1CZKA

Comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
b'AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQNAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Comparisons of wild-type and mutant flavodoxins from Anacystis nidulans. Structural determinants of the redox potentials.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Electron transport
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1czkA00
1XYVA 4XDGA 4DIKA 4YALA 1FVXA 3U7IA 3TZBA 2A5LA 3KLBA 4C14A 1AZLA 3HA2A 4ZVLA 1XT6A 2OYSA 2B3DA 1F4PA 2V5VA 3K1YA 3QFCA 4H2DA 3GFSA 1CZOA 3G5MA 2RG1A 2V9CA 3NHPA 4C0XA 5LMCA 1YRHA 3NHKA 3NHWA 1CZUA 2Z9BA 5LVAA 4C76A 1FLNA 3NHSA 1AHNA 2D5IA 1J9EA 2Z9CA 1FX1A 2FVXA 1CZKA 4U7HA 3U7RA 4D02A 4ESEA 2V5UA 2Q62A 3TEMA 2MTBA 3N39C 3NHUA 2FCRA 1J9ZA 4PU0A 1CZLA 1QR2A 3D7NA 1OBOA 4ZVMA 1YCHA 1V4BA 1DXOA 1TLLA 3TE7A 2XODA 5A4KA 3W77A 4LAFA 5BUCA 3OX1A 4N65A 1B1CA 4LA4A 2AMJA 1JA1A 2WC1A 4QOJA 1X77A 2M6RA 4NULA 3OX2A 3QFRA 4PTZA 2F1OA 5EA2A 3FJOA 2QX8A 1OFVA 4N9QA 5LBTA 3O2NA 4C0WA 3HLYA 1VMEA 1DX9A 2HNAA 1AG9A 1NNI1 2W5UA 4LTDA 3NFRA 4HS4A 2ARKA 4Y9UA 6NULA 1KBQA 1KBOA 2M6SA 3F6RA 2R97A 2FLVA 5LJIA 2OHHA 1YCGA 2BMVA 1FLDA 1AMOA 2X2OA 1YCFA 4QOFA 3UXHA 1AKQA 4QODA 4FGLA 3L9XA 3S2YA 1D4AA 2QR2A 1AKWA 4LTMA 2GSWA 4ICIA 4BMPB 1AKUA 3ESXA 5NLLA 1H66A 4DY4A 2QMYA 2BZSA 5B3LA 5F51A 1T5BA 2FZ5A 1OBVA 3UXEA 1C7EA 4FGKA 2R96A 4CETA 2KQUA 2OHIA 4Y9RA 3NHJA 5F12A 1ZWKA 2HNBA 2Q9UA 3ESZA 4LTNA 1FUEA 1QHEA 1ZWLA 3KEGA 3NHYA 2N1MA 1AKVA 2QX9A 2KLBA 3B6JA 3OWHA 1C7FA 4YAFA 3NHFA 4QOEA 4YAWA 3GFRA 5ULLA 3RPEA 2QMZA 1YKGA 5LBUA 3KAPA 4OXXA 1GG5A 1FLVA 2FOXA 3O73A 5FUQA 3F90A 4J8PA 4HEQA 1CZRA 4M0CA 3OJWA 3OWXA 4DILA 2BPOA 2FZVA 1CZHA 4R81A 1YDGA 1BVYF 5JROA 1QBGA 3QE2A 2Z9DA 1CZNA 1I1OA 2HPVA 4Y7CA 3ESYA 2MWMA 3N3AC 4CF6A 4XDHA 4YAUA 5EMNA 3FNIA 4YQEA 2X2PA 4YAOA 1BU5A 1RLIA 1XI2A 4QOHA 3NHRA 3GFQA 3F6SA 5LLDA 3P0RA 4GR9A 3FW1A 2Z98A 1SG0A 2QX6A 4ZVKA 4GI5A 2QWXA 4FGJA 2XOEA 2FDXA 3W78A 3JSXA 2FAXA 3ZHOA 2BN4A 2QX4A 2FX2A 3R6WA 3N3BC 2BF4A 4GQIA 1T0IA 3SVLA 1SQSA 3EYWA 4NLLA 4ZVNA 4N82A 1FLAA 5FX2A 3GAMA 5FA6A 5B3KA 5F4BA 1ZX1A 2MT9A 5TGZA 3HR4A 1QRDA 5NULA 3NHLA 1WSBA 4F8YA 3EDOA 3ES9A 1RCFA 4QOGA 3L9WA 3B6MA 3B6KA 4S24A 1DXQA 3W79A 1WSWA 1RTTA 4QOIA 1J9GA 3OJXA 3NLLA 2OHJA 3F2VA 3FX2A 3LCMA 1D04A 3W7AA 1FTGA 3KAQA 1AKRA 5LJLA 1E5DA 3LT5A 4BMOB 1H69A 1RLJA 4U7FA 1YOBA 3B6IA 2MOKA 4U7GA 1JA0A 1AKTA 4H6PA 3OX3A 1TIKA 1XYYA 4PTYA 2ZKIA 3K20A 3OVMA 3FVWA 1D03A 1J8QA 5EAIA 4FX2A
chains in the Genus database with same CATH superfamily
3C5WP 1O4WA 2PAAA 1QWOA 3H5RA 5KTYA 3K4HA 3O95A 3ER9A 2Q50A 3O9ZA 2F64A 4RCZA 1KL7A 3C7CB 2DEUA 3VKHA 1S6YA 2VIIA 1FVXA 4PN7A 3EC7A 5AHWA 1B8NA 4IXNA 1UKVY 4PXYA 1ZJYA 1NBMA 3FKSD 5DYTA 1H05A 1BEZA 2I7CA 4G5RA 1SCUB 4O4LB 3VMMA 4AFNA 3LNTA 2IV7A 1EK5A 3TAHA 5BP7A 1TKAA 3HA2A 5DB4A 5E4FA 3MFYA 2PSDA 5EMLA 5HOQA 3C3BA 3EFOB 4PNHA 4AX8A 3U7GA 4ZOLA 1D7AA 3W34A 4L8YA 2G0AA 4M9UA 3RGGA 2F1HA 3TNLA 1X19A 5TMDA 1P1FA 1KERA 1YJCA 2ONZA 4P6VF 1MO2A 1T5TA 5D3MB 4KMOA 3ZCQA 5B2EA 4MV5A 4O4LF 3M33A 2VYVA 4R31A 2M6LA 2E5LB 1T9GS 1V71A 2V9CA 3NBAA 3SDZA 3K1TA 1C80A 1TA0A 4JFAA 1ACLA 5EE0A 1M1UA 1TX4B 3UWMA 3I61A 1GUYA 4RVGA 4Z8XA 1U3DA 2BGGA 1FLNA 2YVKA 1JG2A 1U9YA 4KX3A 4UTRA 1XD8A 2QDXA 2ZSHA 4MUAA 4BTEA 2PV0A 1MGPA 1JVNA 4XJTA 3V8NA 1VBNA 1ZIPA 3CO5A 1T1GA 4GNRA 1H6AA 1AS3A 1JQEA 3FDIA 4RFVA 3O8CA 2G8NA 1I10A 4R8LA 4DBZA 1RXWA 3PC8C 4AP9A 3UYLA 2Z9CA 2I3DA 3AUUA 4ZVSA 3ZU6A 4D45A 3EVDA 5CJ2A 4D0GA 2QN2A 3C8ZA 5HKLA 1E1RD 2IDJA 5J2TA 5FOXA 5KVSA 4KLCA 1G6OA 1RT9A 2AQ8A 4MA4A 1HDCA 5ICGA 4D9FA 3MUOA 5JSZA 2ZB7A 5JRZA 1TUBA 3LBAA 3PKIA 4K28A 3UK2A 2X77A 3DHEA 3PUXA 1UDCA 1LSUA 2AFIE 2FG6C 3CF6R 2XH8A 3DD5A 4P5EA 4DMHA 4L8GA 2WAAA 1VCOA 1YJAA 2NO7A 2R60A 1S2IA 1CZLA 1QR2A 3Q2IA 3MELA 4RDXA 3L7AA 3N5CA 2G76A 1JL3A 4ED9A 3GD5A 4H7KA 5ELXA 1NBWB 4B2IA 2RB5A 3P1JA 3MWKA 4F3NA 1M6VB 1UFQA 1NMXA 4JCOA 4D0SA 5K0EA 1JFTA 4FYPA 5DX8A 1GA6A 1T9DA 3L40A 2Z30A 3MA0A 2FB9A 1Z9BA 2GETA 2MR6A 1GVHA 1GAQA 3LRTA 2Z04A 3A8TA 1DO2A 4JYZA 1RBYA 2YV2A 3WRWA 2BFCA 1FOEB 4QXRA 4XSVA 1QQTA 2P6NA 1AHIA 1KRHA 4BCCA 4N65A 5LP6A 2PHZA 3T1HB 2Q28A 3EVEA 3BEOA 3LPNA 3BYZA 4JI8B 2HJWA 2PLFA 1JTFA 2JJYA 5C1OA 4R2IA 3WGOA 4MIEA 4RY0A 2HL6A 3DB2A 3HXLA 4H7EA 2KBFA 2YJNA 3U62A 1GZ3A 3WKAA 2PMDA 4QPCA 3ZWVA 3SHVA 1VKOA 1DIOB 3AF0A 3EVFA 3OY2A 5E4JA 2H1OA 5GONA 3DOEA 4TROA 2I1VB 5L6LB 3N8NA 4HNTA 2I7VA 1MLDA 2CCGA 1J2JA 4YJ2A 3I3SR 1UBTS 4BEBA 1E1LA 2QXUA 4KDFA 4YRAA 5JMTA 3AUFA 3CWCA 4BP1A 5CNJA 2ZJYA 4OG2A 2FWRA 5EGNA 4UHJA 3JTMA 3CVWA 1WHSA 3KL4A 2VVTA 1RHKA 4PSCA 1Z3CA 3IEKA 1XC7A 1M72A 4OXKA 3OPQA 3OZFA 4M2LA 4IEFB 3V7YA 3BK2A 4CKBA 2OL4A 1I51A 3Q10A 3V4LA 1UPFA 2ZRIA 3KC2A 5I7FA 2PFSA 2ZIGA 1ZQ1A 1Y4SA 2ECQA 3UMSA 4ZJUA 4ZOLB 1OH7A 4MNTA 4QM6A 1EGHA 3BZBA 2VO1A 5KYNA 4QTZA 2PX4A 3D0OA 3DE3X 3DW1X 3D3WA 3E70C 2PUAA 2Q0XA 1FPQA 4EY6A 2G1PA 2HU7A 4IGKA 2WJ3A 3I6MA 1KIMA 1GZ4A 2CMKA 3K0EA 4RD0A 2FMKA 3HM2A 3HO6A 4DQUA 1KMNA 2R97A 1PR5A 2G63A 4WCFA 