2ZTSA

Crystal structure of kaic-like protein ph0186 from hyperthermophilic archaea pyrococcus horikoshii ot3
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
216
Chain Sequence
b'PVRRVKSGIPGFDELIEGGFPEGTTVLLTGGTGTGKTTFAAQFIYKGAEEYGEPGVFVTLEERARDLRREMASFGWDFEKYEKEGKIAIVDFNVDNFLRYIYRVVKAINAKRLVIDSIPSIALRLEEERKIREVLLKLNTILLEMGVTTILTTEAPGKLSRYGIEEFIARGVIVLDLQEKNIELKRYVLIRKMRETRHSMKKYPFEIGPNGIVVYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0186
publication title Crystal structure of KaiC-like protein PH0186 from hyperthermophilic archaea Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Atp-binding protein
total genus 73
structure length 216
sequence length 239
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ztsA00
2DFNA 4KU4A 1AQUA 1J90A 4KJZA 4M2LA 4C30A 2GCPA 2ONKA 1YZNA 4A8JB 2KBFA 2ZS8A 3T15A 2B8WA 3IIJA 1IN7A 2R6AA 2WWYA 3TBKA 4FMBB 1UKZA 3CR7A 4L9SA 5J40A 2XSZA 3O47A 4PQFA 4Q1FA 4TMWA 3SJBA 4GNKA 5IK2A 4QL3A 4RD0A 3PVSA 4TLEA 2PX3A 3AF4A 2CCJA 2J59A 3KTAB 3NDBB 3O8RA 1IN4A 4R71A 3THWB 3PUVA 1NF3A 2WM9B 4V0MA 2RGAA 1TQDA 2VP4A 1D6JA 1TL7C 3VR5A 1G20E 3BH0A 3RANA 2RGCA 1E32A 2IYTA 2XZPA 3KFVA 5JRZA 3W8RA 4CRWB 4OQXA 1RYHA 4KFSA 4D0GA 1KI4A 1S9DA 2V55B 3X1XA 4F93B 5HZKA 2LKDA 5HE8A 4GL2A 2AXPA 2VPPA 1G21E 1KHTA 4Q9KA 4E03A 2HUPA 2WMOB 4JLVA 1CLUA 1N0VC 1E9FA 4KFUA 4LBZA 2BM1A 4JLBA 5JZVA 3FHCB 1SVKA 2QM7A 3TJZA 3PIRA 2REXB 4M1WA 5JJIA 3P26A 4GMDA 2JIZD 4MRSA 1JI0A 4LV6A 4D0LB 4JT2A 4I1UA 3QVUA 4KSBA 3RRYA 3IKJA 2G88A 5EE0A 4EUNA 2FZ4A 3U5ZB 2ODNA 1P2UA 2BV3A 3UPUA 1XPUA 4M21A 5E95A 4Y0VA 1AS2A 2KB0A 4PO1A 3U44A 2W58A 3CX8A 4WZ6A 1CEEA 4NTZA 1UDWA 4I99A 4YLGA 1T9HA 3X1YA 3PUWA 1YQTA 