3JQCA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-6-bromo-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidine-5-carbonitrile (ju2)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 94
structure length 249
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqcA00
1XYGA 1DBVO 4Z6KA 2FN7A 3NDJA 1WZIA 4ZRNA 3SJ7A 3WQQA 2WDZA 1GL3A 1AN9A 3VZRA 4BV9A 4IGEA 2DPGA 1F17A 2ZYDA 4S3MA 5AXCA 2H5LA 4B4WA 1FDVA 4ESOA 2PTGA 3BMNB 1X15A 4XYGA 1K0UA 2CVOA 2BFAA 2AHRA 2Q50A 2ZB7A 5LDGA 4WCFB 4KTVE 1PSDA 2EW8A 1NWCA 4MVJG 4XWYA 4CMIB 1P1JA 4Q3BA 2IXBA 2AMFA 4YACA 1DIBA 1ULSA 2E37A 1P1IA 3D4PA 3ANLA 1DAOA 4O0LA 1SOVA 2OGUA 3LLVA 1W4ZA 1PJCA 3DBHB 1MG0A 1XIVA 1AHIA 2A4KA 2IYOA 5JDCC 3ON5A 4C7KA 4D0RA 2P4QA 4JNKA 4XDZA 3SLKA 3JQAA 3WGTA 3BTSA 4DLBA 1OC4A 1NQOA 4CLDA 5AXBA 3DOOA 4NK5A 4H7PA 4YAIA 1Z6ZA 2HDHA 3E48A 3KRTA 2C29D 2YQ5A 1DC3A 2JHGA 4JP3A 2E49A 1E3LA 2QX7A 1Q7CA 3CUKA 3V2UA 2BHLA 2HLPA 3AUUA 4IQ0A 4J9UE 4RJTA 5COAA 2HMWA 4YWJA 5H83A 3B6ZA 1RM3A 4HX5A 2DBZA 4PLHA 3AWDA 1C3VA 4DPMA 2HRBA 3KLPX 1QV6A 4KQWA 5F5NA 1F8GA 2P5UA 3GC6A 3D7LA 4RO0A 4Y67A 2I65A 4Q3NA 3TZQA 1C1XA 3RAJA 3M2PA 3E9NA 4O5OA 4MJLA 1WZEA 2Q45A 3HWRA 3BIOA 1EBFA 4P8RA 4YJGA 5COBA 3H9QA 3JD0A 1SAYA 3PDUA 3DZIA 3JYQA 4Q9NA 3E82A 1PIWA 3I23A 5DP1A 1ZH8A 3GMDA 1JVBA 2P91A 1KIFA 2W8ZA 3ZZNA 2NVUA 4BNKA 3VH2A 4J91A 5G4KA 5DBFA 5L51A 3HJAA 2YW9A 1PJBA 3RUHA 1DRVA 4FIZA 5H81A 4E2WA 1WNTA 1PGNA 4RPGA 4NFHA 4BGUA 1E7MA 2I99A 1IOLA 3EC7A 3WLFA 1J49A 1P45A 1MXHA 1GADO 2ET6A 3L4SO 5CHEA 5C7OO 3P5SA 3QWHA 5A9SA 2GERA 2NTJA 1X1EA 4N54A 3INGA 1C0KA 1BSVA 3I4FA 4WK6A 2O2SA 4FFRA 4QQRA 2ZYGA 3U0BA 3SJUA 4ZD6A 4PLGA 5KVSA 4TRMA 2V65A 1ZCJA 1U2GA 2YHIB 4FJ2A 2PK3A 5L4NA 1DFHA 4N5MA 2F1KA 2O3SA 1M75A 4MKXA 3U09A 2HSDA 3QVSA 2P9CA 1KVTA 3NT5A 4MINA 3L77A 4K6FA 2VZ9A 1P33A 2O3TA 1VC2A 3KSDO 1G6KA 2G0TA 3D1LA 4XDYA 5ER9A 3TNLA 5A06A 5GZ1A 1VL6A 3GVXA 1FK8A 4XYBA 3TWOA 2AE1A 1KEWA 3TZCA 1A71A 2J5QA 3F4LA 3G0OA 4RQTA 3GVCA 2B69A 4I5FA 3GGPA 1Q0QA 1LXCA 1Y8QB 4R16A 2EJWA 3ANMA 3TZKA 3PFWO 4L73A 2NU7A 2IXAA 3VTFA 3ZNOA 4OOEA 3COSA 4XYMA 3RBXA 4OOFA 2QRJA 2VHYA 1RYEA 3R6DA 1FMCA 2Y1OA 3RUEA 5L3ZA 1E3WB 4DPLA 5DCWA 1EQ2A 4CV2A 2NNLD 3OP4A 5EPOA 3DAFA 1ORRA 5G4KB 3ZV3A 4EUEA 2BFPA 4BGEA 1M6HA 1UH5A 4YBZA 1E5LA 1HL3A 1QG6A 4HNGA 3TL3A 1GV1A 3B1KA 4U5QA 4FJ0A 3MJSA 1M6WA 2JAPA 3VOSA 4CJXA 1LBEA 3BHMA 3GVPA 5L4LA 3S2IA 3ROQA 4I8XA 3WSWA 4CM6A 3OJFA 3PP8A 2ZTMA 4YT4A 4ND4A 1HF3A 3MJEA 5JAZA 3JQ8A 3W6ZA 3PYLA 4B79A 5IAAA 2Q46A 2VUSA 3JYLA 4JGBA 3A28A 4BQRA 4E2ZA 3GVIA 2W98A 4FN4A 1PWXA 1UXHA 5K9ZA 1CDOA 1D8AA 2P9EA 3PIIA 3F6YA 3WNQA 4L4XA 1SC6A 1KETA 4E2XA 2VT3A 5G0TA 5JY1A 3HADA 5C7LO 4B7UA 4A73A 8ADHA 3QJ5A 1VJ0A 4Q3CA 2E82A 5ER6A 5ENVA 3ROKA 2B5VA 3ICPA 3BMOA 1PWZA 4W9NC 3GGOA 1YGYA 2B36A 1CF2O 2EHDA 2GO1A 4M89A 2HO5A 2Y0EA 1T2DA 3VPXA 4D44A 4UVGA 1XHLA 4TROA 5JW6A 4NNJA 1LDBA 3C7DB 2Q2QA 3CXRA 3U4IA 1KEPA 4ZA2A 3GUCA 1BTOA 5LCXA 3HHPA 4BO4A 2AXQA 3B1JA 1R4NA 3GPDG 2OP0A 2QW8A 2NQ8A 5BSHA 2JKVA 4TKMA 5BSGA 3RU9A 3A4VA 3DBLB 4MVJD 1P1KA 3QLJA 1E1KA 2BGMA 4MKZA 3UKOA 5AVOA 4RLHA 4IS3A 3FR8A 3K2BA 2YFHA 2H6EA 1UZLA 3DWFA 1I24A 2JFFA 2VWPA 1IHYA 3OECA 3UF0A 2Y67A 1T1SA 3N7UA 3JQBA 3OSUA 3WQRA 4TMFA 2D1YA 2CVZA 4A2CA 1MUUA 4WEQA 3VHRA 2HK9A 1LI4A 1SEVA 5B37A 3ULKA 1CIVA 3O8QB 3VVBA 4WJZA 5TNXA 4B3IA 4BS9A 4OXNA 3GDOA 4UAGA 1E3JA 3ZN2A 4ALKA 3GGGA 1T2EA 4U0KA 1JLLA 1SEPA 2CVQA 1YE3A 3F47A 2UYYA 4Y6RA 2C2YA 4R1UA 2BFMA 2PGLA 3D3WB 1R4MA 1Q0HA 1UDAA 1JQBA 2FPPA 4FR5A 4EJ6A 1YH3A 2R2GA 4YDRA 3K92A 4JX8A 1YJ8A 3G3EA 2RH4A 4GMFA 5L7YA 2R00C 4D42A 2UUOA 2X9GA 3JD1A 5JE8A 5THKA 2DBQA 3HZZA 3WIEA 3DHNA 4RPKA 4EEZA 3WFJA 4Q39A 3UXYA 4FFPA 3K2EA 4BNNA 4XX0A 3N74A 1YDWA 3D5TA 2B4QA 3DBVO 1LUAA 1Q1NA 3GMSA 1YO6A 2FZEA 4XR4A 3VZQA 1X7DA 2BLLA 3IUPA 3L9XA 4PLVA 4J43A 1Y7TA 2EKLA 4KZPA 4BNVA 4EGFA 2DTEA 4ND5A 3C3XA 4ND2A 4CMEC 2FP4A 1Y9EA 4FGWA 2I3GA 3ZWYA 3QIVA 4CMJA 4UEJA 5G0WA 3DAGA 3KHUA 3UICA 4BNLA 3MTGA 3I52A 1UZNA 5JPIA 2QZZA 5KWEA 1NFFA 1PJ3A 2VHXA 1E92A 5TF4A 4BO2A 4D43A 3NRCA 5DULA 1JWBB 2WD8A 3QWBA 4YYZA 1H6CA 3QWIA 3X2FA 1J6UA 3MJCA 3CINA 5BSEA 1I8TA 4R69A 3F5SA 5IZCC 1NPYA 5L7WA 3FNHA 4Z9FA 3RCBA 3OEYA 4XGKA 4D41A 2PZJA 5DZSA 2C82A 5C3MA 2C5AA 4NBRA 4F6LA 4ITUA 3LZ6A 3NX4A 4GVLA 4LRTB 1I5RA 5B4UA 4J1NA 2O3UA 1NVGA 2P68A 2VTEA 4AJHA 2HMVA 3U5TA 1A7KA 4R1TA 5I7EA 1LLCA 2NACA 4DVJA 1YWGO 3TFOA 5DF1A 3UCEA 4MVJM 1T2AA 1R0SA 4BO9A 2PD3A 4FFNA 1ZJYA 5AXDA 4GPD1 1WLYA 1LLQA 1I2ZA 1EDZA 3PHLA 1HT0A 3NGXA 4AICA 1SCUA 5KNLA 2G17A 1LSJA 2J6IA 3PVZA 3V2HA 2EP7A 1HRDA 3JTMA 3GH3A 3K9QO 4NU5A 3IL2A 4L8VA 4E4YA 5TC4A 1PTJA 4E0BA 1ISFA 3I9LA 4PVCA 4J9VA 4EITA 1EDOA 6LDHA 5B4VA 5CPBA 4PZCA 5FF9A 2AA3A 4CMHA 4A26A 3KETA 1EVIA 1UXIA 1UZMA 2NADA 2DM6A 1NYTA 3WXBA 5KJFA 3U3XA 4TQGA 4GKBA 4MIOA 2HCTA 1X0VA 3Q9NA 4EBFA 2AEJA 2FMUA 1NASA 4GAEA 1GAEO 4BO5A 3QVXA 1NHGA 2P5YA 3BYZA 2PKQO 4YT8A 5K6AC 2OFPA 1W6UA 2GRAA 3V5NA 2V6GA 3GRPA 1UR5A 4LGVA 2UDPA 4AVYA 2ZCVA 1CETA 3QSGA 3VDQA 3ABIA 