2VJKA 4XB2A 1Y81A 2ZVQX 3L5KA 4ZOLF 3WLJA 4YRFA 1OMOA 3HPRA 5DYWA 2BMVA 3QBDA 2HB6A 4D56A 1R66A 2X2OA 1K98A 4KWIA 2EQAA 2QRPA 2Q2NA 2GLTA 4LXIA 1ODFA 1HLDA 2V5AA 4IW3B 1DKNA 1P1HA 4MP3A 4IIEA 3WYAA 3DEYX 1VJ5A 1QO9A 3BFPA 3LL7A 2YIJA 4G89A 4MWOA 4BBPA 5I7UA 5JANA 5J2TB 4DCCA 2CHGA 1XZDA 3QKTA 5A05A 3CJQA 1DADA 3PNQA 5JSZB 2QMUA 2WF6A 2RBKA 3S1LA 3T1QA 4B33A 4G8CA 5EKSA 3B9PA 1H66A 2HF9A 1DCFA 4P22A 3KB6A 1YR6A 1CRQA 2G36A 1J0BA 2WRZA 4FGUA 3QELB 3VH2A 4CM4B 2AIRA 3JYOA 1QK5A 4XWTA 3F97A 5IDYA 1A2OA 5J2TF 3W9BA 2BFBA 2PCJA 4XVCA 1T5BA 4ENRA 2NSDA 4DLSA 3IOCA 3VNVA 2JHFA 1TZBA 3IV9A 1BMFA 1Y4AE 3ZJVA 1VHLA 4EFDA 2AE2A 4PVDA 2IDKA 3HFRA 4MGYR 4C22A 4Z51A 3TBFA 3K94A 2FEPA 5AHXA 4UOQA 3SX0A 2NTVA 5HCIA 4RD4A 5LP6B 1EFPB 2W83A 1ZGBA 3EEFA 2HSGA 3D64A 1AXGA 1DEOA 3IDZA 1HMPA 1NRJB 3OE5A 5H1YA 5AJWA 4YAJA 4RHEA 1K7YA 4GU5A 1CQPA 5EY5B 5TR9A 3BK7A 5EIOA 1YH3A 4RS4A 3ZQJA 4MYDA 3LBHA 4YJ3A 2GPWA 3WGZA 3QLUC 3GVXA 4PZLA 3O75A 5LP6F 1EHCA 4N48A 1KO8A 3HL4A 1CUHA 1WQ1R 2B5VA 3GRKA 1TCVA 1N6KA 2YMMA 3MSXA 3OCUA 1NI4A 3V80A 3VZBA 2O2CA 2PJUA 1G5FA 3L4EA 3LY5A 4YJ2B 4DUGA 1ADYA 4C7KA 4ILKA 2RGUA 2ZOSA 3U13A 4TXMA 1TI7A 3UWSA 1Z4OA 3JRNA 2Z43A 4OHYA 1A5TA 3QKUA 5IBRA 4QDZA 1WHSB 4R3WA 3BE5A 3AF5A 2XYHA 4C6HA 2DSTA 4Z4EA 3RTGA 2K4MA 2XKKA 3H2BA 4NDNE 1OKKD 4TMVA 1DBIA 2GCIA 5GONF 3GRFA 1D0SA 1JA9A 4QOEA 3HK2A 3NIWA 1P9WA 4G5SA 1YR3A 2J3JA 4F2GA 1WKVA 1Y9AA 2H07A 4YJ2F 4LV5B 3GEDA 4CKBB 3GFRA 1X9GA 1NC1A 3GIDA 4ZVRA 3D8HA 1VI5A 1MB4A 1ZH4A 3ROPA 2B21A 3O1JC 3CRMA 4E1AA 1U28C 1D1TA 1I3MA 4RWZA 1HOTA 1BW9B 1KH3A 3MC1A 3D3WB 5B37A 3SI7A 4GDFA 5H83A 1VECA 5B6IA 1JHOA 3QF7A 2ZJOA 1I7DA 1IHPA 3CX8A 4LGMA 4EPTA 4Z53A 2MSLA 1I24A 1UBRS 1HDIA 4Z1OA 5BPFA 2GK4A 3JXEA 1EZZA 3BHMA 2NMVA 4R5HA 3ZJ4A 4P4SA 1EFVA 4FONA 2GPSA 1MJ5A 5BQOA 1XZHA 3FPEA 2IZ5A 1QV7A 1T8TA 1LK5A 3JQ9A 4OQ4A 4JUBA 1AZSC 4LVOA 2G25A 1JFRA 3AERB 4CL3A 4D8VA 4ZQHA 4JBLA 2V7VA 4BB6A 3O47A 3AMVA 3CRW1 3PLRA 1VXRA 4FHEA 4HDQB 2BTOA 4PXSA 1Q16A 4QYXA 1QLJA 1MORA 4YTEA 3VDMA 4GKAA 4GKKB 1C7IA 4M1TA 2IYRA 4J0KA 4R2XA 2RK4A 1YK0A 4QHYA 821PA 1XP8A 3TNYA 1YDGA 4EY4A 3VU9A 1WE2A 2V45A 3I2JA 4A27A 3B9QA 3JTEA 3CS3A 3VSDA 3AR5A 1G64A 2PAFA 5DBGA 4EW1A 4JI4B 4DV1B 1I1OA 2D2IA 1FF9A 4PGHA 5ALGA 2BFBB 2C0QA 2UUOA 4JC0A 1ZHHA 4UNPA 1SRQA 3RSHA 5LQAA 4RQUA 1G2PA 1RLMA 4DCUA 2MWMA 3KSMA 1K8QA 4GUDA 4P36A 4TN5A 4ARZA 2BL4A 3CY6A 2OOKA 4LQLA 3WNDA 1IWBB 5FWDA 4EHNA 5I7VA 2V7PA 1AA6A 1IN4A 4L02A 5AJHA 3T5DA 2Q3CA 2D6FA 3EWIA 3K9CA 5KQSA 3HDYA 4QJBA 2IFTA 4XEUA 3MS2A 2QAIA 1WP4A 4UE3S 5CCBA 4PZYA 3ZWMA 3GBSA 2WMDA 4L9RA 4H3KB 5BWCA 1VE3A 5EERA 2X2PA 1OJ7A 3ILVA 1JH9A 2WBLC 2ZJBA 1YQEA 2RH9B 1ZMRA 1YBAA 3SP1A 3TLYA 5AI8A 4WK4B 1G3QA 3DZCA 3F9IA 3OZ7A 2JIZD 3FPBA 5FUMA 1KE2A 1W5SA 4KR9A 1HNXB 1EG2A 2BWJA 2WJAA 1U8AA 1T1SA 4TZKA 4YJ3B 4ZOCA 5K0LA 3BWEA 2IH4A 5EPUA 3KEOA 3PDUA 5CTJA 2M2IA 2B7LA 3KT3A 4WBXC 1EFKA 4L0CA 1YJXA 2YZNA 3NI2A 4AN4A 5SYAA 3CYFA 3IO5A 3K0FA 1A76A 3OQIB 2EW2A 1J25A 1I32A 4B81A 2QVLA 3FRIA 5B4VA 1T6XA 2X6TA 1B93A 5JPCA 3QLTA 4YJ3F 4LZLA 3EBOA 3G9TA 2NTYC 2Q2QA 3G1TA 4JD5A 4NYIR 1AK1A 3RUPA 4C0QC 1OC4A 2Q3MA 4NMXB 4GM4A 4O4JB 5EVJA 1AS2A 3DV9A 4N6OA 2P9GA 1XZGA 4QVIA 4QUIA 5CK5A 4EPWA 5K7SA 4HWPA 3WGNA 4BKRA 4B9EA 3Q3HA 3TW8A 3JPYA 4I9HA 3LRPA 1ZA1A 2WFAA 4P81A 5DLDA 5ALRA 1SC9A 1XRMA 2RAUA 1ZOSA 1HG1A 1MABA 2XF2A 3CKYA 2DBVO 3HB0A 3LLMA 2GN2A 2JVKA 4GHWA 4GZ3A 1RRGA 3WLHA 1MZPA 2XUGA 3U4HA 1RXUA 3D02A 3GVPA 2EGUA 3EEQA 4ZU1X 1H5UA 1XHLA 4IQFA 5FX2A 2OO7A 1QCDA 1EFVB 4Q48A 1XCGB 2X2EA 3L8FA 4LYFA 4DMLA 4E5UA 2OB1A 1EEXB 1JKIA 4L7VA 1Q7GA 4JXZA 3CINA 2EATA 2AVNA 4NY1A 3W8EA 4FOOA 1A88A 2Q4DA 2A78A 4H0FA 1P7VA 3UAXA 3OU2A 1QRDA 2X0RA 5GGYA 1O4VA 1AK9A 3K73O 3U4AA 1UC5B 2C5LA 4LMPA 4OYLA 4Q7LA 4RVSA 1L3IA 3N05A 1G3IA 2O6HA 4J1SA 1KU6A 2FUG6 4X54A 3T6KA 4D8WA 1LV7A 2WIGA 4B5KA 1IAQA 5FFFA 2DHDA 2WHXA 2JFVA 3FDXA 3OD5A 2HRRA 2W4IA 5BMOA 2I4LA 4J2OA 4ZODA 1II9A 3X1KA 5EZQA 5AVJA 2AJTA 4D2IA 4PRLA 1RYZA 4LVUA 4NHEA 5TT0A 3UN1A 3WWEA 1OC2A 3FOFC 1OZAA 3MXOA 1G9SA 1NP6A 5T4FA 1Q84A 3JWIA 4MS4A 2XZOA 1RBQA 1IC6A 3AONB 3S1AA 3ABRB 4P3OA 3ZLUA 1QCZA 1TAQA 2VPQA 2QORA 2YFQA 4GP6A 4IFEA 1PBNA 4KJZA 3IIMA 3V34A 1K5GA 5EUQB 1KFBB 4HJRA 4ARZB 3H9QA 4YI5A 2A1TS 4KCGA 4P31A 3K2EA 5DSXA 2VYNA 2YR0A 3EARA 1RJGA 3EMDA 3LT5A 4LNUA 4RAOA 5HGXA 1G8PA 3TKYA 5T4BA 3RTEA 2IS2A 4F4HA 4CMGA 4KSBA 3FOWA 4AY5A 4N5IX 3X1DA 2QTGA 1G0NA 4AB1A 1VI6A 2V9PA 2H06A 4JJKA 2EFYA 5CJPA 4OLAA 3OUTA 1CUJA 1G8YA 3K72B 3GCZA 5DNCA 3RJ5A 3ZHTA 4DA0A 3HYSA 2NTNA 2WTNA 5E7QA 3H5NA 2WZQA 4OHRA 4ZZ2A 3S5JA 4C4OA 1N1GA 3NKVA 1Y1RA 4JLKA 1R5BA 1T2NA 3LY8A 4RVDA 4BFZA 4YYZA 2OA0A 3CSDA 1WNFA 1H2EA 2ZRBA 3ORFA 4Q4HB 4ERNA 2YWBA 4S1NA 3SLKA 4F84A 3QKWA 4JIMA 4CQMA 1F2DA 3KTFA 4R98A 1IH8A 3USES 1RPAA 4LEIA 2HMTA 3RVSA 2F1JA 3W5UA 4DRYA 1G3RA 1YBMA 4MPPA 2O3JA 1IZZA 4DIKA 5IM4A 3COVA 1UKEA 1W73A 2H63A 3O8OA 4YASA 2WLTA 5C51B 2P6RA 2Y1FA 1OUMA 4W8HA 3QU5A 5ARDA 1FMCA 3WGTA 5D3ZA 2EKBA 1ILWA 1U5BA 2VNJA 4XQ9A 1J90A 2J7PD 4FJ2A 2HRCA 2ZI5A 