1CZKA

Comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQNAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparisons of wild-type and mutant flavodoxins from Anacystis nidulans. Structural determinants of the redox potentials.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Electron transport
molecule keywords FLAVODOXIN
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1czkA00
2W5UA 4GQIA 1I1OA 3B6IA 3QE2A 2KQUA 3NHSA 3F90A 2QMYA 1FX1A 3KEGA 4M0CA 4Y9RA 4YAOA 4BMOB 3HA2A 6NULA 1D04A 3OX2A 5LBUA 4N82A 2A5LA 3NHPA 3W7AA 3GFSA 1AKQA 1RTTA 4U7HA 3TZBA 1YDGA 1CZRA 1RCFA 1CZUA 4GI5A 4HEQA 2N1MA 1FLAA 2M6SA 3F6RA 2HNAA 3NHLA 4LTNA 1V4BA 4BMPB 1AG9A 3LT5A 5LLDA 2OHHA 1XI2A 1YRHA 5A4KA 4QOGA 1AKVA 4YAWA 2BMVA 2BN4A 3U7RA 1DXQA 1WSWA 1YCFA 2QMZA 4YAFA 3UXHA 1KBQA 1CZOA 1CZNA 1DXOA 1E5DA 1FLVA 1KBOA 2R96A 2QX8A 4J8PA 3UXEA 5FX2A 4ZVMA 5LJLA 4CETA 3NHKA 5EAIA 2BZSA 2HPVA 4Y7CA 2X2PA 1WSBA 3D7NA 2MTBA 3B6KA 4PU0A 2OHJA 3JSXA 4U7GA 1QRDA 5LBTA 3W79A 3R6WA 4C0XA 2Z9CA 3G5MA 4GR9A 3SVLA 4C14A 3OX3A 1XYYA 5F12A 4DY4A 1AHNA 1T5BA 3FNIA 1RLJA 3LCMA 2R97A 3TE7A 3NFRA 2BPOA 5LJIA 2KLBA 4C0WA 1J9EA 1OFVA 3GAMA 1JA1A 2V9CA 3ESYA 4U7FA 2MT9A 2FX2A 1SQSA 2RG1A 3NHJA 2QWXA 3N39C 4QOJA 3NHFA 1D03A 2QX6A 2FZVA 1YOBA 3HLYA 3OJWA 4YALA 1AKRA 1B1CA 1C7FA 1YCHA 4FGKA 5B3KA 4ZVLA 5JROA 4FGJA 1F4PA 2FCRA 3F2VA 3L9XA 5FUQA 4HS4A 1FTGA 1SG0A 1YCGA 5NLLA 5NULA 4YAUA 5LVAA 2F1OA 5LMCA 4NLLA 1NNI1 2OHIA 4QOHA 4DIKA 1FVXA 3KAPA 1FLDA 3FX2A 4Y9UA 1CZLA 1FLNA 3EYWA 1OBVA 3NHYA 4CF6A 1GG5A 2FOXA 2MOKA 3L9WA 4LTDA 1CZHA 4XDHA 1XT6A 1C7EA 1J8QA 1QBGA 2QX9A 3FW1A 3P0RA 4H2DA 4PTYA 3NHUA 4LA4A 3KLBA 1D4AA 2FDXA 4QOEA 1OBOA 2D5IA 2V5UA 3EDOA 4H6PA 1H66A 2OYSA 2Q9UA 1T0IA 2FLVA 2HNBA 2Z9DA 3K1YA 3TEMA 5ULLA 2GSWA 4YQEA 1AMOA 2B3DA 2BF4A 5EA2A 2X2OA 3N3AC 2ARKA 3NHWA 4NULA 4ZVKA 5BUCA 3OWXA 1RLIA 3K20A 3O73A 2FAXA 1XYVA 4R81A 2XOEA 4QOFA 5B3LA 1BU5A 2Q62A 3FVWA 5EMNA 1TLLA 3GFRA 3OX1A 3QFCA 1TIKA 2FZ5A 2QR2A 3F6SA 1H69A 5FA6A 3U7IA 3B6MA 3ESXA 3NLLA 4QODA 3RPEA 2Z98A 4FX2A 3HR4A 3OJXA 2ZKIA 1JA0A 4OXXA 4F8YA 3S2YA 4FGLA 1QR2A 4PTZA 3B6JA 3W78A 1AKUA 2FVXA 4ESEA 1AZLA 3KAQA 3OVMA 4LTMA 1DX9A 1FUEA 4LAFA 1J9ZA 4QOIA 1BVYF 3W77A 2QX4A 3OWHA 1ZX1A 3O2NA 5F4BA 4C76A 2WC1A 4S24A 2V5VA 5TGZA 4XDGA 2XODA 1AKTA 2Z9BA 2AMJA 1AKWA 5F51A 3NHRA 2M6RA 4N65A 1ZWLA 4ZVNA 1J9GA 1ZWKA 2MWMA 3ESZA 3N3BC 3QFRA 1CZKA 4DILA 3FJOA 1X77A 4ICIA 4N9QA 4D02A 3ZHOA 1YKGA 1VMEA 3GFQA 1QHEA 3ES9A
chains in the Genus database with same CATH superfamily
4NBWA 3P0FA 5A05A 4E3WA 4IH9A 2H6EA 5BSKA 4YACA 5A03A 3DZKA 1OLSA 4QA9A 3KTOA 4UHBA 1R7RA 2P68A 1AKQA 1OIWA 2NVUA 1FFDA 3IP1A 3NC1C 3QY9A 4GP7A 2GTIA 4NJMB 4DR6B 3FE2A 1JHMA 4K7JA 1FMTA 2X5XA 5K0JA 1JQKA 2BGJA 2BHLA 3PUKA 5JSQA 2CLLB 2WUGA 1V2GA 2ODAA 3VU9B 4F3CA 1EUQA 1V16A 2F1HA 4JIMA 5LCXA 1LSSA 2MYTA 3QKSB 1BQ3A 1ODJA 1PTJC 1Y34E 5JECA 5LQJA 4L2IB 5FUXA 1H2YA 5C5IA 5JI3E 3ZLTA 4HNTA 1Y7IA 3E1KA 1FFAA 5CX1B 1Z5WA 5LQSA 4M0PA 1NVEA 3SBXA 3A1EA 1U8EA 2AR9A 3QPDA 1Z8FA 2R4TA 1AZWA 3PC3A 4HVTA 4NP6A 1KQFA 5B1IA 2R4UA 1K7FB 3FCCA 4UTOA 2JGDA 3ELWA 1MN6A 3NT5A 3QKRA 4LK3A 5IZ4A 4YREA 3G85A 4Q03A 2VWHA 4OAPA 3OLVA 4QBFA 5JO9A 3IQGX 1E2FA 2ZJ3A 4ACAA 1PZEA 1X1CA 4PLPA 2QYSA 5DULA 5C5DA 1QM5A 1K98A 2EP7A 2P6NA 3NDBB 3KCQA 1SA0B 4DLSA 1DAGA 1KAEA 1NRWA 1U4OA 3GAMA 1L7NA 4R84A 2WJGA 2AJBA 4GL4A 1CR1A 2NN3C 3OJ0A 1Z7EA 3OTQA 3BK7A 5A9RA 4I9FA 2DERA 3FTEA 1YXMA 1ZHOA 1FRNA 1RXWA 2DCMA 4ECEA 3P32A 2PUGA 3NKLA 4DSTA 1SCKA 1J8MF 1Z7YA 2IXGA 2PWPA 1E18A 2ZJ1A 1E2EA 3D4NA 5BSHA 5JNLA 5KTOA 4JI0B 1NBWB 1U8FO 2PKQO 2NWQA 2QM3A 2RJNA 2WF5A 2XYRA 4O1IA 4F72A 4F12A 3R40A 3FLEA 3MGKA 1TEXA 2WPDA 3M6AA 2N3ZA 1HDZA 1P62B 1W5AA 1WB6A 1KSFX 2DM6A 3HCAA 4S0XA 4ALJA 3D6MA 3N2KB 5IT5A 1UKEA 1AS0A 1T8YA 1AOXA 3QQ5A 4DXHA 1RQXA 2Q1YA 2J48A 4KCGA 1QWSA 1TKCA 4LS3A 3GJTA 4C5BA 3SE0A 4WKNA 1BJRE 3K8OE 2HC9A 4ARCA 4CKEA 1JVBA 2R8OA 2QD2A 3EGDB 4UU1A 4P6VF 1U9IC 4P7KA 3MOGA 1H69A 1R50A 2HBYA 4KWEA 3AB3A 3EZNA 4PGAA 1MAUA 3GP8A 3SBEA 2CKDA 2ZUCA 3AK4A 3T12A 5MGNA 1ODIA 3NYQA 1K97A 4JHLA 4LBVA 3B1VA 3F5QA 1VKHA 3OVMA 1L7XA 3H84A 2ZGVA 3PHGA 1MTZA 3Q9NA 1NU8A 5FBVB 3RK0A 3H99A 4ZRDA 2EKPA 3LOQA 4FYJA 1G5PA 2G77B 2JATA 4QTYA 3QIVA 4MRVA 4Q3LA 5F4BA 3TNLA 1LZLA 2J67A 4BAGA 3VKFA 4EW2A 2IHUA 2A58A 4TSRA 1N0UA 1CRWG 1Z26A 2FV8A 2GUWA 2JHGA 3E2MA 4S1NA 1RWNA 3GQBB 1UJMA 4YRDA 4PPFA 2NU7A 3GNSA 1BEEA 2DXIA 5BSTA 4X85A 3MMNA 2FZKA 3B6ZA 1H9BA 2VOEA 4I99A 1N3YA 2ORWA 2VDRB 4J75A 1P0FA 2E82A 1VCMA 2DTDA 3OM1A 1II9A 3IOMA 3OT5A 2FPUA 4US1R 5ESWA 5HFAA 3OESA 4WK0B 3I1FA 1YB2A 1TT7A 1MEEA 2QVGA 3P9SA 4H1TA 4XR9A 4ZAZA 2JJQA 2ATCA 5EP4A 1JPNA 1V8ZA 2IQ5A 1BCSA 4KQIA 3UAXA 3L7DA 1G4AE 1YJBA 2WZBA 2RGCA 5B1YA 4HNVA 3HJFA 1YL6A 3KYCB 2AZDA 3R7SA 1KORA 3U19A 4UHKA 4MUJA 2X8WA 1NG1A 4MS1B 1YI0A 2DE0X 5T41A 5BMVF 1CF2O 4Q1EA 4DMMA 1CUHA 3FNHA 4DUPA 2PUVA 1W44A 2XNKA 1SBIA 1H4TA 2AQIA 2VH2A 3H3XA 4DT1A 2VAMA 2F90A 5DK6A 3EZXA 3GLHE 3THRA 4BV3A 5ITZB 2X0RA 1YUBA 1ZSVA 1D2GA 5CNKA 