4B4VA

Crystal structure of acinetobacter baumannii n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) complexed with nadp cofactor and inhibitor ly354899
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
282
structure length
282
Chain Sequence
MALVLDGRALAKQIEENLLVRVEALKAKTGRTPILATILVGDDGASATYVRMKGNACRRVGMDSLKIELPQETTTEQLLAEIEKLNANPDVHGILLQHPVPAQIDERACFDAISLAKDVDGVTCLGFGRMAMGEAAYGSATPAGIMTILKENNIEIAGKHAVVVGRSAILGKPMAMMLLQANATVTICHSRTQNLPELVKQADIIVGAVGKAELIQKDWIKQGAVVVDAGFHPRDGGGVGDIQLQGIEEIASAYTPVPGGVGPMTITTLIRQTVEAAEKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL PROTEIN FOLD
publication title Acinetobacter Baumannii Fold Ligand Complexes; Potent Inhibitors of Folate Metabolism and a Re-Evaluation of the Ly374571 Structure.
pubmed doi rcsb
source organism Acinetobacter baumannii atcc 19606
molecule tags Oxidoreductase
total genus 101
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature ec 1.5.1.5: Methylenetetrahydrofolate dehydrogenase (NADP(+)).
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b4vA01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 4b4vA02
1UJMA 3E03A 5ER6A 1JAYA 1TA4A 3DMYA 3SJUA 3E82A 1N7GA 3TZHA 1P74A 5IJZA 3BMQB 1VKOA 1NWCA 4ZQHA 3DZHA 4TRRA 1VE9A 3GZNA 4JLWA 4L9RA 4TZTA 5COQA 3KBOA 3V1TC 2D5AA 2X0RA 1KY4A 3HN7A 1EDZA 3KYCA 4HXYA 4BNZA 5CEFA 1HYHA 4Z0HO 1NVMB 3RC9A 3MJ4A 1XCBA 1K0UA 3HADA 3IP1A 1LLDA 4EUHA 2IXAA 3GY0A 1ZK0A 3ONDA 3Q6IA 4BV9A 1BDBA 3VAZA 3PVZA 4NZ9A 3D3WA 3ETDA 3JD0A 3DB2A 4J49A 4KTVE 3H9UA 1KS9A 1CDOA 4D46A 2EKPA 4GKBA 3C1AA 4MDHA 4XGIA 4J4BA 4CMEA 1Z73A 1ISJA 2QW8A 3HFSA 1U2GA 4EGFA 3NT4A 5TSDA 1H2BA 2QIOA 1U5CA 4EJ0A 2FOIA 2AEJA 3EVTA 4WOKA 4CM3A 3AUUA 4XRRA 5B4VA 1PR9A 2EXXA 2OP0A 3ZWYA 4D0RA 3UCEA 1B0AA 2X0NA 3L9XA 2AQKA 1SNYA 1PWZA 1N1EA 3OQ1A 3WMWA 5JMPA 2IEDA 5IG2A 4DC1A 1NPTO 5DZSA 4IDBA 4DLAA 2HCTA 2W2KA 3QVOA 3CEAA 4EUEA 2X8LA 3LT4A 1T2FA 4A10A 3WX0A 1YL6A 4CL3A 4BO3A 2CFCA 5JCJD 4CJXA 1BTOA 2VCYA 4J90A 4XGNA 2X22A 1CERA 2Y05A 1NM5A 1EVIA 1JU9A 4EITA 2EJVA 3RFXA 5DBFA 3WQQA 1TT7A 2QG4A 2ZTLA 3ANNA 3C7CB 1LC3A 4Q3AA 2NSDA 2NQ8A 3O9ZA 1ZK1A 1HLDA 1X15A 1O8CA 3PHIA 3KSDO 1UXHA 3OJ0A 4XGKA 5DULA 4BHTA 3WQSB 4Z9FA 2I5PO 1N8KA 3W6ZA 1N2SA 3QLJA 4KTTE 3X2EA 3ZV4A 1PS8A 1MX3A 3DZIA 3U9LA 3UXYA 4E5MA 1WNTA 3ZWWA 2RH4A 1N9GA 2Y0DA 4LN1A 4CM6A 1IPFA 3BTSA 5A1TA 1LDNA 3HWRA 2BFOA 5G4KB 1Y8QB 4IMRA 5C7LO 7MDHA 5KCZA 2Y1OA 3D5QA 3ITKA 2XXBA 3O8QB 4P4GA 2CDBA 1TI7A 1DXYA 3KSZO 4G5HA 1U3VA 2YFHA 4MVJP 1P1RA 4M8SA 3OICA 3WGGA 3ULKA 2VZ8A 2J5QA 2YUTA 3UH1A 2LDXA 1E3JA 1NX6A 2IYOA 5LDGA 4E32A 5JMWA 4UVHA 4P38A 4Y6RA 4RCVA 1YKFA 1P1KA 4FQ8A 3PGXA 3T4XA 5IFLA 4KQWA 3IKVA 4XQCA 3D64A 2D5CA 2ET6A 4YJGA 1V35A 4OKNA 5F1PA 3ZHZA 4PG4A 1MFPA 3QWAA 4FBGA 1RPNA 2DFVA 4WCFA 2V6MA 5H83A 4Z9YA 5AVOA 3H9JA 3WDSA 3UFXA 2FPPA 1SPXA 3GT0A 3VH3A 4WLNA 2IXBA 1Q0LA 3ROKA 2W2LD 4B4VA 2PNFA 3ZWAA 1LSUA 1JKJA 1LSSA 3WQRA 1HDOA 3C24A 4KDFA 4PRLA 1BRMA 3NT2A 3RIHA 3WLFA 3DBLA 3QWBA 3NRCA 3C1OA 1ARZA 5CAEA 3V2HA 1GV0A 3PEFA 4AJ4A 4RPKA 4IQ0A 4IMPA 1H6CA 4BGVA 4UAGA 5MDHA 2QHXA 4RDIA 1L7DA 1TB4A 2WSBA 3IP3A 1M6HA 2O4CA 1R4MA 1V0JA 2OBNA 4BO7A 5KNLA 4IDDA 3QWHA 4J16A 1QYWA 5ITWA 4GVXA 2ZTUA 1HE4A 4RF5A 5EESA 5BNTA 2PD4A 4RZHA 2HRBA 3MTGA 5A3VA 3FTNA 3IOYA 2O3SA 4MVJH 1IE3A 2IEBA 3UUWA 2WD8A 1OZAA 3DZBA 1ZO8A 1JKFA 1E1NA 4HADA 3PIDA 3PWSA 5GY7A 5FEUA 4IS2A 5CDTA 3JQGA 5F5NA 4Q3NA 5A9SA 4CUZA 4IIVA 4B7UA 5JXWA 4W9NA 1E7SA 2Y1EA 2DAPA 4MP3A 1PQUA 4H7PA 2J3KA 2O48X 1IPEA 2ZJ1A 3VH2A 1PU2A 3NJ8A 3TNLA 2E4AA 2JL1A 3EUWA 3COSA 1IUKA 1GTMA 2C59A 2E37A 4GAEA 5T8KC 3U4CA 4PLYA 1P3DA 2EKQA 3EDMA 3K2EA 4CLEA 1KYQA 4PLCA 4L4RA 3DR3A 1EE9A 4YEDA 3ETEA 3QWFA 3D0OA 4RGBA 3SVTA 2BFMA 3WWZA 5EL0A 5IF3A 3OIFA 3ENNA 1VJ1A 1PWXA 3L4BC 4NBWA 2FR1A 4IZHA 5K0ZA 1CJCA 3B6ZA 4W7IA 4F3YA 1QV6A 3RUHA 3ZNPA 2RBEA 5BSHA 3GPDG 1CYDA 3RFVA 3RCBA 4IQ8A 4TKMA 5DP1A 2H1SA 1Z82A 1JKIA 2FR8A 5A03A 1H5QA 1QORA 1DIBA 4FFLA 4JBIA 3S1LA 4XKJA 3HE3A 1H6DA 3RUFA 4Z0PA 2D2IA 4HP8A 1PGPA 4BV8A 1DC6A 1NFQA 2YW9A 3PPIA 1P44A 4EBFA 1ZIDA 3PFWO 3ADPA 3T4EA 1B14A 4BO1A 1B8VA 1MV8A 5TRTA 5KJEA 1FXSA 1IYZA 3ZWXA 1C3VA 4CM1A 3D4OA 1VJTA 4LGVA 3V1YA 2FHSA 1P0CA 2FZWA 2BF7A 1GUZA 3HG7A 1I3KA 3LC2O 1LRJA 5EJ2A 2P5YA 1D3AA 3ICCA 1ZMTA 2UVDA 1HDYA 1S6YA 3BIOA 9LDTA 1DRVA 6ADHA 1TVEA 2VHWA 3AOEC 4MVJI 3L07A 4RO0A 5TJHA 4B7CA 5B37A 3GEGA 5IXYA 2OBYA 2PKQP 1KVTA 2GZ1A 1JVBA 3A28A 3L6DA 4UVGA 4W6ZA 4E13A 2VUTA 4AL4A 1HE5A 3CZRA 5KKCA 1SOVA 3NKLA 5JC1A 1IL0A 1BGVA 3BHMA 2VT3A 2A9FA 5H81A 3RU7A 1Q0QA 3QV1A 1LLCA 5TLSA 4IIUA 4DTIA 2HKIA 5A4DA 1UDAA 5JDIC 1JWBB 2XF8A 2PR2A 2P9GA 5KWEA 4WCDA 1WMAA 3OJLA 1LDMA 4R41A 3DONA 4DIFA 2PV7A 3R3SA 3LF2A 1SB8A 1PL7A 4D43A 1UZMA 4R3WA 1EDOA 4OXYA 2W98A 2Z5LA 4U0JA 2WE8A 2O7QA 1ISIA 1AN9A 2FSSA 1OI7A 3GGGA 4CLOB 4FJ1A 3VC7A 1ADGA 5KJCA 1ZK2A 1W6UA 4EDFA 1PZEA 1DRWA 4JNKA 5IDYA 5U9CA 3HN2A 3H9GA 3U4IA 1OOEA 4BNMA 3UN1A 2B83A 3JD3A 4RVFA 4Z3DA 1PGJA 4K28A 1BW9B 4K6CA 2DU8A 2OOSA 1E6UA 1ONPA 4DVJA 1LJ8A 2NQTA 4YJFB 3GNQA 4YT5A 4G2NA 5GZ1A 1OFGA 4Y9DA 3RD5A 1ZNQO 3LLVA 2X4GA 1HZZA 3DHNA 