3ADPA 3CLSD 3E1GA 3A2NA 2DWQA 4MMXB 3TW8B 3VDNB 2R8PA 4CM8A 2R00A 4X45A 1UJ6A 1Z8DA 1Q11A 1IB6A 4NH4A 1AURA 4A3SA 4V3BA 1MABB 1AMNA 1TYZA 1N7HA 2B4TO 5I6DA 4R8MA 4RABA 1RWPA 4EMSA 3GP3A 2Q7DA 3SPXA 4F93B 1OYYA 2DSNA 4K8RB 2I4TA 1PCXA 2YDXA 1M34E 4OOFA 1ETHA 4V02A 4YCSA 2ZUUA 3M4ZA 4BJ6A 5CDTA 4LC0A 3LTEA 5K6TA 3NYIA 4IIDA 2PZLA 5BSVA 3PFIA 5DTQA 1JALA 1EM6A 2Q1SA 1E20A 2ZRLA 5LCXA 5DM70 2R5FA 3MJ4A 4GBJA 3HUEA 3R7LA 4B5LA 4Q18A 3HE3A 4E5KA 2XB8A 3DXFA 1J6UA 2YN2A 4E13A 1Z7YA 4NYJR 5FNVA 2C59A 3D54D 1LA2A 4EB3A 3GLGE 1MJGM 3FUUA 3OQOA 3FWNA 1Z75A 3OA2A 4HYTA 2R1UA 4XWAA 2ZM6B 4CNQA 4MP6A 1L7AA 3PEUA 3R5KA 4NE9A 4PHCA 1CJSA 2J85A 3NHAA 4UHEA 5I45A 5LIRA 2AZXA 2KWIA 5IKEA 2H00A 3E8SA 2RGYA 1GSHA 1N6HA 2C7VA 4MV1A 1LF5A 5MF6A 3H87A 1EP2B 1PUJA 1TMOA 2N1BA 3GNSA 3HBJA 3QEOA 5KHOC 1R15A 1Q83A 3NHUA 4A5SA 5CGQB 2VC2B 3WOHA 4MS4B 3AM4A 4RGQA 2J3HA 4PV7A 1G8FA 3FPCA 4HNUA 3HA5A 4CL2A 2GN9A 4KLNA 4TZ6A 1V9SA 3DS8A 4JLBA 4GE0A 4G2TA 4EKEA 1JIIA 1ZH6A 1E3SA 1T36B 4H4EA 2QYSA 3S29A 3T5MA 5GAJA 2Q0HA 2SKDA 1GPUA 4DCGA 1JIKA 3AFMA 4EX7A 1U2TA 4AQYB 5L4SA 1DAOA 3UJNA 2WMYA 5HUHA 1XZQA 2DPMA 2WM3A 1CJKC 1COZA 4ID9A 4GLFA 1P3DA 3E3AA 4MYUA 3DVQX 1PO7A 1J0AA 2VK2A 4WLVA 2AMJA 2RONA 4WDQA 1I4OA 4U6NA 2GCNA 5AXDA 2Q3EA 1WOMA 2Y9MB 3KK0A 3QITA 1XAGA 1QH0A 1MAHA 3F0TA 4YECA 2FW6A 5FBZA 1NM5A 3H2ZA 3HABA 3JU3A 2HX1A 1SXJA 4L9AA 1IY0A 2NZJA 3H9JA 3BSYA 3PGLA 4YRTA 5AKXA 3RC3A 3VR5H 4BQIA 4ZCPA 3KUXA 1QZTA 3S8YA 2RAPA 3WLNA 3GFBA 2Q2OA 3OPYA 1OASA 3D3NA 1MHPA 1XPJA 2D8AA 3IOYA 1X6VA 2NPOA 5JY6A 4ALKA 3IKVA 1WEHA 2PWPA 3C45A 3EVTA 3OFNA 1KGDA 1S1CA 3QA3E 1MKYA 1V7CA 4QXAA 4KGVA 4CKZA 2F1KA 1N2ZA 5FQOA 4A82A 5JAZA 1QM5A 3BT7A 2JBAB 1UKYA 4R16A 5SICE 1S2MA 3T9DA 3SC4A 3C3JA 4DV2B 1A95A 3KDPA 5IZCC 3ZV4A 2HPZA 3H16A 4IDDA 4LJ6A 1LK0A 1HA3A 1V45E 3IESA 3PTZA 4KIGA 4UZSA 4QNNA 1GNPA 5CRIA 4IG9A 5EWLA 1TZMA 4AZSA 3B2NA 3BWDD 3MHPA 1G4UR 3ML1A 3GRPA 2JZCA 1U5BB 1IHUA 2IU3A 5CLIA 1VFNA 4ZTBA 3RU7A 1JZSA 4EHBA 4RHUA 4CM8B 1B6RA 2CL6X 2VXCA 3S99A 3CNBA 3OZIA 4EH1A 8LDHA 5B7QA 2Y1EA 5IM4F 2JFQA 2D1SA 4TYMA 3BMNA 1XQYA 2H17A 3RHFA 1B8UA 1U99A 4GZ6A 3WSTA 1MAWA 2G5PA 5ARCA 3UENA 2VYCA 4ALJA 5AM2A 1SXQA 4D26A 1W19A 3A9WA 4L78A 2NXEA 2R68A 3I0ZA 1KBOA 4H6XA 3TOXA 3HCAA 4CVNA 4OA8A 4KAFA 5DGIA 5AVUA 2D7DA 3P9SA 2D5BA 1PK9A 2UDPA 2ZPTX 3OMXA 3TLAA 2ZJ5A 1L8QA 3E58A 4TXNA 3SR4A 1BS1A 2P5YA 2PO7A 3DEZA 3H84A 4FGWA 4FSXA 3SX4A 1AXRA 2IU0A 5JTTA 4C30A 1E9DA 2GBGA 3F6PA 2QXYA 2D1YA 2A5DA 2CXXA 2ZCVA 1OU4A 2QYTA 3KJHA 2AEJA 3HMQA 2OCAA 1YQGA 4YRPA 1ZR4A 3AHEA 4QO7A 3C39A 2FWIA 1R8JA 4NX2A 3FLAA 4B4UA 2YNMA 4WADA 2FOIA 1P2GA 3IXLA 2I62A 2QR2A 4DCMA 3HRIA 4XLTA 4KFRA 1TDJA 5TIIA 4TQGA 4IHKA 2AI3A 2DFNA 3DL7A 1ZD1A 2XV1A 4BP3A 5EYPB 3GLRA 4ZA2A 4O2BA 4FSDA 4HI0E 1U7WA 2QZJA 3PU6A 5FNVF 3PC2A 2DQSA 3F1LA 1IQRA 1QTNA 1ULBA 1T6NA 4DY4A 2RCYA 4YMWA 3EY4A 2Q3LA 4G67A 5HCUA 3WMFA 5I7RA 1YZGA 3CRZA 4DLXA 1E3MA 1UR5A 1CT9A 1YHZA 1IZ0A 4MB2A 3KB2A 4NATA 2B99A 2CK3D 2EW8A 2JJ2A 3CEPB 3FETA 3IP3A 4PPQA 3LZDA 2Q2WA 1VRVA 3IOEA 2N46A 4R9VA 1TKCA 1NW9B 1XZAA 2AUTA 2WNIA 3CNOA 4KE6A 4UULA 2AS0A 1ML4A 2Z1MA 1P3JA 3DH0A 3KQSA 4XDZA 3OHSX 2UU9B 3UMMA 3R3ZA 1B76A 1PLLA 2A67A 2WPDA 4LYHA 1NNUA 3FWHA 5JFOA 2E55A 1YZQA 1P60A 4A73A 4YRZA 2XMDA 5DDIP 1K5DA 3BCHA 5ARBA 2QDKA 4DWOA 3QXCA 1SXJB 2XAAA 3K3PA 1B3BA 1YZNA 3LCRA 3ESZA 2XIJA 1P2UA 3IRVA 3PE6A 4Y2SA 5EPEA 1SG9A 1SCAA 2NUTB 3FTQA 1XN4A 3I9JA 3KZOA 1U6IA 1XVUA 3LDFA 3OPYB 4BB0A 4DAEA 1GZDA 3ZIAD 2OORC 4G84A 1XQXA 3GQBA 4HYYA 2Y2VA 4LTNA 3HP7A 3I9MA 2FUKA 2HHJA 1VHJA 4YUZA 1RE1A 3E9RA 4PGMA 4RLFA 3WZMA 1F0KA 3AESA 3V1KA 3RARA 4BMCA 2X3UA 2ZUCA 5B5SA 3WLLA 1B16A 4IUYA 3HZOA 1ZSNA 2JZOA 1EP3B 2VSFA 3N9IA 3VI3B 4EB0A 2YZKA 1WQ4A 1YONA 4JI5B 3OZEA 1HG0A 3ZD9A 1QG2A 4PYLA 1G3MA 2FWBA 1CHDA 2O50A 2BP7A 1ZXXA 2JASA 4LJAA 2VJCA 2VZEA 3M6MD 4TTPA 3KFVA 4DL9A 1HE2A 5IJ0A 2PT5A 2XWBF 3DPIA 3L4JA 4DNPA 2L19A 3BMNB 1QGOA 4R7GA 4C03A 1CJUC 2LV8A 3WZLA 2H92A 1P6XA 4DBLC 3X2EA 3RYFA 4WOBA 3W5CA 5CD1A 2XY4A 5KTSA 2H65A 3AYXB 3F3YA 3UMRA 4WUTA 4DT1A 4KXXA 3O73A 1VL1A 2P4UA 1P5RA 3M70A 4NEQA 5DI3B 4MRRA 4BNZA 2JGLA 4AG5A 1P3Y1 1Q77A 1BFKA 3PD7A 3PFBA 5KHAA 1K4KA 4QSMA 3ELUA 4DQDA 4D92A 5B55A 5FOVA 4CGZA 2Q1WA 4WKGA 2AG5A 4ZQCB 3DF7A 4A0HA 1ZLYA 4B44A 3WZ2A 5DGCA 5CPBA 1T8RA 1VJTA 4DMKA 4H16A 4UNQA 2GMWA 4DS3A 4FZ3A 5FR1A 3SJCA 1P1JA 5EIWA 3AY0A 3S2FA 1OBHA 3ZLTA 3EZFA 2F55A 1B2LA 3QFHA 1UJBA 2JLCA 1J8YF 5LZ8A 2GD6A 3KT8A 4RD2A 5CFQA 1K1EA 2WQZA 3U4CA 5EMHA 1IHXA 3ZDXB 4L4UA 3QVGA 2R0QC 1QPBA 4FIZA 2CXSA 4UHFA 1IJFA 3GRAA 3Q7PA 3LYUA 2H5JA 3P9YA 4FWTA 4ZAWA 5K0GA 1FU4A 1KQGA 4RY8A 1KDOA 3A1FA 3O90A 5AHOA 4CIXA 2YWHA 1ISIA 5LMUB 1N5JA 4RKQA 3CLUC 4LRYA 4F9FA 2A9OA 2A5JA 4C6RA 4I4LA 4O2BF 1CV2A 2K7FA 2VQEB 1TJ4A 2P0AA 2ZJAA 4WTOA 2V6JA 1E4VA 4FMDB 2CJYA 5ERXA 5H5JA 3JVUA 3LQFA 1P72A 1NNLA 4FE7A 4ND4A 3RFTA 1IXYA 4ZAGA 4JVMA 5JAUA 3FSGA 4HLUA 5BW6B 4H6WA 3GVCA 5ED0A 4C6TA 4JJFA 4UXIA 2VRWA 3NDPA 5KOYA 5I7WA 1WDWB 2J3LA 2X22A 2R4QA 1BU5A 3MOSA 3PQFA 4FGZA 1XQWA 