1ZMOA 3A9WA 5CEEA 2AG5A 2HQ1A 2UVDA 1I10A 2XPCA 4E5NA 1BWSA 3OETA 5TT0A 4J16A 1PL8A 1OMOA 4BNJA 5IZ4A 4XQGA 4I08A 5G2OA 3GVHA 3HE3A 4OYRA 3JQCA 1PGJA 3B1FA 3PFFA 5IN5A 2PGJA 1B8PA 3OMLA 1W0CA 3FTPA 4OSPA 1E0DA 1B16A 4AG3A 2GZ3A 3ASUA 4A10A 1DPGA 5DOVA 2JL1A 2W2LD 2X7HA 4RPHA 4DC1A 2NLOA 2ZIZA 1PZEA 2PY6A 2JD0A 3JQ6A 2B37A 4RZIA 4B7CA 3WMWA 3KYCB 5FWNA 4DMMA 3JQEA 2QRKA 1JDJA 4H3VA 1Y8RB 4XIJA 2QIOA 1YQXA 2C0CA 3WGGA 2HRZA 1C0IA 3I9NA 1G0NA 3WJ7A 4K6CA 2OL4A 1C0LA 3HSKA 5BNFA 5L40A 3GPIA 4YJHB 1A4IA 2PZLA 1I3MA 1KOLA 3STHA 4CLRB 4J7CA 4WOJA 1ZMTA 3MJVA 4L75A 1GUZA 1NTOA 4GSLA 1PZHA 1EVZA 2DUWA 4NG5A 3RU7A 3GF4A 1NFQA 5CDSA 4H15A 4IMPA 3R3SA 1A27A 3IUSA 3K31A 1KERA 2X0JA 4LMPA 4J2HA 1M76A 3AM3A 3PYXA 4P4LA 3QHAA 1D3AA 2O50A 1AXEA 5JCJA 1JN0A 1UXKA 3M6IA 4M86A 3C24A 5TS3A 4EUFA 4R01A 1UP7A 3QY9A 4GLLA 5KTKA 9LDBA 4OKIA 1WDKA 2RHCA 3Q2KA 1PGQA 3UH1A 3AOEC 3F5QA 2X9NA 1ZZEA 3CIFA 1PGPA 3ZWAA 3T7CA 5DP2A 2GDZA 3S2GA 3DTYA 2AEFA 2ZTVA 4PLWA 5L4SA 4TZTA 1LU9A 1NQ5A 3WX0A 5I9MA 3WDSA 1DFGA 3CMMA 3FBGA 2A9FA 5ITWA 3GZNA 1DHTA 4CQLB 1ZUD1 3RKUA 1LC0A 4QT0A 1HDZA 3RJ5A 1UP4A 4D45A 4Z9XA 2QYSA 5DCUA 3H7AA 1UAYA 4CM8B 2EF1A 2IZZA 3VVCA 4EYEA 5FI3A 2OXIA 4A03A 2JAHA 2O4UX 3CSDA 2AEMA 4BL5A 1ENOA 3JYOA 5FEUA 1ONPA 4OIMA 3ZWXA 3VKVA 1EQUA 3D0OA 1PZFA 1PJ2A 3BMNA 1KS9A 2BD0A 4FFMA 2EXXA 4JJFA 4RPLA 4CM9A 1D7OA 4KOAA 4DA9A 4XIYA 4IQ8A 2NTVA 4HFJA 3KEQA 3OIFA 1CWUA 3AJRA 4WCFA 1FJHA 1DOHA 1XELA 3JQFC 3O9ZA 4ALIA 1SPXA 3AUTA 1ONNA 3JQ7A 4DLAA 4CMIA 3JCZA 3UFXA 3AFMA 4CM1A 4E13A 2B5WA 3PZRA 3I3OA 4M8SA 3TDKA 1KVQA 3RASA 4Q3EA 2PV7A 3I9KA 3WJAA 2Y1FA 1C1DB 1HSOA 5JCJD 5JNLA 3X2EA 3VH1A 3DBHA 3DHYA 2CUKA 4W4TA 1ZNQO 1EE2A 3QA9A 3ZWOA 1GTMA 2Q99A 4HKTA 4NZ9A 4BNIA 1ZK3A 1S7CA 2ZYAA 3OICA 3HNPA 4I9HA 2H1SA 3IOYA 5HM8A 5FI5A 2H9IA 3ZWWA 2WM3A 3KSUA 1H9AA 2J5KA 4EUHA 4II2A 3BZUA 4J3FA 3ICCA 2TMGA 4MDHA 3WG9A 3RI3A 4D79A 3TZ6A 1M66A 1ZEMA 2QYTA 2VOJA 3PJGA 1U9JA 3QWAA 4JIGA 5HRUA 4L74A 3QQPA 1UDBA 4ZU3A 3QWFA 1WDLA 3V2GA 1GQYA 2OZPA 3PK0A 1DJNA 4WASA 2XF8A 3ZNNA 2WD7A 1DC4A 2G82A 2BI8A 2NVBA 3OQ1A 1PQUA 4ZGWA 2GSDA 2NM0A 4XJSA 4CR7A 4A5OA 2GPTA 2B83A 4B3JA 4QTZA 4W99A 1Y5MA 4CMCA 1TEHA 2GR9A 2VT2A 4QECA 1V6AA 3R0IA 1H93A 5EINA 3TZHA 1X13A 4NR0A 3H8VA 1LSUA 2ZK7A 3LT1A 2WWRA 3PPIA 4J4BA 4YQYA 4XGIA 2FR1A 5G0UA 4A7PA 3FWNA 1A72A 1OFGA 2Y05A 4XRRA 4IJKA 1R12A 4MVJE 5T8KC 3M1AA 4K28A 7MDHA 5G0VA 3PGJA 3JQ7B 3WQSB 5B4TA 5A3VA 1YDEA 3GAZA 1ZK4A 1P1HA 1I33A 4DLLA 1UUFA 3S1LA 3KOUA 4MVJF 3RC1A 1EEHA 4OHUA 4UEKA 1IYZA 1N7GA 4WLOA 4BKPA 3Q2IA 4BO3A 4S1VA 2WYVA 4LCEA 1HE4A 1HZZA 3GHYA 1VI2A 4IY1A 3RFVA 4RGBA 1N92A 2D8AA 5TJ9A 3ADPA 5CEFA 1DC6A 4D3SA 4O59O 2A92A 3K6JA 4PZEA 3KSZO 5GMOA 3KVOA 1GEEA 2C07A 1HDRA 1X7HA 3HN7A 5L9AA 4EZBA 4ZQBA 2FHSA 1QRRA 2PR2A 4P22A 2JCXA 4DRYA 4RDHA 4YQZA 2ZJ1A 2QHXA 3ZDFA 3DTTA 2O4CA 1I3LA 2YHIA 1E6EA 2GASA 3T4EA 4LSWA 2YZ7A 5L7TA 2FRDA 1PL7A 1R16A 4OMUA 3BA1A 3GRKA 2WD7B 2YUTA 3HFSA 4JP2A 2GGSA 4HV4A 2X5KO 2HK8A 1GR0A 4KTTE 3OJLA 3QE3A 5TX7A 4MIEA 3ZWMA 1LJ8A 3JD4A 4GLOA 4R5HA 1BXGB 1G1AA 2YV2A 1B2LA 1SNYA 3GUYA 5JAMA 1BVRA 3SEFA 4E12A 1GZ6A 4FS3A 5FYDA 3OFSA 1T2FA 2ZQZA 3WOHA 2O48X 2EEZA 3ROPA 3L4BA 1DIHA 2V6BA 2O3RA 5KKAA 1KEUA 3BHJA 1U7TA 3SC4A 4BO7A 5CFZA 1Y5RA 1TT5B 1NX6A 1Y8QA 3NAQA 3RWBA 3WTCA 1BW9A 4XCVA 4AJ4A 1GQQA 3ITDA 1ZXLA 1X1TA 3GNQA 3INTA 5DNAA 2AE2A 1E3WA 2CMDA 4MOWA 3DOJA 2Y0DA 3SC6A 1H94A 2NV6A 1NVTA 3EGOA 4ALLA 4CLOB 3FN4A 3JQAD 5I9NA 2QZ9A 1MFPA 5JS6A 5EL0A 4RF5A 2ZTLA 3H5NA 4AJ2A 2GN8A 1LRKA 4DIOA 1MG5A 1MB4A 5H82A 1E7YA 3WBFA 3DONA 4OSOA 5HWSA 1XEAA 1MFZA 2C2XA 3QVOA 3RKRA 3LVFO 1SOWA 1DC5A 3KYBA 5TJHA 3PJDA 4U7WA 2RCYA 3SVTA 1JA9A 4YAKA 1Z75A 2Q1SA 1UXGA 4FQ8A 2YHUA 1NNUA 3JQ9A 3GDFA 1I2BA 5A1TA 1KC3A 1XLTA 4OXKA 5HS6A 3ETEA 1B3RA 1YB4A 1LDMA 1NP3A 3PQDA 1LSSA 3FNEA 4RF3A 1NFRA 3Q3CA 1DDOA 2HK7A 4TRRA 1EFKA 4I1IA 2DLDA 4FOSA 3H9EO 1YOVA 1GD1O 2GN9A 3MCVA 4KQXA 1CRWG 2G76A 4NIMA 4TRNA 5I8ZA 3ZHXA 4AFNA 4JROA 4ZJUA 5GZ6A 5F1PA 2D5AA 2OO5A 3M2TA 3VPFA 1T2CA 2IRWA 1BDMA 1E77A 3PHGA 2E4AA 3PHHA 2NU9A 3V8BA 5L95A 2DU8A 1B8VA 4KUEA 4QFCA 4M49A 2PH3A 3NJ4A 3ZWPA 4U0JA 3DBLA 5EJ2A 5JYEA 1BW9B 1X14A 4XKJA 2P9GA 3U4DA 1ISIA 3AW9A 1B7GO 4WLUA 3D4NA 3ADOA 3OQBA 4KUGA 4CL8A 2XXBA 4ID9A 3MWDB 2IYPA 1LA2A 1BDBA 2HMSA 3AOGA 4WEOA 2JD2A 3O8QA 3ENKA 2Y0CA 1Z7BA 3A06A 1ISMA 3WMXA 5AOVA 2HJRA 4WLEA 3AK4A 5DBGA 1BXZA 5EMHA 3WFIA 3E03A 1VL0A 1T25A 3MEQA 1E1LA 4HBGA 2GUGA 4FW8A 4N5LA 1HXHA 4OQZA 3D3WA 5TT1A 2ZJ0A 1VE9A 1O89A 1U3UA 1NPDA 3I1JA 3U4HA 1LNQA 4OO3A 3WGZA 1AXGA 2VNSA 4RVSA 1SO8A 1X7GA 1IHXA 4RL6A 1HYHA 1YBAA 3Q6IA 1PGOA 3I4CA 1L1FA 1GQ2A 4CM7A 2VWGA 1B26A 3GN2A 2J3IA 3IP3A 1IY8A 3FNGA 4JCOA 1YOVB 4J1QA 1MX3A 1H0KA 1TB4A 2BRUA 4D7AA 5AXAA 1DSSG 5JC1A 2ZATA 2UUPA 1LRLA 2LDXA 3DQPA 1SB9A 4CPDA 2WJPA 4NU6A 3ZNQA 4ND3A 3E1KA 3C85A 3LC2O 1QKIA 5ENDA 2VZ8A 3Q1LA 1HDYA 4HFMA 2Q2WA 4PLTA 4BMVA 1FDUA 4HNHA 4BIIA 5IN4A 3GY0A 4MVJP 3Q11A 3C1TA 1MGOA 5T57A 1U8FO 3HN2A 4FD3A 5HBRA 4HUJA 3AU8A 2B0JA 1H2HA 