MR3F 1UBCA 1DG3A 5C2JB 3I72A 1NLYA 5HZKA 2JA1A 4Q7MB 3KFVA 2YWEA 4POAA 1CR4A 1TX4B 4EPYA 4GSYA 1KO8A 4NYJR 2RH5A 2D2EA 3OEHD 5IHPA 3RRNA 3IBYA 2BKEA 2YVUA 5FBLB 2F3TA 5EXXA 2FFBA 2NO9A 2IYQA 3CB4A 4AC9A 2O0KA 1ZM3A 3ZVLA 1MO5A 2J41A 1PZNA 1C1YA 2G0NA 4LY6A 2B7BA 2RAPA 3W6PA 3ADCA 2ZJAA 2EW1A 5A0FA 2G3YA 1FPMA 1DTSA 4BE7B 4TLEA 2CEAA 4ZCIA 1OV4A 4PQRA 3KUCA 2YC2C 2H57A 1Z6YA 2ZUBA 4TL6A 1NN3A 4M1OA 1JEEA 4HZUA 1MO4A 5ELXA 1XEWX 2O8EB 1DO2A 1NVUQ 3S1AA 1JR3E 2OT3B 3O8RA 3KKMA 4D4LA 1C9KA 1E4YA 1Z22A 3C5CA 621PA 1ZBDA 2XXAB 1BOFA 5KYKA 1S3GA 1KK0A 2CE7A 4Q7KA 2XTZA 3WMGA 4BLQA 5EE1A 4RJLA 3K0FB 4C4PA 5J4HA 2G1KA 2QGNA 2DB3A 4FMDB 2P0EA 1W48A 5H70A 5SZIA 1GL6A 2ZVQX 5FBRB 1HT2E 121PA 3E1SA 1P7CA 3DMDA 2AFHE 5FL3A 3O8CA 1YZTA 2AFIE 4TMZA 1XEXA 2C03A 2JGNA 2GA8A 2FSFA 2QTVB 2YNMA 1CULC 2ZRJA 4MH0R 3KQHA 5FL7D 1KI6B 2BM1A 3SC3A 2EFDB 3FFBA 5JI2E 4DB4A 1IOZA 3NH9A 3AVQA 1VECA 4UNPA 4C0LA 3KB1A 4B3DA 3LRPA 1AKEA 2CL0X 1H8HA 4TMWA 4DLXA 3P27A 3B1VA 3ND9A 3QI2A 3T12A 5HKKD 4QG7A 1BO6A 4JLBA 3IEVA 4E22A 2F3RA 3K09C 4OQLA 2J1LA 4HAYA 5DI3A 1YZUA 4JSYA 4UXHA 2A7QA 1ZCAA 1Z63A 2B8TA 4TL8A 2ZIAA 3UATA 3GJXC 4TLCA 4DLVA 1KDTA 3LNCA 5FOTA 2NMVA 1CIPA 3SBDA 2VP4A 2G1JA 3ZIAA 5J4VA 2H1LA 3AH8A 3M1IA 4KV9A 5TARA 2V7QA 1V43A 5KSPA 3JZAA 3QKSA 5DI3B 3I4LA 2PJRA 3I8SA 4BEJA 1E79A 1GTVA 4LJ7A 3U7HB 4BLPA 1XNJA 1LVGA 5GJVC 4BFZA 1R4AA 1ZINA 3HU2A 1W2GA 4HB4A 4PTLA 2OSBA 2BBWA 2XAUA 2ZYTX 3QE0A 2OEPA 4DLTA 1UM8A 1OKKA 2WPDA 4RZ3A 5EXSA 5GVRA 2OCBA 3FWYA 1EFRD 2N42A 4RD3A 4D0LB 1G18A 1I2DA 1V5WA 1N5JA 2FMXA 5CK5A 1CF4A 1UKYA 1P61B 1D2EA 3CRQA 4QHSA 4EQ6A 1QF9A 4JKYA 1ZM4A 3OEEA 4M1SA 1GRRA 4LGMA 3TR0A 1L8QA 5C18A 2XZPA 4TTPA 1FUUA 2ZEJA 4MUAA 2VHQA 4IEEA 4LYJA 2RGNA 1JBKA 1OB5A 4TMVA 2X1VA 1XTSA 2IF2A 2ZRBA 3WNCA 2HYIC 2ODNA 4DB2A 2BCJQ 3I73A 2O8FA 2BVNA 4V0MA 3SR0A 5FPSA 4M9ZA 4D82A 2CCKA 4RSGA 4Q1AA 4O3MA 3A1TA 3EPJA 4BFVA 3HWSA 2VF7A 1IJFA 4GFDA 3R20A 4ASUD 1B0UA 2Z83A 4CYMA 4M8NE 4Q4JA 2VA8A 3AVVA 4AKIA 2D62A 4KFTA 2Q6TA 2ZJBA 1EGAA 3THYB 3EC1A 1OXXK 2K5UA 4U5XA 4IEIA 3ADKA 1WP9A 3UXMA 2LWIA 4DEYA 1II0A 1U0JA 1OH5A 3K70B 5FPYA 4MITA 4KCGA 1ZUIA 2ZRHA 5J4YA 1L2TA 3R7WB 4V0OA 1DPFA 3BERA 3MJHA 4YMVA 3CR8A 4NYMQ 3I5XA 3T1OA 3KXIA 3RYTC 5H68A 2O8BA 4OYHA 1NVVQ 3GLGB 2ZR9A 2I4IA 4B47A 2WWIA 4Q4HB 4RCZA 3ICQB 3PIRA 5KNCA 2HF8A 4B3XA 1TQDA 5LPNA 4QRHA 5D3MA 2QAJA 1GKIA 1QRAA 2RGAA 3P1JA 4LSGA 1IHUA 5FBVB 4PC1A 2ZI7A 1VYVA 1T5IA 5KO2A 3MWJA 5EE9A 2OBNA 4HATA 4MA4A 5ANRB 2B92A 3MLEA 3DL0A 4B74A 4IFBA 5FTMA 4YQFA 5JLJA 3Q5EA 5EZ5A 3PJRA 4HAWA 2XX3A 4ZCLA 1IQPA 4M1YA 5DGXA 1ZD8A 4B3BA 1FW6A 1T91A 3EZ2A 4UXIA 4A6PA 1SVSA 1E9SA 1M7BA 2X2EA 2V1XA 5AUQA 5KDLA 4V02A 2WJYA 5G53C 1KK3A 3SE0A 2W2TA 2JJ8A 4B75A 2OBLA 2FWRA 3AQ4A 1UEIA 2HJVA 2GK7A 2WIBA 4KFRA 4XSGA 2KBFA 2XXAA 4A36A 3VR1A 4WZBE 4ACAA 1G9XA 4Q4AA 4UNNA 4A0GA 