3GJ8A

Crystal structure of human rangdp-nup153znf34 complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
204
structure length
204
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGESEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 70
structure length 204
sequence length 204
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj8A00
4I99A 2W0SA 4BLQA 1N0WA 2G0TA 4LX0A 1YR6A 4ARZA 4AYWA 4JS0A 3FVQA 3VTKA 1UBEA 1YZNA 3QQ5A 5FPYA 2ZVQX 1JPJA 2Z83A 1R0YA 3K1JA 2HYDA 2O8CA 2NQ2C 2QRZA 1EWQA 3ND8A 2OT3B 4DWJA 4PSVA 3K0FB 1T5IA 2RGNA 1NF3A 4NU0A 3QXCA 3ASYA 3QKSB 3I61A 3TGPA 2XSZA 1E2QA 3R8CA 2IW3A 2BHRA 4LZZA 2WHXA 3QJYA 3AF3A 1LS6A 3NHAA 4P32A 1NI3A 4YMTA 3I3SR 1AZSC 2EFCB 3QUSA 3NBYC 2ZJOA 1BH2A 2QP4A 2J7KA 1XCPA 4AK9A 2KI5A 2F43A 2WSSA 1HE8B 5KU1A 2ZI4A 3CX8A 2VRWA 1PVOA 5JS8A 1EFTA 2GCOA 3SEAA 1E2IA 1NJGA 2CL6X 3VFDA 4HEJA 3WHLA 4HZUA 4KBFA 4MGZR 1QF9A 2Q21A 4XSGA 4ACAA 1IN8A 2E1RA 4LBWA 2BKEA 2A3RA 4U02A 1KSJA 1GRNA 2FF7A 5JS7A 4Q4HA 1NIPA 4F4JA 1E32A 3A1UA 4D0LB 4G5RA 1II8B 2AXNA 2IK8A 1A1VA 2R9VA 2HJVA 4QNRA 1R8SA 1P9WA 3LRPA 2IWHA 2QT0A 2PLFA 2QMHA 2IYQA 4CGZA 2HT1A 2XZPA 3FMPB 1RJ9A 2VP2A 4OI0A 3U5ZB 4XVQA 1XTRA 1KSHA 3LXXA 3QF7A 4AKIA 4Q66C 2RHDA 3K0CA 4HDQB 1FX0B 3TQFA 3L0IB 2XNDA 4UXIA 1G16A 1IXRC 1VG1A 3X1DA 3GLGB 2Z5FA 2V6IA 1S0UA 1OXTA 1FP6A 1D9ZA 4TSFD 1AQUA 5FBVB 4GI7A 1EFCA 1C4OA 1M7GA 3SQXA 3FWYA 4MGIR 1OIXA 1SVSA 1HY3A 3W5IA 1OHHA 1YZKA 2UVQA 4FWIB 3DMNA 3PG5A 5P21A 2IEZA 5G3YA 4ERNA 1AGRA 3VX3A 2R62A 1OFIA 3QKSA 3AVTA 5KNDA 1VPLA 4GZLA 2YZ2A 1CKEA 1M7BA 4OL0A 4TYYA 4M4SA 4AC9A 3I72A 2Z4RA 3CRW1 4JBWA 1T3HA 4BLOA 1IAQA 1TEVA 2O0JA 5AWFC 4Q7MB 4YXWD 1Z22A 2CHQA 1TEXA 1IHUA 4CEIA 1KZGB 2H5EA 3U4QA 3FHTA 4TLBA 1YVDA 4UJ5A 1J8YF 5KO2A 2A5YB 4QGFA 2FV8A 1FOEB 5DI3A 3TAHA 1GAJA 4LYAA 4LJ7A 1DAIA 2O0HA 5A4JA 1COWD 3EIQA 3GLIE 2GZDA 2VPPA 2W6IA 2OBLA 2CCKA 4BZQA 4IDQA 5C46F 1SXJA 1GG2A 4GPTA 2YWHA 2OHFA 3M1IA 2QT1A 4GOXA 5KYKA 3KFVA 3GLHB 1RYFA 3QG1A 4A8JA 3QEJA 3GPLA 4RD3A 5GVSA 1DBSA 3CZQA 2H17A 4P4SB 2ZYWX 2VA8A 4M21A 4ESHA 5LD2C 1US8B 2WKRA 4GNKA 3TW8B 1Q21A 3PUVA 4LGMA 3JVUA 4ZKEA 4LK2A 1HT1E 5F9HA 2ERYA 3ND9A 2WJYA 5CM9C 4HLUA 4JVLA 1XJCA 1Z6AA 2BJWA 1ONBA 4IVQA 4MITA 4KVGA 3WMGA 3BK7A 3PEYA 4D81A 3B1ZA 2XITA 1WA5A 1DTSA 5FOXA 4DDVA 4KLZA 4RD6A 1N5LA 1NMYA 2O8EA 2FSIA 4TTQA 1OFHA 3I8XA 4KI0A 4TMWA 1A4RA 4POAA 5FL7D 3AM1A 1G3RA 3A1VA 3KTAA 2OCPA 1ZRHA 2IHYA 3VR5A 1KKLA 2GVDC 5CYOA 3ZVNA 5KSPA 1IN6A 2PCJA 1TNDA 2GXSA 4Q7LA 3GJ3A 4DT1A 4LHXA 4C2UA 3EIEA 1ZU5A 2E9SA 3ZYCA 4D80A 4M1SA 1E4YA 4L8GA 1G21E 5BQ5A 1AZTA 1W4RA 1F6BA 2BEKA 3DKVA 4HB4A 1VYVA 3KKOA 4EJSC 1E0AA 4JT4A 2WKPA 4PAQA 4M22A 1G6HA 5IK2D 1KYIA 3IIKA 4RFVA 5KTYA 1G3UA 2QBYB 2HXSA 4QJ4A 2PCLA 4J0QA 4C0HA 4M9ZA 4HSEA 4KLNA 1G6OA 4QXAA 5HE8A 4DEXA 3I5XA 1VCMA 2D4HA 3GLHA 4TLEA 1R2QA 1MRNA 4IOKA 1MABB 4HZUB 2CLDX 1MT0A 4U5XA 1I4DD 2RB4A 1ZU4A 4Y0VA 1BYUA 4LPSA 3WY9A 4MRPA 3WYAA 3KB2A 3LW8A 1AM4D 1CLUA 3TE6A 4TLAA 1I2MA 4F4IA 5E7JA 4DIEA 4QBIA 3W8RA 1W2GA 5J4KA 2CL7X 4I1OA 5AK0A 5G3ZA 3NH9A 1OT3A 1SKYB 2B21A 3UMFA 4DDTA 2O8CB 2DWOA 3EWSA 3SHWA 5JJIA 3SYNA 2A7QA 5AR1A 1P3JA 4JVNA 4I81A 4A2QA 4YMUA 3THYB 4Z1MA 3K9GA 1G20E 521PA 5DE3A 2W00A 3FFBA 5EE3A 2IYLD 3MFYA 4DLUA 2ZRBA 2OAQ1 3TVDA 4LPKA 2J41A 3OE7D 1IJFA 4XSHA 4AYXA 2ZJBA 3B5JA 2B6HA 4OHXA 2QTHA 5G40A 2ZVPX 1CP2A 1KO4A 1TQ6A 4QHYA 1PZNA 4C30A 5J4YA 1VKJA 2VO1A 4EFMA 4B34A 3GEIA 1Z63A 4TL7A 2TMKA 1E9RA 2AK3A 3PEWA 4D4KA 5CDFE 2CJWA 2CCGA 1WDTA 4NYJQ 1BIFA 2RAPA 2V6JA 3AV0B 3Q85A 1JQJC 1E9CA 1ZINA 3QF4B 5ANRB 4D82A 3U6BA 2BMFA 2MSDB 1ZD1A 4MKHA 5M04A 3IEVA 4TMZA 1E3MA 1G8YA 4GP7A 5KSZA 5EJEA 2XTMA 3B1WA 3U7EB 1U99A 3BE4A 2XJ4A 1MO6A 1XEXA 4JLAA 4KFUA 3NWJA 4BZPA 3AF1A 4ACBA 3EPLA 5J4LA 3RC3A 1OXUA 2GCNA 2JLUA 3EZ7A 2IUUA 1CBUA 4PC1A 4F91B 1E9DA 1ZM9A 3DOFA 3MMPA 1G41A 4G3XA 2DHRA 1OV4A 3SYLA 2FMXA 5TMPA 1OFUX 3AP1A 1E1QA 2HCJB 3TR5A 2XEXA 4PANA 4PAMA 1L2TA 5LB4A 5LD2B 1IN7A 3BXZA 1JR3E 2FH5B 4HLCA 2C98A 5HKKD 1U98A 2FSHA 3IIJA 3HR7A 1G3MA 3AQ4A 4QM7A 2X77A 4KO8A 3VR2A 1P5ZB 1M6NA 4TTPA 4NL4H 4YLGA 5BN5A 1U90A 4C0SA 4BUJA 3LWNA 1PUJA 4ZPXA 1EFHA 3SR0A 4YQFA 5HCNA 3EX7C 1OH7A 2ZQ5A 1M1YE 3U60B 2QRNA 1WE2A 2UZIR 1EG7A 2VTKA 4MRRA 2PL3A 2D74A 1ZNXA 1Q12A 2WVJA 1DO2A 2AWNA 1U0LA 3C5CA 1YZGA 1OW3B 4A6XA 1Z0AA 3I1FA 3QNUA 2WJJA 3W6NA 1KAOA 5FTMA 2DFLA 3C7KA 2QGZA 3PITA 2C04A 2FGKA 4MGYR 4AYTA 5HR5A 1LS1A 4B2LA 4HAYA 3EPKA 5CDFA 1XTKA 4W9MC 2JJ2D 2OILA 1OIWA 3IO3A 1XPUA 4C0JA 2J9RA 5TY0A 3NBZC 1NN5A 1R0ZA 1JEDA 1AIPA 2YHSA 3A1WA 4OK6A 4MRVA 2H57A 1H8ED 1M7HA 2ZROA 2QQEA 2A9KA 2YVUA 4P4TA 2PJRA 3WP0A 4DHEA 2FSFA 2VP6A 2IYUA 3WP1B 4MDFA 3PENA 2XNSA 2WAYA 1GP2A 1T3LA 2D3WA 3K53A 1KI4A 1P75A 1VG8A 5FOVA 3BH6A 2WBLC 4IOMA 3SFZA 1XPOA 3HPQA 4BFUA 1OLOA 1GKUB 3O8CA 1KO1A 4O2RA 3UMRA 1KI2A 3EZ6A 3VHLB 3CR7A 1H8HD 4GBMA 3ADBA 3E1SA 1CJUC 3RDPA 3GFTA 3ICEA 3AVWA 5IK2A 2W6JA 1U8ZA 4KFRA 1E2LA 1RRPA 4B33A 1TQ4A 2CCJA 1HT2E 4PHFA 3F3YA 1A82A 3I92A 1UJ2A 3IILA 2ODWA 3CF0A 1KI7A 3H2YA 4DCSA 