4I5EA 4Z3KA 4J0EA 4PIVA 3C7CB 1JW9B 4EJ0A 2WE7A 4YCAA 1HDXA 3P2YA 1R0LA 4BNXA 2J3JA 4E30A 3GFBA 1E5QA 3U4CA 2VYNA 1Q0LA 4L4SA 4Z3DA 3EUWA 3IQDB 4XRGA 1U3TA 1HE2A 3W8FA 1P0CA 1XWFA 4XQEA 3TFQA 4BNMA 2G5CA 1DIAA 4MP3A 2HMUA 4BNTA 4GQAA 2RHRA 3FBTA 1IPFA 3H5RA 3W4KA 1N9GA 2VRBA 2WYWA 2VZ0A 3LQFA 4DIBA 1BG6A 1A4UA 3KB6A 2X5JO 3HG7A 3PYMA 2BELA 4K1LA 1H2BA 4YAGA 3AI3A 2CF6A 4IZHA 3OIDA 4GGOA 3DMTC 3U9LA 1MXFA 3E8XA 1E7RA 2RIRA 3MWEB 3ZNPA 3NUGA 1OZAA 5KJEA 2Y93A 1A9YA 2HJSA 1PJTA 5F5LA 4LK3A 1JKJA 2O7QA 4D46A 3WTBA 3H4VA 3K8ZA 5A5FA 1DLJA 1GUYA 4M87A 3TN7A 3GDGA 1QV7A 5F1KA 3SBOA 1TLTA 1Y81A 2WSBA 1R0KA 1P9LA 1VSUA 1TXGA 3UOGA 1PEDA 4G65A 3GLQA 4N5NA 1QR6A 4JBGA 5JDCA 2CZCA 1PS8A 3GEMA 2ILTA 4TKLA 3V1YA 4XR9A 3DOCA 1J4AA 1ZVMA 1MLDA 1N5DA 2Q1WA 4M55A 5A5EA 1GCUA 1ADCA 3HB5X 5IDXA 1PU2A 3ZCXA 2AQKA 4QO7A 5JXWA 1HSZA 4BO0A 3UW3A 3AI2A 1WPQA 4GKVA 4DPKA 2PD4A 5JDIC 4A27A 2X0RA 2F00A 1XSEA 4DXHA 1LLDA 4WNCA 4CLXA 3HDQA 2VN8A 3I6IA 1WMBA 4M1QA 1GYPA 2ZKLA 1XKQA 3TQHA 5DN9A 1XDWA 3EZYA 5TGDA 3ZWCA 3S2EA 4ALNA 5JMPA 2PA3A 1NQAO 1G0OA 2DQ4A 1JKIA 4IJUA 1N9GB 1U4OA 3FF4A 4NI5A 4AJEA 5JC8A 4L0QA 2I3AA 1YL7A 1E1NA 2Y1GA 4IBOA 5T6BA 3OEWA 2X9VA 5JYDA 3QVWA 1I36A 3JYNA 4OAQA 3UGKA 4DTIA 4G81A 2VHVA 3HQ4O 2YYYA 4UULA 4GWKA 2RH8A 1B15A 2WEKA 1CYDA 3JD3A 4JJIA 3OA0A 3LDHA 4XA8A 1YRLA 2ZTUA 3UCXA 3WR5A 2EGHA 3H2ZA 1ZFNA 3WS7A 4HFRA 1HZJA 3KYCA 4X54A 4D3DA 2Q3EA 1EVYA 1D4FA 1Y8RA 3L6EA 4YJFB 1V9LA 1VKOA 3BMCB 3OA2A 2I76A 4Y9DA 4BNFA 4GBJA 2CF5A 4RVDA 2VYVA 1HEUA 3VAZA 4I9UA 1UAGA 5A4DA 4XYEA 2CDCA 3KM0A 2WYUA 2YQ4A 1ZIDA 3IP1A 4YJHA 1VRWA 3W6UA 1O9BA 2IZ1A 2V7PA 3PRJA 4CLRA 2X1HA 1I3NA 3BAZA 3FCOA 2X22A 4IDBA 4NBVA 4NDNE 3K73O 2PLAA 2TMDA 4B4VA 1YKFA 4BMSA 4LISA 4E33A 5U9CA 1Z45A 5ICSA 4B8ZA 3ASVA 1B0AA 2WTBA 4MP6A 4Y8VA 4MO2A 4YAEA 3SX2A 1JAXA 4W82A 3F1KA 3FI9A 3AM4A 3S8MA 1KY5A 2Q1UA 1TT7A 2I5PO 3PIDA 1DAPA 1P74A 5EQFA 1JWAB 1ZSYA 1V0JA 1MC4A 5ILOA 3RC7A 1R37A 2YV3A 4YRAA 3KUXA 3FTNA 3MJ4A 1W8DA 1AHHA 3RROA 3DL2A 4IIUA 2O23A 1LTHR 1QLHA 1EFLA 3WWYA 3ENNA 1LDNA 4FB5A 1GYQA 4J90A 4NHEA 1LSOA 1WW8A 5A02A 4FFLA 4XQ9A 1ENZA 4E31A 1UJMA 5JAQA 4PLPA 3EVTA 2XXJA 2JHFA 5ILGA 1QMGA 4B8WA 1V35A 3AUAA 4I5GA 4ZN6A 4ZQHA 4CQLA 1I01A 3PTZA 2CY0A 3G79A 5EQDA 4P4GA 2NU6A 5CDGA 1V3UA 4ZQEA 3GA0A 2ZB4A 5L53A 3WGIA 1K6IA 1MP0A 2NSDA 4CM8A 1B8UA 4U8GA 1IE3A 3LSYA 4DQVA 4P38A 3VTZA 1F06A 2EKQA 1LQUA 4D0SA 2VRCA 3G49A 4RV9A 5DBIA 3E9MA 4GX1A 2X58A 3KYDB 3NEPX 3T7EA 4PN3A 1SB8A 2EGGA 5I7VA 4N18A 4DWVA 3C7AA 4AJPA 3WGHA 3I5MA 2GYYA 3AY7A 4NJMA 4CUJA 5JCXA 1YBMA 3OIGA 2A35A 2PGDA 4NPCA 3MJTA 3PGXA 2GN6A 4QO8A 2DBVO 3LT4A 4CM4B 2VTDA 4RORA 3EVNA 4BVAA 2BGLA 4OM8A 3JQGB 1DIRA 3QVTA 3HUDA 3LU1A 4QEDA 1VL8A 1A5ZA 1PS0A 1C1DA 1SZJG 3EAGA 1HTBA 3OQ6A 3JD2A 4UREA 2D5CA 1BGVA 4GGPA 4IJVA 4Y6SA 4E5MA 4F45A 2VUTA 3N58A 2V6MA 4QFDA 3QP9A 1AGNA 1SMKA 3I83A 5CDTA 4WOKA 4RVFA 3KZVA 4INAA 1EMDA 5EN4A 2OOSA 2AW5A 2JFGA 3L6OO 2GN4A 4L9RA 2EW2A 2FZWA 2HAEA 3H5AA 4FFOA 5BT9A 3UN1A 3ZV6A 4W9NA 3NGLA 5IFLA 2W2KB 2DBRA 1LX6A 4RDIA 4BOYA 3EY4A 4R9RA 3FRJA 3HDYA 3U62A 5HTOA 5T67A 3IJRA 3KTDA 4LN1A 3WSVA 1QYXA 2D3TA 2BGKA 5TSDA 1E3EA 3IAHA 3IS3A 4URFA 4HFNA 5IJZA 1YB1A 1PL6A 3ETDA 1PQWA 1QSGA 2HU2A 4EW6A 3E5MA 4FGSA 4GVXA 5CDUA 3OF2A 4C4OA 4NQZA 4CV0A 3TOXA 5KJCA 1D1SA 5CDYA 3NDRA 1R66A 5F21A 4BKOA 4WLFA 3GEDA 4YR9A 4MPDA 1SBYA 3C1AA 4NJMB 4RZHA 4BMNA 2AG8A 3BMQB 1PZGA 3DMYA 3EYWA 4MVJH 4NFSA 5BQFA 4R41A 2XAAA 3ZH2A 1ONOA 4PVDA 3DHEA 1LDEA 1P77A 2BFOA 3DAPA 2EKPA 4B4OA 1HLPA 3WGYA 4MVJI 1C14A 3KLMX 1WMAA 1Y1PA 3WGOA 4KMSA 4BGVA 3WYBA 3VH4A 3KO8A 3IMFA 3RVDA 2GF2A 3VZPA 3RC2A 4BNWA 5J23A 5THQA 1RYDA 3NKLA 1E7WA 4BNHA 2NUAA 4XZ3A 1X0XA 3VDRA 4FCCA 4BHTA 4CQMB 2VNAA 1E6UA 4ZHSA 4UUOA 4JLWA 1A9ZA 2X0NA 4BNYA 1K89A 3BHIA 2D2IA 2DTXA 2EIHA 2R00A 3DXFA 3ZU4A 4DL9A 2Y66A 2O3JA 4IGFA 4H16A 3WWZA 3NTRA 5A9TA 1HLDA 4E5PA 3GNTA 4ZQGA 3ZW8A 5FFFA 1P0FA 3LLSA 4R54A 4WLVA 5KVQA 3MOIA 3ORFA 3WNVA 4BO8A 4CODB 1ISJA 4ND1A 1ML3A 1TA4A 4K9DA 2P2SA 4O63O 1KC1A 1XG5A 2FPIA 2FSSA 4FC6A 4TRJA 5COQA 2BH9A 3L6DA 4XJTA 1CQJA 1OAAA 3H3JA 4G5HA 4IMRA 1RJWA 3TF5A 4LMRA 2GNAA 4CMEA 3NT2A 2IZ0A 1BXGA 3D4OA 4JBHA 4E32A 3Q9UA 4F6CA 4RCVA 4CM9D 3WIDA 3VZSA 4IS2A 1I0ZA 3GOHA 1PR3A 3I6QA 2DPHA 5CEJA 3G1TA 4XB1A 2C5EA 2X6TA 4GX5A 1GV0A 1A7AA 1TT5A 1ID1A 3JQBC 4II3A 5BSFA 1RM4A 2OBNA 3PQFA 3GAFA 1YB5A 4PFJA 3BTOA 1T1RA 1K6JA 1XQ1A 4Q3AA 2GZ1A 3I9JA 1E1MA 5CG1A 1OOEA 4J49A 4U6SA 3PDJA 4WUVA 5IZCA 3ZI0A 1UXJA 3PQEA 1MV8A 1ZKMA 1HE5A 1LEHA 4XB2A 1RPNA 2PH5A 4CR6A 4CLOA 3G17A 1FDTA 1U28A 1ZJZA 3MTJA 3VKUA 1K2WA 4MKRA 4BO1A 5T64A 4BGIA 5BNIA 4GX2A 1Q7GA 1E3SA 1CJCA 3DBRA 4J2OA 4YJDA 5IDYA 3ZV4A 4PLZA 4RQUA 4R3WA 4JN6B 1Y6JA 2Z1MA 4TSKA 2WE8A 2Q4BA 2CD9A 3DO5A 5G4LA 3RBZA 4CMGA 2DTDA 1MC5A 3PWSA 4ZVVA 4IUYA 2LDBA 3RJ9A 1HDOA 3DC2A 3RUIA 2BMAA 2BF7A 2UV8A 1QYWA 1PJLA 3RUAA 2EG9A 2ZQYA 4GH5A 3L9WA 1PQPA 3PWKA 4UVEA 1CERA 1U5CA 2IDZA 1TVEA 4CM3A 1K5HA 4RPJA 3CZRA 3U49A 1F8FA 1IUKA 3KBOA 4KP7A 3O26A 1LQTA 3UVEA 2GZ2A 