5K8TA 3QG5A 4JLNA 4M22A 2JLUA 4URXR 1XEXB 2IYYA 1Q21A 5L3QB 2HEIA 2GCNA 2X8AA 2PZEA 1CR1A 2CCGA 2G1KA 3BB3A 5EUMA 1ZM3A 3B1YA 4B3CA 4MA4A 1M8PA 2AN9A 4S2EA 3K70B 2FNAA 4GZLA 3U7FB 4KLZA 4ZV4A 2PLFA 1ZJ6A 3EASA 4B3DA 5JS7A 4GRAA 1QVRA 1AQYA 1WF3A 4M1OA 5B2ZA 3TGPA 2JLRA 4JBYA 4TQAA 5EE9A 1Q3HA 3N70A 1N0WA 3L8ZA 3A58B 1MT0A 2JIZA 4ZPXA 1E4YA 1W36D 1U81A 2JJ2D 2ZRIA 1NG9A 1E2DA 1XWIA 3MLEA 3QG1A 1G7TA 1T91A 4TYPA 1F5NA 3UXMA 2IYUA 2HXSA 2V9PA 1S1MA 4DB2A 5KO2A 4C0SA 1S3SA 4LC1A 1KMQA 4QNMA 2O8BB 4AKHA 1KAGA 4QG7A 2B8TA 4DT1A 1P4SA 3HU3A 5FOXA 3AVWA 3LA6A 4PQRA 3FHTA 4F4IA 1OKKD 1SXJC 1YZTA 3CNOA 4DEXA 1XNJA 1T8TA 1RVDA 3IIKA 3CPJB 4PAOA 2Z0MA 4R98A 3A4NA 4Q21A 1DEKA 2QAGA 1G8GA 4P33A 3QVVA 3JZAA 4JBWA 1KY2A 1QVAA 2BCGY 2VF8A 2Z43A 3IPXA 1FUUA 3B78A 1R5BA 1IY1A 3HP1A 3KKNA 1G19A 3AQ4A 1NVWQ 1U90A 4KI0A 1XD9A 1NN5A 2JLXA 2D4HA 2OILA 1NVXQ 5BYKA 3CF2A 1Z0DA 3B8HA 1YHNA 2ZYUX 5F9HA 5CLLA 2JLQA 4TL8A 4TTPA 3THXB 3QKSB 3CF6R 1DAKA 2V3CC 4HZIA 2XNDD 1IN8A 3PFIA 1HQYE 2FDCA 2REOA 2EFHB 2PT5A 4DDUA 4US0R 2ZE7A 2JJ2A 1AM4D 1RZ3A 3R9IA 2C8VA 3I8XA 4FCTA 3T1TA 3EPHA 2P65A 2J46A 3THYB 1JQLB 1SHZA 2PH1A 3LBIA 4G3XA 4HUQB 2BMDA 2XXAB 5FOSA 3TR0A 4G1UC 1MOZA 3NEJA 4TWZA 2DFLA 4C0BA 2YYZA 1KK2A 5DIFA 1WBBA 5FBRB 1KI2A 4URUR 2IYZA 1RIFA 3HU2A 5KYKA 1JEEA 4B3GA 1E2FA 4V02A 1OKKA 1TF5A 4A15A 1IN5A 4LPKA 3AP3A 4GPTA 2DPXA 4CVNA 2I3BA 5EE5B 1DAIA 3BFVA 2QUZA 2YWHA 4G5RA 3T12A 4P31A 3K9GA 4DBLC 3TW8B 5F3WB 1QHNA 4A8JC 5L3VA 1H8HA 2WICA 4GOXA 5EXSA 3DL0A 1HT1E 1F2TA 2FFHA 2ZSEA 5C4GB 3BH7A 3P27A 4AK9A 3QE0A 1FP7A 2BMJA 5SZJA 2XNDA 4AKIA 2WWIA 4XVRA 5HR5A 5TMPA 5JLJA 4IOLA 1E4VA 1M7GA 3A1TA 2ZRJA 4HI0E 4P4TA 4P32A 4S35A 1KI3A 