1CZKA

Comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQNAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparisons of wild-type and mutant flavodoxins from Anacystis nidulans. Structural determinants of the redox potentials.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Electron transport
molecule keywords FLAVODOXIN
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1czkA00
1JA1A 1OBVA 1TIKA 3HLYA 1H69A 2Z98A 3K1YA 2OHJA 2QX9A 3NHRA 4HEQA 2FOXA 1AKUA 2OYSA 1YOBA 2X2OA 2XODA 1X77A 1SG0A 3OX2A 5LBUA 5B3KA 3L9WA 2WC1A 3OX1A 2HNBA 2Z9BA 1VMEA 2FX2A 3TE7A 1ZX1A 4LTDA 2BMVA 4F8YA 2FDXA 2KLBA 4QOHA 3NHFA 5FA6A 3G5MA 1NNI1 1YRHA 4H2DA 5B3LA 1E5DA 4PTYA 1CZKA 1FLVA 1ZWLA 3EYWA 1XI2A 3F6RA 1YKGA 2V5VA 1V4BA 5FX2A 2R97A 1FUEA 4U7GA 1J9ZA 2BF4A 2OHIA 4QOIA 4XDHA 1C7FA 1FX1A 2R96A 1AKWA 2FZ5A 4XDGA 2Q62A 4YAOA 1OFVA 3B6IA 4QOGA 3W77A 1F4PA 1AMOA 4C0XA 2QX4A 3B6KA 2D5IA 2MTBA 4LAFA 2M6RA 2F1OA 3O73A 1JA0A 5F12A 1QHEA 1QRDA 1FVXA 2X2PA 3S2YA 5LVAA 2QX8A 1YDGA 4C14A 1AG9A 4Y9UA 3NHJA 1ZWKA 4QOEA 4ZVMA 5BUCA 5TGZA 3NHWA 1BVYF 1CZUA 4ZVLA 1XYVA 4CETA 1KBOA 2A5LA 3F6SA 1FLAA 4J8PA 2MT9A 3NHSA 3UXEA 1FTGA 5LJLA 5ULLA 3FJOA 1T5BA 1RLJA 3FW1A 3O2NA 3OVMA 3D7NA 3KEGA 3ZHOA 3GFQA 1GG5A 4FGKA 4Y9RA 2RG1A 4PU0A 3GAMA 3W79A 1YCFA 3B6MA 3HA2A 1CZRA 3NLLA 1J9GA 3GFSA 3N3AC 1RLIA 1J8QA 3FNIA 2KQUA 3FX2A 3OJWA 3OJXA 4GI5A 4GR9A 1AHNA 1J9EA 1YCHA 3ESZA 3P0RA 3KAPA 3QFCA 3FVWA 4R81A 5JROA 3W7AA 1RTTA 4BMPB 4ESEA 3NFRA 2FLVA 2W5UA 1XT6A 1XYYA 3TEMA 4QOFA 1SQSA 3K20A 3UXHA 3OX3A 6NULA 1CZOA 2QMYA 1AKQA 4LTNA 1BU5A 3LCMA 5NLLA 4D02A 5LLDA 1H66A 1D03A 4FGLA 4GQIA 3F2VA 4FGJA 3R6WA 2BN4A 1FLDA 2FAXA 4C76A 4CF6A 3KLBA 1DXOA 3HR4A 4YQEA 1YCGA 4N9QA 4NLLA 1AKTA 2MOKA 2XOEA 4U7HA 1CZNA 3U7RA 2FZVA 2QX6A 5F4BA 3OWXA 2Q9UA 2FCRA 3W78A 2QWXA 3SVLA 1WSBA 5LJIA 1AKVA 4N82A 3ES9A 2MWMA 1D04A 3NHKA 4ZVNA 2V9CA 1AKRA 2Z9DA 5LBTA 1RCFA 2BZSA 1QR2A 3ESXA 3L9XA 3N3BC 1OBOA 3QE2A 2OHHA 2ARKA 4S24A 4DILA 4ICIA 5A4KA 2HPVA 3ESYA 3B6JA 5NULA 4FX2A 4NULA 4H6PA 5FUQA 1FLNA 1B1CA 1QBGA 2M6SA 3NHLA 3GFRA 4PTZA 4LA4A 4N65A 4BMOB 1C7EA 5EMNA 4Y7CA 2Z9CA 4QOJA 3EDOA 3LT5A 5F51A 1KBQA 4ZVKA 2FVXA 3RPEA 1DX9A 2HNAA 3QFRA 5EAIA 1WSWA 2AMJA 4U7FA 2QMZA 3U7IA 4LTMA 5LMCA 3NHPA 1T0IA 1DXQA 4DY4A 3TZBA 3F90A 4M0CA 4C0WA 3KAQA 4DIKA 3NHYA 4YALA 4YAUA 1CZLA 3JSXA 1TLLA 2N1MA 5EA2A 2GSWA 3NHUA 2V5UA 3OWHA 3N39C 4OXXA 4HS4A 1D4AA 2QR2A 4QODA 4YAFA 4YAWA 1I1OA 1CZHA 1AZLA 2ZKIA 2BPOA 2B3DA
chains in the Genus database with same CATH superfamily
3UMMA 3PXAA 3ZIAD 3E7WA 3NHRA 3ZQUA 2CLDX 1WB6A 1XZIA 1JWLA 2Y1WA 5HIIA 3OT4A 3BIJA 2I33A 1G4UR 3GGJA 1KXZA 1ZVQA 1AURA 3ITKA 1N1GA 3QIAA 3S27A 3D6TB 3UOGA 3HU1A 1W75A 3V1MA 4TT3A 4MAFA 1REQA 2OEPA 4X1IA 4NMHA 3U48A 2NU7A 1M73E 4YR9A 2Q50A 1E5DA 2I78A 3FFTA 1SC4A 3GW8A 4G41A 1IK4A 4XAQA 4H7DA 1EESA 3NBKA 3WO0A 4B7CA 2B2XA 1EFHA 5BSUA 1SCUA 2LP4Y 3IPRA 4URZR 1JSZA 2W6OA 5D1HA 1RXSA 5DSZA 1T9BA 4MS3B 3TUZC 1E0JA 3RS9A 2WJ6A 5IG2A 3LVBA 3UM9A 4F97A 3ZZ0A 3SHTA 3USZA 3L8ZA 3RT7A 5CXUA 2AN1A 3IAS6 1KP3A 1ZH2A 3R8FA 1ZA1A 3DOJA 3THWB 4OATA 3IOCA 3PFHA 4HDNA 4HN9A 3KFVA 4FMCB 1W5SA 4GSYA 2B0JA 4TN5A 3V1UA 3FKJA 1KS2A 1Q14A 4ZTZB 3TW0A 4DNPA 4NMXB 1GU7A 1MZVA 2HYDA 3ZNOA 1QBKC 4UFNA 5CLIA 3MD9A 4PU0A 4N41A 2YWRA 1YF3A 4UNQA 1RR6A 3H1TA 1QG6A 4KZPA 2GH1A 3NAZA 2IPLA 2YIDA 3OKFA 4FBGA 4HLCA 4JC0A 4MUNA 1BGVA 3EVNA 5HS6A 2OT3B 1KH3A 4IDHA 1E8MA 2CVPA 1FFYA 4TLDA 4R1UA 3SFVA 4LPSA 1MAAA 4K6CA 3T9EA 4XGRA 2L17A 3UXHA 3U13A 5IT9A 3CKYA 2O54A 3UF0A 3U7FB 2GFIA 2YXNA 3AJDA 5C1PA 1JWAB 2JFPA 1IN5A 2X15A 2ZAIA 2GJKA 4UUQA 2HJSA 2CLMB 4WN9A 3N2YA 3VPFA 3SLKA 5HCIA 2J48A 2IXDA 4NEHB 2XQVA 2OMEA 3P4XA 2JIMA 3KJZA 3O93A 1IXZA 4NTZA 4KDCA 3MT7A 1PX0A 2WIKA 4KG7A 5I3CA 3B36A 5FI1B 4BKPA 3B89A 5IKPA 4IVQA 4TSFD 4YLGA 3WLJA 3RBXA 4EHBA 3K0CC 1AVTA 3HV0A 1GGEA 5DN9A 3N0TA 2YY5A 4YRAA 1M1YE 1ZUNA 2HQ1A 1AT1A 2EWWA 4BLRA 2XX3A 4DCCA 2A5YB 4E5SA 3LW8A 2OD7A 1ECPA 4OL0A 5LMNB 3EXEB 2B8WA 4PRLA 1ISPA 4NABA 5FORA 2GRJA 4MKHA 3U4HA 3KEQA 3FGNA 1QK5A 4HQ6A 1ZK0A 4BFXA 4KVZA 1FTSA 1LPAB 1XTQA 3EDOA 4MV8A 1MC1A 1PG5A 1Q0HA 1U4NA 2Q0SA 2VRWA 2XIJA 3L6RA 3C6KA 3Q7IA 1FTWA 3ELUA 4UU0A 3KQOA 1D2CA 3TD6A 5GY7A 2YQZA 4CVNA 2QR5A 4ZO8A 4DMFA 2QZJA 4JI0B 2GZAA 2O1SA 1W34A 2IV7A 1D6NA 1GUBA 1G4AE 3TTSA 3AL0C 2KW5A 3OWHA 2FG6C 1V11A 2PD6A 3JQ8A 4GOOD 5THQA 1R6DA 3MTEA 4D1YA 3GEIA 4B82A 4DEVA 5LMUB 4TV8A 5AP9A 3NEJA 4M8IA 1M9NA 4OFWA 5A2QA 2XXBA 5KYGA 1MAHA 5F3DA 4JZKA 5K5EA 4NENB 2NSYA 3OTGA 4JP2A 4M53A 2GK3A 2JJ2D 3QWHA 4QDTA 5GADl 2ZUCA 2JCSA 1VGVA 1S7GA 2R85A 4OFXA 1YQQA 4RWZA 4CTNA 5KNDA 4MPJA 1E1QD 4O29A 4YT8A 3HMKA 1LTQA 4C2BA 3FMVA 1M6VA 4R41A 4C1NA 4DLYA 5FUMA 4GOXA 2DPGA 4Z99A 1BE8A 1A8IA 1VKOA 3MXOA 2IHBA 3Q3JB 3CH5A 1GDDA 2UZ3A 4J94A 4PBTA 2WWWA 2CBXA 3CRZA 3IBYA 4F8EA 1CYEA 2FN7A 2ZLBA 1Z7YA 1BE6A 1CF9A 1FMLA 2JAPA 2A88A 1ZFNA 2GEKA 3MB8A 3QXJA 5JAQA 3W3AD 4IO1A 4RD1A 2AJDA 2UVPB 3ADKA 4BNHA 1S4QA 5BN3B 2F59A 421PA 1ULTA 4IUCS 4PANA 1XR3A 1S3SA 3S2YA 3TLMA 