1QYCA 3IJPA 1XR3A 3UUWA 4AJIA 4AJJA 1YQGA 1FDWA 3EHEA 3ZU2A 2VHWA 1DRWA 1I30A 1R15A 5JSFA 2R6JA 5K6AA 1BRMA 4WECA 3P2OA 5DDIP 1S6YA 3RFXA 2B4TO 3Q0EA 2EV9A 4U6QA 4NK4A 1YXMA 3QV1A 3ONFA 5KCZA 3AFNA 4CM5A 2X8LA 1O8CA 1VM6A 3LF2A 2JJYA 3E6AA 1HDCA 4XEHA 1DO8A 4Z0PA 3RSHA 1EZ4A 4IM7A 2Y68A 4AJOA 3OBBA 4LW8A 1N1EA 1U1IA 3GG2A 4IXWA 3IDSA 2FR0A 3JQDA 4YT2A 2ZB8A 3NTQA 4BB5A 4DC0A 1E7QA 4RF2A 2SCUA 2P4HX 4WGGA 3ZU3A 2I6TA 3F46A 3EMKA 3JYPA 3RBVA 4GL4A 4DQUA 3C1OA 4YB8A 4BO6A 4R3NA 3DBRB 2O3QA 4L76A 3OJOA 4WKGA 1ZO8A 3CMCO 3OH8A 3H9GA 2FPGA 4FSHA 1U4SA 1UDCA 5I7SA 2YJZA 5JO0A 3R3JA 1V3TA 1HYGA 1V8BA 3ZGYA 2CNBA 3HFGA 3CKYA 3H9JA 2OUIA 4KUHA 4WPGA 4BQPA 2EERA 1XQ6A 4O6VA 3H6KA 4KDFA 1F0YA 2IEDA 5B1YA 1C0PA 3BTUA 4FC7A 3O03A 1ISHA 4R1SA 5HA5A 5TLSA 3JQAB 4AJNA 4XGNA 3H3FA 2IEBA 4ILKA 1XA0A 1FDSA 1TI7A 2D4AA 2QQ5A 3K5PA 1HWYA 1DXYA 1ZK0A 2J5RA 3LYLA 4CV1A 4ROSA 1O94A 3VC7A 3LT0A 4J4HA 1AUPA 5ES3A 2HKIA 4IINA 3F1LA 1Z73A 1ZSVA 2OBYA 4FBGA 4GSKA 4BB6A 1EK5A 1BMDA 1DLIA 4W7IA 3PWZA 5TQVA 1DEHA 3AOEA 5A03A 4PGFA 5I9LA 1U2DA 5C7IO 2JCYA 3OHSX 3BXXA 4J0FA 1WDMA 5GY7A 5GZ3A 2EWMA 1O5IA 5I7FA 1JTVA 1WP4A 1VKNA 2G1UA 4UEOA 4B7XA 4CMAA 3JSAA 1C1XB 1D1TA 5C5IA 5JAIA 1GDHA 3VH3A 2DKNA 5MDHA 1KBZA 2DFVA 5T5QA 2W4QA 2J3HA 3LF1A 4YJGB 4B4UA 1EBUA 1DRUA 2VOEA 1NBOA 3NV9A 4FJ1A 5DT9A 3UAGA 3WB9A 4YRBA 4LSMA 4TVOA 1H9BA 1YQDA 1CEQA 1WVGA 4QSMA 4DBVO 3ZU5A 2A94A 4F46A 3D3EA 2VWQA 4O1MA 4MVJA 4I5DA 1FF9A 4JQCA 3RIHA 1H6AA 2NVUB 2PFGA 1JKFA 2Q49A 3TSCA 3WYCA 4RVGA 5IDQA 1M2WA 4IZIA 5AYVA 3JQFA 4IDEA 4HWKA 1GPJA 3UCFA 4ZICA 4IDAA 2X23A 3NYWA 4BV8A 1XCBA 5CAEA 4CLHA 1WXDA 4YRDA 3ONDA 5LC1A 1GCOA 1ZXBA 2NU8A 1VPDA 1N2SA 2IE0A 5A9SB 1BXKA 2POQX 2OHXA 2FR8A 4ZRMA 2AQIA 3AY6A 3WGQA 1NR7A 2EP5A 3DZJA 3W4IA 2GLXA 4N7RA 2C54A 1GU7A 1Z74A 3WICA 2FOIA 1I32A 3D64A 2PKQP 4DYVA 4PCVA 4DIFA 3GQVA 1LDGA 4XD2A 4YEDA 1RWBA 1IZ0A 4J7XA 5KOIA 4IXTA 4PLYA 2E48A 3NTOA 3GN1A 3ZWBA 5A3JA 2Q1TA 4LVCA 2Z95A 1O0SA 3TRIA 4E5YA 3RUCA 1B14A 2J8ZA 3AUSA 5DOZA 2QG4A 2NVWA 2VWHA 4R1NA 2Y99A 1HE3A 3FR7A 3F9IA 5U4QA 5U1PA 4BNZA 3RC9A 1NAIA 3LT2A 5JY6A 4LRSB 3PLNA 1DIGA 1Z7EA 3FD8A 4BUCA 2PNFA 4Z0HO 4BNUA 5I8WA 4DQXA 1RM5A 3H9UA 2FY8A 1QP8A 1EVJA 2QRLA 3AU9A 4E3ZA 2VHZA 1N8KA 2Z5LA 2C20A 1NM5A 4OKNA 3O38A 3GK3A 2C59A 4WE3A 1IPEA 2GCGA 4PG7A 3W8DA 2X86A 1QXSA 1GZ3A 4NFYA 1NQTA 2AQ8A 2DFDA 4WCFC 5JO9A 4RF4A 2CFCA 3TPCA 3ONEA 1OC2A 5T8KA 4DMLA 5JBIA 4OQYA 3GR6A 4YJFA 3BMCA 1GUFA 3CPSA 4XYLA 4QUKA 1I2CA 1MA0A 1OI7A 2Q2VA 3PXXA 4P4NA 2DUUA 3GZ4A 3RFTA 4GMGA 1NPTO 1H6DA 5JLAA 3JQ8B 3OM9A 1UP6A 3IKVA 4EEXA 1P44A 1U7HA 4JJGA 3F4BA 3BTVA 3TL2A 2UAGA 2XOXA 2VUUA 2YY7A 4EJMA 4R68A 5A05A 3HB4X 1DFIA 5AQ1A 5CG2A 1W73A 4CUZA 4RVHA 2YDYA 4LCJA 3M1LA 2JFHA 3ZW9A 4DUPA 1BHSA 4CUKA 1WWKA 5EIOA 1XU7A 2EJVA 3DFZA 1VLLA 1YVEI 2AQHA 2VYND 1I3KA 7ADHA 1JU9A 1QLJA 1YONA 3BMOB 5BNTA 2Y1EA 3FNFA 4PRLA 5JMWA 4UUPA 3P19A 4AJKA 1F14A 4IDFA 3V1TC 3GG9A 1VSVA 4ALMA 3O4RA 3W4JA 2DC1A 3ITKA 4OH1A 5HS4A 1V3VA 5KJ6A 3CZMA 5TRTA 4ZQFA 5K0ZA 1R4NB 4UVIA 5C37A 2PZMA 4YTEA 4EDFA 4G2NA 5KVVA 3KXDA 1P1FA 4XQCA 4AJ1A 1XGKA 2O7SA 4IDDA 3T4XA 2GD1O 4QX6A 4E5KA 3S55A 4IJWA 3A14A 2Y1CA 1O6ZA 1JVSA 3DZKA 3DZFA 3GHHA 4NMHA 1NR1A 3K30A 3DB2A 4CLEA 1KVRA 2YDXA 2JD1A 1ADGA 2B4RO 4FPXA 1ADBA 3R1IA 4HP8A 1GZ4A 2D0IA 2IODA 1EUDA 2DT5A 3MOGA 1PS9A 4TVBA 3UHAA 3LK7A 3DR3A 4J4TA 3KYDA 2H63A 4NJOA 4W6ZA 2ZCUA 5A04A 4IPTA 4YPOA 3HDJA 2CSUA 2C7GA 1ULUA 3W1VA 4LVUA 3ZV5A 2RAFA 3IIEA 4R9SA 1H5QA 2OORA 3AI1A 4Q3DA 1U3WA 3PHIA 3KV3O 1NXQA 4CM4A 3PLRA 4PZDA 1N1GA 4UVDA 1R4MB 3DDNA 3JQGA 3DEYX 1Y9AA 5ITVA 4OL9A 4Y98A 3D5QA 1M67A 1RKXA 4PG5A 3FHLA 3DZHA 4E21A 2VQ3A 2W2LA 1QYVA 2PZKA 4IDCA 2WMDA 2RBEA 3VPGA 3CE6A 1CQIA 3G1UA 3NJ8A 3ZHYA 3A1NA 1QYDA 3H2SA 1DHRA 1NWHA 4IIVA 2OP1A 2PWZA 3EK2A 4K26A 2HMTA 4E6PA 3CEAA 4YT5A 4FDAA 2X0IA 3K96A 4OGWA 1YBVA 1LDYA 3OJEA 4FOOA 4RVUA 4F3YA 2FSVA 5ADHA 2I67A 1LC3A 1IL0A 3SLGA 3TOZA 3H65A 4R4JA 1WAMA 2W2KA 4OJNA 4CR8A 3GT0A 3SXPA 5G0SA 1JAYA 3F3SA 1EE9A 3OJ0A 1YL5A 3L4BC 4CV3A 3C8MA 3I9MA 1HKUA 3W8EA 5KIAA 1R6DA 2E6UX 5MGBA 1ZK2A 6ADHA 4TZKA 1PR9A 4TWRA 1GPDG 5L45A 5DCYA 5F1OA 2DVMA 2PKRA 4WNIA 4GX0A 3VPHA 2VYVD 2B35A 2Z1NA 2W90A 2O2YA 3MZ0A 3P7MA 1J0XO 9LDTA 5IDWA 1IZ9A 5KVCA 4CL3A 2J3KA 3NDIA 3RD5A 1Q7BA 1PX0A 5IG2A 1NVMB 5A9RA 3WLEA 4L4RA 3GFGA 1BVUA 3ROMA 3BMQA 3INRA 4IQGA 4DYDA 5EESA 1OBFO 1DJQA 4YAJA 1T26A 2C7VA 1L7EA 5IF3A 1Q2XA 4UVHA 4GWGA 3RUFA 2VCYA 1ENYA 1P31A 1ZBQA 2D59A 1ISGA 2NWQA 4MP8A 3FWZA 4MIYA 5CPFA 1T4DA 1VJTA 3JQ9C 4M54A 1U8XX 4CQMA 3VPSA 3PJEA 1KVSA 4Y6PA 1J5PA 3DZGA 5BR7A 3S2FA 1F12A 1P3DA 1AE1A 1HYEA 4JK3A 3FPCA 4B3HA 3FPLA 2Q4EA 3QRWA 4UUMA 1YJQA 5CP8A 2FWMX 2I66A 1XU9A 4BKQA 4UUNA 5EERA 3ZHZA 1L7DA 4E2YA 1IULA 4NBUA 4YA6A 1U3VA 4C7JA 3ETGA 1U5AA 3GEGA 3IKTA 4OXYA 4Z9YA 1ZSNA 2DAPA 2X4GA 3EW7A 1E7SA 1KY4A 2VRCD 1O95A 1ADFA 4KDEA 2BKAA 1ZK1A 4NBWA 3DFUA 4JXKA 4J1SA 1NHWA 3PEFA 1GFSA 2NQTA 1PJ4A 4BKRA 3HDHA 4Z0TA 3TJRA 3GNSA 4YVFA 5LDHA 4JBIA 3CTMA 3DZBA 4NBTA 4R5MA 