5BYBA 4ER5A 5IEJA 4ZAFA 4B3MB 1KO7A 4C3VA 2P9JA 4FMDF 3U7EB 2W2MA 3BBLA 2DFVA 2IA5A 3EH1A 3W1WA 2WF9A 5IX8A 2ZS8A 3ZTTA 1CK4A 1SKUA 1TQ6A 3HVJA 2P35A 1PGNA 1X74A 4N18A 5TMBA 3NBZC 1RP7A 2V4UA 4JA2A 4QGFA 4D3FA 2A2ZA 2F1RA 3BD8A 2QZ4A 1O8BA 2QLFA 3GQBB 4IHJB 5JNLA 4P84A 1L0BA 1SOUA 3VJRA 2ZE7A 2ZBGA 4J2HA 1V6SA 4PGAA 3PPIA 3AESB 1C9MA 5KSZA 5AK5A 2QX6A 2QE7A 3DWGA 3IBYA 4LWQA 3X43A 4ZJPA 4HVCA 4EJSA 2B1JA 1QVAA 1ZK3A 2HWYA 1QU3A 2QWXA 3KSZO 2ID9A 3I01A 4MJXA 1ECCA 1IWPB 4IHJF 3D3KA 4Q1FA 3ELBA 5AVKA 2MU1A 4G0ZA 4P92A 2J7KA 3BSSA 4PC6A 1Z8FA 4TRJA 3OIGA 1Z6AA 1FYWA 4HN2A 4OTZA 3K8YA 4WEOA 2BEJA 2UVDA 1O95A 2RHJA 1J0XO 5IJ0B 1DC8A 4WNAB 4BFUA 3OJFA 5DCYA 3LC1O 1JHAA 3T3EA 3ET5A 4UZFA 1QFSA 3N0VA 3RYFB 3SAJA 3VTAA 4P4TA 4DLRA 1D09A 1JMYA 3IYLW 1QF9A 2P2LA 1XU9A 4U2CA 3BL6A 5TXGA 1GRQA 4GW3A 5JZ9A 2Y6VA 4L4YA 1NU6A 1PYDA 4FZ5A 4YJHA 5LKAA 1ZOOA 2GPTA 2OXFA 4AJPA 5BR1A 3T1YB 4W5NA 2FW1A 4GKVA 1HFWA 1K3UB 3PDHA 4KRXA 4HB4A 5FBLB 4UEKA 3PHGA 3FKQA 3ZOZA 1JBEA 2D5LA 3Q7SA 4GDMA 1LQ2A 5JS7A 4NTZA 1L6RA 2Z56A 3DTTA 3OZBA 1YNOA 5NULA 4F2HA 2UVQA 1PR9A 1NP7A 3C1OA 1DAPA 2TSYB 3FKSA 5TV2A 3RSOA 1HE5A 3FY4A 1OH6A 1GOTA 2W6IA 3AHCA 1S0UA 2Y0BA 4ASUD 4M0DA 4BVGA 3AY3A 3A3KA 3ZHRA 1MN6A 4S24A 3UCXA 3VO8A 5JSKA 4YI3A 5BR8B 3SZRA 1CB0A 2NU7A 2XVMA 3I6IA 3BMOA 3EEYA 4M9ZA 4R2LA 3SU8A 1QRUA 3QVGB 1FS4A 2EF1A 3QLVA 1RTTA 1XPUA 3VUEA 4OFWA 4CL0A 4E5SA 4MCAA 2AYYA 4BAUA 4AUMA 4B3CA 5CDYA 3OE4A 3WNQA 3IBFA 1U3FA 3MAAC 4MGEA 2YY7A 1D04A 1E0JA 3OP1A 1PW5A 2ZTUA 3G59A 3HNRA 1GPLA 3C4VA 1XO1A 3KAQA 4AZVA 2DTEA 5KNDA 4MAMA 1RAEA 4XM2A 3DR5A 3RIXA 3F4KA 4RPGA 5K8LA 1VLVA 3A6JA 2HHCA 3NR2A 2XBMA 4OF4A 2GEFA 3OM8A 2HXYA 4BZQA 3Q9LA 1Q44A 1BTOA 1XZLA 3QLJA 1JYFA 3ED1A 3B1ZA 4OHPA 4C6TB 4IBOA 3GFTA 1RW4A 4BFYA 3GLHA 3PXXA 3WB2A 1JR3E 2QUZA 3LA6A 1YQUA 1Z7BA 2X23A 3VU3A 4F8EA 3LUKA 1XEXB 3K2IA 3SQXA 1VMIA 2FPIB 4CHGA 5KJEA 5GOZA 4LFCB 5C8YF 3GA0A 1QOPB 3QWAA 4RIHA 2TRSB 4O59O 1MFZA 1TIKA 4ITUA 1OGJA 3QEKA 4UAJA 4II3A 4E3WA 5M7EA 3I64A 1QCCA 2NQTA 3E5NA 4RV4A 4ARBA 4YMHA 1U2EA 4EY7A 4K9PA 5SY9A 4V2IA 3I9LA 3JQ8A 4HDMA 5DHUA 1J8QA 1PZXA 3KCNA 3U44A 1T5DX 3H1BA 2DU8A 5DTRA 2JFZA 2WHPB 3NALA 4C4RA 1EA5A 2BM8A 4OB7A 1NYQA 4UXHA 1LPBB 3Q9UA 3G8YA 1YRAA 3KDSE 5ITZB 3UJCA 3G2NA 1XZPA 4D3XA 3SXUA 3ZDZB 4U00A 1EVEA 3OIFA 1PT8A 1YK1A 1EUZA 4K7JA 1FTWA 4AKTA 5IDQA 5KIAA 1AZLA 5EMJA 3M5DA 2R65A 4YC7A 4L0MA 1JDTA 3DHNA 3S2SA 4HXYA 4AO7A 5CEFA 1L8OA 1ZKDA 5KVQA 1SIOA 4RPLA 5DTMA 5HYVA 3ECCA 1K2VN 1MV8A 1NJ5A 4W63A 2EKPA 3CPEA 1I33A 4HB3A 3QEMA 4IV5A 2ZBVA 4I1UA 2OCYC 3WADA 2B98A 1IPFA 1WBDA 4N8EA 5BNIA 2F7SA 3UPDA 3GFSA 5JHGB 5KVAA 1A7UA 1YS1X 1IEXA 1NQ5A 4ISCA 4TZ0A 3DMGA 1FS6A 5E0OA 3HCCA 1P9OA 2WYIA 3D7SA 5CBKA 5JU6A 2XB2A 1CZUA 4XCQA 2PTHA 4LHEA 4JGBA 1M8JA 4YJHB 5HM6A 1W75A 2IP4A 1LQUA 1YE5A 1ATZA 1TYBE 2OCGA 3ELYA 4XOIA 5FPHA 4MZXA 5KQPA 1PJ8A 2LPMA 1P2DA 4YAGA 5T3UA 1F5NA 1LLUA 1IM5A 3PIRA 2EZUA 3CLUD 3L8EA 4JVSB 1C1DA 1GTJ1 4CM9D 4EY8A 2EERA 2A0WA 4AJLA 5KS2A 1WMSA 2F00A 3PNOA 1GQRA 3Q2KA 4N7RA 1DAIA 4QUJA 4MKGA 3EY9A 2IBMA 5DBIA 5A4MS 1LS6A 1M1XB 3R3JA 1Z6ZA 2PM8A 4A10A 1RC8A 1GU0A 1ECFA 3F7OA 3U7RA 2CHFA 4PG6A 1KYIA 4D02A 3DDNA 1NX9A 2NU7B 4Q3DA 4Z9YA 4YXFA 1W4LA 1U8ZA 3BMOB 2ZAMA 5FEMA 1KOGA 4UM9D 2BDUA 3NEPX 2WJJA 4Q93A 3RQIA 2ZWOA 4JOCA 5CW1A 1EFCA 1P18A 4JDPA 1G5HA 1RYHA 3ZLBA 3GZNA 1E9SA 2PUTA 5B57C 1M8KA 4TS1A 5CEEA 4AP5A 1YB1A 3LKZA 1YO6A 4V39A 1GKIA 4Y9SA 2HY7A 3GGCA 5F73A 5JSYA 4AECA 1YAJA 1SXPA 3QXJA 4NBSA 3MJDA 4Q9IA 4ZVMA 1N34B 3DMRA 1FQOA 3AH8A 1S3SA 1EVLA 3Q5EA 4HZGA 5D8DA 1F0YA 1GRCA 2CJWA 2OO3A 1Y48E 1HKUA 5T41A 3DHVA 3KIPA 2A9JA 2YV3A 3DE7X 5K0NA 5DT2A 3F8WA 3IUMA 5C7YA 2ZPAA 3GLHB 3WFZA 3MNFA 3LC2O 1QHFA 4PR3A 1OFUA 3DAHA 2IEAA 1K89A 2OHOA 3KU1A 2V8BA 4G3XA 2J0VA 5E4TA 4R5MA 2WYVA 4TMYA 4BO3A 2IEDA 3OI7A 4ZQGA 3VNRA 4E15A 2VDQB 4DA6A 2IYZA 4PC2A 4BHTA 1WD7A 1FSGA 1Z45A 1DRJA 3AFHA 1BE0A 1MC4A 2EIXA 1QHNA 3IMEA 4PRKA 5EMKA 1I0IA 2Y0PA 2W42A 1E99A 1DWPA 2WKPA 3R7DA 2VWGA 1SZDA 2H4HA 4PTZA 4ZOQI 3EFHA 1K7XB 5F21A 4P98A 2IPXA 3AOEA 3JQ8B 2A57A 3KXIA 4HDMB 5IK2A 4BWGA 5HTKA 2ADOA 1HURA 1RYYA 1R1DA 3IOMA 2AMLA 3GEPA 5BSFA 2B69A 1IXKA 2IXBA 4Q6BA 3WJ7A 4D44A 2D7CA 2PO5A 1YUNA 2YWRA 4YRQA 4BFLA 5IF9A 1U6JA 2VP2A 1U2QA 1A2KC 2JEYA 2WJZB 3D2LA 3EYAA 2W6OA 2GK6A 2A86A 3DMNA 3SXUB 4XYLA 5KYYA 1RKQA 4DSUA 1UPAA 2JF0A 4URVR 2HNAA 4COOA 1PV4A 4UBMA 3HA3A 4I2VA 3W6OA 2QF7A 1C4WA 3VR4D 3I09A 3U5TA 4WGGA 5GINE 1CBUA 1RI3A 2AOTB 1KZ9A 3IBTA 4JBXA 2OC9A 1ZJ4A 4KIFA 2YICA 3F67A 4Q6WA 5JYBA 4Z2AA 3PPWA 2RHRA 2XMRA 4HFJA 2H18A 5KNCD 2PGXA 4Y9UA 3LI2A 3CBGA 4ENSA 1HYBA 3GZJA 3UAZA 1RMTA 4M1QA 4F46A 1OOEA 3EK2A 4BRSA 4AM8A 2FFQA 2YW9A 1FP2A 5IMBA 1JUDA 3U1BA 3AX6A 4LZJA 2WKWA 3EUFA 5LR6A 3SIRA 2FLVA 4HX2A 1FU7A 4LK3A 5LJIA 1OROA 4YCLA 5F2EA 1R16A 2P78A 2NO4A 4QRIA 3U61B 2D7JA 4PXAA 1UMDB 3NTRA 2LIPA 1E3QA 2WWFA 2F3QA 5AUNB 3RFUA 3JAWB 4JLUA 1B41A 1QYCA 1EFTA 1CTQA 1WNTA 3HXTA 5CT8A 4YHBA 1IY9A 2RGWA 1OKKA 4QYIA 1OAKA 3B48A 3T4XA 1C1DB 3FF1A 3QE9Y 5AW0A 1WZ2A 2B2NA 