4B4VA

Crystal structure of acinetobacter baumannii n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) complexed with nadp cofactor and inhibitor ly354899
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
282
structure length
282
Chain Sequence
MALVLDGRALAKQIEENLLVRVEALKAKTGRTPILATILVGDDGASATYVRMKGNACRRVGMDSLKIELPQETTTEQLLAEIEKLNANPDVHGILLQHPVPAQIDERACFDAISLAKDVDGVTCLGFGRMAMGEAAYGSATPAGIMTILKENNIEIAGKHAVVVGRSAILGKPMAMMLLQANATVTICHSRTQNLPELVKQADIIVGAVGKAELIQKDWIKQGAVVVDAGFHPRDGGGVGDIQLQGIEEIASAYTPVPGGVGPMTITTLIRQTVEAAEKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL PROTEIN FOLD
publication title Acinetobacter Baumannii Fold Ligand Complexes; Potent Inhibitors of Folate Metabolism and a Re-Evaluation of the Ly374571 Structure.
pubmed doi rcsb
source organism Acinetobacter baumannii atcc 19606
molecule tags Oxidoreductase
total genus 101
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature ec 1.5.1.5: Methylenetetrahydrofolate dehydrogenase (NADP(+)).
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b4vA01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 4b4vA02
2VOEA 3WS7A 4Q39A 3MOIA 2JD0A 2FPPA 3K5PA 4PVCA 3L77A 1E92A 1BDMA 2A4KA 1OBFO 3L9WA 3LT1A 4YT2A 5G4KA 4PLCA 4WLOA 5F5NA 4CM3A 1R6DA 3FWNA 5AXBA 1P1JA 1MC4A 3I9LA 3ZN2A 1VE9A 1ENYA 4LK3A 1YBVA 2BH9A 5ITVA 3VPGA 3DMYA 4WKGA 3GUYA 4XGNA 5L4NA 1XSEA 3R1IA 2HUNA 4GKVA 1RM3A 4RLSA 4ZQHA 5JW6A 3P2OA 3HB5X 1WW8A 3G79A 2P2SA 4M1QA 4R4JA 4LCEA 2HMWA 2XAAA 3HDQA 5K6AC 1LRKA 3L4BC 1B3BA 4QX6A 4IJKA 1YQDA 1Y5MA 1HDYA 4GGOA 3HB4X 2PZMA 3CUKA 4OOFA 4QFCA 3BMOA 4I9HA 1PEDA 1A4IA 2IEBA 4HWKA 4YBZA 4E2ZA 3BMQA 1LSJA 1QYCA 4TROA 4BGUA 1ADBA 1RWBA 1B3RA 2FZWA 2NV6A 4NFHA 3WLEA 3CXRA 3W6ZA 1LXCA 4GQAA 3C7DB 4BO5A 3WIDA 4YT4A 5BNTA 2YV2A 3IIEA 1M76A 2GZ2A 4EW6A 5ILOA 1I3NA 1LA2A 4CM4A 2O4CA 2PH3A 1GZ3A 2NVUA 4HUJA 2C0CA 4YYZA 4EUEA 5F1PA 1X14A 1HF3A 4FJ2A 4DLLA 1E7YA 4YAJA 2AEFA 4FJ0A 2DUUA 2B0JA 2GD1O 3Q9NA 1B8VA 1BTOA 1I2ZA 1Z6ZA 4XB1A 3ANNA 2DM6A 2Y0EA 1XGKA 4JP3A 3HNPA 2EKLA 1R12A 3QSGA 1U1IA 3JD0A 3HFGA 5K9ZA 5CHEA 4ND3A 5F5LA 2X9NA 1T2CA 3KYDB 4CV0A 2P68A 1AGNA 1SC6A 1NQ5A 5TSDA 4NPCA 1FK8A 2V6MA 3EC7A 5L40A 3KV3O 1GY8A 4U6SA 1LC3A 1PJQA 1VJTA 4JIGA 1WDMA 4F45A 3FD8A 4DGSA 3OH8A 4U6QA 3FCOA 1JDJA 2YQ5A 3O26A 1Y9AA 1KVRA 1F12A 1Z7EA 3CKYA 3OECA 2HK9A 2GDZA 4FFNA 3X2FA 1WAMA 1WZEA 4WUVA 2HMSA 1H6BA 2W90A 4UREA 4EJMA 2CUKA 1L1FA 1LUAA 2GR9A 2LDBA 3RUHA 2R6JA 1A7KA 2B35A 3WJAA 4INAA 3W8FA 3BA1A 4E31A 4CMGA 4BB5A 3DZBA 3QY9A 3JQ7B 5LC1A 1QYWA 4HFMA 5G4KB 4IXWA 1ADGA 4HBGA 5ENDA 2OBYA 3FR8A 4GWKA 2Q46A 3S8MA 1GEEA 3AW9A 2J8ZA 2V65A 3DTTA 1IY8A 2JJYA 1PJBA 1H2HA 2NACA 2GCGA 1YB4A 1NX6A 3OP4A 3DZGA 2E49A 1U3WA 4IDAA 2EKPA 3PDUA 2WYUA 4CMEC 3R6DA 5BSHA 3GFBA 4DL9A 1ISHA 2WWRA 4UVGA 1KVQA 4D41A 2FWMX 1LNQA 4GLLA 3H9EO 4Q3AA 2GNAA 3GUCA 3RVDA 1RJWA 2RH8A 1O94A 1SPXA 1VJ1A 2YW9A 1KIFA 2NU9A 2OMEA 2VTEA 4YJFA 4EYEA 4QFDA 1O8CA 3AOEC 3VZQA 5L4SA 3CPSA 1CEQA 2TMGA 3FRJA 3ZWBA 1R0KA 4ZRNA 3AUTA 2AQIA 5B4VA 1ISGA 1HRDA 1LSSA 4A5OA 4AVYA 1HKUA 4H16A 5AXAA 5CG2A 1A9YA 3PIIA 3RFVA 4E5YA 2DBQA 1M75A 4I5DA 5TQVA 4WCFA 4DUPA 4UUMA 4TVBA 1UXGA 4J2HA 2EXXA 5B12A 1AUPA 3P19A 3TFOA 4GVLA 1DDOA 1H2BA 1EQ2A 2DPGA 1VJ0A 5KWEA 3RU7A 4RQTA 4Z0HO 3RBXA 5I7FA 3E48A 4UVDA 3KZVA 4PZDA 4RPJA 3G1UA 1Q1NA 3ZV3A 1HDXA 3ENKA 4UEOA 5B4UA 3KXDA 4U0JA 1ISMA 3QP9A 2FPGA 3UF0A 5AQ1A 3K96A 3PPIA 3SC4A 2JCYA 2AA3A 3EUWA 3G3EA 5CEFA 4I5FA 1JVBA 4J4BA 4XX0A 4XDZA 1F06A 1KS9A 1C14A 2VYVD 3VPFA 1E7RA 1O6ZA 2E37A 3NEPX 5KJFA 3H2ZA 2GO1A 1A27A 4AJ2A 3GVXA 2DBZA 2GGSA 4WLFA 3PHIA 1KC1A 3ZW8A 4ALMA 1YRLA 2P9GA 4AJPA 5KJ1A 1CQJA 1EK5A 1HSZA 4DQXA 4KOAA 3GN1A 4YEDA 2HDHA 2Y1DA 2FSSA 2PKRA 4AJEA 5J23A 2X0IA 2W98A 4PG8A 4IQGA 4CMBA 2ZCVA 3D4NA 1ZCJA 2H9IA 3GRKA 1NBOA 4BNHA 4R68A 1XIVA 5JNLA 3L4SO 4J9UE 3WMWA 3ZV4A 1AHHA 1P1KA 4UEJA 5C37A 2NU7A 2DQ4A 4OYRA 4PIVA 3DBLA 4ND1A 3TWOA 3VC7A 1LDGA 4MKZA 2YUTA 5G0VA 3F6YA 4MVJG 2IRWA 5JYDA 5TF4A 3U0BA 2I3GA 1OAAA 2D3TA 1ENZA 4PG5A 4XQCA 5COQA 1GUYA 3OQBA 4E2WA 3ZWNA 1JKFA 4E5MA 2A92A 3CZMA 3LK7A 3D3EA 3ROKA 2GN9A 4MINA 2BKAA 1PSDA 4NNJA 4HNGA 3H3FA 1FDTA 5EINA 1UXKA 4YJHB 3GZNA 4CV3A 1UP6A 4K1LA 3RAJA 4J0EA 4JQCA 5FI3A 3EYWA 1RM4A 1T2DA 2NSDA 2O3SA 1S6YA 3GNTA 5A9RA 2QYSA 3RUDA 1HYGA 3UVEA 2X22A 1LJ8A 4Y6RA 1IPFA 5JDCC 4BNWA 2PTGA 1W8DA 1NVMB 1PS9A 4GMFA 5G2OA 1NVGA 4D43A 2ZYDA 1R4NA 1XELA 1D1TA 1G1AA 3PEFA 3WIEA 3U4IA 5COBA 3LVFO 4ZQGA 1DFGA 3RI3A 2PD4A 3AY3A 5H83A 4FBGA 4HFJA 2O23A 3UCEA 3RC1A 3AFMA 3B1JA 1SB8A 4ESOA 4XYGA 5KVQA 1N5DA 1WNTA 1RYEA 4Q3BA 3HFSA 5T57A 1J5PA 4XQEA 3DZIA 3AM4A 1QYVA 1NPDA 4ZA2A 1ZKMA 4M49A 8ADHA 3W4KA 3GAZA 3H9UA 4J7XA 2LDXA 3HG7A 4ZRMA 3K73O 1D3AA 5F1OA 4GL4A 4EITA 4CUJA 3NAQA 1MXFA 1SBYA 2D4AA 1LX6A 2B4TO 3JQBC 4B4VA 5IXYA 2O50A 3ICCA 3AM5A 4RPLA 2J6IA 5TNXA 3NJ4A 3JQCA 3RU9A 4IINA 4B8ZA 2H63A 1NHWA 2EV9A 4QUKA 4TRNA 4YRBA 3EVTA 3ONFA 2DC1A 2OP0A 3GN2A 3IUPA 1N92A 3LYLA 3EHEA 5I9NA 2WSBA 2XXJA 4CMIB 4II2A 4TRMA 4X54A 3WGTA 1U8XX 5I8ZA 1G0OA 4BNKA 3KEOA 2Y1EA 3ADPA 4XA8A 3AFNA 5CP8A 4RCVA 4JN6B 3WWYA 4J16A 