3JQCA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-6-bromo-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidine-5-carbonitrile (ju2)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 94
structure length 249
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqcA00
2BD0A 4BL5A 2CF6A 2IEDA 3H6KA 3T7CA 3I52A 1B7GO 1K6IA 4ND3A 1GQYA 3VZSA 4AJLA 5A5FA 2Q2WA 1RM4A 4K1LA 5KJ1A 4CM4A 3RBXA 2NQTA 3C1AA 4P38A 3WGQA 3IDSA 4J1QA 4W9NC 4J7CA 4W6ZA 5KCZA 3WR5A 1CWUA 1DSSG 3UAGA 1PJ3A 1KVSA 4E5MA 4UVIA 2PKQO 1NWHA 3GNQA 5FF9A 4EBFA 4JJFA 5EERA 4R54A 3P2OA 1DLJA 4HADA 4TZTA 4BNMA 4LISA 2WEKA 3PYXA 4DQUA 4KOAA 2CDCA 2ET6A 1HDZA 3WXBA 2NVWA 4OGWA 5CPFA 4Z0PA 3MJVA 1ZK1A 5COQA 3S2IA 1DHRA 4R16A 3ICCA 2GZ3A 4JP3A 3AOGA 3TF5A 2JD1A 1YL5A 5ITWA 5KWEA 3GAFA 1GFSA 4FR5A 5ICMA 4OKIA 5U4QA 4AVYA 4UEJA 2UAGA 3K5PA 4TRRA 5EQDA 4FC7A 1J49A 1KY5A 3FNFA 4P4NA 3WGIA 5F1KA 2VHZA 3OECA 4YPOA 1D1TA 1DAPA 1T2DA 2DU8A 5EMHA 2R00C 3VH3A 4GSLA 5G2OA 2CDBA 2B5WA 5GZ1A 5I7SA 3SC4A 1CERA 1MLDA 3D4OA 4WNIA 2C5AA 4HFRA 3BA1A 4AJ4A 3HB4X 4RO0A 2PKQP 5TF4A 2XXBA 1V6AA 4PRKA 2QQ5A 1IZ0A 5T8KA 2WJPA 3JQAB 3GNSA 3TOXA 3ZWMA 1IE3A 4MVJA 2D59A 2G82A 2NUAA 4E12A 1X14A 4I9HA 3L07A 5LDGA 4HFMA 4ZN6A 1SOVA 1MC4A 2VTDA 2EP7A 3WMXA 1YVEI 1W6UA 1NXQA 1RM3A 4OSPA 4XZ3A 4BNLA 3HN2A 5I8ZA 5JLAA 4RF2A 3RC9A 1G0NA 2EHDA 4J7UA 5KIAA 1G0OA 1C0IA 1MX3A 1Q1NA 1W8DA 1X7DA 1LDGA 3MTJA 4BV8A 4RF4A 2FSVA 4Z0HO 3U5TA 3A9WA 1JLLA 3DZJA 3H2ZA 1ZVMA 5BQFA 1EK5A 4MVJI 1CQIA 1QRRA 4ZGWA 3UH1A 2EG9A 4MIYA 5G0WA 4GLOA 4OOFA 2NU9A 4DMLA 4BQPA 4BKPA 3ROQA 3U62A 2GSDA 1S7CA 3ICPA 4MKXA 4MKZA 4Y9DA 1HZZA 1WLYA 2GUGA 2AE2A 4UVHA 4TRJA 3V2UA 1HE3A 4FOOA 4JXKA 1UXKA 1C1DB 4XQEA 5TGDA 3RUIA 4XYLA 2AQIA 1YRLA 1HEUA 1YQDA 4NBUA 4MIEA 1B3BA 4O0LA 4QQRA 1NX6A 3LC2O 1O95A 4KWHA 4B7UA 3GMDA 1BDBA 1UZMA 4GQAA 5THKA 3BXXA 1N1EA 1Q0LA 4CLEA 1HTBA 1E6EA 4IQ0A 2Q45A 1A4IA 1O9BA 1T1RA 1E7MA 2J3KA 3RFXA 3DFZA 3PVZA 2AEJA 5ITVA 1BHSA 1Y5MA 2CVOA 2Q1WA 3CKYA 4K6CA 4YAGA 3OQ6A 3E48A 3QJ5A 2DTXA 1NQOA 2X9NA 3R6DA 4JP2A 4FJ2A 2VT3A 4IBOA 3UCEA 3QLJA 1VJTA 1HDXA 1MUUA 1ULSA 2Q2VA 3O26A 4IGFA 3FNHA 2B35A 4CLDA 1P1FA 2HMWA 3E9QA 3GLQA 1ZW1A 5FYDA 1U28A 3ZWAA 2JKVA 3TZKA 4IDBA 1LQTA 4UAGA 3SC6A 3V8BA 1HDYA 1XEAA 4MVJD 4D79A 2D3TA 5U9CA 1CYDA 5JY1A 3U49A 2PD3A 2BKAA 3DHEA 4NFHA 4WOJA 2DVMA 1ISMA 2YHIA 4UUOA 5JAQA 3W6ZA 1PSDA 4I5FA 2XF8A 2PZJA 5EJ2A 1EDZA 3L0DA 3A4VA 4KDEA 5I8WA 1NR7A 3SVTA 4OIMA 4BO0A 4CV2A 2BELA 3HG7A 3PIIA 2P4HX 4URFA 2JCVA 4WPGA 4PCVA 4CL3A 3S2FA 5GMOA 3RUEA 5JDCC 5JMPA 3ETDA 2EJVA 4XRGA 1C14A 2UV8A 4D41A 3RUFA 3HADA 4R1NA 3PHJA 1GZ3A 2R2GA 1MV8A 2J5QA 2BFOA 4WGGA 4U0KA 3E5RA 3V1TC 1W73A 1D7OA 1NVTA 2B36A 5F3RA 3ZV3A 2G17A 4B4VA 4PGFA 3U0BA 4BO7A 1CF2O 3AY7A 1GZ6A 5JAMA 2YHIB 3AOEC 2DUUA 3OJLA 4K6FA 1SO8A 1L7EA 1KIFA 3GGGA 1DPGA 1E1MA 4BMNA 2Q1UA 2YDXA 4AICA 3AI3A 3ZW9A 3FNEA 3NEPX 3NUGA 3V2HA 2Y99A 3C7AA 2ZTUA 3W6UA 4YT5A 5DP2A 3AY3A 5ENVA 1GYQA 1XKQA 2HU2A 3GDGA 4YJHA 2C20A 3FN4A 2DT5A 3C1OA 1Q7CA 3QVXA 3INGA 5KVQA 1CEQA 2V65A 1XDWA 4DIBA 3DZFA 5I7VA 3KYCB 1A27A 3DZHA 1UXJA 3JQBC 4ZRNA 2P9GA 4N54A 5JMWA 5IN5A 1P0FA 1MFZA 5DDIP 2C0CA 1SEVA 2Y0CA 3FR8A 4GSKA 5EN4A 3NTQA 3JYNA 3WSVA 1YL7A 1PS0A 1I3NA 3L9XA 4XGIA 1ENPA 1KYQA 2W2KB 5EIOA 2PWZA 2W98A 3DOOA 3GT0A 4XKJA 1ULUA 3ZWVA 1Y8RB 1ZEMA 4IGEA 4AJ2A 5A4DA 4CV0A 3Q6IA 4CR7A 3JQ9A 2X5KO 4DREA 5F5LA 4YJHB 5CEJA 4Z0TA 1IY8A 1LEHA 2AMFA 2I5PO 3KVOA 5HTOA 3AW9A 3HDYA 4DGSA 4FCCA 1LRLA 2Y1EA 1WZIA 2P91A 3AI2A 3SEFA 1LXCA 3QVOA 1WDLA 1C3VA 4JBHA 3F3SA 2W4QA 2Q4EA 1ID1A 3V2GA 4BO5A 2CZCA 4S1VA 4B79A 1IB6A 3I9NA 1KEVA 2BFPA 2IYPA 1ZZEA 4PVCA 4EJMA 5B4TA 4W9NA 1GU7A 1TVEA 3I23A 4GVLA 1HE4A 3MJSA 3H9EO 4BO2A 3OBBA 3BTUA 5KOIA 3L6EA 1BTOA 4UUNA 2UDPA 3I9JA 4M55A 3NT2A 3D4PA 4IDAA 5EPOA 3EGOA 1NVMB 3NGLA 1UR5A 5KJFA 1PQWA 2X5OA 2HJSA 5G0UA 4ZU3A 4OXYA 4FFMA 3Q1LA 1EE9A 2NU8A 3EUWA 2HDHA 4BNHA 4CLRB 3C85A 1LBEA 1HSZA 3KYDA 1D8AA 3UKOA 2VNSA 2ZJ1A 2JD2A 4YYZA 1PJLA 3ONEA 3UOGA 1Z82A 2PGDA 3RD5A 3WWYA 4DC1A 1YB5A 2AEFA 4K9DA 3JD4A 2H5LA 3S1LA 2WE7A 3RI3A 3TPCA 1VI2A 3ZNQA 2PR2A 5F5NA 3RAJA 2QW8A 2B5VA 5KNLA 2JHFA 4RLSA 2GGSA 3IL2A 2R00A 4ZQHA 2GDZA 2NLOA 4XYBA 3VTZA 1AN9A 4CJXA 1A9ZA 2NTVA 4IJVA 4BNWA 5H83A 4DIFA 1LNQA 4QTZA 4R01A 4RJTA 3F4LA 3WYBA 2YW9A 3UW3A 2VYVD 3ZWWA 1LSSA 4E0BA 3FHLA 2X0RA 4R4JA 3H9GA 3FTPA 3ZWXA 1JKJA 1K6JA 5JYEA 1HDRA 4OM8A 1YDWA 3Q3CA 4JN6B 1JVSA 2O50A 1Y81A 3KYDB 3Q2IA 3WS7A 1R0KA 5BSEA 1A5ZA 2FSSA 2ZK7A 3K92A 3WTBA 4EUEA 4NBTA 3CEAA 1BVRA 1UP6A 2TMGA 1H2BA 1DC3A 1P44A 4ZJUA 2WE8A 4PLWA 1WW8A 2JAHA 3BMOB 1D3AA 4N5NA 1IHXA 3PWZA 2LDBA 3JSAA 1VL0A 2B4QA 3D1LA 3NTOA 1U8FO 3DXFA 3VOSA 5A9SA 1JA9A 4BGUA 2QRJA 5CG2A 2X9GA 2HK9A 5FI3A 1BVUA 1Y9AA 2C2YA 2C82A 2AG5A 4MPDA 3PTZA 2A4KA 3RUHA 1JU9A 1EEHA 3TN7A 1HYHA 3PDUA 1U8XX 2Z5LA 1KBZA 2OL4A 1HSOA 3K6JA 4O59O 4U6SA 4ZQFA 4OQZA 4PLGA 5BSHA 4D3SA 5IXSA 3GEMA 3GC6A 4NJOA 4IDEA 4DA9A 2TMDA 1PZHA 1UJMA 5ICSA 2VQ3A 1E3JA 1YH3A 2NNLD 4BO8A 3EK2A 1KEUA 1EVYA 3MOIA 3D0OA 