3CPSA 4I5EA 1T5OA 2WF5A 4XD2A 3PLAE 4LOLA 1I4EB 2FCAA 1SVMA 2DKFA 2ZRKA 4V0RA 3W7VA 3QX3A 1ZZEA 1NF2A 1EK2A 1Z0ZA 4PS0A 2YASA 4DQLA 1NL3A 4URUR 3E9ZA 2B8WA 1AKUA 4YMVA 2D1TA 5BSRA 5C52B 3RQSA 1BQ3A 4KEAA 3NMUF 1FXWA 3PR2B 4GWKA 1JXAA 3RG2A 3V7UA 2NNWB 3QJGA 4BFXA 4DA9A 1VCHA 4AY3A 1QF6A 4JH0A 4X95A 5ISMA 2DH5A 2OSBA 5IMSA 2OM6A 5K3CA 3BXHA 4EY5A 3FFWA 1MAUA 4XARA 1H8ED 1T0HB 2EARA 3HKEB 1ODLA 1P4GA 1QAQA 3A9TA 3NM6B 5ALQA 3IT2A 3GT0A 4IH1A 1I2AA 1UFOA 2CJWB 1P45A 1ORRA 4RHCA 2QZPA 5AKKA 3IR6A 4DB4A 3DKIA 3AEZA 1RLTA 4RK4A 2EL9A 2JFBA 2C1ZA 4WFQA 1WCXA 4KRGA 4OQNA 1C7EA 1Z0AA 1A5ZA 4CETA 3SQLA 3PVCA 5DO9A 2BT4A 4RGVA 4Y9RA 3S27A 5BMVB 3GLQA 5DYYA 5JWRA 1F2TB 4ND1A 3NTQA 2ZJ8A 2YFKA 5FO0A 4JLAA 3NVMB 2XCOA 3H1EA 2Q5LA 2P40A 3GGPA 3M5PA 4QUAA 3W2GA 4F3YA 5LOVB 2MYNA 1FQKA 3K35A 5G1OA 1P0PA 5JPDA 1TC1A 1XV5A 1X1CA 2C07A 3RU2A 3G9QA 1XJ0A 3RF6A 5DXJA 1E79A 4OQYA 3G2PA 3RF7A 5CD9A 5K05A 4Y2RA 4QU5A 3R9XA 4W5JA 1LVGA 4IOJA 2VZ9A 3CHYA 4KXFB 4MKIA 2KLBA 1I3KA 4V24A 2R11A 5U9CA 3GLIA 2Y1GA 3DO8A 2VHEA 1Z6PA 1CU1A 4R1UA 3RJMA 1GNQA 1OTYA 4CMIA 2HV8A 3GH1A 3NXKA 1ZC4A 3WKBA 5GJCA 4BO5A 1LI4A 3IQDB 3GPBA 3QMMA 3VR2A 1JHDA 2ZK7A 3EZ6A 4YAWA 3UCFA 3QUSA 2OGWA 2G0TA 2NT4A 5L7YA 5AW6A 2WWYA 4PX2A 3AL2A 4GQBA 1NN5A 2VXOA 3BWMA 4LRSB 3VU1A 4OGLA 1LKZA 2OO5C 1YMUA 3HP4A 3TR6A 1ETUA 1ZI9A 3N74A 3Q12A 1MRZA 1NV8A 4I5GA 4H15A 1BQ4A 4MQ6A 4CU5A 2YZMA 2IKSA 4G0QA 1NXSA 1XTIA 1AE1A 2VUHB 5AH0A 1I80A 1SUFA 3GNQA 1XMXA 1Q1AA 1ZM9A 2HAEA 3U17A 4AKEA 2WSSD 1PDWA 5KYGA 3WFIA 1PVOA 3NCHA 3G85A 4O8CA 4ACBA 3Q40A 3G13A 5BRNA 4E94A 3BXGA 2C5EA 4JX8A 1TW3A 1ZMTA 3PNPA 4UQPA 1P1IA 3BWCA 4TKLA 1GGHA 4F56A 4ENVA 5JSUA 2AKEA 1O3YA 5DHQA 1PKXA 3KAKA 3RAJA 4QYIB 1QQ5A 1GPYA 3PTLA 4TL6A 3A36A 4OU4A 2A5YB 3PEFA 4J49A 2VAPA 4LSGA 3N58A 5J5VA 2IYPA 3LDHA 3VBCA 3E9NA 3L0DA 3L6EA 3WFJA 3DFZA 1FMTA 2C2KA 1LNZA 1O94D 3B8EA 5JCXA 1E7QA 1EVKA 1SK8A 3GK3A 4GBED 3FM9A 2VHWA 3B38A 3D7RA 4R81A 1HDZA 2F59A 5IU6A 1CRLA 2FOLA 2Q99A 2G9RA 4R7TA 2ZJFA 5FA8A 5HZKA 5CB8A 3WO0A 3GHHA 4AYWA 2ORVA 4CT5A 5D1HA 1PJRA 5EESA 3U09A 5CX1A 3TX2A 3QVKA 2DQ4A 2PNFA 4JLPA 3U0VA 1YR7A 2AFHE 3Q15C 2PEZA 5CT4A 1WSAA 4XYMA 4A0QA 1E60A 3IT0A 2C3MA 1Z25A 2BGLA 3BFKA 4EVQA 1NUQA 4NJOA 3TFQA 2APJA 3N3AC 3RVJA 5C3UA 1FXWF 4DTIA 3NQ41 4V0LA 2ZUWA 4ZEVA 3ERCA 4LOIA 4C4XA 2HA2A 3E8MA 4RA6A 3RVBA 3H11A 2KJQA 1SO8A 1CEYA 2IYFA 2W98A 3FNIA 5K8JB 2FSVC 3MCTA 3R9KA 3TTSA 1CW2B 3CEJA 3Q7QA 4UE2A 1BAPA 2WA2A 4BNKA 1LRKA 2AOXA 2XDQB 2IYLD 5A6SA 1EE9A 1T0JB 1X1DA 4O08A 4TSRA 4RPJA 1XI2A 3MINA 3VZRA 3W8FA 3ZR4B 1KAHA 1F8GA 4ND8B 1NVKA 4CN8A 3DZIA 2VSXA 2OECA 3GYBA 2XF8A 4DNFA 4NPCA 4DUZB 4GXNA 4P0QB 1NNEA 4IFTA 4J90A 1EGQA 2OCKA 3DC7A 3P5BA 1E94E 2GM9A 3VKVA 3C7TA 1XROA 4YPVA 3HJRA 3CTPA 3AILA 3DOUA 2Q0SA 2C54A 1GTZA 4NP6A 4A7PA 5FWYB 3R3XA 2D1FA 1FFCA 3W1EA 1U8CB 2NW6A 4GX1A 4IICA 2OBFA 3VGPA 2VWPA 4MKFA 1TF5A 2OBXA 4G0MA 4ZVKA 5CFOA 2JLYA 3M89A 2XBUA 4OI0A 1F6WA 2R5WA 2VNKA 3QU4A 3SFTA 2XUKA 3ZXYA 3KJGA 5IJXA 5F2OA 3D0KA 1WL8A 3BQ9A 4CXMA 2IXFA 5IAKA 3Q11A 2JA1A 1PIWA 5CB0A 1HX7A 5FJIA 2PZ8A 3S44A 2Q3HA 1GZ5A 4C06A 5EXTA 4N0PA 1E66A 1DG3A 3LC0A 3ZX5A 5GMOA 2QN6A 3LPAA 1DARA 3D43A 2FX2A 4FEAA 3ZTWA 3N3BC 1L5MA 2B25A 3MQ2A 2P41A 2YW2A 1Y7PA 3BSFA 3C74A 2JFHA 3CZRA 4GSLA 3I58A 3KHTA 3KJNA 3RYIA 3SJZA 2F9FA 2D54A 3OM1A 3GT7A 3SZ3A 4BJ3A 5LMNB 1YULA 1SQSA 3ESDA 1A8SA 3X0DA 2XTZA 4HFMA 2CSUA 4K03A 3N0WA 3IA2A 3ZV3A 4DSZA 1S9HA 2CJFA 2FUEA 3WMRA 3TVYA 4BTLA 3GLFA 2BRUC 3AHDA 3JWEA 1DJOA 1Z4LA 1YQ9A 3KR2A 4QHSA 4OAPA 1V2GA 3IDFA 3ZE8A 1TLFA 3PXAA 3N2YA 5PGMA 1TT5A 4BGUA 5LQDA 5HQJA 1EGVB 4EF4A 4EGCB 4LX0A 1QP0A 1BMQA 1QZXA 3BZWA 3S70A 3THSA 5FLXA 4NMWA 2GD2A 1WSBA 4I4CA 5EIBC 4R8RA 2POQX 3FPSA 2NNLD 2QROA 2BJVA 3PDWA 2J7PA 4DLTA 3RBAA 3CSSA 3IQHX 1LK7A 1OFIA 1XZIA 5LZ5A 3K5HA 3TUZC 2H48A 1STOA 1U0OC 3VYTB 2O3QA 5L7WA 2J07A 4J6FA 3W79A 4OJTA 1AN0A 2K2WA 2NVBA 2QLJA 5JCZA 2ZB4A 2ZE6A 1ISJA 4RETA 2YJGA 1QTQA 1WW3A 1GT91 1SR8A 3L1HA 1GQ2A 5CX1B 3N86A 2JK0A 1OLXB 3V3KA 3VR6D 2IS4A 3NPMA 5EJFA 4D9BA 2K87A 3AR2A 1AD2A 2AA3A 3B53X 3B82A 1KZHA 4OYYA 3OJLA 2UXCB 1T5HX 4KPUA 4QUHA 4W9MC 2FSIA 1R8QA 2OZPA 4N7JA 3E84A 3RV4A 1A4XA 2EZ9A 1IZ7A 1R5NA 2Y1KA 3BM5A 4EJ0A 1HETA 1ZHFA 4KYTA 4DLBA 2DB3A 2A1IA 4YVFA 4AS2A 4RA6B 5DCUA 1VYVA 3H11B 2ZI9A 4M7OA 3WGLA 3JQCA 4KR3A 2ESRA 1NMQA 2FF7A 3OIWA 2XRZA 3RUHA 1C9DB 2CNWA 1YOBA 2I2WA 3N76A 3QWBA 4RW0A 4I8DA 2YHAA 2REQA 3V2HA 3MB5A 4IVQA 4YUXA 3GJ0A 5A6SB 3A1VA 2GZSA 3U19A 3CUEF 3GZTB 1SCNE 3MTAA 4TWIA 1OB5A 2Q0QA 3R0JA 2OOSA 2WD8A 2B2XA 4KXQA 4GSKA 5EL0A 3ZEIA 1RAGA 2NUPB 4EUKA 3ME5A 3M3DA 1BVRA 4QDXA 1DT5A 3BHIA 3B1JA 1Z4IA 3B2EA 3C6BA 4LY6A 4GI3A 4RMJA 2WJVA 5BQ5A 4YT5A 4EEXA 3OZXA 1PF7E 3C3AA 3DE2X 3L6BA 4MW9A 4Q47A 4D6XA 4AJ9A 3EWAA 1GA4A 1GFIA 7REQA 2HWWA 1MP0A 2C9YA 4RC9A 2J87A 1KH1A 4BGEA 1G6KA 2JFFA 3GYGA 4FXOA 1Y4ZA 4A91A 2JLXA 1RFGE 4YX9A 1L7OA 3CH4B 4NCIA 3BF7A 4KAXA 3LDGA 1T34A 3BX1A 5FV7A 4AO6A 4BPBA 5BNTA 1CUGA 1DQYA 2CWWA 3BJMA 4D8TA 3KPUA 5D7NA 1LNQA 1T2CA 1W5AA 1Z4NA 221PA 