1CZKA

Comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQNAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FLAVODOXIN
publication title Comparisons of wild-type and mutant flavodoxins from Anacystis nidulans. Structural determinants of the redox potentials.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1czkA00
4C0WA 4CF6A 5ULLA 4C76A 2V5VA 3NFRA 4YAWA 1AMOA 4Y9RA 3FVWA 2R96A 1DXQA 2HNAA 4LTNA 4N82A 4ZVMA 4FGJA 4NLLA 2QMZA 4H6PA 2WC1A 1TLLA 5BUCA 4GR9A 3EDOA 3U7RA 3F6SA 1B1CA 1JA1A 1XI2A 2R97A 2QX8A 1H69A 4U7FA 2FDXA 3K1YA 5NLLA 6NULA 2ZKIA 3W7AA 1D03A 3O2NA 3TE7A 1BVYF 2OHJA 1AKRA 3UXHA 4HEQA 1RLIA 4QOGA 4ZVKA 2X2OA 1ZWLA 3W79A 5LJLA 2BZSA 3GFRA 1FX1A 3B6IA 4DILA 4YALA 4BMPB 2MWMA 4D02A 2OHIA 3HLYA 3NHFA 2QX4A 3K20A 2BPOA 4GQIA 3NHWA 1FUEA 2HNBA 2QX6A 2FCRA 2Z9DA 4QOFA 2FOXA 4PU0A 3NHSA 2X2PA 5F4BA 3GFSA 1WSBA 2KQUA 1WSWA 3OJWA 4N65A 1CZUA 1V4BA 4ICIA 3S2YA 1ZWKA 1CZKA 4R81A 3NHYA 3NHUA 3OX2A 2Q9UA 2V5UA 3L9WA 4QOEA 1TIKA 1YCFA 1D4AA 1OBVA 1C7EA 3OVMA 4F8YA 4OXXA 3B6KA 1OFVA 5LJIA 3L9XA 3F2VA 4QODA 1XYYA 1FLDA 3TZBA 2MT9A 1AG9A 2Q62A 5NULA 1AKUA 4YAOA 2BMVA 5F51A 5TGZA 1RLJA 1FTGA 5JROA 3N3AC 2OHHA 1AKQA 3D7NA 3GAMA 2MTBA 5LVAA 4NULA 3LCMA 2AMJA 3F90A 1YKGA 1YCGA 3FJOA 3R6WA 4XDGA 4DIKA 4H2DA 1CZRA 1D04A 1AKVA 5EMNA 1YOBA 1CZHA 3TEMA 1DXOA 3NHPA 1KBQA 5LBTA 1T0IA 1E5DA 3HR4A 3KLBA 4YAFA 5LMCA 4U7HA 4FX2A 2XOEA 4XDHA 1YCHA 1AKWA 2D5IA 3QE2A 3KAQA 1X77A 2FX2A 3G5MA 4C14A 1H66A 3F6RA 4QOIA 1I1OA 3JSXA 1BU5A 1XYVA 4N9QA 1VMEA 3LT5A 5FUQA 5EAIA 5FX2A 3RPEA 3OWXA 5B3LA 1GG5A 3B6JA 4FGKA 3ESYA 3EYWA 3NHRA 1ZX1A 2FLVA 2N1MA 4J8PA 1J9GA 3N3BC 1QRDA 1J9ZA 1FLNA 2Z9BA 2F1OA 1C7FA 1YRHA 1RTTA 4QOJA 1OBOA 2MOKA 3W77A 1FLVA 5F12A 4CETA 2QMYA 3U7IA 3ESZA 1F4PA 3NHKA 1AKTA 4U7GA 3GFQA 4QOHA 3SVLA 1J9EA 4C0XA 4ESEA 2FZVA 4S24A 3ESXA 2RG1A 5EA2A 2XODA 1QHEA 1SG0A 3P0RA 4LAFA 5B3KA 2W5UA 1SQSA 1YDGA 3ES9A 3FX2A 1XT6A 2BN4A 2M6SA 2Z9CA 4LTDA 2OYSA 1AZLA 4M0CA 3OX1A 2KLBA 2GSWA 1RCFA 3NLLA 3B6MA 2FAXA 3NHLA 3OJXA 1CZOA 3W78A 3OX3A 3FNIA 2Z98A 4FGLA 1FLAA 4PTYA 5A4KA 2QWXA 3HA2A 3QFCA 5FA6A 1T5BA 4Y9UA 4HS4A 1JA0A 3KAPA 2HPVA 1AHNA 3KEGA 2ARKA 5LLDA 2A5LA 1QBGA 2BF4A 4BMOB 2FZ5A 4YQEA 3ZHOA 4Y7CA 1KBOA 4ZVNA 3N39C 5LBUA 1J8QA 1NNI1 1QR2A 3QFRA 4GI5A 2B3DA 1CZNA 4YAUA 1DX9A 4DY4A 1CZLA 2M6RA 3OWHA 4LTMA 4LA4A 3O73A 2QX9A 2V9CA 4PTZA 3NHJA 3FW1A 3UXEA 2QR2A 1FVXA 2FVXA 4ZVLA
chains in the Genus database with same CATH superfamily
2IIVA 4C0WA 2R0QC 3OH8A 4MGYR 4OSEA 5I9LA 1PLJA 2DTEA 2FN9A 4NMMA 1F17A 1KMHB 3EPRA 4NPHA 5REQA 4UFNA 1JJAA 3F9IA 2GUGA 3WLIA 3OFJA 4IMRA 2GTIA 2PPLA 2FFAA 4L9WA 2ZYSA 1AS2A 1HK7A 4XJXA 1Q7RA 4HEJA 5CR9A 4KQKA 2P3OA 1G63A 1ZGBA 3P9IA 1L5YA 3D9QX 4EJ6A 1RBYA 2B4QA 1ORTA 3EW9A 4LUCA 3VSDA 2GILA 5CA0F 5LU9A 4WV3A 2JI4A 3MT8A 2GEKA 3ONNA 5A7GA 4D57A 3PF8A 4D9JA 7MDHA 5BN5A 4WKNA 3YASA 3GQBB 2YH2A 2HW8A 1UC8A 1D4ZA 1XZKA 4IVRA 3ADDA 2XZLA 2PUJA 1EFKA 1BXZA 2PIDA 5C5CA 5K0SA 1DSSG 2OLKA 1SC4A 1NQTA 2OUIA 1XLVA 2WWFA 4HQ6A 4KDRA 1DKNA 3EW7A 4K9LA 2C97A 3N5CA 3GEIA 4OGWA 3TQOA 1GHTA 3WK8A 3OC6A 5ITWA 4NI5A 3ED1A 1J1ZA 3H0KA 1NFFA 2DR0A 3E48A 3F3SA 2WQ6A 7REQA 1KJ8A 4MV9A 1VKNA 2G5GX 1SOWA 1GJRA 2A4MA 2CDBA 2D1QA 2P79A 1HMYA 1N92A 2J9GA 1Z2NX 2TMYA 3K53A 4LZPA 4ZPJA 3M4XA 3RFVA 3LBIA 4X8MA 1DAMA 1L2TA 2IS6A 3CKMA 4FU0A 3VZBA 1GVNB 1THGA 2Q9AA 4KE7A 1PHPA 2NZUG 4ZQFA 3DFFA 2OBBA 3PDIA 1BOOA 2DAPA 4A15A 4A6EA 2HJHA 4Q4AB 1T0UA 3UJ7A 4KPGA 2PLRA 2A4KA 4WD3A 5LDGA 1V25A 1IATA 2PV0A 3VPHA 4DVJA 5SYAA 4PSAA 3B3FA 4CWAA 5CX1A 1BE0A 1VHJA 3AR9A 4MUKA 2JGEA 1GG8A 3OE7A 1RDFA 4I1PA 4UTOA 4MWGA 5K8TA 2JLYA 1ZW6A 2P8SA 4MS3A 4NF2A 4RA6A 2PMKA 4NR0A 3GFRA 2ZQZA 2O1WA 1FPMA 4IGKA 1F2UA 1N5OX 3P0FA 4TXHA 2AGVA 2QVYX 3AW8A 3O7MA 3NP7A 4YALA 1NM5A 2OVFA 3SWWA 3TIVA 2NU6B 3SMVA 4HB2A 5KNBD 3IUSA 2J59A 4IILA 3WC4A 1ZK2A 1KR2A 4RPGA 1SC3A 3SDBA 2D0IA 5C1BA 2X0RA 4FOOA 3LDAA 4GZ6A 5DM70 4IXWA 4V3BA 2FN8A 2MR5A 1MX3A 4GGOA 2FSGA 2QXUA 4BN4A 3AR6A 1H2EA 4LMRA 1TADA 3UQYS 1P5HA 1T9HA 3RFUA 1Y8QA 3ZWXA 5IM4F 1I30A 1ZUNB 3PSAA 1R10A 2F43A 4ZO7A 2C99A 2H1FA 2I29A 1QXSA 5CTJA 5AVSA 2X4LA 4DRYA 1S9DA 2BDUA 3PE4A 2QIOA 4Q4CA 4AKIA 3NM4A 5BWOA 2HCJB 4IMPA 4LZNA 1ZQ9A 1LNSA 3DCIA 1PQWA 3K2EA 3UA3A 1SQ6A 1VYVA 2XSZD 3TLBA 4PZCA 2ZIWB 2TECE 5F4BA 3K6JA 3OT5A 1CVIA 4OK5A 2VDWA 1XK7A 4ZCRA 2Q1XA 3OKFA 3RGWS 4AX4A 3GFSA 1BXKA 4ZTBA 5AW1A 3DULA 4MWBA 2XIQA 3LHKA 3PIRA 4MS4B 5DTIA 2IZ5A 4EUFA 1SKMA 1K7EB 4YP7A 5D1NA 1XD9A 3P2EA 1EEHA 4HWOA 2O52A 1DXHA 5KTOA 1N6PA 3EZNA 3WJAA 2OCDA 4NJMA 3UCFA 2P69A 1PV2A 1CDEA 2C9OA 2EG9A 4BZQA 4GZLA 2DTXA 2QBYA 2CNDA 3PF9A 2I2BA 4O2BA 1E1RD 1JKIA 4V0KA 4WTOA 4EA7A 4LYDA 5IUJC 3FSJX 3JY6A 1M0SA 1ZH4A 3L1UA 3JCZA 4MRMB 4C7XA 1KORA 5EERA 1YFKA 4BWFB 2H3HA 1Y5IA 4MUHA 2OKCA 2C0QA 3WOVA 4RHFA 2WI8A 4EO9A 3EVTA 1X1AA 1XO1A 3FJYA 3R9KA 1RHJA 3GEEA 4ETNA 1QYWA 2PFGA 1JDTA 1VMDA 3EQ8A 1L7RA 3IP5A 4GR4A 2FH5B 1T24A 3C3PA 3ETHA 2BGUA 3IBCA 3HB9A 3K9HA 4RKQA 1ILEA 1K8RA 1S2OA 1PL8A 3U80A 4JXXA 1I4OA 5KVCA 4R01A 