3QIAA 2FSIA 1PUIA 2NG1A 3PUZA 1CRPA 3BS4A 1M6NA 1AIPA 3R7WA 1F3OA 3RAPR 4B3CA 4ZKEA 3RS4A 1NN5A 1NLZA 1SHKA 1Z2AA 2J9RA 3DKVA 3OFND 3UKDA 4A8JA 1R0XA 3N70A 2CCGA 1XB2A 1E2GA 2ZS7A 4V0KA 5CDFA 4HUQA 3BH0A 4URZR 1EWQA 4UJ5A 3LWNA 4DRZA 1E0KA 4Q1FA 1RKBA 5AUNB 4XJXA 2VL7A 4Q48A 3GJ7A 2AX4A 5KNDA 2OZEA 4HB3A 1J90A 3SNHA 1KNXA 4RFSA 2IYXA 2WJHA 2C9YA 4MYUA 2MMGA 2D74A 1P62B 1SHZA 3JVUA 3W8RA 1KI6A 2WPDD 1J70A 2C8VA 1HURA 1D2MA 1WBBA 1RYFA 4IOKA 3OHMA 2R65A 4I4LA 3CNLA 2FPLA 2GZAA 4TMXA 3I5YA 1H8EA 4PZZA 2ASEA 1E9EA 3FMFA 2OCPA 1TL7C 6Q21A 4TLDA 5JSZB 4XH9B 2VHUA 4KBFA 2AWNA 3C5HA 4KYIB 1W4AA 4ITRC 2ERYA 1S9DA 2ANBA 1ZJ6A 2P6NA 1YJ5A 4Q02A 2WIAA 3A58B 2QPOA 3SZRA 1QHIA 2XOKD 5KU1A 1IN8A 5DH9A 4FN5A 2J45A 3PUWA 4A0RA 3MJRA 1T0JB 2YOHA 2J5XA 4JVNA 3QPUA 1ZMXA 2IUTA 2A5YB 4D4MA 5LD2B 2VO1A 5TB5A 2ZSAA 2AK2A 5E7IA 1AGRA 1WXQA 3WBKA 4FWIB 4N0EA 5EE3A 221PA 3B60A 4KO8A 2GCPA 3LFUA 3SJZA 2JCSA 4PAOA 1J7KA 4HZIA 4PR0A 4I1VA 3AM1A 1F2TB 4DZZA 1YU9A 2ZPTX 3DDCA 3O8DA 1KJZA 3CKLA 4IDOA 2D7DA 2NPFA 2JDID 1FTSA 4BPBA 3X1WA 3RNLA 3GEIA 4KXFB 4R2HA 2B8WA 4MGZR 1ZD9A 3L0OA 3LD9A 4M2LA 3WHLA 1JAHA 1Z47A 4DEXA 1OYWA 3MAAC 4N1AA 3T15A 4CZ2A 3CO5A 2GEVA 3RS5A 4XWOA 5C4MA 3U3KA 2AXPA 2NZ8A 4PHGA 1NIJA 3W8NA 4KVAA 3B82A 5JJKA 2BM0A 4PAMA 4BZPA 3QG1A 4QM7A 3THWB 2MSDB 1Z06A 2W0MA 5DHFA 1Q1QA 3HR7A 4D81A 1HQCA 4H1VA 4B76A 3QXSA 1S9HA 4NCKA 1RYHA 4LJ6A 5FR1A 5IT5A 2QGZA 4LK2A 1D2NA 2QZ4A 2WJIA 2WJGA 1N6HA 4FD2A 4F4JA 5JBQA 2IXFA 3SOPA 2IYRA 3A6PC 3CZQA 5FTLA 1XZQA 2RGXA 1P2TA 2CVFA 4CDGA 3W6OA 4G01B 1G64A 3LVRE 4Y0VA 4OI4A 3UMSA 3N5CA 4LHXA 3T1VA 2QL6A 2GHIA 2C9CA 4G3XA 4MKHA 1D9ZA 3R8CA 1G4AE 4DVGA 4B2LA 2RHDA 1ZNWA 1G5RA 3MSXA 1CP2A 4QC2A 3PR1A 2QM8A 4Q18A 1HTWA 1E1RA 3CNNA 4QBIA 3O8BA 3AF0A 4LX0A 3BJIC 3L0SA 1OLOA 1XD9A 3CUEF 1E32A 2ODBA 2WSSD 5FTJA 4OJQA 1UDWA 1P2VA 3TBKA 3LVQE 4DSOA 1ZM7A 2A5GA 1T4GA 3CPJB 1C4OA 1PLKA 2ZJ2A 5JI3E 1JPJA 1RJ9A 4HAUA 3EZFA 4JBXA 4O2RA 2ORVA 1Z8FA 3VQTA 1AS2A 3B6EA 4DC9A 1E2LA 1M34E 3BAFA 5CDFE 5FTNA 2CDNA 1OT3A 1ZUNB 4NPHA 2I1QA 5HPYB 3GMTA 1NJGA 5KUTA 2BC9A 4K46A 5JWHA 1SKQA 2D06A 3T35A 2HJGA 1G6OA 3BGWA 4EPRA 4A92A 1OHHD 2PZFA 1YZQA 2C04A 3M0EA 5IDVA 2PZGA 3Q3JB 1L4UA 2J0UA 4LBWA 1GG2A 1G3MA 4WOPA 4A8JC 4CEHB 3Q85A 3AVUA 5JWOA 4LBVA 1G8HA 1VG1A 5B64A
chains in the Genus database with same CATH superfamily
3H0KA 3H75A 4KMRA 4JI7B 1Z4QA 5A02A 2IX3A 3WL8A 5J23A 3R9WA 4RACA 5JAPA 4FC7A 1TUEA 4IGFA 5F33A 3HVHA 1Q57A 1MIOA 1L5RA 1KQFA 1UDAA 3AP3A 1TJ4A 4OV6B 3DEFA 3EVTA 4HX2A 3F7TA 2O2XA 1NKVA 1LI5A 1BFDA 5HF5A 4B09A 4EABA 4O6VA 4Z7NB 4B40A 2DMRA 1SRRA 1WU8A 4NK4A 2BBTA 5KYVA 5IAJA 4AX8A 1JQLB 3F49S 5CFQA 4LOKA 4C03A 2QRQA 3NU1A 1MQAA 1NAIA 3AZOA 2AZMA 2GJ9A 2ZRPA 1JHMA 3LP6A 4X97A 3UGQA 3A2KA 1Q84A 4L85A 3G23A 4TKMA 5L95A 3BAZA 4I1RA 1ADGA 5B58C 2X19A 1MC1A 2F8MA 3E48A 4I2NA 