2KS6A 4EG7A 1AO3A 1IAQA 3U4AA 4RTQA 3PKJA 4FDUA 2VJYA 1VJCA 4I7EA 4EKYA 1AHHA 1TCUA 1MRZA 2OB2A 2EHDA 4LDRA 4OM8A 4TL6A 5I8ZA 4D4KA 2L2QA 1FJHA 2UZIR 1SXQA 1X0VA 2CKDA 3FHJA 2EZUA 4A91A 5BUZA 5KCMA 3WGZA 3KEGA 3H5RA 4MR9B 3M1IA 5M34A 4LKOA 1WCV1 3D6NB 2VHZA 3HXTA 4PPQA 3PHBE 1HO3A 3DB2A 4OSEA 4Y98A 3VHLB 1DP4A 1MT3A 4TXMA 1AHIA 1TF2A 1ODCA 2HK7A 3KO8A 2ZETA 5DHRA 1JG2A 3CO0S 3GK3A 5EXSA 3JASA 1ZBDA 3MHTA 1RBYA 1SVWA 2BJWA 4ENRA 4X8OA 1U7OA 1IY8A 4CEHB 4MIEA 5U4QA 3SS8A 4PC1A 5EUQB 3EQ9A 1C30B 2PQ6A 2VYVA 2VAXA 3AF4A 3KKMA 2JGDA 4MVJI 3G2QA 4DCGA 5JJLA 2V1UA 4D3SA 1K7SN 2BL4A 2W6ID 4N76A 3MJEA 1FB5A 3IKLA 2RHWA 4RPLA 2PL5A 4HMPA 3L93A 4NR0A 1MAUA 4Q1DA 1VPEA 1P1JA 2JEOA 3CTMA 4WZAB 4A1OA 1DADA 1IBSA 2P35A 4HGZA 4TKLA 1WSBA 3K05A 1Z8FA 4MRMB 4C4TA 2PRZA 2XKAA 5B30A 6LDHA 3A6FA 3RSGA 5BQFA 1EQAA 1PGPA 3O83A 5AKKA 2HA7A 2QT0A 3EPKA 1X38A 1C30A 4HYEA 4B40A 4KO8A 1SVOA 1UBHS 2QTWB 4B5KA 3L4JA 4YP9A 1HT1E 3ZWXA 1MV8A 3TLCA 3DMRA 2V45A 1YRQA 2OZKA 2R62A 4HNTA 1NOIA 4CN8A 2QPLA 1ZSYA 3JD3A 2IGTA 3EMVA 3QYJA 1Y5NA 1AIPA 2QZSA 3AU8A 5I9NA 4RK7A 3OAAA 2QR3A 1KVRA 4MCHA 4ZV9A 3U9SA 4LF6B 2PDAA 3OAAD 2VTBB 2C8VA 4RZXA 5EE5B 2H54A 1R4MB 3B3QA 3SZLA 1PD1A 1IHYA 2JHCA 4I36A 2AOVA 1R5OA 1GEGA 1RW4A 1MH9A 5DF1A 5A9RA 1S2LA 2ACWA 1N2HA 1X14A 4ZYVA 3D3KA 4PZCA 1DFHA 4G84A 5LOVF 1T2DA 2IK8A 4US2R 4KVGA 4XLZA 2HWKA 3KPVA 5KDLA 4MPDA 2D1FA 2CVZA 1UC9A 1ZKMA 3EARA 4G01B 3WLAA 1CUWA 4FFLA 4D0SA 1MO5A 4TX1A 3SSOA 2AK2A 2GEVA 3BWCA 3DYVA 1L4NA 4Z2YA 1C41A 2ZBEA 4G5SA 5EP4A 3SJUA 1T5OA 1GV0A 3BWYA 2IW1A 3EGXB 3NIDB 1UXGA 1X1QA 2ECOA 3DCYA 4FR0A 2WQ6A 2OHIA 4FOTA 1Z2NX 2R60A 4QBKA 2B78A 3H2JA 4C22A 4FMCF 3M6VA 2OXTA 2VI5A 1UJ6A 4AJ1A 2FQQA 1OFVA 2MSLA 4IIBA 4OQZA 4AZ3A 3KQYA 3LCUA 1DBPA 3DHNA 1EGVB 1P45A 4BAUA 4CI0B 5ALIA 1E5VA 1GCGA 4RA9B 3GHYA 4FGSA 1NFRA 5F2OA 5LP1A 3EPPA 1WZ2A 1UXJA 1I51A 1QGED 1CT9A 1L4MA 2FCAA 3AZQA 1DAIA 3IPCA 3QVXA 4D8XA 2JFQA 1JDSA 2V58A 1XYVA 1J0CA 1QHYA 4FFWA 3EGEA 3GJ5A 3R1IA 4HAWA 3MMPA 3ZCPA 1DG3A 1Q92A 3WGOA 4IJKA 3UGTA 3NGXA 3KEOA 2P4QA 1EFRD 4DAEA 4EUEA 2ZYTX 4H59A 3IB6A 4R8RA 4FZRA 5F98A 2X9GA 4OAOA 1UMCB 5K0NA 5ALKA 2GZHA 4RTSA 2OBLA 1NDUA 2CXOA 2AK3A 1QH8B 4NKRA 2HDWA 2NPOA 3BSWA 5KMGA 1VP3A 2B69A 1OVMA 4WRRA 3RRMA 2W0SA 3FD8A 2A3NA 4GXRA 2VP3A 4LOAA 3TSYA 1GFSA 4BNIA 5CA0F 1BXRA 1EINA 1Z0AA 2RB4A 1T6NA 1WS6A 2I71A 2X1HA 3CBGA 3CW2A 3I9V6 2IEGA 5LIRA 1COWD 5BY2A 3FIUA 1A9OA 1NI5A 4XWAA 3IMEA 2AKYA 4GPTA 2J7PD 3WSVA 1T5IA 1DRJA 3GYGA 5ILGA 3UQYS 4B75A 4XSGA 2C78A 3P2IA 2J3JA 2G0AA 3CM0A 1JIJA 3JD4A 4MV0A 4YCAA 4YQEA 5T6BA 1RXVA 4LF4B 3DHWC 4U7HA 1TCCA 13PKA 4JC5A 5ADVA 3GH1A 2FZVA 2CLIB 4G36A 1WD7A 4KHPB 3B6ZA 3TUJC 5JPCA 1KQOA 4WOCA 2J33A 1Q22A 5H4HA 4AZWA 1ONBA 4YMUA 2ZW9A 4MAMA 4D4JA 5E1BA 2OAEA 3U26A 3ZCVA 3HL0A 2NLOA 5AICA 3MT8A 3PPVA 4S24A 1TZMA 2NXNA 1OBOA 3B53X 3MC1A 2VFAA 4G86A 3MK31 4YDQA 5JI2E 1FDOA 1X92A 3MJSA 2Z2KA 4OHUA 2O05A 1ZD3A 2IYXA 1FFDA 2UZAA 2PJUA 1Q15A 4K9DA 2W00A 1PLJA 4PO8A 1IVNA 1LBSA 2G9VA 3PJDA 4N65A 1VZ2A 4Y2VA 5TIIA 2H92A 3G5TA 3U4MA 3TLXA 2O5CA 1J06A 1NY6A 4KQXA 2JFUA 3QFRA 2QVYX 3U31A 2ADFA 2G1AA 1IM2A 3R6GA 4I2NA 3UK0A 1F0PA 1L5WA 4MUGA 1R4NA 3EZXA 3DBHB 4ZAGA 4PM4A 4BGUA 1UK9A 4G5QA 4MLZA 3CLTC 4PCUA 5C9ZA 2H11A 2XF2A 1EVLA 1NRXA 5J1TB 3COZA 3K6KA 5LXTA 2JIQA 4NK5A 4AROA 5DM60 3RAFC 3U39A 4DQKA 5F5XA 1U8XX 4HF7A 4ZDWA 3NIWA 1HT0A 4RJLA 3IKJA 3G79A 4RVHA 1HNNA 3THWA 2WC1A 1NRJB 2QPTA 2QN9A 4R2LA 3ICCA 1ILWA 4J1QA 2R6ZA 3L6OO 4Z9FA 3UH0A 1C3EA 4IX1A 4RQUA 3U9LA 3LPNA 4IXNA 1TZ2A 1L1QA 1DQSA 3JRWA 3PNVA 4C03A 3ZE7A 4JVNA 2GEJA 3EVFA 5EHIA 2LCFA 1ZZEA 3WYFA 1KP2A 1GYPA 4L16A 4MPTA 3FNEA 1H23A 2F1KA 2GTHA 2XA1A 1MVOA 3V55A 3FBWA 1FBTA 1ML4A 1ZNQO 2OUKA 3PHHA 4P5PA 4BNKA 3QZUA 1QQTA 1Z0SA 2JCGA 1L4LA 1S2GA 4P9NA 4U63A 4GKVA 4M4SA 5ERGB 4LGVA 4LPKA 2CWDA 1GTVA 1OVGA 2XE4A 3JQEA 1MA0A 3REGA 1J56A 3WL3A 4O08A 4BGIA 1KEEB 2FW6A 4CUJA 3CY6A 4HEA1 3CZ9A 4B3TB 2R5FA 1AV7A 1Y42X 2VATA 2Z5GA 1F48A 1NULA 4C3ZA 4IEEA 3IRUA 4FI3C 3KBOA 3RGGA 1MABB 4CF7A 3GEEA 5K6AA 2HXGA 2O3TA 3ISVA 7REQA 1YB4A 2CFIA 2RBKA 4RDHA 3THYB 4EEKA 2DOKA 5AIAA 2I4RA 2AZXA 4WTOA 4R8LA 4DKJA 1RM0A 2DLNA 2O2EA 4L0MA 4GRAA 1T2EA 3SS9X 3UHPA 1XCMA 4W4TA 4WZAA 3OZXA 3O8LA 3TGWA 4KQGA 2I4OA 3DYIA 3FX2A 5G41A 4Y1GA 3DBOB 3HM2A 5I7WA 2Q0HA 3G2KA 1BCSB 3BK1A 4XQGA 1R7RA 1UZLA 5EHXA 3NRBA 2H1IA 3H0CA 3CPHA 2J3LA 3C1OA 2FSSA 3ETJA 3Q40A 1U6KA 1WLYA 1P9WA 1XXLA 1Z25A 1UT5A 2OFXA 2QQ5A 5FQNA 3RFXA 3F46A 2BGTA 1OY1A 2EAUA 5HVNA 1M5UA 3FBGA 1D0SA 3MXTA 2WYVA 1LWNA 1G8SA 5LLDA 2NP7A 1RHKA 4LJLA 3I9MA 1OI4A 1D03A 4PIPA 3V2UA 5I01A 1NBEA 3T4EA 2IZ6A 1NYRA 2AZ4A 2RONA 2ZRCA 1W85A 4YIHA 1YI1A 4BNGA 5JXWA 5ES3A 1M2KA 1GQOA 1T2CA 5DNEA 3TKAA 4AECA 5EXXA 2A57A 2ZE7A 4IXWA 2HU2A 3R7NA 3KUDA 5JSFA 2BGGA 2ZDHA 1RWXA 1OXTA 3S2SA 5A2GA 2BZSA 3KTFA 1IPHA 2JEYA 2AZMA 4XGKA 2DM6A 5CB4F 1E2PA 2HQSA 1K89A 4KMRA 4ID3A 2QUKA 4Z7OB 3TNJA 2BFOA 3KG2A 3TLAA 5LM3A 4KE6A 3TGPA 1TUGA 1ST2A 3UQZA 4JVOA 4MVXA 3DZHA 3QKRB 4XZ3A 2XMQA 2PR2A 2VUTA 3GJ0A 3W8NA 3T5PA 