5JCPA 2PMKA 4CT5A 121PA 2ZRHA 3KJIA 2O8DA 2QMUA 1NJFA 3F0TA 4Q03A 3S1AA 1E6CA 3U2QA 2G83A 4IEEA 3GFOA 3UATA 2QNRA 3GLGA 2FEMA 5K8TA 5CM8B 1G8PA 4YMVA 3BAFA 1VECA 1LFDB 1EESA 4MRSA 2VLIA 2AXPA 1N6PA 2FPLA 4HUQA 3W3ZB 1C9KA 1M2OB 2QE7A 2ZJYA 2C96A 3EZFA 3SBDA 1D6JA 4PO1A 4PPFA 3K70D 3SC3A 3WBJA 3LDAA 2QM7A 4NCJA 4DBLC 4PC6A 1ZAKA 3B1XA 1FQKA 2W2TA 4FCVA 3W90A 1TUIA 5FOSA 3VU9B 1P2UA 3LBIA 4IKEA 2NO0A 4LUCA 3CNLA 1U94A 4KSCA 2HV8A 3SU8A 2PBRA 2XGJA 1VMAA 1HURA 1GTVA 2F1RA 3VKHA 2GXQA 3D8BA 3FMOB 3QKRA 2FN4A 1NVXQ 3HYTA 3QXSA 1CRQA 1X8KA 1G17A 5EUQB 5FBQB 2YINC 2VSFA 4ZIRA 2VP4A 3C41J 3VR1A 4C2TA 3Q72A 5K8UA 2OM2A 3X1ZA 3OEED 2ZTSA 4QC2A 4V0OA 4P31A 4IDHA 1COWA 1X86B 3PFIA 2ORWA 3GLFA 5AUOB 4TT3A 2Y8EA 5JWHA 5BN3A 3KKQA 4LCBA 1GIAA 4N1AA 4TLCA 1XWIA 2WJVA 4OHYA 3G0HA 3NDBB 4NCNA 1J70A 1D8TA 3I73A 5FOUA 4V02A 5BN4A 4NONA 4V0ME 1K5DA 1SXJC 5LB2A 4K81B 1JALA 3IGFA 4BLSA 2D7CA 4PSKA 1KDTA 2SHKA 1S96A 1VDZA 2O8EB 2FNAA 5JI3E 2IYRA 1VCIA 2VP5A 4HLQB 1UM8A 5FTLA 1EFRD 1XD8A 3QXXA 3KXIA 1SXJE 3IIMA 2C99A 5C4GB 4Q4AB 5FOWA 2ZS7A 4UJ3A 3KQHA 2ZI5A 2EYUA 4XD7A 4CZ2A 4ARZB 2WMOB 3RHFA 5F3WB 1Z6GA 1MR3F 4WW0A 5BW8A 3SJZA 1O3YA 2GJKA 2HEIA 4AIIA 4BLRA 4JL5A 4FW9A 1W36D 2ERXA 2MMCA 4JMPA 2G0NA 1ZIPA 2KBFA 1NLFA 2BM0A 2KSQA 3VKGA 4MYHA 5FUXA 1UBCA 1OH5A 4B74A 2I1VB 4B75A 2FG5A 1J2JA 2IWRA 3CLVA 5GJBA 4KYUA 1KZ7B 1Z0KA 4V0NA 1XNJA 4XVRA 4H1VA 4E22A 1S9DA 1EFRA 5F2EA 4URXR 1UAAA 4K8OA 4Q1EA 1X8LA 4QHSA 3LQRA 5B2ZA 2EWWA 3BIFA 1DG3A 1UKZA 3MWKA 4JLDA 1AN0A 3PQCA 4AI6A 1TF5A 2IUSA 3M0EA 1XRJA 4CEHA 1XZQA 1QBKC 4Q9IA 3NBFA 1W4CA 4B76A 2ZPTX 2OE2A 4B35A 1IN4A 2RGDA 3U3MA 2AX4A 2DFTA 1OKKD 1AS3A 1LW7A 1CULC 1CJKC 3TSWA 4FN5A 1G5RA 1R5NA 4HUQB 2JASA 1GRQA 3OFND 4BZXA 1VHTA 4C7OA 2FFHA 2LCFA 2WMNB 2IXFA 3DEFA 3CRRA 8OHMA 2EU8A 1S3GA 2BC9A 2VP9A 3B9PA 3Q8XB 3CH4B 3AUYA 3CZPA 1NY5A 5CYPA 2O52A 2GK6A 2QPOA 2GK7A 1E1RD 2PEYA 4PAOA 4ESVA 1XTQA 1HH4A 2GF9A 4K46A 3ZQ6A 3KQNA 3AVUA 3KQLA 3Q5EA 3VMFA 221PA 4C4PA 1E9SA 2GNOA 2ZITA 1UPTA 1DADA 3D3QA 3RC8A 4RD0A 3B1YA 2GF0A 4G5GA 3OAAD 1XB2A 4IJMA 3I4LA 1W4BA 4NYMR 3SBEA 1FQJA 2ZE6A 2G9NA 4BFTA 4Q01A 3KJGA 2RMKA 2IXGA 3C4JA 3D6TB 4URZR 3CX6A 1J90A 1DAGA 4IRUB 2PT7A 1ZM2A 4MYUA 1HTWA 4Q5IA 3EG5A 3L0PA 4RZXA 1G7SA 4IOJA 1YE8A 1RVDA 3TK1A 1U0HC 4R98A 3LW7A 1QG4A 3EC1A 2J0VA 3MWYW 3RS4A 2X19A 3KUDA 3LQQA 1KI1A 1G18A 2ZRGA 2QL6A 2WM9B 1UDWA 5DSZA 4LBZA 4PQRA 1IN5A 3A1TA 2BJVA 3VQTA 3SN6A 1KK3A 1KY2A 4A82A 4KYIB 4DCUA 3RRNA 4EIWA 3CBQA 2V55B 5JJKA 2OLJA 2QPTA 2NOAA 4MYCA 4NBSA 2VL7A 2X8AA 3WBKA 3OAAA 4BFWA 3IUYA 4ZI3A 5E7IA 2EYQA 1XZPA 4DUGA 3UWOA 1Z6TA 1ZCBA 3RYTC 5DN6D 2PEZA 1FZQA 2QP3A 3ADCA 1G9XA 2ATXA 1W4AA 2IA5A 5A5GA 3PJRA 2OO7A 5CK4A 1N5KA 3MSXA 2CK3D 3GQBA 4AKEA 1NBMA 2GCOB 1MO4A 3B85A 1YU9A 1Z0DA 4M2LA 1FUKA 3JZAA 4D6PA 4FWTA 4KFSA 2JGNA 3RWMB 1FNNA 3QPWA 4X8HA 2CXXA 5CK5A 1L8QA 1VHLA 2GZHA 4JLPA 4P3YA 3DZDA 3TUJC 4PZYA 2L0XA 3HU1A 1SZPA 1SKQA 2OCAA 4OBEA 3Q3JB 3TAUA 3K0FA 1YR7A 4Q4LA 3FOZA 4Q19A 3A6PC 1J99A 2XNDD 2JLZA 1F2UA 1KO8A 2OBNA 1W44A 3AF4A 2IEYA 3GJXC 1GNPA 4II7A 2HYIC 2NG1A 3C16C 1J8MF 3HU2A 2BBOA 4LWZA 1NN3A 4MDEA 4NH0A 1B0UA 2ZSBA 1EX7A 1S9HA 5FH9A 4CEIB 4Z54A 5TXGA 5EP2A 3CF2A 4PFSA 3RNLA 3EC2A 1DAFA 2QSYA 2ZI7A 2OG2A 4L9WA 5G41A 4IVPA 1KI3A 1SVMA 3CW2A 4XTCS 4YDHB 3CUEF 2GXUA 2QMEA 1OIVA 2JLSA 2ORIA 1R0XA 1II0A 2NZ8A 1H65A 2QGNA 1VCOA 2JAQA 1CJMA 2AKYA 2P5SA 4IOLA 1T3SA 2QA5A 1Q3TA 2FGJA 2YOFA 3ECCA 2DY1A 4XTRA 2QROA 3THXA 1KSGA 4GZMA 5FBRB 4XVUA 4ASUA 3E5HA 3LX5A 2P5TB 1KMHB 2JIZD 4LHVA 5EXSA 3SS8A 1N5JA 2PT5A 3HYRA 3L82B 4OYHA 4BFXA 1E2MA 5C2JB 1E1RA 2WSMA 5AUQA 1VG0B 3WYFA 2C9YA 2H8KA 4L4UA 3RAPR 1G3QA 1Z83A 4TLDA 2R6FA 1V5WA 1Q44A 4PTLA 5CJPA 1OF1A 2DPXA 1OE0A 2WZQA 1KDRA 1LVGA 2C03A 4B32A 3RSOA 2XX3A 3OFNA 1G19A 1MO5A 2BVNA 1G291 4PC3A 2A5GA 3GLFB 3MLEA 2X2EA 4LV8B 4KU4A 3IHWA 1U81A 1UKVY 1OB2A 4TZ6A 5KPDA 2XZOA 2BKUA 5ELXA 1BMFA 1U8YA 2ZR9A 3TSOA 2LKDA 4JBXA 2DCUA 1ZUIA 1PV4A 5B64A 1NLZA 5TARA 2RHMA 3FMFA 2HF8A 2HLDD 4BFVA 2BWJA 1ZM4A 1KGDA 4WAUA 2B8WA 4LV6A 4CEJA 1E2KA 3K8YA 4UNRA 1SHKA 4D4JA 3AVQA 2XXAA 2F1HA 3R7WB 3R7WA 3BJIC 3T06B 1P4SA 3GMTA 1N6OA 5EP1A 2IYTA 4TMXA 3DOEA 3NBXX 4JIMA 5BYJA 3BFXA 2F9MA 4M9SA 1GSIA 4HAVA 4DSTA 1N6LA 2P6NA 3RABA 4BGDA 3ZIAA 1LTQA 4URYR 821PA 1Q3HA 2AHOA 4DSNA 1XFAA 2RCNA 2W2VA 3ZJYA 3B82A 4HDOB 3Q7PA 4US1R 2GETA 2CDNA 3AKCA 3S1AB 1Z06A 3AVPA 4I1VA 3TVTA 3AKDA 2J3EA 4TZ0A 2YJTD 1IXZA 1E2HA 4GT1A 2GESA 1A2BA 2NGRA 4Q18A 4EUNA 1R4AA 4HAWA 3QY0A 3W6OA 4U00A 1CXZA 2BMJA 3FDIA 1MKYA 4WA7A 1E2GA 2ZRPA 1U8AA 3SJAA 4DLXA 4HLUC 1KTVA 2XJ9A 1AKEA 2IF0A 4DLRA 2ZYUX 4B48A 4P4UA 2OLKA 4CVNA 2VQSA 4LY6A 3W3AA 3FHOA 3WMFA 4C3ZA 4M0LA 3MAAC 1ZC4A 1SGWA 3A37A 3QKRB 2LKCA 3U61B 4DJTA 2WV9A 2QZ4A 4QJ3A 1RRFA 3AH8A 1TF2A 2PX0A 3CPEA 3LLUA 3P20A 4JJKA 5AUPB 5IRCD 5KDOA 4LOAA 4URWR 4MKGA 1NKTA 2FDCA 2QUZA 3ONWA 1X1SA 5CLQA 2QQ0A 2IL1A 2W58A 2CBZA 3MWLA 4RVCA 5D3MA 2ZJ8A 3PUYA 2G1KA 2J59A 3NDPA 2FEOA 1JPNA 1UADA 3KX2A 4OHZA 1E79A 4OK3A 4ON9A 2A30A 3G82C 4LJ6A 