4A0SA 1YL6A 4PLCA 1E6WA 3EDMA 3PZBA 4W7HA 4CMBA 3E5RA 1YS4A 1LRJA 4PG6A 1LLUA 5JFOA 4QXMA 1GYRA 1NAHA 1FXSA 2PD6A 4KWHA 1QORA 3V1UA 3B70A 1H6BA 5KKCA 1T4BA 1PJQA 4EI2A 4WCDA 4PLFA 4YXFA 5TIIA 2YV1A 4CQMD 1KVUA 3KEOA 4J7UA 4AL4A 5IXYA 1ZEJA 3L07A 3QW2A 3DMTA 1ZW1A 1ARZA 4R51A 5ICMA 4HXYA 1B3BA 1K3TA 3RQSA 4RLSA 2NTNA 5KJ1A 3I9OA 1EUCA 3EZLA 3LC7O 4ALJA 2YFQA 3CH6A 3NT4A 4CMKA 2CDAA 4PG8A 1P1RA 4NH4A 1RM0A 1IB6A 1HDGO 4GI2A 1VJ1A 3L0DA 4ONEA 3PHJA 2X5OA 1PJSA 1DB3A 1ENPA 2HUNA 4I9NA 1K6XA 4PRKA 3FSRA 4DREA 3PJFA 2ZB3A 2Y1DA 3AY3A 5F3RA 4WLNA 1GEGA 4DBZA 3E18A 5B12A 4J6FA 1GY8A 3IC5A 3WBBA 3RUDA 3ANNA 1EUZA 5IXSA 3PI7A 4J1TA 2OMEA 4PG4A 4AJLA 3E9QA 4BNGA 3B20A 2JCVA 3ST7A 4BKUA 4D3FA 5JDIA 1N7HA 8LDHA 1KYQA 3JV7A 2V6FA 3LC1O 1Z82A 3WYEA 1HETA 3ZWNA 4IDGA 1T24A 3GZNB 1EK6A 3AM5A 4DGSA 3ZWVA 3ZHBA 4HADA 4HY3A 1E3IA 2CDBA 2BI7A 4KWIA 2I9PA 1KEVA
chains in the Genus database with same CATH superfamily
4F3CA 1FYVA 3DYVA 3CUSA 4LF4B 1XYGA 5B1DA 1DBVO 2FN7A 2VQFB 4PYQA 3MAAC 4AYTA 2HU8A 1H3EA 3ZEIA 3UJAA 3SJ7A 1JPNA 2X2PA 1ILEA 3TZBA 1H05A 3S6JA 2CLOB 2XRMA 5F77A 2CLLB 2DPGA 2J0VA 1F17A 2ZYDA 2G9RA 5D86A 5FUVA 4EKDA 1ZUHA 4O2AF 4IR7A 2MYTA 2H8GA 1N6KA 4MW4A 2P8SA 1X15A 2ZE7A 4M7OA 5HKLA 1D6MA 2QP3A 1NW3A 2CMFA 3OF3A 2R6R1 4KTVE 3GP5A 1NT4A 2OO3A 4XWYA 2AB0A 1HRKA 2VVTA 2P65A 4Q3BA 4M0EA 2QVYX 4XUEA 3OHPA 4DY4A 1OILA 1R0RE 1TKRA 1EGVB 2IXBA 2IUSA 3MJFA 4ME6A 3ESYA 4DLZA 3LUDA 4F84A 3R44A 1DIBA 1ULSA 4I14A 1P1IA 5CR9A 3OX3A 5LMZA 3AZPA 1U3FA 1SOVA 3LPCA 1W4ZA 1MG0A 1DWUA 2QX4A 2YUIA 2B0CA 4G63A 4W8GA 1UWCA 3ORHA 4D92A 4V38A 1AUQA 5CBKA 1OWLA 621PA 1TADA 1FNNA 1OU4A 3JQAA 2OVBA 3BTSA 1SCBA 4JR2A 4K7JA 3SLKA 4DBLE 3ZG6A 3CNQS 3I5UA 4KVZA 4Q66C 3ZOKA 3IXQA 2H65A 1NQOA 1YI8A 2G5GX 4BLQA 4CLDA 1E6CA 4HDNB 4ETWA 2I62A 5A7GA 5CT6A 1QZ3A 4YAIA 1Y4SA 4W5JA 4XPIB 3QKSB 1L4FA 5CXUA 3KAJA 4A0GA 1HDEA 1KHTA 3UJ3X 5JCOC 2JHGA 2WILA 1G3MA 4KXYA 4ZP1A 1Q7CA 3V2UA 1D2RA 3KWJA 3BSSA 2HTFA 3AUUA 4RJTA 4S1WA 2HMWA 3STYA 1WQ1R 3FUXA 3D4LA 5BWOA 3B6ZA 1MO5A 1QVWA 3EXHA 3KOXA 2LR0A 3E3OA 1WD5A 1PZXA 3EUFA 3TK1A 1C3VA 1UM8A 2IIQA 5F98A 4JT2A 1CE8A 2RCNA 3KLPX 2HPVA 1IOZA 1IB0A 4KQWA 2XUGA 4UU7A 1L0BA 4QATA 4KAJA 2H5JA 2XVYA 4P3XA 4V0KA 5LU9A 1BX3A 4KQEA 4ZMSA 3GC6A 1USWA 3D7LA 4RO0A 2HA4A 3TZQA 4F1WA 2CL0X 3QIAA 4MJLA 4TMZA 1F6BA 4HLUA 1EE1A 4UMVA 3U9TA 3BIOA 1QMPA 2WZDA 4P8RA 2WKPA 1CRLA 4RSMA 2ODTX 2ZE5A 4U00A 1SXPA 1NUTA 2ZVQX 1Q83A 3B13B 2XIJA 3ORRA 4P4SB 4CFSA 5K6AA 2FEXA 1XYYA 1ZC4A 4JP5A 2B8JA 4DDMA 3HR8A 1CNEA 3LA8A 1RHUA 1W1WA 3FROA 4JL5A 4M37A 5CFRA 3ER6A 3EBOA 3TW4A 1JVBA 3W77A 4EKNB 1WPGA 2H06A 4NOMA 3LWBA 1QHXA 4D9HA 4MWZA 1U2QA 2AN1A 1RCTE 3PPWA 2NVUA 4BVFA 4NBLA 1OB5A 2G1JA 3DC7A 4K1XA 3Q15C 1FLNA 1N8SA 3QXJA 5DBFA 5I7AA 1IAVA 4A8JB 1C4KA 3DEIA 2GZSA 2H54A 4Z53A 2WJHA 1JEQB 1DV2A 2JCGA 2O2EA 4WINA 3EIHA 5H81A 3FKSA 1E2FA 3IA7A 4UUAA 1N0WA 4OV6B 2A2ZA 4RPGA 4WD3A 2I99A 4GZ3A 4NARA 3R7BA 4B48A 3AYZB 3I6BA 1V8OA 4E07A 2EW1A 1J49A 5EMLA 2QG9A 3ZH2A 3FUCA 2G5TA 1OXVA 3KPJA 3STVA 3WHKA 4GKJB 1GZSA 4H1UA 3R6WA 1BNCA 4QHSA 1LD3A 2O59A 3INGA 3EIUA 1BSVA 5EE3A 3IMEA 1QOPB 3I4FA 3VYRB 3KDAA 1BN7A 2OILA 2YMPA 3A27A 3QVLA 4G85A 4XD7A 2GZDA 3UJ8A 3CUVA 3HV0A 4TLEA 4AD8A 4FKZA 5CLIA 2AK2A 4PLGA 3G0BA 5CT4A 4BECA 5HK9A 1U2GA 4FJ2A 2O2ZA 1GKLA 4TQAA 5B3AA 3ZQKA 4WXEA 5L4NA 2QZ4A 3VSBA 4ZT7A 2JBAB 3DLIA 2HSDA 4ARUA 5HCUA 1KVTA 3TAUA 5T4FA 4MB6A 5GGYA 1N2EA 5H3HA 4K6FA 3AJEA 4NPHA 2OB2A 1KAQA 1M7HA 3L8FA 4FSDA 4TTVA 1UBTS 1EA7A 5HJ2A 2E4VA 4M8LA 1C8VB 4CTKA 4C76A 1GAXA 2FW1A 1VL6A 5AW7A 3Q0TA 2GAOA 3TWOA 3TZCA 1KEWA 2Q9UA 2XAUA 2X19A 2JFVA 2MWMA 3G0OA 1RMQA 3QE0A 1XZQA 2HY7A 1OLOA 4QJ5A 1DUVG 4RQTA 3ZS9A 4C14A 4LHWA 1JECA 1DKUA 1RSZA 4IAOA 5ABPA 3QE9Y 3GH1A 1VPTA 3WL5A 4N8SA 2D1FA 5JJCA 2Q0SA 3BHNA 3V4PB 3QU7A 2NU7A 5K1ZA 1ZGBA 4J03A 3ZHRA 1MQ8B 2QJFA 3UUGA 3AWIA 4OOEA 4WESB 2RGYA 4XYMA 5FA5A 3NNSA 3ZNOA 2VDNB 2G3YA 5F51A 3HFJA 1W1UA 3K1ZA 3OY2A 3FPAA 2NPFA 2Y1OA 1E59A 4U8HA 3ZXSA 3CLSD 4F93B 4K6OA 5CTAA 5ECWA 5JMOA 5DM0A 4UEWA 1V39A 1P7ZA 1KHHA 2FLWA 2FZKA 3QUTA 3H2JA 1CZHA 1XTPA 1DOAA 2QRVB 3F90A 4EKGA 1IOWA 3GARA 3LZCA 1SQFA 4EGSA 1PR2A 2VA9A 1M6HA 1UH5A 1UJBA 1Z0KA 1QG6A 1Y5IA 2QX8A 3LL7A 4HNGA 1Z2AA 4MS3A 3R3XA 3B1KA 3FRHA 4O2RA 3MJSA 4U5QA 4TXNA 6PFKA 5LJLA 3BHMA 4TXLA 3ROQA 1VSBA 1O94D 2IC5A 4ND4A 1J8MF 3MJEA 3W6ZA 2A1UB 3A58B 5IAAA 5KQLA 1VCNA 3A28A 4QYTA 1AF4A 4WOBA 4JR1A 1MOPA 3B1ZA 5C35A 4RTMA 2NUTA 5CB4B 5K9ZA 1CDOA 1U0NA 1NMSA 4TVSA 3WNQA 1RI3A 2A9KA 3O9VA 5IM4A 2OHVA 1GQRA 2PXCA 5FIUA 4EJ2A 5K05A 1OIXA 3NTLA 3VU1A 3PPXA 4B7UA 3MTAA 3EVDA 2ZWMA 3D7RA 3D1VA 5B1HA 4RE6A 2GBCA 1PD0A 2AHOA 2MHCA 3SE7A 4F0JA 1G55A 5EQJB 4HT3B 4JQZA 1IN1A 2W6NA 3F97A 2Q2OA 1ZN8A 1G9TA 1F8XA 1FTYA 1T2DA 4MPTA 4UNNA 1XNRB 4PM4A 4CG0A 2NO5A 3CXRA 4NYJR 2C5HA 3BWCA 3PQ6A 4B3BA 5IYZB 3V1LA 2XB9A 3B1JA 2J07A 4K03A 4BDSA 4HH4A 5D1HA 4QG7A 3LAWA 2PXHA 5BSHA 3N8HA 3K9FC 3GD5A 3ND6A 2WV9A 4F4FA 3EXFA 2BEVA 3QLJA 1E1KA 2C4WA 5KHLB 2P6MA 5LQNA 1NRXA 4S2UA 