2IIPA 1VKNA 3IB3A 3IILA 1MDFA 2XX3A 2YFQA 4IFIA 1LDMA 1SM4A 1MU0A 1VLMA 2IHVA 1J9EA 3RWOA 4RKFA 1V8BA 3C0KA 4YYZA 4BXOB 1BFKA 1VHQA 1VIDA 3AHCA 4Z8XA 1O9BA 1XMPA 4IZ6A 4WLNA 3ZEIA 2V7VA 1T25A 1CYDA 1DT3A 3G88A 4FCVA 4DM7A 5LZ7A 4FQ7A 2HV8A 1S2OA 3ICEA 4GPZA 1KJJA 5CLIA 4MEJA 1FLNA 5EJGA 5BT8A 3HU2A 1OAOC 4L50A 3PGA1 3PGLA 4QDXA 1E2UA 4A3SA 1IU9A 4EPTA 3ONEA 3EARA 1QS0B 2P2SA 4ZZIA 4U1RA 4ZDWA 3CVUA 3L84A 5DHSA 4Y2QA 4KQMA 5JD6A 2DKFA 1VBFA 3QX8A 4KW7A 2VR1A 1LVUA 2Z9DA 3KUKA 4JFAA 4MV1A 2QMQA 5HRUA 1KEWA 2IWRA 4TQAA 1Y48E 3K9QO 3FIJA 1DC5A 5B3LA 4PS1A 5BN5A 1ML4A 3EOZA 3IT3A 4UBLA 4BX2A 2J9FB 3RIGA 4ZOLA 5EOVA 1QVVA 1FEZA 4LXYA 1KK1A 4IW3B 1WEKA 5L7TA 2YTZA 4F6CA 1QGUB 3D0RA 2ZBFA 2BW0A 3HGTA 1U2TA 3MGBA 2ZTLA 4LGVA 4O3FA 4F96A 3L7CA 4NHEA 2ONJA 1RHQA 3O8BA 3G1UA 3H5IA 4B83A 1OI7A 4K5QA 3I2JA 2P3OA 4OB6A 2OBMA 3SKVA 3W2HA 3I28A 5EXSA 2KJQA 4UTNA 2P6RA 3RT9A 3PPIA 4PFJA 3UT5B 4M46A 2YV5A 5DMHA 4TTJA 1OOEA 3IBTA 1TF5A 2CL6X 3O8LA 5EHZA 3U4DA 4AMUA 3BJEA 1ZRNA 3FWZA 1DAEA 1QHEA 4BECA 4MV3A 4TXNA 5J5CA 4O2BB 3BB1A 4EPWA 5AW7A 4Q3AA 4XDZA 4R71A 4EJSB 1P18A 3FB1A 4P08A 4IIDA 1G3QA 1PNOA 1G3IA 1T1IA 2XSZA 2HJVA 2QG4A 4BXOA 1NVAA 2CL0X 4H16A 2RJ3A 2A1UB 5HKAA 4GBGA 1NN3A 4TKVA 2CWWA 1LNZA 4G36A 1IAVA 2I8AA 3U2QA 4M37A 1V7QA 4JBNA 4EARA 2ZB2A 5CPBA 4MVJH 3KQUA 2OCYC 4MKHA 2JB9A 1K2VN 4H7JA 1P1IA 4YRCA 4WXPA 2QY6A 1ZOPA 3EGEA 1L4FA 3MCZA 3RDPA 1X94A 1AO3A 4KSBA 5CLGA 4Q3NA 1IMJA 3SQMA 1A71A 1O4VA 1R8SA 2DG2A 3LXMA 3N9IA 2Z56A 2HSDA 1HDOA 1OC2A 4DG5A 1TA4A 4LSZA 5LP6B 2C9MA 5EJEA 2FX3A 3UJNA 4HXEB 1DTSA 5L53A 2ZITA 2B2CA 2BSXA 4IQFA 3RRFA 1EFKA 2B4KA 1VJCA 1ZO8A 3Q7EA 5F1YA 5JS7A 4AKEA 2VPZA 3PEFA 3CF0A 4K26A 5J2TA 1NBHA 3HBNA 1G42A 2J0UA 1KTVA 2JGEA 4ZJUA 3DF7A 1IUNA 2RONA 2FA9A 4OP3A 3AEYA 3T15A 2O19A 1QQ5A 4ZVRA 1HYEA 3PQFA 4ZVOA 4QHYA 1J2YA 2D6FA 1K7CA 4J2TA 3DLAA 4LZNA 4W63A 3ZZ0A 3EOAI 3R24A 1A27A 4YJGA 5D00A 3PIIA 5LVAA 1GZ4A 5DLEA 2G76A 2HGZA 3K70D 4QUGA 4M1ZA 3DKPA 4IGKA 3MJHA 1ZI9A 5HE8A 1P77A 1U1DA 5A5DA 2ZB4A 5KBYA 3EVCA 1UKVY 3Q6MA 5AI9A 3CZPA 2P6PA 2PMCA 2R6HA 4OQYA 4UZEA 5J4HA 3VKHA 5TMPA 1NQUA 3KVRA 4OM8A 4LSMA 4U6NA 3SYKA 5FWXA 5C80A 4J1NA 5CMLA 3SU8A 2HWUA 4MVJI 2Q1SA 4DE5A 2YJGA 1ZJWA 1JLMA 1HYQA 4QU8A 3TTVA 3VHXB 2H1CA 3HCDA 4HXGA 1XL1A 1A9RA 3TVDA 4QX6A 1KO8A 3U7JA 1F2UB 3H5OA 1HTWA 3LPAA 4X1YB 4XAQA 3RKRA 5FV4A 1LK0A 1V2HE 5JYBA 4NPAA 4LXXA 3KZ1E 3B3JA 5KYYA 1AKNA 4LZWA 5C2JB 2JPDA 3OH8A 4B7CA 1T4DA 1UZLA 2I7CA 4N5LA 2RBEA 2QRMA 3GRKA 1KOGA 4MS4A 1M83A 4KXNA 5ILOA 2ZZMA 3DV9A 2XNDD 3QI7A 4MI9A 4ZYZA 1Z6GA 1Z2EA 2V7BA 4Q6WA 8GPBA 1UDXA 3PCXA 3KAQA 4N40A 2WT8A 3EMDA 3FWKA 4PFQA 4V0MA 4WD3A 4M9QA 1FMCA 4JITA 2QIPA 4HKTA 4KAFA 1OXKB 2NZYA 3B1ZA 1L4LA 3BL5A 1E89A 3NW9A 5HUQA 5TPWB 1ZJYA 1PT5A 1XIVA 3BBLA 3FYSA 4X94A 3ENZA 5DHAA 1YAJA 2X1HA 3BIJA 3SC3A 5ELXA 5JASA 3IP9A 5JEEA 1UEIA 4C4RA 2QTBA 4R2WA 1F0KA 4ZQHA 4BNWA 2AG8A 5KQPA 4Y2RA 1N8NA 3HCEA 3BK2A 5B30A 5I6DA 2B69A 1ZBDA 3TJMA 4UBIA 3U60B 3TLBA 4GXTA 5FQOA 2BH9A 2OXTA 4QTUB 3ORQA 4CM1A 1Y1LA 4EKGA 1UUFA 5LBUA 5DI9A 2X86A 2CB9A 3VH1A 4PLFA 3X1YA 2JIOA 3V6LA 1WD5A 3QMMA 1W2WB 1BWSA 2ZUWA 4R1PA 1XF1A 2Z8YA 1KDZA 4PLZA 1NIJA 1J56A 1DBRA 3ETGA 1C9MA 3LD9A 1KEKA 1OFUA 2W6IA 3RYCA 1DV1A 1K88A 1JQ3A 1RZ3A 2RK3A 2VJQA 3BICA 3B3GA 4IO1A 4U2KA 5I01A 3EFBA 4Z2YA 4XXHA 4ZCSA 2HX1A 1TJYA 1XRPA 3MWGA 5DT9A 5IASA 2VSYA 5FFFA 2EFDB 3UT6A 2PFKA 2H2WA 3VU1A 4PC6A 1ORRA 2RAFA 2IX9A 5E6RB 5KYXA 2QLLA 1XFAA 5REQA 3PJGA 4OOFA 3H1GA 3JATA 1Z4KA 4PNPA 4UASA 2W6NA 1FW6A 3EIHA 2VUSA 4AKSA 3VPSA 1BA3A 5LXTB 4N48A 2HIAA 1KY5A 5D5PA 1GAQA 2PZGA 3R6TA 6YASA 4CIYA 3LCCA 3HBLA 3QUAA 1NBOA 4I7EA 4RLHA 1YB7A 1IM5A 3T3IA 4QEZA 1HYHA 3NUGA 1IEWA 1S3SA 1JSXA 1TMOA 3RAFC 2VL7A 2XNDA 4WLFA 1X19A 3S1LA 6REQB 1T4CA 1AD2A 2GNAA 1XP5A 3JY6A 5JSZA 1U2GA 3IPLA 2XUKA 2QM0A 4UTZA 4ZVLA 4BP8A 5IHPA 3DPIA 1L5FA 3NCTA 3UWOA 4TZTA 4IFEA 2C96A 2IITA 1UOPA 4CMCA 2XMBA 1W47A 1LTHR 1PL6A 1O0BA 3H0EA 3DKRA 3IEIA 3FNQA 3T61A 4R9UC 1YI8A 3RRZA 1ISRA 5K0BA 5KJCA 5L95A 1FMJA 2AXNA 4TLDA 4WOJA 2XE6A 3WLRA 3TTYA 1VKZA 5KWVA 1XTIA 5DISB 1PZFA 2RHBA 4HDAA 4RIHA 1X70A 2C07A 1R9NA 2XYHA 2OYSA 3FUUA 1T0IA 3HVKA 3FOZA 1GRVA 3OU7A 1QB8A 3H6HA 3LV8A 4IDQA 1FJGB 2H1OA 5IC4A 3U0VA 1X2BA 1K27A 2XOEA 3I5UA 4QOFA 4LV8B 4RJLA 4BX9A 1GNPA 4BLOA 2XGSA 1E4EA 3PQ2A 4E09A 2GHTA 4E33A 5FUVA 2QDKA 1TPZA 3IEVA 4HWSA 1BXRA 1NP6A 5H9WA 3KHTA 3QLVC 4DSAA 5EPEA 3B5IA 4DREA 2H59A 1Z73A 2XUIA 4HN4B 4HQFA 4IUDS 2ZRFA 1KMNA 4JL8A 4Z3KA 4GWGA 3DZHA 3WE7A 1J21A 3AUYA 4LMBA 3VC3A 5CHYA 4Z49A 2JFPA 1YDWA 2KHZA 4X8HA 2OV6A 1TAHA 2Y8EA 4QUDA 3FPJA 3G7SA 3SFZA 5DLYA 2RARA 4IMRA 4BJ1A 1WXHA 3DPSA 1NVGA 1O95C 3ST7A 4RTJA 1C9DB 1XVVA 5DEIA 1SHTX 4M9UA 2ZCUA 1MG5A 4YDRA 4DW8A 1D2AA 3ND5A 2BTQB 4Q3DA 3E03A 2FR8A 1U4SA 3H2GA 5C7OO 4EB0A 4AMVA 3U9SA 1XDWA 1A1VA 1IK6A 4I4NA 4L3VA 3NEAA 5ADUS 1ZNZA 1FS4A 4W5OA 3BH7A 1DAMA 1GZ6A 1NIPA 3BTOA 4PZYA 3O92A 2XJ9A 3VUFA 4OLAA 1MC1A 4YV0A 3T7AA 3VR4H 2R60A 1E6EA 3BHNA 3QA9A 4EJ0A 1WUYA 3OOSA 5BOSA 1ZINA 1E3SA 1S9DA 4Q7LA 