4RCZA 1J70A 4MYTA 2ANCA 1DOAA 4PANA 3AP2A 2ZE6A 5JECA 1E6CA 3NVAA 4NPHA 4AWXA 4JVMA 1ZUIA 3GCGA 4BPBA 2V6IA 5EP2A 3K53A 1KJZA 3FGNA 2VQSA 5CDFE 4M9XA 5E3HA 3I72A 3S1AA 2ZJAA 4DJTA 3BORA 4A0GA 3KUDA 3QPUA 3QF7A 2FSIA 3SYKA 2D62A 4B44A 1NBME 2EWWA 3B1ZA 5HCNA 4NBSA 1R6BX 4TZ0A 4BRUA 1ZNYA 5D3MA 1K5DA 4MH0R 2QEQA 2UVQA 2QTHA 3VFDA 1GNPA 2ZRLA 4XSHA 2WAXA 5DH9A 1XEFA 2Q21A 1Z29A 3NBZC 4PO9A 1DELA 2NTYC 4QC2A 2CXXA 2J41A 2IHBA 4RZXA 2VHTA 1OIWA 3ZIAA 2VRWA 1I4TD 3FMOB 2GF9A 3WYFA 5M04A 4ZCIA 4Q48A 4V03A 1T0JB 4CYMA 1OV4A 2VYFA 4KBGA 4F38A 3AVQA 4BLOA 2ZRPA 2ZJ5A 1BH2A 2ERXA 2PL3A 3ASZA 2XOKD 4LYFA 5TY0A 5C1BA 4NU0A 1GRQA 4JL6A 2NO7A 1E9EA 2W2XA 3BB1A 3FHOA 4IDHA 3AKCA 1FTSA 2YC2C 4US2R 3DHWC 1E0AA 5FTLA 1ZUHA 2FPKA 3OHMA 3DOFA 4TL7A 2VP0A 2V4ZA 2CJWA 5KNDA 3IPYA 4ERNA 4B3FX 3SHWA 1M1YE 1VYVA 1LW7A 1TMKA 2BOVA 1IOZA 2F3RA 2NO9A 4D0NA 1M2OB 1YR9A 4EQ6A 1NVVQ 3H86A 2GF0A 3UWKA 1N5KA 4BFYA 3EXAA 1XD2A 4A9AA 3FVQA 3BE4A 1SKQA 4LJYA 2XAUA 3HYTA 4A92A 1FX0A 4Q01A 1AKYA 3AP1A 2ZRHA 3H4MA 3AVPA 3R9XA 3EC1A 1AJEA 4B2PA 1TX4B 3BAFA 2I4IA 4AI6A 3TVTA 2B7CA 3L0SA 3WBKA 2AWNA 3IBYA 3DM5A 3QXXA 5EXPA 5KTYA 1NBMD 1G7RA 2IUSA 4WIAA 3RS0A 1M6NA 1VCIA 3ZS8A 5DNYB 1W48A 2OO7A 4X8OA 3GFOA 3MAAC 3QNUA 1OH6A 2IWRA 4DXAA 2XOKA 2WAYA 3G5UA 2OESA 2EU8A 1GRNA 1FFHA 2ZU0C 4R2IA 2AKAB 5DI3B 1GOTA 3P4YA 4TLDA 2IUUA 4MDFA 1UM8A 4Q4JA 3LBNA 4DSNA 3GJXC 3THOA 2ATXA 1EX6A 1ZM2A 4OHVA 4C0KA 4HUTA 1MRSA 2QRNA 1IXSB 1XTJA 4Q9LA 1TU3A 4MQBA 1MABB 3R8FA 1X1RA 2AK3A 4QHSA 1SVLA 1Z6YA 5DHAA 3ADKA 5FUYA 3CH4B 3OFNA 5L3RA 1QHHA 4OI4A 3K0SA 4ZDWA 5CDFA 4YDSA 1U2RA 1Z6XA 3K0CA 5E7JA 2EQBA 2PEZA 3TSOA 1WDTA 2CBZA 5FOWA 4Q1BA 3B82A 3W34A 3U4QB 3W3ZB 