1CTQA 3GLHE 2OEPA 1DAEA 4PR0A 5HE9A 5BWMA 2E87A 4XIGS 3THOA 2GJSA 1WBDA 1KDOA 1SULA 4PHHA 2OSBA 3TW4A 3ZZUA 4E07A 2JLQA 2QMOA 2WAXA 1W0KA 2GA8A 2O0KA 3BERA 4BPBA 2NPFA 2GCPA 3HP1A 4Q00A 4GOKA 1RKBA 3BRWD 1QRAA 4BRUA 1X6VA 5DISB 2GHIA 3NKVA 2BV3A 3SNHA 4Z51A 4US0R 3IDQA 2FOLA 1C1YA 1A7JA 1NY6A 5EE5B 4B3DA 2OUKA 3DPUA 1ZP6A 4LI0A 3CM0A 1JAHA 2AN9A 4PHTA 2OCYC 4Q1AA 4PZLA 4X8LA 2XOKD 2NO9A 4HB3A 3TRFA 4AKGA 2ZR0A 1W5SA 1W36C 5SZIA 4PSAA 4QBGB 5JHGB 1F48A 5HKKA 4JJZA 1NNEA 1U9IC 3EWAA 3E2IA 2ONJA 4G5OA 4C0KA 4BECA 1TQDA 2P2LA 3EAQA 2HF9A 3AB3A 1ZC3A 3LVQE 3SDZA 2ONKA 3T1TA 4W5JA 4XH9B 1JNYA 1XMVA 3GJ6A 1W7AA 1QG2A 3CKLA 5HCIA 2CE7A 3KKNA 4HDCA 5FR1A 2H16A 3UXMA 5D3QA 1BS1A 3CWQA 1D2EA 1NG1A 1ZD8A 1HA3A 5GJCA 2IT1A 3IQWA 1TU3A 1IY2A 1JB1A 1NKSA 1JXMA 3AVYA 1KY3A 2MMGA 5AJXA 4D2IA 1DARA 3B60A 4TYPA 4B2IA 5KNBA 1WP9A 3GJ0A 3QEOA 3DHWC 1G3IA 1DO0A 2K5UA 1FTNA 4PO8A 4BEJA 2DFNA 1L4YA 3W34A 3AVXA 1RFLA 4NYIQ 3EA0A 1AGPA 2Q3FA 2RGBA 2WWHA 5G53C 1RJ9B 3VKWA 2VHQA 5DYGA 1FP7A 3IPYA 1NSTA 5CIWA 2F1IA 1BOFA 3PEUA 2J46A 3KZ1E 4NZYA 1Q20A 2W0MA 4Q4JB 4XOIA 2V54A 2Z6VA 5EXTA 5KOYA 4M1TA 1E2NA 1IM2A 1YZTA 5JLJA 1FW6A 1O87A 3PR1A 2CNWA 1DAKA 5F9FA 4Q02A 1GNRA 2R6AA 1GKIA 2J0UA 3EIHA 3EZ2A 3QBVA 4TMVA 5CJ2A 4JLKA 4Z1MD 5GJVC 3U7GA 4EAQA 1V43A 421PA 1W0JA 2ODEA 4JZKA 1DVRA 5FPKA 4TQAA 2VHJA 4KBGA 3UANA 1FNMA 1G4AE 2GWHA 4D26A 1S8FA 3CWZA 1LF5A 3DM5A 4QJ5A 5JWOA 2FU5C 2IUTA 2D06A 2QAGA 3I62A 2VSOA 5EUMA 3K09C 3H1TA 4EPTA 1SVOA 1KIMA 1I2DA 5FI1B 3MWJA 4QL3A 2ZETA 1OYWA 2EFEB 4IFBA 2CMKA 4OJQA 5FR2A 2BDTA 3PEVA 2BBSA 5DYIA 4HATA 5FI0B 4RJLA 4B3BA 1T0HB 4JSTA 4QM6A 3KXKA 1IJEA 5JI2E 2PX3A 2ZANA 2FJUA 1JJ7A 3QF4A 1WB9A 1S1CA 1Z6YA 2BBWA 1IOZA 3Q5DA 4NYMQ 1L7VC 4A4DA 3VNUA 2ZE8A 2ZU6A 3DL0A 3AVOA 3AGPA 4ZDIA 1RYHA 1ZYUA 3L2OB 4BWYA 4D4LA 4QBFA 2B7BA 2AD1A 3PUZA 2DYKA 2G3YA 1WBBA 4LJ9A 2XSZD 3I5YA 3TKLA 5FPTA 2C95A 2EQBA 1XJQA 3N5CA 1UDXA 4PPQA 4H9GA 1S1MA 5E3HA 1ZNZA 3EPJA 3W8NA 5FL7A 4Q1DA 2ZE7A 1M34E 2JJ1D 3UG6A 1R5OA 1Z08A 1GUAA 4L16A 2IYVA 2VHUA 4TQUS 2F6RA 1E9AA 3A58B 4DVGA 1Z3IX 4BRWA 4B3FX 2QP9X 3A36A 4B47A 4DXAA 3ZD6A 3O47A 2Q3HA 1M8PA 2HUPA 2IHBA 1ZJ6A 4CIDA 1YHNA 4M1MA 5FL3A 3T5GA 2FSGA 1QHHA 2ZRMA 3T1VA 2GBLA 4X8OA 2XTZA 2GJAA 5DGXA 2AKAB 5JHHB 4UXHA 1YR9A 3LBNA 4F92B 1NN1A 1W5TA 3QPUA 4JYBA 5AJYA 1XEFA 4Q7KA 2WWFA 3A4NA 4RZ3A 2XXAB 3NXSA 1DAMA 1AKYA 4WXPA 1NMXA 3W9YA 1WXQA 2F9LA 2J87A 1CJTC 1ZMXA 4P4SA 4KCGA 5JCZA 1MO3A 3KJHA 1XU4A 4GMDA 3KXLA 3TR0A 3GEEA 3WNDA 4MA4A 2IF2A 2ZJAA 1NN0A 1XEWX 4DCTA 2WIAA 2CK3A 1G8FA 4R2IA 1AK2A 5DHFA 2QN6A 1HV8A 3V4FA 1CR1A 4TWZA 3GLIB 4GSYA 4DUGD 2YYZA 3NC1C 3VR3A 3BFKA 2AL7A 2NO6A 1QHHB 3EA5A 4C0AC 4UXJA 3GP8A 1RZ3A 1E79D 4YMSA 4CRWB 1ETUA 3M4YA 4TL9A 4O2LA 3FPAA 1NLYA 4MH0R 2V7QA 4UNNA 1WCV1 3FKQA 3WMEA 3X1YA 3Q9LA 3P4XA 3WYGA 4PX9A 5TDHA 4MUBA 4GMXA 5TVKA 1HEIA 2OFXA 1QVRA 3ZD7A 2RKOA 5K8LA 2XTNA 1KDPA 2OAP1 3B6EA 3FYHA 1NP6A 2ZRIA 3K0EA 2YWGA 2ODNA 4WZAE 3TUIC 1MRSA 3OEHA 3RS2A 1Z07A 4N0EA 2QY9A 2WJGA 1E96A 2MSCB 4EJSB 3QKTA 2O8DB 1KMHA 1BKDR 5DHAA 1N6RA 1UFQA 1NVWQ 1W48A 3LO5A 3T1QA 1JR3A 2D7DA 4M1OA 4UNSA 1U0JA 4B6FA 2B7CA 4LJ4A 1Z6XA 3LY5A 5DN6A 3QXJA 3RS3A 3RS7A 4TSFA 1T0JB 1GNQA 2FFBA 5J5CA 1N6IA 4PO9A 3EASA 3KL4A 4DCNA 1HQYE 4O0MA 2W2XA 4FIDA 2W83A 1GZSA 3NC0C 1RIFA 1ZW6A 3ZGXA 1YZLA 2EFGA 1P2TA 4ZI2A 3E70C 1KI6B 3GJ5A 2NMVA 1UBGA 1SVIA 3U3KA 3THXB 1FX0A 3K9LA 4AD8A 2ZUCA 4OQNA 4RKFA 1KO7A 4GP6A 2WWYA 2R6DA 3ZH9B 5DNYB 4JSYA 1F3OA 2BCJQ 1KAGA 3AP2A 4A15A 2FFQA 1KK0A 2NO7A 3LAWA 4NYIR 1Z47A 1EFUA 4QBHA 2PJZA 1XD2A 2JEOA 4XWOA 3QSYA 2GEVA 1WMSA 5J40A 1D2MA 4M9QA 3X1XA 2CEAA 1JJVA 1GL9B 3FKSD 3IBGA 4NMMA 4W7SA 2QI9C 2Q9BA 2WOOA 3ZS9A 2GEDA 2C9CA 1JEEA 1EWRA 4V03A 1XPRA 5EZ5A 1E94E 1YR8A 5HZHA 3K0AA 2P0EA 1G5PA 3C15C 1ESNA 3T5DA 4GFDA 5SZJA 2J0SA 2JIZA 2O8BB 3HDTA 1Z2AA 1GOTA 3QXHA 1CIPA 1P2SA 4JL8A 2R65A 1N5IA 2ZSFA 3A4LA 2J5XA 4DLYA 1N6KA 4E5UA 1F2TB 3B2EA 1KSFX 3A8TA 3L43A 1E2EA 3FKSA 1KNXA 3C8UA 3L0OA 1IY1A 2B8TA 2C8VA 3OE7A 3N70A 3ZZTA 3B78A 4URUR 4ABYA 1T91A 5AJVB 5SZKB 4NDZA 2YV5A 3I8SA 2VIIA 1XEXB 3F5FA 1NIJA 1W46A 3GCGA 3TUZC 4LJYA 1DPFA 3AEZA 1T8UA 4B3XA 1Y63A 2JDIA 4JLBA 4DZZA 3TH5A 3J81k 4JBYA 4URVR 3DZ8A 5JRJA 2YC4C 1TX4B 2ZE5A 4OQLA 1AA9A 3TMKA 4DB2A 2VEDA 2KWIA 3QG5A 1NBME 1AQYA 2QM8A 1KO5A 2ZUDA 3EW9A 4JLMA 3RRMA 3U3JA 1KOFA 4B3GA 4TQ9A 2ZRNA 2XB2A 2WWIA 1OH6A 3ZQJA 1OXXK 1SKYE 2GILA 4FCWA 4FD2A 2UZ3A 3VR4A 1VYUA 2CVHA 1XD2B 3RRYA 4WXRA 2G88A 2IXEA 1Q1BA 1YJ5A 2IYXA 3NVAA 4WIAA 1R8QA 5EP4A 5L3RA 3T1OA 3PUXA 4TT3D 1ZNYA 4LSGA 4LHWA 1ZVQA 3CR8A 1WQ1R 4DSUA 4Q4HB 5EXPA 3SQWA 4NCKA 3R20A 5L3SA 1ZD9A 4DC9A 5LPNA 4M8NE 1CU1A 4JYCA 2I4IA 3CRMA 3UG7A 2BCGY 2ZI9A 2VHCA 1NBMD 5AJZA 4XWAA 1ZUNB 4A0HA 3EXAA 1JR6A 1N0VC 2OESA 3HPRA 1KMQA 4B3CA 3KUCA 5TB5A 1CF4A 1Z0FA 1QHXA 1OXVA 2VF8A 3AUXA 4UQOA 1R7RA 4ITRC 2ZREA 3CPJB 1G4UR 1ZNWA 3TNFA 1K6MA 1MH1A 2F3RA 4FI3C 3N2EA 2QAGB 4W5HA 4R71A 2I1QA 3BORA 1XMJA 2VH5R 1IONA 2IYWA 1Q1QA 2RGCA 2X1VA 2O8FA 1E2DA 1GKYA 3PV0A 2F7SA 2Z0MA 3LXRA 