1WP4A 1KERA 2VHZA 3WR5A 4NNJA 4I5FA 4BO6A 2DBZA 3BMOB 4EZBA 2ZQZA 4IGFA 3EY4A 2X6TA 2VTDA 5JFOA 2P4HX 3JYNA 4YBZA 4HY3A 1YB5A 3DL2A 1WPQA 3GVPA 2HLPA 4CMIB 4F45A 5JAIA 1YS4A 1BXKA 4YAIA 1E1LA 3K9QO 2YDYA 3H3JA 3WJAA 3LF1A 1HSOA 3OHSX 2BGLA 4QECA 1MG0A 3QVTA 2EKLA 4WGGA 4KDEA 5A02A 2DFDA 3G3EA 4XIYA 3GDOA 1GPDG 3ZU5A 5KIAA 4KMSA 3UCXA 3BTVA 5EN4A 3GF4A 4WJZA 1ENYA 1ZUD1 4RVDA 3AUTA 3I4FA 1U8FO 5AXAA 4QX6A 2VUSA 2B4QA 2AEMA 1DAOA 3H6KA 3SLGA 4DC0A 3RKUA 2QRJA 3BMNA 2I6TA 1NFFA 5EIOA 3VOSA 4BB5A 3AM5A 5JNLA 1R4NA 2WEKA 4IDFA 4MIOA 4XJSA 3CMCO 4CM7A 5A05A 4CV3A 1K6XA 3P19A 3KSUA 1DLJA 2GN8A 1LDGA 3WYCA 3HDYA 4CMEC 4KOAA 4RF3A 4LSMA 4BO0A 1ZK3A 4DRYA 3QE3A 1X1EA 2HMSA 2VRCA 4ESOA 1DFHA 4A0SA 1R0KA 4LSWA 3DBHA 1EQUA 3FWNA 4GMGA 5TNXA 2DT5A 5CEEA 2J8ZA 3ST7A 2IYPA 3DMTA 1E5QA 4NK4A 3C3XA 1FJHA 3N74A 3DAGA 4ZJUA 1TXGA 5G0UA 5I8WA 4XYGA 4BQPA 1GY8A 1VSVA 5HBRA 4EW6A 1YB4A 3JQEA 1HE2A 2PKRA 1BXGB 2CF5A 3FD8A 3CZMA 4D42A 3P5SA 4L73A 2J3IA 5C7OO 1E3WB 3JQ9A 4RVSA 3W6UA 3AWDA 3L4BA 4RPHA 2J3HA 1WVGA 2DVMA 5L4LA 3LT1A 4AJJA 1MGOA 3WJ7A 3ZNNA 3RI3A 5ILGA 3VPFA 4R1NA 1ENPA 2A4KA 4XB2A 1EFKA 3KO8A 4IZIA 1P45A 2WM3A 2ZIZA 2Q49A 4ZD6A 3QY9A 3VZPA 3BTUA 4DLLA 3BHJA 4AG3A 3PP8A 2PK3A 1KETA 5LC1A 4DPMA 1ONOA 1TT5A 3RQSA 5I9NA 3IMFA 2WTBA 2JD2A 3JQ7A 3M2PA 1CWUA 2BMAA 2HK7A 4NBRA 1KBZA 4GSKA 4IDAA 3SBOA 5I9LA 2Z1MA 3PFFA 1EVZA 1GAEO 2YQ5A 1AXGA 4NH4A 2E82A 4GMFA 3TDKA 3VZQA 1U4SA 1DDOA 1Y5MA 3JQAA 5TC4A 3JYPA 3HJAA 4S1VA 4DQXA 3E18A 4U8GA 3NT5A 3H5RA 1KC1A 4UVEA 3ONFA 2I3AA 2WYVA 1GQQA 4XRGA 1HF3A 1GADO 2AQHA 1LNQA 4ND1A 5TX7A 1SAYA 1LQUA 4IDEA 3DBRB 1PGOA 1M66A 1B7GO 2P9EA 4C4OA 4OXNA 4MIYA 2J6IA 1H0KA 3W8FA 3I5MA 1DOHA 1XLTA 3GN2A 4OQZA 4BGIA 2O3TA 3DEYX 3O26A 4WCFC 4WOJA 1ADCA 1I2CA 4YCAA 4CM4A 3INRA 4QT0A 2IZZA 4I9UA 2EEZA 1C1XA 4NJMA 3DAFA 3FTPA 4R69A 3DZFA 4GLOA 4PG7A 4B3JA 1QP8A 2ZYAA 1W0CA 3O4RA 4ZA2A 5T67A 3TZKA 4PLFA 2PA3A 3ZH2A 4IJKA 4WLOA 4D0SA 8ADHA 3PK0A 4HV4A 2JD0A 5L3ZA 4J43A 4KWIA 2O2SA 3GVIA 4CQMB 5C7IO 1KEUA 3WBFA 4RQTA 2NU7A 2GRAA 3F5QA 2OORA 1NAIA 1GUFA 2AA3A 2OP1A 1B8UA 1ZVMA 4NPCA 1LDBA 9LDBA 2YYYA 2VNSA 3HB5X 1PZGA 2R00A 4AJIA 1WMBA 5BNFA 3ANLA 3I9NA 5TQVA 2NNLD 2GUGA 1UP7A 4BNVA 1KEWA 1NVTA 2VYVD 4FFPA 2PH5A 4IDGA 1DFGA 5CFZA 1J4AA 4JCOA 3I9KA 2YV3A 1DIHA 1NPYA 1E6EA 1UXJA 3QVXA 4TVBA 3TOZA 4ALLA 1B3BA 4UVDA 4J2OA 5CG1A 1DJQA 2JAPA 1P1HA 1Y6JA 2YZ7A 3QIVA 4BGUA 3FPLA 4DBZA 1CEQA 4HUJA 1HYEA 1E1MA 4M87A 5T57A 3STHA 4TROA 2NU8A 3DFUA 4QO8A 2CVZA 1C1DA 4UUOA 3W1VA 2C82A 5AOVA 2OO5A 1YO6A 1YXMA 4M89A 4ND4A 4W9NC 1MC5A 1Z74A 4ILKA 5A5FA 1X1TA 2X5KO 3CIFA 1HRDA 3GDGA 1YWGO 3VTFA 2E48A 2X5JO 1U3UA 3HZZA 3NTQA 1HDGO 1VJ0A 4XD2A 4M86A 1LEHA 1FDTA 2GR9A 3CSDA 3FNHA 4I08A 1NASA 5JAMA 1Y81A 4GX1A 3F46A 4NFYA 2YJZA 1N1GA 3H4VA 3OH8A 3OJEA 4Q3BA 3UW3A 3VZSA 4DYDA 1VL6A 1U2DA 4XCVA 2H9IA 3L0DA 3WGIA 4ALKA 4BNUA 3GEMA 1Y9AA 3FNFA 1TEHA 4FFMA 3S2IA 1CQIA 5I7EA 1MG5A 1LRLA 3KYDB 3TRIA 2I66A 4E31A 5JCJA 4YACA 3QWIA 4O5OA 1WDLA 1ZFNA 2PD6A 2P4QA 3INGA 4BS9A 3RBXA 2GO1A 4IY1A 4GH5A 2Y66A 4RQUA 1RWBA 2BKAA 3WFJA 4DMMA 5JYDA 1WLYA 3C1TA 1KC3A 1XU7A 1P1IA 3PJGA 1ZEMA 1KVRA 4JBHA 4FFRA 1P31A 2XAAA 5IZ4A 3KB6A 2PZLA 5HA5A 1E1KA 1DRUA 1F14A 1TLTA 3JQFA 3CH6A 1LC0A 4HX5A 4DIBA 5CG2A 3KUXA 1LDEA 1U3TA 3MJSA 3EZYA 1XG5A 3CKYA 8LDHA 5A5EA 3WICA 5IDWA 3W4IA 4DQUA 4YR9A 3FCOA 3KZVA 2V6FA 1MLDA 3ZDFA 4BKUA 1O95A 2JHFA 2OGUA 2FY8A 3RC1A 1H9AA 3RUEA 4WE3A 3KLPX 2ZB3A 3NGXA 2DUUA 3JQ8B 4J9VA 5CP8A 3TFQA 5L7WA 4PCVA 1LQTA 3DZGA 2VOJA 3GFBA 4E2YA 1J0XO 1YQGA 4GX0A 3NTOA 4LCJA 1HDCA 4TVOA 3RUCA 5G0TA 4BNNA 5G0VA 4QQRA 4ALIA 3LSYA 2Y0CA 4Y6SA 2X0IA 1XDWA 2EP5A 4YAGA 3ASUA 5EPOA 3GZNB 3V2UA 1DLIA 1OC4A 4WEQA 2I67A 4YTEA 5EINA 2GN4A 3KYCB 4PLTA 1LXCA 3GGOA 1QKIA 1V6AA 3HDHA 5CDYA 1K6JA 3WG9A 1EE2A 3Q3CA 2CMDA 4KUEA 5B12A 4PGFA 3GHHA 3HDJA 3QHAA 1YQDA 3ZHBA 3ZWCA 4CR6A 2JHGA 2EGHA 3TFOA 3D3WB 2JD1A 4JGBA 4EEZA 2W2LA 2ZYDA 5EQDA 1T1SA 1AHHA 1I24A 3WGHA 2GERA 3I6QA 2P9CA 3OQ6A 1E0DA 5JS6A 4YDRA 3RBZA 4PZDA 4FCCA 5I7VA 2TMDA 1T2AA 3W8DA 4MJLA 5JW6A 2B0JA 4FFOA 3WSVA 2GYYA 4D3FA 4CM8A 4HFNA 1P1JA 4DXHA 3U09A 1YBVA 2NVWA 3SJ7A 2Q45A 5COAA 4A7PA 1PZFA 1QV7A 3KETA 5F5LA 4ZU3A 4TKLA 4QFDA 5TJ9A 5KTKA 1NR1A 1I36A 3JQBA 5J23A 1PL6A 1SEPA 1X7HA 4CV1A 3DZJA 1NVGA 3GMSA 1EUZA 4ND5A 1J6UA 1VC2A 4ALMA 3DBVO 3ZNQA 4QUKA 5L45A 4X54A 2O7SA 2NLOA 3IL2A 2W2KB 2CD9A 2HDHA 4IJWA 5A04A 3N58A 1XYGA 4AJOA 3C7DB 5HWSA 4EI2A 2GZ2A 1DAPA 3AU9A 3FNEA 2VYND 1IHYA 5CDSA 4EUFA 2F1KA 3V2GA 4ND2A 3JTMA 5FYDA 5A06A 3WIDA 2FWMX 1R6DA 1ZSNA 3JV7A 1ISFA 2X58A 1XQ1A 3K2BA 4ALNA 5CPFA 1A9ZA 1X14A 3F4LA 3NGLA 2B4TO 4HKTA 2P5UA 4UREA 3WGTA 4Z6KA 4YRDA 4XQGA 4GX5A 3GPIA 1T26A 4IPTA 3PQDA 3H65A 1T2DA 5L51A 3G0OA 1VL8A 1B3RA 3VDQA 5IDXA 3ZU4A 4J2HA 1N9GB 3LDHA 4XJTA 1U4OA 1HT0A 2HRZA 4I5DA 3F5SA 5KJFA 2PZKA 2P91A 2Q99A 2JCXA 2UDPA 3I9OA 4GX2A 1P77A 1XKQA 2Q3EA 1ZSYA 5I9MA 3PZRA 1L1FA 3NUGA 1PJ3A 5L95A 1UH5A 3MOIA 4E5PA 3LU1A 1YGYA 3H9QA 4C7JA 4JN6B 3O03A 4UUPA 1U7TA 2AG8A 3H2SA 4W99A 3FBTA 2VZ9A 1IZ9A 3E9MA 3WYEA 4CM9D 1C0PA 4YAKA 2P68A 1E3SA 4I5EA 7ADHA 3MOGA 4CLXA 1T2CA 