2R8RA 5LB2A 2QT1A 4HDOB 1NBMA 4NONA 2OHFA 4KCGA 3FKSD 4BFZA 2OUKA 2GK7A 3SFZA 4D4JA 4OHYA 1OW3B 2WIBA 4DSTA 4BFTA 2ZRNA 1Z08A 8OHMA 5KPDA 1LFDB 2J3EA 1IJEA 3GLIE 1T5IA 3UMSA 3C7KA 3D3QA 2BDTA 2GCOB 1GITA 2YZ2A 2RCNA 5BW8A 3PG5A 4ZO4A 2VP2A 4XVQA 3L0PA 4D6PA 1PUIA 2J0UB 4W5JA 2QNRA 4JL5A 4EFMA 1S4QA 4AYWA 3GP8A 1KI9A 3GLGE 2XB2A 1XRJA 2DWQA 5JWOA 1SULA 1F60A 1N6KA 4TTRA 4NCIA 2A3RA 2PZGA 3DKVA 5FBQB 4PPFA 2Q9CA 4Q9IA 4B71A 5JFGA 3VU9B 1ODFA 4N1AA 1COWD 3Q5EA 1P5ZB 3E70C 1B23P 3RSOA 3U7GA 4ABYA 3NC1C 5GJCA 2ZS9A 1E2IA 2VHUA 1II0A 1OH5A 4C0QC 2VSFA 4JSTA 5H1YA 5IT5A 3T1QA 3SI7A 1NG1A 3FKSA 2R6DA 2W2TA 4P0TA 5EXTA 1I2DA 5G41A 1E99A 4AYTA 1A1VA 3WBJA 3GD7A 3QXJA 1GUAA 4MKIA 4YXWD 4P4SB 1RPZA 1FPMA 1BKDR 4MKGA 4DLSA 1GILA 1CJTC 4I81A 3U6KA 3C8UA 3ZYCA 2W0SA 1OB5A 1DAHA 5KSZA 3DZDA 1Q22A 2ZANA 4WOPA 2Q3FA 5SZKB 3VMFA 1GL7A 3CBQA 3W6PA 4FMDB 3NG1A 1DO0A 1NLFA 4DVGA 1ZVQA 1ETUA 2CVFA 4BEBA 3TR5A 1EX7A 4LCBA 1UBCA 1KKMA 3OIYA 5JEEA 5FI0B 5JI3E 3DEFA 5FPHA 3GJ0A 3UANA 5FUXA 3REFA 2XB4A 1U99A 1JJVA 1TADA 3R8CA 3LQRA 3LBHA 4XD7D 2ZITA 2WOJA 3QY0A 4HLDA 2HT1A 1PV4A 4GP7A 1CRPA 5FPYA 1UJ2A 2IXFA 5JWHA 2D2FA 1G16A 2R65A 2E1RA 3IHWA 3WP0A 4L16A 1CU1A 4TLAA 1A7JA 1UBGA 4MRPA 3UATA 3VNVA 4B3XA 1NY5A 3I8SA 4IFBA 4NDZA 1ZIPA 1K6MA 1KYIA 3HU1A 1KI1A 4BZQA 2RHMA 1L4YA 1Y3AA 4YXWA 1KTVA 1NP6A 2QI9C 5LD2B 4G5OA 4RZUA 2EW1A 3R20A 1KO5A 1DAEA 2DWOA 2BBWA 1AGRA 2V7QD 1XXHB 621PA 1E1QD 1LF0A 2JCSA 4FI3C 4M9QA 4U02A 3IUYA 5AJXA 4Q7KA 2C2HA 5FBLB 2C9YA 2ZJBA 1K8RA 2QZ4A 3OZXA 4FMDF 2J5XA 1YVDA 1XX6A 3ASYA 4KXFB 1ZM7A 1OXTA 1YU9A 1II9A 2FPMA 4JT4A 4DC9A 3BWDD 4DCSA 2QGZA 4XWKA 3QJYA 2F1RA 4RKEA 3GLIA 4Z8YA 4UXIA 2QGNA 3LAWA 3ADBA 