3PJFA 2EV9A 4GAEA 3PI7A 3W8DA 2I67A 2IE0A 2SCUA 4DBVO 3GQVA 5A9SB 5C7IO 4RVSA 2GPTA 2B69A 5HBRA 1XHLA 4HKTA 4EJ0A 1VKNA 4FDAA 5IF3A 4RL6A 2XOXA 4K28A 4B7XA 4FSHA 3M1AA 4GWGA 1LQUA 1E1KA 1SMKA 3V1YA 2B4TO 4IPTA 1T2FA 5AXCA 1J5PA 3Q9UA 4FFPA 3OIFA 4HNHA 2AXQA 2RHRA 3GRPA 4M8SA 4AJJA 4BGEA 4CV3A 4QT0A 3WBFA 5L7YA 3PEFA 3LF2A 5JNLA 3AUUA 1PZEA 2I3GA 5AYVA 3QHAA 4NK5A 3DZIA 3PRJA 3TFOA 1EUDA 5JC8A 3I9OA 3KSZO 2V6FA 1FXSA 3FWNA 3ADPA 4U0JA 2EEZA 4TQGA 1HLPA 3OF2A 1YO6A 1GQ2A 3NDJA 4TSKA 3X2EA 3ZN2A 3ZCXA 3KBOA 4UEKA 2HMUA 1U2GA 4TVBA 5L4SA 2DC1A 1GYRA 2WD7A 3VKVA 3GA0A 2C2XA 5JFOA 2NM0A 1KVTA 3B1JA 4PZCA 4RF3A 1JDJA 3RKRA 4OL9A 5JXWA 1PWZA 2O7QA 4MDHA 3DAPA 1TXGA 1PGNA 2VUSA 2Y1FA 4BNKA 1RYDA 3A1NA 5JDCA 1GCOA 4CM8A 2H9IA 1I24A 8LDHA 2BI7A 4NMHA 3VVCA 2WTBA 3I6QA 1TEHA 4AJ1A 3NJ8A 4Y6SA 1XIVA 4HX5A 2BFMA 5BT9A 2O2SA 2YV1A 3PPIA 3E9MA 2YQ4A 1XG5A 3VZPA 4MOWA 2Y1DA 4B4OA 5BR7A 1JVBA 3TZQA 3C3XA 3I1JA 3ANLA 2QHXA 4XR4A 3R3SA 4PG6A 3UCXA 1OOEA 3IUSA 4XEHA 3INTA 2XXJA 4CMGA 3RUAA 1H93A 1IL0A 3ZDFA 4LCJA 3PLNA 1OC2A 3FSRA 1DBVO 1K3TA 2G76A 3HUDA 3WGHA 4HUJA 4IS3A 4ZA2A 5L45A 4XDZA 3WJAA 2AQHA 4CM8B 4PFJA 3PJEA 2OBNA 1X0XA 1ZEJA 3S2GA 1RM5A 2ZQZA 4FOSA 3VZQA 4Q3AA 2B37A 5L7TA 4EI2A 3T4EA 5COAA 2WYUA 3TSCA 3RASA 1I33A 3RROA 1M2WA 2Q49A 4J4HA 3WOHA 1Z73A 2V6BA 1M75A 3DTYA 5TC4A 1PL6A 1OI7A 1HKUA 2D5AA 2JFFA 1AGNA 1ZNQO 3N58A 5G4KA 2GLXA 3F1KA 1E0DA 1I36A 5L4LA 1WMBA 4CLHA 1R0SA 4Y98A 2WMDA 3RJ9A 5A02A 1ADFA 2ZTMA 3DBHB 2PH5A 1QORA 2O2YA 1PX0A 4FQ8A 4W4TA 1WPQA 5FEUA 2DBRA 1P74A 3F6YA 1DAOA 5HM8A 3T4XA 3BTSA 1I01A 3M2TA 3B6ZA 4RVHA 1C0KA 3PFWO 4RVUA 4I5GA 5A5EA 5AXBA 1GD1O 1DDOA 2WDZA 1UXHA 4Y6PA 3WX0A 4A10A 2AE1A 3NKLA 2CD9A 4KQXA 2YHUA 4J1NA 4CV1A 4R1UA 4D7AA 3WWZA 4W82A 2P2SA 5G4KB 3DB2A 4AJNA 5TLSA 4IY1A 1Y7TA 1U4SA 3BTOA 4D3FA 4ALNA 4LRTB 4E2ZA 4KQWA 4II3A 1H6AA 2IODA 3NGXA 5B12A 3KO8A 1E5QA 3UN1A 4XQCA 4BO1A 1LC3A 2QZ9A 4IDCA 5DCYA 1BW9A 4BO4A 1HE2A 3GMSA 3JQ9C 4H15A 3DONA 2PK3A 3LT2A 1QLHA 3V1UA 4L4XA 5KTKA 4WNCA 2CNBA 4J49A 4E5PA 5GY7A 5JY6A 3HJAA 1GV1A 1O5IA 4IDFA 3U9LA 5JS6A 3R1IA 5TT1A 1EQ2A 4FIZA 4DIOA 5JC1A 4ALMA 2IDZA 4OAQA 4RQTA 2AQ8A 3QWIA 1P1HA 3PZBA 3WIDA 3GVIA 2HJRA 5KJEA 2OFPA 1U1IA 4NZ9A 1I3MA 3ZHYA 3I9MA 4YTEA 4XQ9A 5AOVA 1VKOA 4E4YA 4XGNA 3W4IA 2AW5A 3IKTA 1O0SA 3D5QA 4LK3A 1JN0A 2HRZA 2AQKA 3QRWA 1WXDA 2EKQA 2Y05A 1UDCA 1BW9B 1IPFA 1SNYA 4CQLA 1LLUA 5HS4A 3OJFA 1YQGA 2O48X 5MGBA 1ISFA 1F06A 3DR3A 3OQBA 4QUKA 2R6JA 3KM0A 5JSFA 4OMUA 4I1IA 3C7CB 3K8ZA 1T24A 4G2NA 2O3JA 2PNFA 2OUIA 2FPIA 3AY6A 3IP3A 3ZH2A 4RVFA 4J16A 1NHWA 4JJIA 3F47A 2JCYA 3PHHA 2DTDA 2PFGA 4RF5A 4TKLA 1A4UA 3GZNA 3IKVA 1NQAO 3GDOA 2PGLA 2NVBA 3RFTA 3ULKA 5THQA 3TRIA 3I83A 4B7CA 4CM4B 1T25A 4YRBA 3CXRA 3EVTA 2B83A 4WK6A 2W90A 1JKFA 4CMAA 1PZFA 3GHHA 3PHLA 3CE6A 1GTMA 1UXIA 1ZKMA 2IRWA 3MTGA 4JBIA 4NH4A 1EUZA 5JPIA 4UEOA 4NR0A 4I9NA 3WTCA 1IPEA 2DBZA 1YBAA 4IM7A 4P22A 5G4LA 4NIMA 3ZW8A 5I7EA 3WLEA 3GUYA 3LU1A 5TS3A 3U4HA 4RVDA 2EF1A 2O3QA 1NQ5A 3RUCA 4QX6A 1DC6A 2O4CA 2Q4BA 4J9UE 2E4AA 3B1KA 3DFUA 3HFGA 1I8TA 2X86A 1I2CA 4XA8A 3CH6A 2O4UX 4R51A 1K2WA 3RIHA 4KWIA 3LT4A 2DTEA 2Q1TA 1WP4A 1ORRA 4NHEA 3GF4A 1R16A 1PJCA 1ISGA 2QRLA 1DIHA 5FFFA 4BB6A 3IQDB 4BIIA 1VL8A 3VVBA 5CEEA 1FMCA 1D4FA 2ZQYA 1E1NA 4JGBA 4IMPA 1ZK3A 3QVTA 4GVXA 2FR8A 1M66A 3DMTA 5ER6A 1ZJZA 4FW8A 4QFCA 3WLFA 3U4DA 1PGQA 3HDJA 3NDIA 4ND2A 2GYYA 4CMBA 2W8ZA 4GKBA 5B1YA 3UUWA 3AM3A 4A2CA 2BGMA 4QECA 4UVGA 2DQ4A 1QYCA 3M2PA 5HRUA 1VLLA 3GHYA 3W4KA 1H9BA 3CMCO 4JNKA 3ONFA 5A3VA 3CTMA 4D3DA 3VHRA 1ZO8A 4YT2A 4FJ1A 4AJOA 4FS3A 1P1RA 3CUKA 5A06A 2XPCA 1MB4A 3PHGA 1U2DA 5BSFA 3HWRA 3NV9A 3JYLA 4L76A 4RQUA 4EW6A 3KEQA 4LGVA 4HP8A 5CEFA 2NTJA 2NVUA 1UP4A 4HFJA 4BQRA 3QA9A 4BB5A 1E7WA 1E6UA 1NPTO 4AJPA 2OMEA 3ZWOA 1KS9A 3PDJA 3KV3O 3GVPA 1XCBA 4M87A 1VPDA 2WSBA 1YXMA 4KMSA 3E18A 3EZYA 5C7LO 1QYDA 4IJUA 3QVWA 9LDTA 2DM6A 3E6AA 1SB9A 4XJSA 3B1FA 3U4CA 1BSVA 5AXDA 3F46A 4A73A 3QSGA 3AM4A 2JFHA 4HBGA 1PTJA 2E48A 1JAYA 1TT5A 5TJHA 3MJCA 1N5DA 1PR3A 3WGZA 2Y93A 4CM6A 1U3TA 4RZHA 1VSUA 1I0ZA 3VDQA 4WE3A 1LU9A 4PZEA 3BZUA 4IJWA 4MINA 4MP3A 4BO3A 3F4BA 4KUEA 5IAAA 5K6AC 1XU9A 4JBGA 5KKAA 3W8FA 3D64A 2FP4A 3AK4A 5DBIA 3ZWYA 1N1GA 3NJ4A 1WDKA 1GPDG 3GOHA 3KSDO 1DFGA 1QV7A 2I65A 5LC1A 2EJWA 2Q2QA 3DQPA 1CRWG 2DPGA 4YEDA 4CM7A 3NT4A 3OSUA 1FDTA 1PJSA 4YCAA 5IDWA 1X1EA 3KRTA 4P4LA 1Y1PA 3FCOA 1AHIA 1HF3A 4A03A 4ND5A 4RDHA 3DL2A 4GMFA 4LN1A 3EHEA 4WCFC 4OKNA 3HN7A 5IFLA 3LQFA 3DHNA 2VHWA 1HDGO 1NASA 4ROSA 1U9JA 1NQTA 1DO8A 3ENKA 1T26A 3LT0A 3W4JA 1QYWA 1WDMA 5H81A 4MVJE 4BMVA 4CUZA 2Z95A 5DBFA 1N9GA 4ONEA 2C54A 4WEOA 1U3WA 4B4UA 2VT2A 1ENOA 4QEDA 3WNQA 3WYCA 2DBVO 3MJEA 7ADHA 4WEQA 5L3ZA 5BSGA 4DRYA 2CFCA 2VZ0A 2Z1NA 1ONPA 1DC4A 3KZVA 1R66A 4OYRA 3K96A 4E33A 1QR6A 4CL8A 3K2BA 5L51A 2LDXA 4EYEA 5TIIA 3DC2A 3DBLA 1UZNA 4LVUA 1KEWA 1O89A 1PJTA 3EVNA 3GRKA 4GH5A 2WM3A 4E21A 1ENZA 2WD8A 3QWHA 5BNFA 3DO5A 2NU6A 1ZSNA 3FF4A 4L75A 5CAEA 1E7YA 1U7TA 1B8VA 1HYGA 4J4BA 4BOYA 2QRKA 5A9TA 3TOZA 