5ALKA 3MCUA 3RS9A 1D4AA 2F3TA 4R7ZA 4H0CA 2Y99A 1HDEA 1YB4A 1CUZA 1H0RA 2JLSA 2O7RA 3RS8A 4F93B 1MN6A 1OIWA 2UVPA 3BGOS 4GX0A 4ZCLA 3UFXA 3DKRA 3KT3A 1Z7GA 1PYGA 1EBUA 2C8JA 1QG4A 1LLUA 2GARA 3BVPA 1SCBA 4GUAA 1JFVA 4DLKA 1QFSA 3UUEA 5AW5A 3NHAA 2V7BA 1G8HA 2A9RA 2QJWA 2ZSIA 4M7OA 3DEJA 4KZPA 1R16A 5HMLA 2K87A 3KG2A 4D97A 2O05A 2OCPA 3A8TA 4JLBA 4YO8A 2VTKA 3L7LA 5NULA 1L7QA 4QNNA 2ZI3A 4CF5A 3MJVA 2OFXA 1HNXB 2CMKA 2BFDA 3QPWA 3QLTA 1S3GA 4RC9A 5CVEA 3ZU3A 2OGUA 4UBKA 5IT4A 1JIIA 2P65A 1G9XA 1SEPA 3I2FA 3DZIA 4N7RA 2JKZA 3UWSA 2IBMA 3N3AC 1YVEI 3OCXA 3HVRA 1SOAA 1JTEA 2CD9A 3D7NA 3EBPA 3OA2A 4IFEA 1S8AA 1Y98A 5B6PA 3COVA 5LPNA 1EM8B 3AUFA 1XFDA 3MT7A 1CIPA 3WOHA 4ETMA 1UKCA 4GX2A 1YKGA 2B1QA 4JB2A 2GZRA 4GKJB 4Q3DA 2BSXA 2GKSA 1KIFA 2MSDB 4FDMA 2NZVG 5IN4A 3LVFO 3TLAA 4OQEA 5JYBA 3LUPA 1DE0A 3HCAA 4S1OA 1HRKA 1RXIA 4LDRA 4DDKA 4LXIA 1ODTC 1YOBA 2ORED 2VTEA 3HBNA 1I4TD 1GZDA 1Q7TA 2JH9A 4J0CA 4KVAA 4BB5A 2I4MA 4R3UC 5B36A 2PFKA 2FPGA 1E1DA 3KB1A 4FOPA 1YOVA 4TKVA 1EXVA 5KOYA 2F64A 4OB8A 1PUJA 3E1GA 2UUPA 4XTRA 2ZT7A 1ZA1A 5G0UA 5ADUS 1KZ7B 3AG5A 1IBSA 1VI6A 1C9DB 1QVAA 4LZLA 4U7HA 3SF8B 1C50A 1YO6A 4FXOA 1BCRA 4G4JA 5EZQA 2CFIA 2E4VA 7YASA 4R1OA 5B2FA 5AKKA 3FTEA 3EXG2 1NMXA 1ZHFA 4HUQB 4AJJA 4CMEC 5D8DA 2CLDX 4TLEA 2V0NA 5JAUA 4PZLA 1PV1A 3UJPA 1QK5A 3T3HA 3F5DA 3LUKA 3KS9A 3C1TA 1QGDA 3D5EA 3IDZA 1O77A 1Y3IA 4LOAA 1I2BA 2NTYC 1UJ4A 2ODWA 3L18A 1ZVKA 2FX2A 3MIIA 5FFNA 2QW0X 3VNQA 3RLIA 5BV7A 3GWZA 1CHDA 2VRNA 4ZTUB 3TD6A 2DFKB 3GFFA 1W44A 1N2EA 2HDOA 1SPXA 2ONCA 1QB7A 4HGQA 3K2QA 4IO1A 2H18A 4DAEA 3WGIA 1LBIA 1W0JD 1IRXA 4RCYA 5F1PA 3WWYA 3ZV6A 1R3UA 1ZMRA 1GDTA 4B3FX 3M3HA 1I32A 4G8DA 2J5KA 1FA9A 1YJ8A 2F3PA 2NYRA 1SKBA 1LLQA 1A1SA 4LHVA 4QUIA 1H94A 1Y7TA 4HOYA 2HTEA 2Z57A 1Q0ZA 1RQGA 2GO7A 3F6EX 9MHTA 4MICA 2JGRA 1X92A 3KALA 5FBKA 1O95D 4AWBA 3DZFA 3LRPA 1Z47A 3OMLA 2WMYA 1KOJA 1SHJA 5ERGB 5CEJA 1CUDA 2FWJA 1F1JA 3I1JA 2GN0A 4B2IA 4EEKA 4YR7A 2FN3A 3DEAA 1BD3A 2YIMA 4G5QA 1E69A 3QXGA 3OWXA 1WMAA 5B3LA 5LWHA 4ED9A 1K5HA 1R5NA 1EM6A 2X1VA 2X42A 1DIAA 2VFAA 3S7ZA 1CLEA 4BKOA 5CH8A 2XOKA 2J45A 2AQHA 2OD9A 1NKSA 1X1RA 3CNQS 3PWSA 3RSCA 2HSZA 1JNYA 4LYEA 1TW2A 3EXEB 3EXG1 2IS1A 1SCJA 4LXUA 1I4LD 1XNGA 4PSDA 4BRUA 5CYGA 1EGAA 3D2AA 3B52X 1ADCA 4AMVA 4J1NA 4MV8A 4MRNA 1KKMA 3WXBA 1THZA 2HMUA 2FEXA 2VK8A 3LFTA 3PVSA 2WT4A 2PZKA 4HH1A 4MUIA 3L7MA 4B3JA 4KSBA 4HATA 3HB0A 3MNFA 4AM8A 5C52B 3PEWA 4XIGS 1MFPA 1S8FA 4TYQA 1GQQA 4UATA 2XB2A 1QFZA 5IVDA 2PN1A 1QIDA 3EXAA 1I13A 2PSJA 3EDQA 3MIZA 4JNKA 4I3GA 1XJQA 4JBLA 2XB6A 1L7EA 1F4PA 3LIPA 3VDRA 1O0CA 1YL7A 1Z07A 3ANXA 3OA0A 4JD5A 4XCXA 4C4TA 5EXPA 1XAJA 5JD6A 4U2DA 1GM5A 4UCQA 1F8YA 3E9ZA 3QPCA 3HU1A 1WXXA 4DM3A 4RHCA 5I4CA 1ZVQA 4OQPA 3P2YA 1VYUA 3GFQA 4LYJA 3CNBA 1Y3CE 2Z2XA 3AJ8A 4QOHA 1RMTA 3BULA 2HSWA 1GA1A 3A9RA 4H3KB 2H00A 3DG9A 4NTZA 1ESNA 3B6ZA 4TMKA 1N0UA 2BFBB 1OH7A 1Y63A 4OFWA 4ASUD 3P26A 3KR1A 5ENZA 5A3SA 1W93A 1OZAA 1XA4A 3GLTA 3QBTA 4MYRA 3KM0A 5K6RA 2IHTA 2YHIB 4G4SO 5K8JB 3RYCB 1EGHA 1RZ3A 3HM9A 2GBIA 2PUAA 1SG0A 3FH0A 4FNGA 1QO7A 3ZZNA 4R8KA 1ZIOA 8ABPA 3V7WA 3COPA 1UZAA 2X0JA 3JD0A 3GDHA 5DNDA 4HR7A 4EKYA 4WNIA 2N1BA 1IL0A 3LYLA 1JTFA 1VXOA 4LTDA 4REMA 3H9BA 3L8CA 4WK2B 2OYSA 1IOLA 1P5FA 4Q24A 3ZPXA 1IHPA 2BGMA 2JCVA 1H1LA 1ZM3A 2Z3ZA 2UUOA 3TCKA 1W8DA 5F5XA 2V55B 1ZIYA 3U49A 2OTCA 3HR8A 4UJ5A 2PWYA 3LH5A 4RF5A 3LXRA 2R4UA 3Q98A 1O95C 2ZS9A 4FMCF 5BSVA 4ZQEA 2XCTB 2H4ZA 3MOIA 2OGWA 1OLUA 3D8RA 4C0AC 2W0SA 2HWWA 3N86A 3KWJA 2ANCA 3GBPA 3MK31 2G5TA 1KMHA 2YCLA 4KBGA 4LK3A 4KPFC 4QWMA 4YDQA 3OPYI 5F2EA 4FX5A 1Y8CA 1Z62A 3OT4A 2I91A 3TUIC 4MV6A 2C5BA 2QN8A 3NJRA 4A91A 3H87A 3DEFA 1ZCZA 4C0QC 5C3UA 3CLSD 1ZCBA 3E22B 4US2R 5KJEA 3EPHA 3ZGVA 5L3ZA 2IH5A 4M1ZA 3G9QA 1CZOA 4H1WA 3P4UA 1SHKA 5FLYA 2IU6A 2B98A 4G6ZA 2VOJA 4RVCA 3ABOB 3NKVA 2Z98A 1J09A 4LYFA 4WINA 2DLCX 2JFBA 2L82A 3OWOA 4EB6B 2RGEA 1A72A 1J2UA 1FP4B 5A4KA 2JD2A 1FE8A 3HS3A 3HB5X 1IK4A 3C6BA 3UN1A 4CDNA 3WAJA 5ALNA 4Y9UA 2V45A 1MJHA 4EAAA 1NYQA 3CNOA 5BMVF 5AW2A 4C2UA 3AFGA 1PK8A 2NO0A 5JNVA 1LLFA 4U3JB 4BMVA 3U4CA 4ZCMA 2FW9A 4X92A 3C3JA 1AK2A 1R6DA 3DEHA 2CDNA 3V4LA 3O82A 3K0KA 1PQYA 1Y6RA 2HDWA 4F6RB 1J8DA 1E2MA 3ZEAA 1NBIA 1VG1A 4D9GA 1J22A 2VO1A 3E0XA 3WA7A 3B20A 3OUZA 1OH8A 1IDOA 3NPMA 2HI0A 2ARKA 1C3XA 3A9VA 3HKCB 3OZUA 4KO4S 4Q4AA 3TD2A 1TMYA 4DC1A 1NI4B 4MDYA 4QIHA 5E7MA 4RTPA 1WUKS 5BQ5A 4KPYA 1EQUA 3RNOA 1Q3KA 3R77A 3T7RA 2JLVA 1IXKA 3QKRB 4P58A 1FNNA 4B44A 1VFNA 1PAUA 4Q4DA 2D59A 2OL4A 1COZA 3GH3A 3PPIA 4KQHA 1KIMA 3CQ9A 5DM1A 2GCIA 3RAEC 3QEOA 2OA0A 5JTTA 1YQDA 1SBQA 4NCAA 1X13A 1YBMA 4AJIA 4Q9IA 5AJZA 2PL5A 1NSYA 1FU7A 4RV5A 1K4MA 3BCUA 3EVZA 3KDSE 1I3CA 2BKAA 3L0OA 1SG6A 1NUPA 2YWRA 4GPAA 2NU6A 2D00A 4HWGA 4J94A 4MRSA 1KQNA 5TX7A 2I1WA 1KU0A 2FMKA 2WYHA 4TM8A 3KQWA 3CX6A 4H7EA 1F8FA 1H93A 3N53A 4Q7EA 3RRJA 5T7BA 2J8ZA 4JJ6A 4G4GA 1LRKA 4Q48A 1PJAA 5BP7A 2VRCD 1Y81A 5HK9A 2VHCA 5KQPA 3AVWA 4MIOA 4ZXPA 4ZV9A 3ZNQA 2Y4OA 4JB3A 1EFDN 1ZUNA 5EGSA 1FW6A 3EMKA 4QPCA 3BD7A 4Q9DA 