1AUOA 2WKQA 3DOJA 3A6DA 4CLXA 2F48A 5LSAA 3V8RA 5AKXA 2Q5OA 1E0AA 2ZRGA 1YB6A 4FKZA 3UV3A 2AF3C 1V45E 1U7WA 2PV0A 2P9GA 3HFSA 2NU9A 1QIFA 2OZPA 1MX3A 1CE8B 1K7SN 2DQKA 4X61A 5HRAA 4UEQA 1OX6A 4UTRA 2PGXA 4YP6A 1WPGA 4ABTA 3G2KA 1WKCA 1N5LA 2FQWA 3LHFA 4Z51A 1NURA 5ICFA 4DKJA 2XB6A 4CQMA 3DWIA 3EEFA 3H5AA 3RC9A 1DRUA 4WADA 4K86A 1TIPA 2Y27A 5CIQA 3UG6A 5J23A 1QLWA 3GEDA 4Q93A 3B20A 2R8EA 3C4VA 5L6MB 3E7WA 4ZI7A 3CPJB 3I2IA 3SHVA 2BUBA 2P9FA 1HKHA 4G89A 4BC0A 5FWAA 2INGX 1I30A 4NEHB 4AJNA 4CCSA 5A1JA 2P8SA 5BV8A 1DFGA 4JYMA 3WICA 4CM9A 4IKPA 2F8LA 1A2BA 2G9QA 3PWKA 1Y6GA 3CN9A 1KNXA 3G2JA 1GPDG 4FYYA 2OAGA 4G2NA 5H3LA 5JROA 1YOVA 3QTTA 1DS6A 1YIDA 2YJTD 1XMJA 1HDGO 3FHCB 3REFA 3L18A 4IH4A 4P0PB 4BU1A 1ODTC 3LSTA 5KOJA 3OHSX 1ZESA 2AMYA 2PUWA 4IICA 2A7QA 2PZAA 1USKA 2BLNA 2IP2A 3VNRA 3V7YA 4GKKB 1PZGA 5FLEX 4W1QA 3ED5A 1GTRA 1NVMB 1OHHA 4H0FA 4OIFA 5H59A 3ABOB 4I6EA 1C3OA 2GS9A 2Z2XA 3EXIB 3TN7A 1PGQA 3C8ZA 1E9CA 1VJ5A 2ZWOA 2OAP1 3TLXA 1AMOA 4N54A 4KI0A 4CM7A 2BEJA 3LUAA 1B0UA 5KYWA 1GXSA 1LDEA 1RBZA 1WP4A 2F67A 2JBHA 2F8MA 1JDTA 5AOCA 1SC4A 3OT4A 1WOYA 2Z58A 4Z1MA 5FA8A 3TNFA 3VNBA 4JGGA 4YCMA 4IUCS 3ZE0B 3OBBA 2I33A 2C94A 1KO1A 4HAXA 1EWVA 3H5LA 3U81A 4BVBA 5CLLA 1VIYA 3CMMA 3LY5A 3ZJUA 1NYLA 4JXJA 5FI1B 3PFBA 5TS2A 4FDTA 4GT1A 5AW2A 4MUMA 3M9LA 4JLUA 4YUXA 2TMKA 2VFAA 2BCEA 2PRSA 4GC9A 1W9HA 4TUYB 5BV1A 4NJEB 1DNPA 4XEUA 6Q21A 3ZI7A 1GAXA 1Q20A 2ZJ6A 4WCVA 1Q11A 2CF6A 4XDGA 5K8CA 3BRSA 4OHZA 2WJ4A 4FHGA 3WK9A 1EFLA 2RDMA 4YRIA 3M6LA 3B3FA 5PNTA 4MW9A 1SOUA 2X4GA 4OGLA 1RE1A 1I7LA 2IYFA 4MYDA 1DG3A 1Z29A 5T67A 4RTOA 2JGMA 1YZTA 2GJSA 4P0QB 3VJRA 2I2XB 2E6KA 3LYUA 1NXXA 1TNDA 1FYVA 4DC0A 2ZJ5A 2GCNA 3C6ZA 2OC9A 3IX7A 1UBOS 1TW2A 1TMKA 1I2MA 4V0QA 1AX9A 3WLEA 2ZRIA 1W8IA 1OXBB 3T35A 3UHFA 1L7PA 3WFJA 4H6WA 2FH5B 3T9DA 1X7WB 3VSDA 2VTEA 3O1HB 4R8KA 4W82A 2VAWA 1KZGB 3CVJA 4O2AF 3TNDA 4GI1A 5TT1A 3QXXA 3H11A 3CX4A 3KL2A 5DVZA 3H5TA 4B75A 2OCPA 1JDSA 1ICEA 4AC9A 4BFLA 5I8WA 1CW2B 3C6MA 2IUUA 1QV7A 1RRVA 4BJHB 4PRKA 3E27A 4KEAA 4WFQA 8ADHA 1K68A 3SM9A 3JARA 1BDBA 1VLQA 1X86B 2RI1A 1TYDE 3AB7A 5DYTA 1RJGA 5T6MA 1LDYA 2O8VA 1VBKA 3QKSA 3WYEA 1JTEA 2B4AA 4HAVA 4I4LA 3L7BA 4LE1A 5LUBA 1G59A 1AXGA 3K2BA 3LHSA 1UZAA 4PSVA 1PJAA 2ETXA 2IKQA 4Z3DA 2H7CA 4F71A 4F3TA 4A6DA 3TE7A 4FWTA 1EB9A 2HM7A 2WTNA 3P8ZA 2PR7A 4C0WA 1L5QA 4EMTA 4HNRA 5JNWA 3SICE 2ZVQX 5CLJA 3JWIA 2FPXA 1Y1QA 3MEQA 1S96A 3MRVA 4D81A 3C6KA 3KDSE 1N0HA 2AOTA 2YV1A 3IR7A 4KXXA 1Y4DE 1SUEA 2RHCA 4JP5A 4AF6A 5K0CA 1SRQA 2KM1A 3B1JA 3CX3A 5A5FA 1JWLA 3OE4A 2UZ1B 3LPCA 2NSHA 1VPLA 3K0KA 4GW3A 2DHDA 4ZOCA 3K31A 4J03A 3Q7PA 1UJ6A 4F3NA 1LGYA 1ONNA 2CLDX 3KXPA 3I04M 1GWNA 1B1AA 4I5IA 1W34A 1NVTA 4Q4DA 1VL0A 2Q5IA 2G5CA 3LT0A 2IZOA 1P61B 2F7SA 3ZKAA 1TMYA 3VX4A 1HE3A 1ZNQO 3I42A 3WKCA 2WAXA 4JX9A 4NULA 4W6ZA 2PX8A 3WGQA 3PLAE 2JH8A 3SYTA 3ROTA 2XI4A 4HH0A 5CDFA 4WDQA 3TCXB 4DNFA 1KRWA 1COWA 3STWA 1QG6A 3EXHB 2YMLA 4GNRA 4NECA 3AWDA 1Z07A 3HEBA 5TMDA 1SD1A 2EBHX 2H00A 3MPUA 3ILSA 4DCGA 1JSCA 2FUG6 2HL6A 2UYOA 4GMXA 2Y9MB 4KH0A 3U56A 5FJIA 1ZQ1A 4EJSA 1ILWA 4HGNA 2I4TA 1G60A 4BBPA 2HDHA 1KMIY 1ZD5A 3OIUA 4KX3A 5BN3B 3C1OA 2DR2A 1NNSA 3RT1A 1E3TA 1HORA 4J49A 1U65A 4YCJA 4B4WA 1DRKA 1F06A 4XYEA 3PR2B 1QHHA 2GJAA 1COZA 1MLDA 5I9LA 4LRYA 4K9OA 3EG9A 3ICWA 2GK6A 3KSZO 2VDWB 4HNUA 2QD4A 3JALB 1DTEA 1E66A 1PLLA 2GFHA 3GGSA 2A5FA 1USWA 2Z2ZA 4L4RA 4NENA 1JDBC 1WIWA 4RIEA 3C41J 4ARUA 5BQ3A 5AVTA 1N57A 1U6KA 5F1OA 1RT9A 4KRFA 2GJ4A 2QY9A 4URWR 3KB6A 1KMHA 1BEZA 5KYTA 5K4AA 4BMOB 4EI9A 4ZN6A 3DE5X 1JIVA 5DEOA 3U16A 3A6GA 3IKVA 4EMSA 2OL4A 3C8DA 1DPGA 2IYWA 3MGAA 2V03A 4MEBA 2C2WA 3IDFA 2YV3A 1ONOA 3NBMA 4RLSA 4Q19A 1O2DA 3GYBA 3NEJA 3O6VA 3NOQA 4RZIA 2QE6A 1LA2A 3A7DA 3NHLA 1CUBA 1R6TA 1V5GA 2IPXA 4MZDA 4MWEA 5KDLA 3EY4A 3WDMA 3ZWCA 4E5VA 1SD2A 1N2XA 3ILYA 3ETEA 3IGFA 4L8FA 2MINA 4BL5A 5FL3A 4L9AA 1IOLA 2VPQA 4U9HS 4LNAA 1TZJA 4FHCA 2I6TA 3G5TA 3QU7A 2YXLA 4UNPA 5KSWB 3ADDA 4FXOA 3KLMX 3OPXA 3QVSA 4G2TA 3DZBA 4HDOB 1NE2A 1XZLA 2J0UB 4FYMA 4OLFA 4QOSA 1EA7A 1KVQA 4M60A 3VOAA 1O77A 3D7NA 5INTA 2XXJA 3CA8A 5BSUA 4WZBE 3MJCA 5SYNA 1Y7HA 3USZA 3DYIA 3UW3A 5KKNB 3KETA 3K53A 3WQQA 4CXMA 5I9NA 3OQIB 5IF3A 2EP5A 5JIBA 1JBEA 2VEDA 1V5IA 4OYYA 5CCBA 3JQ9A 3IDAA 4TL7A 1U7HA 3BE6A 2GHIA 3D4BA 4FMPA 1N7JA 4J9UE 1YOBA 4L4YA 3TSZA 3HCBA 3JW8A 1L5ZA 3N2ZB 2IGTA 5F2KA 2JIBA 3WG9A 3THWA 2G04A 2ROQA 2QVYX 1RR6A 2GJKA 1PS9A 4CR8A 1XZ8A 1DWUA 4WBSA 2WNSA 4O08A 4LV5B 3QSYA 3QH4A 1RZVA 3EK2A 3IJEB 3ORSA 2ZRCA 1E79D 3MD0A 1GARA 4R31A 4B4OA 1VLVA 2IWHA 5AQ1A 4S0ZA 3AZQA 4WACA 1XCOA 2M6KA 1LDBA 2Y1KA 2YICA 3DM9B 4PC1A 3TZQA 1C7RA 4DA0A 2J4FA 1EVJA 2V5UA 4IXNA 3QEMB 4K6KA 4AROA 1LC0A 3D3NA 4MWZA 3RWMB 4QG3A 4B7UA 4LXGA 3UJ6A 2NXJA 4DLPA 3AIMA 4OHYA 5FB3A 1HFEL 3D6FA 3PENA 4ZAVA 1W76A 2OB1A 4EA6A 5I7SA 4WHMA 3ZHTA 1EXVA 3O3NB 5JR3A 2Q2OA 3IUMA 1R18A 5H8WA 1W4AA 1WMDA 2JLBA 3KAJA 2YMPA 3D31A 4JFRA 3DE6X 2C9CA 1LH0A 2A2ZA 3FDXA 5AOAA 2XDWA 5C51B 4Q7EA 4AJHA 2VZ9A 3VKGA 1IL0A 5F7XA 3UAYA 4R2HA 3MOSA 2G9NA 1DHRA 