4B4VA

Crystal structure of acinetobacter baumannii n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) complexed with nadp cofactor and inhibitor ly354899
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
282
structure length
282
Chain Sequence
b'MALVLDGRALAKQIEENLLVRVEALKAKTGRTPILATILVGDDGASATYVRMKGNACRRVGMDSLKIELPQETTTEQLLAEIEKLNANPDVHGILLQHPVPAQIDERACFDAISLAKDVDGVTCLGFGRMAMGEAAYGSATPAGIMTILKENNIEIAGKHAVVVGRSAILGKPMAMMLLQANATVTICHSRTQNLPELVKQADIIVGAVGKAELIQKDWIKQGAVVVDAGFHPRDGGGVGDIQLQGIEEIASAYTPVPGGVGPMTITTLIRQTVEAAEKALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL PROTEIN FOLD
molecule tags Oxidoreductase
source organism Acinetobacter baumannii atcc 19606
publication title Acinetobacter Baumannii Fold Ligand Complexes; Potent Inhibitors of Folate Metabolism and a Re-Evaluation of the Ly374571 Structure.
pubmed doi rcsb
total genus 101
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature ec 1.5.1.5: Methylenetetrahydrofolate dehydrogenase (NADP(+)).
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b4vA01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 4b4vA02
2J5RA 4QFDA 5EPOA 2JFGA 4DMMA 1EVZA 1NNUA 4WCFB 3GGOA 3RJ9A 4RVDA 1ID1A 3L07A 8LDHA 3D64A 5K6AA 4R4JA 3WMWA 4N54A 4GKBA 5FWNA 1C0PA 5ICMA 1P31A 5JAQA 2DFVA 4J2HA 4Y67A 4JP2A 4BKQA 1ZK2A 2CF6A 1HL3A 4U5QA 4YRBA 1JAYA 2JFFA 3MJSA 4YJGA 1X0XA 2P9EA 3AI3A 4Q3DA 4BOYA 5TX7A 3WYBA 1NQ5A 3JQGB 1OFGA 3PWKA 5JBIA 3ZHZA 3GN2A 1NXQA 2RHRA 1J6UA 2WYUA 3QRWA 1XEAA 2QYSA 3D5QA 1C3VA 3PDJA 5TSDA 4YYZA 4TRJA 3RKUA 2BGLA 2DU8A 4BO3A 4RCVA 4L4XA 5KKCA 1I2BA 5I7VA 2VHVA 4XB2A 4DMLA 1A7KA 2WWRA 1VLLA 3MTGA 1SC6A 2PKRA 1IZ9A 1I0ZA 3BMQB 4JCOA 5LDGA 2VRCA 3W4KA 4KP7A 1I33A 1XQ1A 3H7AA 3PPIA 3R0IA 4CMEA 1U2GA 2HDHA 1ISFA 2OUIA 2CVOA 5G4LA 1PJ2A 2B69A 2PZJA 1DLIA 2WE8A 1TT5B 1WP4A 4L74A 3A06A 1XQ6A 4LSWA 3OA0A 4BNWA 1NTOA 1V6AA 2B4QA 2WE7A 2Y93A 4G2NA 4FFMA 1ZSNA 1JWAB 3KVOA 2ZTMA 1WWKA 5I7SA 2EIHA 3AM5A 2Y1CA 4J7XA 1J49A 5B1YA 4XDYA 1K0UA 3L6DA 3WWZA 1SBYA 4IZIA 4BNZA 3D5TA 2IYOA 2Z1MA 4PFJA 2D5AA 1E3EA 3TF5A 2FMUA 1FDWA 2YJZA 3RBXA 1H9AA 3GH3A 1C0IA 2GZ2A 3KO8A 3OQBA 4KDFA 1Z7EA 3F9IA 3WWYA 1Q7CA 1UZMA 1HSOA 1F14A 1Y6JA 2HUNA 3ENKA 3MZ0A 3BTVA 1UDCA 4I1IA 6ADHA 1SAYA 1ISHA 3QVWA 4E31A 4XQEA 3DAGA 3ROMA 4WLFA 4AJOA 3DTYA 3MOGA 3PJFA 4BNXA 4ND3A 4K28A 2ZIZA 5KKAA 1GTMA 2B36A 4R1TA 5A4DA 2JJYA 2NVUA 4YB8A 3I4FA 3ZWBA 4FPXA 4NNJA 3R6DA 3JQEA 3DZIA 4NFHA 5CPBA 1B26A 3RASA 1UXGA 2VRBA 4PGFA 3S2EA 1Z74A 4TRRA 5C7LO 1G1AA 1YJQA 2FZWA 2AE1A 2B37A 1DFIA 4PLGA 4AICA 4B7UA 1BW9B 4MIEA 2Q2QA 3LT1A 2XF8A 1Z75A 1IPEA 3G17A 4CMAA 1F17A 4D0SA 1E1KA 4IIUA 3EGOA 1H6AA 1PGQA 4DQVA 4UULA 4GLOA 3ZWYA 4FGWA 4XEHA 3ZHYA 2AQ8A 1AN9A 1Y81A 3B1FA 1PJBA 4CPDA 3OIDA 3AOEA 4S1VA 5JDCA 3AUUA 4UUOA 3C1TA 4EJ6A 1EK6A 1HETA 4E12A 5AVOA 3MCVA 1X7HA 5JMWA 1NPTO 3PIIA 2X9NA 2GF2A 2PA3A 2CDCA 2C2XA 2EKQA 5TT0A 4IGFA 2O4UX 3FCOA 1N8KA 3EHEA 3FNGA 4IIVA 2OXIA 2NVBA 3LT0A 2YV3A 4MVJG 1GFSA 5JPIA 1WDLA 3WQRA 2FHSA 5FF9A 4WGGA 2AG5A 4ND4A 4OMUA 5DCUA 1R12A 4TKMA 3ZV3A 1W6UA 5CEJA 4RPKA 4WECA 4FC7A 1EUZA 4ZD6A 5A05A 3DAFA 2I5PO 2EW2A 4GLLA 2D1YA 1H5QA 4DL9A 1B14A 4W6ZA 4HWKA 4BMNA 3TZQA 3KYCA 3SLGA 1PZGA 4XJTA 4FB5A 4DLLA 1SOWA 4BKUA 5BR7A 1XELA 2X0RA 2W2LA 2NQTA 3DOOA 3KSUA 5DBFA 1JQBA 4B4UA 2HSDA 5TJ9A 1GQ2A 1PQUA 2HMUA 2DLDA 2V6MA 2R00C 3VVCA 1LEHA 4IQGA 4RPHA 4GVXA 3PQDA 3WBFA 2OORA 2WDZA 4B4VA 3I52A 3FR7A 3VPXA 3NYWA 1XSEA 1B8VA 5T6BA 1V3UA 3PZRA 3C7DB 2BI7A 3GMSA 2D59A 1XU7A 3B70A 1ENPA 1QV6A 4YWJA 4YAGA 1XKQA 3IKTA 5GY7A 2HMVA 1X1EA 1N1GA 4YPOA 1I24A 1R66A 3V1YA 4BO5A 3UFXA 2NWQA 3GN1A 3GAZA 3M1AA 1XG5A 2ZB3A 2IRWA 4W7HA 4XD2A 1I30A 4CM8B 2EGHA 3PJGA 4D46A 3PIDA 2XAAA 4DYDA 1MUUA 3PXXA 5TT1A 4JQCA 3IKVA 4BB6A 3QA9A 3FPCA 3ZN2A 3L9XA 3OM9A 1C1XB 4JLWA 1BDMA 1N7HA 3RC1A 1ZZEA 2BKAA 5ER9A 1R15A 4LCEA 4IMPA 5HBRA 4YAEA 4D45A 1LA2A 3K2BA 4RPLA 1LC3A 1DOHA 4YCAA 1EVIA 4YT5A 2JHFA 3SLKA 3E5RA 2EERA 3HN2A 3VC7A 1E77A 3JQAB 1E7QA 1EDZA 1MV8A 4MVJH 5A04A 1LUAA 4B4OA 1H0KA 2C5EA 2H9IA 2RH8A 4WLNA 4IDFA 3JYNA 2PKQP 1JKJA 2YUTA 5CEEA 2WJPA 2R2GA 4WLUA 3GFGA 1X14A 1MA0A 5DDIP 3N58A 4E5YA 3DR3A 1SPXA 4MVJP 1A9ZA 1SB8A 2VT3A 3BXXA 3U0BA 3GEMA 5IZCA 3GGGA 1P9LA 6LDHA 3GK3A 5BNIA 5GZ1A 5IN4A 4UAGA 3RI3A 1Y8QA 2A35A 4PVDA 5I8WA 1RJWA 3AM4A 3PLRA 4YTEA 4P38A 1K6JA 1BW9A 1YOVB 4JP3A 4A2CA 5I8ZA 3JCZA 5DOVA 3TOZA 1ENYA 4MP8A 1ZO8A 4ZQFA 1PL6A 3L4BA 3NAQA 3QQPA 5F21A 2QRJA 2FR0A 1Q7BA 4GSLA 3UCXA 3VPGA 1CF2O 2EW8A 3K5PA 2H63A 2WYWA 1OC4A 2YV2A 3ROQA 4ALNA 3UICA 2B35A 3E48A 4GBJA 5G0VA 3TDKA 3KYDA 2HKIA 4R1UA 4CL3A 3LC2O 2ZCVA 2I3GA 3HB4X 3UUWA 3NX4A 4D41A 3IOYA 5ILOA 3KLPX 1HE3A 1O95A 3F3SA 1GPJA 1IHYA 5IF3A 4DWVA 5KJFA 4EI2A 2Q4BA 3DO5A 1Y5MA 5I9LA 4L0QA 1UZNA 3JD0A 1XIVA 2EG9A 1K6IA 1N92A 3VZSA 5DN9A 3DOCA 4O5OA 4AJNA 3B1KA 3CKYA 4YXFA 4R01A 1NR7A 1H6DA 1QKIA 1LLQA 2E48A 3KRTA 3X2FA 5T8KA 3EVNA 5JO0A 4GSKA 1TT7A 1HE5A 5JNLA 2FSVA 1UP6A 3GMDA 1PJQA 1ONOA 3PYXA 3Q0EA 4BGUA 2IE0A 3AW9A 3NTRA 4AJ4A 1O0SA 5KIAA 3ADPA 3I9JA 3WLFA 3P2YA 3ROPA 1B2LA 3B1JA 3EDMA 3FI9A 2R00A 4UUMA 1RPNA 