4KWHA 4R16A 1HXHA 1XIVA 3ZWPA 4R3NA 4YJGB 3GHYA 5C3MA 1CF2O 4TRJA 4WCFB 5IN5A 2SCUA 2GN6A 1NHGA 1HDZA 1YOVA 5BSGA 3LK7A 5A9TA 2O50A 3A1NA 3AUSA 1DHRA 1SOWA 1YDWA 3QW2A 2JCVA 2B69A 2PGJA 3SC4A 2EJWA 3DMTC 4IXTA 1AE1A 4DPKA 4YRAA 3JQDA 1PZHA 4HWKA 3UCFA 2QQ5A 4KQXA 3AM3A 3Q9UA 4Q9NA 5EMHA 2HMTA 3DBLB 1I33A 4RF2A 4TWRA 5TT0A 3ONEA 2BFPA 3DHEA 1DHTA 2O3JA 3IS3A 3NDRA 4MPDA 4OOFA 3PQEA 2Y1GA 1ISGA 3NEPX 3NTRA 2EW2A 1NQTA 3GNTA 3I9MA 4M55A 1AHIA 3JQ9C 2IZ1A 1LBEA 4D45A 1B8PA 1R4MB 2ZCVA 1E7WA 1GZ3A 2VOEA 3FWZA 1JWAB 3ZV5A 4NK5A 2C20A 2NU6A 2XPCA 5F1OA 4E2ZA 1O94A 2HK9A 3BXXA 4XYEA 4FSHA 1QYVA 2I9PA 1QLHA 2AE1A 4HFJA 4J91A 1QYCA 4NMHA 4I5GA 2AEFA 1ENOA 4LK3A 3I3OA 5KVVA 1HSZA 1SCUA 1Q7CA 2GASA 3F4BA 4FGSA 1Y8RA 1UXIA 3JQGB 4BO4A 4J1NA 2Y68A 5A9SB 2I3GA 1EQ2A 1FDVA 4GSLA 4HFRA 2NVBA 3WXBA 5G0SA 3VPGA 3ZWVA 1ZZEA 3L4SO 2UYYA 1B2LA 2G1UA 4PRKA 4YT4A 1EVJA 2YV2A 4UEKA 3I6IA 4QO7A 4BQRA 3Q11A 1UXGA 2CY0A 3INTA 4DPLA 2Y0EA 5CHEA 2EG9A 3B1JA 3ASVA 4DL9A 4OO3A 4XIJA 3K31A 2UUOA 3ADOA 3Q1LA 4CMKA 2GF2A 5U4QA 1F12A 2VWPA 3HHPA 4RDHA 1XWFA 2GCGA 5JDCA 3PQFA 5TIIA 2YDXA 2NUAA 4PG6A 3S2GA 4BNXA 4RPJA 4YWJA 1GFSA 1I3NA 1T4BA 1MXHA 2C2YA 2X86A 4H3VA 4ZRNA 4RJTA 5A9RA 4RVHA 4FD3A 5ITVA 3WGYA 4L76A 1EK6A 2C5EA 5HRUA 1D1TA 1BVUA 3ZWNA 4IGEA 2ZTMA 5JY6A 3DTYA 2WD7A 3I9LA 3V5NA 3NDJA 3P2YA 2G82A 4FOSA 3U4HA 5ICMA 5BSEA 2RHCA 4PFJA 1E7YA 2LDBA 3F1KA 4WASA 2AQIA 2GDZA 5JAZA 1E7QA 4GVLA 2DUWA 4AJ1A 1QR6A 3D7LA 4FOOA 4B4WA 1LLQA 1O0SA 4OMUA 3QVSA 2POQX 1A5ZA 3P7MA 4L75A 1Z45A 3CTMA 1YBMA 1MP0A 3GFGA 1O5IA 3EK2A 4FN4A 4JBGA 3V8BA 4DQVA 1R15A 4RLHA 1UZNA 3WYBA 4ZQEA 3JYOA 4LMRA 1IB6A 2G76A 5IZCA 2Q4EA 4HFMA 4MKXA 1G0OA 3GRKA 3KYBA 3OA0A 4J3FA 2C2XA 4FIZA 2R00C 4PZCA 1PQPA 1YBAA 2V65A 3HUDA 1ISMA 2Q50A 3GUYA 4IUYA 2DQ4A 4IDCA 4TZKA 3MJEA 3ORFA 4R5HA 3LZ6A 4J4HA 4AVYA 1PS9A 1ZKMA 4BNGA 3G1UA 1ML3A 2CDAA 1ULUA 4OM8A 4Y8VA 1GL3A 4JJIA 5A3JA 3PJFA 2FN7A 2Q4BA 3KOUA 1FMCA 3VPXA 4Y67A 4L8VA 3EW7A 5BSFA 4OSPA 2VWQA 1H9BA 4ID9A 2X9VA 4XQ9A 4YB8A 3GVHA 3AI1A 2AMFA 2VNAA 4E5YA 2OMEA 1R0SA 3AFMA 1BVRA 3QJ5A 3I1JA 1GZ4A 2D0IA 5F1KA 4CQLA 3KRTA 4WK6A 4BNFA 1I0ZA 3G49A 5DOZA 4NFHA 3RBVA 4O6VA 5BNIA 5JCXA 4AJ2A 4E2WA 3EMKA 3ZGYA 5THQA 3AOGA 1XR3A 4NG5A 2HQ1A 2Y1DA 2D59A 4QFCA 4RZIA 5L4SA 3K5PA 3ZW9A 2YFQA 4AJHA 3AJRA 2DPGA 2Q2WA 2UV8A 2NTNA 3I9JA 2ZYGA 1M6WA 2Y67A 3BA1A 1IOLA 1NHWA 5B1YA 2A94A 1WXDA 1ZSVA 4MVJG 3PI7A 3LT0A 2HJRA 1A72A 2HMVA 1XU9A 2WMDA 4MVJD 2NVUA 4R1SA 1R12A 4Q3DA 1GEEA 1EZ4A 2X9GA 4BKPA 1HL3A 3MJVA 4PIVA 1C0IA 4P4NA 1QLJA 1N92A 1WAMA 3H5AA 4B79A 4PG8A 5HM8A 4DWVA 2R2GA 1ZEJA 3WTCA 3JQFC 1LI4A 3DFZA 3TWOA 5AXDA 1U7HA 4EJMA 2HMUA 1NR7A 3Q9NA 2UUPA 1KEVA 4OYRA 2EIHA 5JLAA 2DTEA 3EZLA 1C14A 3Q0EA 3PHHA 1UUFA 3RUAA 4UEOA 3WGQA 4XYMA 3K73O 2GGSA 1KVSA 5GZ6A 4P8RA 4RLSA 3GGPA 1ZH8A 1ZK4A 4F6LA 2NU9A 1V9LA 1D8AA 5JC8A 4FDAA 3GG9A 3EGOA 4XR9A 2Y99A 3TL3A 1Q7BA 3DHYA 2QYTA 4IJVA 3SLKA 3G1TA 1NXQA 2FRDA 4N7RA 4CUKA 4DA9A 3RUIA 3PWZA 4YJDA 5ENDA 1JVSA 1UDCA 1VLLA 4GBJA 4D41A 4CLRA 4CMGA 4WLEA 1DC4A 1I2BA 5TS3A 1QYXA 4BO9A 3Q2KA 4B4OA 1ZXLA 4LCEA 4WNCA 3TPCA 4BO2A 1W4ZA 1EBUA 5AXBA 1VSUA 4IM7A 4N5LA 3UAGA 2RIRA 1PJ4A 4WNIA 2IZ0A 5G4LA 2EGGA 3TZ6A 1PR3A 2JFGA 1GCUA 4XDZA 1GD1O 5HS4A 1B15A 3LVFO 3GRPA 2YHIA 1VRWA 2AW5A 3BMNB 3GG2A 4D3SA 3RAJA 3KHUA 1MB4A 1R4NB 2FZEA 4NFSA 2J5RA 3TQHA 3WFIA 3AK4A 4ZICA 5B4UA 3QRWA 2EHDA 1EK5A 3DOJA 3E6AA 3H9EO 4YYZA 3VHRA 4RPLA 1T1RA 5L40A 4AJNA 5JO0A 4YQZA 1PJBA 4YT2A 1O9BA 3I83A 1GQ2A 4UEJA 2IRWA 1ONNA 2HMWA 3DBHB 3S2EA 3LQFA 4BMNA 4J1SA 3ZCXA 4YJHA 2DBQA 2R6JA 1GR0A 1NWHA 4E21A 4XZ3A 3L9WA 4NBUA 4XA8A 4CMHA 1PJ2A 1C0LA 1LUAA 3JQBC 4CM5A 1MFZA 1PGNA 2VRCD 3TF5A 2HSDA 2PWZA 1UAGA 2AHRA 3PDUA 4CPDA 2BGKA 2DPHA 5T64A 2VYVA 1J5PA 5TF4A 4FGWA 2I76A 4E2XA 3C7AA 4CMAA 3ENKA 3U4DA 1K6IA 2B37A 3ANMA 3OP4A 1IZ0A 1GPJA 1DB3A 3OA2A 3BHIA 1ZCJA 3KLMX 3DOOA 1I8TA 3ZI0A 4AFNA 5DOVA 4ITUA 2XXJA 1KIFA 4N5NA 4M1QA 4TSKA 4RVGA 3PGJA 4CMBA 1Q1NA 1W73A 2AG5A 1ZJYA 2PGLA 2Y1CA 4LW8A 1PGQA 3A9WA 4JIGA 2XOXA 4K6FA 1EMDA 4B3IA 3U62A 5I7SA 3WNVA 4PLGA 5AQ1A 2BLLA 2DBVO 3G17A 1DPGA 4PVDA 3ZHYA 1TT5B 3JQ7B 3AY3A 2G0TA 4DLBA 1NQOA 2A92A 5C5IA 1YDEA 2PFGA 2X7HA 4CQMD 2TMGA 2IDZA 2VT2A 3U49A 5L53A 1JN0A 3L77A 1K2WA 1M2WA 3OJFA 5KOIA 2H63A 3HDQA 2EWMA 3BMQA 3JQAB 4AICA 1QG6A 4BL5A 3W4KA 4JROA 4GWGA 4BNJA 5CDUA 1SMKA 3JD1A 4BIIA 1ZBQA 3ON5A 3R6DA 4J0EA 1HZJA 4A03A 4CL8A 2BRUA 4WLVA 4OAQA 2YQ4A 3O38A 2OUIA 1EEHA 3GAFA 4IINA 4BGEA 1HTBA 4ZQBA 1A4UA 2HUNA 4IXWA 1SEVA 3WB9A 4CM4B 4JK3A 2DBRA 4BKRA 5L7TA 3MJTA 4J9UE 2W4QA 1F0YA 2VUUA 4AJEA 4NJMB 4U7WA 1C1XB 1VM6A 1Z6ZA 5T5QA 5DCUA 2YY7A 1CETA 3P2OA 2VTEA 3E9NA 4G81A 5EERA 4F46A 1V8BA 4BKOA 2OL4A 4KUHA 4O0LA 1X0VA 4EJ6A 4YT8A 3F1LA 5IDQA 5K6AA 4CODB 4P4LA 1PX0A 4CLHA 2WYUA 2ZATA 1ZW1A 2Q2VA 4FC7A 3GMDA 2VHYA 3FNGA 5ADHA 1DC3A 1ZJZA 2GSDA 1LA2A 2DTXA 5BT9A 2BFAA 1LTHR 3FPCA 3RC7A 3QSGA 4YA6A 2W8ZA 3AW9A 4HNGA 3DO5A 4DGSA 1HLPA 1D4FA 2H6EA 3PYLA 1QXSA 5COBA 4QTZA 1H6BA 2QRKA 3R3JA 3CPSA 2WWRA 4CMCA 2Q1TA 3GVXA 4DYVA 1GDHA 2X1HA 1R66A 3PRJA 4CV2A 1A9YA 3DTTA 2CSUA 1N5DA 4FB5A 1EUCA 1LSOA 3NV9A 