2OP1A 1QFJA 3KYBA 4K6GA 4OQZA 3SK0A 2FP4A 1GD1O 2XWQA 4L6AA 3MS7A 1RWOA 2COKA 2ZYWX 3FVTA 3FZGA 3HJGA 4ZOQI 3OM0A 1JDZA 1YS6A 2OR3A 2YHIB 3LC0A 2IX3A 3KTFA 1SUBA 3VPFA 4G1FA 4B8ZA 1UKZA 5ENZA 2JGIA 4D5EA 1HMYA 3PSAA 2Q4EA 4QQ8A 4D02A 2OESA 1RI1A 1ZPDA 3EW7A 3N2YA 2GETA 1XTKA 4RPJA 2PSEA 4N5NA 1EPUA 1VE9A 3B52X 3ZH9B 1L7MA 5HSGA 5IAOA 1M73E 1X1RA 3AEKB 3G9ZA 4X64B 2CLOB 3B70A 4MAAA 2YWXA 4AU1A 5LYJF 1QG2A 4IP0A 4HEA1 2F9FA 1ULTA 2DCUA 3LOUA 4N6OA 3BH0A 4E11A 3IAS1 1UBRS 2C2OA 4EO7A 3GVXA 4L72A 3G9UA 4P7JA 1OFHA 4AM8A 2O1SA 4G0QA 1XHFA 1YRWA 3ON5A 4E2ZA 5DM0A 3ZYZA 3NONA 3GX1A 3EE6A 2WE7A 3DVLA 2AQHA 2WFMA 3RARA 2IHBA 2EFJA 2VHUA 3IOBA 1VLLA 3S1AB 1P39A 4R6XA 2HNKA 4E0BA 3UJCA 4ENQA 2ZRLA 3DFFA 1JH9A 1H4VB 2BJWA 5L4NA 1DDIA 4QLAA 4AUEA 5IW8A 3G8AA 1UPUA 2C29D 1ZNYA 1QBKC 5I3CA 3NAGA 3DAGA 2PL5A 3OD5A 4EHIA 4O5OA 2WWXA 3EWIA 5ITZA 1H2ZA 4NEGA 1H2EA 1S1MA 3DO8A 1H3EA 1VP9A 4B0OA 4C0XA 3LX5A 5CNMA 5I4KA 2GK3A 2BL4A 3Q12A 1XALA 1RRPA 2QBYA 1QGAA 1XA4A 2J9RA 3SY8A 3TTUA 5IJZA 1ZL0A 5JDIA 3O8RA 2QJRA 3SXJA 3TL3A 3DMFA 3N8HA 4QQRA 4DIFA 4AI6A 3FSJX 4OLHA 4UUNA 1FTNA 3TLMA 1U5BB 2C31A 2D5CA 3QY0A 4K6CA 5KNBD 3NHJA 1FMFA 3RSGA 4BMNA 5LU9A 1DPFA 5M7EA 3K6RA 4D4LA 5KVVA 3CVWA 3M6VA 4KYTA 3I0NA 1J4AA 4PCLA 1LBHA 1MJFA 2YH2A 2B61A 1NNI1 2XRYA 3QBJA 3VX3A 5A7GA 1F2DA 4CF4A 1EINA 1IH8A 3SJBA 1MC8A 2IK8A 1C4WA 4FGWA 4G0PA 5LLDA 2JI7A 2DBRA 1PFKA 2ZTSA 4JA0A 3CVYA 3OF5A 3JVDA 2O8EA 2RHMA 3IYLW 1F0YA 2VDVE 3IUEA 4NL4H 3JTEA 4U9IS 4CODB 4LPKA 3EDMA 1H22A 4N5HX 2BKEA 3D4PA 5CUQA 5DCWA 1SCBA 1UJBA 1W5BA 4QHTA 1C4XA 1WU7A 2FLVA 3GCXA 3B9QA 4HGRA 4KZPA 1OY1A 4CUZA 1JJAA 2Z43A 3H1TA 3CLHA 2D13A 3F6CA 2IBSA 3VU9A 2DPYA 3ZR4B 1CEYA 2ZXFA 5FBKA 2IYEA 2JW5A 4EKYA 1U7TA 3K2EA 1ADCA 2Q8NA 3O83A 5EJFA 4XTCS 4JIGA 2QT0A 4UDOA 3R3HA 3QPCA 2IEIA 4WEQA 4M8NE 4CW7A 1TT5A 4BLUA 4Y98A 3JXEA 1J0BA 1C1DB 2FNAA 1UC4B 3JQFA 4R4JA 3NQ41 3ZZ1A 2Y05A 4ENUA 2VTKA 4BFTA 4NNOA 4BB6A 3SQWA 2FY8A 1XF9A 1QO0D 2PKWA 2PX5A 3HJAA 4C20A 2KS6A 1Y8CA 3BC1A 1O97C 3QVMA 4BQQA 2Q6IA 3MXTA 2YRXA 2JCBA 3F67A 4C43A 2O1EA 2I1LA 2QUBA 1NC3A 3QENA 1UWVA 2IYPA 4U9UA 5JMPA 2Q5CA 2XRFA 4UUAA 1TI7A 5FORA 4ANFA 2B5OA 5DK4A 1UP6A 3DMYA 5DYYA 2CLIB 3O7WA 4RHUA 4U8HA 2P2LA 2RGWA 4YMSA 1ISGA 3LE8A 5DNEA 3L6BA 2ICAA 1XEFA 3ZD9A 3UGJA 3QE4A 2I6UA 1Q1NA 2HZBA 3R7WA 3WQBA 3S81A 1IVSA 4FNOA 4PG5A 2DWUA 3WAKA 4RJTA 3P9YA 2PV7A 5CVCA 4IVPA 4D9BA 2OORC 1QV6A 3MERA 4YUYA 4K0KB 4X1IB 3BD6A 1ELOA 2ZPUA 3TLGB 4FM9A 3NETA 1DKRA 2X8AA 3F7TA 4HNAB 3V7UA 3W5JA 5ICSA 1RWMA 2A9KA 1U0RA 1ADJA 1VG1A 1MRSA 1BOOA 4HBZA 1K7EB 4DLKA 2HFKA 4KLZA 2O54A 4NMWA 1W581 2MR5A 3O8NA 5CVEA 4AECA 2H1SA 3G5MA 3PTAA 1X1QA 2YHSA 2XA1A 4YCNA 3TXYA 4BEVA 3PCTA 5F64A 3WLMA 2GVNA 1UFKA 3CZ4A 2WWWA 1Y4AE 4Y30A 3WNQA 4U2FA 4BWYA 1M1UA 2PKCA 2ZIZA 1GSHA 1G8JA 3DL0A 5GM1A 2K7ZA 2XUQA 1LLCA 3STXA 3GELA 2AMVA 2D1SA 4N6NA 3STVA 1IN5A 5LB4A 5C8VA 1KHHA 1TTHA 2FR1A 1H94A 4C7VA 1K8RA 1OVMA 4MRMA 5AOVA 4TTTS 5TJ9A 5FUMA 4BDSA 3TRFA 2W6OA 4DIUA 4NJOA 2R1TB 2DHQA 2YVLA 3IJ5A 2NVUB 4Y9UA 3AO0B 2XYPA 1I3KA 1PGOA 1KMQA 4G0VA 4NIMA 4AULA 2EBFX 4KAAA 5BWMA 1A5SB 5HF8A 3FZNA 3RBXA 5AK0A 2ILVA 1N34B 5JQWA 3THXB 1G8PA 2A9RA 1M1YA 1RHRA 2H5JA 4WE3A 5EA2A 3I04A 1E6UA 4GGMX 5FHQA 1SUCA 3FDZA 4LOKA 1JDPA 4MVJM 4YH1A 2NXNA 3O73A 1XYVA 421PA 3OOEA 2OO7A 2WUVA 3HGMA 3AI2A 2ZWPA 2GF0A 1Y6QA 1ORTA 1HEUA 2XB9A 4BE9A 1U0FA 1KQPA 1TW3A 2Q5FA 4H18A 2PWAA 2HQ1A 2Z98A 4IHQA 3JYNA 1UPBA 2A86A 1UMBB 1BKYA 4LBYA 2C5EA 4C88A 1OT5A 1XZHA 4PLCA 5GZ6A 1V6CA 2OP0A 2WKSA 5J40A 5ADHA 3RK1A 3UF0A 4S1PA 3HNRA 3KK0A 5H80A 1ZU5A 1PBNA 1IIBA 4B9AA 1WWKA 3QWFA 4YAKA 1HG1A 1BW9B 3AM5A 4DVGA 5CJJA 1U28A 4IDAA 4ZKEA 5F21A 1DG9A 1NMQA 2H2HA 1U8TA 2WKRA 4KO1S 4OP2A 5EE1A 2NSYA 4EQ6A 4ZHSA 3UJ3X 2PXXA 3D3WB 3WLIA 4C7BA 5HHTA 2H2GA 1M2WA 2O8NA 2PJZA 1Q83A 5F2NA 2XYGA 3V1KA 1HNWB 1WTAA 4XRRA 4ARBA 5JQGF 3TD2A 1P2UA 3WGGA 5KTNA 4EJ2A 1DLIA 1XU7A 3LHDA 3IAAA 4G4IA 4QARA 1O6FA 1YBFA 1T5OA 4RWEA 1NLYA 3T7CA 3IT1A 3RV4A 4HRVA 1KFKB 2FEAA 2VXCA 5HVNA 2ZBEA 1IY8A 1L5WA 2B8TA 4KQCA 3IO3A 4MPPA 2WR8A 4ZC8A 4Z3OA 3O8CA 2YVUA 5TF0A 2C4UA 4B43A 2XVAA 3HCOA 3FM9A 1LPMA 4O29A 2VA9A 1QUEA 3H2IA 1T1EA 3ORFA 1K89A 2P2DA 4HN2A 3UGKA 3T3HA 1N2BA 1KH1A 3LVRE 5M5BA 2DHRA 2V0CA 3D3KA 3GBSA 1L4HA 4Q7MB 5L7YA 1PR4A 3NBUA 4ZJZA 4RGYA 1L7DA 2E7ZA 2I3GA 4EABA 2FFJA 2GESA 4QFDA 1RPNA 4IIJA 2OV8A 4JYPA 2FEWB 1G4HA 4Z6KA 4DFDA 1EBFA 1CJTC 2Y0BA 2CBXA 3GT7A 4G67A 3PQDA 3EXG1 4DCTA 1BE6A 1C0KA 2J0VA 4NFYA 4C2BA 3Q0IA 5DP1A 1X7ZB 2PWBA 3C3AA 3QUSA 2Q5LA 1NLMA 4LWPA 4JKIA 4M55A 4QJBA 3W5DA 3SDZA 1O9GA 1WUHS 3M5DA 3PD7A 4K40A 1KERA 2LW7A 2PCLA 4Z9BA 3VR5D 1IN1A 4MTCA 4H1HA 5I7OA 2J7PD 4PBSA 2P91A 3RU9A 2VHCA 3S8MA 3VH2A 3FVRA 5K01A 1T36B 3N5KA 5NULA 4LFCB 1D2EA 5DFAA 4RVHA 1UANA 1EDZA 3CZAA 3B85A 1RWBA 2LRHA 1XPUA 2XD9A 2OEPA 1A5ZA 4QUIA 1M2OA 2QHXA 5SICE 3CJQA 3CJRA 3DYBA 5K99A 2A9QA 2CL5A 3HMKA 3IA7A 4PC3A 2WYIA 1GZHB 3PWSA 2X9GA 3CGGA 3NC4A 3PXBA 2V4ZA 1OXXK 2CDCA 3MC1A 1L3CA 1UJNA 1DBWA 2BISA 2P9EA 2YOHA 3QQPA 3EUFA 