4CLRA 1H9BA 4XQGA 1BXGB 4KUHA 4QEDA 2FPGA 1ZSYA 3FNFA 4D42A 1WAMA 5CEFA 1U2DA 2VNSA 1M67A 4PCVA 4E2YA 1N9GB 2G82A 2O3JA 3PQEA 4J91A 1I3KA 2PH5A 2QZZA 1YDEA 1ZVMA 1UDBA 3ICCA 3RU7A 4LRTB 4WLVA 2Y0EA 3KETA 1KY5A 2EV9A 4BQPA 4YR9A 3JV7A 4RQTA 1T1SA 5JAZA 2NU6A 1VSVA 2BFMA 5EQDA 4BIIA 4BNNA 4RLSA 3TL3A 4CLOA 1W4ZA 3CMCO 1HF3A 4CMIA 4AJ2A 3GNTA 1QLHA 3UOGA 1PTJA 4GX1A 4LRSB 3D0OA 5FYDA 1QYCA 1E92A 5T57A 2FR8A 2B4RO 1PGOA 4W9NC 1UXHA 4L73A 4L4SA 4OAQA 5H82A 2X7HA 4F45A 5TIIA 2PKQO 1LLCA 3HQ4O 4Q3AA 3SVTA 2H1SA 3Q11A 1IHXA 1UUFA 2A4KA 3WS7A 5MGBA 3H8VA 3JQDA 1Z82A 3NKLA 4GWKA 2Y1OA 1FMCA 3LQFA 4CM6A 4TZKA 2XOXA 1J0XO 1Q0LA 2PLAA 4HNHA 1HKUA 2FR1A 2P68A 3ZHXA 4PVCA 3GG2A 1CEQA 3QVTA 4YJHA 3WB9A 4EJMA 4XR4A 1P77A 1UP7A 3H9UA 3MOIA 1NAIA 2HU2A 5IDXA 5FFFA 1H2HA 5C3MA 4OGWA 4BNFA 2EKPA 4CLDA 2VHZA 2GN4A 2EJWA 1QLJA 3ZU5A 2W90A 4JXKA 4PIVA 3FR8A 3W4IA 3ZU2A 2X0JA 2PY6A 3P7MA 4XQCA 4NG5A 3WIDA 3VH2A 3GF4A 1AXEA 4HFRA 5A03A 3AUSA 4DVJA 2HCTA 1NFFA 1DRWA 1YB5A 3LT2A 4R51A 3GDFA 1K89A 1YOVA 3H6KA 1E3JA 1A9YA 1Q0HA 3L6OO 1D8AA 1O6ZA 3BMQA 4IQ0A 3CZRA 5G4KB 2CDAA 2X86A 2ZQYA 4OYRA 3FWZA 1ZXLA 2E49A 2PD6A 4WCFA 4FR5A 3EK2A 1ZIDA 3WX0A 2VZ9A 3FNEA 4JJIA 1Z73A 3GDGA 4BNVA 4ESOA 3LK7A 4XRGA 3RUEA 4R41A 1UP4A 3PI7A 5ICSA 2HMSA 1NVMB 1NWCA 1P1HA 4OSOA 3DZJA 3AY7A 2A92A 1O9BA 2JD2A 3RC9A 5KVCA 3IP1A 1DBVO 3AUAA 4HFNA 1C14A 1ZUD1 4AVYA 3Q2IA 7ADHA 4CMCA 3EZYA 3BMCA 4C7KA 2BLLA 1GV0A 1JU9A 1YL6A 3P2OA 1HYEA 3FNHA 4L8VA 5A5FA 3ZV4A 4NZ9A 5KVVA 2Q45A 3VPHA 4RGBA 3WTBA 3CINA 1J5PA 4BS9A 3UH1A 1GPDG 3PYMA 1R6DA 4ZA2A 4UVGA 1NVGA 3HDHA 1VM6A 2DBZA 4FW8A 3O38A 4L76A 5EMHA 3VDRA 4N5MA 3FTPA 3RROA 5CP8A 1CJCA 3JQBA 2AQKA 4JBIA 4II2A 1ZKMA 2NQ8A 4IDBA 3NJ8A 3Q6IA 3K6JA 1E3IA 4MO2A 4R3NA 1YS4A 1LSUA 4XYEA 3QLJA 4NI5A 2C20A 3TFOA 4GKVA 4Y9DA 5CDUA 3K31A 2X0IA 3M6IA 4DA9A 4U6QA 1NQAO 4J6FA 5ADHA 4CLRB 2HMWA 3M2TA 4J0EA 4NQZA 4UVDA 1O89A 4QX6A 3RUFA 4BMSA 4X54A 4BNTA 4R16A 3TZHA 4MVJE 3HSKA 2W2KB 2ZTLA 4HADA 1L7DA 3QE3A 1A7AA 3O03A 4J7CA 2H5LA 4AJ1A 1LJ8A 3D4NA 1CIVA 1JVSA 3OHSX 3ZV5A 1L7EA 4A7PA 1YONA 2PD4A 4YRDA 5GZ6A 1VSUA 1YQDA 2W2KA 2ZTVA 5HS6A 3WYCA 1MGOA 1WZEA 1HZZA 3ZWNA 1EUCA 5JY1A 3O8QA 5A9TA 1HRDA 3JTMA 1GYRA 4FIZA 2C54A 3PJEA 3QIVA 3MWDB 4UVEA 3OBBA 2Q1UA 4E30A 2DQ4A 4FOOA 4ZJUA 1JTVA 4BNJA 3DHEA 4YA6A 2HLPA 4IGEA 4EBFA 1RWBA 2I6TA 1ENOA 2Y05A 4IJKA 1LLDA 1C0LA 2OGUA 2GERA 1UZLA 3S2FA 4TVOA 3UW3A 1E7YA 2DM6A 2I67A 5JDIC 2JKVA 3U4IA 4ROSA 3JD2A 1EK5A 1NP3A 4CV1A 1KIFA 4FQ8A 4L9RA 4MP3A 3BHIA 3LLSA 1K2WA 1VJ0A 3KEOA 1E6EA 1GZ4A 5A5EA 5IAAA 2YHIA 1AHHA 4OQYA 1B3RA 1YBMA 4HXYA 3QV1A 1HLDA 4Q3CA 1JLLA 2X8LA 1H2BA 1YQXA 1GV1A 4J1NA 1LLUA 2CNBA 3QSGA 3OECA 2YQ5A 1KERA 1ML3A 1ULUA 2VNAA 1UXJA 4IPTA 4RZIA 5GZ3A 1OC2A 2EP7A 3WMXA 4EEZA 3T7CA 1JKFA 1E5QA 2CDBA 2NTNA 4IDCA 4Q9NA 5BSHA 1WPQA 5G0TA 2VN8A 2VYVD 1DC3A 1JW9B 3N74A 5HS4A 4NFSA 4QT0A 2AQHA 2WTBA 2V7PA 1NWHA 4BNGA 3RD5A 2GD1O 1GEGA 1KS9A 4RVGA 2HO5A 1ZFNA 5L51A 1YB1A 2HRZA 2Q1WA 4NJMA 4E0BA 4IXWA 1TVEA 2RHCA 2I66A 4KMSA 1ZSVA 4AJIA 4CLOB 5KNLA 3M2PA 4GI2A 3E5MA 1PR9A 3ANLA 3WR5A 1DHRA 2OP1A 3QWHA 2Q2WA 3G3EA 4EW6A 1LXCA 5F3RA 3C7CB 1DAOA 3AUTA 4J1SA 2HK8A 4TZTA 3PP8A 4O59O 1V35A 3C1OA 1CQIA 2J3HA 1UAGA 2NVWA 4XJSA 1YXMA 3TOXA 5C7IO 1ONNA 4M8SA 4R69A 4WASA 4YBZA 3TRIA 4BO1A 1KVRA 1PQPA 2AEMA 3QP9A 3WGQA 2NTVA 3ZNPA 5J23A 2UDPA 1CETA 3F5SA 1OMOA 3KSDO 3DBHA 4NBVA 5DF1A 4DBZA 3I1JA 1SMKA 3UCFA 3CZMA 5BSGA 5KJCA 5EERA 4MINA 3Q2KA 1E0DA 3IJPA 1DXYA 3CH6A 2QYTA 4PG8A 1K5HA 1IE3A 1WDKA 3X2EA 4OOFA 2FOIA 1BWSA 1HE4A 4YJFB 3DBHB 1P1RA 4IMRA 1P45A 1Y9EA 1BRMA 3S8MA 4BNHA 2BI8A 5KJEA 1MFZA 4HP8A 4LVCA 4RJTA 3U3XA 3D4OA 2HAEA 1A27A 4IUYA 4D79A 3AI2A 5HM8A 2JFHA 4J9UE 4XR9A 3IMFA 4HX5A 2PZKA 3QWAA 3F46A 3W1VA 4PLWA 4KUEA 2P2SA 2OL4A 3GY0A 1NQOA 4I08A 2HK9A 4UUPA 4BQRA 1JA9A 4M87A 1U8XX 5AXDA 2X58A 2G5CA 3HB5X 2OP0A 4IJVA 4C7JA 2Y0DA 3KUXA 1QYVA 2RH4A 1U3WA 1NASA 5IFLA 4BB5A 3LYLA 2VRCD 1ZMOA 3FSRA 5T5QA 3JYLA 4TRNA 4A26A 3GR6A 1KOLA 3S2GA 3AWDA 3BTOA 2X23A 1Y5RA 1EMDA 4BO4A 3TJRA 5DZSA 3OIGA 5JC8A 1U8FO 3ITKA 3ZWOA 1QG6A 1MXHA 4YJHB 2C29D 2VYVA 3C24A 2YHUA 1VRWA 2QRKA 3NDRA 3ADOA 3NGXA 3VKUA 3VZQA 4MKXA 2XPCA 1NPYA 2CVQA 4BL5A 1X7GA 3HG7A 4OXKA 3DXFA 3PHLA 3QWIA 5L7TA 4E13A 3K96A 3LZ6A 3SEFA 1YJ8A 1LRLA 4CLXA 4UEKA 2CF5A 2FPIA 2WM3A 5I9NA 2OOSA 4NPCA 1TEHA 3BYZA 1LX6A 3CEAA 4NDNE 2PZLA 4NIMA 1FJHA 4J7UA 5ENDA 3ZU3A 3C8MA 4M86A 4PLVA 1UH5A 5CDYA 1JWBB 4BO6A 5HWSA 1TT5A 1KC3A 3HUDA 5IZCC 1HEUA 2A9FA 3WFJA 3OJFA 5AQ1A 1ENZA 1P3DA 1U4SA 2JD0A 2HQ1A 4AJEA 2AEFA 2IZ1A 3E6AA 4HFJA 4RVUA 3EY4A 3Q9UA 3ZW9A 2NUAA 3NDIA 3A14A 3R1IA 3R3JA 1EFLA 1HZJA 3EC7A 4ZQBA 2UYYA 4CV2A 3DZHA 2V6FA 4KDEA 4U8GA 5COAA 3TZCA 1RKXA 4EUFA 4PLCA 1LDGA 2GGSA 3P19A 4NK5A 3NJ4A 4U0KA 4RVFA 3VH4A 5BQFA 3WNVA 2VQ3A 4E21A 4Q39A 2V6GA 1PGJA 3FHLA 3GQVA 3ZZNA 4CM1A 4HV4A 4OXYA 5A3JA 1F0YA 2PNFA 1P1JA 4H16A 2NM0A 1HDZA 1A72A 3OH8A 4KTTE 5THQA 2QHXA 4JBHA 3DBLA 4WOKA 1SO8A 1ZEMA 4D44A 1SEVA 4E5PA 4QFCA 1YH3A 3FF4A 1T4DA 2I3AA 4HY3A 4ITUA 1D4FA 1F8GA 4RVSA 3NRCA 2RCYA 1H93A 4FN4A 4Z9FA 4DQUA 1BXGA 3DEYX 2FWMX 3F6YA 3U62A 1KEVA 