1EG7A 2IBMA 5CJPA 3EZ9A 5AJZA 2FGJA 1X8LA 5EXXA 1Z22A 4XD7A 4QJ5A 1XCMA 4C2TA 3MMPA 1Z0FA 5J5CA 4A6PA 1XMIA 2BJVA 2VHQA 2ZI5A 2ONJA 4KAXA 2DWPA 1F3OA 4PZYA 1Z6GA 4MGIR 1JAIA 3UG7A 4Q66C 2WSMA 4MGKR 4O0MA 4LJ8A 1P62B 3MWYW 5FBVB 2ZRCA 3OIWA 4ZKDA 1ZAKA 4A4DA 1EWRA 1WCV1 3GJ5A 4JJKA 1KI7A 1UPTA 4B34A 1OIVA 1DTSA 1G3MA 5E4FA 4EPYA 4EPXA 1E1QA 1N3BA 1SXJB 3LW8A 4U00A 3SOPA 3VKWA 3GLFB 3RS7A 1WB9A 2WZQA 4MKFA 2J45A 2J7KA 1OXSC 1ZNZA 1UBFA 1YZUA 2ZAOA 5JRJA 4HZUA 4RD1A 3NHBA 3LDAA 2VP5A 1KI6B 3HDTA 2RHDA 1MH1A 4J0QA 4A0FA 4ZDJA 5H8WA 1G8YA 4XSGA 2CE7A 1Q0UA 2KSQA 1KDRA 1KO4A 4RFSA 1FOEB 3W5IA 4CEHB 3WXMA 4LBWA 4LHYA 5CM9C 4PTLA 3BFKA 3EG5A 3T06B 3GJ6A 4KFRA 2BIFA 1RJ9B 2MMCA 2NPFA 3TVDA 4ASUD 3PEWA 2AXNA 4B3BA 2O8CA 3EARA 1PLJA 3QKUA 3FKQA 4YDHB 5KUTA 3P4XA 2FV8A 3GJ7A 1G7SA 4FXPA 4LGMA 4XOIA 3RRNA 4DLZA 2C9OA 4DUGD 1FNNA 2VF7A 4JMPA 1ZW6A 1ZD1A 5JJLA 2OXRA 2FPLA 2H1LA 1ZCAA 4ZIRA 1G6OA 5BN3A 4LRWA 4C0AC 4M1TA 2P2LA 3BRWD 1E9AA 4ZKEA 1CJMA 1UAAA 1R7RA 2ZPTX 1CXZA 4Z1MD 3U7HB 2O8EB 3EZFA 5CB8A 5DN6D 3B6EA 4BZPA 1ZBDA 5AR1A 4B33A 1XTKA 2OBLA 1EWQA 2NQ2C 1EK0A 3V00A 2BWJA 1KGDA 3E5HA 4LOAA 4MRRA 2OEPA 2ZJOA 3T1OA 2EFCB 4A2QA 4KO8A 1G4UR 5CK5A 3I92A 4Q1AA 2RGNC 2ZI7A 4I1VA 4DHEA 5JSZA 1A4RA 1W4RA 5B58C 2WWFA 1CTQA 4ASUA 2HJVA 2AFHE 4KODA 3A1VA 4NYIR 5L8VA 3LX5A 4EJSB 1VHLA 4CGZA 2D74A 2ZI9A 1VDZA 2VSXA 4DUGA 2F43A 2HJGA 1JB1A 2KBEA 5GADl 2WHXA 4IDPA 2XGJA 2W0MA 2FEMA 4DSUA 4PHGA 1TTTA 4BWYA 4JLOA 1ZIOA 4B32A 1TUIA 4XWOA 2NO1A 3OE7D 4QM7A 3DMNA 4KHZA 1IXZA 3D31A 2ECKA 4Z1MA 1CP2A 1W44A 3UMRA 4M53A 1WE2A 3QKTA 2ZR9A 3HR7A 3REGA 4Q4AA 3RS2A 1PVOA 4LYAA 4C9BA 4JKIA 2IC5A 2XTMA 4CEJA 5CIQA 5DN6A 4LV5B 4C7OB 4TLCA 