5DT9A 4INAA 4ZRMA 1AXEA 1SZJG 2IODA 1PL8A 3ZWBA 3PJDA 4BNIA 1NFRA 1PSDA 2GZ3A 1C1DB 1HEUA 2C29D 3DDNA 4ALJA 3ICPA 2B4RO 1PJLA 1U5AA 1XGKA 4NBVA 5LCXA 4RV9A 3ROMA 1YONA 4OSOA 2HU2A 3EHEA 1I3MA 3M6IA 4J6FA 5DP2A 1GYQA 1O6ZA 2J5KA 3GH3A 4B3HA 1Q7GA 2GPTA 3V1UA 3CXRA 3OEYA 3KV3O 1PIWA 3TJRA 3AFNA 3JD4A 5LDHA 4JQCA 2F00A 3B1KA 1WW8A 5G4KA 1OMOA 1Y8QA 1DO8A 1DIRA 5JDCC 4CUJA 3WS7A 3QP9A 2X9NA 3F9IA 3E48A 3O8QA 4IJUA 1DIGA 3PYXA 3RUDA 2VHVA 3T7EA 5JE8A 3WOHA 3B70A 1E92A 3F47A 1JLLA 1R37A 3EC7A 2VYNA 1BG6A 3ROQA 3PHJA 4U5QA 3MTJA 4XYLA 3VZRA 5GZ3A 4CV0A 2GLXA 4YRBA 5K9ZA 3K8ZA 3LT2A 1X13A 5JYEA 4BNKA 1PEDA 4Y98A 4Y6PA 1E7RA 3QA9A 4JXKA 3BMCA 3PZBA 1NPDA 4FFNA 4O59O 3M2TA 3VPHA 3BZUA 2A35A 4EEXA 4R01A 3D4PA 2FPGA 5HTOA 1H2HA 5B4TA 3WGOA 4OQYA 5DN9A 1W8DA 2B36A 4J1TA 2BGMA 1F8GA 1GV1A 3KM0A 5IN4A 4FR5A 2VWGA 2CZCA 5DCYA 1DIAA 4YVFA 3EVNA 1DC5A 2BD0A 4GGPA 5IZCC 4GGOA 1ULSA 1JDJA 2Z95A 3FR7A 3S2FA 1R16A 1H94A 1XELA 5CDGA 1U8XX 3PWKA 3E1KA 4R9SA 3VVBA 2HO5A 4KUGA 5U1PA 3ZV6A 3IIEA 1E3IA 3ITDA 1Y1PA 1PJTA 2X0JA 1CRWG 3GN1A 3C85A 5CPBA 2WYWA 1QYDA 2NV6A 3X2FA 4CM9A 3NJ4A 3FSRA 1XHLA 4QXMA 4AJPA 4PLPA 2CNBA 4WLFA 1NAHA 3L6OO 4AJKA 1U1IA 1PJSA 2FR0A 2RAFA 3ETGA 4B8ZA 4BKQA 4OKIA 4MP6A 4FC6A 3ZNOA 3K96A 1GEGA 4LRTB 2CVOA 3LYLA 5BQFA 4MVJE 3GEDA 2EW8A 1WWKA 1P9LA 4N18A 3DXFA 2C7VA 4XDYA 2WE7A 3I4CA 5IXSA 4ZQFA 1QSGA 4R1UA 1FF9A 3UOGA 4OHUA 3BMCB 3IJRA 1RYEA 5EQFA 1DEHA 3TN7A 4O1MA 1ZMOA 3S8MA 4II3A 3DQPA 1SBYA 5TT1A 3T7CA 1DFIA 1RM5A 3FI9A 1K3TA 1HETA 1JQBA 1D7OA 4Q3EA 1HYGA 3JYLA 4R54A 3U3XA 1C0KA 4TMFA 4CM8B 1X0XA 2PD3A 3I23A 3OSUA 4JX8A 1OC2A 1UP6A 5JPIA 3R0IA 1P33A 4E12A 3PJEA 4K9DA 5ER9A 4NHEA 2NTVA 3SEFA 1FDWA 3LC1O 3E5MA 3GDFA 4GPD1 1A7KA 3RC2A 1JTVA 4DBVO 4OXKA 5JAQA 4H16A 4WLUA 3OM9A 3FBGA 4TRMA 1PJCA 3GR6A 3QQPA 3PHLA 1NQAO 1P1FA 2ZQYA 3JQCA 4NDNE 3WGZA 3IKTA 4J4TA 3TL2A 4BO8A 2ZB8A 2BI8A 2Y93A 3ZZNA 4AJLA 3H5NA 1I30A 1XA0A 3M1LA 4NU6A 4RL6A 4QEDA 1WZEA 3WIEA 1AUPA 1LSJA 4JJFA 4A5OA 4PLHA 4XQEA 3VVCA 1ADFA 5FI5A 3PLRA 2WDZA 5DBIA 3H7AA 1GQYA 3GVCA 2CF6A 4FJ2A 3GUCA 2O4UX 3FR8A 2Q2QA 2GN9A 3ZHXA 3K30A 4E4YA 2QZZA 5IAAA 4J7XA 4Q3CA 4DMLA 3OIGA 4YAEA 3RSHA 4Z3KA 2QYSA 1T25A 4E6PA 2QZ9A 2B35A 1RM0A 5THKA 2JFHA 5FF9A 3NX4A 3ZWMA 3UVEA 1YRLA 3UF0A 3DC2A 3TZQA 1HWYA 4RF4A 6LDHA 4OH1A 3RJ9A 4MVJF 1DJNA 2ZK7A 1Y7TA 1GYPA 2I65A 5JO9A 5L7YA 4FW8A 4LRSB 4CMJA 1I01A 4NJOA 5KKAA 4GLLA 4BUCA 4UULA 3IAHA 4OGWA 1B26A 4N5MA 3AY6A 5F3RA 1ID1A 3IDSA 4ND3A 4J1QA 4DREA 4L0QA 4O63O 3VH1A 1H6AA 3A14A 4GI2A 1I32A 3U0BA 2VHXA 3BTOA 4D3DA 1UDBA 1V3TA 1YOVB 4KZPA 4FS3A 1LRKA 4U6SA 3GAZA 4MINA 4YPOA 2BELA 2ZB4A 3RASA 4PLWA 2JFFA 1Q0HA 1UR5A 1YE3A 4R4JA 4RPGA 4MVJM 4F6CA 2CVQA 3UICA 5F21A 1M76A 4GQAA 3VPSA 1AGNA 3ZW8A 4M54A 4Z9XA 3GOHA 4CLOA 1QMGA 4OOEA 1E6WA 1Y5RA 4BNWA 2IE0A 1O89A 3KVOA 2RHRA 4WECA 1LLUA 1Q2XA 4XB1A 3BYZA 4BNHA 3M1AA 4I1IA 2VWHA 3ZWOA 4RORA 1CIVA 1K5HA 1KVUA 1BW9A 1PS0A 4ZVVA 3KEQA 2OFPA 2ZB7A 5L9AA 1JW9B 1MC4A 3D3EA 3HB4X 4YJFA 2X23A 4P22A 2E6UX 4OJNA 1UP4A 3FHLA 5AYVA 3BAZA 4FJ0A 1MA0A 5ILOA 4OL9A 3NAQA 4XYBA 3BMOA 2PH3A 2B5WA 1LX6A 3OJOA 3AM4A 4E3ZA 4W4TA 3VDRA 3JQ6A 1Y8RB 1J49A 3KTDA 1M67A 1IHXA 1U3WA 2PZJA 2PY6A 2O3QA 4URFA 3KXDA 3RFTA 5AXCA 4CMIA 3F3SA 5ES3A 4U6QA 3GQVA 4EYEA 4A26A 1V3VA 2V6BA 3OF2A 1EBFA 5T6BA 1WZIA 5KJ1A 3D4NA 3GA0A 4MKRA 4NIMA 1VPDA 4TQGA 4H15A 2EV9A 4JP2A 2J3JA 3IQDB 1G6KA 2Z1NA 3EAGA 1ORRA 4BB6A 3W8EA 2O23A 5I8ZA 3IUPA 4MVJA 5TGDA 4D79A 3QVWA 3PIIA 3ZN2A 1F06A 4J7CA 4II2A 5FI3A 3SXPA 3HQ4O 5KVQA 4HNHA 3VH4A 4B8WA 1Z7EA 1EVYA 1ZXBA 3TOXA 1E77A 2ZTVA 3CUKA 5KVCA 2DC1A 1A71A 1UAYA 3LLSA 4WKGA 1UXKA 1GZ6A 3C8MA 4I8XA 2Q46A 1JA9A 2WD7B 2RH8A 3AI2A 2JKVA 4NBTA 4GL4A 2PTGA 1OAAA 4RVUA 5DF1A 1A7AA 4Z0TA 3HNPA 4BNYA 4E0BA 4L4XA 4E33A 1BDMA 1A27A 3A4VA 3FF4A 3SC6A 4A27A 5ENVA 1MXFA 2C54A 3AU8A 4ROSA 2NWQA 5H82A 1Z7BA 5JY1A 3K6JA 3K92A 1NYTA 3D1LA 4WEOA 1U28A 3OETA 3PYMA 1LDYA 3SX2A 3MZ0A 4CR7A 4CLDA 4R1TA 4PLZA 5K6AC 1S7CA 3E9QA 2D8AA 1I2ZA 1YB1A 5GMOA 4XEHA 3MEQA 4R5MA 1Y9EA 3HSKA 5G2OA 4M49A 2FMUA 1I10A 2GD1O 1F8FA 3OBBA 1RKXA 1BXGA 1YQXA 4U0KA 1QRRA 4K26A 2JCYA 1SB9A 4IQGA 3WWYA 2O3RA 1IULA 2HJSA 1E3WA 1XQ6A 2Q1WA 3PLNA 4MIEA 4BO5A 5MGBA 4FPXA 1H93A 3DOCA 1PQWA 5DCWA 3OEWA 4LMPA 3RWBA 2G17A 3G79A 3MJCA 3RU9A 4E5KA 3AI3A 1DSSG 3S55A 2H5LA 4UUMA 2X5OA 4XR4A 1BXZA 3JYQA 3R1IA 4NU5A 3E5RA 3I52A 3ZU2A 4D44A 5C37A 1EFLA 2FP4A 3IC5A 3ROPA 4W7HA 2OHXA 2HK8A 4ZN6A 3GC6A 1HDXA 1L7EA 2Y1FA 1P0FA 3OIDA 3FN4A 3L6EA 4NR0A 3H3FA 3RKRA 1V3UA 4DUPA 4IBOA 1Z75A 3NDIA 4CQLB 3GLQA 1K89A 3B20A 3PTZA 4N54A 4UVIA 4WUVA 1GU7A 4A2CA 1D1SA 3CMMA 2ILTA 1NP3A 1KOLA 3JCZA 3WTBA 2UAGA 3VKVA 4WPGA 3WSWA 1E3EA 2V6GA 1OBFO 3IJPA 4XWYA 5T8KA 5BR7A 2OZPA 4UUNA 3JSAA 5DDIP 4R51A 3DWFA 4BOYA 3WMXA 2NVUB 4PN3A 2C07A 2VQ3A 3RROA 2CUKA 2QX7A 3DBRA 2P2SA 3PHGA 1YL5A 1N7HA 1FK8A 4G65A 1G1AA 1NNUA 2CDCA 1NQ5A 2EF1A 4MOWA 1NTOA 1LU9A 1VL0A 2E49A 3DZKA 1PTJA 4LVUA 4TRNA 4ZQGA 1HDRA 3RJ5A 3HFGA 4PZEA 1XEAA 4OIMA 2AE2A 4KP7A 2OXIA 1FDSA 1GYRA 2RCYA 3CINA 4HBGA 1DBVO 4W82A 5JBIA 1U9JA 2JJYA 4R68A 3CE6A 1F17A 3VKUA 3PDJA 4NI5A 4IS3A 