3O8DA 2VSXA 3GJ4A 1FUUA 1NL3A 1OH8A 3MRSA 2HXYA 4RCYA 4XJXA 1PUIA 1R5BA 3ICQB 2C77A 2IBMA 2QAJA 1LB1B 2QG6A 1X3SA 2B92A 1XMSA 1XTIA 2ODBA 3B1VA 3WNCA 2QORA 2F3TA 3V4RA 1ELOA 3FMIA 2QBYA 4RD4A 4UNQA 5K8IA 3P27A 1E98A 3QENA 2ANBA 1Z0IA 3WHKA 3VNVA 2ASEA 4NTZA 5EQTA 2OCBA 3GLIA 5AJWA 2WIBA 3K0CC 4NCHA 2ZR7A 1TPZA 3W5JA 2V3CC 4KAXA 1XF9A 5IHPA 2GEUA 4BFZA 4PHGA 4YONB 3QE0A 1ZM3A 3AF2A 3OESA 2F1JA 4KJZA 3IO5A 1P6XA 6Q21A 1P60A 2NIPA 4AY2A 2ZRDA 4FCTA 4CW7A 1QHSA 3M6AA 2HDNB 1G7CA 3PIRA 1RRCA 2QE7D 1QHGA 4OK5A 1QHNA 2KB0A 1ZM7A 3VAAA 5IF9A 1KJYA 4OI2A 2FZLA 2NTYC 4NE2A 4BLPA 3BS4A 1SVLA 2MSEB 2BM1A 2VP0A 5FUWA 2O5VA 3K09A 4A9AA 2ZXUA 1GVNB 1JBKA 3D31A 1SQ5A 2PZEA 5FUYA 5H68A 4IW3B 4UKDA 4R9UC 1Z5ZA 2WICA 5CIQA 4NCIA 1II9A 5TV2A 2IYSA 3IHLA 4OQXA 1OXSC 2D2FA 2C78A 4DT1B 3THWA 1XCMA 4YDSA 5HTKA 4WZ6A 2GAOA 4C9BA 3HWSA 4QGAA 4US2R 1XX6A 5JWRA 3K0AB 2EFDB 4CDGA 4DLWA 1LF0A 2ZSAA 3U7FB 3CPHA 4A0FA 4A6PA 1I4TD 1VTKA 2XB4A 2JCSA 3TQCA 2Q3MA 4HZIA 2CVFA 1VIYA 1XMIA 1KJZA 4KVAA 4DLSA 2N46A 1XD9A 2Q0HA 4B2PA 4M53A 4LRWA 1TQ2A 4GRAA 4F38A 1GRRA 5DI9A 1JR3D 3DVLA 1SXJB 1XXHB 1G7TA 4TN1A 3RRZA 2O8BA 2RGGA 4V0MA 5E4FA 4BFSA 5LDDC 3AF0A 2FFAA 3UK6A 1KHTA 2DFKB 4NP6A 4Q9LA 4YC7A 2PZGA 2Z4SA 2D2EA 1JAIA 4DLTA 4LC0A 1G1MA 3RS0A 1HE1C 3WXMA 4LYJA 1ZCAA 1SHZA 4QNMA 5DIFA 3GLFE 3CNOA 3D7MA 4IEIA 2AD5A 4JKYA 2QSZA 3RVBA 1US8A 4D0GA 2RGXA 4ZCLA 4M9XA 3W6PA 5LBIA 3VX4A 2WWWA 5H1YA 2FE4A 4AWXA 1YQTA 4LDJA 1DG1G 2YOHA 2CHVA 1W47A 4OQMA 2QPAA 2GTPA 4EKDA 3HU3A 4Q9KA 1YZQA 1D9XA 1E69A 2AFIE 2JJ2A 3FB4A 4A0GA 3FTQA 5D3MB 4OHVA 4JVSB 2WJIA 4MKFA 1QZXA 2ZS8A 1E0SA 4A92A 3SFVA 5C4MA 4I4LA 1YRAA 5DO9A 4Z8YA 3K70C 2QTFA 3OIVA 4TTRA 3N2IA 2J7PA 2EVWX 2ZYVX 2A5DA 3PXGA 4RZUA 2PH1A 5JEDA 1FMLA 1IXSB 1GITA 4EPWA 3OZXA 3U4QB 5HPYB 2EW1A 3HR8A 3EPHA 5JZVA 4L5BA 2AK2A 2CLCX 4I1SA 4AG5A 2IS6A 4PC7A 1G5TA 2OXRA 2DR3A 4CF7A 3VR6A 2ZU0C 1N3BA 3GLGE 2NZJA 2GVZC 2VYFA 1UEJA 4MUAA 3AKYA 2YWEA 5H8WA 4EQ6A 3OIWA 1VIAA 2ZUBA 1T8TA 2JLWA 4WZBE 4EPVA 2XAUA 1S4QA 1OPXA 2J45A 3KJEA 3CX7A 1OYYA 3BOSA 4Q4JA 3BC1A 4X8MA 4MGKR 1AS0A 1E9EA 1IBRA 3R9WA 2A78A 1E2FA 1F5NA 3CF6R 3U6KA 3AGQA 1P62B 3MJRA 3BB1A 1W2HA 2JJ1A 3GJ8A 4OJKA 5SZHB 4M1KA 3I32A 3RSLA 1R10A 3ZDQA 4RY2A 5J4VA 4DCVA 4DEYA 4JVMA 3ADDA 2ZRCA 2WPDD 1KK2A 4L9SA 4DDUA 1P2VA 3BH0A 1YRBA 4IXMA 4TMTA 3CRQA 3IEUA 4GL2A 2BIFA 3LVRE 2D62A 1E9FA 2FX3A 1NG9A 1Z8FA 2ZJ5A 2JLRA 3C5HA 1GL7A 4IFEA 5EZ6B 4BASA 4P33A 5CB6A 4CEJB 2ZEJA 1K8RA 3FE2A 3CRVA 4JT2A 3QPVA 4E03A 2ZM5A 4A2WA 5JRZA 4BFYA 4LJ8A 1D2NA 4PZZA 5E7MA 1W0JD 1NVVQ 4PPNA 4B73A 4U7DA 2FA9A 2IS1A 3ASZA 2GDJA 4Q1BA 5F98A 4L15A 2PMDA 4B71A 2W6JD 4OI4A 5EE9A 4F93B 1XCGB 1Z2CA 2R2AA 3U44A 2BEJA 3H4MA 4HAZA 3THWB 4UNPA 4DLVA 4NYJR 2FPKA 1N0UA 4RD2A 3CONA 5L8VA 2IS4A 2HT6A 3MGCA 5FTNA 4ZO4A 2P6UA 1KI9A 1W0KD 2WWGA 1E9BA 3NEYA 1XXHA 3ZS8A 1EGAA 1FMJA 4DKXA 1LNZA 4ZV4A 3NG1A 2V4ZA 1SVKA 1UBFA 2DWPA 4OKSA 1TL7C 1JXOA 5UKDA 1Q1EA 1ZBDA 4EPXA 1G8HA 2H7VA 3L8ZA 3QOFA 1E99A 2AFHE 2GZAA 2AR7A 2PZFA 3B9QA 4G01B 5KSYA 2YKGA 4JKIA 2VBCA 2R6GA 1P72A 1UF9A 4RD1A 4QHTA 1TF7A 2EWVA 2R6CA 1CRPA 5EE1A 1M74A 4N3NA 1VG9B 3CIOA 1EXMA 3REFA 4ZKDA 2Q9AA 1F60A 3GEHA 4IXNA 4LYHA 3BB4A 1IY0A 1Q0UA 1Z29A 2G77B 2RGNC 1KI6A 3KKMA 1U9IA 4KODA 1PLLA 4LJ5A 3TIFA 2UKDA 3PUWA 1BO6A 1MV5A 2P6RA 1TUEA 3LA6A 1NRJB 5DLQC 2CJWB 4F7WA 4IDNA 5J4HA 1OFTA 4TL6A 3SZRA 4G5QA 1FTSA 1UEIA 2Z43A 3BWDD 3EARA 3OEHD 3PCRB 3DKPA 4IHQA 3PVSA 3B8HA 4JLOA 2DB3A 4OQFA 3ZVMA 2BMDA 5JBQA 3QVUA 4RSGA 4FXPA 3TBKA 4HI0E 4D0NA 5KSOA 1ZIOA 1Z0JA 4B43A 4WBSA 4V0LA 1IQPA 4Q1CA 5CB8A 4F4CA 5JMTA 2V7QD 2O8FB 4AG6A 2ZAMA 1NSFA 4TYNA 3A4MA 2OFWA 1CR0A 5DH9A 3SI7A 2GRJA 3WRXC 2QENA 5FFMA 4JLVA 3TSZA 5DI3B 5GVRA 1Y3AA 1OSNA 4C7OB 3SHFA 1E1QD 5E95A 1CS4C 2GJ8A 2ZJ2A 3EZ9A 4RFSA 2ZYTX 2W6ID 4Q7JB 3LFUA 5EXXA 2XZLA 1Z28A 3G5UA 5A0FA 1XP8A 4QG7A 5HZKA 3AKEA 2ZRLA 3T15A 1I4LD 1R0WA 3GJ7A 4HYYA 2GKSA 2RGEA 4DIDA 1KNQA 1DAHA 4WVFA 2WKQA 4O3MA 1XBTA 4DRZA 1HQCA 3THYA 5C18A 3GD7A 1DELA 1KJWA 3BH7A 4FMDF 4QKQA 4Y0AA 4ZDJA 2F55A 4PQFA 1PLJA 3K0SA 3UPUA 4DLZA 2HJGA 2J0UB 1N2CE 1DS6A 1QHIA 1RRGA 3UIEA 5JECA 3RANA 2HLDA 4A36A 4FMCB 2C9OA 2AWOA 4I1UA 3ADKA 1MABA 4BE7B 1CJVC 1P9NA 2WWXA 1EX6A 5FOTA 3L0SA 3LH5A 5EP3A 1T5LA 3WRYC 4A0RA 3TJZA 2J0QA 2N1BA 2CL0X 3R9IA 3SJCA 1CR2A 5FTKA 3FHCB 5J47A 3R8FA 2ECKA 5JFGA 1ZUHA 4FMBB 4S2EA 4ZCMA 4EFNA 1H8HA 2ZRJA 4HAUA 1YKSA 2ZS9A 4Q9JA 3LLMA 4Q48A 2WPDA 3QIAA 1FPMA 4KFTA 4E09A 4GDFA 3NHBA 5FBLB 4PC2A 5B57C 4PXAA 4R2HA 1OHHD 3UKDA 4C0QC 3O8RA 1N25A 1RW4A 1UKYA 4Q4AA 4Q21A 5L3SB 1W36B 1WF3A 4EDHA 3AVVA 1U2RA 1D5CA 4EFLA 5JEEA 2VHTA 1J7KA 4KXFB 1OKKA 1XEWY 3KB1A 2ZI3A 2BOVA 4HB2A 4WOPA 1N6HA 2WOJA 2ANCA 4CYMA 5IT5A 1H8EA 4NKRA 1F2TA 3SYKA 2OFOA 4YXWA 3ZVRA 4CT4B 3BFVA 3SOPA 1LY1A 1T9HA 5FPSA 2PLRA 3MJHA 1P61B 2ZRAA 1G64A 2P67A 2IS2A 2V9PA 3K9HA 3P4YA 4EQ6B 2A2ZA 5AUNB 4TYQA 3BBPA 5FTJA 1TADA 3R9XA 5FPHA 4XWKA 4AURA 3NIBA 4A2PA 3LNCA 1TTTA 4M1WA 4EPRA 4C0LA 1QVAA 4O25A 2OXCA 3U44B 2CNWD 3DDCA 3TLXA 1B23P 4LJAA 3H84A 