3CV3A 1NE7A 4RH0A 4DRXB 1JLKA 5BMOA 1RACA 4LI0A 4I1UA 1X87A 2GMWA 2ID7A 3NTLA 3QX7A 3WLTA 3U7QB 4D0GA 3UHAA 4DJ5X 2IZ7A 2AN5A 4FOLA 4ZDIA 4DMCA 3UJAA 2AJDA 1ENZA 4HUJA 2CDBA 1CNMA 4M53A 4ZO7A 5BQOA 4BO2A 2ADFA 2C3PA 2O0KA 1C2YA 4NE2A 1PD1A 5F7JA 5A0FA 3WMFA 4C78A 1C0IA 4OATA 2FEXA 4KQKA 3AVXA 4ZRNA 4ZI7F 1ZGGA 3UAGA 5C4MA 4KUGA 1KK3A 2NPOA 3MJ4A 5G3ZA 3DVRX 3EJ6A 1FYEA 4NFSA 4UTXA 1YU9A 2JHPA 1E98A 2EKBA 1US8B 1V3UA 3ANYB 1GNQA 2ZYUX 3BKXA 4HYEA 4PTZA 3L1VA 5JAQA 4BASA 3VKWA 3M6XA 3EEYA 5CT6A 1CFJA 3DEFA 5LIRA 3BXXA 1SKMA 4HDMB 1XOIA 3O0DA 2GT1A 3PC6A 4H7FA 1NN5A 2Q3HA 2OZEA 3O2NA 3PFCA 3GZ4A 3MELA 1EK0A 2PLFA 4UBJA 5AVKA 3JZAA 3QP9A 1EKXA 1A9QA 4YDHB 2Z30A 2F64A 3UWPA 3R7NA 4QFCA 1JEOA 4KYVA 1SCIA 1Q15A 4V3BA 3LFTA 5EESA 3WYAA 4EGFA 4EWLA 3ETNA 4YBRA 3QK7A 5J43A 1JKMA 1P1CA 2Z2JA 1NPDA 1OIVA 2OCLA 2Q5HA 3E8XA 4H31A 4HC4A 2Q0SA 1XXLA 4XJVA 4JELA 3AW8A 1B0PA 1MJHA 2C2GA 4KR2A 4EK9A 5B7PA 4HPJB 2GXSA 1BFDA 4HYQA 4CQMD 3T0GA 4I55B 4E14A 3I64A 1CS0A 3O94A 5FPYA 1W36D 3ICQB 1CZUA 3IP8A 3V2HA 3KQOA 3C48A 3EGWA 2XQFA 1LQTA 3LC1O 1D0IA 3QLEA 4YC7A 3TQQA 1OB5A 1N32B 5ECWA 1NJ2A 5CVDA 5TXGA 3SYLA 4EY8A 2RB4A 5H5JA 1NR7A 3LLUA 4YAWA 3RUEA 1LJUA 4IIHA 4B82A 3RAEC 3VMMA 5BUQA 1JFTA 4HAZA 4Q4JA 2XZTA 2XMZA 2FOLA 2P9QA 4FR5A 4J8PA 3ADKA 4YP9A 5EE9A 4EBFA 5KNDA 2Q3EA 3IT0A 2FSVA 4AWXA 2UYYA 5K3DA 4KITB 4JBIA 1V26A 2J9YB 1JP7A 5EJ8A 4PRYA 1MW9X 4PCVA 4Y6PA 4TTRA 5A04A 4RHYA 3ZJ4A 2PO7A 5IDVA 2FPGA 4D45A 1QUFA 3J7TA 4JI7B 3OQ1A 1FYDA 1FS6A 1VFNA 4BB9A 4ZODA 3LO5A 1XV5A 2ECKA 2OK8A 2DX7A 4EYSA 5HJEA 3V8MA 2HU7A 3MD9A 5IMSA 1GSOA 4YAIA 4R5HA 3GLRA 3DT6A 4PCAA 2Y6UA 1NJ5A 1Z33A 3QLTA 1E2MA 3NU1A 4F8EA 5ES4B 2PUJA 4EGJA 1C7JA 2LKCA 3SR3A 4IDPA 4Y3UA 5HR5A 2BI7A 1YZHA 1M34A 2NACA 1DQSA 2P3QA 3IQWA 4JJAA 3UB3A 1ZUNB 3M49A 2QPOA 4ERNA 5FPSA 4QDKA 3OZGA 1I7QB 1B43A 2D2IA 3ONFA 5H81A 1U8ZA 4ENVA 2O8BA 1XKQA 3M70A 3ANLA 3CT6A 1LLQA 3D3EA 3RVPA 3SDSA 4ZQBA 2ZUSA 5B1DA 1KFEB 1VIVA 4UU7A 2ZSEA 2H51A 2YINC 4QSHA 5WRFA 4YVFA 3GLGE 3PC4A 1EFRD 1QFXA 4M0FA 3UY4A 4RTPA 2J0QA 1R74A 1U3TA 2AI1A 1ECBA 1P6QA 3EXIA 4OQDA 3H16A 1Z5GA 2ZJOA 1HGXA 4A9AA 1ITZA 1WXXA 3D7LA 4RZSA 4B3XA 4JR2A 5KIAA 1Q2XA 3EBLA 2Z04A 4PZAA 1AU9A 3P45A 4J91A 1PWYE 2VYND 3VJKA 3HM9A 4II2A 1V16B 1HT2E 1TCBA 1ZCJA 1XVUA 4IV0A 4OXXA 1BYUA 3RS7A 3ZU3A 1YE3A 1RD4A 1ZQ9A 4K9KA 2HQRA 4NU5A 1PYDA 2LZ0A 3BRQA 3HSSA 3THOA 5EMKA 1CNEA 1QFMA 3WL5A 5TQ0B 1XQYA 4ROSA 1E96A 2FFBA 2PMKA 3EQ7A 4E07A 2J0SA 1EVKA 3HB9A 1XZQA 2I66A 4M1EA 1R0YA 3DW3X 2LWIA 1N1DA 1J06A 3L6OO 1ZL2A 2QLTA 3C8UA 2NQ2C 1QGED 2WD8A 1M6YA 3CH5A 1PX2A 4O4HA 3UVEA 2ZETA 3FPKA 1SQ5A 4NMLA 1H2AS 4KGXA 2YJZA 3DG9A 4WY8A 3PQ8A 5FCDA 2QL7A 3EDQA 1E1CA 1OX5A 1XZGA 2KMLA 3SYMA 3WXMA 1V5FA 4UQPA 4DY6A 2I9KA 4D3ZA 3I9NA 2VZ0A 5AHRA 3ESQA 3PCRB 1P60A 2WTMA 1Z0DA 4L07A 4IX9A 2CSXA 1EIWA 4R0MA 5B2ZA 1JHXA 3PYLA 4JU9A 1PL8A 1E99A 2IEZA 3L0OA 5AI5A 2QK4A 3JQ7A 4MQFB 2JCVA 1AT1A 3KKLA 1J70A 1PJTA 2WUEA 4GBJA 4NCKA 3WLHA 1T9AA 1I2ZA 1HNNA 3WK5A 1OFGA 3USES 1JBQA 4EF4A 2FSUA 3OZFA 2DT5A 2LUOA 3NMUF 3DE3X 2AW3A 2UUOA 2NADA 3G23A 1D4ZA 3NHAA 3QJYA 4L0MA 4OQXA 1JFFB 2JEYA 4MDEA 3ZQUA 4CFZA 4CDNA 2H11A 5FR2A 5G1OA 4TMZA 5TVKA 2RH4A 5FADA 4HF7A 4JQZA 1L5OA 1TXGA 1QTRA 3AMVA 1EFPA 1Y6RA 1M0SA 5G1PA 1GFWA 3QE0A 4DA4A 5BR7A 5CFQA 5K8JB 4EB3A 2JBAB 3F5SA 3GWGA 5AXAA 2HHHB 1SXJE 1UP7A 1RLOA 1CQJB 1Y5IA 1HYBA 2ZW9A 3Q3HA 1MRNA 3ZHUA 1G5IA 4E1VA 1WBDA 1DELA 2DP4E 4JLMA 4QYIB 1QX3A 3WIVA 3OZXA 1DKLA 4MCHA 1NJ1A 3SIXA 1HX7A 1SRRA 1CQJA 2XBLA 1QLHA 3NRBA 1Q50A 2AD1A 1H1LA 4KLAA 4NPHA 3V4FA 1QIIA 3P71T 3V4VB 4A82A 3Q8KA 1CR2A 1QE3A 1SIUA 1XWWA 3C3PA 3ECSA 2JEOA 4IIJB 4O2RA 2AI2A 2CLEB 3ZD8A 4DDMA 4B4DA 2F1OA 1E64A 2PL9A 2AXQA 4TTSA 1S7CA 2EKQA 1R0CA 2FEKA 1C3EA 1C3LA 1OXMA 2RHJA 2EZUA 1K5GA 1OYWA 5EUCA 2AL7A 1SWVA 1LQ2A 3WMGA 2DF8A 2JGLA 4XIGS 4ZK2A 1JB9A 1CIJA 1NMYA 5C7LO 3TVTA 4EFKA 1U9YA 1P73A 3LUDA 4HLQB 3PSHA 3AQ4A 3H04A 3AF4A 3HMQA 1ZGHA 4NKRA 4Z1MD 3K0BA 4NR0A 4MI3A 3ZE8A 2OMKA 2F9LA 1NJ8A 3DMHA 4G8BA 4LC0A 5ALYA 3VPXA 2R86A 2I3AA 3HGQA 1XROA 4IDGA 4M7WA 3VYSB 4NDZA 1IN7A 1XKTA 1T9DA 2MR6A 1R5NA 1MC4A 3OUUA 3FVWA 5AJUA 1KWGA 4DMKA 1W0CA 2GZHA 4UD6A 1QC5A 3F6SA 1X8KA 3QFCA 3OMWA 4GKVA 4UAVA 3T5CA 4RV4A 3ICVA 3UJBA 4PXAA 3U61B 2ZYHA 1KDOA 3AIKA 1L0BA 3IVMA 4H08A 4KSCA 1BXGB 1RAEA 4JYZA 1KR5A 1UOOA 1CV2A 3O2QB 1MG0A 5KHOC 2NP6A 4WVLA 4WOKA 1T0HB 2AOVA 3UUGA 4H27A 1MC5A 1YZGA 2AZ4A 4QG7A 3QVJA 1CC1S 3SQOA 4QFMA 4Y9DA 4C0BA 4W9NC 1S3GA 1A7KA 1WZEA 2UUCB 1JU4A 1UWCA 3AUKA 3K94A 5KOHB 4GYKA 4DQXA 1IZ7A 2WWGA 1II8A 2LVBA 1R6BX 2NO9A 2QTTA 1LBQA 3GA0A 4OMCA 1U2SA 3N87A 3L4SO 1WY5A 3EXHA 4KQ2A 4B34A 4XH9B 3RR2A 2WWIA 4PIMA 3MW8A 3L6UA 2W2NA 1Z5VA 4H3VA 3KVNA 3V7NA 3ESZA 1UODA 1E9AA 2PX6A 3JAKB 4F5ZA 5C7IO 4LYAA 3T7EA 5H82A 4U0KA 5EWLB 4J29A 3A25A 2XB8A 3ES9A 4U6QA 3OOJA 3ROZA 5IT4A 1CPYA 4AJ4A 4NEQA 3U7HB 3PC7A 1WV1A 3KEGA 3R76A 1XNRB 3CUTA 3HDYA 5G0VA 2GLXA 2HY7A 3D81A 3WIUA 5U1PA 3PYMA 5I9MA 1Y37A 4B09A 2QSJA 4Z5XA 4NMHA 3ZCRA 1X9GA 2B6HA 3DAOA 5CT9A 5E7QA 2HBQA 