2X9GA 1PZEA 1P3DA 2W2KA 4RGBA 3KSZO 5G4LA 4Q3CA 2OFPA 1UXIA 2VWPA 2PLAA 4ALIA 4BNNA 7MDHA 2Q2WA 5JYEA 1K5HA 2WEKA 2G1UA 2JFGA 3F4LA 5EQDA 2YY7A 1OZAA 1NAIA 3H7AA 4FS3A 2BFMA 2DT5A 2QHXA 1IHYA 2HMUA 1N9GA 2HMTA 2OORA 1GD1O 3TPCA 3OJLA 1PWZA 1XQ1A 1GZ4A 5JDIC 3HSKA 5A3JA 4IDDA 3WFJA 1CJCA 3ENNA 4URFA 1P0CA 1QLHA 4DLAA 4ZD6A 3DC2A 3WX0A 1QMGA 2C59A 2AQ8A 5G0SA 1U4OA 5ENVA 1KYQA 4W9NC 5AOVA 3OJFA 5HS4A 9LDBA 2CVQA 3GDOA 4ZGWA 1PQWA 1HLPA 1F14A 3H5AA 1ID1A 3DBRA 4GKBA 1T2AA 2H6EA 4IMRA 1R4NB 1B14A 1Z74A 2O3UA 1P44A 1JAYA 2Q1SA 3DWFA 4L8VA 3WWZA 3VAZA 1ONNA 2GN4A 3LZ6A 4CMEA 3WBBA 4M55A 5JSFA 3FNFA 3QE3A 4D3DA 3F9IA 4I8XA 2AXQA 2ZATA 1BMDA 3AUUA 3K31A 3QLJA 4IGEA 5KCZA 1HEUA 3ZHBA 2DVMA 3QVWA 4XQ9A 2YYYA 1TXGA 2CF6A 1MFZA 4D45A 4CUZA 5T64A 4L73A 3I52A 1XDWA 2NU8A 1H94A 4QXMA 4B3JA 2XF8A 4FD3A 4FB5A 2P5UA 3WGQA 2E48A 4B4WA 4YDRA 1PR3A 1G0NA 1QLJA 4WECA 1UZLA 4CMAA 1DC5A 4OJNA 1MGOA 4UVHA 5CPBA 4HP8A 1U3UA 1FDVA 1H93A 4YAEA 5KNLA 2QX7A 2Q3EA 4JNKA 3JQ9A 2Y67A 5A9SA 5GZ3A 3FPLA 3WGIA 3JQFA 3DFZA 1HZZA 1ZW1A 5DBFA 2VUUA 1B7GO 4CLOA 4PG6A 1GV1A 1NYTA 1N7GA 4ZQFA 1Y8QB 4P38A 2FHSA 4WGGA 1K3TA 3FNEA 2DLDA 1E7WA 3R3SA 4ALNA 1PZGA 3R3JA 1LDMA 1TT5B 4ONEA 5DF1A 3OJEA 1E1LA 1UP7A 4L0QA 2C7GA 1DLIA 1U8FO 2P4QA 3BHIA 1LSUA 1YVEI 4MVJM 1JWBB 4DA9A 4MKRA 5AXCA 4MVJD 4DXHA 4PZCA 4L4RA 2W2KB 1WLYA 4IIUA 4HKTA 2PGDA 1BHSA 4BO7A 2Y1GA 2ZTVA 4NBRA 4QECA 2UYYA 3ROPA 4FDAA 1R0SA 2JHGA 2VWGA 3DHYA 3JQGA 4UUNA 3MJEA 1LLUA 5JY6A 5A05A 5I7VA 1EK6A 3PQDA 3I23A 4NU6A 1HSOA 1I3LA 3PHHA 2GUGA 3GGOA 5EIOA 4CR7A 3C8MA 4G65A 4QEDA 3MJCA 4DRYA 3I5MA 2DUWA 4J4TA 1DIRA 2HQ1A 3QW2A 4J43A 1PL6A 1ZEMA 3SX2A 1QXSA 3BMCB 3PXXA 9LDTA 4FSHA 1PJ4A 4NH4A 2IZ1A 4TMFA 5THKA 2B37A 2VWQA 1EUCA 2B69A 2F00A 3E9MA 3GF4A 3PHGA 4O5OA 1AN9A 3ON5A 4NQZA 2HSDA 4JX8A 2YHUA 3C24A 3MZ0A 5I7SA 1KEVA 4GH5A 3WR5A 3ADOA 4KMSA 4R3NA 1DRWA 1YXMA 2R2GA 4FFOA 1Y5RA 6ADHA 2ZTMA 3VH2A 2YHIB 5U4QA 5A04A 1I10A 1NVTA 2EERA 3GEGA 4L4SA 2EP5A 3OJ0A 1WP4A 4IXTA 4PLYA 2DBVO 5BSGA 4FGSA 4DBVO 5C3MA 5A5FA 3DBVO 3TF5A 4JGBA 4IDGA 3I9KA 3ST7A 2XPCA 4BS9A 5TJ9A 2V6FA 4UEKA 4CQMD 4CLRB 3MWEB 3A1NA 4BMNA 3GVIA 3HADA 1BWSA 3DAFA 3KOUA 3QWAA 5DBGA 2G0TA 5L53A 2NTVA 5FFFA 2PK3A 1LSOA 1VC2A 5U9CA 4WCDA 4BO3A 4D0SA 4TKMA 1M2WA 3N7UA 1KVTA 3JQDA 4P22A 1JKIA 1EZ4A 3WFIA 3OIGA 5IDYA 2X8LA 2EF1A 5CG1A 4WASA 4AJHA 3AU9A 4MP8A 4J6FA 3Q6IA 1LLCA 5JDCA 1E5LA 1K6XA 1PX0A 1ZK2A 2FOIA 3DR3A 5TT1A 2R00C 4YCAA 3PJDA 3OM9A 2XOXA 1O95A 4HX5A 3ZU4A 4KTTE 1WMAA 1GADO 2C29D 4OXYA 5DCWA 4Q3NA 1ZEJA 3VDQA 1UXHA 2JAPA 4BO0A 3WGZA 4DPMA 3DMTC 2RHCA 3D3WB 4BGVA 1ZK4A 1ULSA 4QQRA 4BQRA 3S2EA 4CM6A 4DIFA 2I76A 3EW7A 3ZGYA 3KYDA 1GFSA 1M6HA 4MVJH 4L4XA 1QYXA 1QV7A 1TLTA 4ZN6A 1LLQA 1V8BA 3PK0A 3I6IA 1MG5A 2Y1OA 3GGGA 3AI1A 3OF2A 4KDEA 1YB1A 4M86A 1ZSNA 2WDZA 5EESA 2VRCD 3EK2A 1EE2A 1R16A 4YJDA 1NWCA 3DZKA 5DDIP 3WICA 4L9RA 4NI5A 5JCJD 3EAGA 2YV3A 5THQA 1Y7TA 1ZH8A 4LCJA 4OKIA 4DBZA 3H4VA 3O8QB 3GG9A 3GDGA 4AL4A 4BKRA 1DFHA 2WM3A 3KEQA 2P91A 5DOZA 5T8KC 4YQZA 2AE1A 3JQ7A 4AJIA 4XB2A 1FDSA 4RPGA 3WOHA 4PFJA 4NIMA 1GPDG 1M66A 3T7CA 1B0AA 3N58A 3V1UA 5KTKA 4OQYA 4C7KA 1HE5A 3PLNA 3BHMA 1Y1PA 2C7VA 2VCYA 4YACA 5JC1A 1VL0A 1Z73A 1JW9B 4ND5A 3MTGA 4JLWA 4HY3A 3AU8A 3ZHXA 4XKJA 1HE2A 1HXHA 3KTDA 4DIOA 5L95A 3WQQA 4RF4A 3AUAA 3PZRA 3ABIA 3NTRA 2XXBA 3RWBA 1DC6A 4NU5A 1NQTA 5C7LO 1IZ0A 1WDLA 4LW8A 3C1OA 5ER9A 4E4YA 1F0YA 4IY1A 1IB6A 1EVJA 2HMVA 1LQTA 4Z3DA 3G17A 4R16A 2EW8A 2CDCA 4AG3A 3JYOA 1Q0LA 3DEYX 3VH3A 2IEDA 4Z0PA 1HDZA 3Q9UA 4UUOA 4DMLA 4XJSA 4LRSB 1ZSYA 1TB4A 4YT8A 1X7HA 4R51A 3U3XA 1PGJA 3CSDA 2VZ8A 3CTMA 5AVOA 2X58A 3E1KA 3GVPA 4H15A 4FCCA 4TQGA 4NK5A 4MOWA 3JQEA 3VVCA 1YKFA 1J6UA 1TA4A 3I3OA 4YAIA 3PDJA 1MP0A 4FQ8A 2I6TA 4YA6A 4DPLA 2FR0A 2RAFA 5MDHA 3WXBA 3RIHA 3VPXA 3BAZA 4BMVA 4MO2A 4O59O 5GZ6A 1GCUA 4GI2A 4JJIA 1ZK0A 4CQLB 2EP7A 4CLDA 4R01A 1SOVA 1VL6A 1ZZEA 1E1NA 3DAGA 4XCVA 3F47A 2DTXA 4J1SA 1U2DA 3LT2A 5HRUA 1OMOA 1Q7CA 1GEGA 1U9JA 1EVZA 5LCXA 3GG2A 1TT7A 1WPQA 4BNLA 4LRTB 1U7HA 3EMKA 5ICMA 1Q2XA 3U62A 2Q1UA 1DHTA 4FGWA 2NTJA 4PLTA 1K0UA 4N5LA 3RJ5A 2NLOA 4NJOA 5JAMA 1E6EA 1ONOA 3B1FA 1A5ZA 3MEQA 3DBHB 2J3IA 3QWHA 4E5PA 1O89A 1PJCA 4CMHA 1RM0A 4IDEA 4MVJE 2X0NA 3EZLA 5JS6A 3GY0A 1MB4A 1NFRA 1GYRA 5BT9A 5DT9A 1ZXBA 4Z9YA 4U7WA 3ITDA 1UJMA 1UXJA 1E6UA 2CVOA 4R5MA 3WYBA 3ONEA 3LQFA 2X7HA 2AQKA 4FPXA 2BLLA 5AYVA 1U28A 1P77A 4AJ1A 2Q2QA 3OQ1A 3V2UA 3L6DA 3ZZNA 3DHEA 4Y67A 1GTMA 1PR9A 2V6BA 3GPDG 3GVHA 5FF9A 1DEHA 3DB2A 2EKQA 4XYBA 2IYOA 1K6JA 2CMDA 3ROQA 1GZ6A 3HN7A 2OP1A 4A10A 5IFLA 3PWSA 1EFKA 1XQ6A 2ZB4A 3S1LA 4NZ9A 2BHLA 4WPGA 4DC0A 2RCYA 5I9LA 2C54A 1V3UA 4BNFA 2D5AA 4RO0A 5TT0A 4YJHA 4HV4A 3E6AA 2PNFA 4KUHA 4E12A 2NQ8A 3W4IA 3A06A 4BNXA 4FOSA 1SCUA 4R5HA 5JO0A 3I9NA 4H3VA 3ZWMA 1XYGA 5B4TA 4BNYA 2RHRA 2GPTA 4WK6A 2C5AA 3PGJA 4R1TA 3JQ8B 2X0RA 4PCVA 5IJZA 2PGJA 1H6CA 1TEHA 1GQQA 5IDWA 1B26A 3JYQA 2DFDA 2Z1MA 4TSKA 4XR4A 3QVTA 1CF2O 1GR0A 4R1SA 4F46A 2O3TA 1WVGA 3GAFA 4OXKA 3GOHA 4B4UA 4BO1A 5IZCC 3OHSX 4UAGA 4YVFA 3W4JA 4NDNE 5B37A 2C07A 4DREA 4DYVA 1JU9A 2DPHA 2VN8A 3E5RA 1VL8A 3GDFA 1CRWG 4WEQA 