4A8JC 3WNBA 2REBA 2J7PD 4G0NA 4LHZA 2IC5A 4B44A 3T61A 5JSZA 2YC2C 3F8TA 2CLSA 1G8GA 3JVVA 3P32A 5KPJA 2X2FA 1ODFA 4XD7D 1X1RA 4RCZA 1JECA 3SJBA 3B13B 1AJEA 3DM9B 3REGA 3RLFA 5FBWB 1S2MA 1BMFD 2V1UA 4M1YA 4DSOA 4ZCIA 2J1LA 3U7HB 2KJQA 2RH5A 4B6EA 5H70A 4A8JB 3BD9A 1R6BX 2JDID 1VYTA 5KHOC 1XTJA 5IDVA 3ZIAD 4BLTA 2YWFA 3L8YA 3KKPA 1A2KC 1RPZA 3OEEA 4BEBA 3JZMA 2KE5A 1X8JA 1DE0A 4OHWA 4DB4A 4GOJA 2QEQA 2I3BA 3IPXA 3KFXA 4BQSA 1GM5A 2ZIAA 4G5SA 2RGAA 3MG9A 4TMKA 1XJ0A 1F2UB 5FUVA 4LYFA 4P0TA 4EJSA 3UMSA 1PJRA 4ILEA 3OHMA 5GADl 3BGWA 1CEEA 1KI8A 1XDBA 4DDWA 1FFHA 3A1SA 4ZDKA 3QI2A 2ZI6A 1YZUA 3KDSE 5KDLA 2XOKA 1T4GA 3CH5A 1W49A 2ORVA 2Q6TA 2REOA 1P73A 3QKUA 4Q47A 2JLYA 4G1UC 4LHYA 3BB3A 5B58C 5C1BA 3MD0A 2IYZA 2JA1A 2GJ9A 4Z8XA 5JSZB 4YMWA 4KHZA 2A5FA 2JATA 3U3OA 1TAGA 3UWKA 2R8RA 2P65A 1P7CA 3LBHA 3QVVA 2G1JA 4KV9A 4A1FA 4FINA 5L3QA 3MCAA 4KSBA 2WTUA 4FMDB 4TYWA 4HUTA 1ANKA 2ATVA 2OBMA 2NPIA 1BYIA 4PPGA 3K9NA 1WRBA 2G6BA 2EFHB 4IVRA 3B7GA 3V9PA 1RC8A 3CB4A 1E0KA 3IKJA 4C0BA 1L4UA 3P26A 3CNNA 1KKMA 3DMDA 1Q22A 4NPHA 3T34A 4JLJA 5KUTA 1OB5A 1HYQA 2CE2X 1A5TA 3FFAA 4V0KA 2A5JA 4ZIRB 3X1WA 2REXB 4OI1A 1TU4A 1NVVR 1GILA 2BBTA 4JLNA 1JQLB 4AKHA 1GDDA 4ASUD 4QGHA 1KK1A 1HUQA 1FL9A 2C2HA 4EPYA 4HAXA 3OIYA 2H18A 3IQXA 2JJ8A 3SE0A 4D4MA 3K70B 3LV8A 1VCNA 4W5WA 3LX8A 3LD9A 2R44A 1DOAA 3VU9A 3OF5A 2JLXA 3HJNA 3U3RA 1PLKA 2QAGC 4QOSA 1TMKA 1E2JA 2V1XA 1NMZA 3T35A 1P9RA 1II8A 3O8BA 4RZ2A 1CR4A 4N0DA 721PA 1GWNA 1ESMA 2F43B 1SXJD 4MQBA 4QFMA 5EE0A 4IDOA 4Q1FA 3IBYA 4ZDWA 2FPMA 5GJWC 3ZZ0A 3KQKA 2NO1A 2OV2A 4HLDA 3KTAB 1XXHE 2H92A 2KBEA 2ZJZA 2ZAOA 5CLLA 2JLVA 1E4VA 2FWRA 2QU8A 4LBYA 2BMEA 4JL6A 4PQYA 1K5GA 3H0KA 3T12A 1G7RA 5L3VA 1E2PA 1S3SA 2V8OA 2CHGA 4R7ZA 3KQUA 3DO6A 2YNMA 4LBVA 1JI0A 1MOZA 2GAAA 1QHYA 5KDDA 4QRHA 1OJLA 2IX3A 2DBYA 3RWOA 5BXQC 3ZLJA 2GXAA 5L3QB 1W1WA 3AP3A 3RS5A 1DEKA 2QTVB 4RFSB 1UKEA 2N42A 621PA 3CO5A 4RKEA 5KNCA 1EK0A 2Q9CA 2FZ4A 2LWIA 2DWQA 3NH6A 4MKIA 2WJHA 1LV7A 2IYYA 3QBTA 3P1JA 1RE0A 2ZRKA 1NVUQ 1N6NA 1Q1ZA 4CEHB 1GL6A 5B30A 3V00A 3ZVLA 4MYTA 4TL8A 5JJLA 1GFIA 3Q7QA 4IDPA 4QGGA 4LC1A 3VHXA 2H1LA 2ZRFA 1Q57A 1T6NA 4HB0A 1XTSA 4H1UA 5CITA 3OIUA 3C14C 2ZSEA 2HCBA 3FGNA 2C5LA 3NTUA 3X2SA 4MRNA 1AS2A 2WSSD 5BYKA 1QDEA 2GBLC 1E0JA 3ETLA 2ZSDA 3MUFA 4NHOA 4KITB 2P3SA 3GFPA 4D25A 3NEJA 2VF7A 4FMCF 4Q9HA 2YOGA 1SVWA 4LV5B 2OZEA 3H86A 4S35A
chains in the Genus database with same CATH superfamily
4FKMA 3O6VA 1FY2A 5F1PA 2G0TA 1YR6A 2Q3EA 3RU7A 2W6PA 4YT2A 5ITWA 1UBEA 1ATZA 1RU3A 1KPHA 1JFVA 1LLQA 1YZNA 3EFEA 3IS3A 2ZVQX 1JHMA 1TAHA 4FSXA 1R0YA 2DBVO 3GHHA 3QE2A 1E3QA 2BONA 2QRZA 3DV9A 2IHNA 1A5AB 2OT3B 3N74A 3ETCA 3TNLA 1JGTA 2JAWA 2RGNA 2VATA 1OLXB 2P35A 1R0LA 1TLLA 2X4IA 3MXTA 4H2DA 5L3ZA 5BVGA 3TGPA 2XSZA 4CKCB 1BC5A 2WHXA 2ZIZA 3AF3A 1A9ZA 3IE0A 3HJTA 1WD7A 3ZHBA 4EG7A 2TMDA 4YMTA 3B1JA 3DMTC 2WNIA 1BU5A 5KJFA 4F0JA 2E55A 3QUSA 1L5HB 1P1FA 2PNJA 2NZWA 3LC2O 5HDBB 4JKOA 2KPOA 2Q0XA 2ZI4A 4HCJA 1NNLA 1F4PA 3CKYA 3RJMA 2NTNA 1Y4DE 1ZX1A 3BD6A 3CJQA 4L8WB 3TZQA 5CLGA 3RYHB 4OLHA 3VFDA 5DNUA 4KBFA 2Q21A 1NQ5A 2E1RA 4QO8A 4F3RA 3R9XB 2BKEA 4X7MA 1IAVA 2A3RA 1EUCA 3FRIA 4FYMA 1KSJA 3M70A 4UTOA 2FZCA 4PNPA 4Q4HA 3FD8A 2LD4A 4MVJA 2VAWA 1NIPA 2EKDA 5KKAA 1EXNA 5KTKA 2O19A 4G5RA 3N0XA 1NI5A 2AXNA 5ALPA 2O3RA 2R9VA 2HJVA 1XL1A 2QD5A 3F2VA 4ZODA 1JKFA 3RTBA 5CDGA 5TGDA 3LRPA 2IPNA 1DQNA 4J9VA 2IWHA 5BW8A 1HTTA 3FYUB 2A0UA 4WECA 5B1DA 4ZCTA 2WKWA 2L42A 3O4VA 3MTQA 1WU8A 4H17A 4EA7A 4BMNA 2PZMA 4V3CA 1U2GA 4KNVA 2AA3A 1FUIA 1DP4A 2YUTA 3FMPB 4HWOA 4MWCA 1XZNA 4GBJA 3KO8A 3S28A 1USKA 1U3VA 3U5ZB 1XLTC 1KSHA 2B1QA 2PY6A 4DABA 2F3SA 4ZCPA 3PNVA 4LOJA 5DSXA 4ZVOA 3UKOA 4BKUA 3SCZA 1Y9EA 3RU2A 3OZRA 3L0IB 3K2QA 5DM4A 1ZPDA 3RBZA 3ZXXA 4DJ5X 5CEEA 2X2OA 4Q16A 1J9EA 5MGNA 2RHWA 2FN8A 3JAWA 1I3LA 4QFBA 1I3CA 3AUUA 2H65A 3W5AA 5FBVB 2QD3A 1GKKA 4K9QA 3KQPA 4O33A 3SQXA 4W82A 4IEFB 4MGIR 2B4RO 3JTEA 4CGZA 3EFOB 3R41A 1VKOA 4FWIB 2UVQA 3PKZA 3DMNA 2GPAA 4M87A 4MV0A 2AI1A 4JUCA 1UKAA 3M2TA 4TS4A 5ERGB 1PI3A 2R62A 1OFIA 3E2MA 5DPMA 4NZZA 3UUEA 3ZUPA 5K0EA 5KNDA 1UMCA 3SG0A 1TXGA 3AVTA 4CQMB 1VI5A 1VPLA 5HTOA 4DF3A 1XTBA 4CKYA 6GPBA 3WKDA 3OQMA 4M4SA 3IMEA 4CWAA 1ACMA 4CN9A 1Q17A 4BLOA 1IAQA 1DL5A 3Q10A 3F9IA 1O96B 2AEEA 5AWFC 5I9BA 4MW7A 3RVOA 3BDVA 1OAOA 1BE1A 5JDCA 3K73O 4H0NA 3I30X 2CHQA 5DGHA 5JNUA 1TEXA 1PZHA 3HKEB 2B78A 4CEIA 1IEVA 2XMRA 4MV7A 4ZOAA 4TLBA 1YVDA 2C3UA 2WDPA 3H5OA 4MVJI 2HWWA 1GCGA 2QPLA 3EIWA 4P81A 1MJGA 3AUJB 1SHLA 1EUQA 3SAJA 2IZ1A 1SU8A 2O0HA 2O7VA 4HDSA 4LJ7A 3ZE1B 1COWD 3HO1A 1XAIA 1ZNQO 2VPPA 3W77A 3VPCA 2CCKA 1ZCZA 1P2GA 1IJBA 4CUZA 1YDFA 4Y2TA 1SY7A 2YWHA 4BQOA 5A6VA 5KOJB 2Q6OA 2FFRA 3ORQA 3P9XA 5DB4A 3NNNA 5BV7A 2PZKA 3GLHB 3L0ZA 2VTBB 1UXOA 2GHQA 1D7AA 4K3UA 1EDDA 3I42A 1E18A 4OXXA 3QEJA 4G36A 5IKPA 2DWUA 1WXFA 4EB8A 2ZYWX 1BGWA 4B7CA 2EL9A 2YMQA 4IIDA 2O06A 4XFKA 4D5GA 4IJ6A 4JP3A 1Q21A 1P7WA 5ALVA 2JBAB 3JVUA 4NAVA 2BFAA 3ELWA 1VI6A 2C83A 1HT1E 2R8BA 3PFGA 4HWSA 5F9HA 2F62A 2SKCA 4IG4A 4Z7QB 1F9EA 