3K73O 2CZCA 1P1IA 3RKRA 1BVUA 1HLPA 3NTOA 4NJMB 1ARZA 4XGIA 2RAFA 4KTVE 4NH4A 4JIGA 4RQUA 2FN7A 1VI2A 2HJRA 4TMFA 3EW7A 2BFAA 2GLXA 4IY1A 2AHRA 3ZWPA 4HBGA 4R1SA 2ZB4A 3RUDA 2VYNA 1RYEA 3AFNA 1GY8A 5CFZA 4F6CA 3IL2A 1J4AA 4BV9A 3GFBA 3WIEA 3VHRA 4I5DA 4I5EA 4QO7A 2CMDA 2GRAA 4CUZA 1B8PA 2C7VA 3D7LA 4G5HA 3PFWO 4N7RA 1SOVA 2WSBA 4NU6A 2VOJA 5DBGA 3JD3A 1YE3A 3BMOA 3OICA 2X0NA 2BELA 2X5KO 3UKOA 1XWFA 1E7RA 3VTZA 4W9NA 3DZBA 2GDZA 2EHDA 1NHWA 4L4RA 5G2OA 4E5NA 1GQQA 3I9OA 1IUKA 5COBA 4D3FA 3GT0A 1HTBA 3E82A 1PGPA 2IEDA 1WW8A 1E7WA 4TSKA 3H9EO 3KHUA 2CVZA 1R0SA 1V0JA 3WDSA 2D3TA 1IULA 1ZK4A 2PGDA 2GN6A 3IP3A 1KEPA 4FFPA 2JAHA 1BHSA 1YBAA 4F6LA 1ZBQA 5A02A 1LI4A 4UEJA 4GX0A 1L1FA 3WOHA 5JAMA 3WTCA 3GRPA 4E6PA 3PYLA 1GUFA 1ZNQO 4BO2A 5FEUA 1Q2XA 3JYOA 3ONDA 4GQAA 3D4PA 2GZ3A 1KVQA 1Q1NA 4MPDA 3N7UA 4ZRMA 3F4BA 4DQXA 5B4TA 2ZTUA 4LISA 4Y6PA 3AU9A 1W0CA 2VWGA 2Q49A 4RF3A 3I23A 3RBVA 1O8CA 1GUYA 1YKFA 2Q1SA 1GCUA 1ZXBA 3DONA 4PLYA 4R5MA 5AOVA 5F1OA 5IDYA 3RSHA 2WEKA 3U9LA 4CL8A 1DJNA 3WGZA 1HYGA 4H3VA 4BGIA 4GGOA 1PS9A 4FDAA 4IDGA 4AFNA 2Y0CA 4RO0A 3ST7A 5G0WA 4DIFA 4Y6SA 4RPGA 4MJLA 4B7XA 3VVBA 1E6UA 2JCYA 4GWGA 1NAHA 1HDRA 3PK0A 1B0AA 3D3EA 2Y1EA 3OA2A 3U49A 1QYDA 2OMEA 1F8FA 1PJCA 2YQ4A 5CDTA 1YB4A 3NT4A 2R6JA 2O23A 3BHMA 4IS3A 3GUCA 1Y7TA 3NV9A 5IZ4A 5ITWA 2EP5A 4JJGA 1ADFA 3T7EA 1T1RA 4JX8A 1NM5A 1EZ4A 1NFQA 4OXNA 1U7TA 4CR8A 4IXTA 3GVPA 1G0NA 4CM4B 4GVLA 1P0CA 2PD3A 3JQFC 1EEHA 2EWMA 5EQFA 2GYYA 1ADCA 3TSCA 1IOLA 1V8BA 1MB4A 4KWIA 2P9GA 1K6XA 3SXPA 3Q9NA 1LDYA 1JN0A 2VYND 1I01A 3WFIA 2WYVA 1ORRA 5L7YA 2VCYA 4PG4A 2W8ZA 2JAPA 2GCGA 4CMKA 3I3OA 1HE2A 1KVSA 4D3DA 1I5RA 4PLZA 4R9SA 2Q50A 4K26A 5JE8A 1YBVA 5U9CA 3JQAA 2NTJA 5KTKA 2Q2VA 2BGKA 4FFOA 1A5ZA 2YDXA 3OFSA 2AA3A 1I10A 4HKTA 1DIHA 5L7WA 1VC2A 1DB3A 3PEFA 3RUAA 2Y66A 3TQHA 4CMGA 3S1LA 3KEQA 2D4AA 3CIFA 2WD7B 1PL8A 4U0JA 4WE3A 1PJ4A 4D7AA 2V6BA 3JQGA 4NJOA 4PG5A 3OJEA 1NR1A 3FPLA 3HFGA 3ZV6A 5C37A 4UEOA 4MVJM 1EBFA 3P5SA 4I5FA 3I6IA 1DO8A 4PLHA 3FN4A 5A1TA 3JQ7A 3MJCA 1A4UA 4O6VA 4GMFA 3ZHBA 2DBRA 3G0OA 1KEWA 4MKRA 1DRVA 1PWZA 3UN1A 4DRYA 5IDQA 4BO8A 5CHEA 1ZK1A 2DUUA 4ZU3A 2J5KA 4NR0A 2NV6A 3PFFA 2IEBA 4TQGA 1VPDA 1C1DA 4MIOA 4S3MA 3ZWXA 3F47A 5TGDA 3R3SA 2EGGA 1BMDA 1EQ2A 2HRBA 2O2SA 3WG9A 4DLAA 2YY7A 1WNTA 5BT9A 3ZNNA 3JYPA 1NYTA 1R4MA 3RC7A 1EUDA 5IXYA 5CDSA 1X0VA 4NHEA 3GC6A 3OEWA 5L4NA 2EJVA 3VPFA 4DPLA 2ZB7A 3F5QA 5ILGA 4ZN6A 4YQZA 4B7CA 2O3TA 3V5NA 1YDWA 1ZJZA 1XR3A 3U4DA 3INGA 4U7WA 1GDHA 4M55A 1SB9A 5A9RA 3UHAA 1NVTA 1ISIA 2E82A 1UXKA 2P5UA 3QVOA 2ZYGA 4R5HA 3BTSA 1MC4A 3UF0A 2P9CA 1UAYA 3AFMA 3I9LA 3KB6A 3NGLA 1Q0QA 2ET6A 4WNCA 1GCOA 3WJAA 4CLEA 4CQMA 4FJ2A 1T25A 1BTOA 4LVUA 4BGEA 1ZJYA 3DZGA 4DIOA 5B4UA 4CUJA 1LRJA 1U3TA 3DOJA 3I5MA 2XXJA 2BMAA 4TRMA 4GX5A 3GDOA 2YHIB 4RV9A 3RUIA 3ZWCA 3QVXA 1XYGA 4NBUA 3WGHA 3V1UA 3RVDA 1GQYA 4N5NA 3E18A 1PJLA 1LNQA 3AK4A 3PGJA 2DAPA 2O3UA 5BNTA 1LDMA 1DC4A 2BHLA 1X7DA 1RM0A 1FDTA 2UVDA 1W73A 2Y1DA 4JN6B 1T2FA 2J8ZA 4UVHA 2B5WA 3ORFA 3EYWA 4K9DA 3GG9A 2JCXA 4ILKA 1LSSA 3B6ZA 2X9VA 4XIYA 1NX6A 4IM7A 5F5NA 4TKLA 1E7SA 4BO9A 2PTGA 2I76A 1PZFA 4O0LA 3WQSB 1F12A 5G0UA 3WQQA 4CMJA 1IYZA 4PRKA 3DWFA 3JQBC 5GMOA 2A94A 3LU1A 1LRKA 2EKLA 2W4QA 2FZEA 4BUCA 3GEDA 3RJ5A 2DPGA 1Z6ZA 3I4CA 2J6IA 3DFUA 5TJHA 3GZNA 1CDOA 1D3AA 1PIWA 1Y8RB 5JSFA 2F00A 3AI1A 1B16A 1LQUA 1PZEA 3W4JA 3GZ4A 1I8TA 1PWXA 3GRKA 2ZB8A 1ZEJA 3V1TC 2B0JA 4YACA 4ALJA 1PL7A 3E03A 2UAGA 4YJFA 1LU9A 1MX3A 3H2SA 1PSDA 4PLFA 5F5LA 3MJVA 1G0OA 3F1KA 3PQFA 1GL3A 3DZKA 4FGSA 4ZGWA 3A4VA 3OF2A 1EDOA 2Y67A 5H81A 5HA5A 4U6SA 1VKNA 2BGMA 1T24A 2F1KA 2TMGA 3HADA 4PG6A 4ZVVA 1KVUA 1FDVA 3DTTA 4K1LA 5I7FA 2QW8A 1ONPA 2EF1A 4QXMA 3VKVA 4IBOA 3A9WA 2O3RA 1HDOA 2IODA 1EVYA 2BD0A 3AOEC 4BNYA 2ILTA 1DHTA 4N18A 4TROA 3WGYA 1Q7GA 2C2YA 1I3NA 3ETDA 1YL7A 3ASVA 1TA4A 4I9UA 4CM7A 4E2XA 3WYEA 3VAZA 2C07A 3GVHA 4UREA 3H5NA 2RBEA 4E2WA 4W7IA 5L3ZA 5JCJD 2VWPA 2Q99A 3ENNA 4FCCA 4GL4A 5JCJA 3O26A 2GNAA 2GPTA 2P5YA 3GHHA 4BMVA 4CQMD 1DJQA 4EUEA 3DAPA 1EQUA 3EZLA 1ZK0A 5TNXA 4NFYA 4Z6KA 1DSSG 2HJSA 3BAZA 5HTOA 5U4QA 4YVFA 3U4CA 1T2DA 3JQ9A 4Z3DA 5IJZA 4CODB 2OO5A 5DCWA 2NADA 3W6ZA 3FD8A 5EN4A 4Z0PA 1ADBA 1KBZA 1Z7BA 2G1UA 3BZUA 1RM4A 3WLEA 3PGXA 1K3TA 4ND2A 2YFQA 4J1TA 5JS6A 1F06A 4GAEA 2AW5A 1E3SA 1M2WA 3BMCB 3WXBA 4MVJF 2DVMA 1ISMA 1R4MB 4YQYA 2FRDA 2GO1A 2SCUA 1E3WA 5B4VA 4NMHA 5F1KA 3FBGA 3L6EA 2DFDA 2IYPA 3NT2A 1H94A 3DFZA 4Z9YA 5K0ZA 1SZJG 4PZCA 1DLJA 4ALMA 1RYDA 2B5VA 2DC1A 4Q3BA 3WSVA 2AQIA 4AL4A 1HXHA 4INAA 3C7AA 2O48X 3H5AA 4CR6A 2NU8A 2QZ9A 4J49A 4O63O 4RDHA 1T26A 2C7GA 4YT8A 1OZAA 3RUCA 3HDJA 2YFHA 5DBIA 2LDXA 3OQ1A 1JKIA 1OI7A 3BIOA 1PZHA 3I9NA 4KUGA 2C5AA 3VH3A 3DBRA 1EE9A 3WGTA 1T2AA 1HT0A 3VH1A 5JCXA 1PU2A 4CMBA 3GVIA 4P4GA 3F4LA 3H9JA 1FDUA 1YRLA 4XGKA 3I9MA 1DFGA 1LDBA 3LT4A 4EYEA 3H9QA 3LC1O 2DBVO 5BSFA 3BMNA 1H6CA 1HDXA 2GN9A 4J4HA 1BSVA 2QQ5A 4FS3A 2X5JO 3VDQA 2JD1A 3H65A 4B3JA 5JY6A 1H6BA 3OETA 4NBTA 1U3VA 2GR9A 2ZQZA 4BNMA 1MXFA 4MVJA 3TWOA 3D3WA 4MP6A 4KZPA 4E4YA 4XRRA 1U3UA 2VT2A 4FOSA 4MVJD 5TRTA 2BH9A 3RFTA 3Q1LA 5JDIA 2VHYA 3HHPA 2B83A 3ZU4A 