4AG3A 2VYVA 2DLDA 1GV0A 2DFVA 3MWDB 1N9GB 1YGYA 1YKFA 3IS3A 3B20A 1SZJG 1KVQA 3HDQA 3RC2A 3WGYA 5TNXA 4F45A 5I7FA 2AA3A 3TNLA 4LMPA 4YBZA 2J6IA 2QIOA 3JYPA 1NFQA 1KVRA 3DAGA 3ZU2A 2AHRA 2J5RA 3NYWA 2FHSA 1J4AA 5F1OA 5MDHA 3H5NA 1CIVA 4EITA 2RIRA 4DLBA 3I3OA 4DL9A 4HNGA 3RC1A 3D3EA 3W8EA 4E2XA 1PS8A 1N2SA 3WFJA 1J6UA 2DBQA 4GLLA 3CIFA 1XQ1A 3KEOA 3IJRA 2RHCA 1LLCA 3ST7A 3FR7A 3I4FA 1PS9A 2GZ2A 5JAZA 3GGOA 3EAGA 4M49A 1EZ4A 3CZMA 1T4DA 5CDGA 4R5HA 4YJGA 3SXPA 3KXDA 2PZLA 4UVDA 4CR6A 1HXHA 3ETGA 2P5YA 2D1YA 3PWSA 2OP0A 3HB5X 3AFNA 4AJKA 3INRA 4NJMA 1QXSA 2GNAA 3OIDA 4Z3DA 4RPGA 3H5AA 3PXXA 1PL8A 4KTTE 3ZU3A 1BGVA 3IAHA 4OHUA 4YDRA 3ROPA 1I32A 3UGKA 3AI1A 1X15A 3F1LA 1DIBA 4PLVA 3GFBA 2HMVA 4KUHA 3WB9A 4D45A 2I76A 4NDNE 4NNJA 3QV1A 4Q3EA 1Y9EA 2D8AA 4PVDA 3MEQA 1P33A 1NNUA 2AG8A 3IP1A 4LVCA 4YJGB 3WJ7A 4FPXA 1R15A 3T7EA 3P5SA 3GUCA 3RSHA 2D0IA 3IOYA 4G81A 5KVSA 2Z1MA 4LCEA 1Z7BA 1AE1A 4EEZA 5TJ9A 4E6PA 3DBVO 2QYSA 3NT5A 3KB6A 2UVDA 4NJMB 3JQEA 1VJ0A 4ALLA 2I99A 1YQXA 3BYZA 3I9LA 1X1TA 2RBEA 5CP8A 3OIGA 1JTVA 4J7XA 4GX0A 4PN3A 4MVJH 3M6IA 3FI9A 4MP8A 4PLYA 4O63O 3WFIA 1YJ8A 1Z45A 2CY0A 5L4NA 3ABIA 3GEDA 3FWZA 3BMCA 2J8ZA 1LSOA 2VTEA 4YQZA 3TDKA 4DPLA 5COBA 2YDYA 5A9RA 2PD4A 1E3WA 2V7PA 4XD2A 5F21A 3FBTA 2A92A 3LC7O 3ASUA 2PGJA 3ROKA 2OGUA 1P3DA 1BXKA 4L0QA 2H1SA 1JQBA 1B15A 3I4CA 4FFLA 4BHTA 3D4NA 3NX4A 4L4RA 1NYTA 4U8GA 4WOKA 1FK8A 4GX2A 2ZB3A 2CVZA 3DAFA 2VHVA 1B2LA 3WYEA 2E49A 2F00A 5JCJD 4B8ZA 4IZHA 3RC7A 1ENYA 4OOEA 1GEEA 4BUCA 1D1SA 1E3SA 3ZHZA 1T1SA 1M67A 3ADOA 4JJGA 4DVJA 1UDAA 4XYGA 3TZ6A 2X8LA 4GGOA 3BMCB 3UVEA 2BMAA 4I08A 4HXYA 3ZNNA 3H9QA 4OO3A 4IS2A 3GVHA 4TRNA 3ZV5A 4Y6RA 3ORFA 4E2YA 3JQGA 4QFDA 5ILOA 1T2AA 1E3WB 2C7VA 4MKRA 2HQ1A 4E5KA 3C7DB 2RCYA 3JQ8A 1YS4A 3ITDA 3KSUA 4J43A 4GMGA 4O1MA 3VAZA 1VE9A 1BG6A 2BI8A 5AVOA 3JQCA 4ND4A 3LK7A 3AUTA 4H16A 1HDCA 4CODB 4W7IA 4A26A 3RBZA 2UUOA 3ZHXA 3P7MA 2ZKLA 4LMRA 2OBYA 3DZBA 4PLHA 4W7HA 1LDEA 1K0UA 2WYVA 3DMTC 4NI5A 3I5MA 3PP8A 4Q9NA 2JD0A 1V3UA 2IXBA 1TT7A 4RPJA 3I6IA 1RM0A 2D5CA 2X0IA 4GL4A 1SEPA 3G79A 2ZTVA 4J9VA 3RUDA 4XWYA 1GCUA 3ITKA 3K31A 4KP7A 4A7PA 1ZUD1 3OMLA 2ILTA 5CDYA 3JQ8B 1PIWA 4ZD6A 3D7LA 2GN9A 3GEGA 3LZ6A 2DUWA 1GR0A 1ML3A 1ADBA 2I66A 3DDNA 4OH1A 4I8XA 4RV9A 4CMIA 1NR1A 2O7SA 3PYMA 1CDOA 5K6AA 4PG5A 4E30A 1P1IA 4BNIA 4YAIA 4AL4A 1H6CA 5HWSA 4AFNA 4RZIA 1GQQA 4L8VA 1PJ2A 4N7RA 1MG0A 4N18A 3VH2A 4IZIA 3TZHA 3E9NA 3ZWPA 5T57A 1HWYA 3LVFO 3QW2A 4M54A 1GYPA 3H4VA 4GKVA 1R4MA 1PU2A 1OFGA 3QY9A 4XB2A 3HFSA 3LYLA 4IQGA 1PGPA 4J1TA 4EUHA 4CLOA 1ZCJA 2BLLA 1F8GA 1UH5A 1V35A 1V8BA 2GN4A 1F12A 3NDRA 1UUFA 2IZ0A 6ADHA 2H63A 5L9AA 4WCFA 4Q3CA 2FPGA 1LRJA 2BRUA 3JTMA 3GDFA 3VPGA 3H9JA 1K5HA 4R69A 4B8WA 2EIHA 1P31A 1P45A 4WLFA 3C1TA 4L74A 1XYGA 1A71A 3E8XA 4R5MA 4DUPA 3JV7A 1JKIA 4Y67A 5JDIA 4A0SA 1V9LA 3OFSA 2X6TA 4IXTA 2WD7B 1VRWA 3JYQA 3O8QA 1R4MB 4E5NA 1VSVA 2ZCVA 3RFVA 3ONDA 4NU6A 1U3UA 3DBRA 4YJFA 2G0TA 1I5RA 3CSDA 3PIDA 3S55A 3EC7A 4NFYA 4P8RA 2C5EA 4BVAA 4WCFB 3RBVA 5K9ZA 1Q0QA 1GL3A 4WECA 3H9UA 3JD2A 5DOVA 2NTNA 3RJ5A 5EESA 4E3ZA 1MA0A 2GF2A 3O38A 3ZZNA 1M76A 1YWGO 2JHGA 4WLEA 4J3FA 2P9CA 5JYDA 4CQMA 5TT0A 3JD0A 3DTTA 1BWSA 3U3XA 4P4GA 4CM9D 3DMYA 4OJNA 4YACA 5IZCA 1DRUA 3DEYX 3DZGA 2YY7A 5B37A 4DTIA 3EDMA 3SLGA 2I3AA 1IOLA 4NQZA 3DBRB 4CM5A 2CF5A 4YJFB 3LLVA 3VH4A 3F5QA 4BKRA 3GPDG 1E92A 2J5KA 3OEWA 4RCVA 2IEBA 4R1SA 1KY4A 1LDYA 4WLVA 2V6MA 2YFHA 4J4TA 4F3YA 1QYVA 3VTFA 1KC1A 4C7JA 3IUPA 5EL0A 2RAFA 5IJZA 1P9LA 3Q9NA 3ZNPA 4DYVA 1DLIA 4M86A 1NBOA 4NBRA 4BNGA 3K30A 4ZICA 3L6DA 2AEMA 3ZHBA 2ZIZA 1UAYA 3ZWCA 4RDIA 4AJEA 1I2BA 3B70A 3FPCA 1PQUA 3ZV4A 1Q7BA 4YVFA 1LRKA 4TWRA 1DC5A 4CMCA 2Y0EA 3H8VA 1YOVA 1E5LA 2DAPA 3FTNA 1FDWA 4PG8A 4ZRMA 4YRDA 1EBUA 3L77A 2PA3A 5JCXA 5A3JA 2HMSA 1ZSVA 4I9UA 4LRSB 1VL6A 5ILGA 4ALJA 4B3JA 3PGJA 3ZGYA 1BMDA 2O3RA 4CR8A 1LA2A 1EVJA 1XSEA 2X22A 1KVUA 2E6UX 3MCVA 3VDRA 3Q11A 2YFQA 3IIEA 4XJTA 5LDHA 3HDHA 3FPLA 3CINA 2POQX 1LSUA 4OSOA 4LSWA 1V3VA 4B3HA 4ZVVA 3WIEA 2W2LA 1P77A 2EKPA 1MC5A 1WVGA 1YOVB 4KDFA 3WGTA 3AM5A 3LSYA 2FOIA 2VUUA 1Z6ZA 3OHSX 1FDVA 2O3UA 4NBWA 4BS9A 2NU7A 4MVJF 5T5QA 1F14A 3E5MA 4R9RA 5DCWA 4MJLA 2V6GA 4C4OA 1E7SA 2E37A 3CPSA 3GGPA 3KHUA 3OP4A 1ZFNA 4DMMA 3MOGA 4DPKA 1ISIA 3E03A 1HT0A 3EW7A 2YV2A 5LCXA 2YUTA 4JLWA 4CQMD 2VYNA 3C24A 4KZPA 1EDOA 1YONA 4WKGA 3ZWBA 4DQXA 2CUKA 1J0XO 4C7KA 4E32A 3OETA 4RGBA 2ZYDA 2NADA 4J2HA 3GY0A 1OC4A 1SB8A 2FN7A 3JQ6A 1ARZA 2HO5A 5ES3A 4BNNA 5B4UA 5FWNA 4WJZA 4GI2A 4G65A 2XAAA 1HZJA 2GERA 3LC1O 4RVGA 4FGWA 4GX5A 4QO7A 1X7GA 3TFQA 1WZEA 2HCTA 5DF1A 2F1KA 4FGSA 5DCUA 3UFXA 4CQLB 5I9LA 4TKMA 3QWBA 4Z3KA 3ENNA 1ONNA 3JQAA 3RKUA 1I3LA 2GD1O 2GCGA 1FF9A 3DWFA 4U7WA 3TJRA 1IZ9A 4U6QA 3JQFC 4YB8A 4RPHA 3RWBA 4UREA 2VOEA 4BNUA 1PJQA 3GNTA 1BDMA 4FFRA 4J1SA 3AUAA 3L4BA 3EZLA 4A27A 4CPDA 2VUTA 3GZNB 2UUPA 5DNAA 1X0VA 2X0JA 1C0LA 1E3IA 3WG9A 4J0EA 2ZYAA 2EP5A 2EW8A 3H5RA 3ANMA 1ADGA 1LDMA 1N92A 2ZYGA 3GK3A 1DFIA 4N5LA 1DFHA 4JK3A 2VCYA 1VM6A 5EQFA 5CDUA 1YBVA 2D2IA 