3RFVA 3TE6A 1T1JA 2YJZA 3LT5A 2HV8A 4HVCA 2RHOA 3HY4A 1KPHA 3M7IA 4MP8A 4YLYA 2OORA 1W5FA 4CQLB 1R0KA 2RKOA 3UWOA 3AR8A 3NYQA 4NS1A 1U3UA 2YHAA 3C87A 1JDUA 3GT7A 3QXSA 3GZNA 1DOZA 4XM2A 3JVDA 1JS1X 4EHHA 2IY7A 2UZ0A 4I5FA 2XD9A 2PRIA 3P9RA 1GYRA 4Q3OA 3HFSA 2Y0PA 2GK7A 2NAPA 2Y67A 3T38A 8ADHA 3D59A 1GCUA 2YYSA 3JD1A 4KO4S 4NBWA 1Q74A 3VXKA 4E0BA 4GL2A 1AS0A 4JOBA 2ZWOA 4ZJUA 1QTQA 2OGSA 5BYKA 1XLUA 4J2OA 1PEKE 4FFOA 4F8JA 1J7JA 5DWDA 4XJSA 4HEJA 5AXBA 1C9YA 3X2EA 2D2XA 5JJIA 1RVDA 1RAEA 4WCFB 3VOAA 1U9IC 3VHQA 3WLIA 4BC0A 4ENSA 1H3NA 3LUJA 1GPWB 2UAGA 4LXGA 4CV1A 4JLNA 5AW1A 2GXQA 4TMWA 4BO1A 3GJRA 3IPXA 2FN3A 1FFXA 1VECA 1SELA 2P27A 3EWNA 1FS6A 1ZIOA 2CD9A 3OPYA 4FFBA 3AEZA 4JR0A 3EWSA 4NBTA 5AJXA 5LPNA 2WE8A 4PAMA 1TEZA 1XQXA 3DOFA 5EQJB 2D1TA 2JLBA 3BDVA 5FP0A 5CA1B 1VE1A 2XDYA 3H19A 1XWWA 1GRRA 4J0CA 2LRHA 3FSJX 4KQMA 4RK0A 3WKDA 4F5WA 1G6KA 5JNUA 2VSQA 3Q98A 1DWPA 2CJWB 2WKSA 3PIDA 4CT5A 5KTKA 5CCEA 1NW8A 3KWLA 4RZSA 3GMTA 1TI7A 5ITZB 3AUJB 2Q6OA 3IDZA 1U0TA 1ZJ5A 4KQHA 2FEAA 2C9CA 1GPNA 2C20A 4H35A 2GX6A 2ZJYA 1FFXB 4QXQA 2GXAA 1N4DA 4HTFB 1ORHA 1QO9A 2DYKA 1BW9B 1FS5A 2HTFA 3GAZA 3CT4A 4LEIA 1T1RA 3EY9A 4H7HA 2J3IA 4JJEA 4B6SA 2QAGB 2PYIA 1JSRA 2FF7A 1ZGBA 3EXAA 2NSLA 2Q8PA 1UOOA 2FZWA 2ASVA 4XA8A 5HA5A 1DJOA 3M6IA 1JV2B 1QRAA 3TRKA 4TMKA 3U17A 2VRBA 4D6XA 4ZAYA 4PXSA 4WK2B 4ZTUB 4PPYA 1T4MA 2EBHX 1TO1E 4BMPB 4IXDA 4HZIA 5EPEA 2AYXA 3O1HB 3U3ZA 4G5GA 3DMTC 4JB0A 2FPKA 4AP5A 1YU9A 2ZXFA 3GRCA 3O0DA 2I6XA 1IDN1 3FRJA 3VHXA 4DDTA 3OBIA 4J6EA 5EXTA 5CTAA 2VBIA 2WNSA 2AXEA 3E7XA 1ZJWA 1Q6YA 5CFZA 3T4XA 5K0FA 1TM2A 1E92A 1KFEB 4R1PA 3U3OA 4D9JA 3B2QA 1XPOA 4G5YA 5CJPA 3WLHA 2GNOA 2HREA 1WETA 5HBRA 2G1UA 4Q7EA 2WTBA 3JWGA 4CL0A 2YXEA 3THXB 2Z9DA 4F2GA 3ESXA 1QIDA 4TL7A 1H1DA 1I7NA 1OX4B 1TYDE 3GDGA 1G20B 3T52A 4ALMA 3WMWA 5I9IA 2HLPA 1G18A 1LS6A 4L4XA 4MJXA 1VI5A 1SRQA 1ISSA 1XQ6A 1W25A 1XRQA 2IPNA 4H31A 4RLSA 4B3CA 5A9SB 4LRYA 1CRWG 2YWGA 4H9GA 3CKLA 2A78A 2O3SA 1PQYA 1RQ2A 3DD5A 4OMFG 3X1KA 3LSTA 3ZWKA 2ZJ8A 4LNUA 4YMLA 3PICA 4YAEA 1LS1A 4BIIA 1G2QA 2X8BA 4JJ4A 3ZWOA 2W6MA 2PNFA 1HYQA 4LXUA 1D9ZA 4IR7A 4MV7A 4NF2A 3CV3A 2YIVX 4D98A 3ZCXA 1TEVA 3JAKA 1UFKA 3WGJA 5ADUS 1T8SA 3IBTA 1PNRA 2CZQA 2F8SA 3DT8A 2J9ZB 2WM9B 4HJRA 3SC6A 5HQ3B 4L5YA 1YB6A 1MEJA 3S28A 2BHRA 1OBVA 4K8RB 4G07A 5HCUA 1M2OA 1OZ0A 2GEFA 1U3CA 3WKEA 5JDIC 4JBGA 4QBTA 1BFKA 3H4TA 1A8HA 3N8NA 2CV1A 1AUXA 3FETA 2CLOB 4WLUA 5IHXA 5KNLA 1GPLA 4GUAA 2R6JA 4N4AA 3T0IA 1KK1A 1OWLA 1SVLA 3B8HA 3UUWA 4E5MA 1JJIA 2JA1A 2HJHA 2NO6A 4FGUA 5KPDA 1H93A 4QE3A 4XD7D 4QA9A 1EFVA 3VPDA 1N0IA 3KQUA 2YHBA 1T9GS 3FROA 1N33B 4DDHA 1FVHA 1UEJA 3EAFA 3ZBPA 2YJ5A 4ZAZA 1U98A 4YJ3A 5IAKA 3P71T 4P8RA 3ASUA 2EGHA 1EK0A 1Q57A 1WPXA 3L82B 4HB2A 4UPVA 5DXAA 2K2WA 3JVUA 3VR1A 2OCPA 2IUUA 4O25A 4Y18A 3PSAA 1HNWB 4OQYA 4EPRA 1EP2B 2YWDA 1LV8A 5EUCA 3RABA 2WSYB 1Z47A 2BJVA 1R6UA 2P6RA 3W5JA 3B1ZA 1WD5A 4D81A 1V8PA 5EKDA 3C8ZA 3ICWA 1USIA 3GPIA 1E98A 2E4YA 3LECA 4UNPA 5DTIA 4BO2A 1XJ5A 3GPDG 2V7WA 1KGDA 1DV2A 3LBHA 4QPDA 2VDOB 1IJFA 2V6MA 4XWYA 3KJQA 4YREA 1L8XA 2A0KA 3DTTA 5K51A 1QONA 3GA0A 1XHFA 3HU3A 1B8UA 1HG1A 3RJMA 4GNRA 3BMNB 1G6Q1 3OVMA 4MTLA 1I94B 4L7VA 1PV2A 2XIQA 2F9FA 1QQ6A 1ZCBA 3FCUB 3OUTA 1OF1A 2GVDC 2JKYA 2QD3A 3KYDA 1J8QA 5F78A 4OPMA 5U1PA 4AN1A 2EF1A 1VPLA 5EJ9A 3T3DA 4JB8A 1MJNA 5IPFA 5WRFA 2QN1A 1SWWA 2EQBA 4H0NA 3PDCA 4JU9A 2M32A 4R2XA 4AJKA 3R3UA 4FGWA 4RFSA 2ZBPA 3B1JA 4UZEA 2OC9A 4JL5A 2AG8A 4JIMA 2Y93A 3SR0A 2QLMA 5E2BA 4JU8A 1F3OA 5D3QA 1T5SA 2ASEA 3QVGA 4JJAA 3DLHA 1YZYA 5FTKA 1T6YA 1WXEA 2FR0A 2FRDA 3ID6C 3R5HA 3GNQA 4N6GA 1DKLA 5H81A 1L5GB 3TX6A 3OETA 4M1OA 3QLUA 3PX3A 1TT5B 4N8EA 1A3CA 4B47A 4OBBA 3DEHA 1TJ5A 4GD3Q 2O0LA 3GMSA 2QX7A 4OQMA 3X2FA 1WP9A 4WI1A 4ACAA 4ZVQA 1K88A 2MSKA 4REQB 5F7ZA 1G98A 4DUGD 4XX0A 4LBWA 3N70A 1V8OA 1MRNA 3TFQA 4ZYLA 1NNEA 3H18A 1SVIA 3JTEA 2HT6A 1M66A 3FFXA 3UKDA 3V33A 5FR2A 4X0EA 4YMVA 5JALA 5AK0A 2OZLA 3ASVA 3H84A 4QO7A 1YB2A 2QM8A 3F7OA 1L7AA 2PXCA 5JHHB 3OZEA 1Z83A 3TXYA 5AXDA 4M0DA 1H94A 3GVXA 3R3WA 3GJZA 3RYIB 5ALQA 2GPTA 4PYKA 1CDZA 4BMYA 4CV2A 1DBSA 1L4BA 2B98A 1KBZA 2R8BA 3DDSA 3I9FA 3LMKA 4J90A 2JI8A 4IYRA 1TZBA 1WRBA 4QUEA 1KC1A 5FWAA 4AUKA 2BCJQ 2BHLA 4M54A 1KP9A 2HRZA 4ILEA 1UADA 2ZI4A 3GLVA 4KN5A 3KSBC 4RK4A 3DLAA 2PUWA 4IQFA 3EVGA 1QH8A 3E61A 1NM5A 1R0RE 2ZSDA 3EULA 4YP1A 1BS9A 4WBNB 1FDTA 4L5IA 4DA0A 1WQ1R 1F2TA 1JE1A 1SUEA 4XUGB 1HM5A 4P33A 1Z7GA 1ZD2P 1E66A 1RBMA 3S3TA 1SCJA 3GBVA 1I4TD 3CSUA 3JRNA 3G9UA 1JVNA 1IUPA 1Z28A 2Q5QA 2WFZA 4JMPA 1JQ5A 4TZKA 5CLJA 4P3XA 2I34A 3B60A 1RYMA 3LQFA 3WYAA 1E5TA 4WCDA 4IDOA 3VR4H 3HVJA 3LK7A 1H4TA 1YZTA 1GEEA 2AR9A 4BUCA 4URXR 4DIMA 1XAJA 1FX1A 3VNVA 1RE1A 4RLQA 2Q9AA 2PUGA 1AZTA 3F71A 3M9WA 3VR4A 4CQJA 1PJRA 2WUEA 3KJEA 2PUEA 2H2WA 1X1CA 4B2YA 4TUYA 4KYVA 4Y1RB 2A2ZA 2XZDA 3LT4A 3UHJA 3A1EA 4JA2A 4O02B 2PIAA 4RD0A 1Y8CA 3NHMA 3O3MB 3PHCA 3K0SA 4RSHA 3CVUA 4PYOA 1YT5A 4RGQA 1QHHA 2I6FA 5DM2A 2X1MA 5DBOA 2J6IA 5E6RB 1LW7A 1Y9AA 2HMTA 1WDMA 2CSUA 2QK4A 5ECYA 2Y0DA 1UXOA 