5IG2A 1XCBA 3NTQA 5I9MA 2JHGA 4DGSA 1WVGA 3O8QB 4EUHA 4B4WA 3QWBA 1WDMA 4J1QA 4A0SA 1ADGA 1QXSA 3K8ZA 2PV7A 4J43A 2DUWA 4IDEA 3CTMA 3SBOA 4CUKA 2QIOA 2Z1NA 3IAHA 1LC0A 4LW8A 5EIOA 3GOHA 1MFPA 3DZFA 1V9LA 4QECA 4C4OA 4IQ8A 1XHLA 1N1EA 2FSSA 4E32A 1ULSA 2I99A 2ZJ0A 3INRA 4O1MA 1PJSA 2LDBA 2YDYA 2WD7A 3DC2A 1UR5A 4WOJA 9LDTA 2GN8A 3UXYA 4F46A 1YVEI 3JD1A 3KBOA 2UV8A 4GH5A 5TC4A 2PH3A 5JXWA 5L45A 2GUGA 2QG4A 3ANNA 3EMKA 4URFA 3IQDB 3WSWA 1DFHA 3RFXA 4CR7A 3KM0A 3V8BA 4OIMA 4WK6A 1GU7A 1LDNA 3RAJA 4Q3NA 1DAPA 3JQ6A 4XDZA 4NU5A 4XYMA 5G0SA 1D7OA 4YRAA 2O50A 3GA0A 3QVSA 4BKPA 4CMEC 2J3KA 5IDWA 3FBTA 4WPGA 2Q1TA 3GNSA 2OZPA 4AJKA 1DIAA 2Q3EA 5K6AC 4WKGA 3B20A 1HDCA 1E1MA 3DMTC 4PG7A 4E5MA 1MG0A 2G76A 1HSZA 3KTDA 2IZ0A 1GYPA 1NHGA 2D2IA 1YQGA 3ANMA 4EGFA 1PQWA 8ADHA 3H9GA 4H7PA 2DTDA 3I83A 2CFCA 4WEOA 2VUSA 1AXGA 4UVIA 4DYVA 1KYQA 3HNPA 4I8XA 4LCJA 4LSMA 4PZDA 4XA8A 5G4KA 2D5CA 4Y98A 5JLAA 3SX2A 1I36A 4ZHSA 4ZQGA 2O3QA 4XWYA 1QYXA 3PTZA 5CDGA 4JROA 4CM3A 2CY0A 2BF7A 3KYCB 4RF5A 2X22A 1P1FA 3DBVO 4ND5A 4B8WA 3PWZA 4A03A 3MEQA 1DPGA 1MLDA 4XYGA 3SJUA 2P4HX 3AM3A 4OH1A 2O3SA 2HK7A 4IJWA 2Z5LA 1UDAA 4A73A 1HYHA 5JW6A 4CM9D 4WLOA 3H3JA 1SEPA 1NQTA 2NLOA 3OP4A 4K6CA 3PDUA 3MJ4A 1WLYA 2J5QA 2AG8A 4R3WA 3STHA 4DIBA 4J3FA 2ZYDA 4R1NA 1DRUA 3BHJA 1U7HA 3DBRB 1OAAA 4BNKA 5AXBA 3SC4A 2WD8A 4BO7A 1S6YA 4E5KA 1C1XA 3KV3O 2G17A 4OOEA 3GZNB 1QORA 3LF2A 1RM3A 4YAJA 2IDZA 5ES3A 1FF9A 5FI5A 1O5IA 4FSHA 4OKIA 5LDHA 3KYBA 4ZICA 3HE3A 2FP4A 3JD4A 3ABIA 4FBGA 3DDNA 4WEQA 2Q4EA 2YW9A 5EINA 2DBQA 2PFGA 1P74A 3S55A 2OFPA 1FK8A 3E9QA 5A9SA 3PVZA 4OL9A 3D1LA 4BNLA 1RM5A 1Y8RA 3TN7A 2B4TO 3D3WB 1R0LA 3LF1A 3PLNA 1I2ZA 2O2YA 4YJGB 2NU9A 4QUKA 2C0CA 3GPDG 5EESA 4Z0TA 5TQVA 2DKNA 4DPMA 3MJTA 3PHHA 5COQA 4ZQEA 4FC6A 1Y9AA 5THKA 3JQFA 3L4SO 1PGNA 1TI7A 3HFSA 1I32A 1IY8A 1XDWA 1ZK3A 3TNLA 3LVFO 3UCEA 2CUKA 1YWGO 4ALLA 3ZGYA 2CSUA 5AYVA 3A28A 1PR3A 4XYLA 2C82A 3BTUA 3ZW8A 1YGYA 3S2IA 1GYQA 1KETA 4BGVA 4KQXA 3C1AA 3W8FA 3WNQA 4DLBA 1BDBA 2P4QA 3NDJA 1GAEO 4J0FA 3M1LA 4AJJA 3TFQA 3QY9A 1HDGO 3RCBA 3QHAA 1T2CA 4R54A 1VL0A 2DTEA 2DT5A 1Z45A 3GLQA 3U09A 3K2EA 4GGPA 1JVBA 2OBNA 4CJXA 4AJHA 4BO0A 2PZMA 4DPKA 3A1NA 2PWZA 4WCDA 5JDCC 3EVTA 1JDJA 1QV7A 4XX0A 4RPJA 4XIJA 4FFLA 1AE1A 4WCFC 3UAGA 4DTIA 2TMDA 4FJ0A 5K9ZA 2G0TA 3HDQA 2BRUA 3TL2A 1E7MA 3L77A 2AEJA 4XYBA 4CM4A 3JQ7B 5T64A 2HMTA 2XXBA 3HN7A 1DC5A 3WBBA 3GVXA 1EFKA 1ISGA 2O7SA 1R4NA 1M75A 1MP0A 5JAIA 2X6TA 4OO3A 4UUNA 5DCYA 5F1PA 3T4XA 1I3LA 3ICPA 2ZATA 3OQ6A 5H83A 1WXDA 5I7EA 3VZRA 3F1LA 3U5TA 1BXZA 2NVUB 1P44A 3TZ6A 4DREA 4H15A 1R4NB 4RL6A 4Z0HO 2VOEA 3UVEA 1A4IA 4A5OA 4I9HA 1E6WA 4XGNA 4XKJA 4YEDA 3OJLA 4BHTA 4JJFA 3IJRA 4CQMB 4CQLA 3EAGA 4LGVA 3ZNQA 4Z9XA 3FRJA 5KVQA 1QP8A 2P91A 3BMNB 4RZHA 5JFOA 5JMPA 2E37A 5KJ1A 2NU7A 4IINA 3I9KA 4W99A 1UXIA 5EJ2A 2NNLD 5TF4A 4EZBA 1E1NA 4CQLB 3DHNA 3JQCA 3RIHA 4D0RA 2VTEA 4FFRA 4G81A 1V3TA 4DC0A 1SCUA 3VTFA 3V2HA 3CSDA 3I6QA 4IJUA 1XLTA 3RFVA 5KVSA 1N7GA 1N2SA 1IPFA 1CYDA 3VPSA 3INTA 1GZ3A 4FFNA 3H2ZA 4QSMA 5DULA 3JQ9C 3ZH2A 3NEPX 5JYDA 4ID9A 1B8UA 4HUJA 4F3YA 4K6FA 4QQRA 4EJ0A 1A71A 1NBOA 4WJZA 1KC1A 2EEZA 3PHIA 4LK3A 2OHXA 4R68A 3O9ZA 3OMLA 3H3FA 5L4LA 2IXBA 4IZHA 3K9QO 4OJNA 3GVCA 2VWHA 4MVJI 5DNAA 4A10A 1UJMA 4IDAA 4M1QA 3IDSA 4KQWA 3G1UA 4BNIA 4XZ3A 5AXAA 4B79A 7MDHA 4RVHA 4CM8A 1XA0A 2H6EA 3KZVA 1BGVA 3IS3A 2NSDA 4E33A 4YAKA 2I9PA 1B3BA 3GGPA 3PJDA 3WGIA 3RC2A 3RQSA 1PS8A 1T4BA 1GUZA 1C0KA 1PJ3A 2C59A 2ZCUA 4OHUA 2ZJ1A 2O4CA 3ZCXA 4JNKA 3E9NA 4OKNA 1YL5A 4NBWA 2E4AA 3LSYA 4YJDA 5DOZA 1PEDA 1VJ1A 3ZWWA 5KCZA 3IIEA 4CV0A 2YV1A 3DHYA 3HZZA 3AU8A 4I9NA 5ER6A 3MJEA 5MDHA 1NPDA 3RWBA 1XGKA 2RIRA 3L9WA 3L4BC 1DIGA 2JL1A 4IDDA 1VL6A 4J4BA 3C3XA 1CRWG 4PZEA 2IZZA 1OBFO 3HJAA 2W2LD 4EDFA 4DUPA 3QW2A 2ZK7A 4JGBA 4N5LA 1MC5A 1FDSA 3KSZO 4QO8A 4ALKA 3AJRA 5ITVA 1I2CA 5KOIA 2YYYA 3CUKA 5A3VA 2FPPA 4CMHA 1DIBA 1IB6A 3DB2A 3GAFA 3IC5A 2PR2A 4GMGA 4JK3A 4A27A 4AJLA 1ZW1A 1AUPA 1WMAA 3H4VA 3TPCA 1G6KA 1PS0A 2X4GA 4OQZA 2GZ1A 3ZWAA 1X1TA 4PLTA 3GHYA 3JYQA 2VUUA 2W98A 3GNQA 5CPFA 1DEHA 4GPD1 1M6WA 3JQ8B 1WMBA 1R16A 3IUPA 4L75A 5FI3A 2Y99A 5LC1A 4II3A 3C85A 4LN1A 1TXGA 2J3JA 3GPIA 3L0DA 5BNFA 1XU9A 3Q3CA 2FY8A 4NK4A 5JYEA 2GSDA 1B7GO 3DMTA 1M66A 1TLTA 1GR0A 3QWFA 3VOSA 3E8XA 1BVRA 1KVTA 4RORA 2AMFA 2AXQA 1U5AA 1ZH8A 1E3WB 2AE2A 1QRRA 3E9MA 3EUWA 5CAEA 3SC6A 1SNYA 4M54A 3G1TA 3CE6A 4PLPA 3AY3A 2ZKLA 4TVBA 5HRUA 4MDHA 2BFOA 3SJ7A 4E2ZA 3T4EA 1P0FA 3LLVA 4JBGA 1GZ6A 5L95A 4IS2A 1VKOA 2X5OA 3DL2A 1U4OA 3G49A 1LDEA 3RBZA 4DXHA 2V65A 3TZKA 1LSJA 4D3SA 2VZ8A 4MIYA 3DBLB 3O4RA 4RF4A 4GX2A 5L4SA 4B8ZA 2X1HA 3RU9A 2VTDA 5BSEA 1EBUA 1LQTA 3DQPA 3FTNA 4YDRA 3ONEA 3PHGA 4TWRA 1AHIA 3RUHA 1OOEA 9LDBA 3IUSA 3ETGA 3ROKA 1ISJA 4Y6RA 4WUVA 3OJOA 1DIRA 1X13A 1YO6A 2CD9A 3OJ0A 1ZCJA 3WJ7A 3W8EA 4NBRA 4EEXA 3V2GA 3HWRA 3NUGA 1VL8A 4Y8VA 5IN5A 5C7OO 2BFPA 4B3IA 4Q3EA 1U1IA 2Y1FA 2Z95A 4XCVA 1V3VA 4HNGA 3AOGA 1X15A 3E1KA 2VHWA 1N5DA 4RDIA 2YZ7A 4B3HA 4KWHA 1IZ0A 4PN3A 5L9AA 1U9JA 4LMRA 3ZWMA 2POQX 1D1TA 1U28A 1E1LA 1HWYA 4ALIA 4RF2A 3OIFA 3PHJA 3COSA 1GD1O 2EXXA 3PRJA 1C1DB 4W82A 3OSUA 