1QXSA 2CMHA 2EWVA 3B5JA 3QVSA 2OHGA 4A6XA 1W4AA 2IHVA 1YL6A 3HUTA 2E37A 4B80A 1W2WB 3VO1A 2JIDA 3ZVNA 3PS9A 5LA6B 2V97A 1LEHA 1BN7A 4NHOA 3JCZA 4OQZA 1IZYA 2VA8A 1SMKA 3CW9A 4JQSA 3S5UA 5B3AA 1XZ8A 3EZXA 4QUBA 4EQZA 5CB4A 1ACJA 2X4DA 4H27A 5AM4A 1JN0A 4G5QA 3IURA 5LMCA 3T3PB 3GLFB 3HR8A 4WT7A 3LPMA 5K1ZA 3V1YA 4YV7A 4MUNA 4K6OA 3ZK9A 1C8LA 1DTWA 5LVAA 3NHSA 3PPXA 4PPGA 1NR7A 5LA6F 4B2LA 3I2YX 3GRRA 5JJCA 1TT5B 2IV3A 1L9KA 3AJDA 2CNBA 2P2GA 3GD7A 3L8CA 4LRQA 3H18A 5FOQA 3V4RA 2GWRA 1PDOA 1GPH1 2QAGC 2JIQA 3O8BA 1E2FA 2RI1A 3PFNA 3HP1A 3TQSA 1B0PA 1Q0PA 1YR8A 1C50A 4JYMA 1C9NA 1F60A 2ZI7A 3ENNA 3H7IA 4XCVA 5G4LA 3PQ8A 5LQUA 5J9FA 1PZMA 2EP7A 1EA7A 4FYIA 3Q8XB 1YS6A 2QENA 2Q62A 3EXHB 3NC0C 3FNFA 4GUAA 2Q5JA 4U7TB 4BRZA 3ETJA 3TVDA 2QD2A 2FCRA 2Z5LA 2WFLA 1XMPA 4GGPA 4DREA 1MC1A 4DRXB 4FFOA 4JP2A 3CUVA 2PX6A 5B2ZA 2JIPA 3B52X 5B7NA 3I9V1 2Y27A 3GAFA 3A3PA 1OBOA 1NKSA 4Y3UA 4WVLA 1GL7A 4GT1A 3T15A 3IGFA 4P3KA 5JQWA 1A8HA 3LZ6A 4PQGA 3BICA 1F06A 2IS6A 1NSYA 4L50A 3LQYA 3C41J 1SZJG 1MJGA 2CB0A 4JEUA 4KH1A 4DM4A 4E70A 2WKRA 2I4NA 1UBKS 3HMKA 5C0OE 3QW2A 1E9AA 1VOTA 3P7MA 1M5TA 4RE5A 2REQB 5KINB 3SICE 1UM8A 4DSNA 1HDGO 3DHWC 5ALOA 2CNNA 3CF4A 3NYQA 4MA5A 2WAMA 4FBLA 2C5BA 4POAA 1HDEA 1A9ZA 2O1EA 1HBJA 1IIBA 1JQJC 4D80A 4F5YA 3NJ8A 2JB9A 5EUMA 4REQA 4ZP1A 3TIVA 2OYRA 5ICSA 4KN5A 1N1EA 1WKBA 1ZAKA 1SQ6A 1R3UA 2V7UA 1IMOA 2W0MA 3F7NA 1JQAA 3NTOA 4OHUA 2CK3A 3C24A 4ZC1A 5AW1A 3I1FA 4EO9A 4X91A 1ZUD1 3FJOA 2P69A 1TQHA 1OVGA 3PWZA 3RTDA 3JAMA 1KZYC 1I2ZA 3BXPA 1RM0A 2WPNA 5KPDA 5I3CA 1DQRA 3IJRA 1V8DA 4R3UC 4CZ2A 3KYIB 3O2NA 1IM2A 1A5SB 2CW5A 2TMDA 1WD5A 4FFSA 1VMEA 4NG4A 4IUCS 1CIPA 4K6HA 3I5YA 1X3SA 1KFCB 4B6GA 3G8DA 1G19A 3DUWA 4NJEA 3QKIA 4ZXPA 2NADA 3LY9A 2W5UA 4N47A 4D74A 1T4DA 3BK1A 2O8DB 4KQGA 3RTBA 4XEHA 1PK7A 3IT1A 3OIUA 4MQ5A 5EIBD 3RB8A 2ZDQA 4LDRA 4ARIA 3ZHQA 4MO2A 2QGZA 2H7VA 4HH4A 4PS1A 4BRWA 1NC3A 121PA 1AQ6A 1U1FA 3ZIAA 4ETMA 3UBTA 4YRSA 5CB4B 1JKFA 4C5CA 1V3UA 5TF4A 2FNAA 2G40A 3GDHA 3FFBA 5BWOA 3U3XA 1B8OA 4HUQB 2NXJA 5IC4A 3C6QA 4QDTA 1HR0B 1GYPA 2LIVA 5HF5A 4NK5A 3ZWXA 1Z18A 2L0XA 1UXGA 2R8RA 2P2SA 4UCFA 4NFYA 1DTWB 3T12A 3P9IA 1AMOA 4OJMX 2HFJA 3IPXA 4YFYA 3QE0A 1BRTA 2IHKA 4QXOA 5CB4F 4X65B 4RGYA 5AR1A 1IUNA 3GDWA 2COUA 2R87A 4WEQA 2Y1LA 3FNBA 1TPYA 3SQNA 3V2UA 2ZDGA 4BNTA 3GHYA 1AKWA 2P2ZA 4KP7A 4YP9A 421PA 1YDEA 3W1VA 5AVTA 4N01A 3DJYA 3L7IA 5AI6A 4CMCA 3FOZA 1CQXA 1YB6A 1YIOA 2HF7A 4MUYA 1XF1A 3QPUA 4UEOA 5K09A 2HREA 5A3SA 3OCYA 4PX5A 4KREA 2XGMA 1ENPA 4G1CA 2QMYA 2WHQA 2WFLB 3TTVA 1UP7A 2Q8PA 3UO8B 5IH3A 1WR8A 3KTAA 1H2AS 3MCVA 4MYRA 3ZDEA 4C29A 1J7JA 4M0EA 4P2GA 1HYGA 3QHQA 4FOPA 1CEQA 1KMMA 4BQFA 4EFMA 3ROKA 2OR3A 3IUBA 2FSUA 2CBXA 1IJKA 3KEFA 4JC4A 3PGKA 4DV7B 3V7NA 4WESA 5CA0B 2EG9A 1ECLA 3L82B 4NVRA 3SQOA 1CRPA 1AQYA 1U65A 3VHLB 2G88A 1E64A 4JBWA 4RD3A 5JH7B 2YKGA 3O6VA 3DBHA 1POXA 3COPA 1HK7A 4Q3BA 2P79A 4UU0A 1J8MF 1VMDA 1H9CA 1O08A 2XB6A 2Y0EA 2K6GA 5EXSA 1JEDA 1EX1A 2FZ4A 1Y9DA 3QKRA 4GVLA 4UJ3A 3O8LA 3VDXA 3R4VA 1T1RA 5L95A 3FR8A 4HRXA 1QX3A 2W00A 1N6PA 3F4BA 4BO6A 4A26A 4F1JA 2O6LA 3DULA 4KXLA 1ONPA 1QIIA 1QMGA 3KSRA 4TKVA 4IIUA 4M3NA 2WUGA 3ZU5A 1GDHA 1NUUA 3VNQA 1KP3A 3F98A 1C81A 1OV4A 4OHBA 1LVUA 2OBBA 3C4JA 5CDFA 5BQ3A 1OZFA 4D25A 1I4WA 4YJGB 4BX2A 1O77A 5JCJD 1ZPDA 1XUOA 1ZWLA 3VHXA 5K99A 3L1JA 1J49A 4EL0A 1ZCBA 4NARA 4PCUA 3QEBZ 1PT7A 4QATA 3M9LA 3UF0A 4K0KB 2IW1A 1TAHA 2PD3A 1IY8A 1A69A 1E5TA 2Q4EA 1XXHE 2RH4A 3L07A 4YN3A 5TT1A 5TVGA 4YUWA 1FXSA 3C3WA 5BUSA 2X0NA 3QYAA 1H2ZA 4OUKX 2X8JA 1O8CA 4I9FA 2C2BA 3BRQA 2F3TA 1TQDA 5FKJA 1T3LA 4C43A 2GN0A 3IBCA 3GGOA 3QPAA 5E4YA 1S3GA 4QWWA 1N4AA 4MHTA 2DVMA 2ISSD 1Z8NA 3MJFA 1R5JA 2VPWA 4C3OB 3LWDA 4FZJA 8ATCA 3PQCA 1HNZB 3G5UA 5AKJA 3MJHA 1V8ZA 2HWXA 3HZZA 1TM7E 3KAPA 4KO3S 2QJTA 1F8FA 2GJ9A 1U8UA 4ER7A 2DBYA 1PW7A 3EH2A 4K1LA 2PN1A 1UK6A 2Y0DA 3KJIA 4ZV9A 2CHUA 3Q72A 5K45A 5KX5B 3BH0A 3HDQA 2Z4TA 4B6PA 3I8OA 2VTBA 3N8HA 4YMLA 3LQQA 4LMBA 3ZWWA 1DKUA 3UICA 3ZWCA 1IN7A 3U48A 2XE7A 3AK4A 1LH0A 4F4JA 1G7CA 2YQ5A 3NV7A 3OLXA 1CJTC 4A4DA 1XKTA 3EDQA 3FUCA 3FWKA 4ETIA 1G9TA 3FAZA 3DWEX 2PEYA 3GJ3A 4ILEA 4KUHA 4LZOA 4M0CA 3T1OA 4CMEC 2GCPA 1AQNA 4DILA 2E4UA 1OI3A 4MUMA 3I62A 3L46A 4NOKA 3ZGVA 5BVGB 4MQEA 3RADC 1XLTA 5LFAA 3VNSA 2AB0A 3AF4A 1KI8A 3DTVA 1NW4A 1CZHA 2X76A 3EXEA 1F12A 3CH6A 2BGTA 5CH3A 4ZPXA 3RFCA 3U9SA 4BIIA 4ONEA 2IY7A 4O02B 1EXVA 2XUHA 4GD3Q 1M1ZA 1A0OA 4U5XA 2GHTA 4G07A 3RRYA 1U7OA 1BKDR 5HJ2A 3D4OA 1NMZA 4YREA 3ZE6A 1M83A 4DR5B 3G17A 3ZZ0A 3ENQA 3RU3A 3K9LA 4RKYA 1DBSA 4F4IA 2XYVA 5CFLA 1X1AA 2C5GA 4TRNA 4WASA 3ZVRA 3GX1A 4BBZA 3ETLA 3ZCXA 3DL0A 5KSWB 1BX1A 3OM0A 3B70A 4TTIA 1NOKA 1UWKA 2UV8A 2ECPA 4U8GA 2BFOA 3WX0A 4DGQA 4LOHA 2C9DA 4D41A 4LE2A 3CW2A 5F1YA 1Z56C 3DBHB 3HYRA 3IBGA 3PPYA 1JKXA 3BGVA 4ZRMA 3W9UA 4B1FA 4G0VA 2F8SA 5IAGA 2BEUA 3LW8A 3LKBA 4HMPA 2BZGA 1JG1A 2CDAA 4OQDA 3WYDA 3G9ZA 3NVAA 1PQYA 3PPVA 4ASUA 5L4NA 1BCRA 3DVRX 4H1WA 1T9AA 5TSDA 1GV0A 1YC5A 3HY6A 4D4IA 3I2GA 2OHVA 2FRVA 1BYIA 2W8BB 4M1SA 5JNVA 2FRDC 2OLEA 2VH1A 