3BTVA 4CMKA 4DIBA 4I08A 4FFPA 4BIIA 1D7OA 3MWDB 4K9DA 1E7MA 3FWZA 2ILTA 3AOGA 3D0OA 2DBRA 5IN4A 1BXZA 2OZPA 3LT0A 2BGLA 3GT0A 3GMSA 2ET6A 4FFLA 3RC7A 1QRRA 3PHLA 3OBBA 2HRBA 4JROA 4XWYA 3E8XA 2P5YA 1KEPA 3TRIA 3NT4A 1EQUA 3G1TA 4DMMA 4S1VA 1NNUA 3AI2A 2FZEA 3WYCA 1YH3A 4ZVVA 3PJGA 3I4CA 2JAHA 4IMPA 4R9RA 3V8BA 4YWJA 5L7TA 4CMIA 3NKLA 3WNVA 4WNIA 5ITWA 4HADA 4CLXA 1EUDA 5FEUA 3CMCO 6LDHA 2Q4EA 4RVDA 4NJMB 2GN6A 3U49A 1M67A 4E13A 4OOEA 1H6DA 1HYEA 4MVJF 3NDRA 3JD1A 3FTNA 5IDXA 2PV7A 1I33A 3CZRA 5KJEA 1CETA 1IPEA 3SC6A 3BXXA 4OH1A 4ROSA 3DAPA 5CAEA 1T1SA 1L7DA 1EDOA 1PJTA 1BGVA 3C3XA 2BI7A 3Q1LA 1U3VA 2W8ZA 2E82A 2J5KA 1VPDA 4CR8A 4AICA 3CIFA 5IG2A 2Y1FA 5KKAA 2A35A 2PKQP 2WE7A 4Y98A 1U2GA 1I8TA 3B6ZA 3KLPX 3IDSA 3RJ9A 2WD7B 2PA3A 5FWNA 5G0UA 5JAIA 3ETDA 1HT0A 4ALLA 4JBHA 5DULA 3FPCA 3JQ6A 4W4TA 2Z1NA 3KVOA 4NHEA 4BNMA 1VLLA 2VTDA 4GMGA 3PQEA 3A9WA 1X7DA 3ASVA 2VHXA 2O7SA 3LU1A 4WLEA 3LF1A 3H9QA 1FXSA 1CQIA 4ILKA 1C0LA 1Q7BA 4BMSA 5IXSA 4JXKA 2BFPA 3K2BA 4LSWA 3RFXA 4RJTA 1U5CA 4GBJA 2C82A 2VYND 3D5QA 4E5KA 1YQGA 3HZZA 1ZBQA 3V5NA 4EDFA 4FW8A 3PWZA 2PY6A 4WEOA 5KJ6A 1HDCA 4BNJA 4OM8A 5K6AA 2BRUA 3L4BA 1NQAO 3ZV6A 1VSUA 1BW9B 1LTHR 3FSRA 1UR5A 4BQPA 4BNGA 3MCVA 5IF3A 2ZJ0A 2EGGA 3VZSA 3KO8A 1DJQA 2F1KA 1PJ3A 4KWIA 4RDHA 3TDKA 4J1TA 3IKVA 4EZBA 3HUDA 3Q0EA 4AJOA 4DYDA 3IQDB 5JCXA 3HN2A 1T26A 3I1JA 4IGFA 3GHYA 3U09A 3S2FA 3ASUA 3WGYA 3F46A 3T4EA 2JFHA 4RF3A 2HU2A 1B8UA 3BZUA 1I0ZA 5C7OO 2O2YA 1NPTO 2P9EA 2GYYA 1HE3A 1VM6A 1X7GA 4IBOA 4MIEA 3JYPA 4J1NA 1UZNA 1Y8QA 4Q3EA 2WYWA 3IS3A 1LBEA 1EVYA 3PJFA 5C5IA 2Q99A 1AXEA 3JTMA 4GX0A 1TT5A 2I66A 3GH3A 3OIDA 2I5PO 5EPOA 1PTJA 5BSEA 4G5HA 1ARZA 2EG9A 3CMMA 4UVIA 1GV0A 4H7PA 2IZ0A 3LC2O 5CDTA 3W1VA 4CM1A 3C1AA 3ZWAA 1K2WA 4BNIA 2CVZA 2ZTUA 3LDHA 3WGOA 2C5EA 3A4VA 5H82A 3WDSA 3MJTA 2HJSA 4CUKA 2H5LA 2PGLA 1DO8A 3H65A 2W2LD 3X2EA 3ZWVA 1K89A 3JD3A 2VRCA 3GEDA 2QYTA 3IOYA 1C1XB 4KTVE 5DP2A 1DFIA 2X0JA 5JCJA 1O5IA 2AEMA 1YOVB 2DAPA 5BNFA 2ZB3A 1QKIA 4EJ6A 2JKVA 4FJ1A 3P2YA 3HE3A 3RFTA 2I67A 4ITUA 3IUSA 4BO8A 3DO5A 4WJZA 2PH5A 5CEEA 2NUAA 3PTZA 1KY4A 3QWFA 4KWHA 3RASA 5L7WA 1Z45A 3BMCA 2IODA 2FP4A 3H6KA 3FN4A 3QA9A 1YQXA 2UUPA 4OHUA 3LT4A 4Z0TA 3FTPA 5TLSA 2CY0A 3NT5A 3QJ5A 1HL3A 4I5EA 3WQSB 5CEJA 1DC3A 1IHXA 1V6AA 1PGQA 3JSAA 1R15A 2YHIA 3P7MA 3JYNA 2DKNA 1N1EA 3PHJA 1IL0A 1WDKA 5F3RA 1BDBA 3SBOA 5LDHA 3OA0A 4NBVA 4CQMB 3QVSA 1E1MA 4NFYA 4I5GA 4XDYA 4D3SA 1FDUA 3M2PA 1YBAA 3RKUA 4CLRA 1VRWA 3EGOA 5L4LA 4OSOA 3AOEA 1L7EA 2DFVA 1E3LA 4CM8B 2FN7A 4R54A 1B15A 2EJVA 2QRKA 5I7EA 3GA0A 5F1KA 1X15A 4IDFA 5JAZA 1H9BA 1HWYA 3RBZA 1A9ZA 2PZKA 1MA0A 3INRA 4TRJA 3E82A 3GLQA 4LMRA 2GZ3A 2RBEA 1H6AA 2QG4A 3GHHA 1Y8RB 1Z7BA 1LRJA 5C7IO 3SJUA 4K6FA 1GU7A 4ZQBA 4MP3A 3HDJA 4C7JA 2O4UX 5EERA 3ETGA 4LVCA 2BFAA 3F1KA 2Y1CA 1YBMA 1XA0A 3HDHA 4J49A 4YAKA 2X5KO 3VPHA 5MGBA 5EJ2A 1MLDA 2NADA 4QTZA 3I83A 3DZFA 4A03A 3PVZA 2AG5A 1BVRA 1IE3A 4LISA 4A73A 1C0IA 3D3WA 3FNHA 3E9QA 3H8VA 4DPKA 1QYDA 1X0VA 4D42A 2ZIZA 3TNLA 1U5AA 1BVUA 1NFQA 3FI9A 3GC6A 4KUGA 2V7PA 2I99A 3DZJA 3NYWA 4AJLA 1IULA 3PLRA 4K6CA 4B3HA 4E2XA 4F3YA 5TC4A 4MKXA 4E21A 2X5JO 3RUIA 4IJUA 4FIZA 2WMDA 3TFQA 1P45A 4B79A 2Y05A 3BYZA 4FOOA 2BELA 3AWDA 1ZFNA 3Q11A 5ILGA 3T4XA 4DQUA 2X5OA 2X23A 2B36A 1KERA 3GPIA 4W82A 4RVHA 1PJ2A 2RH4A 2Z5LA 2JFFA 2NNLD 3O8QA 4KQXA 4OO3A 3RROA 1UZMA 2O48X 2ZYAA 5I9MA 3VKVA 1DRUA 3UOGA 3C7CB 5L9AA 4MVJP 2NWQA 3I9MA 4CM9D 3LF2A 2D8AA 1W73A 1UH5A 2FR8A 2AQHA 4WOJA 1ZVMA 4II3A 2VNAA 3CEAA 4D79A 3TZ6A 4IUYA 1Z75A 2AW5A 1DJNA 4IPTA 2FR1A 3BTOA 1I5RA 2OL4A 1DLJA 3ROMA 3KHUA 4JBIA 3KBOA 4A27A 4R1NA 3IKTA 3W6UA 4DWVA 1MX3A 4BB6A 4NFSA 1R4MB 2OXIA 4MDHA 5L45A 3U9LA 2D5CA 1ISFA 4UUPA 4XGIA 4WCFC 1DXYA 1P1FA 5F21A 3QWIA 2I3AA 1GYQA 4B3IA 2QIOA 4W7HA 3JYLA 3PGXA 3RUEA 3GVCA 3KETA 1SAYA 4FFRA 1E0DA 1P1HA 1EFLA 3PYMA 4CM7A 4L76A 2X9VA 1HE4A 2NVWA 3ANLA 4JJGA 1KY5A 1S7CA 2J5QA 5A1TA 3NV9A 1K6IA 4OAQA 2IDZA 3SEFA 1NWHA 1PJSA 3OEWA 4U0KA 4CR6A 1MG0A 2O2SA 1JA9A 4YTEA 2CDBA 2G82A 3PFWO 5IDQA 2QZZA 5L7YA 1W4ZA 3H9GA 3QV1A 3ZWWA 4BNZA 5KOIA 1NQOA 1A72A 3TZQA 1JTVA 2VUTA 1TVEA 3BMNB 3HJAA 3PYXA 3U4DA 3KRTA 1KVSA 3UHAA 3EZYA 1CYDA 3KSUA 2Y66A 2AG8A 3I4FA 5IN5A 1X1TA 2VYVA 4M8SA 3WGGA 4BGIA 3VZPA 1D1SA 2ZJ1A 4EGFA 5U1PA 4CQLA 2EGHA 3VOSA 1PWXA 3CINA 1Q0HA 5H81A 1DHRA 4XYMA 4YB8A 1D4FA 1KOLA 2OO5A 3JQBA 2B5WA 1PIWA 3QHAA 4RVGA 2OOSA 3U5TA 2YJZA 1ZJYA 5DP1A 1IZ9A 1VSVA 1LDBA 5K0ZA 3VKUA 3OQ6A 3IC5A 2BGKA 3JD2A 3SVTA 1YONA 3HHPA 3U4CA 1JQBA 1BG6A 3BIOA 2Y99A 3V1YA 4AFNA 2O3JA 2FY8A 3D5TA 1OI7A 4I1IA 4S3MA 5COAA 1YS4A 3UAGA 4EI2A 5KVSA 1T2EA 3WTCA 3DBHA 1DIBA 3JCZA 2CF5A 1T2FA 2HAEA 4OKNA 1C1DA 3UFXA 4O1MA 4L74A 1NAHA 3E9NA 3DXFA 4GSKA 4JBGA 4W7IA 1DIHA 2X6TA 1I2BA 3NTOA 1PGOA 5JPIA 5CFZA 2VOJA 5GY7A 4GVXA 3RC2A 5GZ1A 1W0CA 2JCVA 3GNSA 3ZWXA 2C2YA 1PQUA 4N18A 4XQGA 2YZ7A 3ZNPA 3HQ4O 4RF2A 4DC1A 3NX4A 4IIVA 5JE8A 5L3ZA 2Y0DA 3K8ZA 1R0LA 1E3WB 2P9CA 1PGNA 3VTZA 2IYPA 4D0RA 4WE3A 5CDUA 1I3MA 4FR5A 3O38A 1EVIA 3DFUA 3IL2A 4KUEA 2CFCA 1BRMA 1X0XA 4CJXA 2YDYA 5JDIA 3GMDA 5DCUA 4OQZA 2QQ5A 5A06A 4NG5A 1PL8A 1ZJZA 1HTBA 5HWSA 2H1SA 