1PJTA 2PGJA 1P33A 5DP1A 3PZBA 5JO9A 4QTZA 1QR6A 1KEUA 3NT5A 5TS3A 1MG5A 3ONFA 5IXSA 3ON5A 4CLHA 4W4TA 5C5IA 1I3MA 1WZIA 3BMOB 1CERA 4KOAA 2VWQA 1VE9A 2WMDA 5LCXA 1QMGA 5AXCA 1BG6A 4EITA 2VUTA 4J9VA 3KLMX 3GUYA 4ZQHA 4YT4A 2O7QA 3ITDA 2X9GA 1LSOA 2UUOA 3HDYA 3KYDB 3WICA 1R37A 4WNIA 3MTJA 5TLSA 1P1KA 4G65A 1BXKA 4MOWA 1EE2A 1JAXA 4XB1A 1ZMTA 2Y1GA 3PWSA 5ENVA 4E3ZA 4J90A 5A06A 1VJTA 1QYWA 2PK3A 3W8DA 4PRLA 2ZYAA 4YAIA 1DC6A 1CWUA 3OEYA 4AG3A 3CPSA 2DPHA 4J4TA 2OBYA 5CG2A 1Y1PA 1W8DA 2DTXA 1LBEA 2QRLA 1N9GA 3CMMA 5L53A 3ETEA 4OSPA 2Q46A 4BV8A 3JQAD 1DDOA 3JQ8A 4D43A 5B37A 4P8RA 3JSAA 4M49A 3ASUA 3CXRA 4MKZA 2J3IA 4CV3A 3UGKA 4AJPA 3ULKA 5KWEA 3V2UA 5L40A 1EVJA 3WGGA 4BKOA 1GEEA 1M76A 2PGLA 4HFMA 4I5GA 1AGNA 3ZDFA 4P4LA 4DC1A 4OM8A 1TB4A 4DBVO 4LMPA 1R0KA 1E3LA 3ZNOA 4R9RA 4ONEA 1B15A 5EL0A 3GEGA 4FJ1A 3BA1A 1NFRA 1QSGA 4P4NA 4YT2A 5T8KC 3VZPA 5B12A 4J2OA 2I65A 2Y68A 4BVAA 1D1SA 2E6UX 1KY4A 3MWEB 4P22A 4XQ9A 3ZWVA 4Z3KA 3G79A 1O94A 3K92A 4BNUA 2D8AA 3WGOA 4RLHA 3LDHA 1M6HA 1CQJA 2VZ0A 1E5LA 2UUPA 4ND1A 4ZRNA 3U4HA 5KJ6A 2GASA 3AY6A 4WLEA 1IL0A 3K30A 4J16A 4CM5A 4FD3A 5A9SB 1U5CA 2VHXA 3QJ5A 5CG1A 3ZI0A 3KXDA 4BKRA 3FWNA 4CMIB 2QX7A 5U1PA 1HDYA 1LTHR 3DMYA 1T2EA 3KOUA 1FXSA 2D0IA 1Y8QB 1GADO 2NACA 5DT9A 3LC7O 4CM9A 5T67A 3W6UA 2JCVA 3H5RA 5JC1A 1PX0A 5DP2A 1S7CA 2IXAA 4M89A
chains in the Genus database with same CATH superfamily
1R8XA 1UJ2A 1YJBA 3GRRA 2JFGA 1Z0KA 3VM6A 1CZKA 4DMMA 4Q16A 4EJSA 1VCMA 4DXAA 1IZYA 3L07A 4ZHQA 1FA9A 2EZTA 1P2GA 3HBMA 1SXPA 5EUBA 3R5KA 4GPAA 5KAPA 3VYUB 1YBFA 4KO2S 3DAYA 3ZTWA 3A26A 5FWNA 4ZYYA 4IEIA 4LXTA 4C0JA 2C9YA 4BCCA 3NUZA 1N5IA 3QU9A 4FE3A 2P40A 4BKQA 1HL3A 3K9WA 3L41A 4L7VA 1P91A 3ZS9A 1W94A 5K6RA 1X0XA 3GIWA 3W2FA 1JMKC 4KKXB 4OV6B 3EFHA 1U0BB 5CT5A 3JQGB 3IR6A 3D1VA 3PWKA 3GN2A 1NXQA 2QQFA 4JBNA 4LEIA 1J6UA 5EZYF 3RLIA 3QRWA 1XEAA 4URZR 3RE1A 1ORVA 3AC0A 4LX0A 3TDNA 3D5QA 2NO0A 2J32A 4D8WA 1M10A 3BDAA 4R6WA 4OQDA 4QELA 4ZVTA 3OPVA 2N3ZA 4ESVA 5DPMA 3GD5A 4ZXPA 4FI3C 5AVKA 3DE5X 3RS0A 3CE9A 3D8RA 4OFWA 2NZWA 4PYNA 4AF7A 3TEMA 1K4MA 3BC1A 5LMUB 3QE9Y 2FOLA 2VHVA 3IMCA 5C5DA 2VP4A 5F5XA 4QBKA 1VLLA 3AF0A 4KQ1A 4HAWA 2Q28A 2XTJA 1JYFA 2ZUCA 4I1YA 2F9FA 3BMQB 1RT9A 1X1SA 4OAPA 3UK7A 3VMMA 4ANFA 2CN1A 2VRCA 4KP7A 3CN7A 1P60A 3PKZA 2AXNA 4MCHA 4DSOA 4ENVA 2RKWA 2PL9A 1DQSA 1Q91A 4C89A 1ISFA 2OUIA 2ZYTX 3Q12A 3HJUA 3NOVA 1TW3A 2WE8A 2JDID 1WP4A 1DKPA 4HVTA 4EW3A 1XQ6A 2DG2A 3FWYA 5CLGA 5H68A 3GJTA 1NTOA 4G5OA 4C6HA 1QIGA 3UK2A 2WE7A 4DT1A 3EDOA 5C4MA 4FFMA 2EJCA 4FFBA 4MRPA 2DE0X 3SR3A 3V8EA 3H5VA 3HVHA 4AZVA 4H1WA 5I7SA 4Q9HA 1M6NA 5HFJA 4RY0A 2Y1CA 3L49A 4G5FA 4IIEA 2AMYA 1J49A 1JILA 4CEHB 5F98A 4XDYA 3HKCA 2YR0A 3FUVA 5LOVB 4IZIA 3KWJA 1P6XA 2XIQA 3QOWA 4H31A 4WXPA 4FK8A 1UK7A 2ON6A 4EFKA 1EGHA 4BDTA 3O7WA 1XZMA 4DYHA 2QU8A 4G5RA 2BTEA 4QQKA 2GZ2A 3OQBA 4I14A 3BCRA 1YBHA 2YJ3A 2QTVB 3IFSA 1RFGE 1RWMA 3KS9A 4JWKA 1Q7CA 2W6OA 4LV5B 5AVYA 5H8WA 1W75A 4EL0A 2RBGA 5DNCA 1Y6JA 3ENKA 3VYSB 2IPOA 1KMIY 4UCQA 3IH5A 2K2QB 3BTVA 1WSWA 3KJXA 4L3VA 4TOIA 2AFIE 5IFKA 1ZGGA 3G2HA 1KIMA 3FCSB 3KUUA 1WV0A 2VAXA 5G53C 2A9JA 4XQEA 5A62A 2IHTA 1O0BA 4WLFA 4EUKA 1G60A 1PG2A 3BFKA 1A82A 3PJFA 1U80A 2OD9A 5F3WB 2GJ9A 1ZXXA 1H2YA 3GLFB 2B36A 4CEJA 3NONA 4U7FA 2I8AA 3USZA 3ZWBA 1Y7LA 4HGNA 13PKA 1JJIA 4WWHA 4UEQA 2I9KA 1IG0A 3CLTD 3GXOA 3K0CC 1UXGA 1YB6A 4FXPA 1FZTA 2VRBA 4IWNA 3D8NA 2ZS8A 4OF4A 4Q4HB 3EGIA 2OXRA 1ZINA 2FH5B 2FZWA 2AE1A 2RHBA 4UU8A 1IFXA 4AICA 3C5EA 1BW9B 3RFCA 1GP2A 2Q2QA 4D4GA 3AZQA 3DWEX 2QSJA 5GOZA 4PAWA 4ZDKA 3EGOA 3G88A 2XMQA 3V8NA 2QY6A 5CIYA 3OHPA 1OREA 2I2CA 4HJRA 3MPOA 3DM5A 2CSXA 5BMVA 1M5RA 2QM8A 4LAFA 1M2VB 4RK5A 2D5BA 3VSCA 3H9BA 3A6JA 3AOEA 3IIJA 4S1VA 2IY8A 4LC1A 2WVGA 3AUUA 5ALNA 2HNAA 1T6ZA 1HE1C 4S1WA 1HETA 1DG3A 1L4BA 2E9SA 4FYKA 3MCVA 3DOUA 5AVOA 1X7HA 1RSZA 1CTQA 4KE7A 3R2JA 4F12A 1FC0A 5DIFA 1E32A 3ND8A 2CDCA 3NETA 3ZLVA 2J08A 3A6ZA 4IOKA 3R7AA 2DWPA 1Z12A 3WC4A 3EIOA 2Y27A 1TAQA 4IGFA 1U7WA 3BL6A 2YV3A 1HBJA 1ZUNB 2YBEA 4ZEMA 3TECE 4H0NA 3QMMA 5JPIA 1WR8A 3NXSA 3SEZA 2AG5A 3WMGA 3L0PA 4TKMA 3I2HA 2JGFA 1A8UA 5CNJA 3CNLA 1A9RA 1M34B 3IA7A 3PQ2A 5CBPA 3PR2B 3A4LA 4YH1A 4FC7A 1EUZA 2XWBF 5A05A 1SG9A 2VP0A 3WK8A 1CRQA 1E2MA 1T3HA 4FINA 3IMEA 7REQA 2XZPA 3BH6A 4A8PA 1JDNA 4QBFA 4DL9A 1JHMA 2O07A 1ZL0A 4HWKA 2VF5X 3IP8A 4KCGA 4BMNA 5JAPA 3QX3A 5FQNA 1WSBA 3KWFA 2IOQA 3MFQA 3DS8A 3RSFA 2C4NA 3VJLA 3DOOA 2NQTA 1R5BA 2IPXA 1D6SA 1LBTA 2QQ0A 4KAAA 4YRCA 5DBFA 5LL6P 1LI7A 5HCUA 4LJRA 5ALIA 5CNIA 3TR0A 3TTVA 3EVCA 2DLDA 3ZLTA 1QQBA 3VXKA 4MCJA 4OHYA 3IT1A 4NENA 4QUAA 1RI2A 3PHBE 2KWIA 4GVXA 4LZPA 4UAUA 4FYXA 4B4VA 5IDVA 4EO7A 3VPXA 6GPBA 4US1R 3ZBPA 1XSEA 1D2AA 3S27A 2FHPA 4ZEVA 1VCNA 3HRKA 3VR4D 1V3UA 3UV7A 3I1IA 2BI7A 3D3QA 3TW8A 3G2PA 1KRXA 3GZJA 4M0LA 1DO0A 4Y7CA 1XKQA 1E0KA 2EBWA 1P4SA 3LOUA 2IYNA 1X1EA 2Y4OA 3NV7A 4BO5A 2GWRA 2F1HA 3GN1A 1KO1A 1P9OA 3N3AC 2PJRA 2IRWA 3R6LA 2R9VA 1J90A 1I30A 1T9AA 3O6VA 3PJGA 3AP1A 1XBTA 3PIDA 1L5NA 2XDWA 4D46A 1MUUA 1M8GA 3CNBA 3KQSA 3VR5H 4JQCA 3QNWA 4A2QA 4RD1A 2RB5A 4BB6A 3H87A 1WBDA 2YV4A 1ZNZA 3DNMA 3B3JA 3E7DA 