3N86A 1EZ4A 4EATA 4WN9A 4V0LA 5DBIA 2XHZA 3FDXA 3K16A 3GR6A 5HEKA 1BJKA 1KEEB 4J0CA 4E1AA 3GLIA 1YL5A 1EE2A 4RELA 5BSEA 4RD6A 5C5CA 1G21E 5HM8A 5G3YA 2H1VA 2Q0QA 2PWYA 3C48A 4G5YA 3U7JA 4XVCA 2E9SA 3QENA 1KHHA 3L7JA 5HX7A 3UHPA 4AKGA 5EHQA 2AN4A 2ZR7A 4IRMA 1RPNA 3F1LA 3Q8WA 1DAFA 1FDSA 4DIUA 4TS4A 2VHTA 5JNSA 2BEVB 2W6JA 2AZTA 4OBEA 1QYDA 1H5UA 5J2UB 2FVYA 3D81A 4YROA 4PLCA 2R8YA 3NDRA 4DE5A 3AWDA 1YQTA 1JNXX 3LQ4A 2Q5EA 4K9OA 3TLBA 3ZWNA 4F4CA 4M1MA 3GPCA 1YZKA 5CLGA 3V8QA 2G8NA 2YFQA 4OFBA 1ZYUA 2O2YA 3P9XA 1X1TA 2DQZA 2XT0A 3O7WA 2I1WA 1IXZA 3GBVA 1R0SA 1F38A 2QVZX 4OI2A 3N07A 3N5KA 4JI0B 2F1RA 1T2UA 1P75A 1D07A 1OTHA 3KR2A 2HCTA 5AJHA 5FOWA 4NOJA 1LD3A 1NDUA 2W00A 4EYOA 2A0FA 1KPHA 1TK9A 1A4RA 1ZI9A 1XLVA 2HSGA 2OUKA 3PDHA 4TT3A 2HL6A 2ZIGA 3BH7A 4KBYA 4EKYA 1HI9A 1O0CA 3AKEA 3H87A 3O75A 2JBAB 2P3SA 5KC9A 3ZVRA 2ZUEA 2FR1A 5IG2A 5EFOA 5AM3A 4PLTA 3U9TA 1N6IA 5KSYA 3KV1A 1CC1S 1P0PA 2FEXA 3QVSA 4S24A 1DBWA 3OT1B 2WU4A 3KTFA 1ZN2A 4PU0A 1WXXA 1UAGA 2WSBA 3U5ZB 3SQWA 1OREA 3NAGA 5LP6B 2H7YA 3EG5A 3K2IA 4G1MB 4P7GA 5KQGA 2C99A 1B2LA 3SJAA 4BE9A 4HGRA 5FCDA 2YXNA 5EOVA 3U4AA 5D6OA 2AR7A 3GJ3A 1Y48E 3TE6A 3KXPA 2VDWB 2A6PA 4KRGA 3FR8A 4F3KA 5K0ZA 3OTHA 4OQFA 4H1TA 4E13A 3JQPA 3K09A 2OV1A 2EWVA 1KEWA 4FFVA 3T38A 4B4VA 4AMYA 5AHXA 2JFOA 3B9RA 3D2AA 3FTDA 3NTUA 1PNOA 4R16A 1YE3A 1OYVA 5CYGA 5KEIA 2CV2A 4RVHA 1JAXA 3IT0A 5DRYA 3ABIA 5CDHA 4BZZA 3AU9A 1JEAA 5JMPA 5CA1B 4R71A 5F98A 2HXYA 5BQ5A 3KIPA 4ZQEA 1MEJA 1JFTA 4O2LA 2JIDA 4MV3A 1EGHA 1PJQA 3ZGVA 4YJFA 2ZXEA 1LB1B 1GR0A 4Y7CA 5CM9C 3WL7A 4L07A 3QUQA 3LTNC 4PFKA 5IP5A 3FE2A 4JX9A 5IFKA 3K5WA 3TLCA 1CJMA 1L7VC 3SEAA 4BO9A 5EZYA 3WWOA 3OJEA 3CSSA 1A9PA 3EIWA 1HTBA 4RKYA 2FMFA 4PSAA 4QM6A 2BP7A 2JEYA 4I7EA 1ZJ5A 1ZLYA 1HYQA 4Z1OA 1E0DA 2QSJA 4QOFA 4UULA 5KOHB 1A71A 1SVMA 3G0GA 3MRVA 4KQHA 4Z0HO 1TVKA 2I78A 4Z99A 1AUQA 3LDHA 3FGPA 5JEDA 2UXCB 4RMHA 1WY5A 1KETA 3A1VA 3BWVA 3NYRA 4JLMA 5JVDA 1C29B 3P9KA 4PG6A 1KYIA 3ROGA 3A6FA 2ZI4A 1C7QA 3EYWA 2DLNA 2WM3A 3MMNA 3QU9A 2CFTA 2JFWA 4U2DA 4WK2B 3D0RA 5DISB 3UWMA 3SMQA 4EX7A 1OLUA 2B8JA 2DWPA 3UG6A 3TCKA 4BFCA 4MB6A 4HNUA 1CLEA 1YR1A 2JAOA 3DDNA 4RF3A 1D09A 4AWXA 1JMYA 3P9NA 1A9QA 3B5JA 2H7VA 4LPKA 4MKZA 5SY4A 3TJRA 3W5VA 2ZGVA 3WLLA 1XA3A 1ZK0A 3J7AC 4BO6A 3T5GA 1MB2A 4NG5A 5GM2A 4JJAA 2V5VA 2JLAA 2Z6QA 1E3DA 1H3FA 3OEHA 1XCPA 3CA8A 5BW8A 3GEMA 2ORYA 2I6FA 2ZT8A 2F43B 1VJ0A 4X8LA 4ZVRA 3CX8A 5K0BA 4IJQA 4BRUA 1GNQA 1FLVA 4GE0A 1IN6A 1N2EA 4PO8A 1RBZA 3TRJA 2IY7A 2K2WA 2GMWA 3PPXA 3QVKA 1UBTS 2Z2XA 4AB1A 1TJYA 5JW6A 2Q0XA 1SURA 1GNVA 1RZ3A 4KH1A 4KX5A 5BV1A 3C3JA 3FUUA 3O8LA 3MK31 3VHLB 5LFAA 2Q6IA 5EMMA 4D9GA 2HF2A 2RSLA 3HMKA 3U4IA 2J7PA 4Z3KA 3DTVA 3H1AA 5KNBA 1RPTA 3AOEA 4JZKA 1PGPA 1XLTC 2QNBA 4KNWA 4NATA 1UADA 3ERCA 4QSHA 3HUDA 1WUIS 4XQCA 4UATA 3K1JA 4J16C 4M0FA 4ER3A 4EEXA 1SELA 1YOVB 