2HO5A 2Y0CA 1T1RA 3DOOA 3IJRA 1UDCA 2D59A 1ZMOA 1ML3A 4W9NA 4YR9A 4IS2A 2E6UX 2WE8A 4QO7A 4RORA 4BNVA 3D4PA 4NBUA 3S55A 4PVDA 1QSGA 4AJNA 1YJQA 3BHJA 4Z3KA 2PD6A 3JQ8A 2VYNA 3BTSA 4N7RA 5L51A 2PZLA 3VPSA 2GN8A 5DNAA 3AUSA 3ICPA 4GX2A 3PI7A 3IMFA 2GASA 3WJ7A 3JQAD 1I24A 4N5NA 4YJGA 4MPDA 5A03A 2Z95A 2VHYA 4RF5A 4TZKA 2GF2A 2PD3A 1T4BA 1PZHA 1ULUA 1LI4A 3H5RA 4W99A 1XU9A 3ZWCA 1ZNQO 3DL2A 4Z9XA 1BXGB 3DOCA 3DZHA 1XKQA 1F8FA 3OJOA 4WLUA 2NQTA 4WLNA 3ZU2A 4J1QA 5BQFA 1VKNA 4D7AA 4RZHA 1KEWA 1XG5A 3WLFA 1P0FA 1DBVO 4ALKA 5KVCA 4CPDA 3OFSA 4RZIA 4EBFA 1YDEA 2A94A 1JLLA 3QWBA 1U3TA 3KYCB 1GPJA 3VVBA 1DB3A 3GGPA 4IDCA 1U4SA 4R9SA 3RBVA 3AJRA 1RM5A 3PFFA 4WNCA 3F4BA 4LSMA 5JY1A 2HLPA 5EL0A 3ZW9A 1N1GA 3ZV5A 1P33A 2O3RA 3EY4A 2Q1WA 4PLVA 5BSFA 2G5CA 2HK8A 2V6GA 4RVUA 3NUGA 4XD2A 4NJMA 1SEPA 1C1DB 3MTJA 4E2YA 1E3IA 3TOXA 3MOGA 1OFGA 4EUHA 1UAYA 1DIAA 1EE9A 1DAPA 1GYPA 4GSLA 3MJ4A 4AJJA 4CMCA 2I65A 2JHFA 3R0IA 2G76A 2W2LA 1YWGO 5KJCA 1JKJA 4RVSA 3O9ZA 1SB9A 2BGMA 3L9XA 4GX1A 5BR7A 1YL7A 4MJLA 3E03A 3KLMX 1Y81A 3VHRA 3OIFA 4N54A 4LN1A 3A28A 4YRAA 5T67A 1H5QA 1N2SA 1O9BA 2BF7A 2JD1A 2PWZA 3GQVA 3NDIA 3F5SA 2Q50A 1WWKA 2WD7A 2PZJA 4CL8A 1PGPA 4ND4A 3K30A 1H9AA 1I2CA 2ZQZA 4GPD1 1AHIA 1HYHA 1OC2A 4O6VA 3PRJA 4GGPA 2JD2A 2YFQA 1P74A 3E18A 4R41A 4XYLA 4PLPA 1XCBA 3AI3A 2SCUA 4M87A 1O0SA 3BMOB 4OIMA 2OBNA 1SO8A 4O0LA 5GMOA 1NR7A 4Y9DA 2GERA 3BMQB 4QO8A 3RUFA 5HM8A 2FSVA 2QZ9A 1CDOA 5DZSA 2Q1TA 4D3FA 3I6QA 1I3KA 4DQVA 5TIIA 1EUZA 3DQPA 3WG9A 3N74A 1YDWA 1YL5A 2VZ0A 4PLZA 2FPIA 4YJGB 2UV8A 5BNIA 5CPFA 1F17A 4KP7A 4RPHA 4CM4B 1MFPA 1SMKA 2QRJA 4RV9A 2E4AA 4XGKA 3V2HA 5JAQA 3ZWPA 1SNYA 2NVUB 3AK4A 2C20A 3JQ9C 4IZHA 1BW9A 1LU9A 1TI7A 2J3JA 1PU2A 4QT0A 5TS3A 8LDHA 3JD4A 1NM5A 1LC0A 3JQFC 2ZTLA 2VHWA 4YT5A 5EQFA 4OXNA 3TZCA 4DLBA 1LLDA 2PKQO 2BI8A 2WJPA 2CSUA 4BUCA 3OETA 4ND2A 2X1HA 1WMBA 5KKCA 3ZH2A 1ZUD1 4PGFA 4PLWA 1DOHA 3TSCA 2CNBA 2UAGA 2Q45A 3NGLA 3RUCA 2OUIA 3D1LA 1ZK3A 2Y93A 4J90A 2WD8A 3WNQA 4C4OA 4DTIA 3PZBA 3PJEA 2VWHA 4WLVA 4IDBA 2R00A 4CM5A 4G81A 3C85A 1N7HA 5JXWA 3WGHA 3Q3CA 3TL3A 4ID9A 2G17A 3FF4A 4XEHA 1IYZA 3WTBA 1I30A 4G2NA 1PS0A 4YPOA 3KSDO 4P8RA 3U4HA 3DMTA 2NM0A 1NHGA 1E3EA 2NVBA 5IZ4A 2JCXA 3QVOA 4MVJA 4O63O 3PQFA 1E5QA 5ICSA 4RVFA 2DTDA 1YL6A 2VZ9A 1WZIA 4B7CA 3OA2A 5TJHA 1C0PA 3KUXA 3FHLA 2VNSA 1ISIA 4B7XA 1CERA 3K6JA 4LVUA 4XIJA 4JCOA 3Q2KA 3OICA 5ADHA 3A14A 4NBWA 1C1XA 1DAOA 3COSA 3IAHA 4LGVA 4ZHSA 3ITKA 1GDHA 1MC5A 3VH1A 4BKPA 4D44A 1YOVA 1J49A 4MVJI 1NTOA 4XIYA 4Q9NA 3SLGA 2B4RO 1V3VA 2X86A 3WSWA 3AM3A 1R37A 4N5MA 4XZ3A 3ZU3A 4CODB 4BNTA 1NR1A 1ZO8A 1GQ2A 1HZJA 5T8KA 2D1YA 3NTQA 4ALJA 4XRRA 3C7AA 3WYEA 4CM9A 2RIRA 1Z82A 1UAGA 5JC8A 1GQYA 2VHVA 3UW3A 5KIAA 3TJRA 3WQRA 4YJFB 5G0TA 3V2GA 1DRVA 5FYDA 1IOLA 4BKQA 3RUAA 3TQHA 3LC1O 3JV7A 5JFOA 4B8WA 4B7UA 3WMXA 3F1LA 5TX7A 4BO6A 4FC6A 4KQWA 5CDSA 1X13A 3FBGA 4KDFA 5B1YA 1JVSA 4AJKA 4CQMA 5JMPA 1CIVA 1B8PA 1ADFA 3T7EA 3PP8A 1MXHA 4RPKA 4WCFB 1I01A 1B2LA 2HCTA 1RKXA 1A4UA 4TRRA 2Q2VA 3VTFA 3ZI0A 3VZRA 1UDAA 3G49A 2ZB7A 3SLKA 1NP3A 4WOKA 3ULKA 3M2TA 3UKOA 1J4AA 4IQ8A 4CM8A 3INTA 2EW2A 4CLEA 1JWAB 3AY6A 2POQX 4CLHA 2HRZA 1QORA 3UXYA 1HLDA 1JN0A 1I36A 3QIVA 2HK7A 3K92A 2GSDA 2HJRA 1W6UA 1EEHA 1XHLA 3D7LA 1Y8RA 2J3HA 2EHDA 3K9QO 3Q2IA 3MJVA 3FNGA 5JLAA 4EEXA 3CH6A 1J0XO 1UUFA 3DONA 1OOEA 1P1RA 4BVAA 1YJ8A 4U5QA 3W8EA 4E33A 4JK3A 3H9JA 4J2OA 1QR6A 3ORFA 1N8KA 3IP3A 1XR3A 1MUUA 3RSHA 2D0IA 3ZNQA 4IJVA 3INGA 4BL5A 1HDGO 2A9FA 3QVXA 1GL3A 4YRDA 3L6EA 5JO9A 5TRTA 3LLVA 1KC3A 3NT2A 1C0KA 1E7QA 1UP4A 2IZZA 3GK3A 4PLHA 4U8GA 5A9TA 3RKRA 1RPNA 2CDAA 2GZ1A 2QRLA 1KBZA 3RQSA 1SEVA 4CL3A 1A7AA 4EEZA 1ENPA 3KYBA 3S2IA 4BHTA 7ADHA 3D4OA 4B4OA 4TWRA 1LQUA 1G6KA 4A0SA 4BOYA 1EMDA 3DTYA 5HBRA 2B5VA 3E5MA 2AMFA 3D64A 3PIDA 4TKLA 3RC9A 4EJ0A 1YGYA 3VDRA 4KZPA 4J9VA 5T6BA 1EDZA 2ZKLA 5LDGA 3DBLB 3OSUA 3FR7A 2UUOA 4E3ZA 4YXFA 1X1EA 3G0OA 2NTNA 1MV8A 4K26A 1E1KA 3TN7A 4BKUA 2QW8A 5TGDA 5JMWA 3ZNNA 1GAEO 1UDBA 1ISJA 4ZQEA 5JBIA 1E7SA 4J3FA 2VT2A 4YQYA 3O03A 2P4HX 3GR6A 3P5SA 3WB9A 4F6CA 4IQ0A 4FN4A 1FJHA 1C3VA 2YV1A 3NRCA 3OMLA 3TZKA 1XWFA 4PG7A 2B83A 4D46A 4P4LA 3GZNB 4GX5A 5G0WA 4TZTA 1GUZA 2J3KA 5CDYA 2Y68A 1Y6JA 1ONPA 1P1IA 4JJFA 1KETA 3I9JA 2DU8A 4IS3A 4OMUA 5T5QA 2IXAA 4P4NA 1R4MA 4HFRA 4XYEA 1U7TA 3C1TA 2VUSA 1KEUA 1EBUA 1AXGA 3PWKA 4M54A 2HKIA 4GWGA 2BMAA 4R3WA 2YDXA 4BKOA 2VHZA 1XLTA 2UVDA 3NJ8A 4I9NA 2BD0A 4RDIA 2EIHA 4I9UA 1NFFA 3QRWA 1LDYA 5ES3A 3AY7A 4GAEA 4PN3A 1QG6A 4P4GA 2AE2A 2B4QA 3O4RA 3GRPA 1BXKA 2Q49A 4LMPA 4HXYA 4E32A 3H3JA 3L07A 2YQ4A 1P9LA 1NXQA 4J91A 2AEJA 1T25A 5KVVA 2J5RA 3NDJA 2OGUA 2FRDA 4BNUA 1FMCA 1KVUA 3HWRA 1LDEA 4IM7A 1Y9EA 4PLGA 2W4QA 2EJWA 3JQAA 3GFGA 1RYDA 1ZIDA 1E3SA 3HDYA 5DOVA 1SOWA 2VRBA 5IZCA 1ZK1A 4PZEA 3H2SA 3FBTA 3DHNA 3B70A 3BMNA 3KB6A 5A4DA 1LEHA 1HDOA 2BFOA 1FDWA 3UCFA 4A26A 4AJ4A 1CWUA 2OHXA 2ZK7A 4UULA 3UICA 3L0DA 3SXPA 3L6OO 2PR2A 4DVJA 4J7UA 1YE3A 1EBFA 1PZFA 4BGEA 4NK4A 2ZQYA 3RD5A 4XR9A 4BV8A 4BV9A 4FFMA 3GEMA 1M6WA 3UGKA 4EUFA 2TMDA 3I9OA 2NU6A 3TL2A 4BO4A 1ADCA 5EN4A 4XJTA 5DCYA 5HA5A 4NMHA 1V0JA 2PFGA 1IUKA 1ZXLA 