1LDBA 4O6VA 1YDEA 2HKIA 2Q1SA 4IIVA 5IN4A 1ZIDA 3WSWA 2OP1A 1XELA 1MG5A 4R3WA 2PLAA 5L95A 2FR0A 4IXWA 1GEGA 2W2LD 3ZNOA 2YV3A 3ASVA 1YL6A 1F8FA 2O3SA 2VWHA 1EUCA 5L7WA 2P68A 1FDSA 5ADHA 4YAKA 1LI4A 1NPDA 2IXAA 4ND1A 3BTVA 3N74A 3FNGA 4DXHA 1Y6JA 4II2A 5JAIA 1F17A 1MXFA 3S2EA 1C1DA 3AFMA 4WLNA 1PJBA 5ENDA 2EXXA 1HRDA 4BO9A 5DULA 3K2EA 1JAXA 3GN1A 1L7DA 4IINA 4NU5A 3QE3A 1O94A 3NTRA 1NTOA 4KTVE 5KJCA 1ZJYA 1HDOA 1U7HA 1P1KA 2CMDA 2EGGA 2P5UA 3GN2A 4LSMA 2X9VA 3QP9A 3OA0A 2ZCUA 4EDFA 2VYND 4HFNA 2O23A 3GPIA 2Y1GA 1SC6A 4PG7A 4R9SA 3JQ7A 1I3KA 1Z74A 3O03A 4FFNA 4XQGA 1L1FA 4ESOA 3KLPX 4EUFA 2CSUA 1PL7A 2HMTA 1NAHA 1IHYA 4I5DA 2GN8A 2X58A 2QX7A 4UVEA 1EK6A 5DBGA 1B26A 2VHYA 3K73O 7MDHA 1M6WA 4TZKA 4IDDA 4Z6KA 1OAAA 2EERA 5KKCA 2ZB7A 5HA5A 4DPMA 1IULA 4BNJA 3PQEA 3P2YA 3G17A 3JQAD 1XWFA 4FFOA 2H6EA 3TZCA 3OJEA 1E1LA 2PV7A 4Q3NA 3OJ0A 4I5EA 1T2CA 4OXKA 4WCDA 4WLUA 4XX0A 1SOWA 4YQYA 1ISJA 4Z9YA 3I9KA 2NVUB 3OQ1A 4ALIA 1CJCA 1EVIA 5CHEA 3JQ7B 2BH9A 5JE8A 2CDAA 1N8KA 1T4BA 1CQJA 2C59A 1M6HA 2EWMA 2PH3A 3MJ4A 3IJPA 3AU9A 1E6WA 4ZQEA 5IDQA 3QWFA 4D42A 1DJNA 4XDYA 2HK8A 2Y0DA 1RKXA 2C07A 3ETEA 4XYEA 1HE5A 1UZLA 1SCUA 1TT5B 3GVXA 1EQUA 3OJOA 5C3MA 1HYEA 1R37A 2X4GA 1ZMOA 2FY8A 2VNAA 2G5CA 4J91A 2OOSA 2FPPA 5I9MA 4PLTA 3VPHA 5A05A 3O9ZA 5GZ6A 4E5YA 3GG2A 4GWKA 3WNVA 2EGHA 4XRRA 1LDNA 3D5TA 1TA4A 3VKUA 5J23A 3FBGA 4B4WA 1R12A 1U3VA 5JDIC 4IIUA 4OQYA 5JW6A 5DZSA 4PLCA 1EFKA 4DBZA 1Q2XA 3G3EA 4FB5A 5DT9A 1PEDA 1H5QA 5B4VA 4QXMA 4M89A 4J6FA 3DOCA 5IDXA 4FBGA 3SLKA 3WQRA 2EW2A 4YAJA 2NWQA 4RORA 3KYCA 4BO6A 2GO1A 3TWOA 3AUSA 4PG4A 2OZPA 1GUFA 2G1UA 2VRBA 3U09A 2Y68A 1A72A 3VC7A 5CPBA 4BMSA 5C7OO 1H0KA 3STHA 3ZV6A 2W2KA 1DJQA 2GRAA 8ADHA 2PKRA 3H3FA 4QO8A 3GG9A 1Y8RA 5FI5A 4Z9XA 4D46A 1XLTA 5JO0A 2IZZA 1NFFA 1FJHA 5G0VA 3RQSA 3PQFA 3UICA 3L6OO 5IZCC 3AWDA 1GADO 4AJHA 4DWVA 1U5AA 1ZK0A 1RJWA 3OICA 4N5MA 3WDSA 4BNYA 4PRLA 1QG6A 1ISHA 3ZU4A 3W1VA 4R3NA 3DBLB 1DB3A 2YZ7A 1WAMA 1IYZA 1ZBQA 5F1PA 3M1LA 1MP0A 5A03A 1H94A 2A94A 2NSDA 3JQDA 3PWKA 2VN8A 3KOUA 2HSDA 1DEHA 4CMKA 2DPHA 2NV6A 1PGJA 2UYYA 3PZRA 1QMGA 3ANNA 1GAEO 5JCJA 1AXEA 1G6KA 1LJ8A 2VZ9A 2BF7A 3ROMA 4ID9A 1OZAA 3LT1A 5L40A 4NG5A 4MVJP 4LW8A 3MWEB 3HNPA 4E13A 1C1XA 3HQ4O 2VWQA 4XR9A 1LUAA 2HRBA 1U4OA 4JQCA 1DOHA 4QSMA 3WMWA 3GAZA 5T67A 1EFLA 1YJQA 2OORA 3TQHA 3UF0A 3H3JA 1PJ4A 1UAGA 4CLRA 2C7GA 4ALKA 1B8UA 3BHMA 4Z9FA 3A06A 2BGKA 3FRJA 2Y66A 3N7UA 3QIVA 3U4IA 3VH1A 3EYWA 4O5OA 1UDBA 2VWGA 4IDGA 2GR9A 1ZK2A 1GUYA 4XB1A 2Y67A 4XGKA 3ON5A 3ZU5A 3F5SA 4JX8A 1TB4A 4K26A 1QP8A 2ZTLA 3P19A 4UUMA 1C1XB 4NPCA 4BKUA 3RU7A 4J0FA 3LLSA 4CMEC 1MXHA 3BAZA 4BNFA 1NPYA 4A5OA 4YJDA 2BFAA 5G0SA 4YT4A 4MVJM 1W0CA 1RWBA 4BNTA 5K0ZA 4MO2A 4L73A 2Y1OA 1I10A 3GVCA 1OMOA 1V3TA 3WICA 1H6BA 4F46A 3L9WA 4CUJA 3JQFA 4YR9A 2NQ8A 4BV9A 1C0PA 3A28A 4PLPA 2PTGA 4JCOA 4XYMA 1DIAA 3X2FA 1PGOA 3VPSA 9LDBA 4R1TA 3RU9A 1QYXA 1V0JA 2D4AA 2I6TA 2X5JO 1O6ZA 3BMOA 3BMQA 4NK4A 5H82A 1B3RA 4ITUA 1EMDA 5ER9A 2JAPA 2QZZA 4BGVA 4EEXA 2FZWA 4FD3A 1E3LA 2PY6A 5IDYA 4YXFA 5KVVA 3GFGA 4Y8VA 4KUGA 4M1QA 4TROA 3RCBA 4D0SA 3QQPA 3PGXA 1H6DA 3QWAA 4FN4A 5T6BA 1HETA 2PD6A 3LDHA 4ZQBA 3JCZA 3ZWNA 3IC5A 4BNXA 3H7AA 1ZH8A 2GN6A 3RVDA 5JBIA 1AHHA 3O4RA 3PK0A 1Y5RA 2P9EA 2Q3EA 3E1KA 3ZI0A 4XCVA 1E7QA 2NACA 3BMQB 1ZK4A 1UP7A 4EGFA 3HSKA 3L4BC 4EZBA 2IZ1A 3MZ0A 1SBYA 5IG2A 1EVZA 1R0LA 4FJ0A 3LF1A 5CDTA 1QLJA 4TMFA 1B8PA 1PWXA 1NVGA 4JROA 1PR9A 3BHIA 4TRMA 1A7AA 1X13A 2RH4A 2VWPA 4Q39A 3UHAA 4BKOA 1MFPA 5T8KC 3KTDA 1W4ZA 2ZATA 1GDHA 1E3EA 1NFRA 3H65A 5DP1A 5TRTA 1Y8QA 1IUKA 4GGPA 1OBFO 1RYEA 1DRWA 1N7GA 3OEYA 4G5HA 1P1JA 3COSA 1AUPA 3DZKA 3GR6A 3C8MA 3CMMA 1WNTA 3JQGB 5G0TA 3S8MA 4MIOA 3WBBA 4E2WA 2HK7A 2J3JA 4CM9A 4HV4A 1R6DA 5C5IA 2IYOA 1SAYA 2C29D 4YAEA 1DRVA 4OXNA 3SX2A 1DHTA 3VPXA 1GZ4A 2ZJ0A 4MP6A 4XIYA 2CVQA 1LX6A 1LLDA 5CFZA 3BMNA 3NRCA 1XA0A 5AXAA 3L4SO 4BNZA 4ZQGA 1RPNA 3QVSA 2Q46A 1YB1A 4B3IA 2FR1A 1Q0HA 2O3TA 1Y8QB 2YYYA 4UUPA 2JJYA 3KYBA 4PLZA 1B0AA 2FMUA 4RPKA 1A7KA 4DLAA 4PLFA 4EJ6A 4FC6A 1JWBB 2OO5A 4IQ8A 5TX7A 2J3HA 4IJKA 3K9QO 4D43A 1GPJA 4BNVA 1DIGA 2Q99A 3VPFA 4GX1A 4BGIA 4F6LA 5BNTA 2Q50A 2J3IA 3DOJA 3EY4A 4R68A 1PQPA 4JIGA 1XQ6A 2YQ5A 4TVOA 1HLDA 4CMIB 4PZDA 4YA6A 1KETA 4CM1A 4E31A 2X23A 3BMNB 3PJGA 3UCFA 3BHJA 5GZ3A 5TSDA 1QSGA 4CM3A 3HHPA 4DC0A 5AQ1A 5DN9A 3Q0EA 4WASA 3MJTA 3JD3A 2WWRA 1JWAB 4L4SA 2RH8A 3WQQA 1E77A 1MGOA 4UULA 3WGGA 4CMHA 1N7HA 5IXYA 1ZMTA 2GASA 1WMAA 1NP3A 2VHXA 2VZ8A 2OHXA 1QV6A 4YT8A 5CDSA 2X7HA 3A14A 4INAA 3PFFA 3PYLA 2VRCA 4CLOB 3PJDA 1WWKA 4ILKA 2FRDA 3JD1A 3G49A 4F6CA 1LLQA 5EINA 4YRAA 2HLPA 1R4NA 2JFGA 1AXGA 4RPLA 3HZZA 1BRMA 1NWCA 3CZRA 1NHGA 2VOJA 3HE3A 1B16A 1I2ZA 1EE2A 3OH8A 1YBMA 1LSJA 2JCXA 1EBFA 3G1UA 1Z7EA 3AOEA 3BIOA 1FDUA 2PZMA 4H7PA 4NBVA 4BKQA 4GBJA 1UXGA 4YWJA 5A1TA 1SPXA 4AJIA 1QKIA 2Y1CA 4DYDA 1E7RA 3NAQA 2X0NA 1Z75A 3H2SA 5U1PA 1A9YA 1X7HA 3O8QB 3WGOA 4WUVA 5JO9A 5KVCA 3DBHA 3KUXA 3IMFA 3GH3A 4GPD1 1HL3A 3G1TA 2I9PA 1LC0A 2PZKA 1R4NB 1H2HA 2HUNA 3OA2A 2ZB4A 