3HKCA 2DEUA 1DQRA 1U2DA 2F1IA 2OBNA 3FBGA 2NOAA 3JD1A 4Y2PA 5BMVB 2DSNA 4IVNA 1RAAA 1UM8A 3I6IA 4FMDB 2CT8A 3AF0A 3I6BA 1TJPB 1DXOA 1Z3CA 2E48A 2C82A 1QHFA 4WFIA 1NASA 5FOSA 1CRLA 4PYJA 3JAMA 2FLWA 1KQOA 1Y1TA 5CK4A 1JMVA 2HYDA 5FD8A 5FL7D 5GZ1A 1K5HA 2UZ4A 4GLOA 3V00A 2ZYTX 2ZANA 2V4MA 3NNDA 1XLWA 3CISA 4WK4B 2IYAA 1L4KA 3WFZA 3DZJA 4F6RA 4GPTA 2XNJA 4YRPA 1KFCB 3UIEA 4D46A 1WX1A 4TS3A 1SPBS 4QGSA 1U6IA 1N1GA 1ZH2A 2G4VA 5BW6B 4S1VA 3FSGA 5AKHA 4RIGA 3K92A 2H52A 4CL2A 4DARA 3GLIA 1EVQA 1ST2A 2IEAA 3QXGA 4MROA 4R9RA 3ANMA 2IPOA 5JS2A 1C14A 4GKAA 4BHTA 2KB0A 4FFOA 4G6ZA 2ZQ5A 3L4EA 2HHCA 2Q1TA 3B36A 4G5YA 4JC4A 3AL0C 2BMEA 2NQ8A 3GAFA 4R9NA 4RQUA 3MUFA 4JLAA 1XDDA 2QRKA 4DWJA 5K9ZA 1GZ5A 1I3OA 2OUIA 2JD0A 5DBGA 2Y1EA 4X66B 1SH7A 1IJBA 2ZSBA 3GNQA 2HBZA 4IJ5A 1B4DA 2JIRA 4TMYA 1SIWA 2XA2A 3K72B 4BV8A 2AFIE 1C7EA 1Y3IA 1GNRA 2FQQA 3H0KA 3JYQA 3S7ZA 2NYUA 3V2GA 4X1YA 2DOKA 1YNOA 2O3RA 4A0GA 1C4OA 4GICA 4YJ3A 4AVYA 2A5DA 2G7ZA 5IYZF 5BSRA 3HPRA 3PGXA 4BKPA 2E87A 2FTKE 3SM3A 4E46A 2E6UX 3K0AA 4FZVA 4RETA 3IVGA 2CC2A 1WCIB 2FAXA 2NPFA 5HUHA 3GLQA 1CB0A 1FK8A 1Y9ZA 2VJMA 4ZAFA 2A0KA 3TXXA 3QMPA 1PDVA 5A6SB 1OIXA 3H7IA 4TSFA 1ZVVA 2P7IA 3N74A 3ESXA 5E6UA 3W6ZA 3WO1A 4A73A 3ZVKA 2WLTA 2XVYA 3HKDA 3U6BA 1CP3A 3RUPA 5JOQA 2PGNA 1J07A 5BSMA 1V0JA 3NGMA 1E0SA 5GM2A 4BQEA 2JBWA 3RIHA 3SJAA 3T0FA 2FVXA 1P3DA 5T57A 1G5TA 2EKDA 3ZE6A 4CF7A 3MJRA 4JT8A 2WYWA 1O9HA 2FKAA 1P74A 4AKHA 1QCCA 2BGGA 3SCZA 5L45A 3D8NA 1WW3A 4IAOA 1AHHA 4IYJA 3M83A 2OLJA 4MKXA 5L4LA 2P79A 3RUFA 1JIXA 4A2WA 1TM4E 2E4UA 4UQOA 1M54A 1ZA2A 2IYRA 3KLOA 3WYDA 1TTPB 1EVZA 4XX0A 3ZNPA 1SURA 2YC2C 4ZEMA 4MP6A 4IG9A 2VXBA 3O4HA 4J0QA 5ALXA 4X00A 1OV6A 4NOJA 1BJKA 2B9EA 3FTQA 1FFSA 4JVNA 4ZO9A 2NV6A 3EX7C 5JV5A 1L5MA 3QOWA 1Z2DA 2ODPA 4CM8B 2VCHA 4L73A 2G82A 3MMZA 4UMEA 2ODQA 1XYGA 4OK3A 3ZJ5A 3U3XA 3FD8A 1W0KD 1SGWA 4KXUA 1HQYE 5ELMA 4MQBA 3PZBA 5BSGA 5BXYA 1LCIA 1E1NA 3LT5A 4MPTA 5HK9A 4UCFA 3JVUA 4GP6A 3UG7A 5IDXA 2ZVDA 3HDHA 1JQLB 4EI2A 3GXOA 2JCGA 2RGEA 1AS2A 3KSAC 3HFGA 5LN1A 2YNMD 1ORHA 3TG2A 4OMDA 5AJHA 3CZ5A 1VE3A 2KSQA 3GUZA 4ZHQB 1UXJA 1JKJA 2W2KA 4DLRA 4JXXA 1M2OB 1AE1A 4B44A 2G1PA 1UBEA 1RI4A 2D0PB 1EZ4A 3DVQX 3JX9A 3P4XA 4G84A 4EFLA 3AVWA 3HY6A 4AZ0A 5DF1A 2HO5A 4MR7A 2R00A 3O21A 1X7WA 1M74A 2VYFA 2IHJA 2WHRA 2Q28A 3CSSA 3DOHA 4G1EB 2VUTA 3DTNA 3QVXA 4KAJA 4DY4A 1U5BA 2O5CA 1NLZA 5K5EA 4ASUD 4K3UA 1XCBA 3KJEA 1O5IA 1S1CA 2NO5A 3NWEA 4D3YA 1IDOA 5DWQA 1WM1A 2WABA 3SOZA 1NJSA 4GE0A 4LZOA 2ZCJA 1E2LA 1WHTA 1ISSA 3KYJB 5JUWA 2PVPA 1GJRA 2JDIA 4FT2A 2NSDA 1UJCA 2O1WA 1F6WA 2WA1A 3E4DA 3L92A 4CTJA 2UYHA 5KJ1A 1Y1RA 3M4JA 3N8DA 3PS9A 2W6CX 4LWOA 3T5TA 3BQ9A 3RS8A 5HRCA 3CS3A 4YWHA 3RGWS 4N8SA 3OCCA 1G7SA 2JH3A 1BNCA 2P6MA 4A8JB 2V7TA 2GKOA 4FN5A 4OAOA 1CB7A 4P22A 2PKQP 2OECA 4QYWA 3P9NA 3AQIA 3DB2A 1OI3A 5EMHA 4PAQA 1DFHA 1C30B 3FLBA 5LKRA 2IPNA 5AHXA 4QGAA 2XCQA 5HWSA 3M6MD 4M36A 2YWHA 5DBOA 3KR9A 1BEUB 2AYZA 2ZSDA 2OO3A 3BDVA 4DYVA 4GQAA 2Q3DA 2WJIA 4MWGA 2QUKA 4DAEA 4V1CI 5JTTA 1FJHA 3Q9SA 4R1LA 2UXCB 3KCNA 4LXQA 2PXCA 3RIXA 2V7PA 4FFDA 3VV2A 3RSZA 2AUMA 4BZXA 4ZIRB 2ECQA 4EUSA 3G8CA 1YRAA 4BNIA 2BBTA 2V7UA 1QQAA 3DDNA 4F9EA 3CUVA 5BNTA 4V1CB 3CSUA 2ZBGA 4KIWA 3WZ2A 3VVLA 1BHJA 3FCAA 1OSNA 1Q6YA 3Q3IA 5JZOA 3VO2A 3HJCA 3TYXA 2VJOA 821PA 1KFJB 2I6FA 5LFAA 2PS3A 1KPIA 2Y1LA 1Z56C 1NPYA 2YHIA 4EHDA 3LAWA 1K4YA 2PH3A 1JHUA 1FPQA 2JASA 4INJA 5KDOA 1THZA 1U2EA 1EU1A 3A36A 1Q1GA 3I09A 3GNLA 4BMVA 4D56A 1Y98A 5ADVA 2HU5A 4BQNA 5C37A 2BEVA 2V59A 4NFHA 1GPMA 1T3TA 2FZCA 4KX5A 4P8RA 4S24A 1KVTA 2NV0A 3V4PB 4OA8A 3E7DA 5I7EA 3OY7A 1FSGA 4AKIA 5BN4B 4CT4B 1LEHA 1SKBA 1V3VA 1Z12A 3BEOA 2GSDA 3COSA 4MQEB 3RUCA 3KEQA 3SMQA 3WLFA 2LNDA 5ESXA 2QLBA 4DLYA 5HZMA 4GOND 2ZIUB 3GJXC 4R2KA 3MIIA 5IULC 2PYZA 2C0QA 3BMNA 4MVJF 5IT0A 1P2VA 1UQRA 1XMQB 1I4TD 4PGMA 2OBXA 1QH8A 1GL6A 1ZOLA 5EEGA 1E3WA 1O0CA 4K03A 4JVSB 4L57A 3P96A 4ZT4A 4CR6A 1HF3A 2VTDA 2RGUA 3JR7A 2JLAA 2VXYA 3G2IA 2BJHA 2FRDC 4UBMA 4AZVA 2GAAA 4F2DA 5A5GA 3S2UA 2IUEA 3L6CA 4KE9A 5A4KA 3R5FA 1P2SA 1XZAA 1D6JA 3VH3A 5HKBA 1KZ9A 5FLXA 2ATVA 5B7GA 1K3TA 2ORVA 2WIJA 1DL5A 2RGYA 3BSFA 3DHWC 3KKMA 4G63A 1XCMA 1DO8A 3CW2A 3LH5A 3E53A 5CW1A 1Q0TA 1OT3A 3AWIA 4HDCA 2WT9A 1RLMA 4N7BA 4PU0A 1VSBA 3AL3A 4I50B 2P5TB 3ZGLA 2XMDA 2UVPA 4GR9A 1ZIOA 2GF2A 3BXEA 1X8XA 1LDGA 3SHOA 2H8GA 1Z0UA 2CMHA 3G2PA 3RHFA 2YYZA 3G0DA 2X1VA 4RA9B 3ZY3A 2VXOA 4CV1A 1Q17A 7YASA 2NSLA 3THYB 3IR6A 3GY0A 3LLSA 3QXCA 3U4MA 2J5QA 4MWSA 2BV3A 4CM8A 1WMAA 3KOOA 4WDRA 2WM9B 5AKGA 2EWWA 1V35A 3DZGA 2R5NA 2SCUB 4XWGA 4CQLA 4DB2A 1E1QA 5IZCC 4D9IA 2F55A 4R8MA 1R0SA 2ATEA 2FK7A 1ZIXA 1Y8RB 4RIFA 3RCBA 3U3KA 5LQUA 3GPDG 1E1YA 1KYQA 4UPEA 2GH1A 3RYCB 4AS1A 1GZ7A 2P27A 2QQ0A 2QRVB 1B3BA 2DLNA 3NV9A 4YT8A 1N77A 1X7HA 1VG9B 3VHQA 3VSEA 2IYSA 3WL7A 3IERA 2D06A 3RVDA 4MQ6A 3HG7A 1W88B 3OKAA 3URMA 4AN4A 4MGYR 5LQCA 3O5AA 1JL3A 3CTMA 3IH5A 4BYGA 2B78A 4KQEA 4LJKA 1PQYA 4QDUA 4X1IA 4UNRA 4EPYA 1T15A 5TC4A 3F96A 3QELB 1JIJA 3I3OA 4NICA 1HUQA 3ZCVA 3PE4A 1MB0A 2E4ZA 4G24A 