4HFNA 3ANMA 4E30A 4RQUA 3GNQA 3DOJA 4A7PA 5FI5A 1LDNA 4PG4A 4BO9A 1ORRA 3KM0A 1DIGA 3UH1A 3LSYA 5DN9A 1B16A 4OSPA 2ZB8A 1DPGA 1ZMTA 5DBIA 3UUWA 3CE6A 4ZICA 1N9GB 3PYLA 2X4GA 2AHRA 5A02A 5I8WA 2WYVA 3IP1A 4J4HA 1GUFA 4NR0A 2DTEA 1LRLA 3EDMA 3LC7O 3UN1A 4TVOA 1V3TA 3V1TC 4OGWA 5HS6A 3ZHYA 2ZCUA 1DC4A 3EVNA 1E3WA 2Q4BA 2CZCA 3DBRB 4E5NA 5IAAA 1E3JA 3ONDA 4F6LA 4RLHA 2VQ3A 4XRGA 1E6WA 4PRLA 2EWMA 1R66A 4FC7A 1AE1A 2VT3A 3M1LA 4JP2A 3NGXA 1SZJG 4IZIA 3STHA 4J0FA 3ZU5A 1BSVA 1JAXA 3WBFA 2YFHA 4PRKA 1F8GA 3B1KA 2IXBA 3B20A 3QQPA 4CMJA 4Z6KA 5EMHA 4CV2A 1PJLA 4E6PA 4HNHA 4PLFA 4MIYA 1YO6A 1PL7A 4QSMA 3ZNOA 4CV1A 3H5NA 3JQAB 2C2XA 4NBTA 1XU7A 3W8DA 3F3SA 4J7CA 1GCOA 3ZCXA 3UCXA 2O7QA 1VI2A 1OC4A 4K28A 4W6ZA 2GLXA 4R69A 1QP8A 1QV6A 2EEZA 4Y6SA 3M1AA 1YB5A 4ZU3A 4Y8VA 5A9SB 3GZ4A 3ETEA 4M89A 2WTBA 1HDRA 4CLOB 1FF9A 1T4DA 1WXDA 4MIOA 3VH4A 4Y6PA 1BXGA 3ZHZA 1V35A 4Z9FA 1XEAA 2IE0A 3RCBA 5HTOA 1PQPA 2D2IA 1ZSVA 4L75A 1H0KA 4BO2A 4Q3DA 4E0BA 3M6IA 3TZHA 4ZJUA 2JL1A 3KYCA 3DDNA 1V9LA 3ZDFA 3K2EA 1PS8A 2I9PA 4UVEA 5A5EA 2ZYGA 4R1UA 1E77A 3WSVA 4MP6A 2UDPA 1HETA 1T24A 3BTUA 5ER6A 1P31A 3ZWYA 1Q7GA 3JQGB 4OL9A 3S2GA 4A2CA 3F5QA 3SJ7A 1I32A 3MJSA 4GLOA 1VKOA 4YAGA 3IJPA 1NASA 1NPYA 2CD9A 2FMUA 1ENOA 1D8AA 2GRAA 3LLSA 5CDGA 3OEYA 2O3QA 4IJWA 5A3VA 5AXDA 4RL6A 3TOZA 3ZWOA 1DSSG 1A71A 1Q0QA
chains in the Genus database with same CATH superfamily
1KYTA 4ENQA 5B3KA 2GK6A 2BLNA 3F74A 4I3FA 2VYQA 3K5PA 4GSYA 2GAAA 3TYXA 2VO1A 3QX8A 2A1UB 1EUCB 4YT2A 4G23A 1QO7A 1GA1A 1W85A 1CZUA 3FWNA 5AXBA 2CXUA 4MA0A 4LK3A 4V0NA 4AXBA 3BK7A 3FKJA 3K9LA 2MR5A 1NY5A 3MMXA 4OLFA 4XGRA 3IBSA 3K09C 4DCVA 4DSOA 4HEHA 3SJBA 1Q1EA 3VPGA 1QRTA 1ZG3A 4ARIA 2WUVA 1XSEA 2QMEA 3R1IA 1RFLA 4ZQHA 3TUIC 3WQBA 4M1QA 2CXQA 2J87A 2HMWA 5K6AC 5EZ5A 1OLXA 3SG0A 1Y5MA 4LZJA 3ICOA 4GGOA 3ESDA 1X2BA 3FA2A 3CUKA 4OOFA 5K0SA 5TXGA 1GNRA 1KBQA 3ANTA 4HF7A 4HWKA 4YBZA 1XMQB 2H5EA 1E1CA 1LSJA 3THOA 4BGUA 1NW8A 4V0QA 4ZVUA 3QSYA 5IM4F 2FZWA 2NV6A 4NFHA 2GYWA 2VRNA 4KR9A 3H5WA 4ARAA 4BZZA 3CXRA 1UM9A 3LP6A 3COWA 4EB6B 4YT4A 5BNTA 5ARDA 3N39C 4KZKA 4BE7B 3ND5A 3NEJA 2O4CA 3HYTA 5AK6A 1PVVA 3AB3A 4KGVA 3NC1C 3OZEA 1C7QA 1G2PA 4IFTA 2NVUA 3OTIA 4YRIA 2OK7A 1M0EA 3BG5A 4HUJA 2I3ZA 2ZKIA 1ZH2A 1HF3A 5CX4A 1ZN9A 1SRQA 4INPA 3DEJA 4YAJA 4HD8A 5GPBA 2MSLA 4FJ0A 2GD1O 2B0JA 3C43A 3MXOA 3N7AA 3BA6A 4XD7A 4Y0AA 3RPEA 3RS5A 3T5PA 4FDLA 2HPVA 4IGAA 1H66A 3ANNA 4YYEA 2Y0EA 2HT1A 1SVNA 4OK6A 4K6MA 3HNPA 3I53A 3SZLA 5JSZA 3HR8A 3QY0A 4WK2B 1P5FA 2REOA 2DF8A 3QSGA 1DC7A 3L1KA 2EJCA 2Z4TA 4ND3A 5F5LA 4QASA 2ZSBA 4EARA 1A5AB 2BDEA 5J2TA 3KYDB 3PE6A 3TBFA 5JRDS 1SC6A 1TD9A 3TINA 2P40A 5D3KA 2XDWA 5TSDA 4AZ3B 2ODBA 1VLQA 2C7BA 1FK8A 2ZBQA 4RH1A 2EIXA 3EC7A 1KAEA 1XJWA 3IGFA 3PWTA 5DM4A 5EZYF 1GY8A 1ZQ9A 5F2EA 1D6MA 1PJQA 5I9BA 1WDMA 2ZJ5A 2YR0A 3DDSA 3MWGA 1ZIPA 2W48A 3OH8A 4YASA 4DGSA 2Z9BA 1Z08A 3QBTA 2YQ5A 3QV2A 1KVRA 6REQB 1NLFA 2IV2X 5BURA 5SICE 3HKDB 4F8JA 1KKUA 2Q9AA 5K20A 3DYVA 4WESA 3RUHA 1LUAA 2LDBA 2PLNA 5CT8A 3O8LA 1A7KA 4DNQA 4I4TF 3ZLTA 1M1NA 3BA1A 4LVOA 1RLOA 5EIBC 4AMBA 4BLRA 3RG2A 3DZBA 2RDMA 4G4IA 1N32B 3QY9A 2OYRA 2HU7A 1JLSA 3PKZA 3NRBA 1DUVG 3IAFA 4IXWA 2AI3A 2PL9A 4UASA 3ZS8A 4O2BA 1RFGE 1KI2A 5E4JA 1WY5A 2Z2KA 4OAOA 1GEEA 2ZRIA 4RAQA 1HA3A 1Q0UA 3UATA 1RYNA 4AWBA 3C7KA 2HHJA 3Q7PA 5F4ZA 4F6RA 4IIBA 1J8VA 2WT4A 1GLNA 1R9JA 1X1QA 1QP7A 2O0LA 5TPZA 4F56A 1W36B 4PC6A 3GJZA 2EKPA 1ZVJA 3PDUA 4JZYA 2WYUA 4HQLA 1JLHA 3AEQB 4F86A 4MYTA 2PAAA 4F4UA 2J32A 2H65A 1AS2A 3NONA 1KVQA 2FWMX 2VG8A 5IP5A 5E7MA 3TRHA 4KFRA 1Y7LA 3C6MA 4L0CA 4Q3AA 3R0XA 2NYVA 4YN3A 4C7XA 5BQXA 5A3QA 1S8FA 2AJLI 3KIPA 1R0ZA 2JIMA 4LG1A 1CEEA 1KIFA 5K3BA 4EYEA 2VTEA 2XUGA 3OZAA 4QFDA 2GLTA 5FNVA 1HYBA 3AMVA 3MWKA 5GV7A 4BWVA 3CPSA 5EJ5A 4N65A 1GGVA 1Z83A 2ARKA 2DHDA 3FOZA 4QYSA 4INJA 4KQ2A 3C6KA 1CRPA 1YRHA 3AEKA 3DOIA 1RPZA 2XA1A 1FFXA 3GXOA 5IC4A 5MGNA 2QL9A 3GRVA 3O31A 5BQ3A 5CG2A 1AGYA 1A9YA 1G5FA 1JV2B 1NNSA 3FVQA 3PIIA 4L3WA 3DWIA 4PZPA 2IIPA 4KIFA 3R7NA 3B9RA 3UQYS 1GA6A 3G2IA 4E5YA 4A82A 2BBSA 2DJIA 2V7VA 3ZHUA 2H11A 1UT8A 4I5DA 5F2KA 1ZUNA 3FCYA 4DXDA 4ZK2A 2BTEA 3T3OA 1NW9B 4U7GA 3SY8A 2W6OA 4UUMA 3WL4A 4PSAA 1MPTA 3NTXA 2PBFA 3HEAA 4QBTA 4DE5A 4DJ5X 2O8EB 2V8OA 5AUNB 3DBOB 1DDOA 2FX3A 1EQ2A 5L6LB 1Z0AA 3DB1A 4L5YA 4TLCA 3UUFA 4URUR 5HKKD 5YASA 5KWEA 4S1PA 4LJLA 4Z0HO 2XQKA 1LK5A 1E2MA 3C4QA 1UWKA 1PFGA 5I7FA 2BEUA 3E48A 4AMVA 1E64A 1LI5A 1O4WA 1W76A 1Q7EA 2PVPA 2QVZX 3HRHA 3KR0A 3KZVA 4OQPA 4QATA 1Q1NA 1WULS 1TM3E 2VP3A 5K4HA 2O19A 3TLCA 5ARBA 1ZPDA 1T34A 3O4VA 1ISMA 2ZRNA 3QP9A 3CO0S 1E61A 5AQ1A 3DS8A 3E9RA 4PRZA 3IHKA 2P2NA 4Q4HA 5LNK6 3PPIA 4LFCB 2JCYA 2H1FA 2BEVA 3EUWA 3G3EA 3UGQA 3ZVMA 1HNNA 1C7ZA 1FFAA 5KQLA 1WETA 1JVBA 3WLSA 4XX0A 1F06A 2FSHA 4UZSA 1C14A 1N6KA 3VPFA 1O6ZA 3UMVA 1IY1A 3NEPX 3EUEA 5KJFA 3H2ZA 1NDHA 2RHMA 4CDGA 3D3JA 16PKA 2QVYX 2DBZA 2GGSA 5KX5F 1GN8A 4KX5A 4EGSA 1KC1A 1ZJ5A 3KPYA 3QG5A 4FGZA 4YRRA 1KJJA 2I22A 4ALMA 2PXXA 1RCUA 5CNIA 5J4YA 1HSZA 4LJ8A 1KIAA 4FE3A 1QX3A 3BE4A 2EX0A 2M9MA 3B3AA 2FSSA 1EKXA 3V46A 4FGUA 3HWWA 5JH7F 2PAFA 4B6JA 1Y48E 1QVRA 3UXEA 3L79A 