3JQBA 2QYTA 2DFDA 5BNIA 3GZ4A 3D3WA 1B14A 1P0CA 1T2EA 1TLTA 1YE3A 3E82A 4HY3A 4J2OA 4S3MA 5T64A 4J90A 2EKLA 4U5QA 4HWKA 1BXGA 1VC2A 1VJ1A 2B4RO 3SBOA 5L53A 1DXYA 1K89A 1ZSYA 4DLLA 1O8CA 4ZHSA 4Q3DA 5C37A 3UXYA 4CLXA 3SJUA 2BHLA 1I30A 1DIRA 4IMRA 3AU8A 3G0OA 3R0IA 4CQMB 4WLOA 4D44A 1PZGA 5CG1A 4CUKA 2FZEA 4L9RA 2JL1A 2YJZA 2A35A 3FD8A 5IZ4A 5KJ6A 3KETA 2DKNA 1S6YA 2BGLA 1H9AA 3VZRA 4DQVA 5HS6A 4PIVA 3Q2KA 4D0RA 1NAIA 4XIJA 3PLRA 3AJRA 1ADCA 4MVJG 2QG4A 1F0YA 4NFSA 1U5CA 2P4QA 3EMKA 1ZXLA 3WQSB 3D3WB 3PHIA 3JYOA 3PQDA 1KC3A 3TL2A 1KERA 1ONOA 2X1HA 4Q3BA 4W99A 5DOZA 3TL3A 6LDHA 1BXGB 5TQVA 2ZB8A 4IUYA 2A9FA 1BXZA 3SJ7A 4R41A 2WYWA 1XR3A 5A04A 2GZ1A 1NM5A 1YB4A 1GY8A 3DHYA 2HAEA 1G1AA 2VRCD 2B0JA 4H3VA 1ZXBA 1K6XA 4CMEA 3F9IA 3OM9A 1XU7A 2OXIA 5I9NA 1JW9B 1XGKA 4RLHA 1Q7GA 1LTHR 3V5NA 3KLMX 1GUZA 3R3JA 4CMJA 1KEPA 2FWMX 1KOLA 2E82A 4X54A 1CETA 1TI7A
chains in the Genus database with same CATH superfamily
3CB4A 4BL5A 1JG1A 3K9CA 4MKHA 1U02A 4E4TA 1GRNA 1K6IA 3VZSA 2PQ6A 1PFUA 4K1LA 1AQYA 1GRVA 4MS1B 5KOJB 4AURA 1A82A 1D0SA 1B74A 3N0XA 3EF3A 4EO7A 3AJ8A 3AQ4A 4OHZA 5AVTA 1Y3DE 2QJTA 2B8WA 1FYEA 4C07A 5KCZA 1KZGB 2O1EA 1IXZA 3IAEA 1LK7A 3NANA 2JRCA 3UC9A 5C81A 5C51B 2PGNA 1DSSG 5JZOA 4LMBA 1PJ3A 1KVSA 3H2YA 4LE1A 2WF7A 4UVIA 2PKQO 2DFNA 3THOA 4PXYA 3UB2A 3UUGA 4EBFA 1A2KC 4EYOA 3OCWA 2EX4A 5EERA 4R54A 2ZRCA 1FTSA 1THZA 1Q3KA 4YY3B 1BYIA 1VMAA 4DQUA 4QPCA 4LISA 4OB8A 2ZJAA 2X2OA 1S8AA 4KOAA 1HDZA 2Q9BA 1ZK1A 2P9BA 1WPRA 1QGUA 1E2HA 1E3DA 3QLEA 4R16A 4XLZA 1PD1A 2C4VA 1J97A 4JP3A 3WK6A 3TF5A 2PMFA 1RZRA 2HK6A 3ZCVA 2VXYA 3SR0A 5ICMA 1ZHOA 5FL3A 1FSPA 1O6CA 1O6FA 1AM4D 1SU6A 4KX3A 1KQPA 3FNFA 3WGIA 2R48A 2VHZA 1ECGA 1W5FA 5JSQA 3OECA 2D4HA 4LGMA 3VH3A 1I1NA 1M2VA 3IQEA 2B25A 4JB2A 5I7SA 3LW7A 3K8QA 4QGGA 1BS1A 1ECCA 3CUEF 4UKDA 5DN6D 4WNIA 1BH2A 4P9NA 3CPHA 2X8JA 3ANYB 3BM5A 2BISA 3V2HA 2RGAA 1WZCA 1HFEL 1TTPB 1FC0A 4HNVA 3KLNA 2O8BA 2GYUA 2M6SA 3KHKA 3ZXSA 4EG3A 2NT3A 3PNKA 4AMZA 4EPYA 1IZ0A 2WQ6A 1Z4MA 2OCIA 1VYUA 5E9WA 3C74A 3AVOA 3JQAB 3TOXA 1RQNA 4F4FA 4I8IA 4YRZA 2HEIA 1IE3A 3I01A 4MVJA 2D59A 3STVA 2G82A 1A50B 4OQPA 2NUAA 4BJ6A 4I9HA 1XEWY 4NE2A 5DLEA 4HDMA 4HFMA 2DKOA 3GV0A 4JUBA 5FI1B 2D5LA 1MC4A 3GFTA 3BXHA 3C6YA 2OHFA 4GPZA 4PCAA 1DE0A 4Y2HA 4JT4A 3BXFA 5H1YA 5FULA 4L16A 5IK2A 4X1YA 1NXQA 1CU1A 4XZ3A 5TEVA 3MILA 3D6FA 4BNLA 4NENA 1V39A 5I8ZA 1G2OA 4U5XA 2YCBA 3I8OA 4RF2A 4DZRA 4EK9A 1XK6A 4ZZ0A 4LHWA 3WBKA 721PA 1P9RA 1MKYA 2H5JA 4P08A 5AHRA 1NW4A 3NHMA 4NMMA 3SHFA 1L8LA 4FFVA 2ZT6A 4L15A 4LYEA 3K9BA 4UHJA 2NO7A 3IRVA 5GM2A 3X43A 3BWDD 3BT7A 3L7MA 1RWNA 5DYWA 4FEAA 1UOOA 2DZDA 1N5JA 4PYOA 2GLTA 2YHBA 1EK5A 3MRSA 5FUVA 1IN8A 1M1NA 1QRRA 2VPQA 2O9JA 3UH1A 2EG9A 5LD2C 1JDSA 1QV9A 3EZ6A 2IYLD 1RHMA 4OOFA 3IUJA 1JIUA 3K1ZA 5CMLA 2NYUA 4IFIA 1ZLXA 4O1HA 2GSDA 1S7CA 4ODIA 3GJ8A 4QHTA 3OZFA 2BTOA 4HSEA 4Y9DA 5EXDA 3TMYA 4MICA 3R8XA 1WLYA 3E1GA 3UO8B 3W5IA 3CR3C 4A0GA 5A7FA 1KWKA 4QTUB 5EP2A 2CV2A 4UE6A 1CUBA 4GOLD 4R83A 4O2AB 3TBHA 3H2JA 1YUNA 3MMPA 1Y6RA 4WN3A 1IVNA 3UGTA 4NMWA 2OEPA 4FOOA 4D9NA 4JXKA 4YP1A 1YA6A 1LZLA 2AKAB 2JFVA 3OE1A 2VJOA 5TGDA 4CTNA 3H11A 3TO5A 1HEUA 1YQDA 3ND7A 4MIEA 1RWPA 1B3BA 4B48A 4FGLA 4G9EA 4O0LA 4JAVC 4QQRA 2ID8A 2QF7A 1L5OA 3U48A 1B1CA 1O95A 1Y1RA 3LC2O 1Z2DA 3GMDA 4KWHA 1BDBA 3EQ7A 4HTFB 4PF1A 2HPZA 4PM4A 4GQAA 4WESA 1RZRD 4U2KA 3LOQA 1YULA 1VSQA 2C04A 3TIGA 4CBVA 3T61A 3RRZA 1XRPA 5IBQA 4NE9A 1A8QA 3AVYA 1O9BA 1T1RA 4DA0A 2FFJA 4KRXA 2CW5A 2IQ5A 1WNFA 3ER6A 1SHTX 2YVKA 3EXEA 4G0QA 4LRWA 4V0NA 3W2IA 4CIYA 5LOVF 4YAGA 3GFFA 3QJ5A 3G0BA 1JDZA 3RYHA 2X9NA 3R6DA 4EZEA 4JP2A 4XVUA 5JXJA 2VT3A 4IBOA 3RAGA 4LSZA 1Q92A 4PQYA 4QTXA 1RS0A 4KQKA 3QLJA 3HWWA 3ZY3A 3EHDA 4EKIA 4JX9A 3VKHA 2FDCA 1CJKC 1MUUA 3O75A 3O26A 4B8YA 5JS1A 2QYOA 4QHSA 1YI0A 4KFUA 1K08A 1JEOA 4Z1MA 4JU8A 1E2JA 4Q12A 4DV7B 2UZ0A 4DKXA 1E5TA 2JKVA 2BGJA 4AMUA 1GL6A 5D3MB 4LDRA 3NGMA 1GFWA 4YBRA 2JNWA 2VZEA 4MVJD 1QH0A 2FSFA 2XMZA 4D8XA 1M1YE 2D3TA 3ZDYB 1KXJA 2PD3A 3U49A 4FHFA 2YHIA 5JAQA 4P3XA 3W6ZA 4FINA 4I5FA 1DAIA 5LQUA 2PZJA 3S5JA 4DIMA 2F43A 2CD7A 1EDZA 1MR3F 1YR3A 4TS3A 4CW7A 4KDEA 4ZEOA 5I8WA 5ALIA 4QYMA 2MINB 4JXJA 3QVVA 2GPWA 4QEKA 2XGJA 1NUHA 4I1RA 3B9PA 2BELA 3GLHA 3MS7A 2P4HX 5ERGB 1MW9X 4RETA 2QM3A 4QOFA 4RZQA 1NVKA 2D13A 3W04A 4F4IA 3RUEA 4L5AA 5JDCC 1QMPA 4QBIA 1DKPA 2IT1A 5KPJA 1JHUA 3EIOA 3GBPA 2I7VA 2FRDC 3O5AA 4BZPA 3BL6A 4I50F 4UBJA 2GUWA 1SVWA 4XRGA 1ECBA 1JLHA 2DHQA 3HADA 3NHRA 4HR7A 3RUFA 2DR2A 1T5OA 1GZ3A 2R2GA 3HKDA 1OXBB 5FBWB 3V8NA 4PE5B 1L4KA 2Y1KA 3G2LA 3E5RA 3TEMA 3EUAA 3WKCA 1N32B 3DDWA 1JQJC 1GTZA 1NVUQ 4IDHA 4KXYA 2FG5A 1Z4PX 3I1YA 4ATNA 5KTMA 2FN9A 5HFJA 4PGFA 4B4VA 4BO7A 3UJHA 1CF2O 3KKEA 1OBVA 3LPCA 3AOEC 1EXVA 1ZDMA 3BRQA 4XSVA 3M3PA 2C4KA 2NPIA 4YROA 1DPGA 2B4AA 3DVAB 3UOAB 2FCRA 5IWAB 2Z08A 1QX4A 2Q1UA 1U3GA 3AIMA 2FEKA 1WSDA 5LLTA 1ZD4A 1ND6A 3NEPX 3HBMA 3RIEA 2VP6A 5F3WB 2VDVE 5DHUA 1FFGA 2AR9A 3NM6B 2OBMA 5K8UA 2DY1A 3UW1A 1XKQA 4YJHA 3QLVC 5KSZA 2J3QA 3EVZA 2XGMA 4V0SA 