4B4VA

Crystal structure of acinetobacter baumannii n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) complexed with nadp cofactor and inhibitor ly354899
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
282
structure length
282
Chain Sequence
MALVLDGRALAKQIEENLLVRVEALKAKTGRTPILATILVGDDGASATYVRMKGNACRRVGMDSLKIELPQETTTEQLLAEIEKLNANPDVHGILLQHPVPAQIDERACFDAISLAKDVDGVTCLGFGRMAMGEAAYGSATPAGIMTILKENNIEIAGKHAVVVGRSAILGKPMAMMLLQANATVTICHSRTQNLPELVKQADIIVGAVGKAELIQKDWIKQGAVVVDAGFHPRDGGGVGDIQLQGIEEIASAYTPVPGGVGPMTITTLIRQTVEAAEKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords BIFUNCTIONAL PROTEIN FOLD
publication title Acinetobacter Baumannii Fold Ligand Complexes; Potent Inhibitors of Folate Metabolism and a Re-Evaluation of the Ly374571 Structure.
pubmed doi rcsb
source organism Acinetobacter baumannii atcc 19606
total genus 101
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature ec 1.5.1.5: Methylenetetrahydrofolate dehydrogenase (NADP(+)).
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b4vA01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 4b4vA02
3LC2O 1P1HA 2W2LD 2VWGA 4IIUA 4Y6SA 4UVGA 3GAZA 4NQZA 2DKNA 5IF3A 4BO1A 5TLSA 4RF4A 3H5AA 4BGVA 3I4FA 2P5UA 5CDTA 1ENZA 2XXBA 4FC7A 4J16A 3GRPA 1K89A 4MVJE 1FMCA 1PGQA 1YXMA 3W6UA 1EE2A 1X0XA 2YQ5A 4BGUA 2FOIA 3TPCA 2E49A 3ST7A 4ROSA 8ADHA 4JN6B 1DAOA 4RVDA 5TX7A 4BO5A 1Q2XA 4G81A 4NBVA 3V2UA 3AM4A 4PG7A 1A71A 2J5KA 2CF5A 5EN4A 4PZDA 1WVGA 2FR0A 3SJUA 3DEYX 3FR7A 4D3SA 4E12A 4JJFA 4GWKA 3T4XA 4CLEA 4PVDA 1Y1PA 3GHYA 1G0NA 3JQ7B 2OORA 5TJ9A 3FNGA 4OXKA 2Y1OA 3ZV5A 1EQUA 3AWDA 7ADHA 4CM9A 1I2ZA 3AU9A 4XX0A 1U1IA 3IIEA 3ZV3A 2YHUA 3H3FA 5IJZA 2P5YA 3D3EA 1O94A 1V8BA 1E7YA 1TT5B 4EUHA 5CDYA 5EIOA 5JPIA 4CUJA 1BG6A 1XELA 1PZEA 2JCYA 1YDWA 2Y93A 4WNCA 3U4DA 4DIOA 5T67A 1E77A 4GQAA 4I9HA 1QMGA 4CM9D 2FHSA 1IYZA 2Y1FA 3Q9NA 3VPXA 2BFOA 4RZHA 1LTHR 3DMTC 4AL4A 4R68A 1HE5A 1HWYA 3PQFA 2VT2A 2B37A 4KQWA 4AJ1A 3U4HA 3PGXA 4CM7A 5DT9A 3TFQA 1FDUA 3QHAA 5G0VA 3JQFA 4B4VA 2VNSA 1QKIA 4ALMA 1QYDA 5A3VA 3VOSA 1E3WB 3KYCB 4RCVA 3WWYA 3H65A 1M6WA 3IJPA 5K6AC 1E92A 3OBBA 2ET6A 2G76A 2B4TO 4CLHA 1C0KA 4FSHA 3UOGA 2Q45A 3E9QA 1KVUA 1N7HA 5EL0A 4R54A 3U9LA 2OGUA 4BNZA 3KYDB 3WTBA 1OFGA 4JBIA 1UAGA 3DZBA 1YOVA 2EP5A 3DBLB 4I1IA 5JMPA 1IULA 4YYZA 3ENKA 1Y5MA 3TQHA 1H6BA 4XYEA 1C14A 3RUEA 1E7WA 2D5AA 4XQCA 4MVJP 2Q99A 2YHIA 1YGYA 4Z3DA 3ASUA 5T8KA 3CE6A 2YQ4A 4W9NC 2WWRA 1JKFA 3ICCA 4E32A 1HEUA 3A4VA 3DFUA 5COBA 3ZWOA 4UUMA 4P4GA 1ULSA 3HN7A 2V65A 4RL6A 4BNIA 2C07A 2Q4EA 1SO8A 2X0NA 4N54A 4JCOA 5B4VA 2HRBA 2Q4BA 4O5OA 4R01A 3W8FA 4TROA 3BIOA 4OOFA 4ZA2A 3FBTA 5I9MA 5JCJA 1EZ4A 1JAYA 3W8EA 3ORFA 3H9UA 1EEHA 1PGNA 1LC0A 5C3MA 3ZWBA 3GVIA 3VTZA 2TMDA 4P38A 2PK3A 1NP3A 2BD0A 3D1LA 1E1LA 3UCXA 2R6JA 4QXMA 4UVDA 2ZCUA 3ZWMA 4E4YA 5JCJD 5DCUA 4BNXA 4XIJA 3ZU2A 1FK8A 3PZBA 3DZHA 5JO9A 2W90A 1GL3A 3B1KA 4OO3A 4PLZA 3WYEA 1GPDG 4XYLA 3I5MA 4XGNA 2HMSA 2WSBA 3WJAA 2QZZA 1O6ZA 3ZWVA 3NYWA 2C54A 1A72A 2VTDA 4Z0PA 1KYQA 2Y0EA 2NWQA 4LMRA 2OOSA 4BUCA 4EZBA 4Z0TA 1O95A 1XA0A 3GHHA 4YT4A 1EDOA 2GN9A 3QWFA 5DP2A 5GY7A 5HS6A 3U0BA 1G1AA 2CVQA 2O3TA 5F5NA 2PGLA 2AXQA 3AI1A 2CY0A 2NVWA 5L40A 4NI5A 4CLDA 1PQUA 4WPGA 5I9NA 4PLHA 2DLDA 1D1SA 1N9GB 4A7PA 1J0XO 1E7QA 3M1LA 4Q3EA 1W0CA 5IDWA 1FXSA 1IHYA 4J90A 4YCAA 2FP4A 4FGWA 4W6ZA 1VKNA 4R51A 1NFRA 3PEFA 4D3FA 4D0RA 4GX2A 4A10A 5JMWA 5JSFA 4L73A 2CMDA 3LZ6A 2X0RA 5KIAA 4NJOA 2IDZA 2PKQO 4EJMA 3GPIA 5JFOA 4BMSA 1RM5A 4YB8A 2FPGA 2B5WA 3DHYA 3OJEA 4YQZA 4BGEA 3RFVA 4B3IA 5T64A 2EP7A 1RYEA 2X4GA 1Y81A 1YQXA 5L9AA 3JYOA 2QIOA 2UV8A 1KY4A 4FFLA 4RORA 3M2TA 2VYNA 2Y05A 4MOWA 2NU8A 1EFKA 5A9TA 1QLJA 4XB2A 2XAAA 1YBAA 5B4UA 3TZQA 1SOVA 2J3IA 2UUPA 1PGJA 4E0BA 3ZZNA 2GZ2A 1IY8A 5B37A 1IB6A 4QUKA 4BV8A 5GZ1A 1A4IA 2W4QA 4ND3A 4BO0A 1R0SA 1T2FA 4XB1A 4BGIA 2EERA 1I3KA 2QRKA 3EK2A 1K6XA 1EVZA 2VYND 4PLCA 4XWYA 5CDUA 2P4QA 1KS9A 1Q7CA 3P5SA 5A06A 1O8CA 1SEVA 1NX6A 4XYGA 1HT0A 5ES3A 4QFDA 3WGHA 2QZ9A 4CMIB 4CLRA 3N7UA 5A5EA 3V1YA 2DBQA 1A7AA 3AU8A 4G2NA 5KVQA 2Y66A 4J2OA 1WXDA 4RO0A 1DJQA 5I7VA 1U2GA 2OP0A 4NIMA 4CUZA 4OQYA 4BO6A 4IDFA 1YONA 5JDCC 2ZYDA 1VL0A 5DOVA 1OAAA 2HCTA 2V6GA 2Y0CA 1PR3A 1LNQA 2DU8A 4II3A 4BNMA 2O4UX 3INGA 4GWGA 3GEDA 3JYPA 3FBGA 4LSMA 4IDDA 4MIYA 3OMLA 1SPXA 3ZNNA 3JQ9C 1GCUA 1WAMA 3VH3A 1PS0A 1YRLA 3E9MA 1N1GA 4E30A 3CMCO 5TGDA 3VPFA 2DPGA 3KV3O 3QE3A 5DF1A 4P22A 3OP4A 5EERA 2YFQA 3MOGA 4KDFA 3DAFA 1XGKA 5KKAA 3OIGA 3L9WA 3E5RA 4AJIA 3U3XA 1Q0QA 3RUHA 2GERA 3HFGA 2GCGA 4N7RA 3QVTA 4YTEA 1WDMA 2JL1A 1KC1A 1EBFA 2JAHA 2C7VA 1MG5A 3RUIA 3DTYA 3LF2A 1HE4A 1VJTA 4ZU3A 2RCYA 4TKLA 1DXYA 3GN2A 3HUDA 4PGFA 3ROPA 1CQIA 4LSWA 2CDBA 3UVEA 3OQBA 1O9BA 3L6DA 3HWRA 4J7UA 2P68A 4ZGWA 4QFCA 4PLFA 3TRIA 3PJFA 5IDYA 2X9GA 1MG0A 2VN8A 1NR7A 2QG4A 3ZW9A 3RU9A 4DPLA 2JFFA 1YOVB 4KZPA 3PHIA 4MIEA 3HADA 4YJGA 3ANMA 1NHWA 4PG4A 2V6FA 2VNAA 3IP3A 4RVHA 2FMUA 3S1LA 4FJ0A 1AHHA 6LDHA 4DLLA 4QX6A 1PX0A 4WCDA 4L75A 4XYMA 4R4JA 1I24A 3AUAA 3H3JA 2I9PA 5TNXA 3S8MA 5L53A 2GDZA 1LQUA 2GNAA 1TLTA 3FNEA 2CVOA 4I5GA 2BI8A 3MZ0A 2JD2A 2P2SA 