2R8RA 4DA7A 5LMNB 1U3GA 1LJUA 1VHLA 4IS3A 4IOKA 2FUEA 1TKCA 3V4LA 3SYLA 3ZHCA 2YFHA 2ZRIA 1QH9A 1UZLA 2OK8A 3R9XA 3CF2A 3NWBA 1Q77A 1I24A 1IHYA 3PUHA 1WIWA 3EG9A 1W44A 4ARVA 3HU3A 3U4QA 3JQBA 1ZJ4A 3CURA 4TMFA 3WQRA 2D1YA 2R6ZA 2V74B 2XSZA 3D6MA 1JL3A 4DJAA 1THTA 4GMXA 5KAMA 3TQIA 2HBYA 2PO7A 5LD2B 3QK7A 5EZYF 1CIVA 2KW5A 2NT3A 2Q3CA 5TNXA 3V48A 1SXGA 4BS9A 4TUYF 3R74A 1XVTA 2CVPA 3GDOA 1JG7A 5TVKA 3V2HA 4BRUA 1LB1B 3AHIA 4EGQA 3PDIA 1T2EA 5CB0A 1ZG3A 3OX2A 3GNLA 3KJFA 4EO9A 2HWUA 2VDWB 4OQ4A 3D3WB 1N2JA 1KSGA 3SYNA 4BFTA 4QJ4A 5CHYA 3E3LA 3EPPA 3ZDAA 4EJ6A 4YDRA 1YJ8A 2H4WA 2VEDA 3O1LA 3HCAA 1ACJA 4MRNA 3UGTA 4DCGA 3ZLBA 2R00C 3FYUC 4ETNA 2H2HA 1R6VA 4JVLA 4Q93A 2HA6A 5HFAA 3GQBA 3KR2A 3T3OA 4F11A 3T7DA 4C5AA 3WBKA 4EEZA 2HL6A 5HTKA 6NULA 5ECGC 1M0WA 2B8NA 1I1OA 3BF7A 4Q39A 4YECA 2O2DA 1ZHOA 1NJ6A 4FFPA 4BNNA 4DLSA 2ZM5A 2RKBA 1JPUA 1SC1A 3D5TA 3ICOA 4FZ5A 1DOZA 4YCLA 1YO6A 1C80A 3OPXA 4JI0B 1IOVA 3UH0A 4NZNA 3VZQA 1X7DA 3IUPA 1C7FA 5BY2A 2VF4X 2ZBDA 2H07A 2QV7A 4EL0A 5HBGA 1Z4KA 3BXZA 4QARA 2J4CA 2R4UA 3GAAA 1Y7TA 5BMOA 2JIDA 1JHPA 3A1WA 4QOSA 4HAYA 2SNIE 3DMDA 2MINB 3PXAA 3WXMA 4LZWA 3JSXA 2FP4A 3LQ1A 1Y9EA 3MRTA 5LXTF 3QIVA 1XQVA 3Q2OA 5KYXB 1M34B 4M9RA 2O7NA 3KHUA 2BT4A 3QVJA 4RIGA 3MTGA 4RW0A 2EL9A 4BNLA 4C6TB 4G1FA 2VTKA 4GWLA 2YY5A 4R8MA 1UZNA 2AH5A 4FQ5A 2HO4A 1GL9B 5DMXA 1Y48E 1NFFA 4HVCA 2XOEA 5TF4A 5L7TA 1JWBB 2WD8A 3CVYA 2B3TA 5U4XA 5LBTA 1OFHA 4BQSA 4XH9B 1GNSA 3QWIA 3F5FA 3T41A 1J6UA 4BQOA 4YMWA 2IITA 3BRSA 3JVUA 3DE4X 3FPKA 3I9V6 5GTDA 4P84A 1I8TA 4DEVA 1Z2EA 3DMGA 2ORYA 2BMDA 4ZOLB 3AIIA 4D41A 1EFPA 2C5AA 4ITUA 1Q19A 4DB4A 4QQ8A 4ENUA 1XB2A 4G1MB 2VDUE 3CUWA 3U4MA 1PL0A 1NVGA 2PGOA 3FJOA 2P68A 4KIFA 3U5TA 4X94A 4P86A 3NBKA 3OZFA 1NSFA 1XHEA 2V7BA 3BRQA 4R2MA 2GK6A 5B6PA 5K5EA 2FPPB 5JECA 2QP9X 4LC1A 3IHLA 1Z35A 4W63A 1M0SA 1KE2A 3UCEA 4W7SA 2NZVG 2JH3A 4CIAA 4K0KB 3O4FA 4WDRA 5CX1B 1L9XA 4XTCS 4RHFA 1I2ZA 2IPXA 4YN3A 1G8MA 2PWYA 3NGXA 4XM2A 5HR5A 2HK6A 4X84A 1WMEA 3PVZA 2INGX 3K9QO 3T9DA 2GPAA 4E4YA 4II7A 4W5QA 2XNCA 1ISFA 2NN3C 4I55B 4EITA 3UFBA 1CLEA 2P40A 2AA3A 3A1TA 3IUJA 3NBQA 4ENWA 1USIA 4DLUA 2XCQA 5TB5A 4CGZA 2NADA 3G2MA 1QPZA 3ENWA 1YS6A 4C3UA 4DWOA 1TCCA 2BY4A 4ZYLA 3P0EA 3UJDA 4WY5A 2H1WA 2HCTA 3Q9NA 1NASA 3EQZA 4BO5A 5CU7A 2GCOB 2WDPA 1TIPA 1XZCA 1W30A 4IH4A 2XWPA 1POWA 1R7RA 1YQWA 3L8CA 1T2VA 1NY6A 5DN6D 1I3OA 5TMPA 1P4HA 3D6JA 4U2DA 2V6GA 3PICA 3ABRB 3VKGA 1MZVA 3K0FB 4KAXA 4Y9TA 2YHBA 2UDPA 4LGVA 1GVNB 5E4TA 4TYMA 4ZZ3A 5CEEA 1ZIPA 3D1JA 1I10A 4FFVA 3ZWBA 3M7IA 4KFCA 1WV0A 1XLWA 5L3QB 1QIMA 4FEYA 4J16A 3QPVA 2WJGA 2QN8A 4AN0A 1OMOA 1H8EA 4OXQA 2F3SA 2QLTA 4QZVA 1X7YB 3DCJA 3DV0B 3ENVA 3GVHA 4FMDF 4EFKA 4EPVA 3JQCA 4EPYA 3B1FA 1OW3B 2BMJA 4NL4H 2PGJA 4KYIB 2VXYA 5IN5A 3FPJA 5KX5F 1W0CA 1E0DA 1QHSA 2QT0A 3O0TA 1X87A 3QYFA 1QZTA 4FEAA 4PTYA 1K0FA 1L4HA 1L5HB 3K0CC 3UTCA 1DPGA 5DOVA 4ZCRA 2JL1A 1BOFA 1Z7GA 1MAVA 3EJWA 2NLOA 1Q6ZA 2ZIZA 1FY2A 1PZEA 4YV2A 2B37A 1Q74A 2KS6A 2V7QD 3F8SA 2FEAA 2ZT5A 3HL4A 3KYCB 3RS4A 4ZCMA 1IZZA 1QGDA 2QRKA 1ESNA 1WO8A 3G02A 3JQEA 4OHFA 5BOVA 3K9NA 3RC8A 3KUCA 3ED5A 4UDOA 4IP0A 3WRYA 2BI4A 4PNZA 1C0LA 2HA0A 3EQ2A 2PPLA 4MV1A 5FPHA 1ILWA 1L4MA 5BNFA 3CRZA 4PZUA 3RABA 1XP8A 1ZGZA 9ABPA 1CCWA 4CKZA 1G291 1I3MA 1PW5A 1KOLA 4CLRB 1KXJA 4J7CA 4PICA 5CBPB 1VL2A 4AK9A 4DSNA 2VLBA 2B82A 1JFVA 1GUZA 1K5PA 3P2MA 4AMGA 4NYIQ 4GSLA 5IRCD 1EGQA 2JFUA 1BFDA 2DUWA 2OAQ1 1V95A 1TW3A 3RU7A 4ND7A 2Q3LA 1JQ5A 5KTMA 4UM5A 3GF4A 1XXHA 4TWJA 5D1NA 4BGDA 1CZRA 1PJZA 2BEWB 2EYQA 4IMPA 3TUIC 4B40A 1UDRA 3T95A 3F74A 1KERA 1P3Y1 2X0JA 1YR9A 2NZ2A 4J2HA 5TQ0B 3SDBA 3RYCA 1CJSA 2Q2NA 1LPMA 3B1YA 3CLRC 1D3AA 1ZNXA 3PYXA 2YWRA 4ZYTA 1YUBA 3FFWA 1UMKA 3HVIA 4QTYA 4EUSA 4PHCA 5JCJA 3K6RA 1FFXA 1UXKA 3M6IA 5PNTA 3TVDA 4DCCA 1EFVA 1U2SA 2XEDA 3QY9A 4DLTA 2OBLA 1UFRA 3D4IA 2HFKA 9LDBA 3IPAA 4KR7A 1TA0A 3FOWA 3GFSA 1SA0A 4U2EA 1PGQA 1G20B 1QIGA 3R3YA 1K7XB 4Q19A 5AHRA 4F1JA 2FB9A 3HVUA 1AGRA 1YC5A 3NVDA 4YAFA 5F7JA 3UMSA 1UJ6A 1P4AA 3B78A 2PS1A 2WJJA 3MTIA 2X9NA 1CV2A 3QELB 3TIIA 3ZWAA 2BGTA 4B3FX 1PFWA 1RMYA 3CW8X 5ALXA 2PZBA 5GPBA 3S7ZA 3U44B 2ZTVA 1IXYA 2OD7A 2XQFA 2O19A 4ZVUA 1U8AA 4GOLD 4TZTA 1LU9A 1A5BB 2AX3A 2CLSA 5DHFA 4EI9A 3OTWA 4R8LA 1DHTA 1THZA 1GAQA 3GRUA 4ON9A 5C81A 1PT5A 3RKUA 1HDZA 2NU6B 5EIFA 3WK6A 3RJ5A 3R6TA 3AKZA 2JLZA 1H1DA 2JI6A 3D6NB 1RJEA 1M1NB 1SCDA 1UAYA 2SKEA 3PD1A 5BORA 2B8WA 1L7MA 2EF1A 3LZDA 3VVCA 4CBVA 2FLKA 1C9DB 3D0QA 3PXBA 5FI3A 4GPBA 4KFUA 2OXIA 3RS8A 4DLVA 4LC0A 6CHYA 1MVOA 5I01A 1UPTA 2GEVA 1K88A 2J08A 2AEMA 3TKYA 1ENOA 2BFCB 4JLAA 2PUFA 3DDCA 4UFPA 4HPJB 3GEIA 2ES4A 1IN6A 1IEXA 1EQUA 3D0OA 1L4EA 4IFIA 1TYAE 1PV1A 2BD0A 2H00A 3FY4A 4CM9A 5IFLA 1U0GA 2XW6A 3QX3A 4KE6A 2AXPA 1T43A 3WKEA 1DTSA 3WK7A 3AGPA 2PNJA 2D7DA 2OHGA 3S70A 2BISA 3ZKWA 1SPXA 4FDMA 1ONNA 5FWXB 1KDYA 3R8XA 3K35A 3MB5A 4ECEA 3NRJA 4OHMA 2UVPB 3PZRA 3I3OA 3IOEA 2GXAA 4ESVA 4TKVA 1VBMA 4Q3EA 4I3HA 3WJAA 4PF1A 5JNLA 1HSOA 2Q3BA 1PV2A 1ES9A 1VHWA 1LZKA 3AHFA 4NRDA 3X2EA 4ZZ1A 