3QF4A 4MQBA 1TZJA 3CZAA 5HGJA 4B3BA 4S2EA 2ZUFA 4NSNA 5IH7A 3O1JC 4BFXA 3BL5A 1GPKA 3HA3A 1F6BA 3B12A 3PQ8A 1UFKA 2BKAA 3VFDA 2R84A 1A5BB 5FTKA 4C1NA 4CE6A 4B2LA 4RPLA 5JRJA 4YCAA 4EX6A 3EVGA 4MIKA 1W49A 2EFYA 4UTOA 2JHFA 2GBGA 3QXHA 4Q34A 5C1PA 1YHYA 2EG5A 3JWPA 3JQAB 3P9NA 2GF0A 1V37A 2XTAA 5FADA 1LUAA 4FNOA 1CSEE 1RP1A 5LQMA 1G2IA 1H0KA 1QG2A 2H9IA 2M1XA 4WLNA 4UDYX 1V3QE 1L7RA 1WXWA 3JYNA 2AOUB 2RMKA 2X9QA 4NPAA 2JLSA 2YUTA 1L7OA 4MRAA 2R2GA 3DUFA 3ILYA 4WLUA 1X14A 4CCAA 4JEHA 4E5YA 1Z5GA 2FPPB 1HLGA 4JEMA 2CUNA 1VIMA 1HG1A 1VHJA 1H22A 3FKQA 3LM8A 3AEKA 1SC3A 4KW7A 4OQPA 1QONA 2YXBA 5DLYA 1Z0SA 2XUJA 5GZ1A 3W5CA 1DKNA 1ZOPA 1PLKA 2Q9UA 5JS7A 1TMGE 4A5SA 1MN6A 3WMEA 5I8WA 1XRPA 1HQCA 2WFAA 3KQMA 1FRVA 1NW7A 1PT9A 3KHKA 4QDOA 2K7FA 2C58A 4C7MA 1G8FA 4DV1B 1NU6A 1C9DB 2VPWA 1S96A 4NYIQ 1GKKA 3KE8A 4P34A 4LY6A 4TLEA 4A2CA 1XMQB 2XJ4A 2H2GA 4LDZA 5DOVA 2IOYA 4NBSA 1JIJA 4MP8A 4B6JA 4TLMB 1T1JA 4KDCA 2IK8A 1MVLA 1DQPA 1XVUA 3NAQA 3T41A 1ZR2A 4AIRA 5D84A 4AW9A 1BHQ1 4GSLA 4BX9A 2CMHA 1CF2O 5LYJF 2P3SA 3CNNA 4GOLD 3RRBA 5EHGA 2A9OA 1BYIA 3Q4GA 3ZVRA 3OTOB 3IP7A 2H63A 1NBHA 3IAM6 3K5PA 3OUZA 4I1OA 4ALNA 4LY9A 5K3OA 1QE5A 1A9XA 1G8PA 5FNZA 2I6GA 4NAHA 3A1SA 4R1OA 2DHQA 4HZIA 1EP1B 1G5QA 5DX0A 1L4LA 2XADA 2FV8A 1QQTA 3HB4X 1T0IA 3RIMA 2JGNA 5JUWA 3ITEA 3C2QA 4D41A 1FQKA 2IEZA 1O95A 1A7JA 2QW0X 4BUJA 3RYIB 3QE2A 1IHYA 1NRJB 4YRLA 3TLCA 2X8JB 4FOPA 3RYFB 4B35A 5KJFA 1EVEA 1JHPA 3DTNA 4A15A 1J2EA 2LZ0A 3OQOA 2Q4BA 2XNSA 5HOEA 3FLAA 6REQA 1SQGA 3KJFA 5E8JA 3ND6A 2HIGA 4O2LA 4X20A 1K6IA 2NYRA 4XDHA 1N92A 3VVBA 2EKBA 5DN9A 3VZSA 2GCOA 9GPBA 3JZFA 2WUDA 4EQ6B 5ITSA 3AIMA 1P4HA 1PYOA 3CKYA 2C7RA 1K3FA 1Y5NA 3O7MA 1XCGB 3K3PA 4R01A 1QKIA 3EA0A 4ZDWA 2TMKA 4IXMA 4LTDA 4IFEA 3HY4A 4D8XA 1UMCA 3X2FA 4EKGA 2RAUA 2JA1A 4IDOA 2C5GA 1TT7A 4MQFA 2XCSB 1EB8A 3W34A 1EFRD 4R1QA 1JYEA 4ZOLB 5HUHA 1AVTA 1JHZA 3W3AH 1W5TA 5JXIA 1E9DA 3GMDA 1HR0B 1PJQA 4BGUA 1N2CB 2GD6A 2C2KA 3AW9A 3U0VA 1PNTA 1XD8A 3KYJB 4K6OA 1W36D 1GAQA 1TX4B 2IIVA 2HXSA 3ADPA 2PCLA 1N3BA 3I9JA 3OLWA 4M0KA 4YFYA 3GLGE 2IL1A 3ROPA 3EIQA 5DBOA 2A8YA 2P3LA 4TYNA 5J40A 4ZOCA 3B1JA 3EDMA 2AGVA 2KBEA 1S4QA 5DM60 3N3BC 4RZ2A 4ZDJA 3AJ9A 1XZPA 1RD4A 5LFAA 3EQ9A 4QEDA 4O3FA 2QUJA 3ZD6A 3FNFA 3T0FA 4MW6A 5CT6A 1M2NA 3WLSA 1TTHA 1KGDA 4DDVA 3BJRA 2PZEA 4E2YA 3SE0A 3L7NA 4ZEWA 1N6LA 1YGPA 1ZJ5A 1YDGA 4LHSA 2RBKA 1KSHA 4NATA 1EVLA 3ZD8A 2Y0EA 3EZNA 1KI2A 4Q66C 1JDBB 3KETA 1NLUA 2I29A 2MSWA 2XYHA 4X1KB 2OFFA 4YR9A 2ZI9A 2BM8A 3IVMA 5K0GA 4Y3UA 4CI9A 1JXAA 5EUMA 1TZKA 2BFMA 3SS8A 4C3ZA 5B5SA 5D85A 2GF9A 1FYVA 2QAJA 3F7NA 1W4ZA 3OJCA 2QP3A 3TL3A 3DVLA 2P9FA 1P7PA 3DMRA 2NIPA 1B2RA 2YMLA 4QOFA 3GNTA 1XZFA 4G9GA 4MB6A 1NONA 3O8OB 1WUKS 5DW3A 1I4LD 1TM4E 3BSFA 4JITA 5T57A 2WMYA 4NLLA 2FR8A 2B4RO 4XGQA 1PGOA 3DW3X 1ZN8A 2MSEB 4W9NC 3ZBQA 3ZJUA 2AYYA 3E3MA 4L4SA 3V46A 1EDEA 2JI8A 3L05A 1V45E 2D4HA 4BRUA 4NWIA 4ICIA 4F45A 2V3CC 1CEYA 1PF7E 1LLCA 2PKQO 1KWKA 3H2IA 2J5BA 4RESA 1A1VA 3Q11A 1IHXA 1UUFA 3CRMA 3WS7A 5HDQA 2ZW9A 3E27A 4ZAFA 4B3DA 1MMFB 2RCNA 4DTCA 1ZA2A 3ENWA 1CP3A 1FUUA 2V54A 2Z5VA 1GR1A 2YH2A 3I37X 3LQFA 3W2EA 1J0XO 4HNHA 3ZHXA 2PZ8A 2FR1A 2MYPA 3IUNA 3CXUA 1CEQA 4MQEA 4UTRA 3N7AA 2G88A 4QYIA 4XR4A 1NNI1 1NLZA 1LNSA 2BZ0A 1H0SA 3H9UA 4GECA 4TLDA 3U44A 1NAIA 4Q1DA 2XXAB 3OQPA 1EE1A 4OGWA 4BNFA 2XY4A 1QLJA 2WSLA 3SFZA 1F4PA 4JXKA 1YRQA 1KI8A 1SXJA 3CPJB 4PYRA 4PNEA 4ZWNA 3V1NA 3ZU2A 3P7MA 4XQCA 5JWRA 4UAVA 1LH0A 4NY1A 3WIDA 2JFXA 4C7OB 3GF4A 1AXEA 2I7TA 4QQ8A 4DVJA 2HCTA 2NAFA 1DRWA 2I4MA 4HQNA 1W19A 5IJAA 4PTZA 2CCJA 5JS1A 1K89A 2YIMA 4HPXB 5EXTA 1YOVA 2BMVA 2OXEA 2XQFA 2GEDA 3QMPA 5C8YA 3W5SA 4OHVA 3I62A 3L6OO 4KXXA 5M5BA 4BX3A 5G4KB 4I3HA 2G06A 3GFQA 2CDAA 2E4YA 5FA5A 4AKIA 4H6XA 1G3QA 2OM6A 4FR5A 3UC5A 3USCS 3HU3A 3EK2A 2FWAA 2HX1A 2L69A 4LOJA 1QHSA 5LD2B 2EIXA 2JAOA 1FFDA 1DUSA 4YHBA 1U5BA 4HOYA 4FS8A 2WYIA 2WTEA 3DZJA 1XTUA 3JWEA 1Q83A 1RI4A 1ZWKA 2JD2A 3GBPA 4ETNA 1ZMRA 2W6ZA 2HNBA 1DBVO 2F2TA 3AWIA 3FFTA 3NIBA 4AVYA 4QGSA 4WV3A 3Q2IA 3EEFA 4CMCA 1TKRA 3KKKA 2G09A 2XOKD 2BJWA 2OVFA 1UKZA 3BMCA 1JU9A 3N05A 4FGZA 5E6UA 4EUSA 1WMFA 1HYEA 4L8VA 2XNHA 1Z8FA 4JJ4A 3NDPA 3UC9A 3KT0A 1SKQA 3PGLA 1KS2A 3L3BA 4GPZA 1KWGA 1T36A 5FOUA 3ENZA 1IUNA 3W5IA 3H97A 3NASA 3INYA 4TTIA 1J5PA 3SI7A 1GPDG 3GLHB 2WILA 3SXJA 4DY6A 1DAEA 1Y9DA 2QL9A 1YZUA 4NENB 3VYTB 5J47A 3K2IA 1K6MA 5AJTA 2HADA 5HOQA 2R8YA 3I0NA 1SZDA 2DR0A 2RGEA 3FTPA 1V96A 4N5MA 1BJKA 4ZCQA 4BNDA 1HX7A 5AVZA 1UPFA 5HZMA 3QFTA 1ZKMA 3H1GA 3NJ8A 1JIIA 5FFMA 3Q6IA 3K6JA 3GCWA 1NUTA 4MO2A 1D6MA 4AO7A 2PJZA 4XXHA 4XYEA 3CKKA 1E62A 3DYVA 3QLJA 5E4JA 3MMPA 4NI5A 4DNOA 4Z7QB 4GKVA 4Y9DA 1DXOA 5CDUA 1S3FA 4DLPA 2XUAA 3M6IA 5IVIA 4OHXA 1NQAO 2Y1LA 5GJBA 4G4SP 3QPVA 1BEZA 3M2TA 1MQ9A 1L5QA 4LMAA 1R8SA 4J0EA 1NW8A 3SSMA 4UVDA 6PFKA 2Y92A 4I1VA 4QX6A 5KOYA 1DJOA 1OI4A 1JQ5A 4X54A 1GA6A 3U17A 2WIAA 4MVJE 2OECA 2VAVA 2W2KB 2ZTLA 4HADA 1DUVG 1GZ5A 1L7DA 1A7AA 3QE3A 4XM1A 2DHEA 2IDJA 1N8NA 2ST1A 5FBRB 3VNQA 2WIJA 4A1OA 4AJ1A 2PRZA 3R40A 3D4NA 3MWKA 1JVSA 1D6NA 3UH0A 3OHSX 4LWPA 3WYDA 2AV6A 2P30A 3ZV5A 4C4AA 3FTEA 5ALEA 221PA 2QWXA 