2FJPA 1ETHA 1ZIYA 1V16B 1VJGA 4OCZA 1P60A 1TAHA 3B6MA 2EYQA 2WWVD 2WHPA 1JT2A 3OJWA 4NCNA 1IM8A 5IKEA 1KEUA 2A9VA 4NYMQ 3H8VA 3C3DA 3ON5A 3V9AA 4XQ0A 2VF4X 5CW2A 1SEVA 2O0HA 3G7SA 3RQSA 5DSXA 3JYPA 4EZBA 1QKKA 3F4LA 4D3ZA 1LLQA 3OEWA 2QL5A 1UOPA 3GPCA 3LCMA 1CD5A 3EMKA 4X7PA 3ODGA 3ZXYA 1F8GA 2WJZB 3KUCA 2AOWA 5EIXA 1H2BA 1OPXA 1JG1A 2BFAA 3GRAA 3I9NA 3LGAA 3U1VA 4DDMA 2FK8A 4LG1A 2A4MA 2PQ2A 3MIZA 1KAEA 2WVJA 1YBAA 4RDCA 3WX0A 1Z35A 3WK6A 1RXCA 5DJ5A 4DR1B 1AU9A 3MOIA 2Q6LA 4A23A 5FUYA 1A7AA 1Z5WA 4HRAA 2GF0A 4DDUA 1ENZA 3K1ZA 5JW6A 4P4SB 4DR6B 1ELOA 2UXCB 3B9PA 1HDOA 2DT5A 1IXKA 4CU5A 3IBCA 1Y8RB 2ZU6A 1A1SA 2QB5A 3UANA 4U7PB 4I4TB 3C3CA 2Y0BA 3TW6A 4QFBA 1SZJG 1H2RS 2XOXA 1Y7IA 1LPOA 4GGPA 1OI3A 1BO6A 3SHFA 2GWRA 4DAOA 5I45A 3DDWA 1SBZA 3IIIA 4I4NA 3X1WA 3L7DA 3K9QO 1ZQ9A 4YK7A 2G9NA 2XGJA 3KAQA 2HRRA 1QP4A 3TL3A 4DCNA 1OHHA 2F43A 1P6UA 3VR5A 4HVLA 5TVGA 3W90A 3TRDA 2X5JO 3IO3A 6ABPA 3AF3A 3T9AA 2XVAA 3OEEA 4A0HA 3ZWCA 1KMMA 2IYYA 2OC4A 4TV9F 3RG2A 2B1IA 1QIEA 2CNWA 3PUIA 3SJCA 3SEZA 2HC9A 3SXJA 1YOBA 4QZVA 1H4QA 2QLLA 1M8FA 1AZSC 2WFLB 2Y1XA 4JEUA 3EC7A 4MQUA 5HKKD 2HNKA 1KI7A 3OHMA 4GEGA 2ACVA 2JI6A 1J22A 5JLAA 1JFTA 5ARDA 3RV3A 1GSIA 1GUDA 2COUA 3DNPA 2XMCA 4K26A 4AYTA 5CDSA 2J45A 3VV3A 3NBUA 1MRSA 3PUZA 1TB4A 2VAMA 4IXMA 1JG4A 1XZQA 4NI5A 4ARAA 2PH3A 2GK4A 2ZT5A 3BAZA 3T5DA 5FHRA 1JIXA 4E07A 5KSWB 2ZZMA 4GMHA 5JWHA 5LZ4A 4HXGA 1W2GA 1U94A 1AXRA 2M6RA 3W8RA 1F38A 2JLXA 3JZAA 2FWMX 1X7YB 5LVAA 5C53B 1IH8A 3WBJA 1J49A 4ND6A 2ID8A 4KVAA 2GAOA 3FNHA 5L45A 5DGIA 5IVHA 4J3NA 1GARA 3UMJA 1CVRA 4NU5A 5AKLA 5LQNA 5GJVC 1FLAA 2O23A 4UAUA 3U56A 5JPDA 3BHJA 2D5BA 1I2DA 2QUBA 3DVAB 4B3FX 1RQGA 1VGRA 1N5KA 5E3JA 4O4LB 4U2FA 1L7PA 3ZHBA 4Y2RA 5BSHA 1XK7A 2ZXUA 2O8VA 2CXUA 2D1RA 4OQQA 4ZHSA 1W59A 5AW4A 4MVJG 4F6CA 1L5OA 2FEMA 2W37A 2XR1A 2JRCA 2P9YA 4TWJA 4L07A 5JO9A 4J7CA 5JZMA 1NF2A 1PEYA 3N74A 1DEAA 3WBFA 4CLEA 4KFSA 4JFAA 4DNQA 3CE6A 4EFLA 4LNHA 5LNK1 5KCZA 2XECA 1T34A 4Z3DA 4F92B 3PK0A 1C1HA 5ENDA 2BEUA 1CUBA 4BAGA 3IJEB 2YVUA 1E7QA 1Y98A 1OV6A 1Y5MA 2QD2A 1PZXA 5H3CA 4G9BA 3UMGA 3AIMA 4RAQA 1GVHA 2PMWB 1SZPA 4ND2A 2Y1CA 1WVMA 2AEMA 2QYHA 2VF7A 5K9ZA 3AJEA 4HPJB 3Q9NA 1XVLA 2GOYA 4JJ7A 1KYTA 2FP4B 2WD7B 4MKIA 4CIAA 2J0EA 3IMGA 4C4OA 1FQKA 3VI4B 3DNFA 1PUJA 3LDHA 5HQJA 1KJQA 3CE9A 1A4IA 2OZVA 2QM3A 4U2EA 4YTEA 1ZUNB 1DAHA 4PQRA 4HWRA 5J2UA 2XWSA 2BM8A 2Y66A 4JT8A 3N5KA 4DUZB 1NUPA 5CYPA 1K1EA 4YRCA 4WL0A 1UBRS 1QTIA 1AX9A 3I73A 3PENA 1JT9A 4C4SA 4L73A 4I9NA 3EIOA 4GYYA 4W5QA 1MG5A 2GBFA 2QOEA 3K6SA 5DNAA 3BM5A 4MWZA 5DYTA 3ZBUA 1TUIA 2FW0A 3GDFA 4D9CA 1W8DA 5ESDA 2FE4A 1CUSA 5F9FA 5EAIA 2M6KA 1Y6ZA 3KVNA 1QVVA 1UBUS 3CUKA 1C14A 5BVHA 5C51B 4D97A 1DZIA 2WSIA 3PD1A 3QBVA 4G1CA 1OD6A 3QUTA 4RHFA 3W0LB 3I2IA 1GQFA 3ZZUA 3GP3A 4G67A 2NXEA 1TXGA 4GYKA 5TS2A 2ZJ6A 2WV9A 4FCVA 1TYCA 5LN1A 2YCLA 2J3MA 5CK5A 2C7RA 4GBJA 3WAGA 3CZPA 2AI3A 4LF8B 3BMCB 5J3JA 2GEDA 2CVQA 4CCSA 1IZ9A 2FR8C 2XH8A 4ZZ3A 5EHQA 2GBLC 4IS3A 1VHJA 4BMXA 2YHIA 1XMOB 3FPFA 2R4UA 4F6RB 4HLUA 2BF7A 3R4CA 4JLDA 1J8FA 1XEXB 4C78A 4I4IA 4PG7A 2R7KA 1NVKA 1P7YA 4P6VF 5AW3A 3LC2O 5H9WA 4Y3UA 4C3VA 4A2CA 2Z6QA 1YKGA 5HP4A 1L5QA 1N2ZA 2WZQA 1RWNA 2BUAA 5EPOA 2IPMA 3C8DA 1QC5B 4B8ZA 3EVDA 5C7YA 1XV5A 3MJFA 2AEEA 3ZKWB 1PKEA 4PFJA 1NQTA 1K9SA 3DFZA 2Y9PB 3PJGA 2E49A 4ERXA 3HACA 2X13A 4HKTA 5BURA 1B6RA 1E3WA 3CX3A 1DEHA 5L3ZA 4TT8A 1M8JA 2ZSUA 3G0GA 3GLGB 5M04A 2W6JA 3F97A 4ZT4A 5EP3A 3A6ZA 3PFKA 1QG2A 3I6BA 3R5TA 4R7ZA 5KOJA 1FUUA 2Y1GA 3FDFA 3W7VA 3FUVA 4A2QA 4QNRA 3DL0A 4C3OB 5JC1A 1GRQA 2XUFA 8ATCA 1HA3A 1NP6A 4ROSA 1QH9A 2DFNA 4EI7A 1JL3A 4JXZA 2XUIA 4CIXA 4Y0VA 3IDFA 2D06A 3GFBA 3LUHA 4EW1A 3RYHB 1MW9X 4NRDA 1DWQA 1ZD8A 3QG5A 1BX1A 1ZN8A 2GCNA 3RS3A 3DM9B 2WWGA 2VDQB 4W1RA 1YC5A 2P6UA 2I22A 1ANKA 3BTVA 3MF4A 3IAAA 1Q21A 1AKQA 3R7FA 2VUHB 4CHTA 3RVLA 4NBKA 2XJ9A 5FWXA 1ND6A 4OL9A 1SKUA 2VJPA 2WM2A 1RI1A 3EVZA 2ZG6A 3GG2A 3ZKWA 1X1EA 3SZMA 4ZJYA 4P7GA 5BMVB 3WWYA 4LRWA 1PIWA 1A04A 1UM8A 3VI3B 5CEEA 5CUQA 4KLAA 1VOTA 2P2ZA 1II9A 2ZOSA 1HUQA 2GPYA 4DCMA 2ACEA 3VYVA 5C81A 1X1DA 3Q8XB 4XJTA 4RPCA 3TG8A 1SXJD 1JQJC 1RJFA 3EEQA 4PSDA 1KJ9A 1VZ3A 1N1MA 5ICMA 3FHTA 3FPAA 3P32A 2O1WA 3CINA 3EIHA 3P9KA 5BN4B 2P7IA 1K68A 2G70A 3U9TA 2R6FA 4FUTA 1CS4C 4YMTA 1HKHA 1WMBA 9GPBA 4EY3A 3IQZA 5C8YB 1V5FA 2XYQA 2IFTA 3K15A 5FV4A 1I3KA 3A1CA 1X1SA 4FFDA 2O2CA 5DCWA 4D74A 2O57A 3R7BA 3I32A 1E0KA 1NXXA 4X5OA 3PWZA 2RCYA 3V00A 1NNUA 4DTCA 5K3EA 5CHEA 3EHEA 3I53A 3P94A 3SE7A 1JTEA 3TNFA 4FFBB 1MAWA 2WR8A 1RS0A 3I6ZA 4JD5A 2PBZA 3HGTA 2G83A 5F1PA 3OEHA 3PB3A 2VEOA 3DUWA 4GBMA 4V0LA 4ZV7A 4X20A 1FUYB 3T5MA 1B0PA 3W77A 1V3VA 1EFPB 3S6JA 4II2A 4YUXA 1KVTA 2FLKA 2OYSA 1XN1A 3JXEA 4BBAA 2CZCA 3QNUA 4WXHA 4KRFA 4IF6A 3EGOA 2V4ZA 1LDBA 2FSHA 3OZVA 4K88A 4ZEXA 1FTYA 2CUNA 5BQ5A 4ARIA 2WVAA 2Z3VA 3IEKA 4X3OA 2WVGA 3SM9A 4EYSA 4PX2A 3X0DA 1H4VB 2RHJA 4G4GA 2R7AA 3AUAA 4LVNA 1CZKA 1QQ5A 3EYWA 2ZUVA 1ETUA 2J5XA 1E0AA 4XCXA 1ZKDA 1NOKA 3SIXA 3T1HB 1K4MA 5K6AC 4ESHA 2IYOA 1R1DA 4K40A 1YFZA 4AF8A 3AUSA 