4XQEA 3CSDA 3WLEA 5H81A 4RPGA 3RIHA 1LRLA 1LUAA 5G0WA 1ADBA 3KO8A 2NU6A 3U49A 1GQYA 5B12A 2EG9A 1XKQA 4CMCA 1HSOA 2EIHA 3RUDA 3PI7A 3MJTA 1ID1A 2PGJA 4JGBA 1DPGA 2WTBA 2DM6A 4YVFA 3VPSA 1KOLA 4CM4A 5IXYA 2FR8A 3KZVA 3DHEA 4W4TA 4I9UA 3NUGA 1U8XX 4OM8A 3LT2A 3QSGA 4NK4A 3ZH2A 3B6ZA 3F47A 3VVCA 3WGOA 4UVEA 3JQ9A 2VUUA 1BTOA 1JW9B 4E2YA 4BHTA 4TZTA 1RM0A 2NQTA 4PLWA 1NFQA 4D43A 3L77A 4FN4A 3GDFA 3I3OA 4HX5A 3EDMA 1L7EA 4FC6A 1QG6A 4BNKA 1HZJA 3WGQA 4BOYA 5B1YA 3SLKA 1LDYA 1DRUA 2BH9A 4NBRA 5EINA 1A9ZA 1P0FA 4J1QA 5BSFA 4KWIA 4QECA 4JNKA 4ESOA 4PIVA 3PGJA 3QJ5A 2Q2QA 4ZQHA 4PRKA 1I10A 2VZ0A 3RC7A 4GX5A 4WLNA 4R16A 3OECA 1EK5A 4HBGA 3A1NA 1L1FA 3EZLA 3OA2A 4RVSA 2NVUB 1VC2A 1V3VA 2AA3A 4M89A 5DNAA 2CVZA 3BTUA 4KUEA 4ZD6A 2VOEA 5BQFA 3C1OA 3ZWPA 4EITA 2GYYA 4WLFA 1E3EA 4OKIA 1DC3A 1SOWA 5CDSA 1IZ9A 1W8DA 1Y9EA 1OOEA 1WLYA 3DBHB 4FDAA 4R1SA 3RFTA 1PJ3A 4FW8A 4DPMA 1VI2A 3KRTA 4IMPA 5JY6A 3PHHA 5IXSA 4IDBA 5DBIA 2IZ0A 2HJSA 2RH4A 4YWJA 3R0IA 3NTRA 2GD1O 2PZKA 3LT4A 4P4LA 2HQ1A 3ZU4A 4Q3AA 3RCBA 4IZIA 3K6JA 1HYGA 1X14A 3E9NA 2AW5A 4BKUA 4ZVVA 1ADFA 5K9ZA 5L4NA 4RV9A 3KSDO 1NVMB 3GRKA 4BNTA 1NVTA 1DSSG 3PHJA 1FDWA 2BGKA 1LDNA 4QT0A 4BNFA 4XCVA 3RC1A 5JAIA 5A5FA 5EMHA 3ZHXA 1E3WA 2ZTUA 5CG1A 4XDYA 3ZNQA 5FFFA 2Z95A 1NTOA 5T6BA 5GZ3A 3KEOA 3FR8A 1PQWA 4K9DA 1X1TA 1EMDA 3GZ4A 3FWZA 3S2EA 1W73A 3CINA 4AJNA 4J7CA 5DCYA 4EUEA 4PLYA 1X15A 2PKQP 4CLRB 1JKIA 1MC4A 1JU9A 3N74A 1F8GA 1P31A 3KYDA 2QW8A 3ONFA 4WUVA 3OA0A 1RPNA 3GT0A 3QIVA 3ZWXA 1JWBB 3AK4A 1FDTA 3TOZA 1G6KA 2C29D 1DLJA 5AVOA 3EGOA 2WMDA 1WZEA 1HE3A 3O9ZA 3E82A 5FI5A 4S1VA 1O5IA 1YS4A 1BXZA 2HRZA 2ZQYA 3PHGA 3EW7A 4TWRA 3GNTA 2OZPA 4ALNA 3ZDFA 4FFMA 2Q50A 2QQ5A 2YJZA 2EEZA 4CM8A 1GQQA 3KB6A 1R4MA 3ITDA 4E5NA 4NFHA 4OXYA 4XQGA 1Y9AA 2LDXA 4JXKA 3BA1A 4IM7A 4ZHSA 3VZQA 3IUSA 1EUDA 1CDOA 1V35A 3PYLA 3GR6A 3RBVA 1GYQA 2BRUA 2PH5A 3ONEA 3KLMX 1PJCA 3D4NA 1I33A 2Y1CA 4QO7A 4C7JA 1FJHA 5H83A 4HXYA 2ZQZA 2PKRA 4O1MA 4UREA 2AEMA 4E31A 1HF3A 1ADCA 4RF5A 3B1JA 3KLPX 5I7EA 2X5JO 5DOZA 1PIWA 1EE9A 1M2WA 1Z73A 3BTOA 3ETEA 3I83A 2WYVA 4L8VA 1V6AA 5JO0A 1A4UA 3D4OA 1WMAA 4MVJA 3WBFA 4BV9A 1BXGB 3G1UA 2IYPA 3PZRA 1T1SA 1JKJA 4S3MA 3TL2A 3MOIA 1E7MA 2CZCA 2IZZA 1CEQA 1ZSNA 4TSKA 2HMVA 3PK0A 4XD2A 1NHGA 4YBZA 1LLDA 1DHTA 2ZB7A 3FTNA 3L4SO 4ZICA 1I5RA 1YL6A 4OOEA 1MB4A 4BO9A 4MVJD 5FI3A 2C2XA 1GV0A 5AYVA 5IZCC 4DBVO 2X1HA 4J0EA 4XQ9A 1JLLA 4PLTA 3L6EA 3LSYA 1E6WA 1N1EA 2Y1DA 4NU5A 2WM3A 1P9LA 4DPKA 1GEGA 3R1IA 1RYDA 3JCZA 1MXFA 1U4SA 4PG8A 2D3TA 2UVDA 4OH1A 3W6ZA 3ZCXA 4E5YA 2P9CA 4JJGA 3LC1O 3VDRA 3VH2A 5U9CA 2FY8A 1N9GA 2B5VA 1RJWA 2IYOA 3GF4A 4BKRA 3F3SA 5C7IO 1U3VA 1TVEA 5KKCA 2PFGA 1VJ0A 4FIZA 3NDIA 4DC1A 2JKVA 5AOVA 1X7HA 4DGSA 2OFPA 5TQVA 1KEVA 1Z82A 4CM4B 2BELA 4JQCA 1EQ2A 4A27A 4BS9A 5FWNA 2JD0A 2TMGA 1P0CA 1NWCA 1UDBA 3WSWA 4KWHA 3K9QO 2QHXA 1I01A 5THKA 3LVFO 1HZZA 2EJWA 4ND5A 4ND2A 3OIDA 2X0IA 4NH4A 1Y8QA 1XEAA 2B36A 1FDSA 1X7GA 1HDZA 1R16A 4E5PA 3CPSA 4IINA 2A94A 4DUPA 4UULA 3D5TA 4OAQA 1LDGA 5C5IA 1VKOA 2VZ8A 3LQFA 4P4NA 4PRLA 5IG2A 3MJCA 3QWAA 3RUAA 2SCUA 4NBUA 1T1RA 1DOHA 4TQGA 3LDHA 1PJBA 4RQUA 3HB4X 1DC5A 1VLLA 5EESA 3V2GA 4CMIA 5TF4A 4K1LA 3W4KA 5TSDA 3AY7A 3CZRA 4IQ0A 3V8BA 3SVTA 3KETA 1JVBA 4H7PA 2W98A 3E03A 4I5DA 4D79A 3WIEA 2JHGA 1LQTA 4CL8A 1RWBA 1CQJA 4FFOA 5L51A 5BSEA 2GN6A 1OI7A 3DL2A 3QW2A 4E2WA 3DONA 1YQDA 2IODA 3LYLA 5IZCA 4F46A 2IRWA 2DTXA 2XF8A 5KVSA 2RHRA 5AXDA 3RU7A 4HFRA 3ZHZA 3SJ7A 2PZMA 3H5RA 5ER9A 2H9IA 3AFMA 1CWUA 5T57A 4ZQFA 2J8ZA 5JDIA 4HFMA 4YJHB 4DVJA 3NJ8A 1UXHA 1VSUA 1U28A 3LC7O 3EYWA 3K30A 4R9RA 3AUSA 4J1SA 3G17A 1QV7A 2NNLD 3DC2A 2GZ3A 3DTTA 1H2BA 3NDJA 4IQGA 2HMWA 3RBXA 4YEDA 4B7CA 3SEFA 4E2ZA 3S2IA 4WCFC 4INAA 4CM5A 1T25A 4RF3A 3IKVA 3HQ4O 1I30A 2F00A 3CTMA 2Y1EA 4M8SA 3W8DA 4UUOA 1KVTA 2VYVA 2YZ7A 3KM0A 1GY8A 1R0LA 5KCZA 1M75A 4DTIA 1QR6A 1SNYA 3LF1A 3MJSA 1YJQA 1ZJZA 3ZGYA 3UKOA 3GPDG 5COQA 3K8ZA 3TOXA 4ILKA 5IN4A 1TB4A 3D0OA 1Z74A 2VYVD 3K92A 3GLQA 1B0AA 1MXHA 4NBWA 4DIBA 3M6IA 4BNVA 4J0FA 2O3JA 1DFGA 2V6MA 4WLOA 4GKBA 1TA4A 2OO5A 1ZH8A 2OUIA 2R00C 1HETA 4E33A 2VCYA 1D3AA 3F5SA 3F4BA 1ISIA 3Q2KA 2C82A 1KVQA 2ZKLA 4CM8B 2NADA 4J4BA 4D3DA 2VRBA 1AXEA 5G4LA 1R4MB 3ZI0A 3WMXA 1Q1NA 3NKLA 1BRMA 2G5CA 3JD4A 4MO2A 4OKNA 4PZEA 2BGMA 2FPPA 1QYWA 3OF2A 1ML3A 3ETGA 1HL3A 3PDUA 3AY3A 3UCEA 4ZQGA 3PFFA 2AEJA 1J4AA 2BF7A 3DDNA 3GGOA 4OXNA 4BNUA 4NZ9A 1YO6A 3PYXA 3DAGA 4CV3A 4OJNA 2X6TA 2PZJA 5A1TA 1HDGO 4RVGA 4WLVA 3C24A 3ICPA 3IMFA 1T4DA 3GA0A 3I23A 1DC4A 3MJ4A 1YL7A 4YQYA 4YPOA 1NVGA 2EJVA 1G0OA 1NR1A 3L4BC 4IUYA 4EUFA 1DO8A 4U6QA 1F14A 5ICMA 1P1RA 2HK9A 4Z9YA 1TI7A 4KTVE 5HS4A 3AOEC 3DMTA 1NYTA 3A14A 1B8PA 2BHLA 4Y9DA 3VKUA 1C1XB 4BMNA 3DMYA 4IBOA 3NGLA 4BNNA 4DWVA 3FHLA 2JD1A 5FYDA 2W2KB 1GD1O 4GX0A 5A9SB 2OL4A 2X7HA 4U6SA 1YL5A 4R3WA 4HV4A 1DDOA 1P1JA 2A35A 1IOLA 5K6AA 1IUKA 1I36A 3ROQA 1J6UA 3SC4A 3C7AA 4NJMB 3NV9A 1W4ZA 3UCFA 3GFBA 3VH4A 3PTZA 3SBOA 4FB5A 4E2XA 2HUNA 4YDRA 2NVUA 2X8LA 3SLGA 1GCOA 3I52A 4PFJA 1DLIA 2WD7A 3I6QA 4Q3DA 3A9WA 4ALKA 3O38A 2I3GA 2IE0A 5CEFA 1ADGA 1LXCA 4J49A 2D1YA 1WDLA 4K26A 1V0JA 5DP1A 2Q1UA 