1F0NA 3VI3B 3QNMA 2XIQA 4CIXA 1RQNA 2I2XB 4TT3D 1PJRA 5FWYA 1KP2A 4D4GA 2CV1A 1J06A 1ZCJA 3NLLA 3Q3EA 1E6KA 2CLOB 3A4YA 5ALFA 4R68A 3SS7X 4QDZA 1MNQA 1R88A 4NNOA 4LGCA 4CZ2A 1AZWA 2D3WA 2FR8C 5B3LA 1T0JB 5EIFA 2I2AA 4Q3KA 4DC9A 1LPOA 1QQBA 2FK8A 1Z16A 3DLHA 1E1YA 5DHPA 2HJHA 2Z1DA 3DBLA 1ZISA 4ND1A 3GFTA 1KY2A 1MIOA 4PIVA 2AJ8A 2YUTA 2H2GA 4PCAA 3O8BA 3IO5A 2D1FA 1M6YA 4MVJG 2IRWA 1P9RA 2OLEA 1YSCA 3DZDA 4OMDA 3U0BA 3R4VA 5JYDA 2XZOA 2GAJA 3I92A 4FMCF 4KE9A 5ENZA 4JC0A 1VL5A 5COQA 2QRNA 2B4AA 4JEHA 2DQZA 2XA9A 3BREA 3NBAA 4BMYA 1FNSA 4DLTA 4KO2S 2FW7A 5IAOA 3D3EA 2GN9A 3OCZA 2BKAA 3MCUA 1H2RS 2WJVA 2VBGA 2ORWA 5H70A 1Q6YA 4HNGA 1UDXA 3H3FA 4G5YA 5EINA 1W59A 2J30A 3BK1A 3O9VA 2WWXA 1PFUA 1UP6A 3GCGA 1ZIXA 4HLDA 4YJHB 4Y9TA 4Z99A 4ZVRA 4I7EA 2O8FA 2QTZA 3HB1A 4MPPA 1JE0A 2A5YB 4XUEA 1T2DA 1PR0A 3JAMA 3FH0A 5BW8A 2YS7A 2CVFA 1E3TA 2W2QA 2VJOA 3KWFA 1CVRA 1JB9A 1RADA 1YTLA 2BP7B 2X22A 4HH0A 1PJAA 4CF5A 5KSWB 3TGPA 4Y6RA 4AI6A 3QKSB 1WCWA 2R11A 4GMFA 4LWQA 5ALQA 2RI6A 1ZOOA 3O82A 4FHGA 1UOOA 2BGWA 1XELA 4JXZA 2HJ9A 1C3XA 1L4MA 4G0QA 3U4IA 5D51S 2NV2B 4JWKA 4BEJA 4OK5A 3TTTA 1BCSA 121PA 5COBA 2J46A 1DFGA 4MCJA 3IQXA 2BY4A 3V8RA 1AURA 1UL1X 4HFJA 1N77A 1V2GA 3RC1A 2X41A 3OFJA 1QC5A 2Z8ZA 1HO3A 3BX1A 1FU8A 5KVQA 3MD9A 2AMYA 3UEOA 4QA9A 4PSKA 3L4KA 5T57A 3KEMA 4H18A 3NVKI 1PEAA 4XQEA 2IY7A 4OP1A 1TVMA 1Y3CE 4FR0A 4LV8B 5C0OE 5ALHA 2GETA 3OSZA 2YWCA 3E8SA 3RGGA 2EP8A 2Y1XA 1CD5A 1I1QB 5K0TA 1RPAA 1ZKMA 1XZNA 3S2UA 3QQ5A 2P6RA 3AVPA 2W83A 4OHCA 3LOUA 4TUYB 3TQFA 3ZUPA 4EJSC 3DWGA 4ZYZA 1PSZA 3AT1A 2RK6A 1D3AA 1M1YE 1W0JD 2PO5A 3G0DA 4GL4A 4WXHA 3ZKWB 4CL0A 1SCAA 4B3GA 3TSAA 1U8UA 2O07A 1SBYA 3G2HA 4XPIA 4EEKA 2BMFA 2OO5C 1YQ9A 1P7YA 3BB3A 2P3SA 4EMUA 5DYTA 1WB5A 4DEYA 1KH2A 3RU9A 4L22A 3Q85A 3IIKA 4HWTA 1J0BA 2G40A 4LHVA 4M0MA 2H63A 1NHWA 4KLAA 4QUKA 4DRXB 2NSJA 1EFVA 3EEOA 5E2BA 1QNFA 3F90A 1X92A 3ZI4A 2PEYA 1PK9A 5I9NA 3LYLA 1O9HA 2WKRA 1U9YA 4LZAA 3UB4A 1N9ZA 1FSGA 4JC8A 1GUAA 1NURA 2HF7A 2RGWA 3SQLA 821PA 1FLNA 2CDNA 3AFNA 2A9OA 4RCVA 4JN6B 1XZDA 1W88A 2RGCA 4I6EA 1P2TA 4NP6A 2XMBA 2AN1A 5C7YA 4I46A 5IDVA 2OVFA 1P3DA 3KKPA 4PYKA 4LDZA 2W2KA 1YVDA 2MSKA 2G67A 4Q3CA 1UJ5A 1EFPB 5HKOA 3B89A 5FADA 4ALIA 4BNNA 7MDHA 5JYEA 3UV7A 1IM8A 1OI4A 3OQIA 2X2EA 3U40A 2ID8A 3KZKA 1KO7A 3DBIA 3PUKA 4RD3A 1M54A 5FFNA 3RYHA 3B51X 5AWFC 3WLKX 1S3SA 2QRQA 3H7AA 4Q15A 3KHTA 2BFMA 2FPSA 2H07A 2VQEB 1IHYA 3BIXA 1V1MB 2P3LA 5B7NA 2HMUA 2HMTA 4C7VA 1PF7E 4JY7A 1G1MA 2IOHA 3HVKA 2ERCA 2WKWA 2EWWA 2J09A 1GZ4A 1UBGA 1QV9A 2ZXEA 3SM3A 4WINA 4IDDA 3L1HA 4R2IA 3WFJA 1CS0A 5KDLA 2I4TA 1QLHA 4BLOA 4DLAA 1S4QA 4C20A 2Z6QA 2C59A 1N0VC 2UVPA 2AQ8A 2YXNA 4Q16A 1K5DA 2DH6A 2BE9A 4EW2A 4BGDA 4DV6B 3CLRD 5ENVA 3U1VA 1A8SA 1VZ3A 2PKXA 1X1RA 3OOYA 3SDBA 1XD8A 1PDVA 2REQB 2CVQA 2LIVA 1P8AA 3GDOA 4MV7A 5ULLA 4ZGWA 1E4EB 1UC9A 1U2RA 3H6HA 3DBRA 4HJRA 3ROTA 1UEJA 2X77A 3JWIA 2R48A 4Y0NA 1B14A 2O3UA 1G17A 1P44A 1JAYA 2YWHA 5AVUA 1XEFA 2O6LA 3CY6A 1W47A 1CYEA 3M3HA 3WLTA 2CHEA 3LZ6A 1BCSB 4CMEA 5TQ0A 4HHEA 1IOZA 1MT0A 4YUZA 3QE3A 4NU8X 2ZUEA 1WCYA 2H7CA 4LFBB 2VT6A 2OV3A 3F7MA 3AUUA 2ZG6A 2ZS8A 3L0YA 3P4XA 3PC8C 1DQPA 3MRXA 4XWTA 4U3JB 2P1DA 4RTRA 2CHGA 1VPLA 2HXSA 3TFWA 3BIJA 1MFZA 3FXAA 4MW9A 5D84A 4D45A 4CUZA 1BQ4A 1KAHA 1BDJA 1T0HB 4KBFA 4D97A 3P2EA 4L73A 1E2NA 1H94A 2ZW9A 1QH1A 3CLUD 3L1JA 2E48A 4GM0A 5J9FA 3RTBA 4YDSA 2ZT6A 1ZQ1A 1DC5A 4OJNA 4D0NA 1OLUB 2XZTA 4O8CA 4UVHA 4V3CA 2IL1A 1Z0UA 3O2NA 3P9ZA 5FFMA 3SIRA 2UYHA 1FDVA 3MSCA 3SZRA 4MV0A 2CFOA 4PSCA 3HN6A 4LXUA 4ZHQF 3QEAZ 3HBJA 4JAVC 3MD0A 1S2NA 1VSBA 5J5CA 4LY3A 1V5FA 3WGIA 1UWCA 1SHJA 2WC1A 3RK4A 1ZW1A 4ENSA 2HSZA 1B7GO 4JU9A 3IERA 3TW8A 3KPUA 1OBCA 2XXAB 3EGVA 4L28A 3FUUA 3GFRA 1K3TA 3ONNA 1G55A 4R8RA 3ZJ5A 4BUJA 1JDBB 4ALNA 3GBSA 4EY3A 1OV6A 2WIGA 1YZVA 1FXWA 1QR2A 2QPOA 1EK2A 3F6EX 5DF1A 1AIPA 1UP7A 1RABA 1TADA 2O7NA 3A0UA 4L0QA 1DO2A 4II3A 4OAPA 1SD2A 4OBXA 4AZVA 1YVEI 1HQYE 3KD2A 1JWBB 2QD3A 2RGNA 3QEMB 2FDCA 2B7CA 4DA9A 1KRWA 1FYVA 4H27A 5AXCA 4DXHA 3ZDDA 4PZCA 4L4RA 2W2KB 2VPQA 1B00A 3U7JA 2KW5A 5KOJA 4HKTA 4IQ4A 4RW0A 5KKNB 3O4HA 1BHSA 4FR2A 4QDUA 2Y1GA 4YUVA 1K3UB 4A0HA 4LJRA 1A04A 3A10A 3OQIB 1KQOA 4QECA 3LQQA 2PGNA 2G0AA 1ZIYA 3F5DA 3ROPA 1FMJA 3OX4A 4TMXA 3ZCUA 1HUQA 1SD1A 5LZ5A 1WW3A 2C4WA 3NUZA 4H60A 5KNCD 5A05A 1NMQA 3EUAA 1QFMA 3FPBA 3KL2A 4CKXA 5DBHX 1FFWA 2OKGA 3HPRA 1WXEA 5KTNA 4IV8A 2QF7A 2GUGA 1KIMA 1POWA 4BQNA 4U2GA 3C8MA 2CKMA 1B0ZA 1YIOA 3MJCA 2OZKA 4J4TA 1PO7A 2NUAB 3SX2A 4EH1A 3EGDA 4KFSA 2G5GX 1DTEA 1QXSA 2IEGA 2NSHA 3PXXA 4ZO8A 9LDTA 4F3TA 4RPCA 1X1SA 4X64B 2ZGVA 1SIBE 3H4TA 4TMFA 1HMPA 4C4ZA 1JFTA 5THKA 1I2DA 3PENA 2P9ZA 2XOKD 2B69A 3GF4A 4FMBB 1AN9A 3KLNA 3S68A 2PKEA 4D3ZA 4CCYB 2HSDA 4JX8A 2YHUA 3T35A 4C7OA 3MZ0A 1OX4A 2I55A 3E2PA 3WR5A 1E3DA 4DCPA 3DEFA 1VFNA 1Y5RA 2ZUDA 1YB2A 3G2PA 3IYLW 4ZCSA 3JRWA 1NI4B 2COEA 5E9QA 1Y1SA 1ZYUA 1TX4B 4KQ6A 4RL4A 5HMMA 1S2LA 3UWPA 2QR3A 1TTQB 5K45A 2RG7A 3FPSA 2DPMA 1RIFA 1WP4A 4PQGA 3VR2D 3SHFA 4MW4A 5DGHA 2TSYB 3BJZA 3CNEA 3LKZA 2R1VA 3EVCA 1XCJA 4FGSA 5LP6C 4DYHA 5KQGA 1JPUA 2R7MA 3TF5A 3LFHA 2ZWVA 4AJPA 1KRHA 5IK2D 