4KQ1A 1W1IA 1ZA2A 3DUFB 3DHYA 2BMEA 4RANA 3UYLA 1ZNQO 1SHUX 3G8DA 3H05A 5FBQB 4NZ9A 1WS6A 1YIAA 1GRCA 5JADA 5FD8A 3HNPA 2H1SA 5HM8A 2WD9A 5FI5A 1NW8A 2QNIA 2X1VA 4HDNA 4HB4A 1JR6A 4DF3A 1OLUB 1Z4NA 4YCDA 3S0JA 2WWYA 1JMKC 3E27A 3NORA 4XPIA 3QKSA 4PINA 5BSMA 3A05A 4MO9A 5EWMB 2OCLA 3RI3A 3AR8A 3H6HA 1DNPA 4MXDA 2E89A 3NYIA 3TZ6A 3ZLJA 1W5TA 4WQMA 2VOJA 4DAOA 4MKIA 3P2JA 3G9QA 1ZR2A 4L74A 2CV2A 5HFNA 3QFRA 3WIVA 1GQYA 1DAMA 3MELA 4HB0A 2B98A 1DJNA 3MBOA 1KA9H 1R2QA 2XF8A 2Y8EA 3KQMA 5TPZD 1ODIA 2OY0A 5JROA 1YA4A 2G82A 3QXXA 3JRNA 2YZNA 3C3JA 3LIPA 3LTEA 3OZAA 3TSOA 2WUVA 2C3MA 2OKGA 1XTJA 4XJSA 4BGUA 3VAAA 4IIGA 2CYAA 2VNIA 4QQKA 3X1KA 4B3JA 1G3UA 5EKTA 4JSYA 3P9RA 1IHPA 2GR9A 5BWBA 1R6BX 4ZDWA 3I6ZA 3NAGA 5FYQA 1H93A 5FJIA 5IK2A 4DMGA 4KNYA 4QASA 1QQ6A 4B6FA 5JH7B 3V34A 3UG7A 5DE3A 1IJEA 4LOLA 4FINA 4KPEC 1N3IA 1KS2A 1V71A 2ALJA 4A7PA 3O4GA 1A0OA 2PT9A 5CDFE 4ICIA 3ROTA 1OFGA 2V3WA 3KQPA 3E84A 1V8ZA 2YJ5A 3KTFA 1QM5A 1NIJA 1CUIA 4IJKA 2C84A 3H16A 4LXUA 3TZEA 3TNJA 3PEWA 5CTJA 2OCPA 7MDHA 5I3CA 1N0HA 3C16C 1V8DA 3PGJA 1XMPA 3W3AD 3WQSB 1M8GA 2X3FA 3GAZA 1EEXB 3PUZA 1NI4A 1X19A 4INOA 4V3CA 1UUFA 1RI1A 5G1OA 2O07A 2OQ2A 4MCJA 2HC9A 1U1DA 3OVMA 4UEKA 1OFVA 3JWHA 3B53X 1N7GA 5DWQA 4A8JA 4PIPA 4DUZB 2V0GA 1P2UA 3IE1A 3S3TA 1LCIA 4M9XA 2RGAA 1GTVA 3NCTA 4BO3A 2EAUA 1E0JA 1JEQA 2BBTA 2JC3A 4G8BA 2VBGA 3IJ5A 4O2BA 4HUQB 2VYFA 3GHYA 4IY1A 2D8AA 3UK1A 1BC5A 3ADPA 2JEZA 4L6IA 4LPKA 5E9AA 2HCRA 2NUAB 2O8EB 1BH2A 4JT4A 2PXXA 4CEHB 4MCAA 2H7CA 4PZEA 1Z16A 5K6RA 2EQ5A 3AFOA 4QE3A 3BOSA 3HN7A 3EEIA 4D4JA 1T3HA 4I4TF 4ZQBA 4BAUA 5B6IA 2CHUA 1SJ9A 1U7WA 4TTSA 3GIDA 2WSMA 4R8SA 5FTMA 3OOYA 2ZW9A 2ZJ1A 4YQZA 4C0SA 4D96A 1A8IA 1AO0A 1Y8ZA 4HPWA 3OQVA 1TYZA 1AJEA 3DTTA 2OESA 1I3LA 1U9IC 1ZD3A 3CLTD 5ALFA 3BIJA 4BB9A 4FWTA 3CVWA 2GASA 2JBAA 3TGPA 3MD0A 2QLBA 4LSWA 2NXCA 1H65A 3QJYA 1BN6A 1PL7A 2FRDA 3O82A 4V02A 4ZO6A 3L0PA 4OQNA 3E8MA 4MR9B 3FWPA 3DD5A 1LZLA 3HFSA 1PKEA 4YRMA 1CQJB 2GGSA 1E9FA 2HK8A 2X5KO 3KXIA 1SOAA 2XXAA 1SC3A 1SU7A 1VFPA 2ZAYA 3I5YA 1PE0A 3QE3A 3ZWMA 5L51A 5JD4A 3JD4A 4HS4A 2FWJA 1B2LA 3KEGA 4I6EA 1E6LA 3AMVA 1BVRA 3DMHA 3O94A 5IH7A 2ZANA 5BV8A 2XQGA 4KQ6A 4Q21A 1GZ6A 3HGQA 4FS3A 4TQUS 3T0GA 3TLMA 3ZXUB 3WOHA 3CSUA 5LUAA 3SU8A 1XAIA 2FE1A 2ZJ3A 5KKAA 4BO7A 2LP4Y 1DJPA 3ILSA 1W59A 1Y5RA 4LYFA 4X1KB 1FX0B 3KCNA 1G8JA 1BW9A 1SHZA 5CLJA 3QBDA 1Q6YA 4B34A 3HM9A 5KOIA 1YSCA 2FPSA 4KW7A 1Z4OA 2PZ8A 3AVYA 2XE7A 4WESA 3UJ7A 1ZXLA 1X1TA 4REMA 5TEWA 4TKZA 4L16A 4BZQA 2P6RA 2M1ZA 3ILHA 3ZK9A 3J7TA 1KDPA 2CNDA 4F2DA 1QJCA 1D2MA 1SUPA 3P32A 4MOWA 3OQOA 3DOJA 3Q6MA 2Y0DA 2OORC 5ANRB 2NV6A 4FOTA 3UA4A 1NVTA 1USVA 2DKOA 3EPRA 3OZWA 3PUKA 4EHBA 5I9NA 2PSSA 4A3SA 1WY5A 4ER0A 4MROA 5D2CA 1F8UA 1F3OA 2ZTLA 3HO6A 3AJAA 3WYFA 4AJ2A 2B94A 1LRKA 3JR3A 2GARA 721PA 2B9VA 5G41A 3DONA 1DV1A 2R7KA 4OSOA 1NXTA 2ZFUA 4LJSA 2IPMA 2A1UA 2NZXA 1DC5A 4FZJA 4RMJA 3CEJA 1BMFA 3JZIA 5FCDA 5TJHA 2D00A 4UTPA 5JS8A 4Y7CA 2BAGA 3MWJA 1UOPA 1YVDA 3JZMA 1L7QA 5AI6A 5DBEX 5LP6B 5ALKA 3R23A 1KMHB 4FQ8A 5CB4A 2YHUA 3JQ9A 5TDHA 3WVNA 1ISPA 5A1TA 1TRHA 3AKYA 3HSSA 4FX2A 1NV9A 1UWVA 2IVFA 4O4JF 4YQEA 1ZJ6A 1ZWLA 1B3RA 1NP3A 1YB4A 2ASVA 1LSSA 2H3HA 2LKDA 2M6RA 3Q3CA 1DDOA 1L5RA 2HZ7A 1OFIA 2IP2A 2EDCA 3GEPA 1IZ7A 4I1IA 2JHAA 1SU6A 4S1PA 5IAOA 3OLQA 1RHJA 5LDDC 4ARIA 3PDCA 3HR4A 1L8AA 3KDSE 4TRNA 4DR4B 2G76A 2LWIA 1G1MA 1YI1A 3FYHA 1L5SA 3L8GA 3PC2A 5I8ZA 5GZ6A 4R2WA 4S05A 2ZXUA 1I94B 1IVSA 1G8SA 2J4DA 3U3DA 2VJOA 3J81A 1U99A 3PHGA 4LJAA 1Z6AA 1N0UA 4PC6A 3T52A 1JRLA 1GU1A 2NU9A 4OHKA 4TS4A 5IYZA 3RYFB 3NKFA 2DU8A 3SVLA 5AKIA 3U3RA 3G2OA 3NJ4A 3ZWPA 5C7LO 3HK2A 1E2LA 3DOHA 4UC0A 2BFFB 5FNVF 4UQOA 1FUIA 3H4IA 3TOSA 1RPTA 2D5BA 3TTSA 3A4IA 3OSZA 3Q8XB 3NUZA 4DCPA 4IRUB 2Q8PA 3AW9A 1NYRA 3U4DA 3L41A 2ZSKA 3FCUB 1PHPA 3UJPA 4GXRA 3P9ZA 1KARA 3KKLA 1B7GO 3H9BA 4DFDA 2NXEA 4WLUA 4PYRA 5E1OA 4X5OA 3ADOA 1FYFA 1HTTA 3OQBA 4HAZA 3SZRA 5BYAA 1HQYE 1A98A 4CL8A 4EPTA 3UJCA 4AXBA 3MWDB 3F6CA 1A9QA 3ZBQA 1ZI9A 2FSIA 2E7ZA 2J9XB 1E1QD 3KKEA 4KN5A 4OATA 4AROA 2ICAA 2YMQA 3ENKA 3HB1A 2Y0CA 3ITNA 2BFNA 3NOXA 2F43B 5A2QA 4RZQA 3EFBA 1LWNA 3AP3A 3TRFA 1A2KC 2JASA 5DBGA 4DJFC 3UNXA 3SQOA 2C4TA 2FW7A 3EMBA 3MEQA 1T25A 4PHHA 3SP1A 4UXJA 4HBGA 2XOKA 4FB4A 5DU2A 2VDWA 3VSDA 4TVKA 1L5WA 3D3WA 3H13A 2ZJ0A 2WJ4A 4F4UA 1WF6A 1U3UA 2R1ZA 3NWEA 3C8DA 4MAMA 1LNQA 5AWFC 3G2QA 3WGZA 2IYXA 1K7EB 1AMNA 4KXVA 2WF9A 2R5FA 4O33A 1T8YA 3C5EA 1ZI6A 2QTCA 1A76A 3VNAA 1QGZA 3I4CA 3L7OA 3VTAA 1L1FA 4JEMA 3BX1A 4CM7A 3NV7A 3GN2A 3PEUA 2J3IA 1JZQA 3H5LA 4URXR 1IY8A 4JCOA 1YOVB 3ELWA 1H0KA 1TB4A 2BRUA 5AXAA 4JKYA 1DSSG 5JC1A 2UUPA 1FE8A 2FEWB 3Q4GA 4A8HA 5CFMA 4GOND 3HCEA 3OZGA 2CE7A 2QLNA 4TTIA 3E1KA 3VDXA 1QKIA 5ENDA 2IS4A 3IKJA 5IN4A 2TMKA 2EGUA 2HQSA 2ZRQA 3GFTA 1WDWB 1UKBA 3G2HA 3Q11A 1P0PA 3B8HA 1AHPA 1Q22A 3QTLA 4ABTA 2SHKA 1SUSA 4HYQA 1HFEL 3AU8A 1KJNA 2ZR7A 4S1OA 1UOEA 1W0JD 3SSOA 1X6VA 2XCIA 1M34A 1NZFA 4I5EA 4M0MA 4MUJA 4B85A 4WUTA 1I7QB 2WE7A 2DF8A 3HEMA 2V7WA 4YCAA 4EY3A 1PF7E 4BNXA 