2YXPX 1O03A 2Q41A 3ETEA 3F5MA 4UD2A 4UU8A 2QL7A 4FFMA 2D2EA 3FWYA 1JA0A 5G4LA 3UKOA 4JT9A 2EZ8A 1M2FA 2XVYA 2BP7B 4IV8A 4Q66C 4PCAA 2VQ6A 4NWIA 2YRFA 1BGWA 1KO4A 4FIZA 4GOKA 2NQTA 4AJEA 1JR2A 2DTEA 1VCNA 4HNRA 2VSXA 1QCDA 1YRBA 4JOQA 4BO7A 2ZJOA 1M75A 2GCOB 5AOVA 2PO5A 5AJWA 5HTKA 3WP1B 4EGAA 3KM0A 4G5RA 3WFIA 4PQEA 3RUDA 5IEJA 1E2GA 4RXMA 4K6KA 1D09A 1O9BA 3H17A 1CLEA 2ESRA 2QRHA 4EB3A 4MQFB 1IFXA 3G0DA 4WKBA 1ZH4A 3WTBA 3LQKA 2ZUSA 4GOJA 3BL6A 4LDAA 4UJ3A 3HJCA 5G1NA 4LXXA 2ONJA 4DJAA 1KNQA 3FBTA 9MHTA 3IQFA 3KZNA 5T64A 4I5EA 4P3NA 3MWEB 2C2ZA 3ZVMA 5IH3A 4B2PA 2FUG6 4H27A 1QLWA 4RHXA 1TPZA 2P69A 2X0FA 1E32A 4W8HA 4ZOQI 2VP9A 1SQSA 4KXLA 2OQRA 2XUOA 5EYPB 2QBYB 4LK2A 4KPUB 3WIDA 1M1NA 5AW5A 2SCUA 2RGNC 2NYRA 3B38A 3ZZMA 3EIQA 2JH8A 1YZFA 2E1PA 3IAFA 2Z83A 3GDWA 4DBZA 5I7VA 1OC2A 4DB4A 3QU5A 4BRZA 1W6UA 3DBHA 4QYIA 1JEEA 4JSTA 2EP8A 1M33A 4OX9Y 2F9LA 1C8VB 1COZA 1ZK2A 3CF6R 4N82A 5H5JA 1PVVA 2VTVA 3WFJA 2YUTA 3RUCA 2IU3A 1IXRC 3V80A 2CWWA 4MGYR 4UAVA 1GXSA 1TMGE 4PPFA 1XVUA 2FP3A 1MF7A 3FWNA 3N6RA 1TU0A 3DEZA 3B6JA 2BI8A 2AZDA 3GVIA 3H6HA 1QWOA 4Q03A 4UNIA 2J7KA 3OM8A 1GR0A 4JKIA 1U3FA 1SC9A 1CY2A 4B80A 5GIPE 1UJBA 5CNIA 3ZLTA 3TCKA 4PZDA 5SZHB 1YJCA 2WTXA 1Q1BA 3QYFA 4A8TA 3M9XA 5C5CA 2VWGA 1PE0A 2PWYA 3ZJYA 4TT3D 1O6FA 1S02A 1KEVA 4YQFA 5LOVB 5FBLB 4FILA 4U6SA 3VZPA 4RIFA 2ZP1A 3GY0A 3H2GA 1KYIA 4FC6A 4LV8B 2E21A 4H17A 4QECA 5CJ2A 2XW6A 5KOYA 4QYWA 4RIEA 3UFXA 3ZVRA 2XA2A 3IHKA 1XZAA 3M49A 5THXA 3TX2A 1WUIS 4NESA 1G1AA 1SXJE 1SK9A 2B4RO 2XB4A 2TSYB 1D8AA 1ZL2A 4YDSA 4DLPA 1Y1TA 1JHDA 3PNSA 3B9BA 2FPIB 4LCBA 1N5LA 1YRHA 2ZBVA 1BFDA 1TPYA 1FDIA 4YV2A 2AIRA 1CY4A 3C6YA 5FX2A 1BH6A 4RY9A 4U7GA 5JY6A 4JXXA 3SKYA 1YVUA 2HFKA 2ZULA 4ARBA 4DIUA 4AMYA 3RHZA 4N0EA 2HIMA 2ZDGA 2J87A 3AR7A 3PNOA 1OX5A 1LUAA 3I04M 3QPAA 3IEPA 4JROA 1UKVY 4YCJA 5SZIA 1KR2A 4QT4A 4PZLA 1QHXA 3HWX1 4MX8A 4X93A 3S1SA 1A8QA 2QTFA 4K6GA 5AVRA 2Z1DA 2DTXA 3Q5EA 4TV8F 3AY0A 5LDGA 1KDVA 3K96A 4CLRB 2I2AA 3R0JA 1RLOA 1Z33A 3SZ3A 5GJWC 4AJIA 4NYJQ 1Q7BA 3D4IA 4Z6KA 1QO7A 4QXOA 1XD8A 4JDUA 2H9YA 4CT0A 3ZGOA 1WXXA 1DQNA 4CFZA 2QROA 3P0FA 2ZTHA 221PA 3TIIA 3I8XA 1T5LA 5CTJA 5ALVA 1KFBB 3NHZA 2QVGA 4X84A 3FNIA 4D26A 2JIZA 4A0GA 2BFFB 4CQNA 4QX6A 3TKYA 2XZPA 2WIBA 4Z9YA 2I2WA 1GNLA 5JJ5A 1RTTA 1BVRA 2Q3EA 1U0NA 4Q7KA 5L3QB 2XUQA 3TVTA 2Q2VA 5JBIA 2AG1A 3GRKA 1K6MA 3IAXA 1FQOA 1XP5A 3UHFA 4WT7A 3WLEA 3E48A 1CFZA 2CXQA 5GV7A 2ZKLA 3R9IA 3E27A 1U0HC 5JCXA 1TYEB 1Y7PA 1P1BA 3MGAA 2QE6A 3NBYC 2CW5A 1TYAE 2JCYA 3CZCA 4NYIQ 3ZHTA 1QP7A 2DQYA 2P9JA 3DXYA 3SX2A 3V4ZA 3QKTA 5DCUA 3E8SA 2XMDA 1XTKA 1U0SY 3O2JA 3DLCA 4ZO7A 1JYSA 1UMCA 2EERA 1IN6A 3OP4A 1KH1A 5JANA 4FWIB 3WB0A 1RJDA 3DDUA 4DR4B 4M9XA 4BX8A 5LQDA 2ZRAA 4YCLA 2WYWA 3VU0A 4BV9A 1O6BA 5JNWA 4RENA 4IIJB 4KQIA 4WXEA 4ZI2A 3L4KA 3WWEA 4DUPA 3HKDA 3OZGA 3PC7A 5H02A 1EE2A 3GRRA 3IE2A 5DM4A 3ZDDA 4NCAA 2QV0A 3BRWD 2LUOA 1C1XA 3VISA 4NNJA 4F9GA 3R7DA 5KJFA 4UHCA 5CD9A 1DHRA 1P18A 1HQKA 3L1IA 1E61A 2QHXA 2PVCA 1AO0A 1JALA 3AG5A 2HSDA 4RPJA 4A2WA 3ZQKA 1N7GA 3Q6NA 4TTVA 2W6QA 3N8DA 4XDYA 3RHFA 3FR8A 5K8UA 3CN9A 3FF4A 1BOFA 3MTIA 1TCVA 4Z0NA 3CMMA 3X3HA 4B46A 4HXFB 2O2JA 1TK2A 1FFHA 3II6X 3NTLA 4NL4H 5BSRA 2AFRA 2IBTA 3COSA 1T1GA 3EGCA 4E09A 4TMFA 5DYGA 1XDUA 4FB4A 3MGCA 2OXCA 2X4LA 2FA9A 3DV9A 1PJ3A 2PSFA 2W6CX 2DFDA 3Q3EA 5E95A 1MPXA 1LU9A 5KYXB 1HY3A 2GN6A 1KKUA 1MTOA 2QSJA 1KJIA 1Z37A 2ZYRA 3L06A 1IATA 4P3YA 2EBFX 4GECA 1MGPA 3PZBA 1I1QB 2ZQZA 2HSEA 3DVLA 1G2PA 4IICA 3KX2A 1K27A 1G3QA 4NPCA 5TB5A 3O8DA 3DOIA 1BE0A 1ODLA 2GR9A 2QRJA 1VHWA 1WDTA 2FN9A 5FB3A 2OFWA 4Q12A 1ZWLA 4YAGA 3OZWA 1J2EA 3PG5A 3I1FA 4BCBA 5AVTA 3QXXA 3CRQA 4DYHA 2FG7C 4KXNA 1VHTA 2CBZA 2GKOA 2DAPA 2ECQA 4PC7A 1YOVA 1LRKA 3GUUA 4QGBA 2RIRA 3A11A 1E2NA 2IZ7A 3H1BA 4JY7A 1A71A 2SKCA 4G0MA 5JMOA 1AMOA 2NZ8A 3KYCB 1O6GA 2XOKA 3SGLA 4TVSA 5A0TA 2BCEA 2ZAMA 4UNSA 4P7FA 1N5IA 3HUTA 4R2MA 3QHAA 5LB2A 2XWBF 3PTAA 1BXGA 5TDHA 1ZM2A 1K7FB 3HY3A 4LHZA 3COVA 4A92A 2VOEA 1U0RA 2YFYA 4NNOA 5H80A 4CETA 3GPBA 1NIPA 5LQAA 1Z68A 2V97A 4UUPA 1AGXA 4JUBA 4CEJB 4F1WA 4EPTA 1VBNA 1FY2A 4CDMA 1UMBA 1K5PA 2FW8A 3PGJA 3WJ1A 1GUYA 1XCOA 4ALLA 3SXUA 3C6MA 2YWFA 4H0CA 1AXGA 4LYDA 4RH3A 3TL2A 2OBBA 4J0GA 3CPJB 3V1TC 5HRAA 4GX0A 4BFZA 1SU6A 3TR5A 4O3MA 4NONA 4JYZA 5EI5A 3VPBA 4CM3A 2IDJA 3D6AA 3URMA 1WPRA 3V6MA 3F8TA 3EBPA 2WLTA 2VF2A 1X7XA 3RUEA 2XNDD 1MHPA 2AMVA 5FWYB 1J21A 4FDVA 4EKDA 4CEHA 1CCWA 1KZ1A 3OPNA 4F3YA 4XTCS 3GCGA 3OY2A 3TJRA 4AKGA 4ZZIA 3G8YA 4F84A 1SZDA 1EFRA 3VR2A 3P96A 2VRNA 1N78A 2V3VA 3KUXA 3CEPB 2DUNA 1MKYA 4NZYA 3K2IA 1XA3A 2R1TB 2WU4A 3DXFA 4ZGGA 3GOQA 5E8RA 3RLFA 2PGLA 2XZTA 1DTEA 1M7GA 3N86A 3QV2A 3S44A 4MW2A 3E15A 3EXG2 1OAKA 4MCIA 3UB2A 2XKBA 3D0RA 4RD4A 1F1BA 2E9SA 4TYPA 3FGPA 3ZUGA 5HZMA 3NHKA 4QDXA 1GFZA 2FY8A 4WSOA 1C5KA 1F4LA 1P9NA 4ZTBA 1CLUA 2GYWA 1UK6A 1SU4A 1D2MA 2AW5A 2D8AA 2H9AA 3EXEA 2ZBDA 1SFRA 2V98A 3B51X 4EJ2A 4ALNA 1AD2A 2WJWA 3FLAA 2BFEB 3H1FA 1EUCA 2WQ7A 4OK6A 2CDAA 1JHOA 1ZOLA 3RPEA 3FOFC 1KKLA 4KNWA 1U4SA 2QN8A 4E03A 4FYWA 1GNQA 