1ATIA 2CYBA 5FLXA 1E0AA 3CX4A 5IVPA 1MVOA 4OF4A 3RU2A 3TSAA 3AU9A 3G2PA 1PG2A 4NMXB 4PPNA 2DECA 1PZXA 1E5LA 2E49A 2I8LA 3CT6A 3T06B 1T1SA 3TOSA 3E15A 3NFRA 2B92A 4KR3A 3LAWA 4OLBA 1JHUA 5THKA 3QPUA 4UTZA 5H1YA 3IVCA 3MWGA 3LOQA 5DCWA 1P4HA 3Q8WA 3QPDA 3R7AA 4MEBA 3VR6H 3JQRA 4MS4A 2LW7A 4S1WA 2O3TA 4DCVA 1Y6GA 5L95A 3KBBA 3MMNA 1P33A 2ODEA 3BL8A 5T3YA 1GZHB 4A8JB 5GVSA 3UMYA 3ANYB 4Q3BA 4QBGB 1EWKA 1YACA 3S8YA 3PQCA 4PAQA 5KDOA 2PE5A 2I7VA 3WIDA 4FLEA 2ZREA 3W1VA 1B41A 1UOQA 1XJ5A 3HYCA 1B0AA 1D9ZA 3NWJA 4O8ZA 3IXMA 2Q5IA 1E3LA 3RF7A 1N5JA 4F45A 2O3SA 3KJHA 4GR9A 2H1WA 4FCVA 3BXEA 1HTTA 4NOMA 4MRMA 5FFMA 2C9MA 4D7AA 5K0CA 4NAVA 2HJWA 1A9XB 2ZRGA 3BB4A 4GL4A 3F6SA 4KWCA 3QVWA 5DWVA 3LLMA 5FOXA 3ZLVA 3LTNC 1RWQA 2PRKA 3WB9A 1B1CA 3EMBA 2H54A 3OM8A 3O4GA 4R1PA 3FWHA 2DQKA 2YDXA 3AT1A 3PNPA 4JX8A 2ZTHA 4TMWA 2CK3D 1HKUA 3L2OB 3IQGX 1X7YB 3FAKA 1I3KA 5J63A 1I5OA 1QKIA 4JJKA 3TL2A 2EL9A 2ZUBA 3KAJA 3HRHA 4EGAA 1W5SA 1Z0ZA 4WOBA 1M5UA 4PHFA 1BWPA 1TD9A 4LBVA 3GP8A 2LP4Y 2VHJA 1Q16A 1QCYA 4YMLA 1XVTA 2WILA 1G20E 5G41A 1A4XA 3ESQA 5BV8A 2WV7A 2X1HA 1A69A 2D0OB 2DWUA 3QRWA 3JW8A 2EU8A 1E77A 2JFOA 3GP3A 5HOQA 2DT5A 3FMOB 4KGXA 1KYQA 5TSDA 2RKBA 4I6EA 4Q7KA 2C9BA 2W58A 3SE7A 3WK4A 2XMQA 4YRMA 2CV2A 2FXVA 1NHGA 1ORWA 4CIYA 4A6DA 4CV0A 1VP3A 4EARA 2JHFA 2AQIA 3DAYA 1XZAA 2YZ2A 3EIHA 1L4YA 4KYTA 4GBJA 2BGWA 4FD3A 4OQXA 3S2IA 2AKEA 2RGCA 5HMMA 1AQLA 1PFKA 3DTVD 2WG1A 2FVYA 4LY3A 1UBKS 3KZOA 3RASA 4KPUB 5I7VA 2GK3A 1EM8A 1HLDA 1NLMA 1NRXA 1SAYA 2X5KO 1YR8A 3D0KA 4MZDA 4NAHA 3SJBA 3WBFA 5F23A 5JSQA 2DPXA 5LP6C 2E4AA 4GM4A 2PX6A 3MSCA 1SUAA 1OI3A 5JZBA 3Q7QA 4MWTA 2Z30A 2WICA 2ZJ5A 4GLOA 1G8MA 4NS4A 1O7JA 1XXHA 1ZP6A 2ISSD 4YAGA 4JP8A 4EX6A 3C0KA 3GJQA 1PJ8A 2X4IA 1K0FA 4PZ9A 5G0TA 4B81A 1DRWA 2WM2A 5LP1A 1SIOA 2N75A 2JLUA 4A92A 1K7YA 1ZD8A 1Y48E 5T57A 2XWBF 2CNBA 1EWRA 3E4CA 5LOVF 4JVSB 4JLUA 2DR2A 4LZWA 3I6IA 1SGWA 3VSCA 1V3QE 2UUAB 3PYXA 2FPUA 4CCSA 4P6VF 4R1TA 3OJWA 1X8LA 3VR6D 1KTIA 2G3YA 3SF8A 3FCXA 2FG5A 5GWXA 1SUFA 3DBRB 3IV6A 2J6IA 2MSEB 1Z5GA 3FKSA 4UEWA 4ENPA 2HC9A 9ATCA 3PUZA 4HUQA 3Q7EA 1QHNA 4FW9A 4EX7A 1OXUA 2V3VA 2HXGA 1ZGCA 1PZHA 1XTUA 2HF9A 3ICWA 3PT9A 4FYKA 3RI3A 1CZKA 1F5NA 1SBHA 4IRMA 3GELA 4RXUA 4D43A 4YP9A 5JNSA 4UULA 1DO0A 3IALA 3NIFB 3E7WA 5DH9A 2NZYA 2AEFA 4DJEC 4HUTA 4G5FA 2WHEA 2ZQYA 3RSLA 1KJQA 1T1GA 4C2TA 3L9WA 4NBVA 3P4YA 5BNWA 2ZBFA 2V3WA 1F1BA 1L4LA 3CZRA 3GAZA 3PT5A 2IS4A 3S1LA 3W6UA 5EHXA 3CCFA 4E6EA 2BEJA 5EWJB 4EL5A 2IA5A 5HF5A 1XL1A 3FTFA 4U7PB 2QVGA 5BXQC 2DKNA 2HR1A 3DH0A 3GLRA 1VSUA 2A1IA 4C2BA 2QLJA 1WD5A 1M3SA 4KGVA 4R6XA 2YV5A 2P3QA 4U39A 1RABA 5TPZA 1JDVA 2CL5A 2IEGA 5CG1A 1T9BA 3A3KA 2JI6A 4KQMA 1SKUA 4RTOA 2O3QA 1C5KA 3ADCA 1HE3A 1FDRA 4ZJPA 3KFXA 2C2MA 3EAFA 3KSZO 4K9DA 1E3IA 5TQ2B 5KI6A 5C8XA 2QTTA 2D1RA 2YN2A 3ONEA 2QG4A 3E2IA 4WCFC 4UBNA 3ZVLA 1CUHA 1U3CA 1C7QA 1I6WA 2WFAA 1G55A 1ORDA 5AW4A 1JHYA 2A5JA 2BGKA 4GMFA 1TUGA 2QD3A 5LQCA 3EXEA 4INZA 4WJLA 3CWCA 2IPMA 1A82A 1U6JA 1E4VA 1TA9A 2FWMX 3HDTA 4ZAFA 5AUPB 2P91A 1WHSB 5EE0A 2DBVO 2MTBA 3EIXA 4BQPA 2E48A 1QRRA 5BWBA 1EWVA 3OIUA 4KYVA 5I9TA 3LX6A 4IUCS 4UZFA 3HSYA 3DEKA 4CV1A 2FR8C 4J9VA 3I2IA 4JUBA 2EWMA 3GDWA 1IOZA 1DWPA 4TQAA 3NOXA 4JN6B 5FTLA 2BMFA 1D04A 4KXMA 3U19A 2XVZA 1QHFA 2OOSA 4TQ9A 3G82C 4UM8B 3CVYA 5K0NA 1XU7A 4QT0A 1QPGA 1XL0A 1AQYA 4HNGA 4I4TF 1TVEA 5FB3A 1QQ5A 2GM3A 3EZ2A 1YKSA 3G2JA 4UNQA 4XJSA 4XEUA 1HYBA 5I7AA 2WM9B 4CT0A 1V3TA 1MB9A 4DQDA 3WV4A 4MYDA 4RWZA 1N5IA 4FMPA 1HFJA 1GWNA 5FHQA 3BIXA 3UHJA 1NMYA 2HCRA 2VA9A 2ZJ6A 1GADO 1TQ6A 2ZRBA 3T94A 3EA0A 5KUTA 2JARA 3OPMA 4W82A 1O8BA 2V7UA 2VPTA 4KV7A 4C7JA 2EHJA 2PQMA 1USUA 1Y7HA 3F47A 4LWZA 3CVWA 3TSZA 2DKFA 5HVNA 2R2GA 2SKDA 4J1SA 3QE2A 4ZAGA 1CY8A 3NBYC 5MN6A 1DG1G 3IPXA 4J1TC 2YHIA 3VYTB 4EB8A 3RYCA 1N1MA 4IW3B 4I9UA 4INOA 4AB1A 2OBLA 4RK6A 1ODSA 4IIFA 1K89A 2VYVD 4MMYB 5JQGF 4DQXA 4BNYA 4C7KA 2REBA 4YRSA 1XZNA 2PS9A 2QTMA 2FSVC 3F6RA 5ILOA 2XXJA 3STUA 4UM9B 5ICGA 1Z6XA 5DWQA 1TCCA 2ZRKA 1EAMA 4O4HF 5F9MA 4ZHQF 2CKDA 1QVZA 1P2DA 1QRSA 1E89A 4HT3B 1FUYB 4HX5A 2CLMB 3FNGA 4XRGA 3EPPA 3ROQA 1U1IA 3ZCPA 2EHDA 2XA2A 1IU9A 5LMZA 4IJQA 4LXHA 3BXPA 3OIGA 4OQ4A 1YSCA 4YBRA 4IIVA 4BATA 4DR3B 2DFTA 5D7NA 3OLCX 2REOA 1MVNA 3R0IA 1XPJA 3RUAA 1I4DD 3PA8A 3B6JA 4PGMA 1CUCA 5TARA 1FSFA 2ACVA 3E22A 2WUFA 4Z8XA 2AMYA 2JZNA 4Z0TA 2GD6A 2J5RA 3CTMA 2C4KA 5TQVA 5B5SA 5ED4A 4NX2A 2EFDB 1KZ1A 3TB6A 3AEYA 3T41A 2O5EA 1Y5RA 4K87A 1CLUA 5IUKC 2H4XA 4DHWA 3F2IA 4Y2QA 2FN4A 2VSNA 3TRHA 2O3UA 1FLNA 1LQTA 2BJVA 4QDXA 4E6PA 4GZ3A 5F3DA 1RYHA 3EX7C 2F1OA 3H65A 2HA5A 3F74A 4QWWA 4B3TB 5FDFA 1FP4A 5IYZB 1X80B 3LHFA 3DGEC 4CV3A 2P9YA 1N7JA 3PC3A 3RODA 4G9BA 1Q19A 1SCKA 2MOKA 1NW3A 4QUDA 1CUFA 2VN8A 3V8RA 1XZ8A 1CKEA 2XRMA 3CRNA 2R48A 4U3JA 2JFPA 5JVDB 3I9V6 1MW9X 2QMYA 4PO3X 2AHRA 3NHKA 4H6VA 1AKTA 2HDHA 4F6RA 4GOND 4HJRA 4W1SA 2QZ4A 3B38A 3MYRA 4IVPA 2AX3A 1P39A 5AOBA 4AJ1A 3HKCA 2OZPA 4NV3A 4E1VA 1B6TA 1NUHA 3GD5A 1NI4A 3O95A 2RONA 5FLKA 2ZBQA 1F7UA 1D6JA 4AI6A 3FRIA 4K6HA 2VCHA 3O92A 