2FSVA 3MWDB 3PXXA 1YJ8A 4DIOA 3E8XA 4MO2A 2WJPA 2DM6A 2HAEA 2PZMA 4ONEA 2O3UA 4K1LA 2G5CA 1I5RA 3FRJA 4CQMA 3GZ4A 4GWKA 1ENZA 4PG5A 3U5TA 3F6YA 3RVDA 2JAHA 2YV1A 2Q1SA 4CLRB 1PJQA 1E5LA 4BVAA 3OMLA 1KVQA 3ABIA 3UHAA 3WBBA 1HE3A 4ZHSA 2D3TA 3NYWA 1SO8A 1A4IA 4GKVA 2GNAA 2D1YA 2NM0A 2V7PA 2NTJA 2EERA 2BH9A 4BMSA 3KEOA 1E7MA 3OFSA 3WLEA 5FWNA 5I7FA 2DTDA 2C0CA 1BSVA 4I9NA 3Q2IA 4C7KA 4PVCA 5KJ6A 3AOEA 1YH3A 2YHIB 4LVCA 3H2ZA 2BHLA 3EYWA 4BMVA 2VN8A 2FPIA 1G0NA 3A06A 1NBOA 3UGKA 1VKNA 1GUYA 3ZV3A 3D5TA 2NACA 4YAJA 1R0LA 2PLAA 1IY8A 2QRLA 4CR8A 4A73A 1YJQA 3TZCA 2AQ8A 1WDKA 1E3LA 1GCOA 3OQBA 2ZJ0A 4BNTA 4LISA 1MUUA 1YVEI 3IUSA 5DBGA 5JDIA 2ZKLA 3N7UA 4ZGWA 3WNQA 1KEPA 2I99A 4YJHB 4B4UA 2BI7A 2D4AA 5L4NA 4MP8A 5DNAA 4NQZA 1X7GA 3OECA 1ADBA 2W90A 4JJGA 4I9HA 1BHSA 4JP3A 3W4JA 1FDUA 1BMDA 3JD2A 3TSCA 4S3MA 1KY5A 1RM3A 2PKQO 3KYDA 4B7XA 4BNLA 3JQAD 4J0FA 4YXFA 3MWEB 4QSMA 1UZLA 1X7DA 1XSEA 4L4SA 1RYDA 3B1FA 4R9RA 3AUAA 4XX0A 2C7GA 2C5AA 2DKNA 2NADA 3H8VA 5KVSA 4D7AA 2YHUA 1RJWA 5JSFA 1SC6A 3GNSA 1T2EA 1VI2A 1HKUA 2ZCUA 5FFFA 4Q39A 1BWSA 5HS6A 4J7UA 4E30A 2PGDA 2Q1UA 4L74A 4YQYA 1CQJA 3VTZA 1T4DA 1ISHA 1I3LA 3AY7A 3DAPA 2O2YA 1JAXA 3UKOA 1B16A 2EP7A 4MKZA 3ZU3A 1RM4A 2B5VA 1EUDA 2VRBA 3LC7O 2DLDA 1M75A 1WDMA 3JQ8A 1YL7A 3MCVA 1T24A 5G0WA 4E5NA 5ICSA 5CEJA 2VZ0A 2AXQA 4PLVA 3GK3A
chains in the Genus database with same CATH superfamily
4RKEA 1JLMA 1ECCA 1MO5A 3EGXA 4R8KA 1C4XA 3S2SA 3DMYA 3NB0A 2BSAA 4MXDA 2I8AA 3EIEA 4R1MA 3SJUA 3AXTA 4R8SA 1GG8A 5C8VA 2FFBA 2Q5OA 2ZITA 3BMQB 3B51X 2IHVA 3IAM6 4EJSC 1W4LA 1PL0A 4QDKA 3WAKA 4TRRA 3RIMA 5LR6A 2IP4A 3KBOA 5I7RA 2XY4A 3OOJA 4M0CA 1SKUA 2NTYC 3KAQA 3QEMA 4BVJA 2WC1A 3KYCA 4BJ1A 4HDAA 4FQ5A 4RAOA 1HYHA 2DSTA 1VG8A 5CEFA 4A36A 3SXUB 4JUCA 1XT6A 4QBFA 3RC9A 1LV7A 2VPTA 4PC2A 4A5SA 1Z26A 5H4GA 3I37X 2H0QA 1JQDA 3GXBA 4PNEA 2DFTA 4BV9A 1QH1B 3SDSA 4KXLA 1R6VA 1Y3DE 5CVJA 4C76A 3OU2A 4NZ9A 1IUPA 3ROZA 4DWJA 4WY2A 1Y89A 4NPAA 1SUFA 4U2FA 3ZY2A 3DB2A 2P75A 2M1ZA 2DY0A 3ABZA 3HLKA 3JRXA 4WBSA 4E51A 4LJ9A 4MHOA 4RDXA 1KS9A 2ISSD 3A1EA 1P5HA 5C8YF 3PC6A 1G55A 4I19A 4J4BA 3UJAA 3ZE6A 1H1LB 3UMVA 4E94A 2QW8A 1Z37A 1IQUA 1XA4A 4MULA 3S44A 1KFEB 3L8CA 1XTPA 4RU1A 5TSDA 1YQUA 1E9SA 1T4CA 4OHPA 3A9UA 3I09A 5AJVB 4EJ0A 3EPPA 4EHDA 3HYLA 3ER6A 3O3NB 4MS1A 5D1NA 1N75A 3KUDA 1QANA 1P5JA 4NMMA 5F7JA 5BOVA 3DVAB 5B4VA 3WRVA 2RKWA 2ECFA 1FS5A 3L02A 1ULHA 3KJZA 1SNYA 5AW3A 1N1EA 1LKZA 3K1TA 3WMWA 4ACBA 4F4HA 5H59A 4A0RA 5JMPA 5HNKA 4S04A 1UEXC 3SVLA 4CFSA 4CT5A 5G40A 5IG2A 2IPXA 4AMZA 4ZHQA 1DJLA 2ESRA 2EFGA 1V16A 2HCTA 2W2KA 3QVOA 5P21A 3CEAA 4XQ0A 3SLRA 5B7PA 4QPZA 3HC7A 2X8LA 2EJBA 3LT4A 1C81A 3NNDA 4A10A 2GFHA 2YOHA 2OLKA 2FH5B 2CFCA 3CZAA 4HZIA 4JQYA 2ST1A 4EPRA 3G59A 4AP6A 3LY5A 1RIFA 1L2TA 1TKCA 3ED1A 1U6IA 4IH1A 3N9IA 1SKMA 5JUWA 2WFZA 2COEA 1EVIA 2VO1A 1TC1A 4IMJB 2II6A 3RFXA 3VA7A 1AQLA 2QG4A 3KSMA 3C7CB 4Q3AA 4Q4AA 2JI6A 3KZ1E 1HYBA 2NQ8A 3L7MA 4QGGA 1YCHA 3O9ZA 4N5HX 4H7IA 3UHJA 1X15A 5BN1A 4D5GA 1S96A 5TDHA 2J09A 1FFWA 1RLTA 1DU4A 3IO5A 1L7VC 3CLRC 4UUAA 4BHTA 4DV6B 1SXJB 1VGRA 4Z9FA 2I5PO 1IQRA 4EA9A 3L0SA 1SN7A 4K6OA 4KTTE 3D9QX 4UBKA 1H05A 3ZV4A 5FWNA 3TSYA 1V41E 1Z2CA 2FWBA 2VDQB 4V02A 1MX3A 3QENA 4XDHA 4AUMA 2ID7A 4CU2A 2R5FA 1OB2A 1GGVA 1WNTA 3DBOB 1LFAA 3MYYA 1N9GA 4U2KA 1TJ4A 3MMSA 5NLLA 3BTSA 4GDFA 4BECA 2F7SA 1FVXA 1NJ1A 5LQDA 2GLUA 5J4KA 3HM2A 5DM2A 4I55B 3MW8A 1QPGA 2IYAA 1NXVA 1P0MA 2ONCA 2IKQA 3KSZO 1BMFA 3KZCA 4WW0A 2B2XA 1KAMA 3PU6A 2AG6A 2J5XA 2ZJ8A 3P9PA 1EFHA 3TYXA 3R7NA 3SHOA 1JLLB 4C89A 1GSIA 1ZJ6A 5T4BA 1RZVA 4RV5A 4O2LA 5I7UA 5BN5B 2AC7A 4WVLA 4UVHA 4CRWB 3WGNA 4DJJA 1FZTA 2IVFA 1XVLA 1YBFA 4C0SA 4N76A 3KX2A 3PGXA 4KQWA 2X3UA 3D64A 1K3FA 5C8YA 2D5CA 5LD2C 2KLHA 3GLSA 1XI2A 4M0PA 4PPNA 3OCYA 1U2TA 1RPNA 3NMUF 2FE1A 1J2UA 4LFAB 1IU9A 1VIVA 3GCDA 4Z9YA 3UPUA 4PZYA 3UMJA 2HIGA 3FETA 2CD7A 4FFVA 3UFXA 5CLHA 2FPPA 2IOFA 2D1FA 2FPGB 4E22A 2JATA 3OZSA 1Q0LA 3O0DA 2GF9A 2ALJA 1GGFA 5BV8A 2ZIGA 1KJJA 5AW6A 2X40A 1VOTA 4NULA 4LXQA 3L7AA 1LSSA 1W76A 4P92A 4QBGB 3WQRA 3MUOA 3C24A 4JA0A 2HZ7A 1XAJA 3ZDAA 2W00A 4RKWA 1Z2EA 3QWBA 3W5IA 2Z0MA 1R0WA 3C1OA 3NRCA 5CAEA 1IATA 2M98A 3HBFA 4J6EA 4EYQA 3IDAA 2G6BA 3TKYA 3VKGA 1H6CA 1LPAB 5MDHA 3AUJB 3HXLA 1V5IA 2NT3A 3PKJA 1SUIA 4LJLA 4ZEVA 1Z5WA 4GO1A 1TB4A 2RGBA 2WYOA 3TCKA 3VR4A 4IOLA 2UYQA 2O4CA 1QWOA 1R4MA 2X6RA 1V0JA 2OBNA 4K6MA 4XSVA 5BN3A 3A0RB 1U8ZA 3N5CA 1NUTA 2H29A 5ITWA 5BVGA 3O8CA 2ZRLA 1F8YA 1TUIA 4X63A 3AVXA 2G6TA 1FFGA 2QRVA 4RF5A 5EESA 4CG3A 5AM2A 1PWEA 4DA7A 4CTMA 5HFJA 3AJAA 4N0DA 1QRAA 2LXNA 3MTGA 5EFZA 2Q0QA 4GMHA 2W43A 4CL0A 1SRRA 1LW7A 1RHRA 3AHHA 3CGWA 3UUWA 2WD8A 1T1EA 1JE0A 1OZAA 1E4VA 1JKFA 1XZNA 3D7RA 1J8MF 1RDFA 4YC7A 5GY7A 4CCSA 5FEUA 1CVRA 2B94A 3K09C 3QYFA 3N75A 4IS2A 5FT9A 4AKEA 3EXIB 3U37A 1RJ9A 3BOSA 5D84A 5A9SA 4KXMA 3SE0A 3U7JA 2X7JA 3RF6A 1MO2A 5JXWA 2JLVA 1NBMA 4FINA 2QVBA 3EXAA 2PYZA 4YRFA 1NYLA 1NSFA 1W25A 2VFAA 4HAIA 2AN1A 4TSFD 1YDHA 2J3KA 3JXEA 1CZRA 4L28A 2O48X 1IPEA 3A27A 4MVYA 1T3HA 1E2KA 2N47A 2JL1A 1U9IA 4Y2VA 1R5BA 1UT6A 4RELA 3CLUD 1KYWA 2A9RA 1BA2A 4DR3B 2PUTA 1UZAA 