2TS1A 4JC4A 5HE8A 2W83A 1YONA 2PD4A 2VJQA 3WYCA 5TARA 3QPUA 3HR4A 3LS2A 4INOA 4C3VA 1HZZA 4D99A 1EUCA 5JY1A 2NU6B 3QBVA 4C03A 4JWTA 5AIAA 5A9TA 3JTMA 4FIZA 1GYRA 2ZETA 4XI9A 3AFHA 4JOBA 5DH9A 1BX3A 1JTVA 2LUOA 4RFSA 4YA6A 4EBFA 3UMBA 3IE0A 2XE8A 5A4KA 4MWEA 1V11A 4OBWA 4DZRA 1JPNA 1O95C 1JMYA 4Q9IA 1YU6A 4NCBA 4X41A 2FMXA 5K0SA 4LBZA 4Q4JB 1KMHB 3UW3A 2YWJA 5F51A 4HH0A 4BEBA 1XHFA 2JKVA 3GBSA 5JDIC 4QNNA 3VQTA 4L3WA 4MLPA 1ZI9A 1CR0A 1U65A 3ZDYB 2RE8A 1GUBA 1UBCA 1Y3AA 2AVNA 4PV7A 1PT8A 4FQ8A 2J9YB 2XDAA 4L9RA 3BHIA 4MP3A 1QGAA 2G9QA 3G02A 1E6EA 1DIOB 1GZ4A 2ZRFA 2YHIA 4PZ9A 3JRNA 3FUTA 2RGNC 4OGFA 4Y9TA 3KQWA 1HTWA 4YROA 5EJ6A 3OVMA 1HLDA 1N2CA 1T3ZA 2PANA 1GNTA 4YMSA 2B9EA 2PS0A 2WUEA 3ZYCA 3RTBA 1GTJ1 1H2BA 2CVFA 4GR4A 3NHRA 4LPSA 1V43A 3P9SA 3UAWA 1LPAB 1R9GA 1OGIA 3QSGA 1NZFA 4JELA 4NF2A 1KYTA 4ZARA 2WHXA 1DCTA 3FBWA 5EJEA 1JR3A 2YQ5A 4NRDA 3UWMA 3W90A 3IE2A 3EOAI 3E7PA 3OWXA 1X7YB 4MARA 1ECBA 1OC2A 3WMXA 4KFCA 1SHJA 2QR5A 3K2QA 4B76A 2AK2A 2JJMA 1A4XA 2QF7A 4NMMA 4Q9NA 2LRHA 2DWQA 1XRRA 4OU4A 1JG7A 5G0TA 5B30A 2PX3A 3HCOA 3AIKA 3MXOA 4MVXA 1KK0A 2M32A 4WCVA 5LXTF 3UAZA 4OHWA 3HB1A 1C30B 1C81A 4LYFA 4YCJA 1JW9B 4OQEA 2R1UA 3T0GA 2AX3A 4NFSA 1QPZA 4D9IA 2WTBA 3VZCA 1H69A 3EAQA 4DR3B 1YZTA 4D6YA 4DJFC 2APJA 4MEBA 2YFYA 3LX5A 4E2FA 4Z99A 3WGLA 2IDMA 2P8SA 5L51A 3HCBA 2HRZA 2QPOA 2FPLA 5BN4A 1ECLA 1WBJB 2H5EA 2V74B 2RHCA 4G1VA 2DY0A 2I66A 5B6JA 1RLOA 3GLHE 3OPYI 2X13A 4RZXA 4GI2A 1BFKA 4DR7B 1PR9A 3ASYA 2ORWA 5K0JA 3BULA 5WRFA 3KKZA 2X2FA 1ZRMA 1LXCA 2V5VA 1PJAA 3LO5A 1N4DA 2WU8A 5F3RA 3SX4A 3C7CB 4D82A 2YV5A 3AUTA 4L5IA 1QS0A 3PX7A 1V35A 5K3CA 1CQIA 2SNIE 3A6DA 4XJSA 2NVWA 1YXMA 2VZEA 3LD9A 3IT2A 3H75A 3G0CA 3VNVA 2F90A 4YBZA 4BP8A 2BM1A 3FRHA 1DTEA 1EK2A 1KVRA 1ZG3A 2P9QA 3QP9A 4HSEA 3BWMA 1XD2B 3M9XA 2UDPA 3F5SA 2JIMA 1SUAA 3KSDO 4NBVA 4WY2A 3WRVA 3CH7A 3P8ZA 3UCFA 3B9RA 1J56A 5KJCA 3C3AA 4X61A 2EOAA 1FDRA 2P7HA 4MINA 1KDYA 3TW8B 4EY8A 5B7QA 3DEFA 1MDBA 2OK7A 1MH1A 3CH6A 1IE3A 1K5HA 1WDKA 2WPDA 4G0XA 4XCQA 1OBHA 3WO0A 3X2EA 2XR1A 1Q20A 3Q87B 5IULC 4HX2A 5H16A 1AH2A 1SRRA 2JKYA 2XX3A 4IMRA 4C7VA 5KTOA 1KOJA 1G64A 3OJWA 1P45A 2WMOB 4QOJA 3WGNA 4X5OA 1BRMA 1Z5NA 3EQZA 1BQ3A 1G3IA 4NULA 3FXAA 3L7LA 1N25A 4KNVA 2BI8A 4GGMX 3BD9A 4TM8A 5KJEA 1PSWA 3C4VA 2NUTB 1V6CA 2YASA 3TSWA 2HAEA 3OZUA 5LZ9A 4BY9E 4IUYA 2RGBA 5KPJA 3U16A 2JFHA 1Z8NA 2PWBA 4HX5A 4H3HB 1UODA 3H8JA 3Q5DA 1C2YA 3QTTA 5T3YA 5KOHA 1R7RA 3QWAA 4JXXA 5JJ5A 3PRHA 3ICEA 3CH5A 4LZWA 3QH4A 4RA9A 4TKZA 3ZV7A 4TKVA 3GY0A 1VSQA 1HO3A 1CX9B 1GZSA 5KOHB 4UUPA 4M87A 3QE0A 3STVA 1RTKA 1U8XX 1NJ6A 3DLTA 1KMMA 3H5LA 3NKFA 2FI1A 2X58A 3B5IA 4JLOA 5GWXA 3HB5X 3AKEA 3C0KA 2ZWOA 3TTUA 2IP2A 1QGUB 1YZQA 4BJHB 4E3WA 1R1DA 3W9BA 4BJ1A 4MH0R 2BDTA 4EHKA 1JEEA 3GRZA 3IB3A 3O31A 3QITA 5AI8A 3MT7A 4C3OB 4I6GA 4ZANA 3EXG1 5BW6B 3DQQA 3JYLA 3K4PA 3RTCA 1YJCA 1ESMA 4K8OA 3GR6A 4C06A 4ESHA 1R0ZA 4X95A 1BROA 4CN9A 2UZ4A 2HT6A 1WDTA 1J5EB 3NHPA 2OCDA 1A9QA 4IV5A 4LOIA 1VE5A 3T0IA 3GP8A 3T1NA 1T4CB 4GC5A 4M7OA 3NDRA 2QRKA 2YHUA 4GM1A 3VKUA 3ADOA 2OUKA 4J7AA 5EP1A 4ES6A 4UEWA 2XPCA 3KUDA 4AYTA 4HNUA 5L3VA 1X7GA 4LRQA 4NE9A 4MR7B 3PHLA 4RH3A 1U7OA 5E9AA 3SEFA 5DHPA 3MD9A 1H8HA 1YJ8A 1LRLA 3KXLA 3BQ9A 3D6FA 4ZPJA 4JLJA 2XHZA 1NF3A 5K3BA 1FX0A 2QMHA 4LKOA 2V59A 3CLVA 1SVOA 4KVFA 5BW4A 1IWBB 5TEVA 3RB8A 3CEAA 1XTZA 5ENDA 3O8CA 4M86A 1XCMA 4PLVA 3T06B 1R6UA 1K8RA 1UH5A 4GMKA 4M1MA 4D80A 1VA5A 3A1CA 5IBRA 4EPTA 5CBKA 4EG0A 2W2PA 1HEUA 2IQIA 2G8LA 5DN6A 2QZSA 4PONA 2H2HA 2F3SA 5D87A 3VTAA 3PVCA 1RE0A 3VR1A 4DRXB 2Z6UA 1ENZA 3IELA 1EDBA 1P3DA 4FX2A 2HQ1A 4O4JF 5DLQC 5FR1A 5C1IA 2W2TA 1X42A 1V71A 4LY0A 4M76B 4N0PA 3SYTA 3ZI4A 5KQLA 4RVUA 2CFSA 3EY4A 2NUAA 3EXFA 3R1IA 2W9XA 2W8BA 1LWOA 2XQJA 4IKOA 4ZQBA 4F5EA 4LG1A 4CV2A 1VP9A 2V6FA 4KDEA 4U8GA 1NF8A 1SULA 2WAYA 3AEZA 3DV2A 1VHTA 5KYVA 1IOZA 2A5FA 1MENA 2J5XA 2GGSA 2QDXA 3OSZA 3OZDA 4N5IX 1WU7A 5NULA 2UYOA 2WJGA 2QN8A 3QU4A 4RVFA 5BQPA 5F12A 1NTRA 2BFEB 3WNVA 3CRW1 4RULA 2JBHA 3UWDA 2QL6A 5KQSA 3D9QX 3FHLA 4DV7B 3PQ7A 4HV4A 3WA6A 4OXYA 1L5YA 4LDQA 1Q22A 1YZLA 4D4JA 1PBNA 3LBFA 1WF3A 4H16A 3O92A 4GMDA 1TVMA 4HPJB 3RYCA 2F1JA 1CZUA 2YJ5A 4NYIR 3BPSA 2VSFA 3UT5B 4ZDIA 2AN1A 3BE4A 4L5YA 3FVQA 4HI0E 5AO9A 5AHWA 3FJOA 3HEMA 3UJ7A 2CNOA 4MS1B 1EXVA 4MV8A 2RJNA 1H8ED 2J7PA 1VGQA 5BPFA 4H27A 4QYWA 1G19A 3TNDA 2I3AA 1D4FA 1F8GA 1NSTA 3NRCA 4KFTA 1H93A 1U2GC 5DXJA 4D4LA 1YFZA 1YZYA 1AOXA 3SJZA 4OXIA 3F6YA 1TECE 3U62A 3WGVA 3IBFA 1PR4A 1Q0UA 1N2GA 2X6QA 1KEVA 1SBIA 4L27A 2CZCA 1P1IA 4MWBA 3W3AD 1N5MA 5BNZA 1KDVA 1RHUA 1NU8A 4L0DA 1HDEA 4XGIA 2RAFA 4KTVE 1IHOA 2Q4TA 1KZGB 4HDAA 1VI2A 1JZTA 1JPVA 1KHTA 1YV9A 3TGWA 2BFAA 2IYYA 5BVGB 4AYXA 3G6WA 1NX9A 4HDSA 4FI3F 4J03A 4HBGA 1V5FA 4R1SA 3AEXA 3ZWPA 2IYUA 1OXTA 3DG9A 2VYNA 1USUA 4EARA 1NDUA 1F9AA 3AFNA 3M8KA 1GY8A 4WINA 3TD2A 1QP0A 2WU1A 1ZM2A 4PICA 4YCCA 3AR5A 1KTVA 3DWIA 2CMDA 1UWVA 1JV2B 3EGVA 4QO7A 3FTFA 1RCTE 3DDWA 1GGJA 2C7VA 2SICE 4F91B 3H1PA 4N7RA 1ABFA 3V33A 1D2CA 3FMFA 4NU6A 5EXXA 4EVIA 3VJRA 3JD3A 1YE3A 3M3PA 5H3HA 1Z4KA 2QJTA 2X0NA 2P11A 5FPHA 2FCRA 4TTSA 4IHJA 3CO5A 3DNPA 