3MPUA 3H5TA 3HRKA 5D01A 1IQPA 2IF0A 3SPXA 3ZG6A 1HKHA 3NATA 2PBFA 5K3EA 2JLWA 3LVQE 2ZAYA 3QKRA 2BKLA 2EGHA 2KX7A 2SCUB 2NADA 1RJEA 1EDDA 3EEOA 4EH1A 3WJ7A 5IZCC 2PMEA 1I51A 4ID9A 1NVTA 2AFVA 1FXWA 2YMPA 4RORA 5HQ3B 1X2EA 4EHKA 4DV0B 2QPTA 3DYIA 3EE6A 1KSFX 3LPCA 4O59O 3CZPA 1AS3A 4TLMB 4DV2B 1GRQA 2COKA 5EA2A 3R5SA 3KOOA 1HE4A 4BB0A 5TT0A 1KK0A 1ML3A 1VCNA 4L3VA 4ZU6X 3BL5A 4PGGA 2EZ8A 2FOIA 1YAHA 4LV8B 1XT6A 3JZIA 4EWLA 2V74B 1EDOA 3OZSA 1Z2AA 4H1UA 1GPNA 1XZDA 3UUGA 1O2DA 1D1QA 4IV5A 4KWHA 1VYHA 1VE5A 621PA 2ZR7A 4RCZA 4KV9A 4JJEA 1PFVA 4NU8X 3BG5A 5G1PA 3WDLA 4QM6A 1RAIA 4LRUA 4WLUA 2IX3A 1NIJA 2VJNA 1KYIA 4IBOA 1Z35A 5D87A 3KO8A 2G0AA 1W581 4M7PA 1MC5A 1DQRA 2QLMA 3LT1A 4W9RA 1JEDA 5BSMA 4F1KA 2WW8A 4I1IA 1NQVA 5BRNA 4C0KA 4ZU3A 1OFHA 3N8KA 2HN9A 4JX9A 1TB4A 2XCUA 4L15A 2NZXA 5EP3A 3PFIA 2FPMA 3EZFA 2FZGA 3WO1A 1MOPA 3FDJA 3JQAB 3QI7A 4G9GA 1DUIA 4AK9A 2AF3C 5EHZA 1O5OA 4YHBA 2NO1A 5HIJA 5T8KA 1G66A 2CXUA 2OMEA 1MH1A 1XQYA 2VHZA 4ER6A 4A8JA 4NABA 3QELB 2BLNA 3KRTA 3LQQA 3IR7A 4QO8A 4RPKA 2HMSA 3R7DA 1BQ4A 2X2EA 4DSZA 3NVDA 2O9JA 2XEDA 3DBVO 3WSTA 4WVFA 2AOXA 4FHCA 1SQFA 2O8BB 1VKOA 4XSHA 4AF7A 3OJ0A 4IH9A 2QPLA 4HNUA 3WNQA 1Y9ZA 3DE7X 2LV8A 3IVXA 3O31A 2O54A 4MQ4A 1RM3A 1A5TA 2ERCA 4JP5A 1A9XA 4HWTA 3DLTA 2NV0A 2R79A 3M5PA 4JBIA 2EJTA 4I08A 4WBXC 2HQBA 4UPVA 1GAXA 3GN2A 4FYJA 1H9CA 2PZ8A 5DKFA 2A5YB 4N48A 2P9JA 4MEAA 3IAXA 1G5RA 5AJWA 2DFNA 5IRCD 5EPOA 4EI8A 1A9PA 4Q4LA 4B3SB 1X7YA 4EFKA 4XXHA 2CLOB 1J8VA 4XUCA 1F38A 1U0HC 1V2HE 1GU0A 2KM1A 1U0RA 4ZT5A 1GKLA 1ZONA 1PSDA 4JC4A 1YE5A 2W7TA 3AF0A 3UHOA 5ENDA 1O6BA 3S2UA 1G8GA 1JB9A 4KACA 3F8WA 5EIXA 2FDRA 2Y66A 1RACA 1OW3B 2Q5OA 5KWIA 4HNVA 3MS7A 4OLFA 2XGJA 1WUJS 1GPKA 2Z3WA 1JDBC 4OHZA 2Y8EA 1Z17A 1IIBA 4QHYA 4QELA 3MJHA 1US8B 3QY9A 4BMSA 1YR7A 4F3KA 1SU4A 2BISA 1YHZA 1ZW1A 2ZK7A 3LHIA 6LDHA 4LPSA 1M10A 5KSWB 1E3EA 4XSGA 4FS8A 2H2DA 5EP4A 3JQCA 2A8YA 4Y2TA 3HWWA 2OD2A 3QTTA 4P86A 5MGBA 5HIIA 2BI4A 1FOEB 3M1IA 1LKZA 1ONBA 1MA3A 5T41A 4I4LA 3SCZA 1M6YA 2HF2A 2OLEA 4DA9A 4BQFA 1H3NA 4BHTA 1CF9A 4M9XA 1GNTA 4CCAA 2EGGA 2TRSB 3DDZX 1K8XB 4NOJA 5E7QA 4KPUA 1G2QA 1NURA 3UVEA 1LBEA 4Y2XA 1M6EX 4Q1EA 3UW1A 4E2XA 5A9TA 3VGJA 1X38A 3IAM1 5AT1A 2Y68A 4HGPA 2AFHE 2HLDD 2ZUCA 4WKGA 2CLIB 2DEUA 2WMNB 4JLVA 4ZC8A 5HF6A 3RK4A 4QFBA 1LD3A 1V8ZA 3ETGA 1JG2A 1JZSA 1TCBA 2PGNA 1JWAB 4UUBA 4M99A 2YVQA 2R62A 3VPFA 1RXUA 1VHWA 4HAOA 3V1YA 2C3OA 3WGHA 2JAWA 5C7YA 2J07A 5BXYA 1M72A 1WVGA 5DGIA 5EWMB 3KX2A 1K5PA 1N9ZA 4MW6A 5CB0A 1NG1A 1YUMA 4A0SA 4CMAA 5KEIA 5LMNB 1D3AA 4NCNA 5M2QA 3SIRA 4BVKA 2Y1XA 4RKRA 4M49A 3W8FA 5DM4A 1IBLB 1UKEA 3EZ7A 3AVOA 3AG6A 3LC7O 1E6KA 4CTOA 1LK7A 1NSFA 2ZJOA 5ER9A 2YOHA 4ZGGA 3H11B 1TEZA 3AI3A 2HNAA 3DMNA 2AEMA 2HXYA 4Z3DA 3MXOA 3ND8A 1I14A 2R6R1 4KH1A 2I3ZA 4OHCA 3DBRA 4D8YA 1RPZA 4DLSA 1JALA 3EOBI 2FFJA 1SULA 5CXUA 3CUTA 3LLSA 5GZ1A 3NBAA 1P9NA 5KOHB 4X64B 3TE6A 5HA5A 5A9SB 4U5XA 4QT4A 1Z4LA 5JAQA 4LKRA 2QB5A 2XT6A 3PRKE 4O02B 5AI9A 3N8HA 3RR2A 3KJEA 3SN6A 5IABA 5L4NA 5LD2B 1UMDB 1QFMA 1RKQA 3IT3A 4ND1A 2C1ZA 2BFCB 1Z0JA 3U3KA 1YASA 3O8BA 1XCBA 6AT1A 1RI2A 1CQJB 2BFWA 5IBPA 3UNXA 4A2PA 4BVAA 1NBEA 4K6GA 2RJNA 5KVSA 3N8DA 2I6XA 3H1GA 2FY8A 4FK8A 4UTNA 2AD1A 4IMJB 4II7A 1QH0A 1RRGA 4O4JB 4UXJA 1D2CA 3PZBA 4PLFA 4Z1MA 3O2NA 3FZEA 3IURA 3QE4A 3QOWA 2HD4A 4XIFA 2ZCJA 4ALIA 4MV5A 3EXHC 4U2FA 1ZK4A 3GJSA 4LQLA 2BC9A 4MWSA 5T4EA 3UXHA 1KI3A 4G4IA 2G5CA 4MW7A 3D6TB 4Y2JA 1STOA 1M2HA 1Q0UA 3L0ZA 4RPIA 5BNFA 3OY2A 2PPVA 5IAEA 3VOTA 4QSHA 3PL5A 1YRYE 1KETA 5TQ2A 2JBWA 3R3HA 2WA2A 2XTMA 1RXSA 2XR1A 2D5CA 2ZIXA 1FYDA 1WVIA 3Q1LA 2YW2A 3L7AA 5DLYA 2Q3CA 4BLSA 5KTTA 3UBTA 4FGSA 4OYLA 3MN1A 2PD4A 3MRSA 3OHMA 4RLQA 3QXXA 1QP7A 4D9NA 3KUXA 2WP0A 1UK8A 1M0WA 2Q6VA 3LVBA 3H1AA 3GO4A 3MHTA 3QWHA 4D82A 1SOUA 1TZJA 2R1ZA 3KLOA 1XKXA 2BM0A 4GEGA 4QEZA 4DSUA 1DQNA 5KSYA 1RAGA 1WHSA 1D2GA 3G88A 2G0TA 3FXAA 4XEHA 4C3VA 5E4JA 1IZ7A 4JOBA 1P9WA 3W2TA 4CEHB 3JZAA 5KTKA 1EJ6A 2DHQA 3VAYA 4OGFA 4UNPA 2AG0A 4OO3A 1XXLA 2HXSA 4ZEWA 3UT5B 1X7GA 3E5NA 4BQNA 3QU4A 2Z2JA 4JU8A 5DXFA 5KAPA 5T4HA 5HSGA 1SU8A 2V96A 2XTNA 3AI2A 1G0NA 3OKAA 4XUDA 4KXQA 3SVZA 4B2PA 9GPBA 1Z63A 1QLJA 4GRDA 5F2OA 3TRDA 2UVDA 2C7VA 2HMAA 4B6JA 2AXPA 1ZO8A 2JGLA 2RAUA 4WFIA 3SLRA 3VDXA 1LF5A 4MYHA 4W6QA 3ANNA 4NEGA 721PA 1K63A 4MQBA 5CDUA 4X00A 2JGDB 3RS5A 2V4MA 3TZQA 5KC8A 1HYEA 3D6UA 3JYHA 1W2WB 2CFCA 3L92A 3LDGA 1PGQA 1NBMA 4FIDA 4I1RA 1ID1A 5BR1A 2XAAA 4ZCPA 3C4QA 4HDCA 4FB5A 3C6MA 5ERYA 2GO1A 1BE1A 2RHOA 3K9NA 3GVPA 5IKOA 4MLCA 1U3DA 2PQ2A 3VI4B 5U4XA 3B3QA 1YGYA 6Q21A 1FP2A 1MIOB 5KAMA 3VVCA 3L04A 1N3BA 2XNHA 3DPSA 2YHUA 2OCKA 3KOUA 3LM8A 2Q0SA 3LOPA 4PY2A 2FUEA 4R81A 4KG7A 1NC1A 1YRLA 3OX2A 2L69A 1J90A 3E3NA 4I3HA 2DPYA 2QT1A 4R54A 3AB3A 1Z15A 4D0LB 4QOEA 4L9SA 2QM7A 5B6JA 5H4GA 2QVZX 5AFSA 5BQFA 1DCFA 4DLAA 4IP0A 4KNWA 5JAOA 4PYLA 3RYFB 3JX9A 1IXSB 1Y9AA 1L8AA 3OAAD 3LDUA 2AZ4A 4QVIA 2FRVA 2XMDA 1JSXA 2JD1A 3B6KA 3Q41A 5KX5B 4Z4QA 4L5YA 4AKHA 4WXHA 4U7TB 4FJ0A 3DHEA 3CX8A 1P77A 2OCGA 4GPTA 4US1R 2DBZA 