4AJLA 2AG5A 5AXBA 4A26A 3DBHA 2D59A 1ONOA 1GV1A 3OJ0A 1YB4A 3UF0A 2JCVA 1NQAO 2WYUA 4DLBA 1ZO8A 4J6FA 3PWKA 1EVJA 1JAXA 3Q0EA 1N2SA 2UAGA 4W9NA 4B8WA 4IY1A 4TVOA 3Q6IA 4IJWA 1C3VA 4R41A 1Y8QB 3H9EO 3QP9A 3VAZA 4BNYA 1H2HA 3OQ6A 4CR7A 5A03A 2AG8A 4BO3A 5JAMA 2I6TA 2C0CA 3ZWNA 3G1TA 2NSDA 3NX4A 5F21A 2G0TA 1MFPA 4LCEA 3T7CA 3WQSB 4HKTA 4NPCA 3WSVA 4YT5A 2AEFA 3WJ7A 2IZ1A 5JXWA 3U09A 1PS9A 1JTVA 3CXRA 1JVSA 4W7IA 4RLSA 3JD2A 3C1TA 2FSSA 2DUWA 3I9OA 3UAGA 2RH8A 5L7WA 2PA3A 1M76A 1UP4A 3VHRA 3DZJA 4IDCA 1UUFA 5G4KB 5TT1A 3GVPA 4NU6A 1UZMA 4D42A 1E5LA 5I7FA 1AE1A 2H6EA 3CEAA 3HNPA 3S2GA 3MCVA 4HUJA 4BKQA 1GDHA 4DQXA 2X9VA 3L9XA 3GEGA 4EBFA 4MVJF 1TEHA 1RM3A 2PD6A 1UDCA 4AJ2A 4TZKA 5JE8A 4EDFA 1ZK1A 3HDYA 3AOEA 1H94A 4FGSA 3D5QA 3MEQA 5L7YA 1HSZA 1H5QA 3PWSA 3GMDA 2GZ1A 4DBZA 4L76A 1YVEI 3NDRA 2WJPA 4YRBA 5JS6A 4ND1A 1MA0A 4IS2A 4D41A 4JK3A 2F1KA 1GUFA 4E21A 3H8VA 4IXWA 3B1FA 4AVYA 2QYSA 4B7UA 1SC6A 1I3LA 3KVOA 3GFGA 4NNJA 1N8KA 4BO7A 3V2HA 2O50A 2V7PA 3GDOA 5FEUA 4WLUA 4FJ1A 4XGIA 4O0LA 5EQFA 5DZSA 1ZW1A 5I9LA 3RBZA 5KJFA 2O3RA 3G49A 3HB5X 4HFNA 2RIRA 1NAHA 4X54A 1EFLA 3P19A 4R5HA 3GVXA 4RDHA 4CQLB 1D1TA 2EW2A 2Y99A 4FFRA 4BNWA 2E6UX 3X2FA 3OJFA 4D7AA 4OQZA 2NM0A 4FPXA 2Q46A 3MWEB 1BXGA 3VPGA 4KP7A 4AJOA 2GGSA 1ENYA 2PZLA 5CP8A 2Z1NA 2DQ4A 2X5KO 1NPDA 3RKRA 4OHUA 1ZK3A 1ZK2A 3KEQA 2NTVA 1PWZA 1JQBA 1QSGA 4R69A 1PZFA 4D0SA 1ISMA 3JSAA 1GEEA 3ZWCA 4YJFB 1Z7EA 1E3IA 3GGGA 3BHIA 3VTFA 2EGGA 3VZPA 4BB5A 4JLWA 1ZFNA 5IAAA 4CM6A 1N92A 3PWZA 2ZTLA 2OXIA 1UAYA 2Q49A 5KWEA 1H9AA 2E48A 5TRTA 4RGBA 1KY5A 1K0UA 4CMEC 5A3JA 2AE2A 4J4TA 3X2EA 4UEKA 4AJJA 3GUCA 4DQUA 4L0QA 4O63O 1SMKA 5ICSA 1HE2A 4XR9A 4URFA 5IZ4A 1LSJA 1VJ1A 4UVHA 1DRVA 3G0OA 2NU7A 4GKVA 1B8VA 5DN9A 3JTMA 1WWKA 1EBUA 1U5CA 3GN1A 3QRWA 5JYEA 1VE9A 1GYPA 5JDCA 1LDEA 4J9VA 4NR0A 1NPYA 1O0SA 3K5PA 1QXSA 3OM9A 2WE7A 4ZN6A 2E82A 3BMCB 5KJ1A 4MKRA 1YB5A 5L4LA 4EEZA 5GZ6A 4XJTA 4MVJM 1T2AA 3VDQA 2OP1A 4YJDA 3V1UA 5COAA 3IKTA 3IL2A 2BGLA 3WOHA 1P45A 1RM4A 4IZHA 1YWGO 3QQPA 3JQAA 3JYLA 4D46A 3WGGA 4WASA 5C37A 1ULUA 3ONDA 1H0KA 4PZCA 3GQVA 5DULA 1Z75A 3NT4A 2EXXA 1P1IA 3IDSA 3JV7A 5ADHA 4GSLA 2YDXA 5HWSA 3IJRA 3DOOA 3DZKA 1UZLA 1PJQA 4CMKA 1LDMA 1HDOA 2I76A 3TWOA 3IS3A 2NVBA 3M1AA 1QRRA 5F3RA 1KEWA 1PTJA 3OJLA 4TRRA 4A5OA 4FS3A 4D45A 4EJ6A 1NNUA 3U5TA 3HDHA 4AJEA 2RAFA 1H6AA 2IXBA 4CR8A 5I7SA 2WD7B 2E4AA 4JBGA 1XIVA 4UVIA 4ZJUA 2GSDA 2WDZA 3DB2A 3E48A 2VTEA 2HMUA 1P1FA 4ALJA 3GNQA 1WW8A 3D3WB 5ITWA 1O89A 2HDHA 4YA6A 2IEDA 4CL3A 1KETA 5ITVA 5MDHA 1OC4A 4YACA 3JYQA 4IGFA 4YJHA 4WLEA 3E1KA 1MFZA 2A4KA 3OHSX 4A0SA 3GUYA 2B83A 3ZHYA 1PJTA 1X0VA 1ZCJA 5TT0A 3BAZA 4GGOA 3DO5A 4B8ZA 3A28A 3WDSA 2Z1MA 2Y67A 4D44A 1K6IA 1XU9A 4MINA 5I8ZA 3QY9A 4BO4A 4IDEA 3PIIA 3MTGA 1KERA 4B4WA 1GAEO 1KBZA 3IP1A 1DC6A 4TKMA 4TRMA 2VT3A 4J43A 1BGVA 2G1UA 1WDKA 4FCCA 2POQX 2VOJA 4W82A 1SEPA 1ZSVA 2P4HX 3UN1A 2HAEA 3DHNA 4WEQA 3I6IA 1PSDA 4ID9A 4DQVA 1PQPA 3GK3A 1AGNA 3HDQA 3HZZA 5CDGA 4ZQEA 1LRKA 3WICA 2D5CA 2GLXA 4I5EA 3OQ1A 1IL0A 3C85A 2ZIZA 2X9NA 4EGFA 4HNGA 4UAGA 1VRWA 4J91A 4EYEA 3TL3A 1K5HA 1Y5RA 3OETA 1ZBQA 1HKUA 3EVTA 5CHEA 5LDGA 1LI4A 1ZXLA 6ADHA 4LRTB 4Y6PA 1NM5A 1GFSA 2O2SA 2O2YA 4MPDA 4QTZA 1ZJYA 1WP4A 3EUWA 2CUKA 4WGGA 3LLSA 4B4UA 3IOYA 4MVJI 1ORRA 1DB3A 1LJ8A 4CUKA 3H2ZA 1DIHA 1HTBA 4OGWA 4NDNE 3Q2IA 2GO1A 3AUUA 3JQCA 3NAQA 2P9EA 1HXHA 4K6CA 5KVCA 1Q0HA 4YXFA 1CF2O 4ZQBA 3AJRA 3FCOA 3E18A 4M55A 4PVCA 5C7OO 1ONPA 1WZIA 2J3HA 3A06A 3RWBA 1UP7A 5L3ZA 2X0JA 2UDPA 4I08A 2J3KA 1A5ZA 2JFHA 2WEKA 3RVDA 3L07A 1JWAB 3S2FA 1LA2A 1DJNA 3AOGA 2R2GA 3H9QA 1ZNQO 3V5NA 4R9SA 3BTVA 4K28A 1M67A 3EMKA 4Z9XA 1Q0LA 2GPTA 1C1XA 2OBNA 4HP8A 4BO2A 3PQEA 3ZN2A 5KJ6A 1PZHA 3SXPA 1NPTO 2W2KA 5A9SA 3JD0A 2ZB8A 2P9GA 1UXIA 2C20A 4ZRNA 3JQ6A 2BLLA 3M2PA 3CUKA 1B26A 5HBRA 1VL6A 1NQ5A 4UUPA 4PN3A 4NJMA 3ITKA 1PR9A 3DFZA 5G0TA 5CEJA 3AM3A 5HTOA 3MTJA 2JJYA 4F6CA 3O8QA 3KUXA 2ZB3A 2YFHA 4F45A 3I9KA 2AHRA 4Z3KA 4EJ0A 1M66A 4BQPA 1LEHA 3KYBA 4EEXA 3I1JA 3DOJA 3RFXA 3U4IA 1HDXA 1BVUA 1FDVA 3HSKA 1B3RA 4DYDA 2WE8A 5BSGA 2CSUA 4F3YA 4FQ8A 2PR2A 3LU1A 2J5QA 2BKAA 2FWMX 5DDIP 2H1SA 2Q2WA 3RAJA 4CM1A 3JQFC 3N58A 4UEJA 3FN4A 2EW8A 2O3UA 4Q3NA 3H9JA 4L74A 3C7DB 3EC7A 4H16A 5TS3A 3INRA 5AXAA 3NGXA 3Q11A 1QYXA 5KOIA 3ZU5A 3JQAB 2ZJ1A 3OH8A 2X23A 3K2BA 1UH5A 3HDJA 1WNTA 4OSOA 2NU9A 1BSVA 2NUAA 4Y67A 3IQDB 3K73O 5G0SA 3W4JA 1MLDA 3DBRA 5JY1A 1P44A 1YE3A 3GEMA 4DC0A 4IQ8A 1T2CA 2I67A 4JJIA 3F9IA 2EWMA 4DRYA 2I99A 4CQMB 1DIAA 2ZB4A 4TVBA 1XQ1A 3GC6A 1M6HA 1LLCA 3RUCA 2AQ8A 5G4KA 4YAIA 4B4OA 4YR9A 3MJEA 2ZJ0A 4W99A 5T8KC 2RBEA 5ENDA 3RC2A 5CFZA 2H5LA 1H6CA 1PEDA 3P2OA 2FZWA 2XXJA 3PLNA 4M49A 4FD3A 4M86A 2O48X 1CIVA 3AI2A 3CIFA 4MKXA 1DFIA 3BHJA 4HY3A 1P3DA 1HYHA 2CDAA 3SC6A 3WBBA 4DLAA 1HLDA 4W7HA 3RC9A 4WOJA 1VSVA 4N5MA 1D7OA 4ALIA 3GGPA 4DREA 2A92A 4N18A 4II2A 3FNFA 1I3MA 4BO8A 1LSOA 1SBYA 1Q7BA 4RVUA 1LC3A 2C2YA 4MVJG 1Z45A 2EKQA 2ZYAA 1R37A 2JFGA 2J3JA 2EF1A 3NT2A 2AQIA 3TF5A 1RKXA 2O7SA 1ZEMA 1N7GA 3O03A 1R4NB 1Z7BA 4CLOA 3WGTA 2ZYGA 2E37A 3H9GA 1ZZEA 2NLOA 2O4CA 5F5LA 4G65A 1X7DA 3ZWAA 4B3HA 5K0ZA 4YAGA 2O3SA 