2FMHA 3N3BC 2O19A 4V03A 3NHRA 3ND8A 1WMSA 4IS2A 5AKHA 4NENB 1VM6A 1L7BA 1PWZA 1U5CA 2E1PA 1WKCA 4JJEA 4Y1FA 2PQ0A 4TT8A 5A3QA 3VA7A 3AUJB 1BE8A 3PHLA 4JGIA 2Z5FA 4MGKR 1E2KA 3RV3A 3ZW7A 2VF4X 2CMDA 1J2EA 1GZ4A 1LNZA 4W5HA 1N7GA 4RK5A 2OLEA 1D1PA 2OY0A 3PNQA 3L7CA 1V8BA 4X1KB 4EFDA 1JSCA 3BGIA 4GECA 5DDIP 3ZS8A 1GQFA 5A3JA 4FIDA 2EKPA 1SQFA 2XXBA 3TSAA 2R7MA 3KZ1E 1QR6A 1FRFS 5CH8A 1G17A 3EVZA 1JSLA 4FGKA 5AW0A 1P1KA 4BX2A 2V65A 4WGGA 3UAYA 2W6JD 1ZOIA 2FW8A 1XZLA 5EIBD 2XMRA 3OG9A 3U7QA 3ZGYA 4GR4A 4YRNA 3B8EA 4HJXA 1QAOA 1YIOA 4IDFA 2P65A 4RA9B 4Y0AA 3MXOA 5ADVA 3DKPA 2GRUA 3L06A 1GPYA 3PHJA 5T4HA 4N40A 1A82A 4OIMA 1Y63A 1Z25A 4Q3EA 3FBWA 3I39X 5CT8A 3HXLA 1RAAA 3PQ8A 4UBJA 4BIIA 1Y5NA 1YB2A 3C8MA 2A88A 3CRVA 3IH5A 4AUNA 3TW0A 3NM5A 4H77A 4D5EA 4CEHA 3TX6A 3NRJA 2ODWA 3DTNA 3FWNA 3M6WA 4IDPA 1YOBA 1VGVA 1ACJA 4JYZA 3DQZA 1XQ9A 4FD3A 3HN7A 2OQRA 1AMNA 1KDOA 4Z49A 1UJNA 1Y37A 3D2BA 5I7AA 5KQPA 4W5WA 2XIJA 3FGNA 2P0AA 4ETWA 2Q29A 4OBWA 4EPXA 3EAGA 3RC2A 4D9BA 3IBCA 3NHKA 2ZIXA 4LV8B 1XL0A 2E55A 4ZQBA 2ZUSA 4JWTA 4QODA 4GMFA 1OXMA 5EL0A 4TVSA 4FGSA 3T0GA 2MJLA 4UASA 5CFZA 5JAZA 2RJOA 3N87A 4YJ2A 1O95A 1V5GA 3A1DA 3VFDA 2DY0A 4N6OA 1GKLA 4BEBA 2Q5HA 2WTNA 1DINA 2I1VB 2OMKA 5I9SA 3N6XA 2Q3HA 3OIYA 1CK4A 5ITWA 3UPUA 1W4LA 1GCAA 4MWSA 1YBAA 2Z0MA 4PYKA 4YJHA 5P8WA 5LM3A 3THXB 4UTZA 2EKZA 1TPYA 1YQ9A 2ECFA 1JB9A 4ZOLA 3H4IA 2RKBA 4LOJA 3TAHA 3WGNA 1C30A 4HB0A 2QT1A 1NVAA 5ENVA 4TYYA 3OETA 3PS9A 1SIWA 4D57A 5KCMA 4EVIA 1EP9A 5G41A 3F3YA 5FUQA 1SUAA 5FLEX 2OXRA 3E7WA 1X2BA 2RHTA 4TKUB 3OZSA 3CVYA 3E3AA 1WUHS 1JXAA 2ILTA 5L4NA 4KV7A 5LQJA 3I2KA 3BYZA 3CRW1 3DLTA 1U81A 2WV9A 2HPVA 1JSRA 2O05A 2XB4A 5FHRA 5AYVA 3ROEA 3WLPA 1FDVA 4KXWA 5K2MA 3ZHCA 2AI2A 2PKYX 1SHTX 4ZEXA 1SWWA 3AGPA 3I0NA 1AHHA 3TSCA 2AJ8A 3GN2A 4UEKA 4FGUA 3GLQA 4PICA 4E2YA 4BFXA 1B26A 4D9MA 4D0NA 2KB0A 1R3UA 1NRXA 3L1UA 3R9XB 1O6FA 2O8CA 5ALUA 4QPCA 4HNTA 3MAGA 3GEPA 1SULA 2GN6A 4J2OA 2ISQA 1DJQA 2ANCA 2HB6A 3FVTA 5DXAA 3IIKA 1FNSA 1A9YA 3M6LA 1P1FA 3MS7A 4WK6A 5AI5A 1TVKB 1Z0DA 2J0SA 2Z3ZA 4ZT4A 3OSUA 2PQ6A 1DKRA 2E4AA 3TLGA 3DUWA 2LCQA 4I08A 4B83A 4OIFA 1JAZA 4KLAA 2UUBB 3SDBA 2VN8A 2EGHA 3WQQA 1UBMS 2W9XA 2KE5A 3FSGA 4OAOA 3QLEA 5JEEA 2MR5A 3F3MA 3J7TA 3IKVA 3W1EA 3AG5A 3BWDD 3DBHA 2AFHB 5E2IA 1MRSA 1CY1A 2JANA 1T0HB 4BV9A 3LDUA 4ONEA 3LHKA 4F2WA 1TLLA 4F6LA 4QECA 4YJ3F 4OLJA 2F90A 2NU7B 4QEKA 2JIPA 3GIWA 4W8HA 4AF8A 1XTPA 4DG5A 4Y2QA 2Y3IA 3V8BA 3G8DA 4EUKA 5IJXA 4L73A 2ATVA 1AQ6A 5CXQA 1PZXA 3CSDA 3UMYA 4CI0B 3STTA 3GMIA 1Z28A 1Z8DA 3D2CA 3DZJA 1NBIA 1UKZA 3E61A 2DQSA 2FFRA 4P3YA 4EI8A 3HDGA 1YA4A 4CF6A 1K4YA 3E9EA 1Z3IX 3KAPA 3O2QB 1XWIA 5TGTA 1JE1A 2EW2A 2EBHX 1XK6A 3LW8A 2HX1A 2A9JA 2Y1GA 3I4CA 3OZIA 4JOBA 5FOUA 1IHYA 3MQFA 5COBA 2PXXA 4WNCA 3BHJA 3TD2A 2Y1LA 3JRWA 1UPTA 4MV0A 1WUYA 3PTZA 4YQYA 1TTTA 2O8DA 2D5AA 