2QD4A 2WJYA 3ND9A 1N57A 3FCCA 5T6BA 4QQ8A 4ZQIA 1FNSA 2IUEA 2PWYA 2V9ZA 1Q7GA 2VJYA 3E27A 5LYYA 5A02A 2KS6A 2Q7XA 5LP6B 3TEJA 4MITA 4DBLE 2PHZA 1R6XA 4RAOA 4W1PA 3HHPA 2G9VA 3WMGA 3NDJA 4B81A 3B1ZA 2XITA 1KORA 1HLFA 1EP9A 4ZAVA 5FOXA 5KS2A 3ER8A 4LDNA 4RD6A 3RNOA 2G9RA 3BGVA 4C4ZA 2FSIA 2J3IA 1Z74A 4D9HA 2I2FA 1NF9A 2NVOA 3AESB 3I8XA 5JD4A 2ZSJA 5K3DA 1I36A 5FL7D 5F5LA 2DERA 5FHQA 3NHMA 3PC6A 1ZRHA 2IHYA 4CM1A 5I7UA 4CODB 4BVBA 1KKLA 5KSPA 3EJWA 1IN6A 1PL0A 3RI3A 1BOOA 4HFNA 5K4GA 3BL8A 4UM9D 2IV2X 2P78A 2PS0A 1ZU5A 4CF6A 2JH8A 4D80A 3VM6A 1E4YA 1M2EA 5BQ5A 2A1TS 1AZTA 5LKRA 1W4RA 2BEKA 3DKVA 1D1SA 4HB4A 4M89A 1UPCA 2Q6LA 3LOQA 2NVUB 4GUAA 4OQEA 1E2UA 2WKPA 1FBNA 2CNKA 4M22A 3CQ9A 1N3LA 5ELMA 4BGUA 1G6HA 2GI4A 3OT5A 3SHVA 3IUJA 4GMKA 4W7HA 5GPBA 1CSEE 1G3UA 4MDYA 4W9NA 4ZGBA 2QBYB 3BD8A 2IIBA 1KR2A 2Q62A 3NGMA 3IUEA 4C0HA 4EENA 1NT2A 1AXGA 4HSEA 3URKA 4U39A 2POQX 3GUZA 2CVZA 4NZOA 4E3ZA 5FOQA 3I5XA 1K2WA 1VCMA 2H4ZA 4YGXB 2B3DA 1UQTA 1Z6QA 2HBZA 1HEYA 1R2QA 3NYIA 4TLEA 4EHDA 3OX3A 1LD3A 1YASA 3K2IA 4HZUB 1MAWA 2Y3IA 4U5XA 4R8KA 1RWMA 3GA0A 3T7RA 1ACLA 1BYUA 1RQLA 3IRUA 4XR9A 1XHFA 3WY9A 3VRHA 1KOGA 3I9KA 1BSVA 3G2NA 4M0PA 1OROA 1O5TA 5JSQA 1ZUWA 2IGTA 4IHKA 4MW1A 1DWUA 4ZI7A 4TLAA 3SIRA 3UWMA 1AC5A 1ZVVA 2O48X 4F4IA 5DOZA 3AY6A 1JSCA 3MB5A 5I7OA 4QBIA 1IZ7A 3IX7A 5ALQA 1U7WA 1UPAA 2IEGA 1L8LA 3NH9A 4F9FA 1DEOA 4H7EA 1OT3A 1SKYB 3QU2A 4KBYA 2B21A 3IA2A 4MGHA 1YCGA 2ECPA 4IDDA 4UULA 2GLUA 2DWOA 2WF6A 3WB1A 4YCAA 3RUFA 3BREA 3SYNA 2H1SA 4AF7A 3KETA 5JJIA 4I81A 3BQ9A 3L40A 4YMUA 2BUBA 3AZOA 1D8AA 4PIPA 5EMMA 3THYB 1G20E 4YMIA 4R7GA 1PS9A 1T43A 2P5YA 4JYZA 3ASUA 1N2SA 1H6BA 2ETXA 3KOOA 4M6WA 5HZMA 3HB9A 4WL0A 3OFJA 3DAPA 5AVQA 2W22A 4PX3A 3TVDA 4LPKA 4QASA 4MIKA 5EHIA 3O2NA 3OE7D 1IJFA 2E4WA 5CW1A 4AYXA 4EFDA 1GA1A 2P77A 4Y2RA 1WKBA 3LCMA 2AG6A 3C3MA 1QH1A 3GGSA 4F8EA 3N6XA 1TQ6A 2FPWA 1DRJA 1CUSA 4IYRA 1CCWA 1PZNA 4CZ2A 5IEJA 1X77A 2FKNA 2L82A 3LDHA 5A5VA 3QE4A 1NF8A 4ZI7B 2ZDHA 2O0LA 2P11A 5KEIA 2FQXA 3RVSA 1Z63A 3ERCA 2TMKA 3OF3A 3ZDZB 2I7DA 1L7PA 3PEWA 2HA0A 3AFNA 5EJ6A 1RXCA 4PFJA 1FMTA 4NYJQ 5ETJA 1NLMA 1BFDA 1AUXA 2E6UX 4MAFA 1CPYA 2V6JA 1JQJC 2RAFA 1PF7E 5DULA 1ZD1A 3WWZA 1CVIA 1S89A 2O7RA 1G8YA 1MPXA 3FAKA 4RPKA 2Z3WA 2NU9B 1GN8A 1GVHA 3FX2A 1BX3A 2EKZA 4ACBA 3PYLA 1GG9A 2M9MA 2X9VA 4V2IA 5J4LA 3RC3A 1OXUA 2GCNA 3FWNA 2AQHA 1Z4MA 3EZ7A 1CBUA 1RQXA 3A6ZA 2H2FA 1KOJA 3DJYA 2IUUA 2GPTA 3W1VA 3UK0A 1B76A 1G41A 3GPBA 4G3XA 2DHRA 1XZCA 3LFHA 3M1YA 3SYLA 3QYAA 3NHSA 4LNUA 1LNQA 1T35A 2CKDA 2HCJB 1XTTA 2O2SA 2HK8A 4WY8A 1JHRA 4HK4A 4H08A 2QRGA 5E3JA 3WLEA 4YJGA 2FH5B 4MCAA 5JAQA 4J3NA 2C98A 4RTLA 4B85A 2C1EA 4N3AA 1NM5C 5DNAA 3I9OA 4IIXA 3OBBA 4CLXA 3K6KA 5HKKD 1U98A 3ISTA 2FSHA 4Z9BA 1PK7A 5LXTA 1O0CA 4ER6A 3HR7A 4LYDA 4BNYA 1V6SA 3TTYA 3WDLA 1O6FA 4IMIB 4QD3A 2QHXA 1T9KA 2XMZA 4N0QA 5BN5A 1NAHA 1W2WB 4ZYLA 3GRFA 2Q2QA 2NUAB 4ERXA 2Q1WA 5M29A 2BSXA 3AK4A 3MRXA 2GPYA 2RFLA 1VXOA 4ZPXA 1QP0A 3AU8A 4FYWA 4ZO6A 3RU3A 4YQFA 3ED5A 4HS4A 1Y6JA 4II2A 1J06A 3WRXA 2GZRA 4ESOA 4MQFA 3U60B 4IMPA 5AICA 3HUTA 4IFIA 1WE2A 1P4RA 2IRWA 2VTKA 3FTFA 4YP5A 4K2AA 4D1YA 3HA2A 3KKKA 4D99A 1Q12A 4AMYA 2IH5A 1U2DC 3C5CA 5EMJA 1YZGA 1OW3B 3D3NA 4ZO7A 1GPWB 4WA8A 3KSAC 3Q7SA 1KAOA 3LTNC 4MKXA 3AEYA 3C7KA 3GJSA 1XL0A 3GRCA 4HEHA 1M6VA 3X1KA 4B2LA 4F5ZA 4HAYA 2BGNA 3ESZA 4WK0B 1H2EA 5CDFA 2WLSA 4YT4A 3OLYA 1TVCA 2J85A 1QGUB 1ZGAA 3IO3A 4K5QA 4CLOB 4EW3A 4HTAA 2ZB7A 2J32A 3UNXA 1YULA 4Y6SA 4KUGA 1JEDA 4JFAA 4YCDA 4KLAA 4WLEA 3VOAA 4BNGA 4CE6A 2C3OA 4IP0A 2ZROA 1M7HA 2QQEA 3LUGA 4ZRDA 5AVVA 3DKKA 4U0JA 1B15A 4KQCA 4PIMA 1X80A 4BVAA 4C6TA 2FSFA 3LC1O 1GGEA 3ZKAA 4DRYA 1U4SA 4Y2XA 2PRJA 2L18A 1R6VA 1H5NA 2WC1A 2A1UA 2XNSA 2YNMD 1SUEA 3AYZB 4PX5A 2NU9A 1T3LA 1Y6ZA 2OXEA 4MR9B 4E6PA 4UASA 3FW1A 1PV1A 1P75A 1VG8A 4N9WA 3EIFA 4KH1A 4AUEA 1VSTA 1TW2A 3JQFA 3DE2X 4HDSB 2FEXA 3BH6A 1NSYA 1JIQA 4WVLA 1Z4OA 1JFSA 2J3KA 3CUSA 4J94A 3AR9A 4PM4A 4Q34A 4G09A 2Q07A 3MJFA 4GQIA 1FLAA 3ECAA 4NV3A 4B0OA 3ROFA 4KB5A 3SFZA 3HPQA 2JB9A 3DS8A 1MRZA 3BD7A 4MLCA 1UK7A 3MELA 3ROGA 1RI4A 5IMSA 1KYTA 3UMRA 3LRTA 3HKBB 3VHLB 1J2TA 1Y8AA 3RVDA 4DA9A 2UUCB 3FZYA 1DAOA 1H8HD 1RABA 1A2OA 1Z75A 3E1SA 4DQKA 1OT5A 2OSVA 3RDPA 4JJIA 3WSTA 5L7TA 3AVWA 3FNIA 3OOHA 4H27A 5U4QA 1RRPA 2Q5EA 1XQ9A 4MWEA 4LY0A 3EHEA 3QLUA 4IGKA 1HT2E 5FO0A 1JAZA 3F3YA 4RXMA 1A82A 4DZRA 4DSZA 5L9AA 1HNZB 3DC7A 5EVJA 3IE2A 2PJUA 2GEKA 3GFSA 2XMDA 1THGA 2QW8A 2LR0A 2WB4A 4ZQHA 2PMKA 4WZBA 3WMRA 3H0EA 121PA 3VR0A 1ZD5A 3EXG1 2O8DA 3DAHA 2WEKA 3EFOA 4UEWA 2YWCA 1GZDA 1VI2A 2ACEA 5LQSA 1YOBA 3S1AA 1KRXA 1E6CA 1CUUA 3G9ZA 5I7SA 2PQMA 4WXHA 1KEKA 4FB4A 2P1ZA 4IEEA 1IWOA 3UATA 3DZBA 1V5GA 3DFIA 5EWJB 3UJ3X 4YK7A 1ZOOA 1M8JA 3DSRA 2Q2VA 4EYSA 4G0UA 2A9JA 3MTIA 4KAAA 1EPUA 2HU5A 1N6PA 2FLVA 2VLIA 3BUSA 2FPLA 4LOIA 3DBIA 4HUQA 1C9KA 3GMSA 3RJ9A 3F4LA 4DANA 1D6JA 2YN2A 3V1LA 2CWDA 4Q6WA 4QULA 3SC3A 3VDQA 5KMGB 2UUBB 3ZE7A 1MW9X 2BGIA 1KARA 3L4BA 3VNAA 4RE6A 1MHTA 1ZAKA 1L6IA 1P7PA 4JSRA 1BNCA 2W2TA 4FCVA 3W90A 