1JDJA 1FF9A 1GR0A 1XDWA 4LGVA 2EV9A 4TRNA 1R0KA 3FNHA 5I8WA 3GDGA 3QVXA 2HU2A 2ILTA 5KNLA 4HNHA 2VHXA 3KXDA 4A2CA 5KJCA 3PPIA 2CFCA 3LLVA 5JLAA 5CEEA 3RKUA 4CODB 4CQLA 3BMNA 3AY6A 2VZ9A 5LCXA 4KDEA 1HDRA 3Q1LA 3U4CA 1BDBA 4YAKA 4BMVA 1DIBA 2VRCA 2C5EA 4E5MA 2PH3A 1U4OA 2VWPA 5DCWA 2FPIA 2CF6A 1GYRA 2D4AA 1C0LA 5HM8A 4O6VA 3F5QA 1ZSYA 4FJ2A 3D64A 4I9NA 4FOSA 4GX1A 2NTJA 1XQ6A 1VM6A 1E7RA 2YV2A 4DYVA 3IAHA 1ISJA 1U8FO 1XLTA 1LX6A 3L0DA 1WPQA 5G0UA 1I3NA 4NMHA 5KVVA 4MP3A 1QORA 1V9LA 4FOOA 5F1KA 1U5AA 2VRCD 1LRJA 5A9RA 4NG5A 1P1KA 3TDKA 3ANNA 5JAQA 3RI3A 1E7SA 1JN0A 4HWKA 2HLPA 4NK5A 3GMSA 1MX3A 1EUZA 3H4VA 2XOXA 2VWQA 4QEDA 4JBHA 2C59A 4BKOA 1Y8RB 4YJFA 4CV2A 4NBTA 3WYCA 5JNLA 4FBGA 3ZU3A 1P74A 5F1OA 2GR9A 3AM5A 3BZUA 3JQ8B 3ENNA 4HFJA 2Q1WA 1DBVO 3BHMA 3G79A 2DT5A 3EAGA 2VUSA 4GL4A 4Z0HO 4IS3A 4U8GA 2P91A 2Q1SA 3EZYA 3FD8A 4BNGA 3E8XA 4GBJA 1QP8A 1F0YA 3FPCA 3FTPA 1Y7TA 5MGBA 5U1PA 2RHCA 3JQGA 5KJEA 1ISHA 4AJKA 1EUCA 1ZMOA 3BYZA 1X1EA 3JYNA 4P8RA 1KEPA 4WEOA 3C7CB 1GU7A 3RJ5A 2NQ8A 1GPJA 4J2HA 3WTCA 3HG7A 2PV7A 1LLQA 3PDJA 3ROMA 4YT8A 1PS8A 3KTDA 4PLPA 3HJAA 3BMCA 5L95A 1A9YA 2GUGA 4O59O 3FI9A 2JHFA 3ADPA 2DTEA 4MDHA 5A04A 3TSCA 3LK7A 2B35A 1P77A 3WFJA 3UHAA 4XYBA 5A02A 1DIGA 4LVUA 4PLGA 3WQQA 2I5PO 1NAIA 1ENPA 3BMOA 3VH1A 4PCVA 4CMHA 3B20A 9LDTA 1GUZA 2XPCA 4L4XA 3JQEA 1U7HA 2QX7A 1P33A 3FSRA 4DIFA 3PIDA 2B0JA 1GZ4A 2O3QA 4Z9FA 2HKIA 3IC5A 1GTMA 1PGOA 4WCFA 1UDAA 2PD4A 4FR5A 2O7QA 2VUTA 4RVFA 3JD3A 4YAJA 4JP3A 4GVLA 1PU2A 5B4TA 4UUNA 1ZK0A 2EHDA 4XA8A 1XG5A 3DQPA 4DXHA 2Z5LA 3ETDA 3O8QB 4RDIA 4M54A 2HMTA 1V3UA 1PWXA 1VL8A 1LSSA 1YQGA 1ZVMA 1XYGA 4ALLA 1S7CA 1XCBA 3EHEA 4DMMA 4CM3A 3ZV4A 3FF4A 3ANLA 2DUUA 4IIVA 1K2WA 1B16A 1YBVA 4JP2A 4XDZA 2GN4A 2G17A 3NEPX 3SX2A 1BVRA 3BTSA 1U3WA 3D3WA 4DMLA 2FZEA 3MWDB 4E3ZA 4DL9A 1E1NA 2IXAA 1QV6A 3HE3A 1XU7A 2R00A 3VPHA 1NFFA 1OZAA 3TJRA 5HA5A 3MJVA 2VHVA 5HRUA 3DZFA 2DC1A 4BQRA 4MIOA 3GAFA 5KTKA 1EDZA 3D4PA 3PJDA 2EGHA 1DRWA 1C1DB 4IPTA 5JYDA 3DBRB 4XZ3A 1ISGA 1GZ3A 3IUPA 3C1AA 1L7DA 4XEHA 5CPBA 1IZ0A 3ULKA 1OBFO 1I2BA 3U62A 1A27A 1ZKMA 4GGPA 3GOHA 3UH1A 1S6YA 5BNTA 3ADOA 2W8ZA 2FSVA 3OSUA 3TN7A 4Z6KA 2AQHA 3WLFA 4E5KA 1U7TA 2J6IA 3WGIA 2O23A 5THQA 4J1TA 3FWNA 1KC3A 3STHA 1XWFA 4G5HA 1BMDA 1PL6A 4IXTA 5JW6A 2PLAA 3L4BA 3H2SA 3HFSA 2YW9A 1E6UA 3K96A 3B70A 3H6KA 4JX8A 4U0JA 3BXXA 2ZTMA 3PXXA 4LISA 2DVMA 3PLRA 5CPFA 3UW3A 2OBYA 4N5LA 3TZHA 1K6JA 2DFVA 5ILGA 4BNHA 3WQRA 4UEOA 3ROKA 1VPDA 4AJ4A 1I32A 5BT9A 2QYTA 4KMSA 2AQKA 2B4RO 4LCJA 4CLOB 1OC2A 2AE1A 3PVZA 5TIIA 4LN1A 1MUUA 3GVCA 4GMGA 3DOCA 1UR5A 1W6UA 2D2IA 3RD5A 1BWSA 1SAYA 3P7MA 3PP8A 1MV8A 5AQ1A 3ZHBA 3E6AA 2ZK7A 2A9FA 4RLHA 3TNLA 1ZXBA 1IPFA 1D4FA 1XR3A 5BNIA 2DPHA 4LK3A 2GN8A 3BMNB 1LBEA 4J7XA 1NQTA 1T24A 4BNJA 1U3UA 3S55A 8LDHA 3WG9A 4MP6A 1I8TA 1N5DA 5EQDA 3KOUA 1GZ6A 4Y6RA 4MJLA 1ISFA 1SB8A 3K31A 4IJVA 2ZATA 4BIIA 2Y0DA 3WX0A 2IEBA 1WMBA 2FRDA 2CDCA 3KSZO 5A05A 5JBIA 1F17A 3QVWA 2UYYA 3GVHA 2LDBA 2WD8A 3I9JA 2Q2VA 4GLLA 4J3FA 3F46A 1PL7A 3T4EA 1XSEA 4U7WA 1H9BA 3DWFA 1HYEA 4WE3A 1UZNA 4R1UA 3NTOA 3K2EA 4RZIA 4AFNA 5LC1A 1ZMTA 5BNFA 5FF9A 1NBOA 3PHLA 5IN5A 1UXJA 2CNBA 3VC7A 4YRDA 2YYYA 1E5QA 2X5OA 4OSPA 4RF2A 4BKPA 4NHEA 1DEHA 4YAEA 2DBVO 1NXQA 2Y1GA 2YHIB 3JQGB 4ONEA 4CLXA 4H15A 1IHXA 1QYCA 2NTNA 3E5MA 2I66A 1T2DA 4TRJA 9LDBA 2VHYA 4E13A 3QV1A 3OICA 2V6BA 2PD3A 4FFNA 4R1NA 3GZNA 2VWHA 3Q3CA 2BFAA 3V1TC 1YBMA 3P2YA 4CV0A 1A7KA 1B14A 2VHWA 3DAPA 4XR4A 3PJGA 4AG3A 1H93A 5CAEA 2YUTA 4J4HA 1DHRA 1U9JA 5H82A 2NACA 4KQXA 1Y6JA 2HK7A 4XGKA 1F8FA 1UP6A 1UXGA 5ENVA 3RUFA 3CKYA 3BMQA 1DFHA 3W4IA 1ONNA 3PRJA 4XRRA 3WS7A 4EW6A 1PJ4A 1BW9A 2YDYA 1GADO 4PLVA 4RPKA 1YB1A 2D0IA 3NTQA 3BMOB 3OJOA 2OHXA 1E3JA 1MGOA 3PQDA 3WNQA 1CYDA 5JAZA 3QVOA 3RASA 2Q1TA 4OMUA 2WYWA 3R3JA 5LDHA 3JQAD 4CQMA 4KTTE 3DXFA 1CETA 1B2LA 3WXBA 5ILOA 4GMFA 4WCFB 4ND4A 4N5NA 5A4DA 3GH3A 4GVXA 2YV3A 2HO5A 3F1LA 1MC5A 4GSKA 5G2OA 3I9NA 3NJ4A 4TMFA 3QA9A 1R15A 4B3JA 3GG2A 1KIFA 3RROA 3O26A 1IPEA 1HRDA 1BXKA 2EKPA 4I5FA 1Q7GA 2HSDA 2OMEA 1B3BA 3WR5A 4AJHA 4CQMD 3DBVO 2B4QA 5ER6A 5L45A 5BR7A 1MP0A 2PTGA 3FPLA 2EKLA 4PG6A 4LMPA 4U0KA 4NFYA 4U5QA 3WFIA 4MP8A 4RJTA 1U3TA 1NQOA 4IDAA 2PNFA 4M1QA 4WECA 3CZMA 1F06A 4Y8VA 4L9RA 1B7GO 1J5PA 1KVSA 3WB9A 3ON5A 3ZWWA 4BNLA 4Q3BA 3JQ7A 2DTDA 4FFPA 4ZRMA 4GH5A 2BMAA 3F6YA 3AUTA 1R4NA 2PY6A 1PL8A 4J1NA 1HDCA 4AICA 3ZNPA 3VZSA 4CMAA 2X22A 3W1VA 1SB9A 2I3AA 1HDYA 1SCUA 1UJMA 1TT5A 5C7LO 1E3SA 1HLPA 1AUPA 4CMEA 5F1PA 3ZNOA 3RSHA 3JQBC 1EK6A 1GQ2A 3WYBA 3FRJA 4I8XA 2PWZA 5DBGA 4Q9NA 1Z6ZA 3QWIA 5EJ2A 1YH3A 1GUYA 2UUOA 3OFSA 1LSUA 4IMRA 4PG5A 4Q3CA 4A73A 1E0DA 1T26A 4RPHA 3UICA 4B79A 4CJXA 4C7KA 4CMJA 4GPD1 1ARZA 5TC4A 5TJHA 5IFLA 1C0IA 1T2EA 4DA9A 4CMBA 4IDGA 2CD9A 1PJLA 4MKZA 3TZCA 3AI3A 3KYCA 3WGYA 3I4CA 3VKVA 5L4SA 4KUHA 3T7EA 5AXCA 4BB6A 1CERA 4CV1A 5EPOA 3CH6A 3I9MA 3KHUA 5U4QA 1AXGA 4WNIA 3DZGA 3PJEA 4JIGA 5J23A 2BFPA 3HN2A 2ZTVA 3AFNA 3UGKA 5JC1A 1IE3A 2DFDA 2B69A 2BI7A 3VVBA 3NT5A 1Y8RA 1E3LA 1K3TA 1KEUA 2JAPA 2G82A 1LLUA 3LT1A 1CJCA 1QYVA 1ZIDA 3C8MA 4XIYA 3DBLA 3INTA 3JQ8A 4WK6A 3GG9A 4OL9A 3WNVA 