4MIEA 2P6PA 2H8GA 2Z6VA 5AWFC 1WMFA 4Z2AA 3GLHB 5DX0A 3T7EA 1D0VA 2QU7A 4XDZA 3INGA 3OECA 1QDEA 4JQOA 4MB2A 1DT3A 3QY0A 3R9XB 1D7OA 4AP9A 4MUFA 3T1NA 3MWYW 1K5GA 2CE7A 1FXUA 2QE6A 1FNMA 4M1EA 3KXPA 5DI3B 2ZIZA 3KETA 2F8SA 4XVHA 2ZSDA 1EB8A 2W2QA 3UENA 1ODFA 5KKAA 4RDXA 5K0TA 5E1OA 1JHOA 1U2RA 1E3JA 2OFPA 5AOAA 5JRDS 4DIOA 4KH0A 4JROA 1TAGA 2ZKLA 1GGNA 2VYFA 5CTAA 4ZRMA 4UCWA 3OBIA 3UOAB 4R2IA 1IXZA 3P0IA 1EX1A 5JW6A 5JC1A 4X62B 3T95A 2ROQA 3QEKA 3QWFA 5COBA 5B1YA 4TX1A 4PCAA 3NTOA 3EZ9A 4QUGA 4EQ6B 5SY9A 5KIAA 2EG5A 1YE3A 4F7DA 1PDOA 1KIAA 3LCMA 4QEKA 4TL6A 1Z2EA 1X80A 1SCDA 3L84A 4LYYA 2RC6A 1E2UA 3WQHA 4KE8A 2XBMA 5DBOA 4PFJA 2AC7A 4DIKA 4H2DA 4BNIA 5J1SB 1WXDA 1LBSA 1CZRA 1JG3A 2JVKA 4P7FA 1C1DB 1IVNA 4XVRA 3I8XA 4MW1A 3M2TA 2QU8A 5H16A 4V0LA 2V7VA 2ENUA 2OGZA 1V7ZA 4WERA 3LNTA 3MCAA 2WOOA 2X9LA 5AXCA 2AOUB 2JA1A 3W8EA 1ZOSA 2OP0A 1KZ4A 1FYVA 2EQBA 1Z2CA 2WVAA 3TRIA 1S2GA 4BX2A 2IIQA 2AG1A 5BNTA 4MLZA 4UE3S 3TSYA 3EVEA 4BV3A 2G36A 1XPRA 2C2YA 4OJTA 2GBLC 4ILEA 4DDWA 4JNCA 4PG8A 4FYWA 3HHEA 3ZCRA 5F2KA 3ZLJA 1JSZA 2SCUA 2WG0A 1T3GA 4KLAA 2YWGA 3GMTA 3JSAA 4XDHA 2P1RA 1H65A 1U63A 3FR7A 4YJ3B 5HQ3A 2GESA 2K2QB 1ZBDA 5DNVA 3AHFA 3CU5A 3GJ8A 4MVCA 4BNTA 3N8NA 4BFSA 1XBTA 2EW8A 2RBEA 3Q3EA 4URWR 1N9KA 3AY3A 3S28A 5I47A 1H9AA 1JFTA 3BWVA 3QLVC 4N54A 4UAUA 3NB0A 2XX3A 3FAZA 4EZIA 2YKGA 2PLNA 3I2KA 1IEWA 1SZPA 2GVNA 2XYQA 1FS5A 1OASA 4K40A 4D81A 4L8FA 1AA9A 1H66A 4J6EA 3JVIA 3N0XA 3OKPA 1ISHA 1Q1BA 2D2VA 2QHXA 2Z09A 2AMFA 3PU6A 1IAQA 3PPVA 2O59A 1XTPA 2P62A 1GLGA 3EY4A 3SZ3A 2QI9F 3JSXA 4U0JA 4DE5A 1GAEO 3ZBPA 4JOSA 4KFUA 1PWEA 4ID3A 4TWJA 4TVKA 1VE7A 4AY5A 4YT2A 1ADFA 3VC2A 3GPCA 2ACWA 4ITVA 3N28A 2J4DA 3MD9A 2JCYA 3D6VA 1Y1LA 3GXOA 1ZR4A 2VWQA 1Y1SA 3LYUA 3Q6IA 4DJDC 5HX7A 1B8OA 4I9FA 2B35A 1Q3TA 3OLQA 2J4CA 3SEQA 1UPTA 2IYFA 3PFKA 2F8TA 3HP1A 3JQAA 3SJUA 3VPCA 1EVEA 5EUMA 3FPLA 4F38A 2VSYA 5TGTA 1ZKMA 2GNAA 5H3LA 1NC3A 3EYWA 3WB2A 3GYBA 5I9BA 1P1CA 2PHZA 4Z4EA 3DCJA 3EH2A 4HVAA 4LFBB 5FT9A 4BIIA 3GH1A 1J23A 1R88A 4I8DA 4ZAYA 3FETA 1QV7A 2V97A 3C5CA 4U9UA 4KR9A 4QBKA 4URZR 3ED5A 2JJ8A 1Z4MA 4BV8A 5J58A 5U9CA 4OHRA 1Y7IA 2YHAA 3PGJA 2BFNA 4OH1A 5CLQA 3QBDA 1EBFA 3VQTA 1D09A 1X7ZB 1TU0A 1EVIA 2ZATA 3E35A 4PV7A 4Z3OA 2O8BA 3LK7A 1C3OA 2QAGC 3KOZA 5COQA 1P5ZB 4DMMA 5JY1A 1YA6A 3HN6A 2XQJA 2UKDA 2EAUA 1O58A 1R18A 1ZOLA 2Y0PA 4RK5A 4K7JA 1EK6A 1PBTA 4BXOB 4WZBA 1KAHA 4JL8A 1G5PA 3SGLA 3NI2A 1HQYE 4KGDA 2YN0A 3SBEA 3O9ZA 4RKYA 4L4RA 1JDPA 3RRBA 2H1CA 3SI7A 1UKZA 2D1SA 3M6VA 4EG0A 2XEXA 3KZKA 1PEKE 4C4PA 1XU9A 1NVVQ 3GPIA 3KJGA 3L02A 4QU0A 4EY5A 3OQOA 3NEJA 1DC3A 4CKBB 5DULA 3OU2A 2RKWA 1G8KA 1OCEA 2MINB 3OUTA 4FZ3A 4Q47A 3O5AA 2AJDA 4AN4A 5DGTA 4YCLA 1RRPA 1Q17A 1Q77A 1YZ3A 2NX2A 3GGOA 3GZTB 3QNWA 4N7MA 3AHJA 3LWDA 3ZOKA 1HYGA 4RE6A 1A7UA 1M9NA 3R7LA 3FOCA 5JPIA 5WRFA 5HKAA 3PUVA 4EPYA 3PFGA 4F9EA 4G5HA 3IUMA 3M1YA 3ULKA 4ZCTA 1US8A 1QTIA 3UJBA 2RI1A 3T1VA 3RUPA 1DQZA 1W94A 1W29A 1G8SA 4OXYA 5CM9C 3OC0A 4XVUA 1DJQA 4G8CA 1J70A 2XKKA 2C1EA 2RGRA 5D5PA 3DQQA 3G5AA 1WMSA 2YJ4A 2Y3IA 1HDOA 4IIEA 2I1VB 4XOIA 3ZV7A 2P75A 3G6KA 4CKWB 1YQEA 3NWEA 3TLZA 1AZTA 2C1XA 1OZFA 3Q2OA 3AEXA 4NJEB 2PSHA 2H9IA 4YLEA 4ZYTA 1FSPA 3FOAA 1MV8A 3KOXA 4Q00A 5A4MS 4NH4A 5LP6B 1SZCA 2XUIA 3C87A 2OEPA 4S12A 4US0R 4DM7A 4JI6B 3SJCA 2ILTA 4QFCA 4V0MA 1GCUA 2PX3A 4PN7A 1SUEA 3EMDA 2W70A 2EP8A 2WU1A 3I04M 3RH0A 4CN9A 3EZLA 5KJCA 1VZ2A 2CNOA 1EVLA 2LGJA 3EAGA 3S5UA 2Z8YM 1EZ4A 2H48A 1NLUA 4J0QA 3OOJA 3AGPA 4PSUA 1E96A 4ZOLB 5EP2A 3G68A 5FNVF 4TUYB 3AF3A 3W5JA 3KLMX 4RD3A 3VU1A 5EWMA 3I42A 4PONA 3B6MA 1M54A 2QUJA 1KK3A 1QV6A 1TT7A 1VFPA 1SCQA 2C5EA 2HBRA 1GTG1 5BW4A 1AXEA 2OXRA 3K4PA 1R8XA 5EESA 4FD2A 2KI5A 4C0JA 4P8RA 5KTMA 1X1DA 1E5QA 2HO4A 3H11A 1E1RA 3HO6A 1IM8A 5A71A 1S7GA 4X61A 3SEZA 5L45A 2GZAA 2O0MA 5CDHA 5IXSA 2O5RA 2BHLA 2GPNA 1EB9A 4U7FA 4UVGA 4CMEA 1RAEA 3E03A 1PR6A 1T1EA 3DVRX 3IPYA 1ZH6A 4YX9A 2BR3A 2ZSAA 1AF7A 1RT9A 3KJZA 5KSZA 4NBLA 4F5YA 2NYAA 3AR7A 5C37A 5K6AC 5KOHA 2GF0A 1JP7A 1UJ6A 1C3EA 1ZU5A 3IAM6 4P2GA 4W99A 5A9SA 1QP0A 3MVEA 1T5BA 3A32A 4OHMA 3D4IA 4MCJA 4BL5A 3RRZA 5B6IA 4JDUA 2NU8B 3S1AB 3ESRA 4BRWA 4BQQA 5CT4A 2ZP1A 4GC9A 4L74A 4LDQA 5HDBB 2BFCA 2CXXA 2INGX 3EWAA 3OZRA 4M9ZA 2BH2A 1NJ6A 1ZNQO 3QUBA 1CQJA 1LRLA 4UUPA 3RWBA 2IP4A 1UBNA 4ZVPA 3M83A 1EP3B 4O4JA 2F48A 4BIMA 5LYJF 1HMPA 3K2IA 4IZHA 1DI0A 4FONA 1YDEA 3FNBA 3HCNA 3MCWA 4MINA 5I8ZA 4BBAA 1A77A 2N46A 3QYAA 3CF4G 4OG2A 3LQ2A 1EH5A 4LV6A 4I46A 3LL4A 4WN9B 1XMXA 3DOFA 4HAXA 4ZYYA 4RSRA 2VAWA 4L4XA 4QBTA 5M29A 1CG6A 1NN1A 3N70A 2XUKA 2ZCUA 3K5WA 1WIWA 5F1OA 4WCFB 3UC5A 3W8NA 3C3MA 3N39C 1KS2A 1L1FA 1R12A 1YI1A 2ZSKA 2B69A 3K0FB 3GL9A 3C6KA 1GNQA 1VJCA 5DTRA 5ED0A 1TK2A 1NNI1 3U48A 4KR7A 3UKOA 5BW8A 3T38A 5LQNA 5GJVC 1M2WA 3PQ8A 2R86A 1Q50A 3EDRA 5HTOA 2F3QA 4GPD1 1CUYA 3BAZA 3GEBA 2CHGA 4WJKB 2Z8XA 3UGJA 1XTIA 2RGWA 3NTRA 4UZEA 2BM8A 4PVCA 4TV9B 4PC7A 1XMIA 2OHOA 4GNKA 4L5IA 4OOEA 4DIBA 1Z0SA 1XTBA 2HOQA 4DSAA 4NFLA 5ALZA 4RGBA 3UMJA 4DLTA 4H60A 3H3FA 4TS1A 1XCOA 3ZC3A 