4BGVA 4ZVMA 1ZCJA 2ZM6B 1P4AA 2QW0X 1Z2NX 2NO0A 2QZSA 2H2DA 3FSEA 4LUCA 4CV1A 1CZNA 4C7MA 3CNLA 4KSCA 5J1TB 2GARA 5KKNB 1VMAA 2F1RA 2ATCA 2I4LA 2Y1OA 2H29A 4JX9A 3VKHA 3D3KA 2FHSA 2JI9A 3D8BA 3FMOB 3QKRA 4HGZA 4UBOA 1HSOA 3O9ZA 1O54A 4FFBB 2YINC 1FFWA 1KH2A 1THZA 3F90A 5B6JA 4DNFA 3C41J 4IH9A 2G9ZA 2O3JA 2G71A 3B3AA 3X1ZA 3OEED 4O2BF 5HIKA 2GYUA 1X86B 3HMKA 3PFIA 5FWYB 5TMDA 1K75A 2PVCA 3RKSA 3WG9A 1FFXB 4OXKA 2I62A 1XWIA 1AZLA 5GP1A 1JQKA 1VGQA 2PN1A 2HEGA 3GLUA 4M86A 4QOIA 4E14A 4V24A 4YQZA 2YN0A 3Q3EA 3DOHA 1D8TA 1ISMA 2A0WA 3LFTA 2AZDA 5FOUA 5BN4A 5LB2A 5K3OA 5CA0A 2WJ3A 4WKOA 1UH5A 2BSQA 2QN3A 5BMVA 3Q12A 2HTEA 3OJFA 5K6TA 1IOVA 1VCIA 2VP5A 3O75A 4N76A 1HKHA 1UM8A 1YC5A 5FTLA 5ALUA 2VDJA 2ODQA 2R66A 1ADCA 3M5PA 3LUKA 4Q4AB 3SLGA 2YHIA 1VP3A 4JBGA 4PGHA 4C89A 5LQUA 2G1PA 3KQHA 3EVEA 4NRDA 3S2ZA 4HYTA 3F98A 4B7UA 4N48A 3NM6B 3ZHXA 1W88B 5ITVA 5F3WB 5JIBA 1ZVJA 1ZK2A 2GJKA 2HEIA 3CISA 5FFNA 5JVDB 3DKIA 2XEDA 1DC3A 3UV3A 4WT7A 4I46A 4MEAA 5JZ9A 5LZ9A 1JIXA 2ERXA 2MMCA 1NRXA 4OU5A 5F3DA 4NE7A 4LFAB 1ZK4A 3R6GA 2FPUA 1CD5A 3PPVA 2I1VB 1EHIA 2DMRA 3CZRA 2IWRA 1X7HA 5GJBA 3G68A 4RY8A 1I2CA 1Z0KA 3DFKA 1XNJA 5DXAA 4H1VA 4O2AF 4XA8A 4E22A 1CZRA 5F2EA 4HO1X 4Q1EA 1N2EA 3OZDA 4DXDA 4JASB 1H2RS 4B9AA 4OHOA 4Y9DA 3E1GA 3A0UA 5L7WA 1UKZA 2RJOA 3MWKA 3S3TA 4PZPA 1KY5A 4JLDA 3FSRA 3KSRA 1TYBE 4AI6A 1H0HA 3TZ6A 1JIKA 3M0EA 3QVWA 1XZQA 2CXOA 1QBKC 5EYPB 1W4CA 3R7LA 3PSHA 4HQRA 2RGDA 1K3TA 3STVA 2PMCA 2B36A 3MSCA 2DFDA 5CFLA 3KALA 4ZARA 4YRNA 1HNXB 2X14A 2QJRA 3TSWA 2E82A 2WHYA 2GFHA 2EIXA 1GRQA 3OFND 1N1DA 4H3SA 3H1EA 2WMNB 1J0DA 3WLAA 4I4TA 2IXFA 1NR1A 2VVTA 1XOIA 2V7PA 2FZWA 4V1CA 3Q8XB 3P2YA 3MOGA 4N12A 4EM6A 3HXMA 3NOVA 5ADUS 5LSAA 1XZMA 2GK7A 2X8BA 3N86A 4CM9A 1OYVA 1IEXA 2DBZA 4YRSA 1H5QA 4ESVA 1XTQA 3ZHZA 1HH4A 5LMCA 3OU6A 3KQNA 5J63A 1RZVA 4Y2VA 2PGDA 4CI0B 3DHVA 3JSXA 2C8KA 1NJ1A 1UPTA 1DADA 2PYZA 3D3QA 3HU5A 3R7AA 3U4DA 4B4UA 3Q98A 5AKHA 5F1KA 4RD0A 5TE9A 3WLPA 3WYNA 4UFPA 3B1YA 4YRDA 2GF0A 4G5GA 1XB2A 3HCBA 1CIJA 3AL2A 4FGJA 2NSLA 4FONA 1W4BA 4PG6A 1FQJA 2ZE6A 4BIMA 4JV5B 3C3KA 3LE8A 4Q01A 1NNSA 2WNSA 3RUIA 2H7XA 3M5DA 1NAIA 3L05A 4QYIA 1QPBA 1NASA 4GGOA 2BFDB 3KKZA 1PEDA 1J90A 1HYBA 1RZRD 1RXSA 4J43A 3T3IA 1ZM2A 1RM5A 2RHLA 3ABSB 3DEHA 1EMDA 3KE9A 3L0PA 4IRXA 1UOOA 4JJGA 4RZXA 3KV3O 3HCPA 1YE8A 1RVDA 4OBBA 5AKEA 3S99A 1UJNA 4REQA 4WOJA 3NRJA 1DCKA 2OV8A 4O4IB 3RS4A 3KUDA 4EF5A 5HK8A 5EJ2A 2C29D 4GGPA 3A1TA 3OG9A 4BAGA 1H4TA 2R7MA 2I2BA 1KY2A 3B8EA 1NUAA 3JR7A 5LZ5A 4RSMA 1YDHA 3N87A 1J24A 1K6JA 2FVYA 4L57A 1ZISA 4HYEA 4AMVA 3RFCA 1DDIA 2OLJA 4MEJA 5KTPA 2X4LA 3L1KA 4MYCA 3SFTA 3LWBA 1GRVA 4EHFA 4F2PA 4C87A 2X8AA 4UMEA 1ULZA 3SYMA 3STTA 2HRCA 4AQDA 5JPCA 4FS8A 4L6CA 4Y30A 4DA6A 1CYEA 1VMKA 2LDXA 3PI6A 3DP9A 4KMOA 3I05A 1ZCBA 4NK5A 5TVGA 3B6MA 1XA3A 3Q41A 4AO8A 4FE4A 1M2VA 4HFRA 3KDAA 1EH5A 2G0AA 4UAGA 5ESXA 5C5CA 2QVYX 1NBMA 3KHUA 1FNBA 3ZWWA 1RYMA 5K6AC 1ZN7A 3JZAA 3ZR4B 4FWTA 4KFSA 2JGNA 1NFFA 5TQ2B 3QPWA 3QX9A 3VHRA 3ESRA 4FWBA 5AOBA 1WMAA 2P9QA 3GDHA 4MQUA 4MCJA 1NVTA 3TUJC 3ZWYA 4KE6A 3MWDA 4K03A 2R86A 5F77A 5AVTA 1J49A 3FNEA 3M3DA 1L5SA 4MYRA 1OA0A 3FOZA 2Q9UA 2XUGA 3BTSA 1J99A 3KLNA 2OBFA 1EA5A 1Z7GA 2OO5C 3COVA 3EG9B 3AF4A 3UICA 1AO3A 1N36B 1R4MB 3EGXA 4IAOA 1NE2A 3RSFA 2CZQA 3A1FA 4GICA 4BMCA 5IVKA 1ILEA 3DFUA 3H9BA 4GXNA 1NN3A 1IZ0A 3AB8A 4HN9A 5DGDA 3RV4A 2HN9A 2WD8A 4W8OA 4BO6A 5IWCA 4NJEB 2J30A 2JIQA 3CUKA 1RHRA 5D3ZA 3F6SA 1SC6A 2WYHA 4KR9A 4G0VA 5TIIA 3Q7RA 2IOQA 3CF2A 4M8IA 4EL5A 2FRDC 2IPMA 1DAFA 1GUBA 2OG2A 1GGMA 4L9WA 4CM4B 1K6XA 1QCCA 3CW2A 3L1HA 3OM9A 2P62A 4X62B 2LP4Y 2JIDA 1UINA 1VCOA 4R3WA 4CIWA 2B4YA 1JBQA 1CJMA 2BEVB 2COUA 4JB3A 2ZG6A 3E7DA 3U0VA 2DZDA 1T8PA 3V4LA 4X64B 5KYNA 2FGJA 3VR5H 5IJXA 3K9FC 2E5FA 5IKMA 4FR5A 3VZRA 4PFKA 4BE4A 3R3UA 5AI0A 4H7KA 1DFHA 3LZCA 1RLIA 3EWNA 4MW5A 1QU2A 1U4NA 3KSUA 1RKVA 4P58A 4GZMA 1V9CA 2EV9A 4XVUA 3QUCA 4NFLA 3DF9A 2ZBDA 3KZKA 4XYGA 3R5HA 1OA1A 1XUOA 2X3FA 1XQVA 1YC2A 3SS8A 2JFHA 4BRZA 1YA6A 3GL9A 3RAEC 4TXNA 1HE2A 1P1JA 1Y9AA 1TYAE 5KWJA 2XRYA 2H8KA 4ECEA 3O74A 4G5XA 4BU0A 3CZCA 1V5WA 4E13A 4M1QA 2HIGA 2DPXA 2P2DA 2V0GA 3UAWA 1RNLA 4J4HA 1QH8B 2XX3A 3OFNA 4CIVA 1KVTA 3M6LA 5T67A 2Y2VA 2X2EA 3D8TA 3IHWA 1RYDA 4HQKA 4ZAYA 1HSZA 2WJAA 3R6WA 3WHPA 1C7FA 1YHYA 5KPDA 4BY9E 2C9ZA 1GG5A 5ADVA 1JHVA 5ELXA 3ENKA 5EWLA 1ZRMA 1JHQA 2PWPA 1Z3CA 1V5EA 2QJTA 3OSZA 5CNKA 4BMXA 2DCUA 3VO1A 5IEBA 2OO3A 2OKCA 4CQJA 5TARA 1RXWA 2ILTA 4CJXA 1W4LA 2VHVA 5JQGB 1JKJA 2PGAA 3C70A 2R60A 4BO4A 7MDHA 2OAEA 1E2KA 3JVDA 2X7HA 3OUZA 3PR2B 3RVKA 4DGQA 2F8SA 1Q2XA 1YZ3A 1SHKA 5LL6P 4D4JA 1CZHA 5IUJC 3HYSA 4Y3UA 2C2XA 3R7WB 3OTOB 4RIFA 3GMTA 1N6OA 4OMUA 3U4MA 3LECA 4JQYA 5I7EA 1GGVA 1Z35A 4PZEA 3NBXX 2JH3A 3DUFA 3FDXA 3GK3A 5AOAA 2F9MA 1QYRA 4M83A 4JBLA 3UWDA 4G8BA 5FFFA 2P6NA 3PQ7A 1YJ8A 4UVGA 3ZIAA 821PA 1P19A 4Z1OA 3MGBA 3PZBA 4NAUA 2RCNA 1XDZA 2QQ5A 3ZJYA 1UJCA 2GKGA 4GXQA 2E85A 1YR2A 4US1R 4E1BA 3S1AB 1PRYA 1Z06A 4I1VA 2X7XA 3TVTA 2C97A 5C35A 2J3EA 4DRXB 4D9CA 1IXZA 4GT1A 