3LUGA 4U00A 4I4LA 4PLYA 5T8KC 2DR3A 3TINA 2EKQA 3EDMA 3TS1A 5HZGA 1AGRA 5BYBA 1UBJS 1XJQA 4L4RA 4LYHA 3LTNC 4YEDA 1QCYA 4TLBA 4IP0A 3EPKA 3AHDA 1GNLA 1Y3BE 2WA1A 3QWFA 3KAKA 5LUAA 1EFVA 1BXRA 1NN5A 2BFMA 3SVTA 4N48A 1VKJA 3WWZA 4EVIA 5GJCA 1YSCA 2O8FA 3A1WA 2BSQA 3ENNA 1VJ1A 4NBWA 2YS7A 2XT6A 3RYIA 3A4NA 5HMMA 4B7AA 3AUKA 4MUGA 3R9XA 2RBEA 1KAQA 1YZ3A 4YRMA 3N05A 5MFZA 4LF7B 4II7A 2HC9A 3RCBA 4TKMA 2H1SA 4ZVRA 5F7XA 1SZPA 3REQA 1JKIA 3EA4A 1N4AA 1N0UA 1DIBA 4FFLA 4ZK6A 3A10A 3H2KA 3LD9A 3UZUA 4LZJA 4Z0PA 4YLEA 4BV8A 5JNRA 2R86A 1BHO1 1P44A 2XYHA 4DQ0A 2MCFA 4CEIB 1QGDA 3DYIA 4MRMA 1XF9A 1GTRA 5LQUA 1MV8A 3EA5A 1TKRA 4NP6A 5TRTA 1CDZA 1MT0A 1ZHFA 4X7PA 4C20A 4RTJA 1NQWA 3Q7TA 2XQFA 1RJFA 3QE2A 1VJTA 2WIAA 1JB1A 1Z4LA 4OHVA 4TV8F 4BLRA 4LGVA 2AJBA 3HFRA 1L5SA 2FZWA 5J43A 3UNXA 3HG7A 2C77A 1TYDE 1K9SA 1X9GA 2XNHA 1QO7A 3COWA 2QI9F 4TX1A 3OFKA 2D4HA 2OT3B 1REQB 3NCTA 4HNSA 3E58A 2A2ZA 5DT2A 4EFDA 3AQ4A 3CEMA 4UAJA 5IJXA 4OK5A 3REOA 2GUWA 3RS5A 1P1BA 3D6NB 3BIOA 4E14A 5I4BA 1JXMA 2HA6A 2XUZA 1JA1A 4KMRA 1TVEA 2VHWA 4MW0A 3L1IA 2OBYA 2IGTA 3HA5A 4FMDB 3CF6R 2R8PA 5JHHB 1RWMA 4UMDA 1CR1A 1QFMA 3EA0A 4W6ZA 4FHCA 4LJ5A 4IIJF 4BV2A 1XQWA 4HGQA 3RYHB 3NALA 1IL0A 1W44A 5FWYA 4KLZA 2OBFA 1P2FA 4GYJA 4P3YA 3EVAA 1GM5A 1LLCA 1MOSA 2OZLB 4CF4A 1UDAA 1K7XB 4NOMA 5JDIC 1JWBB 3KEFA 3LP5A 4F06A 4DBLE 1TZKA 2P9GA 3L7YA 2PMBA 4WCDA 1YQTA 2OHVA 3F7MA 3PGA1 2C7PA 1WD7A 1Z17A 4BLVA 4EG6A 2V6JA 2AFIA 2ANBA 2Y71A 1NKTA 4QGHA 3EWSA 2HPAA 2XUPA 4IILA 4TTPA 3C97A 4RS4A 7ABPA 5K2MA 3OZDA 4LDNA 3DUFA 3N6XA 2ECOA 2WE8A 4KR2A 4FCWA 1AN9A 1EK2A 1GFWA 1R10A 4MV8A 4QULA 5LQJA 3OZ7A 3S2YA 4DTCA 1MAVA 1MJ5A 2WU4A 4B87A 1ADGA 3H8JA 4GYWA 3AVTA 3ZDEA 2PRZA 1PZEA 5C1BA 3U4IA 2ZYVX 4ER3A 5FPPA 2G4CA 3IVMA 3TTWA 1GQFA 4BNMA 4QU0A 4EL5A 5LYJF 4JL6A 4G09A 3F6BX 1BS9A 1MDBA 3UAVA 3CUYA 3IIKA 2J4DA 4FVTA 4UATA 4K6CA 2OOSA 5FWAA 4B4KA 1E6UA 3BN3A 1BO6A 1JQAA 1G21E 4OTZA 2EX4A 1CQWA 3RM3A 4F9EA 2NQTA 2X19A 4C0QC 2A9VA 1JFRA 4PBRA 4G2NA 2WSIA 3FDIA 1A9OA 2X8JA 4ZOLF 3ABSB 3GRRA 4HQNA 1ODLA 3E9ZA 3OUUA 3E9CA 3DHNA 2FDXA 1N6OA 4KVFA 2VHZA 3QUQA 3WL4A 2EL9A 1UKBA 3NG1A 2PMCA 2DBZA 3BMOB 3GLHE 4EZBA 3FPBA 4JI7B 1VB3A 1BE8A 1QF9A 3F8TA 3LIIA 4DV5B 3JYNA 1E96A 1SOMA 4YBZA 2PJZA 4OHFA 3EOBI 3RVJA 1Q17A 3DL2A 4QE3A 5K5EA 5HEKA 3BCUA 4TV8A 3EVFA 2HLPA 2Z3ZA 4C5BA 3TECE 2V4UA 2PANA 4Z4CA 1TF5A 4O4JA 3E3MA 3QEKA 4YRNA 3K9QO 8ABPA 3HKEA 4TVKA 1IDOA 4R7ZA 2CT8A 1D1QA 1R5JA 5ESWA 5FTJA 3QPDA 1KKUA 4G0ZA 5AKHA 3VDXA 1JG4A 1XZEA 3BVPA 3SX0A 2EKLA 1FFBA 2P5SA 1CU1A 3PBKA 4NYMQ 4ZODA 5A02A 1C3LA 2Y27A 3SI7A 1QKJA 3I45A 3JWHA 4M46A 1ENYA 1D4OA 1KOJA 1Y1SA 4YXWA 5JS2A 3K0EA 4BX3A 1EFDN 1G2IA 1U8FO 4QJBA 4QX6A 2VUSA 1K4MA 4G8DA 3PGLA 5AXAA 4K0RA 3ZE0B 4B0PA 3QFRA 4CETA 4IIJA 3KTAB 2YWHA 2JJ1A 1JFLA 2GZHA 3MCZA 4DC0A 3BMNA 3TE7A 4DXAA 3VOSA 1QIKA 3WO0A 1L5MA 3IOEA 3D31A 3KKEA 2WEKA 1K8RA 3VO9A 4C0AC 3R5SA 2AN9A 2G7MC 5G41A 3CMCO 2CB0A 3O4GA 4ZOAA 5JEDA 3BJIC 4ZI3A 4CV3A 3P19A 4HAOA 3DLHA 2ZROA 3KSUA 3LX4A 5M34A 2GN8A 1F9AA 1SC4A 2VYCA 1FZQA 2I29A 3D6MA 4CMEC 2VTBB 4DDUA 2QN2A 2FQWA 4TS3A 1XWIA 5AJUA 3GFTA 1U1FA 4M0LA 2Q9CA 4FEGA 4ZT6A 2X5NA 5PGMA 5A4MS 4BYGA 1O6BA 4UKDA 5HDBB 4A0SA 2XOKD 2GPNA 4LSWA 1E2BA 3DO8A 1K7CA 3Q6NA 3FW1A 3R24A 1Z6QA 3C6BA 3FM9A 2IYPA 3DNFA 2VCEA 4H35A 4ZT2A 3I58A 1DEKA 1E5QA 1UBGA 1FJHA 1TRHA 4M9UA 5EY5B 1YRWA 4ZVNA 4ZJUA 3G6KA 4DDWA 3GT4A 1V1JA 4BQOA 3FGPA 2GXQA 2PIAA 3WJ2A 1V11A 1YB4A 4AC9A 2PKRA 2JLSA 4FFWA 1SUSA 5LJIA 2Z3WA 3DMFA 5AM3A 4J76A 2H1CA 4QM7A 2ONKA 3CB2A 4MEBA 1YIAA 2NN3C 3B8EA 4NJEA 2I2CA 4QPPA 3V8NA 1CULC 3A1DA 1CDEA 4RXUA 4EGSA 2BBTA 4ZOLA 4RH0A 5A3QA 1KYZA 4MR8B 3L4BA 1SBNE 1SU8A 2VEDA 4LXYA 3PIRA 1U8YA 2OV8A 3EBLA 1O5OA 2I4TA 1VCNA 1OHHA 2FX3A 1NM5C 1H2YA 3C16C 3IHKA 4X1OA 1TZCA 3SYMA 4L6CA 3QGMA 1DT3A 4QNMA 3DDWA 3EIFA 5DGTA 2A4KA 1V47A 3L7OA 4ZI7F 5DNYB 2RC5A 1RJEA 5KX5F 3JASA 4Y3UA 3CCBA 1JR3D 3P9NA 5AKJA 3VZPA 3OLXA 2GK7A 4BX0A 3WQBA 4C0WA 1AKYA 1FVOA 3THSA 2QRNA 4ZOCA 2OWDA 3PP8A 3FROA 1KYXA 2PK3A 3U3DA 3WXMA 1KETA 4Q9DA 3WAJA 5FBKA 1NVWQ 1J8YF 1JBEA 4RD1A 3H0CA 3OX2A 3RIXA 5I9NA 1Q15A 4NBRA 4PYOA 4D81A 1MT3A 3CUVA 1C3JA 3U9SA 2FEPA 4IDAA 2GD6A 3QKSB 2QN8A 1G8GA 5F2NA 3PFFA 1MPXA 2YQ5A 5CVEA 5CUQA 4PV7A 2C2HA 3LHIA 3N2LA 5K20A 1LWOA 4GMFA 1DDOA 5DU2A 7GPBA 3KVRA 3C3MA 2FKAA 4J75A 4AWBA 4DQXA 3E18A 1JXAA 2ZPUA 2OCLA 1KC1A 3IOCA 1LI5A 1QLWA 3CH4B 3LO5A 3NT5A 2QTZA 5DNEA 4B73A 4YRPA 2UUCB 1XNQB 1U0GA 2WYVA 3N8DA 4REQA 5LYJB 3NKVA 1ZUNA 2AQHA 1BCSB 2K2WA 1R4AA 1ZL2A 2RG7A 2RGCA 1GTL1 1PV1A 3DBRB 3GP5A 1IN7A 5FOVA 3V6LA 1PGOA 4RIHA 1DBWA 1DUSA 1MIOB 3IQEA 3SZGA 5CM8B 2OA0A 1DOHA 3UQYS 2ODTX 3NUQA 3O8BA 1FNMA 4OQZA 1SXPA 2O3TA 3EDRA 5K0FA 3AEXA 3O26A 1E98A 2QRMA 4N0PA 1ADCA 5ICFA 4KRGA 3INRA 4EI9A 3KLBA 5DGDA 4N8SA 3P2EA 2EEZA 3K8QA 5KQSA 3DAFA 3IHWA 2R751 3BE5A 1KMMA 3DZFA 4GLOA 4QGFA 2UZ1B 3HA2A 3I92A 2VP0A 3S1AA 5JS8A 1A77A 3UEOA 1V4VA 3O4RA 3QX9A 2N46A 1I4LD 2OK7A 3KOZA 1C9YA 1GRCA 4NCIA 4OJKA 4U63A 3GWGA 2FQYA 1EVKA 4FE3A 1ZNWA 3EZNA 4KWIA 2LWIA 3FYHA 3GVIA 4CQMB 2AC4A 1UM9B 3JARA 3WBFA 4B2PA 3GJQA 3WGMA 3OTIA 1D6SA 