3JYHA 4BS9A 2P0YA 5HR5A 3D7MA 5CW1A 4UEKA 4CQMD 5K0LA 3MWEB 2WSMA 1OYVA 4AJ1A 1BWSA 3DAFA 1QBGA 1E1RA 1P7WA 2G0TA 3BFVA 3E27A 3GLUA 5KINB 2AG0A 2A8YA 2J08A 1CJKC 4MULA 1E9BA 1ML4A 4W9MC 3FPFA 1R8QA 1IAVA 4OD0A 3B5EA 4C1BA 1GPUA 3EVFA 3PQ8A 1DBSA 1M2WA 4NCNA 4TKMA 3ESBA 4D0SA 3ZTTA 3N7UA 1W44A 1RP7A 1KVTA 4Q4JA 3V4PB 4ARVA 1JKIA 1EZ4A 4TTJA 5A4IS 5IHPA 2ZJ7A 3OWXA 1XTBA 4P6VF 1Z3IX 3RTCA 2AG1A 3C6QA 5CG1A 4NKRA 4R6WA 3GLHB 1M2GA 3AU9A 4R7GA 3TD9A 4MP8A 1FJ2A 1YC5A 5GJWC 4HAWA 3OFNA 1GVHA 1H5UA 1JJIA 1B6TA 2ZUFA 1VECA 3AHFA 2RE8A 2E1PA 2IHZA 4GYWA 3OTHA 3DR3A 1ZK2A 1IJKA 3RVOA 3UJDA 2P1RA 1RLTA 4ARZA 1RP1A 1XDUA 4ZREA 2M6KA 1Y6RA 3RIYA 5LM3A 2C29D 1NUHA 3I2HA 1SVKA 4KXFB 3UBTA 3VDQA 4DPMA 1CZHA 1F2VA 3VAYA 1UKZA 1G98A 3M6FA 3QOWA 4BGVA 3SE0A 3BXPA 4N49A 3STTA 2OGWA 1EE1A 1R6XA 1ZK4A 2F90A 3NVDA 4B1FA 4NYMR 2PBRA 4ZCQA 3FUXA 5C4GB 3DUFA 4CM6A 1DOAA 1ZGZA 4FE7A 2WPDA 2YJNA 2OXEA 2QL7A 2O5EA 4E6EA 1IZZA 1M6HA 4BFSA 5AESA 5KYYB 1YZLA 5JIBA 1JDVA 1QV7A 3CEPB 3A6GA 2GZDA 4CHGA 3JAWA 4HRXA 3U26A 4W5NA 2VK1A 3FJOA 2F1HA 2HNAA 1MG5A 2L19A 3GGGA 4KDEA 2M98A 1GKLA 4JQOA 4C0LA 1U7WA 1Z88A 5HKBA 4WBXC 4JLVA 3CSSA 1U31A 3VDNB 5JCJD 4F4IA 1SHLA 4EHAA 2BBTA 1Y7TA 2Z5FA 4OKIA 3T3PB 4IV0A 4YRSA 3EAFA 5G02A 4JSTA 1QHIA 4MV9A 3WB1A 3H4VA 3RU2A 3O8QB 5DW0A 1J2RA 2FN8A 3GG9A 2QP3A 5H4GA 2VPIA 1XFAA 2WM3A 3KEQA 4BKRA 1YIAA 4D9EA 4AF8A 3RLFA 2W9XA 4XB2A 4BFLA 1U1EA 4PFJA 1Z5OA 5CXSA 5CBPA 5HMLA 2ISQA 4MWZA 4KWEA 3V1UA 2XECA 3R8CA 3W2HA 3VV2A 3EG9A 1P7CA 1U63A 5LQDA 3PLNA 1QOZA 4DA4A 2C7VA 2VCYA 1EHCA 3H5TA 1UFQA 2J59A 1Z73A 3IPXA 4OP3A 1JW9B 3EZ7A 3FPHA 3QPDA 5DGDA 2VAWA 3DPIA 4E7PA 3EGCA 4ZAGA 4YO8A 3MTGA 4R71A 3FUWA 4NF2A 4JI6B 1Q77A 4MI3A 2VAXA 3GCWA 4DIOA 4CKCA 1YFJA 3LSTA 3FCEA 3WQQA 1YIDA 1KH1A 1SUDA 5DM70 2BGNA 3U5ZB 2IXDA 1LPNA 2YRWA 4QELA 5FBQB 3GEHA 3ABIA 2FMTA 1T0UA 2R5NA 3SMQA 4B87A 3HB9A 3NUQA 1OA1A 2W93A 3RWBA 3WSTA 5BOSB 1LF0A 1UODA 4D3YA 5IM4A 2OO3A 4DBLE 4FSXA 2X8WA 1NBWB 1Z6GA 3O0DA 3LRPA 2Q4TA 4WY5A 3RHZA 5C7LO 1A8IA 2ZIAA 3FUVA 1QVVA 1KEEA 2OHFA 3IOBA 4IMJB 4JLBA 1L5RA 4JKOA 5EIXA 1ZR4A 1L8OA 1D0VA 2GRUA 4QDTA 1F0YA 2ZULA 4L5JA 8OHMA 1L2TA 1H4VB 4U2BA 5FHRA 1XBTA 1Z2NX 3Q3GE 1NN3A 4KPUA 4P98A 1OXKB 1DKMA 1COZA 1LQTA 1VLMA 3MLBA 4NV3A 5JR3A 1BWQA 1YV9A 2YOGA 2CDCA 4AECA 4C05A 3A0RB 1WTCA 2WIAA 3JYOA 5AHKA 4EG0A 5IAAA 2IEDA 1UC8A 1EGQA 1FSPA 3NIFB 2OO7A 2C4VA 4YMIA 3NASA 4RXTA 4Q1CA 5EEHA 1OPRA 2QPLA 2EQ5A 1JDBC 4W8GA 4Q1VA 3CTMA 1K63A 3HU1A 4EAQA 1FP4B 4W7SA 1C1HA 3GVPA 4B46A 1JRLA 4ZO9A 1SCKA 1TQ8A 4N9WA 5K03A 3K1TA 2I1LA 5EP2A 3KKNA 1YA4A 3LAWA 2WP8J 3VVCA 4BV2A 2J7PA 4BVBA 3L3BA 2X3YA 1MP0A 1ABEA 1LS1A 3GB9A 3MB5A 4OG2A 3LDFA 1MJ5A 3DKRA 3FDZB 2FWBA 3DG9A 3RIHA 4FBMA 4J6EA 4UE2A 3SMVA 1RHMA 2BFEB 1FFSA 1QKKA 4MJXA 1H3NA 4RYDA 4R01A 3KQUA 1JHXA 1SOVA 1VL6A 3DAGA 1E1NA 4FP9A 4JVLA 4Q05A 5LQRA 3F47A 2DTXA 4HMQA 3T54A 4FWIB 3ZGOA 2B1IA 5ALLA 1U2DA 5HRUA 3JVUA 4HEA6 2Z6AA 1C0EA 1VZ2A 4LYEA 1IZ8A 1Z6XA 4V0SA 5DX1A 4PF1A 5EE1A 2QP9X 3T6KA 5ICMA 2Y6UA 2J0QA 4I4TA 4X8MA 4XASA 3NIDB 1XO1A 2P2GA 2WNIA 2XMRA 3DCNA 4N5LA 3AP3A 4YGYA 5HK8A 5DEOA 1FU7A 2DLNA 3RK0A 5IPFA 4ZC8A 2F6RA 1ONOA 3KKZA 3OM1A 1A5ZA 3MEQA 4Q9LA 4EUKA 4G97A 3A4IA 4B32A 2ZUUA 3KOYA 4DMHA 1RU3A 2GD6A 5GGYA 3UFXB 5JI2E 3UWDA 1SY7A 1PJCA 2E3JA 1KDZA 2X0NA 2XCOA 1CJVC 4M1MA 1AN0A 1GYRA 3DDWA 3RVSA 1ZXBA 1LPAB 2R6R1 1GU1A 3UGTA 2JH8A 1D6NA 4U7WA 1BS9A 1OXUA 2QUJA 3HA2A 3P9CA 3Q41A 3RAFC 4R5MA 3AF5A 3LQFA 1E2KA 3HU3A 4FPXA 1RKVA 3IRUA 1HURA 1P77A 3G6WA 1B93A 3LLCA 3OQ1A 4W5WA 1EGMB 2VHCA 3AETA 3IH5A 1WBBA 1GTMA 2Y1LA 4JODA 2R6HA 3WO1A 3K6RA 2V6BA 2JAQA 2XMQA 1YJ5A 2ZR7A 3GPDG 2EKQA 3KQSA 3ZDBA 2H0RA 2UZAA 4B3CA 1XEWX 1AMOA 4DIUA 1T9KA 1SXJE 2Y0PA 3N2EA 4J94A 1XL1A 2GFQA 3BRCA 3DT6A 4OFWA 5IFLA 3SIPA 1XQ6A 1XWIA 2JI9A 2ZB4A 1N34B 5KNDA 4NZ9A 2BHLA 1C5KA 1IBLB 3LPCA 4WPGA 2QR2A 3FAZA 5ALTA 4ND8A 4BAZA 4ZZ0A 2G9QA 4L78A 4TTIA 5TT0A 1G9TA 1QYIA 2BZ1A 3E6AA 4UM8B 3AONB 3C5EA 4Z4CA 4KUHA 3WE7A 3W4IA 3A06A 3C98A 2IGTA 3DLAA 3IMEA 4ZI7A 1YOBA 3WGLA 1SCUA 5F3DA 5LOVF 1FYDA 4KPUB 4O4JF 4R5HA 2XYPA 1Y63A 4QGFA 1YZGA 2A58A 4W5QA 2CLDX 1M5UA 3T7IA 3ZWMA 4ACBA 4F84A 2VJLA 4D02A 3PGJA 4R1TA 1N33B 3SNHA 4D98A 4DY4A 3W5HA 2W6PA 4DCSA 2P35A 1DEXA 4JXJA 1Y9JA 1PT7A 1U7PA 1K86A 3LCUA 4ITVA 4PX9A 2ZXUA 2V6JA 1B26A 1QG0A 4KIGA 4X66B 5DM2A 4K7JA 2G07A 1TMOA 4A0FA 2PLWA 3QVTA 2AZMA 4R8VA 1CF2O 5CX1B 1R0BA 2O3TA 1WVGA 3GOHA 4B4UA 3S2SA 4BZWA 1U1CA 1JZTA 3SKVA 3W4JA 4IJQA 3K9GA 4CF6A 5GONF 2WWHA 5H9WA 2JLXA 5LP6F 3NM5A 2CJFA 1VL8A 2JHCA 2XSZD 2X4LA 4B4KA 2PX6A 3R7FA 4EMSA 7REQA 3GEPA 5HEKA 3BTVA 1D2NA 4M4SA 4RA6A 4WGFA 4TL8A 1DWQA 2FVYA 2FMKA 4BIIA 3W7AA 4EHKA 3K0AA 3AOGA 4F97A 3EGWA 4PO9A 2FGJA 1PR4A 4R1QA 3MPUA 4QM6A 2XB9A 3FW1A 2HMYB 3PD7A 2Y92A 1D9XA 1G4HA 4N0MA 2JW5A 3RC7A 3PHLA 2XF2A 4P7BA 5AOCA 3SSOA 5KX5A 1A8PA 1JLLB 1U3GA 2H4JA 2JAOA 2P5YA 2G3YA 2LNDA 2WP0A 1MVOA 4HDQB 1RI2A 5ICFA 3RFUA 1P4GA 2JJQA 3R5SA 1PZNA 5FOXA 1MENA 2OBXA 4HOYA 2I4NA 4LNAA 2GM4A 2UU9B 1JI3A 4ZVVA 1XZQA 3D8SA 5JH7A 3L49A 1QAOA 2UYQA 5IAEA 3ZXXA 2JAHA 4IMPA 3VC2A 5L7TA 3TFOA 4CMIA 3NKLA 