3TSAA 4FC6A 1A2BA 1F0KA 1J42A 3QQPA 4OQ4A 4WZBB 3CKMA 4Q18A 3KNZA 5THKA 4DR1B 1TA4A 3OCZA 3WB0A 3W6OA 3UBTA 3EUFA 4OSEA 4XYBA 2M2IA 4CT0A 1WABA 1BGXT 1ULBA 5KQSA 4I3FA 2PUVA 3QEMB 1BKYA 1EQ2A 5JDIC 2ERCA 3RVNA 1I5RA 2JIPA 4DLXA 2E21A 1CZLA 1QYXA 2WT4A 2IF0A 3KSZO 2OR3A 5AKXA 4QPJC 2X8JB 3O73A 4YRGA 4FR0A 4CTKA 2MTBA 4OGKA 4C3ZA 2ZXFA 1BS9A 4E15A 1ZC4A 3ONFA 3A37A 2I2CA 2Q4DA 3E9QA 1WW8A 1X15A 2LKCA 3G2HA 3NKLA 4NBTA 4Q7EA 4BNWA 2WV9A 5LJLA 4G4GA 5JMWA 5AHXA 4QJ3A 1RRFA 2QD1A 2ISCA 4KO3S 4BYMA 1K88A 4JFRA 1JFLA 3G2OA 3P20A 4O4LA 4OV6B 3LGSA 5E4JA 4I4TF 4KHPB 4LOAA 4TQGA 4EHAA 3ONWA 1UMBB 1X1SA 2NYVA 3B51X 1V7CA 2LZ0A 1SBCA 3I37X 5JXGA 3GT7A 5CH5A 4QLOA 5F4ZA 2ZJ8A 4HEA6 2W37A 1Z26A 2Q5HA 2YZNA 3LT2A 3Q11A 4M37A 3OCUA 1JE0A 2X41A 2Z3VA 1I7LA 4LVCA 4OHZA 2A30A 3KL2A 3QWBA 1QIIA 1ZGJA 3GLKA 1JZSA 4DYHA 1PGPA 4PLGA 3FNGA 3CBGA 2FXIA 4PTZA 2ZBQA 3C3WA 1NKVA 1MB9A 3THOA 4NZPA 1G9SA 2C58A 3H13A 4YJDA 5AI8A 5EJGA 3ZZUA 4ZZ1A 4NABA 2GZMA 1W19A 1W0KA 3RV3A 4IBOA 1GSHA 2NPFA 1YSCA 2GCPA 4Q00A 5LBUA 3WX0A 4BX3A 2LIVA 2WUEA 5HWSA 1DUSA 4CMEC 1RKBA 1QIFA 2WZBA 2NUPB 3A2LA 5ARCA 3IEXA 4KQ1A 4CM6A 3ZDCA 2ZJ0A 4BNMA 5DISB 2O7SA 5A5EA 5EJ8A 5K0TA 4YCJA 3MILA 4D9NA 1WEKA 2BTOA 5AIAA 2PL5A 1EWVA 2NACA 2P1DA 1DIRA 2CFSA 1X1CA 1JVSA 2AC4A 4GO1A 1C1YA 1A7JA 4IIJF 4ND5A 4B3DA 2VPQA 4LI0A 5FQNA 3EIUA 4QPPA 4BKMA 2AN9A 1SK8A 1X8XA 4NIMA 4Q1AA 3G7NA 1UFOA 3ZE2B 3LUAA 1CNFA 2W7TA 2OHVA 2XOKD 4RA9B 4AKGA 1P3DA 2YIJA 1OUMA 1Y1QA 1JTVA 2ZR0A 1U3FA 4HGNA 1XE3A 5KYWA 1NBHA 2R8YA 1T8RA 1FUEA 4JJZA 4ITVA 1QNFA 1OZAA 2OKGA 1DAPA 3AR8A 4W5NA 1NNEA 3DTVA 3DD5A 3AHCA 4U7FA 2EZTA 3WGJA 4G5OA 4BECA 3B3QA 3IDFA 5ES3A 4D56A 4HQOA 2GN6A 3EAQA 2GPNA 3D7NA 4ZHQA 4U2DA 4GXRA 1PDOA 3AB3A 4YNBA 5E3IA 1Q92A 4R7TA 1SCBA 3E9YA 2AUNA 2Q41A 4G86A 3HBMA 3G0DA 3T1TA 4XH9B 1XMVA 1ZK1A 1JTEA 3GJ6A 3I3OA 3JD0A 1I32A 4KE7A 2CE7A 3KKNA 3TIXB 4D7AA 1W7AA 1UPFA 1BAPA 1Q1GA 2RHGB 4HRXA 4RVHA 4TS3A 4TUYA 4LZOA 1T5HX 3RTGA 2Y1EA 4BCBA 1ZD8A 5P8WA 5ALXA 1HA3A 1V4BA 2GF2A 3OJEA 5ERXA 2OVFA 1XCBA 1JB1A 4YUWA 4UHJA 1KY3A 1NOIA 2AR0A 4D2IA 1YQQA 1DARA 4EYKA 5KNBA 2A9VA 3GJ0A 3CH6A 3IVXA 4X44A 3DHWC 4MPRA 2IDJA 3WGMA 1K4MA 4AP9A 3T5TA 1FTNA 5K7SA 2DFNA 2CFCA 1E4EA 3C97A 4K9MA 3S29A 3W34A 4B6RA 1BTOA 3AVXA 4NYIQ 1KEVA 1ZLXA 1XWFA 1N2BA 2B9VA 1ZEJA 2GJ4A 2J5BA 1W5BA 2Q3FA 4HY3A 4O2BB 2R00C 5DYGA 4D9FA 2I7TA 3IPYA 1USGA 4MW4A 1GCIA 2GZ3A 2F1IA 3L1JA 3N2GB 1ICEA 5CIWA 2JGMA 2I3ZA 4U5QA 5J9FA 4BV3A 4KRYA 3R7BA 3D54D 3EVNA 3KZ1E 3QVMA 4U7PB 1BDJA 3KLBA 5D7NA 4LDQA 3GW8A 4BN5A 4Q4JB 4GR9A 1Q15A 5JLJA 5HF9A 4G0YA 4ZQFA 4CM8B 1O87A 4J4TA 1K06A 3L84A 1TK9A 2CNWA 1DAKA 2Q6VA 2WT9A 3RFTA 3WQHA 5F9FA 3FYUC 1GNRA 5D7BA 4EGQA 1GKIA 4RC9A 5ENVA 3GIWA 1N78A 2O54A 4TMVA 4AU1A 5JS1A 1JLLA 1FXSA 1CJBA 1UJMA 7YASA 1ZDMA 5C81A 3NHPA 1PL6A 1C0EA 3HY3A 1BGVA 2H2WA 3EF3A 4FQ7A 3TLGB 5FPKA 3B1KA 1YIDA 2HH9A 4JQZA 4MTLA 4U9IS 4D26A 3QM1A 5PGMA 1K2VN 4R4JA 1LF5A 4RVUA 4QJ5A 4PNEA 2VBIA 2FU5C 2QJOA 4AZ0A 2V45A 2QAGA 2BFEB 3TZBA 2C4MA 5EUMA 3CUTA 5JCJA 2ODPA 1L4KA 5T7BA 3QNWA 5C1PA 3IYLW 1CUYA 2WK1A 1I2DA 3JQ6A 4QL3A 4UE2A 4KPEC 3TQSA 2CMKA 1FW8A 4G5FA 5FR2A 2MSLA 4DJJA 1ML4A 5EY5B 4DCPA 1Y98A 3TZHA 1L8OA 2H48A 3JALA 1VRCA 4JA0A 1PV2A 4LYGA 4RQUA 3KXKA 3D3JA 4I66A 1I3MA 2CLFB 2X0KA 4P22A 1XRNA 4CMGA 5JFTA 1C3JA 3AF5A 1CG6A 4EY5A 1M6EX 2FJUA 2I8CA 1PJAA 2ZUVA 5IYZA 1S1CA 1XLWA 1QB8A 2BBWA 3JSAA 3PFNA 4G24A 3WVNA 4CNBA 1GPMA 4RF2A 1PNVA 4NYMQ 1UOQA 1WNFA 3D0KA 1FJXA 1G4HA 3P52A 3V7YA 3GXBA 4UMDA 3HKCB 5HQ3A 5AVJA 2A9PA 1YQDA 3G6WA 4W8GA 4EMTA 3MMSA 1RYHA 1TECE 1ZYUA 3L2OB 4WZAB 1GG8A 3H18A 4BWYA 1A4UA 3GZ4A 4QBFA 3VZSA 1ULAA 4GMFA 1UQUA 2B7BA 1C4WA 2O3UA 1WHTA 3AR7A 3DV0A 3TR6A 1YVPA 2G3YA 4LJ9A 1JH9A 1CNMA 2C95A 3WYCA 5JATA 3DHEA 3DL2A 4NMWA 2VXYA 3B36A 2OO5A 4MB2A 1UDXA 2ODAA 3COZA 3FF4A 4IQGA 1S1MA 2O8VA 4O6VA 1ZNZA 2Q4TA 3PXUA 4G5YA 4C6SA 4OB7A 4QXPA 3W7VA 4TS1A 2ZE7A 4UATA 3SXPA 3NKFA 3K4QA 2M6LA 1FSPA 2IYVA 3HEMA 4TQUS 3RM3A 3TTXA 4DVGA 1MDBA 2Z98A 1SUAA 2H85A 5K0FA 2CDAA 4B3FX 4OKIA 1JDZA 4KQHA 4B47A 4EABA 3ZD6A 2FF5A 1M8PA 1J0XO 3MNFA 5JD6A 2PKWA 3T5GA 1T5BA 2XQFA 3E18A 2GBLA 4INAA 4X8OA 5EJ7A 2XTZA 5DGXA 5GONB 3RBAA 3FHLA 2FPGB 2IHVA 3LBNA 5LZ2A 2I87A 3RO7A 3D8UA 4YP9A 1C1XB 2HB6A 2HK7A 3AW9A 3MCWA 1K08A 4JYBA 4W63A 1CT9A 4GGMX 3J7AC 1RWVA 5BN3B 1DAMA 3CLSD 3VSBA 3ZTYA 2YDYA 1C8LA 2JZOA 3DWIA 3FWPA 1WEHA 1WXQA 1TYCA 5E6UB 2F9LA 4F96A 1I94B 2VK4A 1OR8A 3I34X 4FFDA 2GLXA 1MO3A 1N0HA 3P9ZA 2D0PB 1XU4A 2BY4A 2XGMA 5EHGA 3UJ9A 2A8YA 2DE0X 5AKLA 5A7GA 3TR0A 4MPTA 3WNDA 1YBMA 4W5OA 3EBPA 5FWXA 5B2EA 4GM0A 2CSXA 4POOA 4TKLA 1NW4A 4D3YA 1X13A 4KN8A 4MPJA 3PGMA 4XZ3A 1G8FA 4ND8B 1POWA 1XCJA 1XZAA 1YVRA 1KAQA 5JAIA 2EARA 2BZGA 3ZHVA 2OORA 4X0EA 3V4FA 4PYJA 4V1CI 3A0RB 1D1PA 3JY6A 2X6RA 4GSYA 3ZG6A 3M4XA 4WV3A 5IBQA 3ZE0B 2PRYA 2PS3A 3NC1C 3BFKA 2AL7A 2VNSA 3TJRA 4P5DA 3VR3A 2VJDA 4LW8A 3GP8A 2RK3A 1RZ3A 4J0IA 4NECA 3PXBA 2SCUA 5JAMA 4D4GA 1NLYA 4EP1A 4F3YA 1SXHA 4RGQA 3KT0A 1FFYA 1GPNA 3L93A 3WYGA 2NW6A 4E2FA