1OX4A 5EIHA 4UEOA 1NZDA 5JS6A 3G5LA 1XBTA 2BFEA 4GBED 1MIOA 3D5QA 4RHCA 5JH7A 3UMGA 3WGKA 1OXVA 5EHIA 4NU8X 2V9PA 2BEKA 1VA4A 3Q4GA 3I9V6 3V1NA 3WV4A 3VZRA 4BLWA 3D5TA 1VYTA 3AF1A 4ZT2A 4J1TC 5B57C 4Z4IA 1GUAA 1BMFD 1LJ8A 1U11A 2C7GA 2OWEA 3DKVA 1YQQA 3LT1A 1V6SA 3INNA 3TUZC 2GKGA 5AUPB 3FBWA 4F5DA 1GTMA 1KRHA 1EWRA 4PRLA 4DRYA 3Q11A 4FCTA 4JBHA 2HF9A 1BH6A 4MIEA 2D1YA 5HM6A 3F6BX 2A35A 3NTUA 3P19A 3SLGA 3LY9A 1MFZA 4ARAA 4N18A 3B3QA 2GBPA 5BN3A 2FI1A 1EHCA 1QIDA 4P36A 2JFQA 3B7GA 3N8NA 3K8QA 3R0IA 3PUHA 4LK2A 4TMXA 2XNHA 1YJQA 1I4DD 5MN6A 3QJ5A 1RAGA 1D2NA 3ZXSA 2XR1A 5EWMA 2JLXA 4ZHQA 3QE2A 3D6NB 1WPRA 2Q2NA 4LF9B 2JLVA 3EQ9A 2HRRA 2ZYDA 2C57A 2CLKB 1VMKA 3N53A 3OF2A 3IO5A 4P35A 2AHOA 3A4YA 1XJCA 4EKIA 1JTVA 4JEHA 4LMRA 3SMVA 3IEMA 5LLSA 2QVBA 4NTZA 1S7GA 1LB1B 4HH1A 2A1TR 1XAHA 4OEHA 5DXFA 3WMRA 5JAPA 4NONA 1LVGA 1T2UA 2RIRA 4RSHA 2QRQA 1RHUA 2DFVA 3E9CA 4BVLA 5CITA 3MTQA 3O4RA 2FSGA 1IEXA 2O6HA 4LBZA 4YJGB 5TE9A 1KAHA 1L8QA 3R5SA 1EIZA 4FTWA 5KYUB 1R8JA 1IG0A 1NBMD 4QELA 1QDLB 1SXJD 3AHJA 4PINA 5DGCA 3K9FC 1F0PA 4FLEA 1T5SA 5BNWA 3NJRA 4MKZA 2HWXA 2WF9A 3TFOA 1RRKA 1KI4A 1OA1A 2HSEA 4XYLA 2AOTB 2WWFA 4BO5A 2EBUA 1QKJA 2XVMA 4H17A 3IBSA 3F71A 4ER5A 3CRRA 4GZLA 1GVHA 3QYJA 1M5RA 1XN1A 4IOLA 4IINA 1GKIA 4H3HB 1Q14A 4QM6A 4UM8B 4IGAA 1J0CA 1U3FA 3I0MA 3E35A 4ZCMA 3IEKA 3MSXA 2GBLA 1RBQA 1SXHA 2PIDA 4WLUA 2A1TS 1NW9B 2G1JA 3KKZA 4EA9A 4FCCA 4YJ2F 3QBTA 4PYKA 4G9GA 5C1DA 4S05A 2BGTA 1EZ1A 1GG2A 4QL3A 5IK2A 4HQLA 4IWNA 3FJYA 3NOOA 1V9SA 1ESEA 4OX9Y 5JHGB 2VP6A 2XTMA 1F3OA 2H4XA 3NVAA 2VCYA 5A06A 1YD7A 2HHLA 4X54A 4BFVA 1QNLA 4JROA 1JKIA 3OQPA 1WCIA 1YQEA 3TCKA 4US2R 2ZM5A 2FCAA 2A84A 4EELA 1ODFA 3ELYA 1M1YE 2CXSA 4NZOA 4B6RA 3P0RA 4JLWA 1V3TA 2Q6OA 4A2PA 4C03A 1DIHA 3M9WA 1MQSA 3RVJA 1K8ZB 5DLQC 3HWSA 1YS9A 3E5HA 3JZIA 4JP3A 5KTPA 1KWKA 1WMSA 4RELA 3P4UA 4G5FA 4JEIA 3WWPA 4PEVA 3QOFA 3E7XA 5TNXA 2O2SA 2II6A 1FDIA 1CJBA 4OHUA 4QVKA 4U4AA 5HG0A 3DFIA 2A94A 2G5GX 3HHEA 4FEGA 4O4JF 5J9FA 4OQNA 3I72A 1UINA 3DONA 3K96A 4P3OA 4FNMA 2OFXA 1KO7A 1LD3A 2P67A 3HU1A 4OYHA 3SZ3A 3T3PB 2EX0A 3WLNA 1PV1A 1DIRA 3GRCA 3NUZA 3OIYA 4OD0A 1U9ZA 2PH7A 3L4BA 3W5UA 5FPPA 1PJLA 3CLVA 2VH1A 3P97A 3U3MA 1LTKA 1UBUS 3A3OA 1RJDA 4CEIB 2LXNA 2EX4A 1T3LA 2IUFA 5HMLA 3I2HA 2ZBPA 2ZYAA 3D6VA 4LDNA 4OTZA 2GN9A 3NWBA 4EJ6A 3SD7A 4E2FA 2BFBA 3K5PA 3CTPA 5C8DA 4BKMA 5GGXA 4PANA 2ZUUA 3A8TA 3A9TA 3HWX1 1UBFA 1ZD3A 5TT0A 5AXDA 3EVTA 4WJLA 4CCWA 4IY1A 3RVQA 1RRGA 4KE8A 2WHEA 2I7VA 4WNCA 2A57A 2GN2A 3GA7A 3T1TA 1EX9A 3CB4A 4B87A 4X6UA 4E5SA 2I4LA 3DL2A 1B00A 5AFSA 3SP1A 4HVCA 1L1EA 2YJ3A 3QUTA 4KRGA 1H1LB 1VZ2A 3IMGA 4LISA 2VRNA 4UVDA 2W2QA 1WNFA 2IHTA 2QRVA 3UJPA 1EP9A 3COWA 4DV3B 4P4NA 1MPTA 4J7UA 4MIOA 5GJCA 3U37A 3ZY6A 2M32A 4RCVA 2YRFA 1LU9A 3X0DA 5KOYA 2VWPA 5I9SA 5BV7A 3ZWQA 3L7AA 4DEXA 4UUOA 5MFPA 3NX4A 4U5QA 1E8DA 3C3WA 1DUVG 1GSAA 2V65A 3KP1A 3O4FA 5HZKA 2BMAA 3I9FA 2JJ8A 2QUJA 2EGUA 3PQ3A 4G8DA 1AN9A 3VAYA 3OQVA 3ZTWA 4JB3A 2L69A 3LNCA 1XMSA 2MSKA 3HKEA 1E5DA 1C2TA 2NZJA 1HDXA 3FKSA 4QAJA 3RVMA 5BVGA 2XWBF 2VDQB 1IHXA 3C87A 3CEPB 1ND5A 3B78A 5TMBA 3E8MA 1JLLA 3WRWA 3C3CA 5D3ZA 5LBTA 2EBWA 2RIPA 4FSDA 3K16A 2BEUA 5DHPA 2QNIA 3L7OA 3R7FA 5LMUB 3IVRA 4MGIR 1B2LA 2W37A 1UOQA 4LWQA 4TQGA 3TH5A 3HBJA 5B12A 3HKEB 3U3RA 4B3SB 1QORA 1R2QA 2EW1A 1T36A 1OKKA 2JRCA 5G2OA 3TUJC 1V5WA 4RQTA 1YJ8A 2YIMA 2GD6A 3LZ6A 4HWPA 1YZNA 1BXGA 2VJAA 1JWAB 1PD0A 2H48A 3I9LA 4ND7A 5LYYA 1RBMA 2CNKA 3WGZA 2OAEA 1R5OA 5G1NA 1U0GA 4A8JC 3CUSA 4ND5A 1ZA1A 2I2CA 1PZNA 3BL6A 1EUDB 3CWZA 3QVWA 2IXEA 2BFFA 3TGPA 4LJRA 2C4WA 3HL4A 1LSOA 2EEPA 2R8YA 1M0WA 3HCFA 3ZCSA 3LHIA 2BGNA 3TRIA 3MCTA 4LRUA 3ETCA 2P4EA 1OHHD 1X2EA 5DNDA 1CRQA 1SHZA 5JDCA 4JSTA 2RK6A 3NYRA 1Y4UA 3MQ2A 2LCFA 2PKXA 1DC3A 2OMEA 2W7TA 3BIWA 3DEAA 4FYXA 4DR3B 2Z6AA 4JH0A 3EDRA 2ODEA 1VCOA 2A14A 1ZITA 3BXZA 3IUSA 2WTEA 1LX7A 3OX4A 2AVDA 1F6BA 3QA3E 1C1XB 2L82A 1IHOA 1VPTA 1D5WA 4OSPA 3AUFA 1JH8A 721PA 1HETA 3N0RA 4MZXA 4L4XA 5CYGA 1GQSA 3CR3C 1ZEMA 4TKUA 5EHNA 4E5DA 5CXUA 1B16A 5K7SA 4LRQA 1T2FA 3I45A 3KFLA 4CCYB 2JKZA 3RASA 1OFTA 1E3MA 4ESEA 5C5EA 3WTCA 4RZHA 1J1ZA 2G4LA 2GWHA 1K6EA 1T9BA 3HB0A 1RQRA 4IHAA 3SHQA 3W77A 2O8BB 2FSIA 3NFYA 1KEPA 3M6WA 1BKSB 1PJSA 5D3QA 1Z68A 2GNOA 2PAAA 2ZRPA 3TBHA 4JAVC 2JFUA 4HAWA 4II3A 2J59A 5A0VA 3IQDB 5BUZA 3UHJA 3HVHA 3GV0A 3E2IA 2BTEA 3H9JA 4XYMA 4CFSA 2XKBA 3I0ZA 4XUCA 4D9MA 3FF1A 2MSLA 3FRHA 2NXCA 1PQUA 5ANRB 4BLQA 1J2TA 3AGPA 1J8DA 3G9QA 4PSAA 4Q9NA 4BMCA 1JR4A 1KYZA 3VYVA 2HJ9A 1G38A 2BMWA 3IT2A 4OHKA 3ZJTA 4I3FA 3TX6A 1X3SA 2PT7A 4MQFA 1YI1A 1XRLA 1U7UA 4NRDA 3RBVA 1RCFA 4UFPA 1N25A 2HMYB 2HO4A 3TGLA 3DD1A 1VDZA 1MD9A 1W0KA 1BRTA 2ETVA 3JS5A 3V3KA 3AR7A 4OHFA 1MF7A 1J00A 1LFAA 2J32A 2LIVA 4KREA 2ZDQA 3D1VA 1YZ3A 2HQOA 3K1AA 2GR9A 4YAJA 5KNCH 3SIRA 3SNKA 1L8LA 1GZVA 2QL9A 2RH9B 3UTDA 1HE5A 3KJFA 4HVLA 1GQOA 2FPWA 3GN1A 2KBEA 4HZIA 4QSMA 4WCDA 3T9AA 2W4MA 1VA5A 4ZTBA 1QZTA 4HSEA 1HDCA 1ZVKA 1XUOA 2B20A 4FMDF 2XUGA 5B4VA 1KU6A 5HKLA 3NB0A 5A02A 5JSZB 2XUOA 1EUYA 3NOXA 2FSVC 