3W7BA 3QXCA 1KQFA 1EIZA 4CM8B 4D74A 2F8MA 3MCTA 3CH7A 4CEHA 3ICEA 4KHPB 4BQOA 2W6CX 4JLMA 2QZPA 2DY1A 3KK0A 2HF8A 4GP9A 5K0LA 3UT5A 3W1WA 3UXYA 4TXMA 4N5MA 1FFYA 1ZC3A 1BCSB 1PK7A 5HE9A 1W4LA 2JLBA 2G4CA 2DRIA 3IAAA 3OZ7A 4BUJA 5AW6A 3GLFB 1IUKA 1ZUHA 1O54A 3R40A 4EZBA 1RYNA 4NV1A 2SNIE 1DBRA 2XE6A 5A06A 1EI9A 2ZT8A 1RBQA 5K3OA 5G2OA 3RNLA 3A1UA 1ODIA 2M1XA 2BM9A 1PJRA 4YACA 3IQZA 4R2LA 3ZI0A 3DFUA 5UKDA 3O4FA 4ZOBA 3V1LA 4M9CA 5JPDA 2JGDA 4XPIB 4D0RA 5JCXA 3N7UA 1FYWA 3DEZA 1E58A 1E94E 4QG7A 1UK6A 3T3PB 3WTBA 1DHRA 3PR3A 1GEEA 3KB8A 3WHPA 1JHMA 2JFQA 3V2HA 1I7SB 1PEYA 3R5KA 1B76A 5ECDA 5HPYB 1KY2A 2PX8A 4IVQA 1W46A 1GY8A 4AJ2A 3JWEA 3SYRA 1QRAA 3Q88A 2BRUC 2OB2A 3B78A 2GERA 2FEKA 3DQZA 4MDHA 1VZ3A 1UWVA 3BJRA 1IY2A 3CN9A 1MT3A 2W2LD 3F3KA 1DIHA 4M98A 2DLNA 3TO5A 1XEWX 2HH9A 3AZPA 4YEDA 1U9IC 1UQRA 5CYPA 3HVUA 2WIKA 1LLCA 1RAFA 1WU7A 5KTPA 2RB4A 1EU1A 2QN7A 1WBBA 3CE6A 3WLHA 2JRLA 2G83A 1OI7A 1QX4A 4O8CA 2YJGA 2C5FA 3ZWYA 4GFDA 4ITUA 3F9CA 2HBQA 3IAS6 2FDXA 3K1YA 3M6LA 4LZOA 1QP4A 1GVHA 1PGNA 3RYFA 4BZWA 4RGQA 5JJKA 2GQ0A 3Q5GA 5KBYA 1EFRA 1TCVA 4P81A 4FWIB 3WNDA 3IC5A 4AFNA 5KX5A 5I4BA 4O08A 2ZBDA 1QORA 5E4FA 3PXBA 5IDVA 3BMQB 1GSOA 2QD4A 1AB5A 1MOSA 4G85A 3CBQA 4DNPA 4WCVA 4Z6KA 1SN7A 1QV9A 4M0PA 5C7OO 3HUUA 1Q1QA 3OQJA 3GLHA 4DBLE 2F1RA 1E3QA 2C83A 2Q3JA 3PNSA 1Y1KE 4EPVA 4PG4A 5EHNA 3A6PC 3R9XA 2QRMA 2AXQA 1LX7A 2A14A 1U7HA 2Q2QA 1EHIA 2JVJA 2VH1A 5DI3A 2PUDA 2AA3A 1EK5A 1Y9EA 3EG5A 3HA5A 3HNPA 3TX6A 2P11A 1OX4B 2ZBVA 3K92A 2ZAGA 4HB4A 1W0KA 1R4ZA 4CJXA 1ECFA 1U1FA 1YMVA 2PH5A 3O74A 3IDFA 2JB9A 3ZJTA 1CDOA 1ECGA 1IPEA 5DYYA 1KVRA 3HCEA 4E12A 3IT0A 3ZCQA 5K3FB 1MJFA 1KAOA 1VGVA 3IHKA 1UDAA 3NHWA 4L5JA 4L07A 3A6DA 2A9JA 5CGZA 1V1RB 2C7RA 4EQ6A 2YYAA 4MHTA 1PR4A 1GQRA 3JR7A 4HFJA 1LI5A 3CZ9A 1GYPA 1O03A 3CB4A 5JWRA 2PK3A 4NFYA 5BRAA 4FOTA 3CY6A 3VYVA 5DXAA 5MN5A 2LBPA 1KHHA 4IM7A 2Y1FA 5JEEA 4MQ6A 4OB6A 3UW3A 4FZ5A 3T9BA 1OI2A 2HM7A 3GAFA 3A2NA 1C1DA 5HFNA 5DM2A 3I9JA 5CJPA 7ADHA 2WAXA 4R1UA 1JLLB 1PNQA 3TQFA 1L5QA 3RC1A 3BGWA 1K3FA 1KDOA 1TO2E 4I5FA 1APBA 1PDWA 2XB8A 3A10A 3BWBA 3CF0A 3GG9A 3L43A 3LP5A 5G02A 4HWKA 4KAFA 4LSZA 3T5TA 3SOZA 4TKZA 1USWA 5E6UB 2W6ZA 3IT2A 3K3PA 4ZHSA 1NPYA 2AW5A 5JXIA 3VKHA 2ZJYA 1XHEA 3LBNA 1BMFD 4AICA 2DERA 1CEYA 1E9RA 2Z08A 2ZDHA 3DLAA 3H19A 3JZDA 4KXNA 1I6KA 3HJBA 4IS3A 1XZJA 4OMUA 4ARZB 4I55F 4L8YA 3JTEA 4NY1A 1GU7A 1EXWA 1VG9B 4I1OA 3HKDB 3R20A 4N65A 2J4FA 1IPFA 3UJCA 4IWXA 1AHHA 2OCLA 4KR0A 1U0OC 1LPPA 1Z5OA 3GRFA 2XDYA 5IP5A 4YRTA 3MZ0A 3WISA 1V5GA 1VMAA 3WMXA 4DLWA 1PJSA 1U2PA 2AVDA 2R25B 1MZPA 2P9BA 1X3SA 3DNMA 4LXQA 4AKEA 4AYXA 1Z3CA 2FEOA 3IMFA 4IGAA 5AK6A 2XV1A 4L4UA 2F4NA 4K81B 1JQBA 1ZD3A 1R9NA 2V7TA 4P5PA 4XD7D 1OTXA 1G6HA 1QKJA 5KVAA 4GMHA 1G4UR 1RYYA 1U3TA 3PXAA 1O97D 3R8XA 3CUYA 3WWEA 1W25A 4RELA 4B76A 4CIBA 1P1JA 1JB1A 3RQIA 4QC2A 4LF5B 3AXTA 1AQUA 1K68A 2PL9A 1XWFA 5KB3A 1W9HA 3VNAA 1MDFA 2DWOA 5H82A 3VKGA 5LJIA 4KN8A 1ZDMA 3QBEA 4KXXA 3I9KA 2ZRAA 3L0DA 1XELA 3JTMA 1QFJA 1PT7A 3R74A 2EGUA 2IL1A 3KVNA 1WDMA 4L5AA 4PNZA 5LZ9A 3IE1A 3KQOA 1V8DA 4HSGA 4P1ZA 4R2XA 3TOXA 3EODA 2Q62A 5CA1B 3CG4A 1JKJB 2IDMA 2W9XA 2X0NA 4OQMA 2PUGA 1RKBA 3IOMA 5IS2A 1N2CB 3WGTA 2EV9A 4CG2A 4ZYXA 4PAMA 5FEMA 2WF6A 1J8YF 3ROTA 1CR4A 1JXMA 1KNXA 4U9HS 3F73A 1RR6A 4DEVA 1F4LA 1GGHA 4JJ7A 2EXXA 3LLCA 4PWZA 2FMTA 3P45A 3ETNA 1AKQA 4IGEA 2WJYA 1GFSA 2WSLA 4B73A 2AKYA 1WRBA 1X7ZA 2JHPA 1QGUB 2W6NA 4PG7A 1UINA 5F64A 5LVAA 3BGSA 2IOFK 1PT8A 4PXSA 1BDBA 1QG6A 3OCCA 1CNMA 1T8WA 5LBIA 1XNRB 3WYAA 1XV5A 1FNSA 3GK3A 2PWBA 1D2MA 1ZZEA 4BTVA 3KB6A 3MQ4A 3P4XA 3QP9A 3VU9B 1FU4A 2L18A 3UWDA 5DNUA 2F8LA 4PSCA 4PYOA 1LSJA 3GFPA 4MHSA 3TZEA 5JI3E 2PGXA 1HF3A 2XLCA 5A1JA 3AETB 4ZZ3A 1NF2A 5F35A 3K70B 3DXYA 1ZXXA 2HSGA 3Q9LA 4O1IA 4FFVA 4HYQA 3JWPA 4CKBA 3GRRA 2WIDA 2MINA 1E79D 4PHHA 3ZU6A 1R0YA 5ELMA 1PU2A 1UEIA 2Z6QA 1JDBB 1VL8A 3E05A 1XDDA 2A84A 5B7GA 2WSIA 3IODA 4EMTA 4YPFA 4I99A 4LGCA 4M0LA 5ALUA 4B6FA 5GIOE 1T5HX 2O2GA 3LECA 5EHQA 5B53A 2GF2A 4WKPA 4JP3A 4U8GA 1XLTC 2D5IA 2QLBA 5L3RA 3RJ9A 3WGGA 3A6ZA 1FL9A 1IOVA 2AJTA 3OZWA 3LX8A 4ZZ2A 5AUQA 5HYVA 4YUWA 1JMVA 4GL2A 1V39A 2VRCA 4Y3UA 3LQ1A 3RM3A 3MA0A 4BN5A 5GIPE 2HWKA 4EFLA 1Z8NA 4RX1A 3K4QA 4YDHB 1U0JA 4XWAA 4Y1FA 1NMZA 1P18A 1O97C 4HFRA 5K3DA 5J2UF 2Y0DA 1H1DA 5AI6A 2TS1A 4ZARA 3AHGA 2WF8A 3IA7A 2CLFB 4LDPA 1Q15A 3KSMA 5HTKA 2B8EA 5LP6A 1ZCAA 3AILA 4LMAA 2I62A 4Y6LA 1OKKD 3PUKA 2H3EA 3A58B 5KNCH 4JWKA 1L1QA 1ONNA 2SKEA 3O8NA 4P4GA 2WJZB 1Z4PX 1O9HA 1DDIA 3T4UA 3TLEA 5A5DA 4DCUA 3U6BA 1ZNYA 1U0FA 1X8XA 1NE7A 3UMCA 5DGCA 2I65A 2GNPA 1GT91 1YGPA 4C04A 1KMQA 4ZOLA 4XLZA 2XBLA 1WZEA 5G1NA 1ZM9A 1YQ9A 3T9CA 3T3IA 5IDXA 4TUYA 1JPJA 3V6LA 3T1YB 4DJAA 3EA5A 4BFWA 3GVCA 1HG0A 1HM5A 3ELYA 3UGTA 1J33A 4EI7A 3UJ3X 2QRGA 2R6HA 3V97A 1ZYUA 1OB2A 3WGVA 4XQCA 2JH3A 3DOJA 3PA6A 5EXDA 2IEYA 5IASA 4R1QA 1KBZA 3ZY6A 4P32A 2XYRA 3C1AA 2GK7A 1JFSA 1EK1A 2X19A 2DCUA 4IQGA 1VMKA 1GL6A 4P31A 2RHMA 1OAAA 4QQ8A 1NWHA 1GUZA 3L0CA 3TLXA 4XIIA 1MPTA 1JIUA 2K6GA 5ENVA 3DF9A 