2GRAA 2KMLA 3F5QA 1Y3HA 2OC4A 3TPZA 3QYPA 4IVNA 3W7BA 5LQNA 4NPCA 1U0TA 3NORA 1G8YA 1LDBA 3DJFA 1FSZA 1RVV1 3G0BA 3HVUA 2YYYA 3VKWA 2R1TA 5KUTA 1CQZA 2RHJA 3T54A 4KSCA 2TMYA 3FF1A 4J16C 3B9BA 5TQVA 1U1CA 2RHMA 2FV8A 3NATA 4JEHA 3TVTA 3GBSA 4ZYLA 4CKEA 4H1WA 1JR6A 3V8EA 1KYIA 1DFGA 3C43A 4Z9BA 1J4AA 2BMVA 3N3BC 3Q3HA 2G1PA 4CIWA 1NJ8A 1GARA 3R09A 4QAJA 4JLVA 5DLQC 4ZI7A 1XP8A 2A59A 4I2VA 3G5LA 1VP3A 5KX5A 3T7TA 1J5XA 2JAPA 5GGXA 3VNAA 3EG5A 2YZ7A 5FPKA 2WTNA 3VMFA 3ZJ4A 2WFAA 1EJ0A 1US8A 2OTCA 3I9FA 3TLJA 5CITA 5KQPA 4GXNA 1U7DA 2NU8A 2R1UA 3PFIA 4HTFA 4IJ5A 3TD9A 4UOZA 3BT7A 1XD2B 5HQTA 2FPSA 2PMEA 5AOVA 1PEAA 1YXMA 3OFVA 5HW0A 2BCEA 4YNBA 4ILKA 3RVSA 1S0UA 2BJWA 2XNDA 1G8SA 1BZYA 1HRDA 3A4MA 3GDGA 2QGFA 2EJTA 3C0KA 3I1FA 4EF5A 5J4HA 2D6FA 2X5JO 4DM4A 1U3UA 3HZZA 4PGGA 4UTVA 3LW8A 1HDGO 3M49A 2FQ1A 1VJ0A 4LVNA 4XD2A 1TMOA 1VHWA 2GR9A 1PR0A 3CSDA 3H4IA 3IXLA 2FLVA 3WNBA 5KSWB 1Y81A 4GX1A 5J3JA 1J33A 2DH6A 3DFMA 1W34A 4HD8A 5TQ2A 1N1GA 3H4VA 3P97A 3VZSA 1T9BA 2PJDA 1TUEA 5HIIA 4AZ0B 1UC9A 4L95C 1MR3F 1U11A 3FLBA 3L0DA 2R60A 4EPXA 4ZQCB 1B4DA 2J41A 3I05A 1NNEA 1KDYA 3EXG1 4IH9A 1GG5A 1PT5A 1XXLA 3FNFA 1X9IA 1W5EA 1VB5A 1XVUA 3S2IA 2XGJA 3KYDB 2V45A 4LZPA 1NVVR 4N03A 4L07A 4BS9A 1NW7A 2PD6A 4B40A 3Q72A 1GA1A 3ND7A 3H11B 4IY1A 2C3YA 4OJTA 3EZGA 4DMMA 4JUIA 1H85A 2A5DA 2VXCA 3IIIA 1X8KA 5FJIA 1E2UA 2QY6A 3C1TA 1KR5A 5IW8A 3TCXB 4EW2A 3ESDA 4HWSA 4N7JA 3CCCA 5DN6A 3RDPA 4Y30A 2M1XA 1U0BB 1IBLB 5HDQA 4IICA 2FR8C 4EKEA 4ZGGA 2FAXA 3ER9A 4BQIA 1DRUA 2GZAA 3WK8A 1UWCA 1TLTA 3OCWA 3CH6A 3OQIA 4NE2A 3MLEA 4M2LA 1SHTX 5FTNA 3ND6A 2Z8XA 1YNOA 1ZNYA 3NCHA 1XN1A 2CL0X 4BLUA 2ZZNA 3WADA 2E85A 5J9FA 4YAUA 1PR6A 4IO1A 3RGWS 4UOQA 4P53A 5ESXA 5D3MB 4DJAA 2C4HA 1EUDB 2PEZA 2AN4A 4RSMA 1L8XA 1ZN9A 4GUAA 1F0KA 1MLDA 2ODBA 3RT9A 5L6MB 1DL5A 2RDMA 2OGUA 2FY8A 4AYXA 3IUEA 4DE5A 3KLPX 3FGOA 2XI4A 3K9NA 2XQVA 5CP8A 5L7WA 4HDCA 6AT1A 1IEVA 4JWTA 2BVNA 8OHMA 2VOJA 3EQZA 2CYCA 3GFBA 4E1BA 4G0VA 4ILEA 5KS2A 3NTOA 5GVRA 1PFYA 2HOQA 4XVCA 1AHNA 4QQRA 1XNRB 3C5WP 2Y0CA 3LSYA 3KZOA 1XDWA 1DIOB 3ASUA 4PSUA 1OX4B 3VI4B 3SHTA 5F2OA 2HDWA 4FOLA 4D6PA 1QMPA 4MGHA 4WEQA 2I67A 4X91A 4PSAA 5EINA 4M1YA 4KL8S 2GBIA 2FRXA 1YJAA 1LXCA 2Q9AA 3L4KA 3GGOA 2ZS7A 1QKIA 3HDHA 4FILA 4QUGA 1N6RA 4C5CA 4KPYA 1JKMA 3OTQA 4X95A 3FCEA 4GKJB 3BH7A 3Q3CA 3OOYA 2F3QA 4PGFA 3PSAA 3R6WA 3ZHBA 4CR6A 1XVTA 5ESRA 2H1OA 1BN7A 1E69A 1H1DA 1MORA 3D3WB 3G0IA 3TFOA 3CSUA 3FJYA 1PNQA 4P4TA 1NV8A 4HDKA 4EEZA 3HSYA 3W9BA 5EQDA 4KHZA 2Q0HA 3THXA 3SQXA 1N7IA 2GERA 1O87A 2P9CA 2WWFA 3I6QA 3Q7QA 5JS6A 3TR5A 1RZRA 3WNDA 2OZEA 5IS2A 1SQ5A 3GCWA 4JLUA 5I7VA 5LN1A 3MA0A 1I14A 3A9CA 3PFBA 4M3NA 3W8DA 1Q5PA 1Z9BA 4MJLA 5CFRA 1IQ0A 1OH6A 1II0A 3ZZ1A 1TRKA 2R7MA 5C3UA 4D3FA 1W4AA 1YS1X 2J9RA 4HFNA 3ZVLA 1YBVA 1AKUA 2VP3A 3VISA 4NTZA 1ZCZA 2D1SA 4TWBA 5AVSA 4OQDA 5TJ9A 1BOFA 1S2NA 1E1QA 4UM9B 5KTKA 1I36A 4E88A 3CR3C 3BEOA 1J5EB 4EO9A 1TX4B 1TQ2A 2PVPA 3CT4A 3DZJA 1NIJA 2VDMB 3GMSA 3H04A 4JL5A 3SJBA 2UZAA 5KYGA 1VC2A 4TMZA 2JASA 5REQB 1DAKA 2O7SA 2NLOA 3IL2A 3KQNA 1S2GA 2PTHA 3PVSA 3HB1A 1N34B 4G41A 1Y34E 2C92A 1OLSA 3ANYB 4RD0A 4RVCA 4KSYA 1XYGA 3UG7A 1YHZA 2C8JA 1P4GA 2GZ2A 1DAPA 5AVYA 3FNEA 1SD1A 4OMDA 1DZIA 4NDZA 3NV7A 2C7BA 2JJ8A 4EUFA 2F1KA 4JBLA 3JTMA 2P6RA 4MICA 1O4VA 4V0ME 4IR7A 3MVEA 1R5OA 1CY8A 1ISFA 1OVMA 1U0EA 1XQ1A 3OU7A 3OZUA 4S0XA 3SU8A 4ABTA 1MB2A 4XE5A 1KJ8A 1U9YA 3ISTA 4LYEA 1HDIA 3F4LA 4QTXA 2JFOA 3W2FA 4KQMA 1UKCA 2ZW9A 2B4TO 1QGUB 3NGLA 2P5UA 1RQLA 3OE5A 1J7JA 4B3GA 2JI4A 4GX5A 1UBMS 3F5FA 1P17A 3OFND 1T2DA 3IHLA 3X1MA 5BUCA 3B85A 4U9HS 5BMOA 1Y5LA 3ZU4A 3UJNA 4LJ7A 1NULA 3I4LA 1CVIA 1IBRA 4X90A 1NY6A 4DLYA 4CGYA 1Y1KE 5JH7B 4ARCA 3LDHA 2HRZA 4UQPA 1Z6XA 3LFUA 2MYUA 4H27A 2UDPA 3DAYA 2Q5JA 3I9OA 2IHKA 3WZMA 4JXJA 1P77A 1E8DA 1SG9A 1XKQA 2Q3EA 4RQAA 3FKSD 5AKXA 5I9MA 1OWLA 2HADA 1L1FA 1TM1E 3NUGA 2OYCA 1ECGA 3BCRA 4UASA 2XSZD 3TD2A 4D92A 2PO7A 3KT3A 1FUEA 3LU1A 3H9QA 3PNQA 3X2SA 4C7JA 3RVKA 4B3XA 1U7TA 3O4IA 2WR8A 3KHKA 4JJZA 2VDJA 3FBTA 5JI3E 4JI3B 1NVEA 3GELA 3E9MA 1F1JA 3WYEA 1C0PA 5K0EA 1KJ9A 3E61A 5C81A 2DFNA 3F9CA 4BZPA 3WP1B 7ADHA 3SZRA 4JQSA 2I2BA 1Z2AA 4R16A 1PFUA 2OCXA 4XFDA 5DNVA 3D8UA 4GOLD 4D4LA 3GCXA 5GIOE 2CFOA 2EFJA 2XGMA 2GEKA 1W19A 3AF2A 3WGVA 5BR4A 3DW1X 1JS1X 1T5LA 1V48A 4DRZA 5IN5A 1Z06A 2SCUA 2V1XA 1HO3A 3L6CA 1JZSA 1HDZA 3PCXA 1TD9A 3LVBA 3PRHA 3ANTA 3A1NA 1V1RB 3IKLA 1DHRA 5A9TA 1SQGA 2OG1A 3HEMA 3ZDXB 2Q9BA 2UYHA 4PCLA 1IUOA 5KHLB 2P9FA 3U6KA 4DPKA 3CRNA 1G19A 1PZHA 2ATXA 3EG9B 2IPMA 4YCMA 1GNRA 2CLHB 3P0FA 2FZGA 3DDHA 3W5BA 1QIDA 2HMTA 1CS0B 1N6NA 2ZT8A 3BFKA 4RF2A 4JI5B 3RVLA 1N5IA 3DHEA 3AKYA 4MPDA 2B61A 2BEUB 3H86A 5JQGB 1SPBS 4TT8A 1M1YE 2EW2A 1B41A 3GNTA 4F2DA 4CCYB 1AHIA 3FG9A 1DADA 1ZISA 2IZ1A 4QHYA 1B8PA 6NULA 2FFHA 3ZJVA 1EDEA 2VOEA 1NMYA 1NU8A 2ZUBA 2AIRA 2I4MA 2WAYA 1YIDA 4CNBA 3FXAA 2C20A 2VT7A 2E9SA 2LPMA 4P35A 5CNJA 5EA2A 1V2GA 4E2ZA 1O94A 5EIFA 4EQZA 2HK9A 1WF3A 1M2VA 2V03A 1OZHA 1UT5A 2CXHA 2RGDA 2I3BA 3BXXA 4B47A 5CVTA 2JLZA 2NYUA 3FDZA 1G5RA 2O7RA 4LMAA 5I4IA 3LY9A 2F1IA 2AE1A 1ONSA 4J91A 1V7ZA 4RZXA 4HQLA 4PC1A 