2G04A 1W19A 2EFYA 3GV0A 4ID3A 5DWQA 2X6QA 3RK1A 1BCSA 4PWYA 5DMXA 3WADA 3WKCA 2HIAA 5HK9A 4LWPA 4FJ0A 4MKFA 3UICA 4BO8A 4N5NA 1C1XA 4RX1A 2MSKA 3SQOA 4IDAA 3Q7IA 4WZZA 4KDEA 1Z13A 4OXQA 1ZIPA 1KO4A 2OVBA 3FI0A 3VR5H 2WMNB 5IMSA 3TFQA 4P4NA 2EKLA 4GUAA 1G7TA 2HMWA 4Q7LA 1VKNA 4U7DA 2V97A 3UAXA 1NXPA 1OV6A 1S2LA 1QG2A 4KQ6A 4L95C 4AW9A 1DB3A 1S01A 3ONFA 3EQZA 2ZETA 4ZYVA 3CT4A 4Y9RA 1K27A 2ABWA 2VEOA 5DI9A 3SZOA 3UWDA 1EM8A 2QLMA 3Q2OA 4PLPA 5K05A 4TMTA 4TLBA 4GRIA 3R5JA 3GFSA 4A5OA 4F21A 5FOVA 3DBLA 1I7QB 3MF4A 2IS1A 3LQYA 4E08A 2EG9A 4UZFA 5IDXA 3QWAA 2VLIA 1O96A 2G4LA 1EUQA 5FWXA 2ID9A 1JVBA 4E46A 3G85A 3PNLA 4BFTA 3T1TA 3QXJA 2C57A 4YMIA 1ONBA 2FV8A 3N53A 4EMUA 1FFCA 2ZR0A 1W29A 1YFLA 4FBLA 2AVDA 5TSDA 3LSTA 2GZHA 1R27A 3RU3A 3PNKA 2C3UA 2NZJA 4RL4A 4B4UA 4AX4A 2Q8PA 3FKJA 1AK9A 2QUAA 1TF2A 2IZ5A 5JPIA 4EZEA 2ZRAA 1W93A 4G0PA 2AZXA 2C8KA 4EVSA 1HQKA 1BKDR 1UK8A 3C2QA 1OGYA 2QQ0A 1UKVY 1P7YA 1SZJG 1TU4A 3QJ5A 2XQIA 4XQ9A 2ZTUA 2B3TA 2XCIA 4RE6A 4YRLA 1RDFA 2F1HA 3UGTA 1CUZA 1M0SA 2FZLA 4CN9A 4WOBA 3AHGA 4QBHA 3S40A 2R6FA 4XPZA 5F1PA 4CG3A 2ZXUA 3Q6MA 3UFXB 1W6UA 1FMJA 4L02A 5EQDA 3TNJA 1KMQA 1XVLA 2G09A 5IJ0A 3CWQA 1PVOA 2OZKA 1F0YA 5CTJA 5LLDA 3EFHA 3JARB 4QRIA 4WN9B 1A88A 3VXKA 3LUGA 3CINA 2R85A 5DM60 4CVNA 5JRZA 2PMFA 5DM1A 2X0IA 4YV2A 1F3LA 4M0PA 4C7OB 2O3RA 1RIFA 3GLIE 2UUCB 4R8KA 3DFIA 2W90A 4JVSB 1ZHHA 3CY6A 4B32A 5JNTA 2DBRA 3OLWA 4AICA 1Q74A 3AEQB 5JZOA 5LQUA 1IN1A 1UXIA 4L5JA 4YAWA 1VIDA 2LNDA 3LGSA 3VMFA 4MRSA 3ABRB 3UENA 2MSWA 3SDZA 1OTYA 3GAAA 2G77B 3SC2B 3K15A 1QZTA 2CK3A 3IRUA 1FNNA 2VHZA 3QF7A 4AROA 3CHYA 3L7OA 5E6SA 4EG0A 4BNNA 5EJEA 5DM0A 3E2MA 3AC0A 1UT6A 2OXFA 4F3RA 4CKBB 1GA1A 2AJDA 2DTDA 3HADA 3OPYA 5EXEA 4NAVA 3KJFA 3W5CA 1UQTA 1B8UA 3V1TC 1L4NA 5DIFA 3SNKA 4IF6A 1ZO8A 4HP8A 3QEBZ 2PNFA 1E5QA 2FFJA 5CVCA 5E4YA 4GQBA 1Z75A 1I0IA 4ZPXA 2W0SA 1LEHA 3VSCA 3Q6IA 3LQ2A 3VI4B 4S2EA 4ZI7F 5E9JA 2ODEA 4RYDA 3OLXA 1XLWA 3ZK8A 1FU4A 2PVPA 4E1VA 5BN5B 4C0SA 1CTQA 5CB8A 4QD3A 5CB4F 2H06A 1X80A 3IIJA 1EXMA 3KBOA 1WCIA 1LDNA 2XWQA 2HEGA 2P41A 2AH5A 5TJ9A 3PHGA 5EWLB 3RFUA 4TSFD 5KKNB 1N3BA 3Q0EA 4DUGD 4KPUB 2QORA 3RRMA 2GK4A 1ZGJA 1Z74A 4W7IA 5BUQA 3I3OA 4K9NA 3SU8A 4J3FA 3F97A 3G2IA 4H7FA 1IOWA 1IY8A 3BGSA 4MQMA 3MRSA 4BO0A 4HTFB 5A5DA 3UPDA 3II6X 1Y7TA 5IUKC 5J3JA 5MN5A 2HK8A 2ZANA 1WBJB 4JLWA 3QUTA 3WYDA 5B4TA 1H9CA 4H31A 4WZAE 1T8RA 1YUMA 4YUXA 1RYZA 2OHHA 2Q3JA 3P0JA 4QHYA 4TRMA 3DTTA 1J2YA 3K8ZA 2EIXA 2V7QD 3KG2A 1ODCA 3COSA 4IICA 4U00A 3WE7A 2FPGB 2QN2A 3FYHA 3IR5A 4N82A 1TF5A 2VRCA 5PNTA 2HN9A 2FK7A 2ZI6A 3FVWA 4FOTA 4DN6A 5K01A 2XQVA 4B71A 1B43A 3KETA 4ME6A 1OI2A 1Y9EA 5AICA 4DJJA 1TTHA 3IDAA 4GPZA 1ZNXA 4JNKA 4EDFA 4TZ6A 1WDWB 1XK7A 2NUTA 3GUZA 4K9PA 3F96A 5IJAA 1IXYA 5HQJA 4RANA 1NKTA 1QIKA 5I9BA 5JXIA 1T1EA 2ZM6B 3KXDA 3N7AA 4NV3A 3IVMA 4C05A 1RBYA 3PGVA 1LPBB 