2G25A 1AQUA 3C1OA 1N5OX 3CUYA 3INGA 1O95D 3NKFA 1YZNA 2Z2KA 3O4VA 1XDWA 1G42A 2H2AA 3DZFA 4IHJA 3KYCB 1A27A 1N8SA 3M5DA 3PGVA 4IRXA 4UM5A 4ZOQI 3WY9A 1OB5A 3EPPA 3AP2A 3D1JA 3LRTA 1W19A 5JMWA 1UJ6A 5DDIP 2C0CA 5JJKA 3MBOA 3TOVA 1XVTA 4AO8A 1BE0A 1J0BA 2D2VA 3EN0A 2AFIE 1Z12A 5E2IA 1CYEA 2VPXA 3U17A 5EIOA 3UUEA 3C4VA 3GT0A 1DQNA 1ULBA 4XKJA 3CT6A 4G8DA 5BO5A 4FHEA 2FFRA 1E2BA 1ZONA 2Z98A 3H2HA 5A4DA 2FAXA 4DXDA 1CBUA 4IVNA 4WT7A 4A16A 1EG7A 3BXEA 3QU9A 4NEGA 4CV0A 2XZLA 3I61A 2O07A 2X5KO 3HH8A 2HHHB 5F5LA 4G0XA 1MC8A 1RHKA 2Z09A 2CVPA 1IY8A 3KXPA 1PT7A 1RKVA 4QUIA 4Z0TA 5C0OE 5DXFA 1N25A 3G13A 3A6EA 2P7IA 4Q47A 3O3NB 1WZIA 2P91A 2X76A 3PNMA 3KKMA 1LXCA 4CTJA 4X20B 1M6EX 1F20A 2EHJA 4BMYA 4LOKA 3L79A 3TR6A 3BGVA 4UBOA 3EVDA 1ID1A 3V2GA 2CZCA 2VF2A 3DWIA 4N12A 1ECPA 4OYHA 1XMVA 2GD2A 3CLUC 3IUNA 4DCPA 4G8CA 4PVCA 1XVAA 2FTKE 1I4WA 1MA3A 1RQGA 2VXOA 1P72A 1HE4A 4DRXA 4IUDS 2WNIA 1NM5C 4QELA 5DX1A 2D1FA 3MSXA 5H9VA 3BTUA 4X5OA 1GIAA 2R8RA 5GIOE 2IY8A 5EPOA 3D4PA 4IDAA 4PYIA 1L7NA 1S2NA 4FWTA 4GKJB 3MA0A 4ND8B 5EXXA 1ZD9A 1UR5A 3B53X 1E1CB 3QKRB 4FGKA 3TGWA 1R6XA 4N03A 3TX2A 5KJFA 5ALDA 3AEUB 3T3PB 2YV5A 1Y7LA 4ZU3A 3Q7SA 4BTLA 1RW4A 4CLRB 3C85A 4P1ZA 1J09A 2IIPA 2F3TA 3SU8A 5HIAA 2HA2A 2XRYA 3L8MA 4OV6B 4C1NA 1GNLA 2YBDA 4DLZA 4YYZA 2RE8A 1N6OA 1GDDA 3HWSA 4R6WA 4I1PA 5CVDA 1JXAA 3WWYA 4DC1A 1YB5A 4EEKA 2ZDHA 3D4LA 1XJQA 3ZXIA 4YLYA 3JD4A 1YZYA 2WE7A 4Q37A 5DIFA 1KJIA 3DE2X 3WNDA 1XLUA 5I3ZA 2BSQA 1AS3A 2XCUA 3ZJ5A 2GARA 2TECE 4NRDA 5F5NA 2QX9A 2QW8A 1JIXA 3D8HA 3P9IA 3RAJA 3L4KA 1VKZA 2W8BB 5JDIC 2B2CA 2BGGA 2ZWVA 1AN9A 3USCS 5C7YA 1A9ZA 5J2TF 2P6PA 4RFSA 2A9RA 2VJLA 4OHMA 5HF9A 2EL9A 2BCEA 1L8OA 1LNQA 1FLVA 1U8YA 1R0YA 2ZXUA 2IA5A 3R6TA 4J3NA 5C5CA 3V6MA 4IKPA 3ZWXA 1JKJA 2QRUA 2VJQA 5JYEA 1VZ2A 1JG7A 4ZV7A 1JVSA 1P75A 1Y81A 3Q2IA 4C0AC 4RIHA 5TVKA 4UFOA 4IW3B 2R6CA 3GT4A 3EIFA 3KPYA 4MRVA 1YZFA 1A5ZA 4S2EA 1B43A 1AGYA 1QF9A 3LOPA 4BATA 1P81A 3Q5DA 1JHVA 2ZUVA 4JQYA 1CS4C 1H2BA 1RPZA 1DC3A 1D2NA 5H68A 5J4HA 2KYRA 3OT4A 5AVSA 3K0EA 1N0UA 3OEEA 3PUKA 1EK2A 2XCQA 1IHXA 3PWZA 4WZ6A 4R8MA 4YRSA 4ZYYA 1S3FA 2VQEB 3PFBA 1OX4B 3D1LA 3BL5A 3OP1A 2PMDA 1CNMA 1XA4A 4CFSA 2QRJA 1F0KA 3V1LA 3ISJA 5AHOA 3LLCA 2WAOA 3TE6A 1WPGA 2FZLA 4U8HA 4GOKA 2AG5A 2AG6A 4P4SB 4WGFA 3AHJA 2ZJYA 1Y5IA 4MI6A 5CNIA 3OQJA 4FMPA 1EEHA 4NQRA 1HYHA 3KVNA 1HSOA 4ZQFA 4OREX 2FQ1A 2QROA 4NCXA 1CF9A 1V95A 2LIPA 5DHPA 4C03A 2Q9AA 3TBFA 1IBLB 4AF7A 3EXHC 3M6XA 2C9CA 3BA6A 3M49A 4IVQA 3R24A 4O4HA 4NJOA 1EUYA 1SPBS 3OTQA 3TD9A 2ZBPA 2PU5A 3SZLA 1W0KA 2HLDA 1RCTE 4GOOD 2IUYA 4GQBA 3QI7A 2Q7OE 3HACA 4UFPA 1EVYA 3CFYA 1C7FA 1SIBE 3PJFA 3QKSA 4ADSG 5JEEA 4EI8A 3LPMA 3VSEA 2IE0A 4D92A 5DNUA 4DBVO 3OPMA 3GQVA 3LIIA 3UHAA 5KYUB 3KQNA 2JFWA 5KOHA 3Q7RA 1XNHA 5K99A 4HD8A 4IAOA 4RAOA 5FAKA 5KWVA 3LL4A 2WJIA 3OO0A 2RSLA 5I7VA 2BKVA 5JHGB 4EHKA 3DV2A 1VKNA 2QE7A 3R0ZA 3PWTA 3TLXA 3AW8A 5B1IA 1DELA 3CRZA 3A3OA 4ZJPA 2OV4A 2VEOA 3RABA 4P82A 3K16A 4LYDA 4Y2VA 4U7JA 4AW9A 1UBRS 2NYVA 4K9MA 2WFMA 1SMKA 4TMTA 3UHOA 1EFPA 2VK1A 1JXMA 1T2FA 3DFKA 1QP4A 5AXCA 1X2EA 2XUOA 1FSSA 2AK2A 1GNTA 2AXQA 4IWNA 5K3FA 2RHRA 1H1LB 2WKPA 2HCJB 3L0YA 4QUAA 4TV8B 4C08A 4CV3A 4F38A 5LZ2A 3C43A 3WBFA 4GOJA 4JASB 3LF2A 5L7YA 3CVXA 1Y37A 1KMHB 3AUUA 1PZEA 5CM8B 1BX0A 5AKYA 5AYVA 4UTOA 3BCSA 4BLUA 2CE7A 1O08A 3C48A 5BUQA 5E6RA 4Z4GA 2OXFA 3OCVA 1JEDA 1XCOA 4GO1A 4IJ5A 5A0VA 2CXRA 5HQTA 5LZ9A 1UINA 5AVKA 5FPTA 9GPBA 3A6DA 3BQNB 2Q3BA 1TO6A 1J39A 1X38A 3FWNA 3FG9A 4ZVUA 1C8VB 4C4RA 4D25A 4Q15A 2EZ8A 2GCIA 1OGJA 1HLPA 1ZA2A 1TIPA 1L7AA 6GPBA 2W6JD 4TSKA 3LWNA 5K20A 1QM5A 3VR2D 4M8LA 3AG5A 1GYRA 1CTQA 1EA7A 1EVKA 2C2XA 5JFOA 2NM0A 7YASA 4Y0AA 3TQSA 1JDJA 3ELYA 4M9RA 3RKRA 1FU8A 1IUOA 1Z56C 2XMPA 3OJXA 2C92A 3A2KA 3S2YA 2Y1FA 5HIJA 5J4LA 4ML3A 2UYOA 4KLZA 1V96A 1U0FA 4A6PA 4OBBA 2HQBA 3DL4A 1IG0A 1XNJA 4KPGA 1VIVA 1I24A 1C80A 1P7ZA 1KYWA 3CGWA 3KB1A 4DHWA 3F6BX 2WTBA 5IULC 3ER9A 3I6QA 4AJ1A 4BEVA 3WMRA 2G36A 5KYTA 3CUWA 3LIPA 3S5UA 6PFKA 3EGDA 2BFMA 3TB4A 1AF4A 3M5PA 3D6UA 1E2FA 2PS0A 1CB7A 3HC7A 2ZUEA 4GL2A 1XG5A 1ACJA 2Q7XA 3VZPA 1MO5A 9ATCA 3LCMA 2HM7A 4CGZA 3C3XA 3N2NA 4JUAA 2R6DA 2QHXA 4PG6A 4AQDA 1OOEA 1PT8A 1W0KD 2GAIA 2HLDD 2OO7A 2BSXA 3SZGA 3OTWA 4BBZA 1NUSA 4WBSA 2WVAA 1WA5A 2F8SA 4CMGA 5BSWA 5GVSA 4JQSA 1IL0A 3ZDFA 4MIKA 3FSRA 3QYJA 3WGHA 5CA0F 3UPTA 3SOZA 4ZA2A 1W6RA 1EJBA 4XDZA 1LI5A 3SZUA 3WJAA 3RNOA 1AQNA 4UQPA 3NEYA 4QOSA 2A0FA 4W1QA 3V1NA 2I29A 1I7DA 2CWWA 2CMHA 2ZGVA 1X0XA 1UM8A 5CB4F 5CFQA 3S2GA 3V3KA 4X6LA 3S8EA 1RM5A 2QE7D 3L7CA 4OQLA 4AF8A 2HA0A 4Z9AA 3U37A 3PEYA 3DVRX 4KAJA 1UKCA 2A5DA 3IVGA 4JBYA 4EFMA 4MQ5A 1ORIA 1NV8A 2AWOA 1DQPA 1PNOA 2BUAA 2Q49A 1U8CB 3A25A 3DE7X 4J4HA 5IYZF 3WOHA 5BQXA 2IHUA 1M75A 2FSPA 2G88A 1JQLB 5F1YA 4MHTA 1PL6A 1BX3A 2AXNA 3EOZA 1JH9A 4U3JA 4YMVA 1AGNA 4TMWA 4RTQA 5KC8A 1AUQA 3F1KA 4ZCIA 5EAIA 3GIWA 1G64A 3IAFA 2OCKA 3L4JA 4Y98A 1ZD3A 1FX0A 5KX5A 1CP2A 2KS6A 4CEHA 3T7RA 1R18A 2JGKA 5A02A 4R31A 3FZEA 2KPOA 4FGJA 3R44A 3K9FC 4M21A 4DWJA 