5BQPA 2NAFA 5K3AA 4UEJA 4XLLA 3K09C 1EGMB 3M0EA 3OQHA 4CQLA 4KQFA 5BWNA 2J3LA 1OBOA 1B23P 1L1EA 1PL0A 1R2QA 3T0GA 5DNWA 4DZTA 2O2HA 2NU8A 4I50B 3S1AA 3VOAA 2R5FA 2IHJA 3CSSA 4A03A 1LS6A 2ZUDA 4IJUA 3RC2A 2ZU6A 3K9WA 1W88B 2CB0A 2QTBA 3ESZA 3QNMA 2HU5A 4P0TA 2FRDC 4IOJA 3HXLA 1Y7PA 1TJ3A 3PB3A 2NSDA 4DBZA 4U7GA 4BNDB 3W9BA 1PNOA 2COUA 2GZMA 2F67A 3D4OA 1ZGZA 3C3WA 3A9UA 1U7XA 1IXRC 3EXHB 2WWGA 4J7UA 5EE3A 1AMNA 3I39X 5JHGB 4J6FA 3KZMA 1XVVA 1P4AA 3C48A 3C4VA 4HMQA 4WLVA 3HADA 3JAKB 4WN9A 3AL0C 3DOUA 3HKEA 1H85A 1RRCA 3QYJA 4H27A 4CMJA 4H4DA 1U98A 2BBSA 4MB6A 2BFAA 5CPFA 3T4PA 1C4XA 3EF3A 1RQ2A 4MV4A 4WCFA 3JQEA 5DTEA 1CUAA 2DR3A 1NVVR 1PJBA 1SJ9A 3RADC 3HTXA 3K0FA 1E1QD 1SIWA 5DCLA 4JI3B 3NCHA 4A5OA 2RARA 2ZCVA 3LT4A 4CEJB 2C4NA 1T1IA 1VHTA 5JAMA 1KVTA 4UHDA 5CVJA 3C3AA 3QEMB 1E2EA 1V47A 2YVUA 1YRAA 2HREA 5H59A 2IH4A 3A6KA 1A98A 3N1UA 4NE7A 2FCAA 4TV9A 2BD0A 5AVOA 2Y71A 3SQLA 2YYZA 3X1WA 4ALKA 4YAKA 1QIHA 1T26A 4Y6SA 2JATA 2GEFA 1EUCB 1VHDA 2GCNA 3R0JA 3TM5A 1I7NA 5KNDH 3TQSA 5LP6F 4R6WA 4JU9A 3S1SA 1KYZA 2HLPA 2FR8A 4CM8A 1E1YA 4NEHB 3U17A 3L06A 2VKTA 1MTZA 1S6YA 4YUZA 3TGPA 4J1QA 3ZHQA 1K6IA 1ZRMA 4CM9A 1WZIA 5DOZA 3U40A 2GN6A 1FTQA 1BCSA 3FPKA 1JJBA 3SIPA 5CURA 4RM3A 3GLFA 4KVFA 4U2EA 6ADHA 1PVVA 3CMMA 3EEQA 5DHFA 1GZ4A 4E5PA 3IKLA 2PRIA 4WFKA 4E21A 2XTZA 2CL0X 1TZCA 1UZUA 1G7TA 3FCAA 3V8QA 5B7QA 1EEXB 2C42A 2VHVA 3OZIA 3O6VA 3RBAA 2C2KA 2LTAA 4BASA 2W2KB 3FF4A 2IZ7A 1IBRA 4KLNA 4C07A 3DO6A 4XPIA 1KJYA 1WZNA 2W2MA 3EWSA 5JD5A 5LKAA 2EQ5A 3G0CA 3F5QA 3WGZA 5LUAA 3OIVA 5GGXA 3SBOA 4MVJP 5J5CA 3VTAA 3K94A 3F7NA 1NW8A 4YAJA 4QM7A 3PR2B 2DMRA 5ICCA 3AMVA 3A6FA 3RVMA 3LF2A 3RAGA 4U6NA 1P5RA 5SZJA 4WWHA 2X0DA 3HA2A 1G5IA 4J1TA 3W6NA 3PHGA 5CXXA 2I67A 4AZ3B 1TX4B 1JEQB 4WUTA 4YGXB 4HVCA 3U2QA 4Z51A 4IRXA 4LMPA 4O25A 4CM4B 5IWCA 4UCFA 3GI1A 3E9YA 2WPDD 1FMFA 5LKRA 2XH8A 3NHBA 2G25A 3GNQA 2ECFA 2AMLA 3FPHA 3R7FA 2XCRB 2R1UA 5KWJA 3VPBA 3P2IA 4GKVA 3RJTA 3FE2A 4MVJM 2PRSA 3DV0B 4JBWA 2WFZA 3TDNA 2BF4A 1DWOA 1GOTA 2NXNA 1EFVB 3AHDA 4K6KA 1YHNA 1Z29A 1Z6QA 4X1KB 3VDNB 2NUPB 1DRVA 1LWNA 3IDOA 1CB7A 3RYIB 5INTA 1IC6A 2O48X 2EX0A 3K5IA 3BMQA 3IB3A 1I2CA 1KFCB 2Q7DA 1D2NA 4G5SA 4ZVNA 3W2GA 1LVGA 1QVWA 4UHEA 1EVYA 3Q7RA 3QJGA 3PQDA 4Q3EA 5EUBA 3DE1X 3DAOA 5KNDA 5DOVA 1T2UA 4AUNA 5A03A 1ISGA 4DLLA 2AXNA 1P2VA 2Y76A 1KRXA 4GLJA 3FA2A 4EL0A 5KWEA 3MMXA 1L8XA 3I9NA 1CHNA 5TLSA 1S9HA 2XUQA 4XCVA 1Z83A 1OX4A 2IEAA 3SNKA 4F2PA 1WCWA 4AJKA 1K3UB 2WYVA 3A28A 3NEAA 2C00A 4CL3A 4F3NA 5HRAA 3B1JA 4I1UA 3I6BA 4E4RA 2QX7A 2W71A 4LJSA 3WY9A 2Z4RA 1OGYA 5K3FA 5T67A 2V9CA 2D6FA 2WKSA 3PC8A 4FEYA 1ZJ6A 3O75A 3ZWDA 3JVDA 4YUAA 4TYNA 2I3DA 3SQXA 2QQEA 2CNLA 2Y6UA 3M6MD 4WJZA 3VNUA 1YTLA 3CYFA 1N1DA 3OTGA 2FVXA 3ACCA 5JDIA 1YXMA 1W1UA 3ZUPA 1NVKA 1SIBE 5JNUA 3WGKA 1TC1A 2HZBA 3GP5A 1Q1ZA 4EF5A 5C5DA 3ND9A 1Y80A 3TIIA 4A2CA 2A94A 4IH1A 3CH6A 1YR6A 3QX7A 3IUBA 3B2NA 1NU8A 3WRYC 3EZYA 3LU1A 1JLLA 2XQIA 4WBNF 2XRFA 1VPWA 3PDUA 3QVKA 2ZJ8A 1E6LA 1UBSB 1VJDA 2CZQA 3DS8A 1WZUA 3M2PA 2R96A 4RS4A 2O7QA 1KEEB 1LZKA 3GT4A 3WBKA 5E6UA 4BFCA 4Z4IA 4M0DA 3L4JA 3DD5A 3FSGD 4HPWA 3NHZA 1DOZA 5GAJA 5IZCA 1EFHA 4ARZA 1RQNA 4D3FA 1L4EA 2QGNA 2FMHA 3QLJA 1CJSA 2A7QA 5CB6A 4JLPA 3NIGB 2KJQA 2R84A 3TPFA 1F2TA 1NJ5A 3PFWO 3EFBA 4KXVA 3U7RA 4AG6A 2CKMA 4BNGA 1E6CA 4D46A 2I7DA 2ZJFA 1V1JA 1MQSA 1OZHA 1WUIS 3FDIA 2GN2A 5AVWA 3BXGA 1DX6A 1PJ3A 3PI6A 4JODA 1F0YA 1BDJA 1Z5PA 1IHDA 2VYVA 4NNOA 5CFZA 1E64A 3ZKAA 3OZGA 2D0DA 1P81A 2Q3LA 4OGLA 3SQMA 3QUCA 5D3MB 3U44B 5AM2A 1B43A 5CFRA 3IEKA 4AXXA 3JQ9C 1UAYA 2RAPA 3BEOA 4F4CA 1UDXA 4W63A 4WY2A 5JADA 2IHNA 1QU2A 3KHKA 5JD3A 2JJ2A 4N5HX 2PSEA 3A9SA 3VPSA 1EFTA 2NM0A 3BKWA 1TW3A 1V8FA 2OKGA 4XGKA 4ALNA 1D03A 4KIGA 5JY6A 2ZJAA 5FQNA 5ARCA 4B3XA 4JK3A 3H1FA 3U3RA 4OGKA 4F9TA 1OY1A 2B6NA 2OXCA 2VDQB 3FB4A 3LYAA 5L6MB 3QX3A 4C06A 3VH3A 2OAGA 4KITB 1ETHA 2YWCA 4KIUA 4EB3A 4DC9A 1E7WA 2M2IA 1SQGA 3PVZA 3WYBA 4C0HA 5AW3A 4RNDB 4L02A 4OBXA 3G0HA 1XMVA 5BUQA 2ZYAA 5HJ7A 2BFPA 1IE3A 1L7XA 3GFVA 3PQ6A 5CA1A 5IPFA 1JKJA 2IH2A 3LQRA 1QQBA 4EFNA 1LW7A 2AH5A 1N2CA 4MVWA 4QBFA 4C6SA 3G49A 1A8SA 2FA9A 4C5BA 2FNAA 3D8NA 3JYOA 1RRKA 1NVFA 1R0KA 4TYWA 1BH2A 2QTHA 2FLKA 2O2ZA 3MJRA 5FWXB 4DR5B 2QL5A 4UU8A 2Q1SA 4AY3A 1QGUA 2PKCA 2QAGB 3N6VA 4LS3A 1QQAA 3TNJA 1Z13A 1P0PA 4YQYA 1RW4A 4EYGA 2HMWA 3OY7A 2FJPA 4UARA 1R9GA 3S8EA 2VEDA 3TF5A 4IX1A 3L07A 3BYZA 3WLQA 4D5GA 5FOTA 3BJIC 2HHJA 2QXYA 1IN8A 3VU9A 1U5CA 5EJ9A 1U11A 3TTXA 2WB2A 4JJ4A 3ZWQA 2QT9A 2P27A 2J0SA 3FSRA 4LCJA 5FPTA 5TMBA 3ZE1B 1NOIA 1RS0A 2SKCA 3AETA 3T1HB 4RYDA 1DQSA 1AC5A 2GKGA 4DG8A 4N18A 1N7IA 5AVQA 1K6JA 1TUEA 3BTUA 2BBTA 2B78A 1E9EA 3DKPA 4D4LA 4BKQA 1RI1A 4DA7A 3J7AC 3FDXA 3PFFA 4MTCA 3EDCA 5AM5A 3TXXA 1KJNA 2Q1WA 2CHQA 2FPKA 4CEIB 2NQTA 3ZQ6A 1EINA 2C4VA 2JFNA 4AKGA 5IXYA 4DT1B 1RFLA 2VJLA 2RHRA 1RJGA 5EIBC 4X0EA 1GSIA 1LGYA 4DN6A 1NJ8A 3U1BA 1CZUA 1YONA 3M5CA 1YRWA 3E9QA 2Q0XA 3RABA 1IUPA 4M9RA 3H86A 3VU8A 2VDRB 1GQ2A 4M8LA 1MPXA 3PLAE 3RBVA 2VF4X 1I8TA 1SK8A 5IT0A 2PO7A 3NHYA 