2SICE 4FYXA 1ORIA 1GL7A 2AOXA 3Q15C 4NBRA 2JK1A 4FHEA 3ZNPA 2IHKA 1NSTA 1GZ3A 3PEWA 2J1LA 1A0OA 5KTOA 4MOWA 1KDOA 2YXDA 2B8NA 2C99A 1U2DC 4NOLA 4OXRA 1GSAA 3OX4A 3D7KA 2I9PA 1DAFA 2Q6IA 1PR2A 2QTAA 3TI7A 3ZY5A 2JIOA 1D2NA 5FFFA 3J80A 3RRZA 4IHKA 1V35A 4HYTA 2IZ0A 4DG8A 4RADA 3T99A 4KGXA 1NC1A 2GBGA 2OV1A 5CDTA 3T61A 2BEWB 3ICEA 1RHUA 1C8LA 1NRIA 3SDSA 2IDKA 4X65B 3O9ZA 2GD0A 3Q8LA 2Q27A 5HFNA 3AF6A 1ZD9A 5LA6A 1VMAA 2X5OA 4NZMA 2BOVA 2Y77A 3DH0A 5IDVA 5T67A 4BMSA 3O0TA 4C6RA 3C14C 1GGMA 2H06A 2QRQA 3HKDB 2JPDA 4R8KA 1GTRA 1YULA 5EL0A 3MMNA 2GZSA 2X3YA 5AJUA 1ABEA 3PDWA 3A06A 1YV9A 4L8LA 4MMXB 5A03A 3SN6A 3ZD7A 3AC0A 3BFPA 2BGUA 4GZ3A 4KGDA 2NXCA 3REFA 1Q0ZA 2G7MC 2BEVA 1F2TB 4PO3X 1CZUA 3WDKA 4F4JA 3EJ6A 3PDUA 4EMSA 4M1ZA 4ZCPA 4PNHA 1BTOA 1U90A 1MTZA 1K7XB 2XE6A 3FJOA 5I7FA 4Y2HA 3TD2A 2PSSA 1ZGCA 1RHMA 4UUBA 2G72A 2K4MA 2BFDB 5CURA 5BR7A 2QJRA 2AWNA 4U6QA 1AOXA 3DL4A 2HA5A 2JKZA 3C24A 3IT2A 5IVKA 4HAVA 4CKCA 4PPGA 5BYBA 1CQZA 3E5RA 4GEKA 3JAWA 4FE3A 1B8VA 4KCGA 2FFQA 1A5BB 2MYUA 2OV3A 5G0UA 4BFLA 1BKYA 2FW1A 5BV1A 1CF4A 1WHSB 3K5WA 3NJ8A 1QHSA 1B73A 5FV7A 3U3DA 1MVNA 2VKTA 4YJGA 1S8OA 3HN2A 4YMHA 4HDSA 4M9CA 1FNSA 1KI6B 3IBGA 4BJHB 4V0KA 1A96A 3GX1A 3HWSA 2Q21A 1EXVA 1H66A 4JNCA 4S12A 4YAKA 4AY2A 1WVGA 4IGIA 2ZI6A 4Q0MA 1KMHA 5KVAA 3ED5A 2VPYA 4TMXA 1Q11A 4D0RA 2VBGA 3VH4A 1G63A 4QUGA 3R77A 3DFFA 2RGWA 2CE7A 3V2GA 1T36B 4DT1A 1DO2A 1Y37A 2J9YB 3C39A 2CVOA 5JXHA 3OESA 5DT2A 1AF4A 4J0HA 4TKMA 1IUOA 1ID1A 1XDZA 1F12A 1Q7TA 1RWKA 4IUBS 4YFYA 2IE0A 1KO7A 1L4GA 4RVNA 1WXDA 1LFAA 3UATA 1GWNA 4EI8A 1NQVA 3UBTA 4ICIA 1JYFA 2DKNA 2C96A 1TA4A 2JFZA 3JWIA 4DZTA 3ANYB 3NBFA 1NP7A 4JENA 4CQMB 3KBBA 3RTEA 1NW6A 1ND5A 1UCFA 5HBGA 5DX8A 4JFRA 3I01A 3MVEA 3ND5A 1G60A 4B4OA 3I9KA 4LRQA 4RZIA 3I2KA 1WSWA 4KK3A 3AR4A 5IM4F 4QUHA 4X95A 1LEHA 5AKZA 3RS7A 2C88A 4HYYA 2H17A 3KVRA 1WL8A 4ZOAA 3BKXA 3C5VA 5C0OE 4MVJE 1HMYA 1WSDA 4QQNA 2XGSA 3V8MA 4AB1A 4YONB 3FAKA 5FIUA 3QELB 3B3GA 2IYUA 2W42A 1OTXA 3JYNA 3AH8A 4IOKA 3V8PA 1VPWA 3MUFA 4D96A 4UW9A 1E89A 4QFCA 4P4TA 5KHLB 5FPSA 5M29A 3K9HA 3GI1A 5GONB 2YHIB 1MNAA 4DLVA 3M81A 3Q9LA 4H7JA 2G4VA 3IJPA 1E5QA 2VRCA 1J1IA 4FM9A 3NHFA 1VLZA 4L9AA 5LFAA 2E4VA 5JARA 3DCJA 1T3GA 1VE3A 4ECEA 3OHPA 4OJYA 4Q9NA 4MGIR 1W1IA 2ZYIA 2NUTB 1WIWA 4R5MA 2FWBA 3JU3A 4MB0A 5DASA 1UPAA 4LSWA 1EE9A 1GL3A 1VLJA 4XDHA 4UDNA 2Z8XA 1NJ8A 1S7CA 4G0NA 1UKBA 4NYJR 3FDJA 2CDRA 3OT1B 2WEKA 5BSEA 4IIFA 4FJ0A 1QFYA 4U3JB 3VVMA 2A0FA 4LV6A 5CITA 3R0IA 2BBTA 4G6ZA 3UHOA 4IQ4A 2ZIZA 2ADOA 3C5EA 4XLTA 1SHJA 4LI0A 1L7DA 5HIKA 4OXIA 3ER8A 1BWSA 3Q7PA 1XWFA 4M21A 4O4JB 3U16A 1OLSA 2VYVD 1Q6ZA 4JGBA 4S1WA 5CVUA 3FW1A 1FNNA 1P6XA 3RDPA 3SG0A 5AW6A 5HQTA 4BXOB 3PVCA 3QKSB 4UBMA 1I0ZA 1T0BA 3BK7A 4IVRA 1KOFA 4FZJA 4NBLA 3WGHA 5HQ3A 1T9GR 5KTMA 5KU7A 4NDZA 3ZX4A 4ABTA 2IH5A 1U9IA 2HTEA 3C15C 3LFHA 5IDQA 1KAOA 1Q1EA 2JANA 1UJ4A 3QTLA 3SBXA 5J58A 3NJ4A 2WD7A 1VIDA 4FSXA 4IPTA 1J09A 1OXXK 4J0QA 3LV8A 3P2KA 4ESEA 5JY1A 3RYFB 4N03A 4OKIA 1DNPA 3TZKA 4UUNA 4TQGA 3IMKA 2AZTA 4BN4A 1CQWA 4C0KA 4D0GA 1V95A 2NIPA 3OM0A 4E1VA 5E4JA 3ADDA 2DQSA 3QHQA 1TKAA 1W96A 3B13B 3LE8A 5ALPA 1LZLA 2OPHA 1KSHA 2H08A 2NUPA 1N6IA 1HX7A 3BWBA 2ZWIA 1UBEA 1HYEA 3E9MA 5DHAA 1N0VC 1P5FA 3RLIA 4CM8A 2JFXA 4NLLA 3ESAA 3D2LA 1G3MA 4K2HA 1IYZA 1OA0A 5JECA 4OA5A 4MKRA 1G8FA 4QJ4A 1BKSB 4MYDA 2IIPA 1V45E 5E7JA 2EL9A 2HMAA 5KSPA 4M37A 2XB8A 3DHYA 5EMMA 5KJ1A 1ZM3A 4LX8A 2AH5A 4X1OA 1KTIA 2OHHA 2BMDA 4MCJA 4ENWA 3IFSA 4R31A 4W6QA 3PUKA 4D43A 3WYBA 1ZC4A 4FX2A 3GQBA 4PZAA 1YJAA 1FJGB 1WEKA 2AF4C 3GFRA 2IHJA 4O33A 1ZRHA 1Z4KA 2GQ0A 4G8BA 1AQUA 1VL6A 3TQHA 1RQXA 1DCTA 4N0QA 5U9CA 1W88B 3TXAA 4N47A 3BILA 1FFSA 3LCJA 1FDWA 1F5SA 3IUQA 4DXDA 4MVJP 4KWHA 4EJSA 4F46A 1PGNA 1BN7A 1E2EA 4GIBA 4R1NA 4UOZA 5DOZA 1TE2A 4YUYA 2CE2X 2WIGA 1MDBA 3K0EA 4PLGA 2JGMA 3SYLA 1Z4PX 2P5YA 1I1OA 3AHDA 3BREA 3H2KA 1IONA 3QKIA 5EE0A 1K8ZB 4AUMA 4BO5A 1AB5A 3LC7O 4NJMB 2HO4A 2ZR9A 3HABA 1G38A 3PE6A 3G8BA 3G23A 3GF4A 1I2MA 2KLHA 2ENWA 2XCRB 2H1WA 3OF3A 3T7AA 2WT4A 4BYMA 1PP4A 1PR4A 4OTZA 4IZOA 4L4RA 4PAOA 1JR4A 1WWKA 3WNQA 1Z6QA 2LKDA 4YAJA 2HUPA 1NBME 2RGDA 1WBDA 4N7MA 4P36A 4L6AA 3B1WA 1NRWA 4EF6A 1CEQA 2JAOA 1AKWA 4QFMA 5B37A 5F76A 5IAJA 1RRKA 3NNDA 2ZSHA 1AMNA 1YFKA 1C9NA 2FVYA 3QXHA 5LSAA 2MTBA 4RAOA 1IHXA 3KJHA 3L1KA 3GFPA 4KIUA 3I9JA 1YJQA 5KWEA 3IERA 1Y6GA 4XSVA 4O6VA 3PHLA 5DI3B 1MMFB 5J59A 3FHOA 4WXRA 2V59A 1DBWA 3RC2A 3SYKA 1HDYA 3TAXA 3PRHA 4CL3A 3IVXA 1M76A 2GM9A 3FE2A 5T3YA 1ZSNA 3WMXA 4DCOA 3THYA 4QU9A 2CYBA 2OM6A 3AF2A 4MO2A 1PFUA 2ZCUA 3FNRA 3D7NA 1Q17A 3OOHA 3LPCA 3LK6A 3OA2A 3N8IA 1YZUA 4MIYA 4R68A 4UDOA 4C21A 2AQIA 3ORYA 1FVOA 1BG6A 3PC8A 1YTUA 2VP0A 3FCCA 5AVKA 4RJTA 1KKMA 1BA2A 4BUZA 2PE5A 3JALB 4TKVA 4GI7A 3RYHA 2CXXA 2R8EA 2RGXA 3C43A 5DHQA 2WE7A 4IILA 2QORA 1C9JA 1E2MA 4PSUA 3WL5A 2J0UB 3ZV4A 2C03A 1MCZA 1N2CB 2VNIA 3BWMA 2CKMA 2P4EA 4WGFA 3JSAA 2A1TS 3DZ8A 2CK3A 4MEBA 3ACDA 3CH4B 5EP2A 5IUNC 4MVYA 3THOA 1P75A 4RGYA 2K7FA 1CP2A 1GA4A 1EHCA 1M1YB 1ZK1A 5F1YA 5H3HA 5LQCA 1LF5A 