1OIWA 4LIPD 1QBKC 4C22A 2VH2A 3C15C 1Q0LA 1RWWA 2PUVA 1W47A 1E2JA 2R97A 3N39C 3PCXA 4M0PA 5FBLB 2CDNA 3AESB 3W8FA 1C7QA 1NN3A 5IC4A 3L8HA 3MS4A 2G5CA 1W5AA 3LP8A 5HMLA 4D9EA 4MP3A 2AKEA 2HMUA 2IUTA 1SXJD 5I45A 2D6FA 4M60A 3PNQA 3AG6A 3B38A 4ESEA 4ZOLA 2YL2A 3UMJA 4RD3A 4KN9S 4PANA 3LQFA 4YMTA 4M7RA 4PX9A 4M76B 5IJWA 2W58A 1BG6A 5CXXA 1KI2A 2ZUDA 2BELA 1KPIA 3IQGX 3N8DA 4YAGA 2A9PA 5EJ6A 3AI3A 1K66A 2W7TA 5FPKA 4LXYA 3CPEA 5KVAA 1TZ2A 3MWEB 3ZY3A 1I9GA 2BL4A 5KJEA 2GFHA 2Y93A 2G25A 5DT2A 5EZSA 4RJJA 3O1JC 2V97A 5I7WA 3IO5A 4OK5A 3KHSA 1INLA 4TGLA 4Y2SA 4Q4CA 2BIFA 3WTBA 1QF6A 1SGWA 4BFXA 3A36A 3M8KA 4MS1B 2OHOA 1DLJA 5CX1A 3NRBA 3GUVA 3QLVC 3VR0A 3TN7A 4JLMA 3IDZA 4IEFB 4CIBA 2B7LA 2YC4C 1TLTA 4JLDA 5BRAA 4BYGA 3QV2A 1QF7A 5DHSA 3R3UA 2P1RA 3AEUB 1P9LA 4LZAA 5EJGA 2Q4RA 3AUXA 4GL2A 2Q5FA 4NY1A 1TXGA 3SC2B 1VRCA 3MT9A 3UOGA 3IEPA 1PEDA 5BXQC 5EJEA 2NO6A 1V4BA 1JIKA 2FWRA 2ZPTX 4N5NA 5FDFA 5LFAA 5EKXA 4CCAA 3H0CA 2WM9B 5K99A 4M1WA 3VR6A 4RTLA 4FFSA 3V1YA 3LCUA 4XR9A 3DOCA 1EXNA 4ASUA 1IDN1 4NBSA 3OQJA 1N5DA 2Q1WA 4B47A 1W88B 5F9HA 1RWOA 2BMFA 5D3QA 4J2TA 1OHHD 1PQYA 2AX4A 4D7AA 2VNHA 2N1MA 1SC4A 1HSZA 5ETJA 5JXWA 4BO0A 1P91A 2GCOA 1E94E 1US8B 1XTSA 1WPQA 3L1VA 4KR9A 4GKVA 4M8IA 4DPKA 5JDIC 2UXCB 4A27A 5AM4A 3GMIA 4ZGBA 4JXXA 1T6ZA 4KAAA 1TEXA 5DGTA 5KWSA 1LLDA 1E5VA 3FOFC 1OXMA 2FDXA 1PWHA 4P92A 1WMBA 3K0FA 4B2IA 2VPZA 1L8XA 3GRAA 4M1QA 1GYPA 1AV7A 4RHXA 1JGTA 3CBGA 1XDWA 1WSBA 1Z8NA 3ZWCA 2O5EA 1H8HA 4H2DA 3RFUA 5JMPA 1JG6A 1MO2A 1SVSA 2PA3A 4MVWA 3MHTA 4MJ7A 5FWDA 1UT6A 2JGLA 3AP1A 1N9GB 2Q6KA 3FF4A 1X7YA 1COZA 4C2UA 2Q0QA 5K3AA 1Y3AA 4L2IA 1PG5A 1YL7A 1E1NA 2Y1GA 3DXYA 1T8RA 3IXMA 3NHUA 2QJWA 1IHUA 4DTIA 1Z5UA 2VDRB 2H7XA 1QRTA 3VO2A 1QE3A 2JIQA 2QL7A 4UULA 2HF2A 2RH8A 2H4FA 1TCVA 1L5HA 5GADl 3JD3A 4BC0A 1IJFA 4O4LF 5GONB 3UCXA 1MX5A 2OPBA 3MAJA 3OT1B 5FQNA 1JKJB 2G1PA 3EE6A 3IRUA 3WS7A 2O2IA 1KOFA 4HFRA 2BGGA 4C7MA 3KYCA 2XZTA 3B60A 5LUBA 3NETA 4K6KA 1D4FA 2J0QA 3PKJA 1XZJA 3NH9A 1V9LA 3OA2A 1A9XA 4TT3D 2XTAA 4LHZA 3VAZA 2VYVA 1HEUA 4ER3A 1Y8CA 1EK2A 2CDCA 1OH7A 5EWLB 4C0BA 2FZ4A 2PMDA 4AN4A 2C8VA 2IKQA 3H2GA 1ZU4A 3AF3A 5JPDA 3M89A 2JHPA 3QOWA 1E0SA 3AHGA 3OLXA 1I7PA 4CLRA 4TLAA 4B2YA 4IDBA 5CBPA 3TX2A 4AUKA 4C4SA 1D5WA 3K73O 4BE4A 4ZVMA 3WK5A 1R88A 4BMSA 1OBCA 4LISA 2JNWA 4E33A 2IV2X 2M32A 2GILA 1Z45A 2I1LA 3LE8A 4HR7A 1E58A 4YCMA 4LECA 4P5EA 3S5JA 2QX6A 1OY1A 3ASVA 4B81A 4MP6A 4BRSA 4EMBA 1OB2A 4Y8VA 4MO2A 5IVKA 4W82A 1FMLA 1RBMA 5TQ0A 4Q4DA 4JGGA 2AW3A 2I6FA 4R9NA 5EQFA 1V0JA 1I51A 3GGCA 1GU0A 1D6NA 1MC4A 1MIOB 2ZRGA 3PWTA 1FS5A 1R37A 3ABQB 3JTEA 3G8YA 4JYAB 2WZQA 5E6RA 3MJ4A 2JI9A 1P2VA 3EXHC 4CT0A 1W8DA 3UA3A 3VAYA 3PUIA 3DL2A 3EIOA 3NHKA 1IJKA 1SU4A 1A4RA 1G20A 3J80A 4IZOA 4B74A 2XE4A 1DTWA 3LOUA 3QELA 1MEJA 4HWPA 5KYVA 4GI5A 3CF0A 2ZUUA 2ZIWB 2QGNA 1DKMA 3RG2A 1W6RA 1QFSA 2I34A 2LD4A 3MIZA 2PJZA 3U44A 4PLPA 4NCAA 1KRHA 3VKHA 5HNKA 2XXJA 4MUMA 1CUBA 3MGAA 4H35A 3WRXA 1KYYA 4HLUC 5KQRA 5KJFA 3PTZA 2CY0A 3G79A 4YP6A 5BO5A 1PFQA 3G13A 4P4GA 2NU6A 4ZO8A 5ALSA 5CDGA 1EINA 3FTDA 1LTKA 2GBIA 5FUXA 5L53A 1K6IA 2JH9A 1M1NA 3GFFA 4RHTA 3B2NA 4LZPA 3C39A 4P38A 3VTZA 5E8JA 4LVOA 5JATA 3CT6A 1ZL2A 2BSXA 2A5YB 1OZ0A 3G2JA 2VRNA 3RLIA 3VR3A 4PC7A 1PNQA 2B6NA 2M1XA 4WK0B 1U9ZA 2J6CA 2JVIA 2Z2KA 5E2AA 5FI0B 3RS7A 4WERA 1A2OA 1C81A 2FZ5A 3ZC3A 3KXLA 2IEAA 3ETJA 4MGYR 1CZLA 3I5MA 4Q7EA 5EKSA 5FFNA 5DGHA 3MJTA 4JHXA 3AETB 3TOCA 1B93A 1E5TA 1WBBA 2DBVO 1NW6A 3SKVA 5EJ4A 3E1GA 5FWXA 2PSHA 4CU2A 2IHVA 2PGNA 3N2IA 4JQYA 1X42A 2BGLA 2P75A 3G6WA 3HN6A 2UVPA 4IRXA 2YXPX 4D9FA 1KK2A 3AL3A 3HUDA 1SKQA 4QEDA 3K0BA 2AJDA 5AKEA 1JHYA 1G5PA 2I3BA 1QTIA 2GEFA 5ESRA 3ZJ5A 4IHAA 4E11A 4EA6A 1XMXA 3MUNA 4IJVA 4B8YA 4F45A 1ZD5A 2RFLA 4IWNA 1NGSA 3M6FA 4HLDA 3DVQX 2CCGA 1U2GC 2FPKA 4RTJA 1L5KA 2CNWD 2DWPA 3KJHA 2KPOA 1P39A 1XVIA 4BPRA 3I2GA 1XX6A 2R7NA 3GI1A 2BTQB 1OLUA 3BBPA 2COUA 4INAA 4JA2A 2R6DA 1EMDA 5EN4A 1FLDA 1NQWA 1KPHA 1QO9A 4RK6A 2UYQA 4MQFB 4X7BA 3X0DA 4C6RA 5J4HA 3B7WA 1G8FA 3T5BA 4ER6A 3H5AA 4NONA 4KH1A 2PEYA 1CUAA 5BT9A 3RTAA 2FUG6 4BLRA 2FEMA 1UPCA 1KP3A 4RFLA 4E5DA 4EB3A 4I50B 3RTCA 2W2KB 2ZJ2A 4HLQB 1LX6A 3TXAA 3DE5X 2C9OA 3EY4A 5KREA 3FRJA 3VNUA 2BR4A 4LZJA 3NFYA 5FFMA 4JEIA 1QH8B 2I54A 2RBKA 4LYJA 1JT2A 3PS9A 4LN1A 4OP3A 2GETA 4PAOA 4WV3A 3Q8MA 4ZFNA 3WLHA 5JWRA 3T12A 4H7DA 1BJRE 3I30X 1YQEA 3IAHA 4BJHB 3JAWB 3IS3A 4URFA 1YB1A 3TQCA 3BIWA 5AVWA 1BX1A 1BEZA 1Z0JA 2QVXX 2H1LA 4CV0A 5JH7A 3GUZA 2OMKA 4H0FA 1W19A 4QFMA 4ZYZA 5HK8A 4A2QA 3REFA 4V0ME 2I7CA 2IOQA 2QT1A 1PR4A 4TLCA 3UOWA 4BKOA 4WLFA 5FAKA 4AP5A 3QUCA 1J42A 1TUGA 2RHMA 3QUSA 3C1AA 1GCIA 4NZMA 3SM9A 4C06A 4EHNA 4ZZ0A 1PZGA 1QKKA 3EYWA 4MVJH 4NCKA 4X93A 4MI6A 3UANA 1ADJA 3DV2A 1OTYA 2OFFA 2W2OA 4ZU1X 3VU0A 1P77A 2BFOA 1ST3A 2C2GA 2D2EA 2DPYA 4MV9A 10MHA 3CUEF 3DLPX 4IO1A 1C14A 1QWSA 3D2CA 3WLJA 4BGVA 2C8JA 1R0CA 1SELA 4LI0A 2EOAA 4OMDA 5D7BA 3ASYA 1JEYB 4FT2A 4UPEA 1IJBA 5J23A 2FMFA 1E7WA 3GO4A 5ECYA 2NUAA 3GJTA 5C1BA 2O8EA 3NS7A 3B7PA 4H59A 4LQ4A </