4PCVA 2ZI9A 4MROA 4L15A 4XR4A 3STXA 4QG3A 5JNWA 3H2BA 3DH0A 3E23A 1KBZA 2B78A 4KHPB 4TYWA 1LTQA 1MJFA 4YRCA 5EIOA 2OG2A 3LBNA 1PT5A 1YS4A 1ZUWA 3OFKA 4FNAA 1GA6A 1W94A 1YHZA 3P97A 4HDOB 1O6GA 5DYGA 4EB6A 3EDOA 1M83A 1FJ2A 3UMVA 3TCNA 5KYUB 2W6PA 1V48A 4AYWA 3FBTA 1GAEO 3HSSA 3FPKA 4Z8XA 4TN1A 4EHBA 4BV2A 4I55B 4A7PA 2CLDX 4ZGBA 2R6GA 1GUZA 4LY0A 5LZ8A 3PFNA 5TQ2B 4GYKA 3GA7A 5CFMA 1J2UA 3QVGA 1SHUX 2VK2A 1XZCA 2OGSA 3L8MA 2MDTA 2J85A 1ADBA 2DE0X 2ZQ5A 1IJEA 2B30A 3U26A 4CM1A 4DCUA 1Y89A 3HR8A 3C3EA 4FFBA 3SJCA 2PXHA 3OZ7A 3AL2A 1QVRA 1DKLA 2G9RA 4AP9A 2DXIA 2I7XA 2LP4Y 2PSHA 4LYFA 4CKEA 3G1UA 3SCZA 1CKEA 2ERXA 2CHGA 2O52A 4OMFG 4R51A 3VV3A 2VTEA 3OTIA 3SIXA 1JZSA 1P18A 5KWEA 4YMSA 4ENSA 2FB9A 1MC4A 5HUJA 1TA9A 2XUOA 4KRYA 5KVQA 1BGXT 3AVPA 4U02A 4XM0A 2JRLA 1CUEA 4ZP1A 3ZJVA 3JV7A 4EECA 3EZNA 2QK4A 4OHRA 4HNRA 1H3NA 3ZEAA 1IUKA 3EEOA 3EIQA 2HA2A 4NV1A 1SXJC 1MPTA 1A98A 3U44B 3WSVA 2BV3A 4L4SA 6AT1A 2CDRA 1J6UA 2QTWB 1VSBA 2ZWMA 3AUSA 3GC6A 1JR2A 4XCVA 4KLZA 1DAHA 3CZCA 4KHZA 4B3GA 1NN0A 4GGMX 2VT2A 2SKCA 3QNUA 1JI3A 3SBXA 5BSGA 5GINE 3P96A 4C2TA 3MQ2A 3B12A 5CJ2A 4GXRA 3AI1A 1S8AA 1VRVA 3C6MA 2WSMA 4KFUA 2O8DB 2YW9A 4MUEA 1EI9A 1ZVJA 3CS3A 1H2EA 2DT8A 2WYOA 3ICCA 4KQFA 3NOOA 2YFHA 4OHOA 3IJRA 1GJRA 5DFAA 5IBQA 5JD6A 2G8LA 4IIJB 2Q5CA 4IIXA 1I4LD 2CC2A 1GAJA 1JHRA 1H8HD 2AB0A 1RFLA 3AUKA 3DB2A 1ZK2A 3LLMA 2EKDA 3I6MA 4F0JA 5C1PA 3BL8A 2PEYA 4JJKA 3ZCTA 1KI8A 4XJTA 3ISTA 2G83A 1O2DA 1CPYA 4B2IA 3RVBA 5CLFA 4EEZA 5JS7A 4P0QB 1F0KA 3KJNA 4H0NA 3B1YA 1C3LA 3W0LB 2H00A 5K6RA 4JR2A 3VAYA 3ONEA 2L2QA 2ZK7A 2NU9A 3JQBA 1B8PA 5A4FS 3MN1A 3WGIA 1WBDA 3E8SA 5JLAA 1T1SA 3WZMA 1U3CA 5L3VA 1E8NA 1GZDA 2CV1A 1MXFA 2J7KA 4AJ9A 4D43A 3AK4A 5FO1A 1D5CA 4JI4B 2VQ3A 3DT9A 2X0DA 4BUZA 3L18A 3VPAA 3AEUA 4Q47A 3RSHA 1NVXQ 2QLLA 2B1RA 5LXTA 2IUUA 4C5BA 1SBTA 3I30X 3Q3CA 4EYGA 4G5QA 2PCLA 4G24A 1R64A 1J0CA 4PX9A 1BCSB 5FPPA 3M4JA 1ZOSA 3T0FA 5M34A 1XZ8A 1FUIA 1MCZA 4XCXA 4A6DA 1LDEA 1BQ3A 4YRGA 3VOBA 3EW7A 2XDWA 2EKQA 1I4EB 3GLVA 4RULA 2Z9BA 1S2NA 1JG4A 3PA8A 3KEQA 1W36B 2DFPA 4GLOA 2IYWA 4ZT2A 1YK1A 2A92A 1XN4A 4ZCQA 3QTBA 4TYMA 4ALJA 3BJMA 2VNJA 3JASA 2HV8A 2IXAA 2WRZA 3VHQA 3VPCA 3ETDA 1RJGA 5ICSA 1NDHA 3MWLA 3Q2IA 3NVAA 5FDFA 2GF9A 3WYNA 3SIWA 5K8CA 1YB6A 1OFIA 1RLJA 1SCQA 1ZI8A 1Z0JA 2BF4A 3WIVA 4TYNA 3AF4A 2GJ8A 4MDYA 5B4VA 2QXUA 4MRMB 4BNIA 1Q11A 2Y9PB 1E2EA 4O1MA 3I6BA 4OEHA 3KSMA 3MGCA 3JY6A 4RH3A 2KHZA 4ZVNA 4BKOA 1G3IA 4OQ4A 3N1UA 2CT8A 1KZHA 3TVYA 2BE7A 3PJFA 1GGFA 3B8HA 1X77A 1RM5A 4CN8A 1QG4A 2D1QA 2DG2A 3CLHA 3OZGA 4I8IA 4QJ4A 3MUEA 1GRVA 2BKUA 3LCCA 4ZODA 2V7VA 1C3EA 1JHXA 1CHDA 2Q3LA 4ENUA 2CL7X 4DLAA 4P93A 2F4NA 1HBJA 5HK8A 4CFYA 1VSQA 5FWYA 1BFKA 1XPRA 4YT8A 3NS7A 1UMDB 5L53A 2X3YA 5FWNA 1JTEA 4GI3A 2BE9A 4ZPJA 4R8LA 5F3WB 2EJVA 2WMDA 3AB7A 3JS5A 4FCTA 2V55B 3SICE 5BWOA 3U6BA 1GDTA 1J1UA 