1JIXA 3AL0C 3P9KA 3GFOA 5EMKA 3NBYC 3N2KA 3W6OA 3OIUA 4OI1A 1OLSB 5EY5B 4X6LA 5AVYA 2H08A 2GN6A 1S01A 1VLJA 3BXEA 3U49A 4CEJA 5IKPA 2HCJB 4JT2A 4OUDA 4X1YA 5DGTA 3JD1A 5FI0B 3FTNA 4M2LA 3GLIA 1B1CA 4YNBA 3EPPA 4MS1A 5J1SB 3NP9A 1Y7IA 2PV7A 3H9CA 3U7QA 1U8AA 1ZUWA 2P4UA 2ZQ5A 1IPEA 3IB6A 4HQKA 4AJEA 4UTNA 1YQWA 3COPA 2V97A 3RKSA 1K8YB 4GT1A 1EZZA 1Z4IA 3HC7A 5CAEA 2B3TA 4IDPA 3K6SB 1AQUA 1PJTA 3U0VA 4GI7A 1RJ9A 2PRJA 4JL5A 1G42A 5DIFA 5KAPA 4IIGA 2XIJA 2BI7A 2RHOA 3CFYA 3FFXA 2V3WA 2J5KA 4XVHA 4WZAA 3C16C 3GARA 4AICA 1XTPA 4DA6A 4ZVPA 3KS9A 5KKAA 1PHPA 4BRUA 1RE1A 2PH1A 2OAP1 2P2CA 3CN9A 4WZBA 4Y98A 1T4CA 1B1AA 1U2GA 2HDOA 3FRIA 1Z5PA 4GS5A 1I8TA 3VR4D 3A4MA 3IDSA 5H8WA 2PRSA 2CEKA 3AYXB 1HT0A 4I9FA 4X7MA 4JBHA 4LDPA 4XTCS 2NXNA 4QYIA 4AMYA 2VHXA 2O7SA 2Y8EA 3IKMB 4WLEA 4G5QA 1F7VA 1CQIA 5A71A 3H1PA 4JXKA 3VNAA 3KELA 3K09A 1RAEA 4MPRA 2OCPA 4LV6A 4RJTA 1U5CA 2OBFA 4BQEA 3IAS6 2C82A 4LCBA 4LTDA 3RRMA 1X80B 4TPKA 3B5IA 2JLYA 3ODPA 2FPIB 3HZZA 1M5TA 1MA3A 5KJ6A 4WEOA 3TIIA 4JUIA 3RRBA 1HYQA 3T1OA 1O97C 4JYMA 5K6AA 2D13A 1GPLA 1DXHA 3MWLA 1CB0A 2QSJA 4J3JA 2DEUA 3NHBA 1YZTA 3ZV6A 2WILA 1K1EA 1VYUA 3L5KA 2EDAA 3AKCA 3NORA 3IDZA 4ZYXA 1MJGA 2DG2A 2F1KA 4RDHA 4P7JA 5DLPA 3TDKA 3ENVA 4X3PA 4KPYA 1EWQA 3Q0EA 4Z5XA 1QG4A 4OMCA 1JPJA 2CWWA 3IQDB 2EL7A 4W5RA 2F3PA 3V1LA 1ZH6A 4I55F 3VO8A 3HWX1 4Y9RA 5I5EA 5L8VA 2XYQA 1CNMA 3ASUA 2G6TA 1IWPB 2A9RA 3KG2A 1VYTA 3GWGA 3T4EA 3TZLA 4NU0A 4ZO7A 1Z68A 5K05A 2P4SA 5K8VA 3V4SA 2ZIXA 1UEXC 5EHZA 1FSSA 3LUJA 2HU2A 4Q4AA 3R8XA 1T8SA 2CZQA 4KHPB 4P5PA 2DBYA 3COZA 4MR8B 3ELUA 4C0XA 2QMOA 2AMLA 3DO6A 1GN9A 4CL2A 1KOGA 1VM6A 3T0IA 3EVZA 1UK7A 1OZFA 1PE0A 1Y8QA 4RKQA 3IS3A 2PWBA 2B7LA 3TTUA 3IAM6 3PJFA 3T9FA 3CUYA 4PSUA 2G63A 1QHHA 1Z4NA 4GX0A 1N0IA 2I66A 3FVRA 4MYDA 1MABA 1M8PA 2NUBA 3G82C 3R40A 5J63A 1XU4A 3HKCB 4UVIA 1Y3FE 5AM2A 4OUDB 1NN1A 5TQJA 1VE6A 3GLIB 2R6AA 1CXZA 2G06A 1GGNA 1FTYA 3BKWA 2XUDA 1GAJA 3U7QB 2XCTB 4YJKA 4Q0MA 2PRZA 3PEWA 4UARA 2QJOA 3UB2A 5H82A 2GBPA 2HLHA 3WDSA 2HJSA 3FHJA 4ETNA 4O5AA 3VR6H 4CUKA 1NXWA 3BE5A 4Q48A 4W8HA 2WYOA 3W7BA 3X2EA 2I91A 2C5HA 4QRHA 2G8NA 3IEMA 3CUSA 3K70C 1M2OB 3IMGA 3DDOA 2QYTA 4GPTA 1C1XB 1PL0A 2I9KA 3HB7A 2X0JA 1JFRA 1YJAA 3ZDEA 3T1NA 4LEIA 3HNRA 2HCBA 3LL7A 4MR9A 5LQAA 3RFTA 4WZBB 3ESYA 4ZYYA 3NBZC 4ITUA 4UNQA 2VJMB 2WIJA 4BVEA 4CG3A 1O6FA 1R00A 4RLFA 3DYBA 2GD0A 2WTAA 3QWFA 1QQ5A 4BUZA 1ND6A 1LLFA 1L7VC 1T3LA 2IODA 2CHQA 3A8TA 3FN4A 3GFPA 1E4YA 3OIYA 4NABA 4BJ6A 1H4QA 3WRVA 2HSWA 3FWYA 4AP6A 1RLJA 3CUTA 4Z0TA 4MB2A 5TLSA 2PA0A 3WGUA 1WV1A 2CY0A 1D7AA 1CQIB 1HL3A 1ZH4A 2FF5A 3L7LA 2NX2A 4IO1A 3SX4A 3W6NA 3WQSB 2O2CA 4UM9D 5CEJA 3UXHA 4R2JA 1QWSA 3ED5A 3V4OA 5GM2A 3A3NA 4L4YA 1KI3A 3AR2A 5CBKA 4V1CA 1EXDA 2YWEA 3V8NA 2ZTHA 3SJCA 5C5CA 2C2HA 2RJNA 4R8KA 5DI9A 5JHGB 5AVKA 2H1IA 4LUCA 1IL0A 3T15A 2CUTA 2XHZA 5F3RA 3OZWA 3SBOA 5C4MA 5H16A 2YS6A 3OA0A 1QDLB 3FLAA 5M34A 1HG1A 3LQKA 1JJBA 3QVSA 4LGMA 1Y8ZA 1XDGA 4RQAA 1E1MA 4I5GA 4DUYB 3A27A 4LKRA 4XDYA 1A2QA 1DKLA 2Q8NA 3M2PA 3RKUA 2WZBA 3HKBB 2ZRFA 2CCKA 5A4JA 5L4LA 4OSOA 4OQNA 4N3GA 4C7BA 4X7BA 2HF9A 2L17A 1L7EA 4GXRA 2DFVA 1L6RA 4ZOAA 3AF4A 2WQZA 4PNPA 3WY9A 5CB6A 4V1CI 1QIMA 3PT9A 2QRKA 5A0VA 2V98A 1X15A 2YNMD 4IDFA 1HR0B 2AZDA 1J97A 2JI7A 4N0DA 1H9BA 2OHHA 2XMDA 5JAZA 4BJ3A 1L4LA 3HR4A 2Q5EA 3INRA 1KR2A 1VTKA 4I9GA 4ZHQA 1PR6A 4U2DA 1QHEA 3M0EA 3OLQA 1JNXX 5EJ4A 3OQVA 3A31A 3EIUA 2VBFA 4RMGA 1CUHA 3SF0A 4CE6A 4MV5A 3W3AH 1XJ5A 3G7SA 4Y2XA 2UZ1A 1EHIA 1X9GA 2ST1A 3RYFA 5JWRA 3JASA 2I7CA 2BFAA 3KJNA 4YAKA 1XA0A 2PKCA 1DVRA 3PFBA 2KSQA 2HIGA 2X5KO 5HQ3A 1OHHD 5EKXA 5LP1A 4TYNA 3VPHA 5L6MB 5ITZA 4FM9A 1XTUA 1A9XB 3HJRA 3TRDA 1MLDA 1MOQA 4MROA 1KMQA 3DZFA 1FFEA 4CRWB 4MUBA 2AG5A 3DKKA 1E2LA 1IE3A 2F9FA 4W1QA 1P73A 1DWPA 1MABB 4EQZA 1XXLA 1Z35A 3FNHA 1KEKA 3E9QA 3HSSA 3ILSA 5IT5A 4BPBA 4BCCA 5LBIA 2ZIZA 3IVMA 3BBPA 1OH7A 1NFQA 3GC6A 4KXYA 4D25A 1J0EA 5FNZA 4WV3A 2I99A 3JVVA 3DZJA 3NYWA 1RC1A 3PFNA 1XQWA 1H2ZA 2AOUB 2Y2VA 5DWQA 1EA7A 3ZIDA 3HMQA 4HYTA 4DM4A 1EFCA 5TC4A 2IP2A 4E21A 3LTEA 4FIZA 2WMDA 1CBUA 1EP9A 1ECPA 2QM7A 4IIHA 3TFQA 3NNNA 4B79A 1X3SA 3BYZA 4NULA 5BPHA 4DQUA 2DUNA 5HK9A 2X5OA 4HI0E 2XCIA 3BUSA 3GPIA 5DRTA 2JFFA 1YR3A 2P0AA 2YXDA 2NNLD 2E0IA 1OZHA 4OO3A 3SKYA 3A4LA 2ONJA 1E9FA 4PWZA 3FG9A 3VTKA 2ATVA 1N8SA 4EWLA 3ZV7A 1GZHB 2RHGB 3COJA 2IUSA 2QUIA 3R0ZA 5G41A 4GW3A 1O94C 4DIKA 5HFAA 4YPVA 4KO8A 1W73A 1RYBA 4D82A 1NRJB 3EWSA 2UZ4A 2FSVC 1GRRA 4P34A 1MBZA 4KQ9A 2FR8A 2BFDA 1UPXA 1US8B 5CT9A 4YRMA 1O57A 4IWXA 3I8XA 4D79A 3COYA 2DUJA 2F3QA 1SU8A 3JWJA 3ZDRA 3GPLA 2R6GA 4IPTA 1SCQA 1DKUA 1G19A 3PFHA 4JBIA 4A27A 4R1NA 4DV1B 5BQ5A 2WHXA 1E99A 4D81A 4B71A 1X1DA 5JAIA 1YZYA 3MINA 4ND6A 4MDHA 1GNTA 5FBVB 3DE0X 3U9LA 1ISFA 4C87A 1O58A 4WCFC 1GRCA 1KORA 1YCHA 3GLFE 2I3BA 5DNYB 3QWIA 1GILA 4TT8A 4CBVA 3WWEA 1LJLA 4QQ8A 1U8EA 3OQHA 1V41E 2W5UA 4ZK6A 5LIPA 3PGXA 5BXYA 1C80A 5HW0A 2XD9A 1PFQA 3WRXC 1QP4A 1NATA 1SAYA 4JT8A 1SU4A 4QJ5A 4X45A 1R27A 1Y9ZA 1U6IA 1UKAA 4GL2A 1KWKA 2YYAA 4CM7A 1XNQB 4U39A 4OUKX 1I9GA 1WW2A 1MZPA 2NVWA 1RIIA 4Y6QA 1QM5A 4Y9UA 2G9UA 1GPAA 1S7CA 1FS4A 3G2JA