1A9TA 4NMHA 2AEFA 4LK3A 5I7OA 2ZUFA 1SCUA 3CZ5A 4ZVMA 1T1GA 3KTOA 1QGAA 3P2JA 1C9MA 1FDIA 1ULTA 3F4BA 4FGSA 4I4TA 3RKSA 4C4SA 3K0AB 2OQIA 5C32A 1ISPA 1IOWA 4ZYWA 4MPTA 4ZYZA 2I3GA 4C04A 1LPNA 3HJGA 3NIWA 1XAIA 4RVOA 3VPGA 3L4SO 1LV8A 5DWVA 5A3SA 3WK7A 3OTHA 4HF7A 4PRKA 4GM4A 4UEKA 3MWFA 1J24A 3DWGA 4OHCA 2WQ7A 2CY0A 2G1JA 2JIBA 1IN4A 2PS0A 2Y0EA 3D3KA 2EG9A 1SCAA 2AXEA 1JVNA 2QGNA 4XIJA 1KEEB 2GZDA 5TV2A 2JH3A 1RFGE 4CMKA 1QK3A 2O0HA 2PZEA 3M4NA 4RD6A 4JR2A 2VWPA 3ROXA 2FMTA 2I6GA 1I0LA 5JDCA 1O97C 2JDID 3ORQA 2P2LA 1XNJA 3RYFB 4BNXA 4AY5A 2A88A 1EK1A 4P86A 1GFSA 3R0QA 1T4BA 2G9NA 4PCUA 4PTYA 2I2FA 1E5TA 1YU6A 2RGEA 4RJTA 3QJYA 2JLRA 5A9RA 2OV2A 4RVHA 4U2BA 4F7WA 4DBLC 3R9WA 1JNYA 2NPOA 1NX9A 2C5EA 1H2RS 5JY6A 1X39A 1XHFA 2WD7A 3V4RA 4EKDA 1F7VA 3BXGA 2ZJAA 3LPCA 5AW0A 1CB7A 2ZUEA 1V8PA 2C8LA 4FOSA 3U4HA 2AXNA 5ICMA 5E3HA 1P73A 1Z88A 2LDBA 3F1KA 3KYIB 1F2UB 2AQIA 2DETA 5T41A 2DUWA 3KEGA 5DYIA 5C4GB 5BW5A 4M0UA 1QR6A 5ALHA 4LQ4A 4J94A 1LLQA 1BWQA 4OMUA 1ECBA 2POQX 4CKYA 5BVHA 2HN9A 2HRCA 4PHCA 4WA8A 2JFQA 1WO8A 3DD1A 3DHVA 1KZ6A 3GFGA 3GMTA 1O5IA 2W2OA 4XUEA 2YZNA 1ZGBA 5KNBD 4G0UA 3DPSA 1R8SA 3U1VA 4X8HA 3D6UA 1UZNA 4ND8B 5FTMA 3PWTA 5JT1A 3WYBA 4ZQEA 4DR5B 1JDUA 1N78A 2ZIUB 3KJXA 3P9RA 5I3CA 4LMRA 2A7XA 2BISA 2G76A 3CLTC 1HT2E 2Q4EA 4UOEA 2GFIA 3HKDA 1IY2A 4HFMA 4TQAA 4DANA 2Q8QA 4R6WA 2HLDA 2XVXA 4BGDA 3HO1A 1YBAA 3IULA 2FI1A 4HDMB 2GCOB 1M0WA 1N3IA 1XV5A 3SK0A 1AA6A 2WJZB 1ISMA 1NYQA 2J0UA 4TQUS 1XCLA 1V6SA 1VCIA 2YASA 1Q19A 2GHQA 4EHJA 1NF9A 3TOVA 3MJEA 4Z2YA 1JZQA 3E22B 5TMEA 1USGA 2HSEA 1XO1A 2J5BA 2HJWA 2LR0A 4LGCA 2CDAA 3V1KA 1GL3A 4HGPA 3GLIB 1PTKA 4HB2A 1W0KD 1ZM2A 1J99A 4X3OA 2C2OA 4EENA 4MCAA 3BREA 3VPXA 5FPTA 5BSFA 3UW1A 4OSPA 2VWQA 1H9BA 3B52X 2GOYA 2WOJA 2OOKA 3H05A 4XQ9A 5D85A 3UAXA 3H97A 4DA8A 3FMVA 3T0GA 1G6HA 1QUEA 3K9GA 1QM5A 2VNAA 4E5YA 2OMEA 4M6WA 3KE8A 2HDOA 4ZAFA 2YNMA 1BVRA 3QJ5A 4CXMA 3I1JA 2JIPA 2IYFA 3PTLA 3H2BA 1GZ4A 2D0IA 2V9CA 3FUCA 5EJGA 4WK6A 3A9VA 1Q3KA 3K0CC 1XZPA 1HH4A 1I0ZA 2HA5A 2X1MA 3AUYA 5BNIA 3M70A 3DMGA 2JFPA 3FAKA 4H6VA 4ZI5A 2OHGA 3ZGYA 4E2WA 5THQA 1VG1A 5FOQA 2W6JD 4UE6A 4RZIA 4ZP1A 5L4SA 3K5PA 4FTWA 5FV4A 3ZW9A 3M9WA 1A76A 1GLGA 1GQSA 3AJRA 2UV8A 2NTNA 4Y0NA 1MAHA 2VKQA 3E9DA 1N5JA 3BA1A 1SVNA 3P0HA 4G8JA 2DBYA 5DX8A 3TOSA 4Q7QA 5BUZA 1IOLA 1KH1A 1MA3A 1S1CA 2A94A 2B2CA 2ERXA 2PSDA 4L08A 4N39A 4RY9A 2SKEA 5ALPA 1AQUA 3PI7A 1G5QA 3B2QA 4OG2A 2CXQA 4Q4HB 1N5KA 3SS9X 1XU9A 3E53A 3M6XA 1HT1E 2GEUA 3H1PA 2EJCA 4L5JA 3IERA 4TXMA 3NVMB 5DWDA 4UDOA 1QIHA 3Q41A 1BKSB 4Q3DA 4D3YA 5BRJA 3OZWA 1X80A 1FP1D 1GEEA 1II9A 2YXLA 4PIVA 1L5WA 3CRVA 3AVQA 3ZHUA 1WAMA 1N92A 3PJRA 4QU8A 2DPLA 4B79A 2XNCA 1N2GA 3KSBC 5SZJA 1TTTA 2VSYA 2ECQA 1ORDA 4R71A 2CJWA 1E6MA 1ZLYA 3E35A 5DM4A 2JGNA 3WTCA 4H18A 1Y6QA 1AS2A 1U04A 1K7EB 3AEQB 3K0FB 2N1MA 2WT9A 3QY0A 3ZG6A 1JEEA 2HMUA 2P9ZA 4OYLA 4E2FA 4OYRA 4B6JA 2OO7A 3FZGA 1T9GR 2DTEA 1C14A 4LXHA 1M1UA 1OLXB 2HX1A 3L0YA 3RUAA 2PSFA 4ARUA 2GGSA 1OXBB 4Q9JA 4EJFA 3GGPA 4X92A 3EOAI 4IZ6A 3C6XA 1GKYA 4F6LA 1O95C 1V9LA 4RSHA 1D8AA 4OI4A 1W2HA 1F6DA 4BWYA 2WHYA 1FSGA 1P7ZA 3EGOA 3GLGB 4LHVA 1Q7BA 3DHYA 3A3NA 3HNRA 3SLKA 4CUKA 4DA9A 4K9RA 3JZFA 3JWPA 2MINB 5KYWB 3PWZA 1ZM7A 3TIIA 4RW0A 1UDCA 4CLRA 1ZITA 3IUBA 4BZQA 4CMGA 3MUNA 1C7ZA 1MB0A 1O57A 4H77A 1ISRA 4DMFA 1CIPA 1UOOA 1WQ1R 4LCEA 5DEIA 2JAWA 1HOXA 4PSDA 5EJAA 4B4OA 1YQWA 2D8MA 1SXJE 5EE9A 3R6TA 3VYUB 5IBQA 1VSUA 2C9MA 1U8UA 4N5LA 3UAGA 1PHPA 1KDZA 3Q10A 1GKIA 1CQPA 4DF3A 3GRUA 4O2AA 1ODTC 2D7JA 4M1KA 3SJAA 1J22A 4D2IA 3GYBA 3L2OB 1RQ2A 3OCCA 4HATA 5K8IA 1J8DA 1GD1O 1M7BA 2QTCA 2I2DA 5HS4A 1P6QA 2XMCA 1MKYA 3LVFO 1MJFA 1WTAA 2F90A 5DLEA 4EB0A 1VRWA 1ZI9A 4OGGA 2AYZA 2WJ4A 3IBFA 4WDRA 3WA7A 4EQ6A 1R4NB 3CVOA 2UKDA 2FZEA 2VNHA 3TL6A 3AK4A 3B3JA 3P20A 3AR4A 2FW8A 3OZAA 3JVVA 4G89A 4GP6A 4JZKA 1S8OA 3DOJA 3M4JA 4I1OA 5CT5A 3E6AA 2JLCA 5FOWA 3ZK9A 4RPLA 2BWJA 3CE9A 1CRLA 3TNDA 1CBUA 3ESRA 5HQ3A 1TQ6A 3AKZA 2BR5A 4RZQA 5IAGA 3O92A 2NW6A 1PJBA 4MS3B 4YT2A 1OWMA 3I83A 3QPCA 2IRWA 3LUAA 2WDPA 5BMVB 1IMJA 3O3CA 2JGKA 3GFQA 3DBHB 4QRHA 3S2EA 1DJOA 1ILEA 4J0DA 3D6JA 5JYCA 2R6JA 1X9HA 1GITA 3STTA 4MQ5A 4NBUA 2RB4A 3BK2A 4P34A 2OHIA 1PJ2A 3U39A 1R8YA 3TF5A 5DVZA 2VRCD 4S1PA 3GB9A 4HMQA 2IBTA 5D6OA 2BGKA 3SYLA 4GXTA 4RSRA 2R44A 5T64A 1G8AA 4QPJC 1RNLA 2VYVA 1MCZA 2YOFA 3OCVA 3HB7A 5LYYA 4DA4A 1MDFA 2AMLA 1PD0A 3IQFA 2HB6A 3OAAD 4CN9A 4E2XA 3C7AA 4CMAA 1AXRA 1ZR4A 3ENKA 4Y2SA 5ADUS 4F93B 2QGZA 5JI2E 1K6IA 3HRHA 3OP4A 2CDNA 2OAEA 2V4ZA 5CLGA 1JDNA 2HO4A 2B25A 2V5VA 4GZ3A 3DYBA 3BHIA 4PEVA 1L7MA 2GM9A 4IW3B 3PUIA 4G3XA 4UBJA 4AM8A 3TSZA 4JEMA 2QQGA 4AFNA 1URPA 4ITUA 4ENWA 2MYNA 1CUFA 2Q5EA 1JU3A 2PBRA 3I1IA 3VHQA 1FNDA 4M1QA 4H1HA 2JLQA 3DUWA 5T4FA 2YX1A 3I2IA 3AHFA 3PGJA 1Q1NA 1RFLA 5HUQA 1H1TA 1JHYA 2HTEA 3IV6A 4OQQA 4ZYTA 3L4EA 5LZ8A 4DR7B 1XE3A 2W5UA 1WDWB 4ZIRB 2PGOA 3MD0A 4ME6A 2XHEA 1MHPA 3NP7A 4PLGA 1CR4A 3CT6A 1DPGA 2F64A 1N0WA 5CVUA 5JZOA 1ZR2A 1W8IA 4F1KA 5FAXA 1WETA 2FF7A 2H08A 5EGSA 3NHUA 1XEXA 4F86A 2Q5FA 1NQOA 1IJBA 2H9AA 3HCWA 4Y9TA 1U1DA 2ZANA 1YDEA 3LNTA 2X7HA 4QWMA 1DRJA 1K4KA 2GEJA