4OQDA 1M76A 3DE0X 4RKFA 5F5XA 1QOPB 1OCEA 2V5UA 1YZ3A 1J9GA 4YRFA 2ZUDA 4FR2A 4TWIA 2AMFA 1Z62A 5K0LA 2FQ1A 3BKWA 2D8AA 3GJZA 1T10A 3B36A 4RVSA 4HDSA 2QLJA 1KMHB 1RYMA 4B5LA 3DPSA 1NBWB 2ORWA 4OU4A 3K0AA 1IBKB 1YOVA 5IM5A 1FZQA 3IJEB 3ZE0B 1TGVA 2QTLA 2Y1OA 3WMFA 4BRSA 5F73A 1WHSB 3GGGA 4FFSA 2J3HA 1FLAA 3DSRA 4FMCB 3H2IA 3V1YA 3V4FA 5IT0A 2O8VA 1P0CA 5A4IS 3LAWA 1FFXB 3NBUA 1R18A 5CLLA 4Z7QB 7ABPA 1R8SA 4XDYA 1ISHA 1X3LA 3AP2A 1U0GA 2F9LA 1R00A 5IVKA 1LK5A 2L19A 4Q4LA 4XWWA 3B38A 3USCS 1G1AA 1KEKA 2RONA 1Z0IA 2FAXA 1M1YB 4TWBA 3D8SA 4GSKA 4P32A 2I29A 3ZHOA 1SU8A 2B98A 3CU5A 4UDXX 2B4KA 2M6LA 3ZWWA 3G0BA 3K31A 3NJ8A 1X9IA 1ZVMA 4WMLA 2H4XA 2R8OA 3F3SA 5B58T 2I2WA 3GRZA 4JJFA 3MGAA 1E5TA 1Q12A 1DC5A 3EXHB 4CM9A 4R1UA 2UVPB 2AI1A 1OLXA 1PL7A 3H2YA 1M2FA 1BS9A 1QDEA 3IP7A 2W71A 3MA0A 4PC2A 1IM8A 3PR2B 1DFIA 3AEXA 5CT9A 1NC1A 1PFKA 4Y9DA 2H17A 3PE6A 1K6JA 5FI0B 1FFEA 1DAPA 2QQ5A 1PTJA 2CHUA 2J3MA 3HWX1 2EHDA 4QOSA 3STHA 2DLCX 1C0LA 4ZI2A 1Z8HA 4L2IB 1P2SA 1Z45A 4C06A 2R1VA 1QH8B 2Y8EA 4TQAA 3ZWBA 4K9QA 1J33A 3FPSA 5CDYA 1TK3A 3C1AA 3GF4A 4ZJUA 3CEPB 4DYVA 1ISJA 4JY7A 3VKFA 2WWGA 1N33B 4O4LF 4RS4A 1RVV1 1BHO1 3R7LA 3TTWA 3MWEB 1D7AA 2SCUA 3I64A 1UH5A 2G4CA 3AM4A 3MJ4A 3ELYA 2QY9A 4HXFB 2BJHA 2B0JA 1JFVA 3X1ZA 4OFXA 3I28A 2FUCA 2R5NA 3D9QX 3BFXA 3QF4A 5MGNA 1PJTA 1X14A 4OB7A 4BKUA 3A4YA 1OIXA 3I01M 1ZCZA 4MGEA 4MR7A 4Y1GA 5F12A 2WIGA 5FI5A 4YLEA 2WVHA 5KYUA 4RD1A 2WSIA 5I7VA 3F5FA 2XPCA 4H2DA 1TCBA 1E1MA 1WMBA 4OJNA 3HPRA 2VA9A 3NI2A 3VX3A 4CW7A 5ALVA 2OQVA 3TRFA 3QA3E 2WT4A 2YWGA 2ZB4A 2Z95A 3IQGX 4KPFC 4BQOA 1V11B 5I8ZA 4CCWA 1MU0A 1MD9A 1MO6A 3FNEA 3QOFA 2C4KA 2A30A 4IHQA 5DGCA 4I4TA 3REQB 3BXPA 4IJ6A 3AJRA 2B1GA 1NVDA 2G82A 2O59A 4MI1A 4OGFA 3BA1A 4LHVA 3CRNA 1K7EB 3HVRA 1QVAA 3SYTA 1LLDA 3EXAA 3ABOB 3ZGNA 3PDCA 4EUEA 4CEIB 2J6BA 4M8KA 2A1TR 2IHJA 1E0AA 1MFZA 2A0YA 4AXXA 4FYYA 4K9LA 1OZHA 1VIAA 2FLWA 3HA3A 5K6TA 1ZC3A 3VHRA 3H1PA 2XGGA 3G89A 3PJGA 3TL3A 4JQOA 1K75A 2WAYA 5DJ5A 1Z2CA 1IWPB 3C7AA 3FIJA 1YZLA 1SHJA 3ST7A 3DS8A 4EFNA 4BWGA 4UCQA 1NUTA 3ZDXB 4FYXA 2ECOA 4ZAXA 3WVNA 4L57A 3UB2A 4KOAA 2JI6A 1V6AA 3HDYA 4XUCA 5A2GA 1W5FA 3QZUA 1RQLA 8ATCA 5J43A 3QXXA 4ZMBA 3QOYA 1JIXA 4ZEMA 3ZCPA 2CNWA 1ENYA 3VAZA 4BMNA 1D4AA 1WXFA 2EJTA 1JALA 1QUEA 3DQQA 3G7SA 5AI8A 2ZSJA 2GPAA 1E1YA 1BRMA 2PEZA 1W4BA 3PEUA 2HSEA 2QM3A 3F7MA 1JR3A 1U94A 2NXWA 2QTAA 1UBFA 2C2GA 1VGQA 3DXFA 4J0KA 4RHTA 1RLOA 4RJJA 4C22A 1TQ6A 1RM0A 3BTVA 2OFXA 2AIRA 3OFVA 4Q6BA 6ABPA 1G19A 4G0OA 1JKXA 3HHEA 4BLTA 5A7FA 2YCBA 3FWKA 3C4VA 5A4JA 1W9HA 2OYRA 3PQ7A 4YRMA 1G98A 1P7VA 2BDTA 4KXYA 1JAIA 1E0SA 3LV8A 3CX7A 1EFDN 1OXTA 1Q83A 3C6ZA 5CNIA 3L5KA 4MQLA 3MCUA 4QUDA 4TYQA 3SDSA 3U3OA 4YO8A 1HY3A 3G9QA 4HFJA 2B7LA 4JOQA 4EKNB 1QCZA 3HZHA 1VHDA 2UYCA 5LMUB 2MMCA 3WGVA 1R0BA 1MO3A 1L5QA 4KLNA 5DW0A 4CEIA 4TQ9A 2AUTA 1EA5A 