3MAGA 2FMFA 3NW9A 1KQ3A 2PBRA 3CRZA 4N47A 1NGSA 2IYRA 2BAGA 2IDKA 3ER6A 2Q9UA 4FYVA 3VV3A 4LQDA 1OT3A 2IUYA 2Q4TA 3PKIA 4IIGA 3CVVA 3C6QA 1N8TA 5ALSA 2EJBA 2IY9A 2GAAA 3CW8X 3UK2A 3KELA 3M3PA 5HCNA 4MYUA 3CWZA 3MOGA 3EUAA 1C81A 4BNMA 3AM1A 3LD9A 2PCJA 4LDNA 4MQUA 2VP3A 2RKOA 3BRWD 1U5AA 1XDGA 3MUNA 1L4UA 4NMWA 1UJCA 1SUBA 4MV1A 1VDZA 3C4JA 1R9JA 4QODA 2O2IA 1KWKA 2ZXUA 5K2MA 3VUFA 3PX3A 4HADA 2FK8A 3E3OA 1U2QA 3CV3A 5CNKA 5GP1A 1YJCA 2HRZA 1RIIA 3R0VA 5C81A 1TU4A 2CVOA 1KOFA 2GEBA 2GM5A 2PO5A 2VK4A 4B80A 1X0VA 5EJMA 3EQ9A 3MWFA 4C1NA 4JV5B 1X1SA 2C20A 3EIWA 3GNSA 3GOHA 3HCRA 4QATA 4ENVA 1TYEB 5IAOA 4XARA 2QDKA 3TNYA 1NRJB 1OAOC 1AKUA 3ZVNA 1ACJA 1SZJG 4MCAA 4YRRA 5HIAA 4PLTA 4RZIA 3HKBB 4TTPA 3ZV3A 2HA2A 5EQDA 1XIVA 3LS2A 3D81A 1QO0D 4CG1A 4ITRC 3BDIA 3THSA 2P6UA 1Q91A 3MUOA 3X1MA 4QJIA 3B13B 1Y34E 3QXJA 2FR1A 2OORC 5T5QA 4E0BA 4W5OA 3DAGA 4UBIA 2EEZA 5SZIA 1V35A 2VA8A 1OSNA 3R6WA 1YZNA 3PL1A 4MKIA 4EFMA 4I5DA 3OHPA 3QOXA 3IRUA 4HMPA 4I50A 4N6GA 4ESHA 2JIQA 2C9DA 5JZMA 1AS0A 4Q39A 3KXLA 1U7TA 1W88A 4PM4A 3CGWA 5B37A 3IB6A 4AO6A 1HDCA 1SCNE 4JAVC 4O0LA 3LUHA 2QTZA 4BNDA 3HHPA 4ZYUA 2O2DA 4L6IA 1M75A 3KKKA 5IYZF 4GYWA 4DKJA 1KAMA 2WJVA 3T99A 1KH2A 2GRAA 4Q18A 2BEKA 4OVKA 4YA6A 3EXHA 4OJMX 1XMOB 3CPJB 1NUSA 3ISTA 1WD7A 4BP8A 3L6RA 5JMPA 4E3WA 5D00A 2QY6A 4BQSA 1XZBA 3JAKA 3OPYB 1XZHA 2I2CA 1C8LA 4FX2A 1MORA 3AUKA 3L46A 4NCKA 2WEKA 4ZYLA 5JVDF 5GV8A 3FDZB 4BRSA 2HLNA 2HEGA 2CF6A 1UZNA 5LQDA 2RB5A 1JLMA 4ZD6A 2YWFA 2OO3A 3JYPA 5EIHA 2P2LA 4UREA 4O2AF 3LUGA 1FFXB 1AKWA 1F8GA 1Z37A 2A67A 4OJNA 1KEPA 3N7TA 2BP7B 4C0BA 5FNZA 4E13A 4CEJA 1R4NB 2RGGA 2WSYB 3CG0A 1VBMA 3N8IA 3QEMA 4QXQA 2DFPA 4G0MA 5KVVA 3WGLA 1NN3A 3BAFA 1XROA 3G2OA 2ZJBA 1KPHA 5THXA 3SMQA 5JNRA 4CFZA 5KJ6A 1P7CA 1R0WA 2JH8A 1L4BA 1UFRA 2XWSA 4MVJA 1GA6A 4JITA 5AKZA 5T3UA 1EUCA 4HZUB 2HLDA 4OMFG 5CT9A 5EJ7A 4ANFA 2B34A 1JKFA 1GGMA 1BU5A 2WRZA 4V2UA 1W36D 1JJIA 3ITDA 1YFLA 4U7DA 4BO3A 1KH3A 3CEJA 4H15A 4S1PA 2JFXA 1QUEA 2QTGA 4QULA 2W6ID 3F49S 4HTFB 4RGYA 5BQOA 3WDMA 3D0OA 1X7XB 4DABA 4MSUA 2FZEA 3AB7A 5JAPA 1NULA 2WM8A 2ZUSA 1YRQA 4ECAA 2R9VA 5D3KA 5MFZA 3FGPA 1PNVA 1SRQA 1GG5A 4HRVA 1JT2A 2VBIA 1CUGA 3JQBC 2C4WA 2YV2A 2YJNA 5HKLA 5FWNA 3WR5A 2O2CA 1L5GB 5C8ZA 4EJSB 1OGJA 1B93A 2W2KA 3ZYZA 2XKAA 2BKUA 3LCUA 1G4AE 5FTJA 1ZX1A 1ZD4A 2N1MA 2D7CA 2R8ZA 1LWOA 2OO5C 2HJ9A 3ZCSA 3BSWA 3PE3A 2O2EA 1ADJA 4BX0A 5K01A 1QRDA 4LF6B 3LWNA 3K31A 2P90A 2AOTB 4COKA 4PW0A 3RIHA 2QR3A 2AZMA 3X2SA 4JBGA 4PO1A 3BILA 1MA0A 1PWXA 2P9QA 1P2GA 3IPRA 5GONF 1DC6A 3RRXA 3P20A 4B4KA 5AKIA 4CN8A 4Z1OA 4W8OA 3JQFC 3EULA 2V6JA 4G26A 3ZLBA 4IUBS 4AZ3A 5K0BA 1U1CA 2V03A 4PLYA 5EIOA 4CM4A 1C0LA 1XU4A 3FUVA 3PHJA 5LN1A 2CXSA 3WVNA 2RHCA 4ZMRA 5AJVB 1VBFA 3G7SA 4AL4A 1OXSC 4FC6A 4C6HA 4Z99A 4B4DA 1NPTO 2ASEA 4QLAA 1KK2A 1ZSVA 4PXAA 3B6EA 1K3TA 3MWJA 4HEHA 4URHA 3DV0A 3LPLA 4ZCIA 5I7SA 4NIMA 1RQXA 1L6RA 4U00A 2YJ3A 1EFVA 4E2YA 2J3EA 1PLKA 5FBLB 4E7PA 4X1KA 1OFTA 4OHFA 2NUPA 3WG9A 3RYIA 3UG6A 2WTNA 3PDJA 4B17A 4B4OA 3P97A 4RMIA 3G9UA 2O7SA 4KR2A 4Q03A 2VWHA 5A62A 4HD8A 1D6NA 3O8RA 4X8OA 5KJFA 1C0PA 4M0KA 5EJGA 3RIEA 4CHGA 4DSTA 1FTSA 3A14A 1U2GA 3M89A 1W85B 1FDOA 3A4NA 4M86A 1PD1A 1O08A 4RFVA 4ZO8A 5JLJA 1ACMA 1F3LA 3QUSA 4GT1A 3LPAA 2OG1A 4G67A 4RF4A 5BSRA 4WADA 4B83A 3EIEA 2OILA 2CLCX 2HU8A 2Z9CA 4W7SA 3ZH9B 1AZSC 1XKQA 4LISA 4NZ9A 4UDNA 4F3YA 2P9CA 2YUTA 3HZRA 3CKKA 4H7HA 5B30A 4GVPA 2JI8A 2VP6A 3EGOA 4A26A 2QE7A 1JEAA 4D9IA 3BFJA 1FUKA 3P0HA 4RVGA 1M76A 1HFEL 5IEJA 1O3YA 1MAVA 1Z6GA 5B58T 1RWNA 1FB5A 3HDVA 4NFSA 3ESCA 1DLIA 3L8GA 4AAYA 1AZWA 3NLLA 3V7YA 4P0PB 1DJOA 2QVCA 1NATA 4RIEA 1NI3A 1N1EA 2FPPB 7AT1A 1Q2UA 4EABA 1EX6A 4G65A 4DR7B 4YTEA 1JFRA 4WAUA 1F9EA 1QPBA 1U7UA 2DKOA 4HWSA 4KQCA 2RGAA 1Z6ZA 4DWWA 1H5UA 1RWMA 2I1QA 1YS2X 3CZ4A 1L3IA 1DHTA 3S6JA 1KEEA 1NBME 3MWEB 4O4IF 2GBLA 1NVUQ 4EYEA 4R83A 1QTQA 2WABA 3NUQA 4DCCA 3EVNA 2JLQA 1XCJA 1ND6A 4KAAA 3W06A 3WI7A 3FCOA 3SAJA 3DL4A 5FOUA 4DSNA 4OPMA 4CKEB 1QIIA 2NVWA 4MMXB 3CZCA 2EYQA 4WESB 4MA0A 4RVOA 3TNLA 1ZPDA 4DIUA 3OZTA 1AE1A 2AEJA 2YZNA 2YRWA 4F2WA 5JCOC 2IYYA 4ZT2A 1NN0A 3CEAA 3QLVA 3WO0A 2PANA 2WFLB 2E9SA 4JC0A 1KZ6A 4BB6A 1J07A 2FW0A 2QTAA 1D5CA 5TEVA 3OQMA 1JT9A 3ELBA 4QUJA 5EKXA 5ESDA 3VZPA 3KAPA 3TUZC 3GCZA 1M66A 1XJ0A 5FL7A 2O2SA 1KO8A 4U7WA 4XQEA 5D3MA 3TCNA 1AUOA 5AP9A 3U44A 1Z5NA 1NUTA 1O0SA 4E03A 1QYDA 3G02A 3PQ2A 1TYBE 2WLSA 2D54A 3C3DA 1N5DA 3JD4A 4Y30A 1EDZA 3H5IA 4FFBB 1P9RA 4Q5IA 3TSWA 1YB2A 5JE8A 1EIWA 2DP4E 4I1YA 2BFFB 3WB0A 1T0HB 4XOUA 2ZRNA 1SUWA 3F67A 3NETA 4QAQA 1O94C 1ZNXA 2ODBA 3L49A 4M8IA 1ZL2A 3G2IA 1D4FA 1JHZA 4OXIA 4OUDB 4DLRA 1O0BA 3BBPA 2VDLB 4MDFA 5HZKA 2BHTA 3AR4A 1A9RA 2VZ0A 1RHQA 3AY7A 3UF0A 3WMWA 2P2ZA 1SUSA 2XTJA 3WWCA 1J49A 1UC5B 1NNLA 4V0QA 5E8JA 4K86A 4JQCA 1EPUA 2DC1A 4C30A 4DPKA 1QM5A 1RD4A 4MVXA 4PG6A 4CI9A 2LE0A 1JW9B 4O4JF 2F7SA 4AO8A 1IIRA 1ZJ4A 1T3SA 2GS9A 3AQIA 4GI5A 4LJ7A 4B5LA 4B82A 2C7QA 3BF8A 1BWRA 3F5MA 2NT3A 1N4AA 1Y7LA 3ZZTA 1PI3A 2C04A 1MXFA 1DJLA 3CPEA 3F1KA 4GLLA 1U8FO