1U2DA 1X13A 4WOKA 3F4LA 4QQRA 3OEWA 1H6DA 1R12A 3HHPA 2DBZA 3ASVA 1JA9A 2VQ3A 4OIMA 2GRAA 3C3XA 2JCXA 3JQDA 4XKJA 3DR3A 1TXGA 3EVNA 3GNSA 4L4RA 3H5NA 1D8AA 1EVIA 1LU9A 1ENOA 3KSUA 4IJUA 2X58A 1ZK4A 1CRWG 4KUGA 2NV6A 4IJKA 3VZRA 5BSHA 2GASA 4KOAA 3UFXA 5JCXA 4C4OA 4LVCA 2YV1A 2GF2A 1C0PA 1T4BA 2ZCVA 4L4SA 4R3NA 1TT7A 3L6OO 3QLJA 3JD1A 4QSMA 4WKGA 4XJSA 3ZW8A 3CMMA 3NRCA 4CMGA 1E1MA 3I9LA 2D8AA 4R1TA 3TZ6A 3KBOA 3ZWYA 4LW8A 4YRAA 1XHLA 2H63A 1OMOA 2Y68A 3GY0A 1B8UA 3O4RA 4JROA 4Q39A 1PJ2A 4BL5A 5JC8A 4CPDA 2Q3EA 3R3SA 2X86A 4H3VA 2VHZA 3QVSA 1E6EA 4NFSA 2YY7A 1PZGA 3OIFA 4AJPA 3R6DA 5CG2A 3ABIA 2DBRA 4GLOA 2AMFA 3H7AA 2C7GA 3JQBA 4E6PA 3QWHA 1ZEJA 3ZV6A 1R66A 1V3TA 1YDEA 2HK8A 5IDXA 4YJGB 4QO8A 4YT2A 1AHIA 1SZJG 4MVJH 1BHSA 3G3EA 1NASA 2FN7A 4LRSB 5T5QA 3PYMA 1EVYA 4GI2A 1PGPA 3RQSA 1QLHA 4EI2A 4Y98A 3LT0A 2QRLA 1DIRA 4CR6A 4F6LA 7MDHA 3WWZA 1BDMA 1E1KA 3UXYA 4OYRA 2FR1A 3WGZA 1J49A 3Q9UA 1AN9A 3WMWA 5JDIC 1YKFA 1DAPA 3AW9A 3GZNB 5DBFA 1I2CA 1B15A 4M87A 3WIDA 3PFWO 4BVAA 3TZKA 3QWBA 3DZIA 3COSA 3UUWA 5L7TA 2C5AA 4RPJA 4GAEA 1ZUD1 4RPLA 2PGDA 5GMOA 4RQTA 3OEYA 4A03A 3TFOA 4XRGA 2DAPA 3EY4A 3BMQB 2J5RA 5IDQA 1R6DA 3F1KA 4B7XA 1BW9B 3D7LA 4K6FA 2W2LA 2HJRA 1UXKA 4R5MA 1I0ZA 1LDBA 4WJZA 1C1DA 3RJ9A 4HADA 4IGEA 2I65A 2BFMA 1PJSA 1KVRA 1YJ8A 1NWHA 4J9UE 1F12A 4ITUA 2QRJA
chains in the Genus database with same CATH superfamily
1L5SA 1RHRA 1A2QA 2W2LD 4FYWA 7AT1A 1NRXA 1IHUA 1IJKA 3L5OA 3PDIA 1CLEA 3BFJA 4NQZA 3C6ZA 5IF3A 4HDRA 1KP3A 1RBMA 1RZUA 2ECFA 4OP2A 3OPMA 4BGVA 1QVWA 3I4FA 4X0EA 4PC6A 3AILA 2YBEA 1RR6A 4NENB 2VNKA 2EZ9A 3ZWQA 4D4MA 1TQ2A 1TLLA 2OO5C 4YAWA 3KQHA 3GRUA 1EE2A 3EEFA 4BGUA 3UGQA 4ROSA 3I9V6 1R6XA 3IQIX 3IUJA 4JR2A 4RA6A 4G81A 2B78A 3P9PA 3QUQA 1YMVA 5CFMA 4AN1A 3V2UA 5BWLA 5D00A 5ALFA 1FMTA 1A71A 2I8AA 4C0JA 2CKMA 2OOKA 5KTSA 3R6GA 5EN4A 4PZDA 1I6KA 2FR0A 3K1AB 1AZWA 1QTQA 1K0FA 4TWZA 1ZL0A 3I6BA 3AL3A 3VMFA 4GWKA 1OVGA 1QHNA 2NAFA 4DIMA 1TM4E 4PVDA 5TDHA 3RF7A 1HQKA 3NONA 1RRGA 1Y1PA 1UM9B 1G0NA 2ZRNA 2F43B 2QA5A 3GHYA 3JQ7B 4MWSA 1GTJ1 2L0XA 2OORA 2P9HA 4OXKA 2Y1OA 1EQUA 7ADHA 4QYWA 5LBIA 3MAGA 2AFHB 4JLKA 4XX0A 4LF7B 1JNXX 4LHZA 5CLQA 1CHDA 1DQRA 3IIEA 3ROEA 1IN1A 3CTPA 5BRAA 2YHUA 1SKMA 4S1WA 1WCYA 3O2NA 5EIOA 5JPIA 3RG2A 4B80A 2XWJI 1T5DX 1I7PA 1XELA 2ZT8A 2Y93A 3ILSA 4WNCA 2OZLA 3PI6A 5H3CA 1A2KC 5AI8A 4O2LA 5DYYA 4I9HA 4BMZA 1UJ6A 3SXUA 3ECAA 4JEMA 1KQNA 2ZBFA 2XIJA 4OVKA 4FM9A 4Z53A 5JZVA 2YXEA 3T3NA 1LTHR 1Q0ZA 2O2XA 4R68A 2YY6A 4F2DA 1EVLA 2OPBA 1HWYA 1IEXA 3GP5A 3BHNA 4KBGA 2BKUA 1UBUS 4N0QA 4FYXA 5DT9A 4G41A 3TLCA 4RM3A 3QHAA 1QHGA 3SX4A 5G0VA 4KRYA 1XTIA 1MAVA 3RVPA 3STVA 4CEJB 2JCSA 5A3VA 3AJDA 1ZKDA 1E3WB 3VSEA 4X00A 4KGXA 1M6WA 2HBZA 4UW9A 1E92A 1P2VA 1EK0A 3LUDA 4FW9A 4JLJA 2G76A 2CVPA 5FNVA 5BSTA 4MCJA 4HXFB 4CG3A 2PX2A 4CLHA 1C0KA 4F9GA 1DZIA 4YRKA 2Q45A 1M2FA 3AVXA 1XNJA 1ZNYA 4DM7A 1N7HA 4J0CA 1AB5A 2PX8A 3NHSA 5KYWB 3I62A 1OHHA 3KYDB 3WTBA 1OFGA 4D8TA 3DBLB 2F8MA 2HDWA 1C9DB 1LLFA 3PXCX 3RIMA 1EX1A 1T4GA 1UBHS 3TQHA 1CY1A 1YZKA 4ZQIA 4F4CA 4FI3C 2MR6A 3KB8A 2IS4A 1YD7A 3RUEA 4RANA 3VTKA 4A2PA 4U2EA 1HH4A 1LTKA 1X7XA 1WV1A 5I5EA 1OXTA 1FQKA 4QM7A 2RHDA 2Q99A 2W11A 1WSDA 4I2VA 1RTKA 4PZAA 4H7KA 5DT2A 4EBBA 2AJCA 2E4XA 1JJ7A 3NH6A 2CNKA 4I3GA 4XSHA 2WWRA 4E32A 1G6Q1 4MTCA 3E27A 4GP6A 4QUGA 4QULA 4CG2A 5K0GA 2X42A 1IG3A 3L82B 1UQTA 3I73A 5COBA 3UMSA 3ZWOA 4UUMA 5ESDA 1Y37A 3T7AA 4BQFA 4W5QA 2XZTA 2QDKA 2V65A 4BNIA 5KDDA 3I12A 1JG2A 3AEYA 3O3CA 4X6YA 4NY1A 4CXMA 1IOWA 4N54A 4QBIA 3I2JA 3REQA 2IBTA 2ZIGA 4KXVA 4O5OA 4R01A 2ZSHA 2AT1A 3FLBA 5AKIA 1HQCA 3N7AA 4I4IA 3SP1A 2ZTHA 3WE7A 1D2RA 2R1VA 4ZA2A 1IVNA 5BXYA 3FBTA 2NO5A 4HPJB 4MXDA 3E15A 1S01A 5FLYA 1N1MA 3ORFA 1T5LA 1J0AA 1EEHA 3TRFA 4DNPA 3GEPA 3GVIA 2F48A 4I99A 3V4OA 3HTXA 2D0OB 1M1XB 1MABA 2RAUA 1QDUA 4P38A 4UMDA 3T99A 4O8CA 3R3HA 5J2UF 1E2NA 1D2EA 2H5JA 2Q3LA 3MWJA 1TVMA 1ODKA 2FZ4A 2R6JA 5F7ZA 5JHHB 2ZRMA 3BDIA 4E4YA 3P9QA 5DCUA 1QPZA 2ZUDA 3ZU2A 2X3YA 2VJQA 1KY2A 4NCIA 4O4HA 3DZHA 4PO1A 1OXKB 2W90A 1GL3A 4JUDX 1M34E 1NYQA 1PZMA 1SUDA 1WB6A 3QELA 1VXOA 5LQMA 2Q27A 3IAAA 3TCNA 4EPYA 3DR5A 5G3ZA 2OOSA 3AKZA 3AFOA 1DAHA 4XWOA 5LBUA 1NJGA 4F2PA 2IY8A 2ZRIA 3GJ6A 5LMUB 1MW9X 1NMEA 2PEYA 3TQTA 3QWFA 5HS6A 4YT4A 5DNUA 4G25A 3I9V1 1A1VA 5EZYB 1L8LA 2GJ8A 4BBZA 1G1AA 3IAM6 4M9ZA 4NG4A 5F5NA 3HSSA 1G4UR 2OTCA 2XQVA 4DIDA 4F9EA 1W85B 2ZWPA 3AVQA 1KK3A 1NUUA 1HFEL 2XVXA 2VJNA 3K0CC 2QM3A 3L6CA 3ADKA 3AI1A 3TQFA 5FWXB 3E1SA 2VQEB 3WKBA 2RHHA 1T43A 4P33A 2RDMA 4EHIA 4HX2A 1I0LA 1AHNA 1TM7E 3P4XA 1LBSA 4Q1VA 1IWBB 1D1SA 1N9GB 2H4JA 4A7PA 5IF9A 3BF7A 2WIGA 2ADOA 2B98A 3NP7A 4GP9A 4NATA 2G0NA 3MW8A 4Q00A 4Q3EA 1L5KA 4J90A 2FP4A 3LPDA 5AHKA 3W34A 3ZTWA 5JBQA 1CCWA 1Z4KA 2AHOA 1JG1A 1VCOA 1XZLA 2SKEA 2IITA 2Y27A 3LZDA 4HR7A 2OUKA 3HDVA 5BY2A 4KFRA 5JXHA 3AR7A 1NF9A 4A10A 3UBTA 2H2IA 2X2OA 4L73A 1X87A 3LZ6A 5KIAA 1QWOA 4NJOA 3L41A 2G40A 2PVPA 4EHDA 5CVEA 2P40A 3DLIA 4FBLA 2FPGA 2B5WA 4ZEMA 5K05A 1BE8A 5ADVA 4D9MA 3R76A 2XB2A 2AZTA 5DYGA 4YP7A 4BBPA 4QPPA 4B3IA 1KO8A 4YRFA 3PDIB 1XZ8A 3QKRA 5L9AA 3HCDA 1X2BA 3I39X 2QIOA 4HDRB 