4OA5A 5KQMA 5DXFA 1SKYB 5AH0A 5DEOA 4AKTA 3LIPA 1KEEB 4UMFA 5TPWA 2ZVDA 1SWVA 3SZGA 1IRXA 2V0NA 1Z25A 2EHDA 2QTHA 3L8FA 3ZUPA 2PX4A 3ZLBA 4HB0A 2JGAA 5COBA 4OP3A 3W5JA 5J43A 2YHBA 3ACBA 2V3WA 2GBLA 2AN4A 3ITNA 1K98A 3OFNA 4ISCA 5J2TA 4GPBA 1P4AA 3A4MA 3THXB 3WDSA 3DDUA 3WAJA 1X7WA 1P0QA 2PV0A 3IT3A 4MYDA 1VTKA 4DIEA 2ICAA 1XV5A 2FF7A 3FNIA 1ZK4A 3HMQA 2QVYX 3K1YA 4P58A 4F6LA 3W7AA 1ZBQA 3U4GA 2EP8A 1RLIA 1YRYE 1TCCA 3K8YA 1RDFA 1CB7A 4GX0A 4N3GA 3X0DA 1U9IC 3WOHA 2VAMA 4TQ9A 4ZOBA 7REQB 3KCNA 3WTCA 1JHDA 3MMZA 3O9VA 1GAXA 3ECAA 4KLCA 1WUTA 1Q2XA 3H2YA 3MW8A 3ONDA 3D4PA 4JT2A 4LZNA 4MUAA 2BONA 2ZSIA 4U9IS 2G08A 3K0AA 3PITA 4KL8S 1KVQA 3B7GA 4WZBE 4NMLA 2C31A 2PH7A 4ZRMA 3NM6B 3NS7A 3VKFA 1CIJA 1CUFA 4DQXA 1U31A 4RD2A 3WKEA 4CTJA 4YV1A 3AVPA 5B4TA 3HKEB 3O90A 4Y6PA 2VWGA 1XCJA 4Z0NA 1CG6A 1QYIA 3I23A 4RF3A 3H5OA 4EGAA 2BV3A 3GUHA 1G3RA 4R5MA 4PLYA 5F1OA 3DONA 3TYXA 5CDHA 5IDYA 1CQZA 1R3DA 3RSHA 1XXHE 3G9UA 4WZAE 1CUIA 2HDNB 3G13A 3UATA 3WGZA 5KS2A 4BMZA 2EARA 1Z4IA 3FNRA 4BGIA 4HN2A 2I8CA 4B5LA 3I5XA 3RC3A 2RKBA 1J42A 1GRVA 2WWFA 3OKCA 4IDGA 4Q1VA 4LGYA 5EFOA 5DM1A 5GQSA 4AFNA 2X7XA 4CFYA 1ZESA 4RO0A 3ST7A 4EHHA 3MF4A 4TT8A 3CJQA 1XMVA 1YZNA 2FJPA 4I0WB 4DIFA 1I7NA 4MJLA 3SQMA 3N28A 5LKAA 4IZOA 1XPJA 3OZBA 3VU0A 1HDRA 4AXBA 1QDEA 2XZOA 4O2RA 1L7BA 1DOZA 3D3EA 2HIHA 2IYEA 4GXQA 1CZNA 1QYDA 2XI4A 4RELA 1AS0A 1F8FA 2J59A 5TPZD 4YMVA 3NT4A 3DCYA 3PE6A 4HWRA 4I5IA 2JRLA 3JSXA 4J0IA 3CNHA 1SKUA 2WJ4A 2G9NA 2C57A 3UTCA 5IZ4A 4G23A 1VHQA 1NQVA 4ZOLF 5IT0A 2VBCA 1NM5A 1NFQA 4M88A 5SYMA 2IUSA 4DQKA 5KNBA 3T3OA 5DMHA 2VC2B 3UOAB 1G0NA 1JXMA 3X2SA 2AMJA 1HPLA 4CM4B 1P0CA 1EWRA 1P1CA 2PD3A 1E98A 4FYPA 1XNQB 1ACJA 2I4LA 4YP0A 1ADCA 1SHZA 3UY4A 4OHFA 3QPWA 4C5CA 4MLDA 1IOLA 4N3NA 2AXEA 1MB4A 2G5GX 3SXPA 4WH0A 4UMDA 4DIMA 1IY1A 2RGDA 2V1XA 1SBNE 4H1UA 2AOUA 2ENWA 1MRZA 2IHUA 1AX9A 1ORRA 1J9EA 1VJCA 3IAAA 3VAAA 5JECA 4PG4A 1MNAA 4XEUA 4HMPA 4QGFA 4CMKA 1ZJ6A 2GBPA 1KQGA 1G291 3I3OA 5A1JA 3W2HA 1I5RA 3HBLA 4R9SA 1E58A 4IEEA 5EPUA 2PRIA 4FKMA 5KQPA 3IRVA 4IO1A 4ZXFA 3VNSA 4BFLA 1JJ7A 2QRUA 1IY9A 2OO7A 4JJZA 2YDXA 1U04A 2DSNA 1GFZA 4GRAA 3NLLA 5AI9A 3OFVA 4GOND 3RABA 3J81k 3NPAA 3OX4A 2BKUA 1PEAA 2AA3A 3WBFA 3R3VA 2ZAMA 2ZBDA 3RUAA 5IJWA 3TQHA 2EQBA 2O8EB 1X87A 2D4AA 2DEUA 1NE2A 1RRFA 1MPTA 4U0JA 4BAZA 4HNVA 2OMKA 4LJ5A 1TO1E 1WPXA 2K6GA 3DCNA 3MLBA 4PSKA 3DH0A 3OJEA 4LVNA 1NR1A 1GG5A 1PWYE 3SYRA 5KVAA 1E9BA 5EMNA 2E6KA 2XLBA 2G04A 2YC2C 4UEOA 3GUUA 3KVNA 4ZAWA 3C3JA 1AKRA 4DE5A 5A6VA 3I6IA 3QK7A 4KYUA 1BCSA 4KRGA 2X8AA 1EAYA 4XX1A 4RV5A 2FUCA 3BERA 1A4UA 1ZN9A 3QX7A 5G1OA 9ATCA 2DBRA 3G0OA 1DRVA 3QGMA 4CCWA 3QI7A 4C20A 4A9AA 2PFKA 4EP1A 3OC0A 5JCOC 1UKCA 3SJAA 4UFPA 4LJ6A 2PH1A 4JYCA 1R8YA 2QX9A 3TW6A 2L82A 2FZLA 1VPDA 1C1DA 2PTHA 3THWA 3T7IA 2G40A 1CULC 1RR6A 5EKDA 1G5RA 4OCZA 3VZPA 4KWCA 4YS6A 3TLYA 2R85A 3QEOA 4RMIA 5JNWA 3ICVA 2O2SA 2J9XB 4DLAA 4KHPB 4TWBA 3ZNNA 5EE3A 4PZUA 4DABA 3AF2A 1DZIA 1XC7A 2I3DA 2HF2A 3RC7A 4EYKA 5IXYA 4D3YA 2ROQA 1XVTA 4CKEA 5CDSA 4R2WA 2ATXA 2RHGB 4G8CA 2ECQA 3M9LA 4Q12A 1PUXA 2WD9A 3VPFA 5FOSA 3GFVA 3C45A 3V7WA 4QA9A 4ZN6A 2DUNA 3BZBA 3V5NA 5HP4A 1YDWA 3TVTA 3LBAA 5FV7A 3CWCA 1GHTA 1XR3A 1JECA 3I34X 3RS9A 1S2DA 5BWNA 2RGNA 4U7WA 4ZEOA 3TIFA 3NTVA 2BEUB 2J7KA 2W43A 5A9RA 4DWOA 1TEZA 1ISIA 1NW3A 1UXKA 2P5UA 4RTOA 1QZ3A 3M4XA 5DWQA 5F1YA 2F1OA 2JVJA 2WV7A 4US0R 3UJCA 4CKBB 5CFNA 5EJ8A 2BEUA 4GBGA 3NGLA 1Q0QA 3ZCTA 4OPMA 4LXQA 1DCKA 4UBLA 1BTOA 4D9HA 4BGEA 1ZJYA 5EHZA 3EEIA 4R84A 4CUJA 1A77A 1OGYA 3CLSC 4R71A 2WUFA 2TMYA 4LOKA 1J2UA 2XXJA 1WUIS 2FMHA 2IU6A 2Z3WA 3BG5A 1JHOA 1N5JA 2H17A 1QPBA 1XYVA 1Y3BE 2Q8PA 3O3MB 5EZ6B 4EPYA 2WSYB 2WAAA 3ZWCA 4JXZA 1RYMA 4DM3A 1Y63A 3WGHA 4CVNA 4ER6A 4I1SA 5G1PA 5J1TB 3UGTA 4MDEA 2WJVA 3ABSB 2CHUA 1W88A 3OIUA 4BVJA 1X7XB 1E1RD 2DFKB 2B0CA 1KH1A 1LDMA 1N0WA 2FEPA 5KU7A 2IW1A 1G9TA 2BHLA 3A1UA 2ID8A 4ARAA 5BN3A 3CRQA 4D9KA 1R4AA 1WD7A 4X8LA 5H1YA 1TTTA 3ORFA 1UBOS 3UFXB 3E5HA 4TL7A 1A5TA 2AG0A 3B6ZA 3SR0A 2WRZA 1NX6A 3IO5A 3D6UA 2WWGA 3QA3E 3DTVA 4IM7A 1E7SA 2OCXA 2PX0A 1FUEA 4TKLA 4UJ3A 3WLPA 4MJ7A 2W58A 3KTOA 5GZ3A 1WHSA 3GJZA 2QD1A 4O0LA 1ZVKA 3W9UA 3EARA 1F12A 3FOWA 5G0UA 3WQQA 4CMJA 3L04A 4R8SA 3DWFA 2OYCA 4V38A 1P2DA 2A94A 5KTSA 5I5EA 1G3UA 1V4NA 3S99A 4RANA 1XRNA 2A9QA 5FCDA 1CJMA 3ABQB 1Z6ZA 1JR3E 4NMWA 2VTBB 2CXXA 5TJHA 2O1EA 3IESA 1D3AA 3FYHA 3K5HA 3AF3A 3NHWA 4WZBA 5I7UA 4ZCSA 1B16A 1YRBA 4PQRA 2XYPA 2FFAA 3GZ4A 1QC5B 1XK6A 4JL5A 2ZB8A 4WZBB 4PE5B 3GP5A 1PFUA 1VE3A 1WP9A 3LWNA 3C5HA 3E0XA 1EX7A 3L6RA 2AI1A 4JXJA 4QIHA 2YOHA 2H1HA 1MX3A 1JLLB 4MUXA 2Y0BA 3LFHA 3REQB 2M2IA 1XROA 2RJ3A 2NPOA 1EDOA 4FTWA 3VZDA 4U6SA 5C0OE 1U0SY 1WRBA 2OE2A 4JNCA 4ZVVA 2HC9A 3SFVA 4A0HA 3F9RA 4GD3Q 4HDQB 3RU2A 4OHPA 3REQA 3VR4A 4RXMA 3U7IA 4MHTA 2JLWA 4UM5A 1NQUA 4WKOA 2EF1A 4K3VA 4LNUA 5EHXA 1YHZA 2O3RA 4LHEA 1HDOA 2QXYA 1EVYA 2XSZD 4KQMA 2MINB 1AZSC 5J5VA 3C3KA 4DM4A 5BQOA 3A7DA 3I05A 3WGYA 1I3NA 4OB6A 4TKVB 4WDRA 1TA4A 1AQIA 4CM7A 3VAZA 2C07A 5F73A 1O57A 3NQ41 4OJKA 1OY1A 3UTDA 4ATNA 4BU1A 2OILA 4BQOA 4QWMA 3LUHA 3IAS6 3SQNA 5CCXA 1TMOA 4O4IF 1SKYE 2OPHA 3T3EA