2JFPA 3QMVA 4BLTA 3W9UA 3UH0A 5C80A 5FEUA 3A4IA 3H8WA 4MUHA 1XPUA 2P9QA 3WGJA 4DIKA 4PC1A 1OH7A 1G21B 3AHGA 1EPUA 5ALWA 1DT3A 1BO6A 5B2FA 1CQZA 1Q50A 3CLSC 3IPCA 3MB5A 3QLUA 4QQFA 1DTWB 4R2MA 2J32A 2WYHA 3GEBA 5A5EA 5DNCA 4DR5B 3NDPA 2QLLA 3LFHA 5AXBA 1GD1O 1TF7A 4RGYA 1JFSA 4B6OA 2OCBA 4M8IA 2AE1A 2BI4A 2CD9A 3NKLA 4X3CA 4J1NA 4A10A 4CV1A 4D7AA 3WWZA 5EJ6A 4TZ6A 1K4YA 1W1UA 4CNQA 1JEQB 3DB2A 3LYAA 3LCVB 4G2TA 4MI3A 2MYNA 1U4SA 1S5PA 4KVAA 2H29A 5AJTA 2BVNA 4B6QA 4D3FA 3QM1A 5LQNA 1E5QA 1F4PA 3U13A 5M04A 3A10A 1LC3A 4BRUA 4X00A 1BW9A 2VSOA 1HE2A 4CTOA 2ZRDA 5T4HA 3FGNA 3RVBA 1PG5A 3QXXA 2FMFA 3U4AA 1U1DA 4WX2B 1R5NA 4YREA 1RJ9A 1D6MA 2C9ZA 2CNBA 3JVIA 3MJHA 4HDQB 4RKFA 5GY7A 1V11B 1X6VA 1Z13A 1N1MA 2WUGA 4IDFA 1GL7A 2UXDB 5TT1A 1F2UA 1I4LD 1Q1EA 2W7TA 4COOA 4R9NA 4DIOA 5HUJA 5JC1A 1XRRA 4Q1FA 5JY6A 1AS2A 5IEBA 3F7NA 3A1FA 3WIDA 3PZBA 4HGNA 5AM4A 1T9BA 1RYZA 2OFPA 1OBOA 1UODA 2D3WA 2C4TA 4WFIA 2ECPA 5HDQA 5BVGA 3I9MA 3I30X 1F60A 2ZRJA 1FNBA 1KEZA 1L3BA 1EHIA 2BFDB 3AGPA 4MPRA 1BE1A 3I2GA 4HMOA 1O0SA 4Q1CA 4V1CB 4Q9HA 1GITA 3GJ3A 2O2XA 1TEZA 2QAGC 4EY3A 1VKJA 1XKLA 2WLSA 2BEVB 5FBRB 2L0XA 1LLUA 3O92A 3EASA 5JWHA 3ZE9A 5MGBA 3DR3A 2WWYA 3WISA 1PD0A 2R6JA 5DYTA 2OHIA 4OMUA 1UANA 2AC7A 3OIWA 1JG6A 3KAQA 3ZCRA 3N86A 3ZK7A 2FPIA 1M6YA 2VF5X 1V37A 4RVFA 3QE0A 4JJIA 1F2TB 1N2JA 2JCYA 4LQ4A 3PHHA 4XAQA 4RJ2A 4RF5A 3SAJA 1R9GA 3RV3A 3GLGE 2H2DA 2JFBA 5AW8A 3IEIA 1ZX1A 2IUFA 2PRIA 2NVBA 3IAS6 1V26A 1NZFA 2PL1A 3I83A 3RFTA 3STUA 1T25A 5I9IA 1DJLA 4C2TA 4HGYA 1X19A 1L5HB 2F1IA 3CRNA 3DE3X 1JIIA 2ZT7A 3CXRA 3EVTA 4FEEA 5BV0A 5KQGA 1AV7A 3EEBA 2R1VA 3RK1A 3ORRA 2IEAA 5AKZA 3TNYA 5HE8A 4QUHA 5I9BA 4QZVA 3CE6A 1SBHA 1GTMA 3KT0A 4S1PA 2IRWA 1MRNA 1UIMA 3ZHQA 2G1KA 4JENA 2XA2A 2NG1A 5I7RA 2TS1A 3THYB 3PEUA 4QSHA 1QOZA 1JILA 4Y18A 2QTHA 1ML4A 1PAUA 1UK7A 2DUJA 4JOCA 3RS4A 4A6DA 1BFUA 3L01A 3HP7A 3FRIA 5IJWA 4LZPA 4XGQA 5JAPA 1VQ1A 4J76A 2PIAA 1QGUB 4LCBA 1LVUA 4LZOA 4OXQA 1X87A 1UBKS 2O4CA 4MW1A 3VR1A 3WYFA 4CG2A 2LV8A 2E4AA 3AETB 3DFUA 3E27A 1I8TA 3HFGA 4J75A 2C8KA 1YFZA 1L0BA 3PNBA 5HW0A 4M37A 1U5BA 1U3DA 4NBNA 1K2WA 3MQ4A 4LJ8A 3ES9A 1BHQ1 2TSYB 3BAFA 4BCCA 3TPZA 3ZE7A 3IQIX 5HJ7A 5IT5A 1WABA 4MYCA 4NHEA 3PUIA 1XZPA 3JALB 3L1JA 1O03A 1PJCA 4DB4A 2BM8A 1ISGA 4KO3S 1NJFA 1XEXA 3ETJA 5FFFA 4EY7A 1N3YA 1AK2A 4OJMX 3PDWA 5CEEA 4ID3A 3T15A 4TSFA 2VO1A 4U7DA 4LV5B 1ST2A 4M36A 2ZQYA 1E1NA 3D8SA 3OSZA 4MGYR 2PWBA 4GBMA 1E4YA 4Z4HA 5ER6A 1D9ZA 4Q7EA 3ONNA 1JKXA 3L1VA 4BFTA 2X8JB 3AP3A 1GLGA 4OGFA 3EFOA 3HDJA 2QS9A 3NDIA 2KW5A 4JOBA 4ND2A 4C0XA 4QQ8A 1Y4ZA 1B6TA 2E1PA 2DJIA 1HYBA 1TRKA 3QX8A 4N6GA 4D82A 1UQUA 1V16A 3R5HA 4EOGA 3ESZA 1M10A 221PA 2HWUA 2RGBA 3F6SA 4UVGA 5CX4A 1QYCA 3NYIA 3FH0A 4GPAA 4LI3X 4P83A 2NUAB 2IS2A 2FPOA 3D43A 3GHYA 1H9BA 4JNKA 2OYSA 2CK3A 3M34A 1UMKA 2X19A 3ONFA 4HDMB 4D3DA 1IN6A 4CCSA 4DMHA 1ZO8A 3HUFA 5TY0A 1L7BA 4FJ1A 1JPVA 1QDUA 1GPLA 2GTIA 3IKVA 4FMDB 4AJOA 1TQDA 1J0DA 1XTBA 4X1YB 5CLIA 5EWMA 1ZI9A 1MB4A 4NENB 3PHGA 2HF9A 1J8QA 2XTMA 2G0NA 4QDKA 4DR7B 4Q93A 3D6JA 2CNLA 3HWRA 3JYLA 4L76A 4EW6A 3HVHA 4LQLA 2HT1A 3KEQA 4LGVA 5KYYB 3EPRA 5IRCD 2QZPA 5DI9A 2EX1A 2BFBA 2OCAA 3AJAA 4P2BA 2NTJA 4QAJA 4BQRA 4ZYXA 2I03A 3DAOA 3W8NA 5KDOA 3LUCA 1Q0TA 3NOQA 1EX6A 5IASA 1KS9A 3PDJA 3KV3O 2YJ3A 3C8ZA 4M87A 4A2WA 1VPDA 2F3SA 4EELA 4KMSA 1E9AA 3E18A 5L8VA 1QH8B 5C7LO 1FYXA 1QYDA 4MV0A 1Y33E 4R2WA 5D7NA 2W6PA 1TVKA 1NVDA 3IP9A 3U4CA 4YMHA 2WG2A 4MLZA 3RRMA 3HP1A 1J33A 3F46A 3QSGA 4WY5A 2QRNA 3WK8A 2JFHA 1WEKA 1PTJA 3IPLA 1JAYA 1EVQA 1TT5A 2YIJA 4WSOA 1R9MA 3DOUA 1T1IA 2ZBRA 1LPAB 2YFYA 3WGZA 1Z4QA 1WTCA 1DUVG 2OZEA 4EG8A 1XTSA 1NKTA 4K9KA 1E1DA 5A4FS 1XDZA 1QZTA 3TLCA 1ZM9A 1QYIA 2WJJA 3VDQA 5BW8A 2H5IA 5BYKA 1GNQA 1QFYA 3OY7A 1JEEA 1SRRA 4ARSA 2ZAIA 3EODA 3PDIB 4MV8A 4G0ZA 4JBGA 3AK4A 3OHPA 3DMDA 2XNJA 1HTTA 3HBFA 3I5YA 3BX1A 3GLIE 2GILA 2XNKA 1OXVA 4OP2A 1NONA 4WQMA 1GPDG 1WV1A 1WL8A 3NHYA 4AZ0B 1U9IC 2Z8ZA 3LPNA 4GOMD 2W00A 2Q2QA 3OY2A 2JGMA 4IHJF 4LJRA 3EXEB 4YEDA 3EIQA 3NT4A 2QM7A 4J1TC 4W5WA 4B17A 5IDWA 3TI9A 3LO5A 4P4LA 2PUHA 1WXFA 4TSFD 2P9FA 3B7GA 3ZZ1A 4ZCQA 5JCPA 4QGSA 2H54A 2EQ5A 1VB5A 4QJBA 3WK5A 1SKQA 3RVKA 1FNDA 2ZUBA 2Z2JA 4ER5A 2CB9A 3LXMA 4OKNA 3HN7A 5C9ZA 5HQ3A 2IH2A 5J2UA 2BRUC 3PX3A 3RJMA 3JWEA 2O2DA 1N2HA 2AMLA 3R7BA 4L1KA 4F5YA 1HDEA 1T26A 3AV0B 3ENKA 1E9BA 1X42A 2QMEA 2V9ZA 4CUZA 2I7CA 5EFZA 5DBFA 4L8LA 2XB8A 5CFMA 4CF6A 4N6OA 1E94E 1ONSA 2C54A 4WEOA 2B6HA 2BFNA 3OCZA 3M81A 4ZV9A 4BFSA 4I4TA 3G9UA 4EYGA 3TGPA 3K5HA 2CK3D 2DBVO 4KXWA 1V45E 3BE4A 1TCUA 5BSGA 1HDIA 1OUMA 2CFCA 2VZ0A 2Z1NA 3OQHA 1ONPA 1DC4A 3KZVA 4BRSA 5LB4A 1F6WA 3K1TA 5SZJA 4MUKA 1QR6A 2JKZA 4ZOLA 5L51A 2IPXA 3R40A 1DAFA 1NVVR 3Q9SA 4G9GA 4EYEA 1QQ5A 1Y8AA 3DBLA 1ODJA 1UZNA 2LCFA 1KEWA 3HY6A 2AL7A 2EX0A 3DUFA 4HGQA 5A7HA 2ZROA 4B83A 2D1QA 5EGNA 4E21A 3CRMA 2BM1A 5JH7A 1JEYA 3Q3VA 2XQVA 3TRFA 4R7GA 1YOBA 3L7LA 3FDIA 3GRUA 3DO5A 3Q8XB 3QPWA 4UOQA 3WAKA 4BNDA 1BU5A 4X6UA 2HI0A 5CAEA 1Z8HA 1YTLA 2QORA 1B8VA 1V25A 2A2ZA 3D8NA 2R65A 