5JJLA 3FOFC 2C2GA 2C04A 5CGQB 3M2TA 2HO4A 3BIWA 5JRJA 3G2KA 1ZD8A 3BBLA 1Z26A 3SE0A 1QLJA 2XAAA 3THOA 1XMOB 1UPXA 1WB5A 4TXNA 1PGJA 4E0BA 1AC5A 3ZZNA 2A0WA 2QLMA 4LY3A 5ALLA 1PCXA 3OFKA 5GGXA 5B37A 5GZ1A 1R8YA 4P36A 5AJYA 4BO0A 1ABFA 3VSBA 4LTNA 1YQEA 3DEHA 2AWNA 4BGIA 1N0UA 2QRKA 4B6EA 5IVPA 3ROTA 3LCRA 1FRVA 1ZU4A 1QP4A 2B92A 4AW9A 4PLCA 4PSUA 2PPVA 1I14A 3I05A 1EIWA 4U8HA 4HPXB 1CDZA 4QUDA 1O7JA 1SEVA 1Z13A 5AHOA 2IYSA 1QHHB 3W7BA 5ES3A 4W5TA 4KN6A 5AKXA 2PWYA 1EIZA 1VCIA 5A5EA 2ANBA 2OCDA 3AXSA 1Y1SA 3G9UA 1LNSA 5EWMB 5KVQA 4DR4B 2Y66A 4J2OA 1WXDA 2HSEA 2NYRA 3PB3A 3T5DA 3UJHA 1A9TA 2PHZA 3WIBA 3QYPA 2C7QA 1H8HA 2IPLA 2ZS9A 4OQYA 4KQ2A 2JHAA 1SD1A 1VI6A 5CXSA 4EI9A 1W34A 2ZYDA 4UDOA 4YNBA 3EXG2 2VTKA 3D6AA 2R7MA 2IS2A 2HCTA 1PR3A 4YI3A 5ALHA 2DU8A 4XARA 3T41A 3U9TA 2XMBA 4XI9A 2O6HA 4DDUA 5FD8A 5FTLA 5JFTA 3L93A 3IEXA 3GEDA 1ZGJA 3DVLA 5EJ4A 3N2GB 2GAJA 3ZNNA 4AXBA 1WAMA 2PXXA 3ANTA 4ZAGA 3VH3A 3C3YA 2PSDA 4AKHA 3CMCO 5TGDA 1UAAA 5GV7A 2WABA 1XN4A 5DF1A 5FPYA 2WMNB 3VNBA 4P22A 5EERA 4YRJA 4TWBA 2GBCA 3DAFA 5CA1F 1E3MA 4CVNA 5KQRA 3SD7A 2PJRA 1JL3A 1KDTA 3AP3A 1AURA 2PYZA 4N40A 3U3XA 3RUHA 4LJRA 3DE4X 4KKXB 1LBHA 2VCEA 2G88A 2HF7A 4TQ9A 4YTEA 3W3ZB 1U5BA 2JL1A 5CDFA 5DBHX 1EBFA 5ELXA 2PO7A 1B4DA 1PWYE 2C7VA 3DTYA 3LF2A 5B1HA 1TQ8A 3DULA 5IT9A 4ZU3A 2AW3A 2RCYA 1DXYA 3ROPA 1V7QA 4HN9A 1TRKA 4C5BA 1V5GA 4KGZA 2I7XA 5FNVB 4A15A 5FT9A 4J0JA 1I7LA 3L6DA 1YJBA 1QIDA 4XTCS 3L7KA 3WAJA 3QHQA 3AIKA 4QFCA 2Z0MA 4OFWA 3DVAA 3N3BC 1J0BA 1QCYA 2AFIB 4PLFA 1N4DA 3PJFA 3TRIA 2OCAA 5KO2A 3WL4A 4OLBA 4H08A 1FQJA 1MG0A 2VN8A 4FNOA 2QG4A 3WB0A 3GBSA 4KXFB 1XTQA 3HADA 3LUCA 3FHTA 4D6PA 4PG4A 4ML3A 2V7VA 2XLBA 4BECA 4RVHA 1M73E 1NU8A 4I4TF 3MAAC 3GWZA 1X7XB 3UJCA 1AHHA 2I71A 4RIHA 4V1CI 3DNFA 4YP1A 2Q07A 2PLRA 1PX0A 3L8DA 1WPXA 4WJKB 2PUVA 4WCDA 1PUIA 1X86B 4XYMA 4LYGA 4GBGA 3VU8A 4UTVA 5KOJA 2IZ6A 3H3JA 3S8MA 4RSGA 2JLWA 1FC0A 1OFUX 3Q7QA 2GNAA 3ROXA 2RMKA 2CVOA 2BI8A 2KM1A 1BS2A 3IAM1 4EHAA 3UZUA 5JT1A 1KFCB 3WLEA 3RYFB 3PDCA 3ZIAD 3DL4A 4RPGA 1LRLA 1LUAA 1QIEA 3ITNA 2NQ2C 1IC6A 2Z8XA 2BM0A 3RV4A 1M7GA 3C2QA 2PRJA 2ZB2A 3JQQA 3QYAA 3ZD8A 3REQB 3DT6A 1GQYA 4N6GA 4IMIB 3VPDA 1JG3A 1GDDA 2FW7A 2WDPA 2YX1A 1SBIA 4CMCA 2I4MA 2R1VB 1HSOA 5BRJA 2M1XA 3RSLA 4AB1A 2UYHA 2ZI9A 3NOVA 3FOBA 3PX3A 4J07A 1H2FA 1X6VA 4L7QA 2UUBB 2BZSA 4N82A 4UZSA 3FVRA 5K8IA 1L3BA 1L2TA 1KMQA 1MABB 2Q4OA 1EFCA 3S1SA 1KOLA 2RONA 3KZVA 1AJEA 3EIUA 4IIDA 2KE5A 2GWHA 1U8XX 1G8KA 1HE1C 4QOGA 4LYDA 1ZUNB 1VZ2A 4NK4A 3ZH2A 1YCHA 1NJ1A 3VVCA 4PNEA 2ZT5A 5DM60 3EVDA 2WFLA 3JQ9A 3OU6A 4O4HB 2BHRA 4MQFA 3UUEA 1BTOA 5MN5A 4QU0A 4BMCA 1C41A 3D6FA 3LHFA 3QELB 5KNCH 3ZXSA 5CYGA 1PG2A 2BEUA 2FQWA 4FN4A 4KYUA 2BFFA 4IHAA 5A5DA 3EDMA 4PSDA 3WGQA 3IBFA 5IVHA 2Z6AA 2ZUBA 4KFTA 5C2JB 2H0AA 1XWWA 2O2HA 5DGTA 5E6RB 5AESA 3SEQA 1P0FA 2P2DA 1EJ0A 4QECA 3WY9A 4AP6A 2XSZD 4ESOA 3FNIA 3JARB 4PIVA 2FFHA 3B7GA 4DA0A 3PGJA 2JATA 3LWNA 2PXCA 2Q2QA 2Q41A 4TQAA 3LL4A 1Z36A 3BZWA 3VAAA 3I45A 3E61A 3O3MB 3RC7A 4GX5A 4M0UA 2IXEA 3JVUA 4WLNA 5JYCA 1DDIA 2BY4A 4EA8A 5BN5A 1DJPA 3A1NA 1XRJA 3OA2A 1VYTA 4ZCQA 1NDQA 1V3VA 3JPWA 3T0IA 5I7AA 1W36C 2FP4B 3THXA 2CNWD 4GYKA 1O4WA 4ZD6A 1FYFA 2HSZA 4LBVA 1FQOA 4YONB 1TAQA 4OQQA 4BB9A 4EITA 5HF6A 1GDTA 1Q7TA 2W6PA 1EVQA 1NVAA 4MJ7A 5JD5A 3TLYA 1E3EA 1EX9A 1FRFS 1SOWA 2A9QA 2QQFA 4JI8B 3SKYA 5CDSA 1OW3B 2D5BA 2OCYC 1PFYA 5EQTA 1HG1A 1OOEA 2B1GA 3IO3A 1J2RA 4R1SA 2YWFA 4JWTA 1KI7A 1C8KA 4Q9LA 4FW8A 4C7MA 3KOMA 1CU1A 4IMPA 4LK2A 5JISA 2HQSA 3ICVA 4FHFA 1PQ4A 3K4HA 1LB1B 4YWJA 4KR6A 4WXHA 3NTRA 1OI2A 4BLUA 2Q5CA 1LPPA 2Z5GA 3QKRB 4B44A 3ELBA 1NATA 1XCOA 2HQ1A 4NV1A 4RFLA 5HOEA 3VX3A 2QZSA 2IJGX 1PFGA 1S3FA 3ENWA 1E20A 1HYGA 1X14A 3FSEA 3QTTA 1TCBA 2WJ3A 1ADFA 1KAMA 1RI5A 3A7DA 5EE9A 1QQ5A 5TQJA 5TXGA 4X90A 4B6QA 1QS0A 2EFEB 2REBA 2MSDB 4RV5A 1FDWA 1RZ3A 1GTL1 2BGKA 3RC1A 1G5RA 3ZZUA 5A5FA 3OLWA 3AV0B 4LTMA 4O4LA 3PC3A 4I66A 2Z95A 4UHFA 1NTOA 2ZUTA 2DFTA 3GFFA 3U7RA 3EDQA 3FR8A 1PQWA 3SF0A 3DGEC 4EHNA 5CXUA 3OIWA 3TW4A 1YIOA 2V03A 2JBAB 3EFHA 2IUFA 3FWZA 4RJIA 2XHZA 3Q0TA 3IMCA 4FGKA 3S2EA 4AROA 4W5NA 5TEWA 3AKYA 3CINA 4AJNA 1UOPA 1XXHA 3X0DA 4M9XA 5BORA 1GKLA 3FUUA 1ECJA 1F8GA 3ONFA 4IILA 4WUVA 4BX9A 3WMRA 1IXYA 4ETNA 3FZEA 2OZEA 1JWBB 2KS6A 4NXNB 4I8DA 2GXUA 3KTAA 4B43A 1FDTA 3MYYA 1GA6A 2HGSA 2QG6A 4LVOA 1P73A 2RKOA 3EGOA 2WMDA 1WZEA 1N2CA 2AB0A 1HE3A 3IPYA 1JSZA 1PR2A 2N1BA 3O9ZA 4S1VA 2ZQYA 4MQEA 1RZRA 1TEZA 1PI3A 2YWDA 3M5CA 4WKOA 3GNTA 5AK4A 4Y2UA 5FPHA 5F77A 1W30A 5C8XA 2LPMA 2AJTA 3HEMA 2ONKA 2X2PA 1YAJA 4HNAA 4FFMA 3BQMB 4HI0E 3L1UA 1U1GA 1CX9B 4MQMA 5ALXA 5H70A 5TMPA 4GBED 5JFGA 2C5HA 2NO1A 3T61A 4E5NA 3GBPA 4NFHA 2FTKE 2B8TA 4KN9S 4PX3A 4C06A 1Z6TA 3HXOA 3UAYA 3X1ZA 2G80A 1D2AA 2I4LA 4JXKA 1NOIA 1K4MA 5EOVA 4ZHSA 4TWJA 3R7LA 1EUDA 3PYLA 1QE5A 2FCRA 5IT4A 1V7ZA 1QYIA 2JS7A 1U5BB 5ESXA 4GYYA 1W4BA 3FJOA 4Q1EA 1I33A 1WHTA 1WX1A 1FTGA 7MHTA 2J7PD 5I7EA 3KLPX 2LKDA 1CRLA 2X5JO 1FJ2A 2BGRA 3NTXA 1Z73A 3CH7A 3I83A 4I50F 4L8VA 5C1OA 1JXMA 1IIRA 4GRIA 2P77A 4BV9A 1BXGB 2WJYA 3DVAB 3V8NA 3E9YA 1EWYA 4FEYA 4E3WA 4XWAA 1FOEB 1JKJA 1RAGA 