3HGTA 4A0GA 4UTPA 3FPKA 3RVLA 1MEOA 4TKVB 3UHFA 4WY5A 1R0XA 2CZCA 4ZOBA 4DDHA 5JQGB 5FWXA 3CURA 4P32A 2OYCA 1ACMA 1JHXA 1LC3A 3FCEA 2FTKE 3U39A 3LOQA 3VO2A 1I2CA 2GM3A 3VHXB 4QREA 3MJTA 4BNDB 3UTCA 2C5HA 3FW1A 3IIEA 3TQOA 3UM9A 4JSYA 4DC1A 4MUGA 4QASA 4GXTA 2PT6A 2I6TA 2OLJA 3LUBA 2O8VA 2OORA 5FHQA 4A23A 4F5WA 3WQHA 3DOFA 4ZVVA 5FF9A 2IP2A 2X8JB 5CNMA 4B2PA 1CKEA 1CS4C 1ESMA 1CJVC 2FR1A 4I14A 2PNJA 4DIEA 1KS2A 1E98A 2YHSA 3UBMA 2E6UX 1AQLA 4G24A 4W5WA 5KB3A 2Y3IA 5D84A 3WLFA 1NUTA 1INLA 1W48A 3EEOA 4BNFA 1DIHA 4H7DA 4X3OA 3MMXA 3AI7A 3KOUA 4LBWA 4OBBA 3TW6A 3WHKA 1I5RA 4V2UA 4I5FA 2G7ZA 1SELA 3MWDA 4R69A 2JFWA 3NOQA 5IUJC 5D7BA 4AMZA 3BJRA 3ZE1B 3RS4A 4G4SP 3IUNA 4Z1MA 2VTBB 4CW7A 2PSEA 3ABZA 1A9RA 3PX3A 1T9GR 3AINA 3PF9A 1FLAA 2A7XA 4OB8A 1H5NA 5BV7A 3H04A 3RWBA 1I3OA 1NF8A 1RQPA 5GV8A 2OUIA 5IFKA 2GUGA 3CKLA 4E09A 4M55A 4KV7A 1VLQA 2PZAA 4RMHA 3EBPA 1UKBA 2YXEA 2GBPA 3OOHA 4L85A 1E77A 2O3TA 4QGHA 4KXNA 3RS8A 4TZTA 3HVUA 3E4CA 1G55A 4CFYA 3EISA 2FR8C 1Z5NA 1I8TA 2PL3A 4DG9A 4B3DA 3SJAA 1SC6A 4MQEB 5J1TB 3QEAZ 1L4KA 1QFXA 3KSAC 2PLNA 3GMSA 1KMIY 3ES9A 4FLEA 1ZN2A 3QZUA 1EBUA 2X2FA 4C0HA 2FGJA 3PRJA 1DEHA 1JDBC 2ILTA 2PLWA 5BN5A 3E2IA 3AU8A 2YFHA 1ZY2A 3VPFA 4LDJA 2PRYA 2XOKD 4ND7A 3RD5A 5E9AA 3U2QA 4AJEA 4E3ZA 5JYEA 2AEEA 2H4ZA 3S28A 1WSWA 1RPZA 2ANCA 4PYIA 4BGIA 1BRMA 1KVQA 2Y68A 3TMAA 1TCBA 1P7CA 1BA2A 1R6BX 1I7QB 1TQ4A 2QTZA 3TCKA 4FKZA 3JQ7A 4KG7A 1PJ2A 4HP8A 3CN7A 3LDAA 4IXTA 4HH3C 3TYXA 3KQUA 3MQFA 3QVOA 1KXZA 4RQTA 4CG1A 1II0A 1H2RS 2RHLA 4BY9E 1JIQA 1SD2A 1PJ3A 4MW4A 4CIVA 3THOA 1P2BA 4MUJA 2XCIA 4KMSA 2WHEA 5IYZA 4QNRA 2NUAA 3OU7A 1B4DA 2VCYA 2ZRMA 3LQ2A 5A1JA 3K0HA 5EMMA 4YXWA 4EECA 1SZPA 1Q6YA 2B37A 1NHWA 4KVFA 2A3RA 4RZ2A 3EPJA 1XMSA 3TL2A 1A72A 4G8JA 3BWVA 1XZNA 3DNMA 4LI0A 3IQFA 4YRDA 2BEUB 3NM5A 3VPCA 1WXEA 3LOUA 4JUCA 2JIRA 3SOPA 2GBIA 1SBHA 4LHXA 4NMMA 4OI4A 2GYUA 1XRNA 1J00A 4KPGA 2CKMA 1W47A 4H6PA 1F17A 1XMJA 5HUQA 1JJIA 3OF2A 2RGBA 3PB3A 5C8VA 2J6CA 2I4OA 5BSWA 4RH3A 2BFWA 3OKFA 4AWBA 5FWXB 1DTSA 1L5RA 1OAOC 2O4UX 4IRMA 3U4DA 1KJZA 2ODAA 3R6TA 4HGQA 4N3NA 1XSEA 1G5RA 3GG9A 1KJ8A 2W4MA 1R9NA 2OFFA 1NRWA 2Z2ZA 1IXRC 3CB4A 1MC5A 4D3DA 3KYBA 4RTNA 2WF8A 5J4HA 3AT1A 2AWNA 3BJIC 4Z5XA 5ALJA 4C4PA 4TVSA 1HE3A 4C5AA 1HF3A 1SVKA 3IPYA 1XYVA 2PXAA 1XD9A 621PA 1SCQA 2OCIA 4OL9A 4CLOA 3ZZTA 4ER3A 1CR2A 2GPNA 2ETVA 1Z35A 3T4EA 4AZ3A 3ZQUA 4HFNA 4DCPA 2A5LA 3GQVA 4Q9HA 1E63A 4LXYA 1E58A 2YZ2A 4HGPA 3RANA 4YP1A 2WSIA 3B1FA 1A96A 1A7AA 2D8MA 3M6WA 4RWEA 4KDRA 3ROZA 3VTKA 1XL1A 2O5VA 5KJFA 5B7PA 2C7PA 2BBSA 4M6WB 3GJ6A 2QN8A 3QFCA 4XPZA 2RC6A 2VJYA 3OJ0A 1L4UA 1SUEA 4IV0A 4PSDA 2PBLA 4ZO6A 5FWAA 3P71T 3HJUA 5AUQA 2QLMA 4BV8A 1C1YA 5GJWC 5KQGA 1ZVMA 4OCZA 2QBYA 4JI1B 4AXBA 2OXRA 2RHWA 1FTQA 4C87A 1SQFA 4JBIA 1E7SA 2V54A 1XNQB 2C9BA 2OHXA 4WZAA 1N75A 3BZUA 5DU2A 3RT9A 5F7XA 1S7CA 1VIMA 2ORWA 3F7MA 2KLHA 3C3DA 2NWQA 4C78A 4MA0A 2R6HA 3N87A 2J09A 4MQFB 4UPVA 1YB7A 1J9EA 4GGOA 5T4EA 1EDEA 5GZ1A 1LDGA 3ZWKA 3RH0A 3GROA 4DWWA 3MJEA 3VR4A 2SICE 2P75A 4Y9DA 1SRRA 1QQ7A 1T5LA 5BN5B 1B6GA 1C29B 1VJ1A 2GUWA 2QM7A 4UHCA 4A36A 4RV9A 4U7HA 4IDEA 5KNCA 4KQKA 3PUYA 1G8GA 4HNHA 5AVXA 2ZAIA 4JLJA 1SEPA 2ZGVA 1JSRA 1RWMA 5C4IA 2DKNA 1J39A 4CG3A 3DL2A 4WN3A 4Q1BA 2XWJI 2BYTA 1XDUA 4RPHA 4NFSA 4EW2A 1UWLA 2IZ7A 3DFUA 4F2WA 5LB4A 3DTNA 1RQ2A 4B7AA 2H0AA 4HWOA 2IXTA 1UXIA 4NV3A 4RYDA 3OQHA 1N6NA 1YS4A 2C1XA 4E4YA 2GFQA 5IYZB 2ZUEA 2NUAB 1NY6A 3ICPA 3FYSA 4TL7A 1FTYA 4W9NC 4MV4A 3FTNA 2IYEA 3ON5A 2QZSA 3ONEA 4IXMA 3U60B 1OLOA 2N47A 3FHCB 3P9NA 1G8SA 1PLJA 1M2NA 1S8OA 3A9UA 3QVTA 4FZRA 5D2CA 5DEOA 4LJ7A 2OBLA 3R7AA 3UHOA 1QHYA 5A4KA 2OQVA 5JJLA 4F1WA 5IVPA 4P4UA 5JW6A 3AR6A 4KDCA 5BUCA 3O4VA 3Q1KA 5JASA 2XLBA 5IYZF 3DL4A 5DI9A 4YA6A 3PNYA 5DYNA 4KQFA 4X3PA 3PUJA 1S4MA 4ZYYA 5AK6A 4PO8A 1WTCA 4UM9B 4TKMA 2R6JA 4XPIA 2TYSB 1AN9A 4EAQA 5E2BA 2GAFA 2PX3A 5A4AA 2JATA 1XZKA 1GDTA 4G1BA 2I33A 1E2MA 2ZB3A 3L5OA 3QFRA 1ZS9A 4FX5A 4PHTA 2I7TA 3ETCA 3OQJA 2AMVA 2GAJA 3BDVA 3GA5A 2IHYA 1XLVA 2A35A 2DOKA 3H5AA 4RELA 5AI4A 3VV2A 4ESVA 1W59A 2OKCA 4TXLA 4EATA 4JJ8A 3IO3A 3K8OE 3OZTA 4M86A 4AJ4A 1ZNYA 3G79A 2H5IA 3TQFA 3HVRA 1NYTA 4H9GA 4BDSA 3NG1A 3V7WA 1Y5IA 3QBEA 1XLWA 3VPSA 3WGMA 2YOFA 3WLSA 3ZUGA 1JXQA 3PDIA 1ZJ6A 4CLOB 5L8VA 5EQJB 2O8NA 3IQXA 1DC6A 1L5YA 1ZNZA 1IVYA 5CTAA 4AZ3B 3TL3A 2DRIA 3V8EA 5AP9A 5C35A 3AR7A 3LH5A 3O8QA 5I9MA 2Z1DA 3F2IA 3VSAA 3JVVA 2C29D 4JY7A 1BEEA 3P2JA 1N5LA 2DPXA 5DV9A 3P20A 1IK6A 3LPCA 5K3FB 3SEFA 3QX7A 3LYLA 4QJIA 3VSBA 3DMYA 3WNVA 5HMLA 4Z7OB 5K8TA 3F4LA 4O63O 2AN4A 1XMQB 4B83A 1KBQA 4BNUA 1E6WA 1KC3A 3CUKA 4R1TA 1TVEA 1PNVA 4QDJA 1RNLA 4HPXB 5DEIA 5JLAA 3R7FA 2RIPA 2ILVA 4DR1B 2YHIA 3T0FA 4G1VA 4Z9BA 2IUSA 1CUYA 4J9UE 1JMKC 2J5QA 2QBYB 4OHWA 1LPPA 3H2IA 2Q6VA 1YCGA 1UAGA 3C6XA 3TL6A 1C0EA 1FLDA 2SCUA 5C32A 4WZAB 1V9CA 5I51A 3WA7A 1H0SA 1IONA 4HQFA 3LTNC 4QU8A 4QOFA 4ND3A 4IQ8A 1J99A 4AKIA 3ANLA 4JITA 4R83A 1JR6A 3E7XA 5B1IA 3C15C 3QQ5A 1W30A 4N7BA 3V4ZA 4UDXX 1CEEA 3FNGA 4G4JA 3LYHA 5IBCA 4ICIA 1Q50A 3C3XA 3I23A 5JAQA 