2OCYC 5JWRA 3KAJA 1G7TA 3LNTA 4ZAFA 4F6RA 1M2OB 1TO1E 1N9GB 2LXNA 3VR0A 1X9HA 2GFHA 2VQSA 2BFEA 1S9DA 3KWLA 4HN9A 5FR2A 4Z49A 1CCWA 1KVQA 3COZA 5GWXA 2X8WA 4F45A 5KVAA 3CVUA 3VDXA 3S44A 5AVZA 1BXRA 3UT5A 4FE7A 4GYYA 1VP3A 4A82A 3NC4A 1VXOA 1FP4A 3VZDA 3ZX5A 1UFRA 2LBPA 5DHRA 1K68A 3HO1A 1DTSA 2MMCA 1AO3A 3M9XA 3NYWA 3CLRC 1SHKA 4F9GA 1IZ8A 3EPKA 3ZJUA 4RKYA 1BOOA 2D0DA 3Q3HA 4JBLA 3K1YA 1CIVA 4JP1A 5EC8A 4ZJZA 4IP0A 1Z07A 3DE1X 5ALHA 1LPOA 1FLAA 4L02A 3W8EA 4OBEA 4B34A 1N2SA 3EEFA 4EHNA 4X8OA 1FRNA 1M9NA 1UM9A 1N5RA 1JBQA 2WAYA 3LQ2A 3U7HB 3HBAA 1O5TA 1W46A 2BKEA 2IXDA 2WNSA 4KK4A 4X7BA 3ME5A 2W93A 3T5TA 3ZD9A 1XYYA 2QUHA 3EAGA 3K8OE 1P39A 3ZY6A 2J0EA 1T4DA 2QENA 4HJRA 4MB0A 4YJGA 3SXPA 1K6MA 1P1CA 1JA1A 1NU8A 1TJYA 2Z9DA 4BX8A 4ZHQA 4FMCB 2NO1A 4CR6A 1EDBA 3WB1A 2VLIA 3U0VA 2P5YA 3GEPA 5B57C 5C1DA 1SN7A 2HMAA 3RV4A 3R20A 3I64A 4AJKA 3DXXA 3NI2A 5JZVA 1QF6A 2CVFA 5HCUA 4RPGA 3H5AA 3R9XB 4PGHA 1VZ3A 1CY6A 1GO2A 1PL8A 3PXXA 4A3SA 4ZV4A 1L4MA 3TDMA 3THRA 4AU1A 3U7JA 1GTJ1 4HEHA 1PLLA 4C4XA 3HVKA 3K0FA 1K7FB 1EDDA 4AO6A 4NNOA 1JUDA 2B61A 3F1LA 3RR2A 2NSYA 3FFAA 4O2BF 3GFBA 3RIYA 3A8TA 2YZNA 4UEQA 2H59A 4WY2A 2CUTA 4RD6A 4D45A 2FZ4A 4OMCA 1WB5A 2ZYUX 2HBYA 1EGAA 4BKUA 2CYAA 3O84A 1PT9A 1Y9EA 3QV1A 5THXA 4AY3A 1NNEA 2F4NA 5AKGA 1U0HC 1NNUA 2AG8A 2VK2A 3FDZA 2RHMA 3TTWA 2P8SA 1Q12A 2COUA 1JNXX 4FPXA 2GXUA 3P5SA 1C9KA 3GUCA 1PLJA 4MUNA 2D0IA 3RS2A 4JUFA 1QP7A 1QVRA 5T7BA 2C5GA 5E95A 2A5LA 1G8KA 1D1QA 2PQMA 3DDZX 1VHTA 3GD7A 2UVDA 2FMTA 4U2FA 4H1VA 4LNUA 3ZD7A 4TGLA 5JALA 1VJ0A 1J8YF 3ZGZA 1YQXA 5KS2A 3BYZA 1X1TA 2ORED 2RBEA 3DMRA 1GPAA 3CF0A 2W2XA 4HATA 2ABWA 3V8QA 1V7CA 3M6IA 3FI9A 3LGXA 4MP8A 3WFIA 1DARA 1R8YA 4QOJA 5EP1A 1E62A 1T34A 2A1UA 3GEDA 3E3NA 2DHCA 4JITA 2J8ZA 2YWDA 1SHUX 3GJZA 3MINB 2QBYA 3HUTA 4XPIB 1M6NA 4YQZA 3TDKA 4OQQA 2I2CA 1MOZA 2A9OA 5COBA 4DANA 5A9RA 2X6QA 5F21A 4QDZA 2DSTA 3DKIA 1JHRA 1BQ3A 1TUGA 1ABFA 2ZDQA 3ASUA 5EUQB 2EW1A 2PGJA 5BOSA 3HXMA 1XMIA 2H1HA 3GPLA 1Z5PA 1H8ED 2H1SA 2XI4A 1JQBA 4N5HX 1H2YA 1JFFB 2WFLB 4BHTA 3DFFA 4COKA 4U8GA 2QOEA 3IKLA 4WOKA 4KNWA 4ZARA 1G20A 5K4GA 3LH5A 3M9WA 2CVZA 1FRQA 1CX9B 3P0HA 4RFSB 2R7MA 1B2LA 2H1WA 2IHVA 2L19A 3B1YA 3ORQA 1GEEA 2Q0HA 4OOEA 4R84A 5DTMA 3TTTA 4E09A 1ILEA 4RSRA 1E3SA 2Y0PA 3ADOA 4JJGA 1UDAA 5K0EA 4N0PA 2X8LA 3UEOA 1X7YB 3SHTA 1JFTA 2GB4A 1Q15A 5ALSA 3HCFA 2YWEA 4IS2A 2ZJ5A 3Q10A 3SIXA 5EHQA 1Q83A 3I72A 3NWOA 2DEUA 1U0LA 2M1ZA 3U4QB 1R0RE 2P9ZA 4QWMA 4Z7NB 3N1UA 4HEA6 1E3WB 1EUQA 2BE9A 2EFHB 3DULA 4FHDA 3WGUA 2FWAA 5EMMA 1O97C 1U63A 3ITDA 3W06A 2AFHE 1QGYA 1K9SA 2XE7A 4ER3A 2ZSEA 1QHHB 2PLNA 3CT4A 3M70A 4Q6BA 5DEOA 1PR2A 1TCBA 2R2AA 1Q19A 3A3NA 4RC9A 4YUWA 3CTPA 4PN7A 3LGSA 5ALQA 1CEEA 3P7MA 2WWGA 1BHJA 2Z3WA 4H35A 2I62A 4LMRA 2VYFA 4W7HA 1ETUA 5EXTA 4A2QA 2WYVA 5H9WA 4LDQA 3F9RA 3I5MA 2BL4A 4Q9NA 5AHXA 2IXBA 1RR6A 4RGVA 1ZN7A 2XA9A 3W2GA 1L8AA 4LA4A 1NXTA 3UT6A 2H0RA 3JQQA 1KDTA 2R8YA 2WZQA 3ED5A 3EA4A 4FWBA 1MVNA 2ZTVA 3CRW1 4YRQA 2GBGA 5EP3A 3ZWVA 1VB3A 1MQAA 2ZWAA 3ZGNA 5A5DA 3DLHA 2HY7A 4R2KA 1E3MA 1N57A 1T4MA 1T5DX 3ITNA 3VKFA 2C9BA 1GCUA 2XCSB 3ELDA 3C3KA 3ITKA 3VOAA 4A1FA 5C8YB 4RJLA 3OMLA 3JQ8B 1Q22A 1PIWA 1WKVA 4OG2A 2PL5A 2RJNA 1PJ8A 3GEGA 3LZ6A 2I33A 3IFSA 4WI1A 3OIVA 4HQFA 2B8TA 2I66A 3TE7A 4CIBA 5CT5A 4UD2A 4Y2TA 1XZJA 3NP9A 2O7SA 4TVSA 1WBBA 4CZ2A 1CDOA 1HA3A 4K86A 3HZHA 1Y3CE 1SHJA 3FCXA 4RZ3A 3CWQA 3EZXA 5IAOA 2ODPA 3PQ6A 5FD8A 4C01A 3HI4A 2WZBA 3H6GA 4RZIA 1F38A 2RK4A 1XX6A 3KLOA 1KI6A 1PJ2A 2Z2YA 5EIAA 4EARA 2AJCA 2I4NA 1E2PA 2EF0A 1ZLYA 2QJOA 1AKUA 2PGAA 1QOPB 3DDCA 4KBFA 3QW2A 1W5BA 5JQGF 2C2HA 1FP2A 1GYPA 3H4VA 2WTMA 1HO3A 1BH6A 3LYLA 3NP7A 4I9FA 5ALFA 4Y2PA 3VYWA 1EKXA 4H1WA 2PMCA 2BLLA 1F8GA 1V8BA 1F12A 1N1DA 4HGOA 3HYSA 3OUUA 3FPEA 1OWNA 4C0BA 1YE8A 2IXEA 3KJIA 1P0IA 1E63A 4F2PA 4LOIA 1FDOA 3A4YA 3T8YA 4LS3A 1V4NA 3SXUA 2AUNA 4IGAA 1K8ZB 3JTMA 4B31A 4HAUA 1CK4A 3IV6A 4X6YA 3VPGA 4NOMA 3MCWA 3OFJA 1UPAA 1SCJA 2EIHA 4B8WA 3VTAA 3ZCUA 1WY7A 4WLFA 2ODBA 4C2BA 3QHQA 1PI3A 3E8XA 2QTRA 2BONA 2GPNA 3I9V1 3O8CA 1NVFA 3JV7A 4Y67A 4L8GA 1PVVA 4A0SA 2QLTA 5JDIA 1V9LA 3OFSA 5JVDA 1D04A 3DWGA 1AS0A 1CUZA 5KPDA 1VRWA 2PSFA 2PBRA 3O8QA 4CF3A 4WZBB 3FM9A 1VSVA 3RFVA 2J1LA 4NU6A 1U3UA 3QU7A 2VDJA 1ORDA 1XXHA 5F7OA 2G0TA 5EEHA 1E5DA 1I5RA 2GRJA 3MELA 1QQAA 1DJMA 1GPNA 3EC7A 3HUEA 5CBPB 5K9ZA 1PWYE 2W2TA 1DWUA 4WCFB 4ZYLA 4Q66C 5DHAA 2FPGB 3VHLB 1MB2A 3H9UA 4MA0A 1UC8A 2OD2A 4TVKA 1NN1A 2RFLA 2RGUA 1UOPA 3JXEA 1DAMA 1T9GR 2CXTA 2WWTA 3DDOA 3EGDB 3VR5H 1MBZA 2GF2A 2X8BA 4UJ3A 2CGEA 1M76A 4DLKA 4OCZA 1VPTA 1Z8NA 4EPRA 4WLEA 3ZLBA 3KNZA 4HH4A 3C8HA 5JYDA 2P9CA 1M7BA 3IA2A 4D80A 2K2WA 1E6KA 5CW2A 1KQOA 3CW9A 3RVJA 3A6LA 1RKBA 3MM4A 3PNQA 3PXCX 3U3XA 1JMVA 1DRUA 4CM9D 3LUGA 4NDZA 5B37A 4KQMA 2I3AA 3TSWA 2G6TA 2OSBA 4YJFB 3A1SA 1T1EA 3LL7A 3U9SA 5AW7A 1IXRC 1UK9A 1TLFA 3KTFA 1A8PA 1R4AA 2NVOA 3TFWA 4DV1B 2IEBA 3W3AA 3HK2A 2O8FB 4CT4B 4V3CA 5BMVF 1QYVA 2OC4A 3IUPA 1Q0RA 1LWNA 1NULA 4EMSA 4WUTA 2RAFA 4MYDA 1VL5A 4TPKA 3I0MA 1IXYA