4IEFB 3PEEA 1PR2A 2C97A 4KAAA 5T4FA 3ZGLA 4X64B 2GPYA 2P40A 2Z8ZA 1C3OB 1F7VA 1QMGA 3P7MA 4LG1A 5C8YB 3A3PA 2BEWB 4LXQA 4AG5A 1ZESA 2AE1A 1WPQA 5LYYA 3T61A 5JALA 4X20A 3WK5A 4KXMA 1X1SA 4HQNA 4U2GA 4C01A 2GEJA 2R8EA 3D4LA 1FFSA 4JODA 2EZTA 5DNDA 4CV0A 2HFJA 2WWRA 2VJMB 4QJ5A 3H9JA 3QLTA 4E70A 1KORA 3MUFA 4EY3A 1ZEMA 4V38A 5BVHA 1VPVA 3H17A 5HHTA 2BLLA 4EUFA 1Y4UA 1VMIA 4IR7A 5TDHA 3M6VA 2R44A 2ZBGA 5CVJA 1XSEA 2B34A 3K53A 3KFXA 4I36A 1PS9A 5MHTA 3PEYA 4M9XA 4D1YA 3C41J 4LJRA 3N8KA 5AHOA 4RKRA 2BONA 2WAXA 1M1YE 3AUAA 1WEKA 4DABA 3T3DA 4Q5IA 4YN3A 1QGYA 4ZXPA 4DMFA 1PZMA 1GPH1 1H2RS 1ZZGA 2PS0A 4B3JA 4O4HB 1VE3A 2FR8C 5A06A 1CQXA 5I4BA 3G0DA 1X8LA 3KLOA 1ZA2A 3M9LA 2YXEA 4WZAA 3FB4A 3PWSA 4QARA 3KQNA 2FPRA 4QE3A 3N7UA 4D8UA 3AFHA 3EAQA 5JCXA 1F2UB 1VJ5A 5EMKA 1C2TA 2O9JA 1QJCA 2E5WA 4D9CA 1K4KA 3LP8A 1P19A 2Q3CA 3FZQA 5L6LB 1G55A 3RHTA 1GLVA 2NADA 4H6XA 4KE6A 1RRCA 2GAJA 1ZXXA 1LK0A 1XVUA 2NZXA 2FPIA 3BD7A 4RGYA 4S12A 1RQ7A 2WKQA 4JELA 4ZVTA 4DL9A 2QUJA 5TMBA 2YUIA 3P2EA 3V4OA 4AJ4A 2OXCA 3BMNB 4B7XA 3ZWDA 3ZPXA 1G9TA 4BHTA 4MLDA 4NMXB 1BW9B 3D8NA 3QY9A 4QELA 1SG9A 3KP1A 3QU5A 5H82A 1R4ZA 2D5LA 1LRLA 3ZVMA 2PY6A 1MAHA 3GLHE 3LYLA 3KO8A 3QVUA 2XF2A 4AULA 1NR5A 4JYMA 5DNUA 4QYIB 4ZVPA 3L6RA 3TZLA 3EPKA 1VYUA 2GESA 2N46A 3L0CA 2VYVD 1SR8A 4C0WA 2C7PA 2O0JA 3VZDA 1TT5A 2DSTA 2NWQA 3I5MA 2IHUA 1NYQA 4C4OA 5JBIA 2HIMA 3NEJA 2LIVA 2ZYUX 3GGOA 4I5FA 4ED9A 2EX0A 5JAMA 1TAHA 4GOJA 1MRNA 1RKXA 2FFHA 3E9ZA 3F5DA 3IEIA 3R2JA 1ZMTA 4L8VA 1TMYA 1N6KA 3C45A 3RR2A 4RZ2A 1SEPA 1CUCA 3CPHA 2FWBA 3IQDB 1WCV1 3W1WA 1V39A 1E64A 2VZLA 1EGVB 2WIJA 3VR6D 3EJ6A 1QV6A 3DZIA 3U4MA 3SEQA 2ONCA 4Y6GB 3S1AB 4BMXA 1ESNA 2PV7A 4MWEA 1UODA 4DXAA 3WLAA 3RTAA 1QHNA 3NVKI 1HFWA 1M2GA 2JIBA 2WEKA 3MINA 4D44A 2DM6A 3T9CA 1CUUA 4FR5A 1MG0A 4BYMA 2AJBA 3EZ6A 2PUAA 2P1DA 1BXZA 1YVEI 2PBFA 3IMGA 3D5EA 1UCFA 4M46A 4CUZA 4DCSA 5FPKA 4V0QA 1WF3A 3TQIA 1K8QA 4HMQA 4R9UC 4LBZA 4C5CA 3K9LA 5E6SB 4U9IS 1ST3A 5IJZA 1QANA 4NSNA 1ULZA 3T34A 3WWEA 3OCXA 2GZDA 4ZARA 4IH9A 4CEJA 1P5FA 2PL1A 3W04A 2PD6A 2HZ7A 3HKEA 1CZNA 1KPGA 3K9QO 3PNBA 5LOVF 1E4OA 1XZHA 5IVPA 5K8JB 1VPWA 4AM8A 2NLOA 4C7MA 1XTRA 1J5XA 3GJ4A 2EJBA 2Z56A 1ANKA 2JL1A 3V8EA 3I62A 2IOFK 1PSWA 2IZ0A 1DQYA 2NACA 3L01A 4U8GA 4ZAYA 4WBNA 5EHZA 1G8FA 1Y3DE 4FYIA 4KGDA 3O0DA 4R1QA 4RHCA 1P1BA 2G9ZA 3PUXA 3PXXA 4UW9A 3C3AA 5C52B 3OZUA 2EJUA 3IBGA 2PWBA 2G88A 5EWJB 3HM9A 3IFSA 4JL6A 5UKDA 4Y9SA 3UANA 3NB0A 1YMVA 1VP9A 3VTKA 2FE4A 1SXQA 2BEJA 1Q44A 1ZL2A 4OHYA 3U60B 2VXCA 3M1LA 5B3LA 1N57A 2JFUA 2VNSA 4DJDC 1GPUA 1N2CB 3M3PA 4UKDA 2DT5A 3NWOA 4OF4A 4HWRA 4NCIA 4NENA 4CKCB 1W76A 3S8MA 1CJUC 4BZQA 3QITA 3ZHTA 3WGUA 1TYCA 1L4FA 2BFCA 4JXXA 3WLRA 1S8FA 4G2NA 2BEKA 4QU0A 3VH3A 4GMHA 3RKUA 4FDTA 4DWJA 2Y66A 4ZOAA 5U4XA 4Z51A 5GY7A 1K7XB 1AS0A 1B76A 2YMQA 4RADA 2ZJ8A 4UD6A 2VJDA 3ESYA 1JF8A