4NNPA 1GILA 5JBQA 3QWIA 3ZWDA 3PXCX 1N3LA 3IEVA 4I66A 5KDDA 3K5IA 3Q3CA 1QH1A 2QSZA 2IXAA 4LWZA 5L95A 2WFAA 1E8DA 1KI2A 1AKRA 2I99A 3B5JA 3F3SA 2PL1A 4ZQIA 3WWZA 2DFKB 1YJ8A 2RHBA 3B7WA 1T29A 3VX4A 2YMLA 5FLXA 5DZSA 1JAHA 2ZUTA 1W73A 3ZCQA 1RAGA 4LC9A 3SCZA 4II7A 4A27A 4H3SA 1F9AA 3CG0A 1HT2E 2VZLA 2CLLB 1T1SA 3ECAA 3K9NA 4WFIA 4CLDA 3TNDA 1Z36A 3HVRA 4FDTA 1W0KD 2DUWA 5GGXA 1I4EB 4BJ1A 5C32A 3INRA 3FF1A 4IHJB 3HADA 4KC0A 4RVFA 3K73O 2IZ1A 4WJLA 5C2JB 5BYAA 4DV0B 5JD5A 1WAMA 3E84A 2GN1A 4QPCA 4ZO4A 4X8MA 2HA0A 4NQRA 1AUOA 2I66A 1CR4A 3EFOA 3T5BA 3DR3A 1QOZA 2PKWA 2QMEA 3RRYA 2YRXA 1GG9A 3K0BA 4DPMA 3QQPA 4AX4A 4U0JA 1PGOA 3WBKA 1NPYA 5DVZA 4MH0R 4OH1A 3UV6A 1M2VB 2B4YA 1PX2A 4HCJA 2Y92A 4KNVA 4YASA 4C05A 5KSZA 2R0QC 4DCTA 3RS4A 5BVHB 2W93A 2GERA 3ZXIA 2BYTA 3GB9A 3ZN2A 3OMLA 1P3JA 4B32A 4N9WA 4ZEOA 4ZV4A 1WJGA 4C0QC 4BZWA 4HH0A 2VDVE 2W2KA 3LVRE 3LP8A 3PR2B 1JHZA 5H68A 3U4DA 4BVAA 4ZYXA 4UFOA 4NAHA 4EY7A 4RFVA 1RSZA 4HC4A 3IH5A 1K98A 1WY5A 2F3PA 1A8SA 3AR5A 2QD1A 1YS7A 3A04A 3D8RA 2B7LA 4O4JF 1A7UA 4UHHA 4RANA 2JGKA 1F3LA 4HD8A 4UMEA 1GGHA 5F1KA 5E4YA 4TQAA 1D2EA 2QDXA 3QBJA 3H4IA 5I4IA 2O2ZA 1TEXA 1PI3A 2R9VA 5SY6A 4BVGA 1M2VA 3LPMA 1NR5A 3TLGA 1NATA 1XYGA 4DEXA 4L08A 3BXOA 4BZZA 2EKDA 2EX0A 2BAGA 2QU7A 1Z5OA 3QF4A 2MIIA 2DULA 3KOXA 3R74A 1R0WA 3KJNA 2OR3A 1QHIA 2FFRA 1NE2A 2ZYGA 5CB4B 1VM6A 1A2OA 2GAJA 1AHNA 4NFSA 1A9YA 2R6AA 1QGAA 4UTVA 2G08A 2JB9A 5KWJA 3P97A 2V7QA 2FMHA 4MRVA 1XA4A 2W8BA 3O4GA 4FZ5A 3ZQJA 1NVDA 3S1AB 4FYJA 5K20A 1ZMRA 2ZYHA 3BXFA 4UM9B 3K31A 4HAXA 4H3KB 2HRQA 4KQ9A 5CBKA 2VOJA 3ENNA 2PRYA 2VUSA 4O2AB 5TF4A 4EGJA 1ZN2A 3KLBA 4O2BF 3GEBA 3MS2A 3PGLA 5LC1A 5AVYA 4KTVE 1BRTA 3MPUA 4E14A 6REQB 2PBRA 1QPGA 2RI6A 4HQOA 3SHOA 2FCRA 1Q84A 1EVEA 1X7YA 5LJIA 1AKVA 3QV1A 1Z0FA 1AE1A 2DGDA 2VUUA 3HVKA 1OT5A 2I80A 5G0WA 5E1OA 2J5BA 4PXAA 3UFXB 3FWZA 3M6AA 3DBLA 1LTKA 3UGKA 2PUJA 4MLDA 3HGMA 4NIMA 1BVUA 5JSKA 4R3NA 3B70A 3G13A 3IMFA 1X80B 2RGCA 3LWZA 3M4ZA 2Z3ZA 3O92A 3GJTA 4JLBA 2REQA 4RFLA 4ZU3A 1BD3A 2W11A 5BQ3A 1ZHOA 3KXKA 1H8EA 1POWA 1ZG3A 3WXBA 2RG7A 5IUJC 4RYLA 3H99A 1IB0A 4V0OA 4NE2A 1SVUA 2WB4A 3K4HA 2O0JA 1JLRA 2VBFA 3GLHE 5DHFA 4XOUA 5EJ4A 1N4AA 2QJFA 1PFGA 4Y6SA 1D4AA 4JLMA 2NW6A 4DM4A 3KAPA 5JZ9A 1XCLA 1CVLA 4XIFA 1LVGA 1C4OA 1E2FA 4Q9AA 4M0LA 4NV0A 4ZHQF 5AFSA 3L9WA 3VGJA 1H5NA 3A6HA 1FPMA 4R1SA 3QXCA 3FDZB 5DK4A 3FYDA 1RWVA 3ZX5A 2FDXA 4JL6A 2GAIA 4TKUA 4OHZA 2JI4A 2WBLC 4I55B 4B6OA 4X41A 4WKNA 1TF5A 1Y4DE 3CWCA 1PWZA 4HQKA 3N7TA 2A33A 2ZQ5A 1SC1A 1XWIA 3RUHA 3O8RA 2PZMA 4MCAA 5TJ9A 4KXMA 2C82A 2DRIA 1VMDA 2JC3A 2OM2A 1TA9A 1KJJA 2HEIA 3W6UA 3WMFA 1WW3A 3OTQA 2WHEA 1JHMA 5CM8B 3QE9Y 3L40A 2EVWX 1H1LB 4W82A 3PTZA 2CYAA 3OZSA 5EPUA 1LLCA 1T2AA 1NGSA 5SV2A 4IOMA 4JNKA 2A67A 2PANA 2XUZA 3K16A 3L7MA 4FBLA 1G5IA 2HMWA 2YYZA 5DBGA 2YOGA 1FL9A 1U0GA 3KU1A 1EZZA 2W22A 3PXEA 3BX1A 1FTGA 2X9LA 1D1PA 1WF6A 4I1VA 2NTEA 2BFPA 4NQZA 1Z8NA 2Z6VA 3HCEA 4LVOA 4CYMA 2EFJA 5LQJA 1OJ7A 1ULHA 1A5AB 2VQ3A 3VV2A 1NPTO 2PSDA 1ECGA 3GNSA 2VZ0A 1Z0JA 1E2UA 1Y9JA 2YV1A 3LQRA 3WB1A 5T7BA 3BJEA 2DEUA 1RRVA 3P1JA 4A16A 1HLFA 5ETJA 2F7SA 1QKJA 5A05A 5DULA 1U63A 3GD7A 3ZW8A 4XVRA 3RKUA 3MT0A 1ZEJA 5T4FA 3AL2A 5CRIA 4A8PA 5C3UA 3LF2A 1H42A 1YD7A 1PNQA 3E58A 2O3RA 4WX2B 2H2DA 2P9EA 1NYTA 4ZWNA 3V2IA 3VC2A 1KK3A 3ZGLA 3M4JA 4UM5A 2E55A 1DE0A 4CM1A 2XUKA 4OJKA 5FKJA 3JQAD 2NUAB 3RODA 4IOJA 2FPOA 2FSFA 3MA0A 1SCBA 3OEYA 1EP1B 4KWTA 4B48A 4WJZA 3C74A 3TQFA 3LRTA 1TZJA 2QX6A 3KWJA 1QX4A 3OE4A 5IZCA 5T41A 1QAMA 1DTSA 3HJNA 2BONA 5E6UB 1XZFA 2FPSA 2FI1A 5DDIP 1AA6A 1WXHA 4Y2JA 4EO4A 1ACMA 3DWIA 4GZLA 2EG5A 2JLVA 1DB3A 2QVXX 2PNJA 1VYUA 3LYUA 2R6DA 2V7EA 2WJVA 3F5QA 4HTFA 4C29A 1T24A 5K09A 3HXKA 5JDCA 3GYBA 4HFRA 1Z34A 1Q0PA 2CMKA 3B2NA 3IIMA 2D62A 2FQWA 4KJZA 1ZHFA 3EVCA 1DX9A 2QE7D 2PKRA 2YQ5A 4G0VA 4EFNA 4UBNA 1J20A 3OQHA 2RAPA 3BG5A 3QRWA 4YCNA 4Z7NB 5H3LA 1IBLB 1R18A 1P3DA 2W4MA 1HORA 4MYRA 4DMRA 1RYDA 1JA9A 1ZIDA 1TQHA 1KFJB 2OD2A 5H0IA 2YZMA 3PEFA 5FCDA 4HOYA 1RM3A 1XL0A 5HGXA 1N8TA 2G0NA 4FOLA 1C3OB 1OAOC 4XOIA 1EWYA 3ZDEA 5BN4A 3A58B 3DP7A 4NFLA 1JDTA 4IJVA 4YS6A 3D31A 5DT9A 1PR6A 4L15A 2BFMA 2UKDA 2C3MA 3E9YA 1H2XA 3HCWA 1W5TA 3EWAA 1GZUA 1TIBA 3CPEA 3FSGD 5MGNA 4MR8B 3NNSA 2VC2B 2GCPA 3HNPA 1SZCA 3S2EA 3WYDA 4BMCA 3PCTA 4ADSG 2WHXA 3BULA 4A0SA 2C59A 1L5VA 3U80A 1A88A 3DD1A 3O91A 3SWWA 2ZRGA 1L4HA 2EC5A 3D8BA 3BK2A 4JOCA 4DMUB 1K97A 1PK8A 5AI0A 2Q9BA 1Z22A 4YROA 2IDZA 3DCNA 4RKWA 4Z54A 1XELA 3P5BA 3OFND 1FW6A 5JCJA 4KOEC 4XVQA 2PY6A 1XLWA 3IIJA 4K6OA 1F5NA 4B31A 2PZBA 4YWHA 5F7OA 5K2OA 1L3CA 3VNSA 2WWFA 2OQIA 3E23A 1LK5A 2H9IA 1P7CA 3Q8WA 2ZTVA 3QSGA 4X1YB 3UKJA 4E1BA 5CB6A 2QEQA 4UDYX 4AULA 1GNSA 3VR5D 3O47A 1CRQA 4D9KA 2BBSA 1FRZA 3FCAA 4J16C 4JWKA 2WK1A 4G37A 3DHVA 3BJZA 4XKJA 3SKVA 2VDMB 4X97A 5FAKA 3A1TA 4IFTA 5L3RA 3PC2A 1E1DA 1B15A 5HHTA 3Q2IA 1J5EB 1L5FA 2ZBFA 3OIUA 2Y8EA 4RVDA 3T5AA 4TS4A 2ICAA 2KQUA 4IV0A 4BQSA 3HYNA 1NVEA 3FJ1A 3PFWO 4HBGA 1L7RA 1W36C 2R68A 3AF5A 3ND8A 2I62A 2PXXA 2R2GA 4JHXA 1R8SA 1JFVA 1K06A 