3ENQA 4FHGA 4S3MA 4ZXFA 4K8RB 4YCLA 2P6RA 1OU4A 2CZCA 4TXLA 4P34A 2PRZA 5D1HA 1JR3E 1PV1A 4AKSA 2HMVA 5A4JA 4XASA 2CZQA 5K4HA 5I7UA 4Y0AA 1I4WA 3C5WP 1QOZA 5K0CA 1DJMA 4MCAA 4ZZ2A 4DQDA 4MVJD 2Y1WA 5DPMA 2HDOA 1ZJJA 4N49A 4XW2A 4DBVO 1I7SB 1TEXA 4J0EA 4WZBE 2RGWA 4PLTA 2QSZA 1R4AA 3TL6A 3L6EA 3HCWA 2D7DA 5JALA 2PN1A 2PGNA 5I4IA 5KOJB 4NU5A 4KFSA 5H4GA 1DVRA 4DPKA 1JRLA 3QW4B 4R8KA 2AG6A 3RSGA 2XYQA 1S7GA 3R1IA 5CA0B 5JRDS 4Y2TA 5B7PA 1QIIA 1C7JA 3BWEA 2WA1A 4OH1A 3WRWA 1W0JA 2EAUA 4PTZA 5CK5A 3HV2A 1OYYA 4MX8A 2K7ZA 5U9CA 3KPUA 3UPUA 3DDUA 3HP1A 4BZPA 3SAJA 2QTNA 3W0LB 4OQLA 1U7UA 2DLCX 4HS9A 2PUTA 2KHZA 4RAQA 4K9LA 1G7CA 2GYUA 5CYPA 1JPJA 2F17A 1U3VA 5C7IO 2H51A 1VJ0A 5THXA 4B0OA 2JKVA 1O6CA 2IHVA 2QZJA 1DX9A 4JXJA 3ZR4B 5FBZA 4OBEA 2DHQA 4YXWD 2EQ5A 3NHRA 4CL2A 2B21A 1QFXA 2ODNA 5FWNA 2XI4A 4BPBA 1P0CA 4IOLA 3BWVA 1KJYA 2XMDA 3HV0A 3OZAA 4MWGA 3RVKA 3K9QO 2WSIA 4M6WA 1KP2A 3U61B 1OLXB 1ZYUA 1JKMA 5K8CA 2EJWA 3L2OB 4ND5A 3P9CA 1XPUA 1J23A 3EFEA 3OIDA 4MQFB 2X0IA 4NH4A 4BRSA 1FDSA 3EZ2A 4H17A 3AIIA 5ENZA 4N8SA 2BFFB 4ZYUA 4HLNA 2BBTA 3V3KA 3R3UA 4DUPA 1TYCA 4UULA 1AMOA 2I6SA 4KLCA 2VZ8A 3IELA 2VSQA 1FNNA 1MIOB 3LQFA 1N34B 5IG2A 2HSJA 3S27A 3QWAA 1FDRA 4NBUA 3OZGA 1T1RA 1IXKA 3D7RA 5GJCA 1Q21A 1F3OA 4E46A 2GH1A 2I6UA 4LMBA 1T9GR 4BRUA 1WR8A 4A8JA 1EFAA 4RQUA 3HB4X 1N2OA 4TTPA 3MINA 4O1HA 3UAWA 1M3SA 1UANA 2PWAA 3NWEA 3H11B 4M1SA 1EFHA 2OY0A 1K97A 1UIRA 3BB4A 1ZGBA 4BLTA 1TZMA 1ECCA 2BHNA 3EDYA 4FFVA 4D9EA 3SVTA 1Q92A 2AJDA 4Q3OA 1UPCA 3ZQ4A 1RRFA 1RQLA 2WAAA 2BFCB 2GPWA 3E03A 4TLDA 4TKUA 4LS3A 4G89A 3R74A 4D79A 1LY1A 4IEIA 2AF4C 1FRNA 1RSZA 1MR3F 1P9RA 2ECKA 3OQJA 4MA0A 5BSEA 5L51A 2GN6A 3DL2A 3WLNA 3VR6H 3DONA 3C3MA 1HKHA 1YQDA 2IODA 5LJIA 2IRWA 5JS2A 2DTXA 2XF8A 1Z4NA 1O57A 4N0DA 1XWIA 3MCUA 4HFRA 1Z6PA 2Q21A 3SJ7A 2PZMA 1BDIA 2AWOA 1EJ2A 2P6PA 3PKIA 4F4JA 1CWUA 3B3FA 4ZQFA 2J8ZA 1AO3A 3R9IA 4P5DA 1FY2A 4DR6B 3NJ8A 5BSMA 1WL8A 2ZPUA 2C1EA 3HBAA 2RGXA 2D4HA 3EFBA 5DM2A 4RTRA 3TX2A 4QNRA 2ASVA 1X9HA 1QS0B 4N7JA 3AUSA 4G5OA 4D8XA 3V42A 1DTWA 3AR3A 2EKBA 3UATA 4ER3A 2HMWA 1F1BA 2R84A 1IZ8A 3QV2A 4NPHA 4O4LB 3L1JA 4YEDA 3S2IA 1SA0B 4D97A 3K7EA 4E2ZA 2D06A 3O4VA 4RF3A 4A6DA 1XZHA 4UD2A 3O4HA 2VF8A 2A78A 3CTMA 3W8DA 4FX5A 2PIDA 3ZQKA 1A2BA 1WMDA 3MLBA 3O92A 3DMNA 1VBKA 1KVTA 2H0QA 3GLIE 5ECDA 1XXHB 3AP1A 1IBRA 3OI7A 4IGAA 3SN6A 4S1NA 4F3CA 4URVR 4DDVA 2I55A 3LP5A 2BFBA 1ZJZA 2QTFA 5MF6A 3UKOA 2VJKA 1NJSA 4JI7B 1JYFA 2J6BA 4CE6A 4PSCA 2IVFA 5J2TF 3KTAB 1Z74A 2VYVD 2QTWB 5FULA 4CIVA 2BFEB 1MXHA 2GBFA 4NBWA 3ZWKA 3OLXA 1N2CB 4RNCA 1SUCA 2WAOA 3OEHD 4J0FA 3PD1A 2O3JA 2VHJA 3Q1KA 4MQEB 2R8YA 1OHHD 1TTQB 4M8NE 5EMKA 4MUAA 4DUGA 4J6EA 1TA4A 3E3NA 4C7VA 1EXWA 2A2ZA 2WYIA 3A10A 3GFOA 4DAEA 3JAKA 2CLHB 4HNAB 2VXYA 2VCYA 4UPDA 4BFLA 5ALQA 1ISIA 2O52A 4ZCIA 4JC4A 2XRMA 4J4BA 4B6OA 5FBRB 2AMJA 3W9UA 3T0GA 4EKGA 3ZI0A 5HMLA 4O3MA 4HSEA 2G63A 4FWBA 3WLMA 2G5CA 2GJAA 2JI8A 2R5NA 4HUQA 1EP9A 1GKKA 2HPAA 4RNDB 1EUDB 1JA0A 4C4RA 1C0EA 4V38A 3LNTA 1J7KA 4GECA 2CHVA 5F33A 1NW7A 3EG9A 4YDQA 3M7IA 4A23A 3ETGA 3WLLA 1HL3A 2IQIA 3PDUA 4U7DA 3CCFA 2EJCA 4ZQGA 2B94A 3WV4A 1SXHA 3GJ4A 5HZGA 5IVDA 1MT0A 5EKXA 1J4AA 3BD9A 1CUYA 1MV5A 1TCCA 4N3BA 1G8PA 4E88A 1T8RA 4DMKA 4FEEA 4CV3A 2FZGA 3L7BA 3QU9A 2WT4A 4U39A 4OCZA 1Q11A 4Z4IA 3I23A 1JKJB 4YPOA 3WV5A 2C3PA 1AH2A 4MAAA 1DO8A 4U6QA 5ICMA 4MHTA 5H59A 1IQPA 4F1JA 2HLNA 5EZ6B 1XMQB 2QAGC 2PL1A 1ST2A 2J5BA 4N12A 1CTQA 1U98A 5F52A 4KC0A 2LKCA 4QRIA 3W06A 2G77B 4X1KA 4BMNA 2CD7A 3HKBB 1QO7A 3F7MA 4HAVA 4QYXA 1XZAA 4PO3X 5JAPA 3L8MA 4NNPA 1JU3A 1OBCA 5FYDA 4H1VA 2W2KB 5DNEA 5BV7A 1EXDA 1XFDA 1ECLA 4EELA 2XUIA 3TLEA 4U7GA 3TUIC 5DO9A 1M1YB 3LKZA 1CUCA 4IIGA 2PSEA 2BW0A 1YL5A 4HMPA 4WWHA 1Z5UA 1X7WB 4MS1A 4R3WA 3T3GA 2UXBB 4DIKA 2CL0X 4IGKA 1U94A 3DV9A 2H1LA 4FWTA 4PANA 1I36A 3SC4A 1J6UA 1OFTA 1VSTA 3CUWA 4L6CA 1NSFA 2GBIA 3L1VA 2BONA 4NJMB 3RS9A 3V9AA 1W4RA 2VAVA 1GPLA 2H57A 4QGGA 1EYZA 1YMQA 3TRHA 3ZVLA 3EXHC 1LWOA 5KQGA 5E4TA 1B1CA 3SZRA 2X8LA 1QONA 3B38A 3ZI7A 4B3RB 3OUZA 1GGFA 4PYRA 2AJBA 4NH0A 3VJMA 3ZUPA 3GP3A 5A6SA 1E99A 1I4TD 2QW0X 4WOCA 7ABPA 2I1WA 1ADGA 3Q41A 1RABA 2B8JA 1WDLA 2LGJA 1V0JA 4Q3LA 2Q1UA 1R74A 2JFVA 3IYLW 5DU2A 3DBHA 1GV1A 4H31A 5IVKA 4PTLA 4FGJA 2O0HA 3IA2A 2JGRA 4J6FA 1B1AA 3EGVA 3EMDA 4NMWA 4QPZA 1KK2A 1N2SA 1APBA 4W9NA 4IY1A 2KWIA 3Q6IA 4OMFG 1T1EA 4BNYA 2CVHA 4CR7A 4JYCA 1FFDA 1ORHA 1N2BA 1YU6A 1AS0A 3OUTA 1JMKC 4ESVA 3VDXA 4MUEA 5AJZA 2G0TA 2E4WA 2XUPA 4LCEA 4N8EA 1SRRA 4QDOA 2NU9B 3WQSB 4YV0A 2HRQA 2OFWA 3FUCA 1AK2A 5HX7A 4E7OA 3T3MB 5I7WA 2ZCJA 5G02A 3G82C 4MWBA 4YT5A 3K09C 3PCXA 2IZ1A 4REOA 3G8AA 3ES9A 4EWLA 1Z6YA 2P5SA 3CXRA 2O5RA 3UTCA 2NSHA 1JVSA 3R0VA 4AY6A 2EX0A 3KQTA 2FSSA 3AONB 3ECCA 3K5WA 4FXPA 1Z4OA 1PUJA 4R8RA 2AOXA 5JRZA 2VQ6A 5G4KB 4NU6A 2ZSUA 4A8JB 5DRYA 3MINB 3DDWA 3CEAA 4H7FA 3UC5A 4QNMA 1C7EA 4DQXA 2X9VA 5IJ0A 3FPSA 3COVA 4MVJF 3UAZA 1RM3A 1DWUA 2OHJA 1BEUB 3BC1A 3FHOA 1UPFA 1C4WA 3I4LA 3IULA 3L8GA 4ASUD 3C7TA 5IBRA 4XE5A 3WMGA 4XM1A 1ADYA 1W49A 4G0WA 3OC0A 2F9MA 1H94A 4FGSA 5L7YA 5K8TA 4H0NA 2J7KA 3IVRA 3HZOA 3WZLA 1H5QA 3PWSA 4A16A 1JF8A 