3KJHA 1YA6A 3T7JA 3ZD7A 3CLRD 1XU9A 3A1CA 1GU0A 3NTXA 4CVNA 4EB6B 5KYUA 2P9YA 2RKWA 2X0IA 1WV0A 4A1FA 5CXQA 1X0XA 3FMGA 4LQ4A 4LNUA 4U7FA 4CKXA 4MRMB 3FUTA 4QOJA 3BYZA 2RHWA 3BE4A 3WADA 2A9FA 2VP3A 4I5EA 1JVNA 1YZUA 3DNMA 4KOEC 1HZZA 2CXNA 2FSSA 4DMUB 5K03A 1WHSA 4I5FA 5KSZA 4Y2JA 5KYXB 1PO7A 1X8LA 3PTLA 1EP2B 3O3MB 2B34A 4HEA6 3EXEA 3IP6A 4OI4A 2REOA 2NTVA 2RH5A 2ZSHA 1CF4A 1M7GA 2J5KA 4RBNA 3GHYA 5B37A 4FUQA 4L95C 2SECE 5M34A 1NW8A 2OORA 2FGKA 3WGUA 4D3SA 5AHOA 5KQMA 1UM9B 1DC8A 4MW4A 3ZUGA 1KAOA 2C9BA 2AWNA 1I94B 1RQLA 3ZZNA 1P91A 1U80A 1MP0A 1P0QA 2DFNA 2EJWA 2FLKA 3CH6A 3OY2A 4G25A 4G0XA 4LSGA 1E9DA 4GP9A 1KIAA 4WOCA 3SNHA 3R6LA 4LRSB 4ENPA 2C7QA 1KAQA 1MORA 3QF4A 4GRAA 4OJKA 5DE3A 4XVRA 4R81A 5JLAA 4DRZA 1UC8A 2W6MA 2WW8A 4NH0A 5EMNA 5G0WA 2ATIA 3EVDA 3QI2A 4G0ZA 5A4FS 6CHYA 3SE7A 3MRXA 2ZR0A 3VR4D 4ZZ2A 3F49S 1Z36A 3K1AB 2IDZA 3K9WA 2GVZC 4G0MA 1RRMA 3OQBA 2R6JA 4YRJA 3UV7A 1OV4A 1XLTC 2OSVA 2REXB 1WAMA 2DQ4A 5IBPA 2VRCA 3IAM6 1F5SA 4HRXA 3WHPA 4DQDA 4CKWA 2P4QA 2LBPA 3OPVA 3A06A 4HH4A 1MMFB 2V96A 2Z9BA 5DHFA 1OFUX 1N1MA 3CR8A 1GNVA 4J0HA 5F5LA 3ZE1B 4DADA 4DBZA 3QE9Y 4MB6A 4ZVNA 2GPWA 1IOWA 1J20A 4DSNA 1FFWA 1CD5A 3EMBA 1OAKA 3N2GB 3R75A 1U98A 2AKAB 3UTCA 3AR9A 3JQ8A 3LKDA 4AMGA 4IPTA 1L4MA 1H3NA 1HOTA 1RP1A 4BNTA 4TXHA 4IJKA 2FU5C 5KSYA 5JXWA 4MYUA 1ARZA 1EB8A 1R8QA 2WHYA 4IDEA 4I5DA 4QRDA 5D01A 5GONB 4ETNA 5C1OA 3VA7A 3GFSA 1OJLA 2O2EA 1XNJA 3RIEA 4EUKA 4U7HA 3IULA 2X0EA 2ZCVA 1SC3A 1CY2A 3K30A 4JI8B 2WM2A 1U2QA 1FLAA 1QHSA 4WBXC 2HNAA 2RHHA 1TA0A 3Q7IA 3U7GA 3A4VA 1G9XA 3QE3A 4CCYA 2YR0A 2VP9A 5G4KA 4EMUA 4FJ1A 4ZVUA 4DQKA 1WB4A 1P3JA 4FE3A 4ZO4A 5CA1F 5H16A 3N6VA 1HG0A 4JR0A 3WA7A 5IANA 3THYA 3OP4A 2Y1XA 4G4JA 1V96A 1QQTA 4FN4A 5ALHA 3CCFA 5HFJA 2R66A 3EBPA 4PZZA 3NTQA 4I9HA 1KC1A 3RVNA 5LBIA 1W2GA 3VTKA 5KC9A 1OB2A 2ZOSA 4LNUB 3GEHA 1FFHA 1OJ7A 1TVEA 1E6MA 2FW6A 2ZJ7A 3ENWA 3F7MA 4TTAA 3Q3JB 1P9LA 3TKAA 3H1BA 3WLJA 4QUKA 1XMOB 2J87A 2FK8A 4PHTA 1T34A 1RLJA 4NVRA 5AUQA 5DM70 3FBTA 2C59A 5L6LB 1OLSB 4UE3S 1Y8AA 2JA2A 4IYRA 4C05A 4YY3B 1Z5NA 3ITKA 3VMFA 1JZTA 1ZCZA 3LVFO 4PW0A 3HKCB 1G5HA 1X8JA 1KSHA 5TRTA 1P7VA 5AK5A 1O3YA 4IMJB 2PYDA 4MGHA 1DT5A 3ICPA 5KMGA 2HMWA 3U3JA 4ISCA 3V1MA 5F9FA 4DEYA 4O4IB 2CZGA 5KPDA 3IB6A 5JRDS 2DBVO 1NXOA 2MSDB 2QYTA 3MJEA 3AL2A 4COOA 4WBNB 3K0SA 2J5XA 3MLEA 4JI6B 5EWLA 5BR8B 2X8JB 3AEQB 2JGKA 2NNWB 4NG5A 2MIIA 1H2FA 4KQGA 1T91A 1CQIA 1LBTA 1ZK4A 3BIFA 4BO1A 4M87A 1WMEA 3PBKA 4U5XA 2G0TA 4FOSA 1B2RA 1PR5A 4WINA 3WK6A 1AS3A 3TZ6A 4IUYA 3CUKA 1NFQA 2R00C 1RMQA 1II8B 2HJHA 1ZNWA 3A6HA 4FMBB 5BVGB 5AK4A 1U0LA 5ALRA 5KOHA 3EZ7A 5HQJA 3CZ9A 4BNMA 3II6X 1TEHA 4RXTA 3D7MA 4RGBA 5E9AA 2QSUA 3SSNA 4JENA 4L0QA 4RFLA 2HA0A 2GM9A 2PFSA 5JEDA 3PHIA 3W3AH 1WTCA 4K9QA 3TW8B 4CV0A 4KFRA 2WFLA 1BVUA 1JHAA 1NW5A 1Z5PA 1CG6A 2PEYA 3MXOA 4EY6A 4IIUA 3EZLA 4QPJC 2Q7XA 4DR1B 4BMZA 5JPDA 3HK2A 1HDIA 2QJTA 1HURA 3X3HA 3AF3A 1WXIA 5EWJB 1H85A 1KEUA 4YGYA 4WLOA 2BJVA 4QOIA 4B3BA 4K8OA 3KSDO 1DKOA 3TFQA 3KQQA 3B8EA 3STHA 3GEMA 4CKZA 2EQ5A 1IUOA 1O6ZA 1SU8A 4FJ0A 3HPQA 2H0AA 3EUWA 2GZDA 3CLTD 4R8SA 2C9YA 3U3ZA 3ZS9A 4X71A 2PTGA 4RVCA 1XQ9A 1U0OC 1A97A 3LKBA 3MWDA 4E5NA 5B5SA 2YNMA 3FH0A 4NZYA 4CG1A 4PLYA 4KDCA 1PWEA 1YR8A 2XOKD 1P2FA 1J99A 1FXWF 2WB2A 5DASA 1TU3A 1PNRA 1M9NA 3HU5A 4LQLA 4BFWA 4BIIA 5LQMA 3KKEA 2NP7A 1UK7A 2G5TA 3HRHA 1FTWA 1ZIPA 5HTKA 3KV3O 5AUNB 2F4NA 3C6BA 4WL0A 1CEEA 3PFNA 1VHWA 2GCIA 4H77A 3RT7A 3UPUA 4K1LA 3JYHA 1YTLA 4I08A 3THSA 3K70B 3TZHA 5C35A 9LDBA 1IB0A 3Q72A 4DG9A 3LSYA 4JZYA 3UXHA 2HU8A 2IKSA 5KNCD 1IBCA 2F59A 2JFNA 2JFOA 4XFKA 2PUTA 5FX2A 3SJZA 5B53A 3ND6A 3KPVA 1NSYA 3ZIAD 3L3BA 2MTBA 2PZLA 4BCCA 4JYAB 1O5TA 5KX5A 3RLFA 2O5EA 1FYXA 2J5RA 3BZUA 1BS9A 1DJPA 3C5WP 1T4CB 5JO0A 2NTJA 1TZ2A 1XL0A 3FKJA 3S4YA 5GINE 4FGZA 2KX7A 1BD4A 4PQEA 2W4QA 2YZ7A 3CT4A 1O0SA 3L01A 5CDUA 1PW7A 5LKAA 4OIMA 1JXQA 1PNVA 5CH5A 1NJFA 2Z4RA 4NXNB 4TV9A 4J0GA 3OZEA 3BCSA 2AEMA 2P4UA 1HE2A 1N6LA 5DLPA 1RQ2A 1ECPA 4QUAA 3MTAA 4NLLA 5JH7F 1HKUA 3KU1A 4ZP1A 4MS1A 2ET6A 4PYNA 1I01A 1JXMA 3LUGA 4BBJA 5KZMB 5AH0A 5AMXA 5CIYA 1A7JA 4C0AC 4RTRA 4B3GA 3JR3A 4ZYXA 3N8KA 1D07A 1LRLA 5TEWA 3IV9A 4DBLC 4XDHA 4OUDB 3EF0A 3EMKA 4OQ4A 4DCUA 4DJAA 1QBGA 2PM8A 2ZYSA 4LNHA 1U63A 3KWLA 1BXKA 3BF8A 1Z0KA 4QEKA 3IAUA 1S8OA 1KJYA 3BWMA 3DV2A 3MTGA 1NOKA 4BU0A 1GEEA 4TLMB 2O8CA 4LCJA 4EKDA 1SUSA 2V6MA 1A9ZA 1Z8NA 3GGGA 2Q49A 1E7WA 5ALOA 5FBLB 3GAZA 2PUFA 3HVUA 1GT91 2MINB 3HADA 4RIIA 1CYEA 1XR3A 5EKUA 3SEAA 3TDNA 4HLUA 4P0TA 1Y4ZA 2OD2A 2DTEA 4Y6SA 2F8SA 3W5IA 1V1JA 4PZLA 4KQ6A 1BO6A 4QDTA 3OJXA 4I4TA 4OXRA 5DXJA 4MHTA 3L0CA 4C7MA 3PJFA 1KKLA 4DR2B 2BM9A 1DKNA 2WFZA 3I2GA 4KUHA 2XB4A 4EENA 1LNSA 1V7CA 4U63A 3Q7QA 3UMVA 2IIQA 1BVYF 3BQNB 2WSYB 4PZ0A 3PQ7A 3MK31 2JI8A 1YL5A 1Z16A 1SBYA 1VYUA 3H4IA 4RCZA 3RO7A 3C7CB 5C8ZA 2XWPA 4JUBA 4MO9A 3PEVA 4MIKA 2FG6C 3LP6A 5K3AA 2QXYA 3UJ9A 3PNSA 4CDRA 3ER8A 3AEXA 2UVQA 5CDHA 4ZAXA 3TL6A 4LFAB 4ENWA 4WPGA 4GQIA 4MVJA 3O2SB 1BHQ1 3D6AA 2I3DA 1EM8A 4KH1A 2HWWA 1EVLA 3RTDA 1U9JA 3B2QA 3Q0EA