1F3OA 2AZ4A 2RGEA 3MSCA 4OHMA 5ALWA 1TNDA 5GOTA 4XRGA 1ADJA 1NZJA 3B89A 3WIBA 4ZHSA 2X5JO 1Z36A 3HV2A 3P9KA 4EUSA 1U8XX 3K9HA 1N9KA 1PJLA 5AUOB 1KK1A 4DZTA 2BMWA 4KHZA 2O2DA 1OFUX 1A4UA 2J9RA 3SR0A 1Y0BA 5FOUA 5JVDA 3Q8KA 1WIWA 1X13A 3LPDA 1AS0A 1OGIA 3AW8A 5EHGA 1J33A 3QPCA 2W70A 4ALNA 2FWNA 1CULC 1KDTA 2QJRA 3L05A 1A3CA 2OM2A 1MGOA 4YRNA 1EK6A 1Q7EA 3DMFA 3LF2A 3QH4A 3E3OA 1RHUA 4FHCA 5EE9A 1GRRA 1PX2A 1EQUA 5IN4A 1OBVA 1GNLA 1Q14A 3TRDA 4AAYA 1IBKB 2HLDA 3COYA 3HWRA 1Y4DE 1BJRE 2N3ZA 4I55B 3VRHA 2YQ4A 3NUQA 1ULZA 3F96A 3UVEA 4Y6RA 5L3QA 1XA4A 1XNGA 3NHJA 3RNLA 4B40A 3NFYA 2LW7A 4AN0A 2NYRA 2R6DA 3NKFA 3RC2A 1JIXA 1E6KA 4XPIB 3AI2A 1I9CA 2DCUA 2DQYA 3TOZA 4CLEA 5CLJA 1NQAO 3QM1A 4Y6SA 4ZYZA 3DLHA 3N6RA 4WOPA 4X1OA 2FY8A 1RRMA 3ANNA 1X8KA 1E5LA 4CKYA 3BGSA 1EE1A 4ML3A 1Q0QA 4TXJA 2WNSA 2VQFB 2ADFA 5ER6A 2IGBA 2LDBA 3UT5A 3WQQA 4F11A 4JROA 3HKCB 3C3MA 3LECA 3UAVA 3D1LA 2C2WA 3OWHA 1SVNA 1E9CA 1IBSA 5FTWA 4F3CA 3PDIB 2GA8A 1DCKA 3A9RA 1HEIA 1A04A 2GD1O 2X5OA 3GEHA 3I45A 2PXCA 1PFWA 1QRAA 1N2GA 3B1VA 4YRLA 1ODJA 2FVYA 3OCWA 4HF7A 4RNCA 3LW7A 4C0JA 4KQJA 5DKFA 3ZHYA 3I9FA 3RS7A 2HYIC 2QW1A 3MZ0A 3PFKA 4J0EA 4WGFA 3QOWA 2NVOA 4GMDA 4I6EA 4PPFA 3VZQA 1LDYA 2AZDA 4BNIA 3CVXA 1P1BA 5LBUA 2P9YA 5CHYA 1E5QA 5HK9A 2FW8A 1ECJA 5L6MB 3DCIA 3A9VA 3R1IA 1XAIA 4Z2YA 3N53A 2A1UA 3I76A 2CXTA 4JIGA 5HBGA 1RYBA 1NURA 3FGNA 3WLTA 4DV3B 4LRWA 1NJSA 4HX5A 3ZV5A 5M04A 1R8SA 4X1YB 1P4RA 2FETA 1X1BA 3WAKA 1PZNA 1MFPA 5C7LO 5KDOA 2FN8A 1QG0A 3G8CA 1QO0D 3Q3CA 4TV9A 4ZO9A 1H2FA 3JX9A 4KLAA 3LUAA 2QV7A 2R1VA 4N3BA 1RQRA 1FSPA 3EFEA 2HBRA 3AY6A 3VPBA 1TKRA 2DHCA 5FCDA 5A0VA 4N0QA 4KAJA 4KPFC 3O3MB 4K6GA 3FPGA 4F85A 2CVFA 5JT1A 4Y2PA 1UBLS 1UMBA 3UXYA 4CV3A 1K06A 3OLYA 2Y99A 3O9VA 2EAUA 3VR5A 4C3UA 4AQDA 4BYGA 4F60A 3LGSA 2CLFB 4XH9B 1PZFA 2NM0A 3W5VA 4KPEC 1EP9A 2BHTA 4MRSA 3AQ4A 1BVYF 3KWMA 1T2DA 1PK8A 3LX5A 1G5PA 4G4GA 4Q1AA 4UTOA 2V59A 2NZ8A 3KZNA 1Q17A 4BQSA 4OLHA 2D74A 4GWLA 5AMXA 3U3JA 1KKMA 2ONYA 2WZBA 4YCCA 3GT3A 3JAKA 4KACA 4JR0A 4BMDA 1C7RA 3UOGA 4ETNA 2OV1A 5ECYA 1KEEA 3LHFA 1OB2A 3UK6A 1VE7A 5CIYA 3O2JA 3DMDA 3GDGA 3M0EA 2E6KA 2A1TR 2C31A 5FADA 3TEFA 3GC6A 4P7FA 3TRIA 1GPWB 3WLEA 4O2LA 4IIFA 3W7BA 1IG0A 2TS1A 3N2ZB 3AW9A 4U2FA 5DHPA 4KKVA 4BATA 5BW5A 2IEZA 3T5PA 1U4NA 2AXQA 1TTPB 4Z7NB 5AOCA 1U0FA 3C8MA 4TKUA 5DISB 1QWSA 1N2XA 2VXBA 3UWKA 4E33A 5A2QA 1GR0A 2BUCA 5CB6A 3WLIA 4AWAA 1QJ4A 4NC9A 5EJ4A 2FQYA 3B7WA 4EFNA 1JHRA 4X3CA 4UD2A 4Z7JA 1FA9A 1C3JA 5C5DA 4KO4S 4GNKA 5L53A 4L3OA 1PG0A 1VP9A 4FPXA 4HDOB 2ENUA 2C92A 2D5CA 1AF4A 1QK4A 3F6YA 4LN1A 3ZQ4A 1T6BY 3HKBA 3VR6A 2AOUA 4NU6A 4C07A 2I1WA 3KD2A 2JCXA 3PQ4A 3Q85A 4MVJE 3INTA 2HW8A 2HWKA 2DUNA 2HSEA 3CG4A 5JJIA 3U0BA 3NASA 3URMA 2GYWA 1EWQA 2JI9A 2R44A 3TN7A 2BHSA 2C3PA 2EWMA 3HN6A 4D98A 1V3VA 2RH5A 6ABPA 4GI5A 1BD4A 3OLZA 3U7HB 3MMNA 4AC9A 4GRAA 1QYWA 2VBCA 4JS0A 4QJ4A 1BMTA 3O4GA 4P54A 5JD3A 3SJBA 5IVDA 4DVGA 4A2PA 1V8FA 3IP5A 2WTBA 1N4DA 2V7WA 2ASVA 4ISBA 1RTKA 2OB2A 5ECWA 2YWCA 2ZROA 1JV2B 3FF4A 5JD5A 4OJKA 2V7TA 2BN4A 2EJBA 3THWA 1JEQA 3KVOA 1VCNA 2H9AA 2WD7A 1OWLA 2BF4A 2EFHB 2IOFK 3AIIA 4RKFA 1S3IA 1W0KA 3T3HA 5I4IA 5FXMA 3MCWA 2A1UB 2LCQA 2ZYRA 2RG7A 2MHCA 2OO5A 3HZHA 4II7A 4J7UA 2BI4A 4N82A 1DELA 1Z83A 3DEJA 3DEHA 2HO5A 4WY8A 1MIHA 3I1YA 5EN4A 3KD3A 2GCEA 3A3NA 2FW0A 3ZGYA 4MI1A 3ZJTA 1TFUA 3DO5A 2RHDA 4TV9B 5FA6A 4NJMA 2ONKA 5C4MA 3B7PA 2R1VB 3THYA 4MCHA 2WI8A 1Q0ZA 4IQ0A 1EXWA 2MDTA 1EK0A 3N2LA 1UMBB 3RVNA 5G4KA 2R47A 1SD5A 2PLRA 2FFAA 5IC6A 5CFNA 5EI5A 2FZEA 2XKBA 3UNXA 3K70D 1ST3A 1D8TA 3R0XA 4RENA 4C04A 1N6RA 2AC7A 3AFIA 4U63A 3OLVA 4TV9F 3G2OA 4QT4A 1DC3A 2FE4A 3EZLA 4K6FA 4TKZA 1B43A 2JCYA 4NMLA 1LDEA 1CDZA 4UVGA 3JRWA 3EHDA 3Q41A 4U5QA 1DBPA 3KPYA 2WE7A 3WYCA 1H8HD 3ZIDA 1OD6A 3AVWA 3IT3A 2PMFA 1QGZA 3IAAA 3MGBA 1SU6A 1E69A 1W1WA 5CVUA 2VHQA 2OV4A 3FCAA 4LNAA 4AUKA 3JAKB 3LLUA 2NO0A 4UEWA 1YSCA 1KEEB 3OQPA 3O3NB 5G3YA 3RKRA 1F7VA 1DQPA 5ALLA 4UNNA 1FTGA 2YYSA 1NLMA 2FRXA 5DZSA 2HIHA 3N59A 3D6HA 5JDCC 1ZGZA 4JVLA 3KRTA 4Y2VA 4CM6A 2Q27A 4LSZA 4R8VA 5HBRA 1BO6A 1JR3D 4LS3A 3DO6A 2FA9A 4JJAA 2NN3C 3LIIA 1HH4A 1H69A 5FAXA 2XQGA 3TUIC 4EL5A 1GSOA 4TKUB 4PM4A 4HAVA 3DDUA 3HDGA 2HU8A 2BMAA 2BD0A 2RGNC 4IRXA 4RZIA 5DBHX 2WABA 1N2IA 4YMUA 2H2WA 2X19A 1R18A 2FFBA 4K5QA 1IEVA 2G67A 5FAKA 1PQUA 1Z2DA 2YV1A 4PC7A 4QECA 1NVAA 2SHKA 1OA1A 4IDGA 4R6WA 4F21A 2NGRA 4PAQA 4MDEA 3ETDA 2CYBA 3LFHA 4AF6A 1TADA 4PBTA 1IXSB 4DZZA 3SKVA 3TB4A 1FY2A 1FDUA 2SNIE 2AOUB 3TZKA 4OFZA 1GGFA 1JQDA 2IJGX 2YUIA 1QQBA 4CCAA 2UZAA 3BE8A 3BOSA 3CG0A 3FVWA 4JBNA 4BNVA 1N6IA 4K6CA 4X7MA 1N8NA 4H1UA 5K3SA 2VH5R 3JASB 5TLSA 2GARA 3DEKA 5JJKA 1WZIA 4AQ7A 1FC0A 4YACA 1ICIA 4V0KA 1KHTA 3FB4A 1T3HA 1F8UA 2Y1CA 2QRNA 3LUPA 4R2MA 1JI3A 1WBJB 2B82A 4LY3A 1NASA 3O93A 4XGRA 1SBNE 3GJXC 3PC6A 1VYHA 4JODA 4XIJA 1V3QE 4Z9FA 2BV3A 1FDSA 1V9LA 1Y3CE 5KTPA 2X6RA 4G1FA 4LZNA 4NK4A 2J45A 5EJ2A 2AJLI 2LGJA 1KJNA 4FFMA 3HWSA 3RUDA 4CF5A 1EFRD 1I0ZA 2W4QA 4OMDA 3A7EA 2C9MA 4BNGA 3FFTA 3THWB 4NOLA 1JEQB 2F3PA 2WD7B 4RDIA 4XQEA