3A4YA 5HX7A 2K5UA 2ZIUB 3FFWA 2IU6A 3RC9A 1NQ5A 5CDYA 2CFRA 1R0LA 4Y2PA 1GNRA 3A37A 4DMLA 1IPFA 1Q12A 3KV1A 3HN7A 4YRJA 3F2VA 1SHKA 1MEOA 1QQ7A 1V2HE 1FMJA 1XA0A 2Q3DA 2TMGA 2V0CA 3I12A 1HKUA 4GLLA 4ITUA 4NMWA 1GN8A 3RNLA 2LDBA 3KB8A 5DISB 4UMVA 2ZM6B 1OA1A 1US8A 3IODA 3GLGE 3T3NA 2I7DA 3CYFA 3N59A 3DMDA 4CDGA 4MAAA 1R8YA 2SECE 3BGVA 3NU1A 4G97A 4Y9SA 5ALGA 3QH4A 2VWQA 1VGQA 3PKZA 4A8JA 2ZUEA 3UAWA 4ZALA 3HDYA 3IDQA 4Y6OA 2NG1A 4F04A 3SEFA 1RZ3A 1OIWA 2VO1A 1CJUC 3HFRA 2PSEA 5ICGA 2PGOA 4PZ0A 1ZS9A 3MSCA 3E8MA 3D8HA 3SHQA 3HGQA 1NL3A 2AI1A 2X23A 1A4UA 3A28A 3D7LA 5CAEA 3GLIE 2D7JA 3GJ8A 4D25A 1GPH1 5JSHA 5KQRA 4LRTB 3TOZA 1UC5B 3EPRA 3HCFA 5JD3A 1CKEA 4LTMA 2GLTA 1HE5A 4IDCA 2YMMA 4F21A 2E4ZA 3KTAA 4C0BA 2IU4A 5KYYA 1PT7A 1Q3KA 3JCZA 2DKOA 2N1MA 2YBDA 3KHKA 4JLAA 4G5FA 3WG9A 5IAOA 1CETA 1PJTA 1JLMA 3RG8A 4I6GA 3ZBQA 4P7BA 4C08A 2XRZA 3NFRA 2VDLB 5FL3A 3NNNA 4FCWA 1DINA 4BWVA 2OLEA 4OQNA 1E3MA 4KPUA 2X4IA 4WGGA 3PR1A 4CEIA 5JXJA 1SVKA 3OIFA 3QWFA 5JV5A 3E8XA 3O84A 3NOXA 4FC7A 1ZZGA 4TWBA 3N6XA 2AHOA 4EELA 1YBHA 3B52X 1OCEA 4N7RA 4DV2B 5K0SA 1B16A 2B7BA 2R6R1 2DECA 3MG9A 4D7AA 5GGYA 2HBRA 3L8MA 5T57A 2YVAA 2DVMA 1QR6A 3O90A 2Y71A 2C57A 4AWBA 1E20A 1XCJA 3AETB 3MILA 2FFAA 1D7OA 1SCUB 4S05A 4HMOA 1NQOA 4JB2A 3C7TA 3RSCA 2GMWA 5ENVA 3H3XA 3T5TA 1DCKA 2R7MA 1TVKA 3BXHA 5BQOA 3D5QA 1CS0A 4GKAA 3FZNA 3BGWA 4XTRA 2JFYA 5D84A 1A2BA 1VG1A 2J3QA 6Q21A 1BHJA 4WZAE 2KPOA 3F1KA 1USWA 2PUFA 4UEKA 2B9VA 1DEOA 2HJ9A 1UDRA 1Q5PA 1CYDA 4IDPA 1XTSA 4ZN6A 2D2VA 4WV3A 1QNFA 1V9CA 3ZWWA 5B7NA 1ZJ4A 1CC1S 1Q7GA 3AF1A 3ZY3A 2C3PA 3G1TA 5A3RA 3IQDB 5LU9A 3HKCB 2PFGA 4U0KA 4X61A 4PY2A 2BDTA 2C4KA 3QVSA 1GPAA 4MIKA 3HA2A 4BVFA 3QTTA 5FOVA 3TIXB 1NWHA 4WMLA 1DKRA 2VXYA 3PXDA 3V97A 2PUAA 4UXJA 1QRSA 3N28A 3N2GA 3ZK7A 3UHAA 4WK4B 1O8CA 2C9MA 3ZU3A 3I0NA 1YVPA 1T2UA 3OPYI 4XVUA 5AM4A 4Q82A 3SFZA 5D7BA 2II6A 1ZLYA 2OK7A 5J5AA 4MR8A 5IABA 4LXQA 5J4YA 4KLCA 3AVTA 1O8BA 4Z7JA 1GSHA 1H85A 2A5DA 4A5SA 4ZEVA 4V1CA 4HLNA 2NUPB 1NJGA 4Q47A 4QSMA 4FUQA 1BW9A 4BVJA 1KI3A 3GBPA 4WECA 3ELYA 4Z9BA 3PC6A 3VR4D 5A5VA 3MS4A 4PGGA 1KU6A 4DGQA 1E9EA 1YQUA 3W2HA 1JIVA 4JUCA 5HS4A 2R87A 3M2TA 3IXQA 3KOYA 5JR3A 5ER6A 4RIIA 4TYWA 4KE8A 3Q7QA 2Z2IA 4BZPA 1EVIA 2VJBA 2PT9A 2X9QA 4Q3KA 2VJKA 1RI5A 1NJ5A 4QVKA 3RSSA 2DU8A 4CNQA 1WDLA 4GI2A 4QTUB 1M8PA 2ZRBA 4XPIB 4YJHB 4INPA 4TWRA 3ZY4A 1N2CE 3RM3A 3RANA 3G2MA 1FOEB 5BSGA 1U0BB 4MLCA 4JQZA 4ZVKA 1GAJA 4QKQA 3RD5A 2FK7A 3W2GA 5IWCA 2HU8A 2P3LA 4WCFA 1N2XA 2CCJA 2IA5A 1HQCA 1ESCA 2CEAA 1OGYA 1JQBA 4EL5A 2NTVA 2PKXA 5DU2A 4RCZA 3ROMA 2FPUA 1R5NA 4AMVA 1V6AA 2G4CA 2V96A 1P1KA 4J1NA 4TYYA 4OLAA 1C3VA 4BX9A 4E13A 5JAIA 3JD0A 1CZHA 1AZLA 5LCXA 1JKXA 3BTSA 4F4FA 1N3BA 4E46A 1GPKA 4P4SA 3D2CA 1H5UA 1KNXA 1C2YA 4EM6A 2YN4A 3I58A 4US0R 3SYRA 1J1ZA 1WKVA 3NVDA 5F35A 5HRCA 5ILQA 1TNDA 3O26A 1BXGB 4CQLA 1H6CA 1M83A 2DWOA 4HT3B 4QOHA 4J91A 3DO6A 2CMHA 3AONB 3DO5A 1NJ2A 3HDGA 1U1EA 4KKXB 3DEJA 5LUBA 2PZLA 1H8HD 4HAIA 5E8JA 4OQEA 5HR5A 5FUBA 3U37A 3H7AA 4N5MA 3SSAA 1KZ7B 1M2WA 3A32A 3GT0A 4RD6A 1VSVA 2QLJA 1WHTB 2YHUA 1J70A 4G1UC 4K5QA 1DRWA 4S2EA 2WHRA 2DFTA 5CT4A 1CR6A 3AI3A 3G1UA 3A31A 2HY7A 1E3EA 1LJUA 3QLVC 4HB0A 4WY8A 1V3UA 2A35A 3PL1A 5EKSA 1O58A 2H3EA 3OY7A 5K03A 4LWQA 1FP6A 1DKQA 2BUBA 3B48A 4LOIA 3MIIA 3K72B 4N7BA 1OXKB 4U9HS 3GJ6A 2AT1A 4S1PA 2G40A 2P40A 1SIWA 2J4CA 3BGSA 1JU9A 3QVJA 1C9DB 4GVPA 2YS7A 4J2HA 3ZU4A 3U4IA 1J8VA 3V2HA 4KR3A 4FFSA 2WKQA 3JQ7A 1ESMA 3OFVA 2AEJA 2KBFA 1EM8B 2OWDA 2OV2A 4N6OA 4E21A 4W5TA 1EAMA 4I3GA 4A10A 5FOTA 2O07A 2CNWD 3GAMA 3K9CA 3QM1A 2ZZNA 1SU8A 2VAPA 3ZLVA 5CGQB 4C6TA 4CG2A 3ZDFA 4ZCIA 1HTWA 2RSLA 1T0JB 3I30X 1TA0A 4URYR 4MV5A 3EYAA 3RUFA 5IK2A 4ZAVA 3KLPX 1DUVG 4G09A 4UVIA 4F86A 4EAAA 1ZH6A 5CH3A 3WLTA 2I0FA 3IA2A 4YP5A 1R0CA 4W8GA 5TV2A 2YV5A 1V8BA 4QYSA 2CFOA 1QAQA 5DHTA 2G36A 1PT8A 3C98A 1HDXA 1WOMA 2J9RA 2GBLA 3TH5A 2C1EA 1PFYA 2GN4A 1CIJA 3VO1A 1VDZA 3M1LA 4G25A 1NQUA 2MOKA 2YXBA 3IP1A 5CVEA 3A4TA 3U7RA 1HMPA 2MU1A 3FVTA 2Y1KA 3DAYA 1UP4A 4PRZA 5LLSA 1BMFD 5DM1A 1X6VA 4PVDA 4ZREA 5E2IA 1FSPA 7ADHA 3TQRA 1DEXA 4LFAB 3P19A 4LYEA 5DXJA 1P1FA 3REOA 1QYWA 2HPZA 1HE3A 4U5XA 3DM5A 5B2EA 4R6XA 3CVOA 3F5DA 3IP8A 2P6PA 3ICVA 4C01A 4HI0E 3IQGX 1ZY2A 4MRSA 1NVXQ 5IJ9B 2I3AA 1OH8A 3D64A 4JXKA 1ZXBA 4UBIA 3LNCA 1LBTA 3JRXA 4PHCA 3AZOA 2XWQA 3AR9A 2P78A 3D3WA 5JO0A 2QAIA 3E05A 4M55A 4XQCA 5HKKA 3NTUA 1QQBA 1QANA 1XZKA 3TZBA 1XHLA 3N2KB 4ZZ0A 4YALA 1II8B 4JLPA 3TJMA 3EK2A 3C0KA 1T5DX 4LSMA 2EJWA 3VGPA 2XQFA 2XYVA 1XTPA 1ZICA 2YY6A 4NEQA 5CVJA 1HDCA 1QORA 1YMQA 5A4DA 1WXFA 2ZKIA 2IS6A 1Z2CA 1R8QA 1H69A 2HF8A 3LCVB 3ND6A 5K45A 2ZIXA 3FI0A 3KQTA 2ZYDA 4CKYA 2J3KA 2ES4A 2JBAB 3KSDO 4BN5A 3GJXC 1RRMA 2BH2A 5IZCC 5H59A 1E9BA 2LBPA 1VPTA 3Q72A 3DC7A 3RU3A 3GCDA 4IHJA 4KWEA 4LYYA 4TVKA 4YFVA 4H7KA 5HIJA 4ZKEA 1G59A 3G9QA 1QYCA 1I5RA 2Y1OA 3S1LA 1QMPA 1Z3CA 4HJXA 1UXKA 4PTYA 1TC2A 5DCYA 4ZEWA 1CJMA 4TXNA 4CT4B 3RSHA 2QENA 4AU1A 1ZGGA 2YFKA 4WN3A 2W6IA 2UZ1B 4B8YA 1A9XA 5TE9A 1TRKA 1UPFA 3FWHA 3GLQA 4ZK6A 1I2CA 1CQJA