4DCOA 1BZYA 3DYVA 4DBZA 5C1PA 4OAOA 2YYAA 2H2HA 3EBOA 4KACA 3P96A 4ISBA 2DPMA 3LUBA 4TZ6A 4JK3A 3REFA 1XI2A 2MSLA 2QT0A 3R5TA 3SJAA 5G40A 2QPTA 1SURA 1XVAA 1LI5A 4DM3A 2P6OA 5AI4A 3UAOA 2AZDA 4EKIA 4Y2XA 4TL6A 2H4XA 3GFGA 3BE5A 2HREA 1N8KA 4G01B 2ZS7A 1JFLA 1P5HA 2O50A 2V7PA 4JODA 4QPJC 5EZYF 2YOFA 4C7XA 3E23A 5DXJA 1GU0A 5I7RA 2RGNA 3TI9A 3OZEA 4O0LA 3R23A 1ZW1A 2WKSA 4RY0A 4ACAA 5F12A 1VIYA 5KJFA 3N2LA 4WADA 3UA4A 2RIRA 2XADA 3GLVA 1NVVR 4H3KB 3ZK7A 5JSUA 4US2R 1F4LA 3CLSC 2YVLA 3DUFA 3RIEA 1MEJA 1NQUA 5DHUA 2W7TA 2EW2A 1A0OA 1SU6A 4Q12A 2C96A 4MEAA 2WWHA 3CM0A 3THWB 4BVGA 2P2ZA 2GAOA 3RRMA 3MQ4A 4DEVA 2O8EA 4ZMBA 1GU1A 1JIIA 2IYLD 1X8LA 3S2ZA 5EIXA 4AJOA 1P7WA 2FE4A 3ABRB 1K7CA 5IUJC 1CV2A 4G07A 1T4CB 1ENYA 2QROA 1ZD5A 2F9LA 4IJ6A 5ESRA 5B1SA 3SZOA 3VOAA 1FU7A 4A3SA 1IOZA 2F8TA 5FTJA 2DQ4A 3G0BA 4ZXPA 3Q3IA 5ALOA 1T5IA 1JLMA 1FUIA 1ZIYA 4KJXA 3AUJB 3RREA 5KSZA 4MYSA 1QSGA 4JYMA 1E32A 2IP1A 2QPLA 5BYBA 4OHKA 1AA9A 1ZN9A 3BRWD 3JSAA 3WMEA 4D0SA 5JTUA 2R8ZA 2PH7A 3ZWCA 1Z7EA 2FXVA 1FX0A 1JJBA 1E3IA 1JX6A 3GGGA 1C5KA 2FW9A 3ONWA 2CFOA 2XQKA 4MI1A 4N47A 3VSDA 3VZPA 3TLBA 4BEBA 1ZFNA 5ETJA 1DXOA 1T2VA 5HUQA 4UBNA 4TGLA 4LJ8A 2PVCA 13PKA 5FR1A 2HR1A 1JZQA 2QM8A 2QWXA 4WFKA 3HA3A 3ZE9A 4HUQB 4X7PA 3HMKA 3HU1A 2EF0A 2JH8A 1KY5A 5J47A 4US1R 1DWOA 2Q5QA 1ZJ5A 4AJJA 2HM7A 5H3HA 3GUCA 2NSYA 4O63O 5ICSA 3PEWA 1DO2A 2O59A 4URFA 1Z0FA 2JDID 2B6HA 1LSJA 2V8OA 5IZ4A 3GJ7A 5B6IA 1DRVA 2E1PA 2WSYB 3G0OA 3HYSA 1F2DA 1B8VA 2VSXA 4GKVA 4MV1A 1L7PA 2Z57A 3IUYA 3QRWA 3LKDA 2Q4RA 1PN3A 3D3NA 1Y1TA 4J9VA 3NETA 4NR0A 3NU1A 4XWTA 1AF7A 1VL5A 3EG5A 5CITA 4Z4QA 3OM9A 3LBAA 1CR0A 3BMCB 1RPAA 2AFRA 4MKRA 1FL9A 3VO1A 6YASA 2YOHA 3QU5A 1PYGA 1T2AA 4MVJM 1L7QA 3T06B 4X3PA 5CLFA 4EJFA 8ABPA 5JH7A 3IL2A 3NP9A 3KLBA 1TW3A 2YKGA 1DTEA 3JQAA 1YKSA 3WGGA 2LW7A 3ONDA 5HZHA 4PZCA 4X1KB 3WB2A 3O2SB 2RSLA 1TK9A 4UBKA 3DCIA 2QD2A 3HKCA 3I8SA 5A62A 2AZXA 2VH2A 5ADHA 2FPXA 5HWSA 4U6NA 3BMXA 3IJRA 1JLSA 3O7WA 3R0JA 1UZLA 1G60A 1SHUX 3V8MA 4ZVUA 2CB0A 4BDTA 4EYKA 5CB6A 3AR9A 1HDOA 2H1FA 2I76A 2WP0A 4U7JA 4XOIA 3SZGA 3M1AA 1QRRA 2WY2D 3ET5A 3ZIDA 4B85A 1PTJA 3AVTA 3OJLA 3EC2A 4CIXA 1Z3CA 3OZIA 1ETHA 3E9RA 3RARA 2HT1A 3L8CA 1RWXA 4WERA 3U5TA 5FNVF 1M2KA 1YHZA 1XPRA 4YBRA 1DRKA 4BP9A 5SZKB 5EXXA 2G83A 1G4AE 4NKRA 4IX9A 2SECE 5JJIA 1G2OA 3PXBA 3T0FA 2XV1A 5HOQA 1H6AA 2AKEA 5A6SB 2XDQB 2GM5A 1LVUA 3AUYA 4JBGA 3K05A 4UVIA 3TSOA 1QH8A 3ZHCA 4E03A 2G25A 2QMYA 4R8SA 4ZJUA 3EVAA 4HWPA 2HPHA 4JGGA 4QNNA 1IN7A 5KBYA 4PAOA 3GNQA 1WW8A 2CW5A 1N8SA 3D3WB 1ZN8A 3K5IA 3KOZA 3U3MA 3VU9B 4E22A 1P2GA 5FA5A 3LA6A 3L7AA 5PGMA 2IEDA 1HI9A 3UHPA 1QE3A 2XNJA 1KETA 3WB1A 2I6FA 3QXSA 3OFNA 5LP1A 2O8VA 1BO6A 4V0SA 3E3MA 3JYQA 3SS9X 4HEQA 4LPKA 3C3AA 3E1KA 3OHSX 2FFAA 2NYVA 3OEEA 5FRDA 2Z9DA 3UB2A 2B83A 2Z4TA 3GJRA 1M2VB 3K9WA 4D4GA 3WGKA 1E1QA 4PN7A 1II9A 1AGXA 5TT0A 3KR1A 1D2NA 3DO5A 4GGOA 4RESA 4WD3A 4WXRA 4QOFA 5CT9A 5ES4B 5CIWA 1QOQB 4G26A 4EVQA 5GTDA 3AMVA 1K6IA 4AZWA 3FMPB 1TOAA 1FLAA 1V1JA 5KSWB 1XU9A 1RLIA 4A82A 4BO4A 2ZJ3A 5BVHB 1WTAA 1GM5A 1JG6A 1X7YA 2NSJA 1N2XA 2B2CA 2HWKA 3DLCA 4TRMA 2VUIB 4YALA 5IM4F 1US8B 1E2DA 1WDKA 1XVUA 4FCCA 4Z9AA 3WNDA 5DHRA 1SFRA 4MUGA 4C87A 3JYHA 3ESCA 3T52A 2GHRA 1TYEB 4CGYA 1D5CA 5HKBA 4IRUB 3R9XA 1SEPA 3LWBA 3F8WA 3UN1A 3Q8WA 2F64A 2HAEA 3A1TA 2IYRA 1XX6A 1Q0PA 2X3FA 3G88A 1UBOS 1YFKA 5D7BA 5ERYA 1VXRA 4IW3B 4A2QA 3DUWA 3N6RA 5FJJA 3GK3A 3A6HA 3FFAA 4RD4A 1WE2A 3LTEA 3S81A 3SWWA 2F2TA 2D5CA 3W2IA 2HWYA 3B1ZA 4ZV4A 3AJAA 1F8UA 2R6CA 3GYGA 3Q7EA 2WR8A 2I54A 1OWMA 2X9NA 2ZIZA 1YUMA 1QB8A 3C85A 4GBMA 4O4HF 2AX3A 4EGFA 1OTHA 1SKUA 4UAGA 1Y80A 2D3WA 4J91A 4EYEA 3OETA 1HKUA 5CHEA 5DNCA 2P2YA 1LI4A 4PPNA 4QAJA 2NZXA 5J43A 3U19A 4NP6A 4Y6PA 4CT0A 1NM5A 1QK4A 2XGSA 1ACMA 2O2SA 1N6NA 3VYRB 2CV0A 4UNNA 4MPDA 3WJ1A 10MHA 4RCYA 2WVAA 5JYBA 4X3OA 3TLGA 1VOTA 4R1QA 3EDCA 4O2BA 1NGSA 1B0ZA 1XV5A 2PUHA 3EUWA 1LTQA 2PEZA 2YCBA 3BCHA 1RZRD 2Q5FA 1ZU5A 3VI3B 2WAXA 1JMYA 3QU7A 4MVJI 4QUBA 1RLTA 4UNIA 1DB3A 1LJ8A 3TUJC 2HJ9A 5LQRA 4OBWA 2XYVA 3OZ7A 3TIIA 1RXCA 4N3NA 2EKDA 1HTBA 4X66B 2PBRA 4INOA 2B2NA 1ODTC 2C2ZA 3Q2IA 1E6MA 1GPKA 3NAQA 3PGMA 2P9EA 5HJ5A 1HXHA 4K6CA 1Q0HA 3J7AC 2UYGA 1CF2O 1HT2E 3I0MA 5AIBA 1M6VA 1Y1QA 2G3YA 2AFHE 3EEQA 4Z7QB 2HJGA 3ZXUB 4E1VA 1BN7A 1G20E 3L46A 4NTZA 4YIKA 2JVIA 5KYUB 3NIBA 1WZIA 2AR9A 5EI5A 1SHKA 3A06A 4FEAA 1FP7A 1UP7A 4EA7A 4UXIA 1BHJA 2FUEA 2X8WA 1MOSA 3V55A 1RRVA 2YY5A 1RMYA 1SCDA 2WEKA 4ZOAA 3HRIA 2QI9C 4AZTA 3UMVA 3HCFA 3QE2A 3KXKA 1DJNA 3H9QA 1YB2A 3I01A 5I4BA 5EYPA 4WZAA 5JWHA 4R9SA 2VDJA 4L51A 1MZPA 4PQRA 1Q0LA 2GPTA 2OBNA 2QJWA 2UZ0A 4LQ4A 3PQEA 4MGKR 4EHFA 3SNKA 5KJ6A 1PZHA 5CCBA 1PHRA 2R4TA 4FOTA 1KI8A 4DCMA 2BM1A 1ZLYA 3ID6C 4Q82A 2OORC 3S1AA 1FX0B 2CHQA 5FO1A 5HUJA 1XCMA 4IWXA 2HXGA 5YASA 2R65A 4JQZA 3NPMA 4WESA 1K4KA 2ZR8A 5HBRA 5ALTA 3HY6A 3UYLA 2VJAA 1NMSA 1YRWA 2PS9A 2YBDA 4BFUA 1RJ9A 3AM3A 4MYUA 4X85A 4ER6A 5JEEA 2JJYA 1VYHA 1PP4A 3FRIA 3O8QA 4F6CA 3BIXA 3UMYA 3NVKI 1OREA 4F45A 4E70A 2ODEA 4EJ0A 1M66A 4BQPA 5A5VA 2Q4TA 2CLSA 1CZNA 2FMTA 2H3EA 3LGXA 4L16A 1H2XA 4DLYA 3I1JA 3PEEA 3ZHSA 4ARVA