2VO1A 2ATVA 4TMXA 1G291 3I5YA 3B7GA 3RYTC 5LD2C 1FNMA 4B35A 1US8B 3B85A 4Q4LA 1KO7A 1VMAA 3CLVA 4A8JA 4NYJR 2GJ8A 4PSAA 2CCKA 5DI9A 1CKEA 2FH5B 2QL6A 4WZAE 4IFEA 2XITA 3K1JA 3GJ8A 1QHIA 1FTNA 2R6GA 3N2IA 3NC0C 3RC8A 2OFWA 4OHZA 4B75A 4B2LA 3H2YA 3KJGA 3A1UA 4HLCA 3TUIC 4BFWA 3KTAA 4LY6A 2CDNA 3CUEF 1JECA 3I1FA 1XJ0A 2GXUA 4BFXA 3THWA 2AKYA 1AA9A 1KSJA 2VP9A 4TTQA 3IO5A 4YC7A 2AR7A 4EAQA 1ZRHA 3ZD6A 2GBLC 4L8GA 3AF2A 1QBKC 1XD8A 2RGXA 3CRMA 4FMCB 5FPSA 3TK1A 5F2EA 1XJQA 3IBGA 4OQFA 4YMWA 3K70D 4NCKA 1IONA 2WKQA 2D7DA 4OYHA 1ELOA 3OE7A 1FMJA 2ZR7A 3EZ7A 2C5LA 3VKGA 1FL9A 3OEHD 4ZCLA 4WVFA 4JVNA 4QM6A 4NH0A 1S9HA 1NVUQ 2W00A 3ND8A 3PUYA 3Q3JB 3VHXA 4EFLA 2CNWA 4BFVA 4FCWA 2FSFA 4BASA 1J99A 4Q02A 2GHIA 3PENA 3D8BA 5EQTA 3NH9A 5KPJA 4BLPA 2QTVB 1Q1QA 1W4AA 1MO4A 1EFCA 3P32A 2H57A 4LJ6A 1OFIA 3TIFA 2R6CA 5A0FA 2G9NA 1SVIA 4PPQA 3F0TA 1IY2A 1FUKA 1Q12A 2RAPA 2GJ9A 2QMHA 2FFQA 1CRQA 3HJNA 5CK4A 5DLQC 5GVSA 4AYXA 3K9NA 1CJKC 5EUQB 2C99A 4CEIB 1H8HD 2O8DB 1EFRD 3B1VA 1Z6TA 1P2VA 3LO5A 2ZSBA 4HAZA 1XEXA 5L3SB 1GDDA 5L3QA 5AJWA 2ZE5A 5SZIA 1J2JA 5K8IA 4B76A 3FE2A 4NMMA 5D3QA 2IYSA 4KYIB 4FMCF 3LVRE 3MD0A 4OJQA 4TMZA 3MWLA 2FF7A 3ZZUA 3R7WB 2YNMA 3CZQA 1XDBA 3M4YA 4Q1DA 3EZ6A 4PC1A 2AL7A 1VPLA 2CL0X 3LQQA 3OEHA 4B47A 4TLBA 2I1QA 4DEYA 3IQWA 1N6HA 3WMFA 1Z8FA 3BOSA 3FMFA 4IEEA 1XEWX 2HCJB 4B6FA 4K8OA 3CRVA 5HCIA 4V0KA 4A1FA 1OB2A 2K5UA 3NHAA 4HAUA 4MGZR 3I61A 4R7ZA 4MYUA 5AUQA 2RGDA 4OL0A 4XTRA 5FBWB 1ZD8A 4G0NA 1SZPA 2O8BA 2FE4A 4V0LA 1IQPA 2QROA 1NI3A 1MKYA 4IKEA 4NCJA 1GKIA 3RWOA 4PSKA 4YMTA 2PEYA 1IN6A 2ZJYA 4JLDA 3QPWA 2IYXA 3P20A 2B92A 3W9YA 3AF3A 2R62A 4OQMA 5SZHB 5HKKD 1EFRA 3AKYA 4KBFA 2AWOA 4YONB 4BRWA 1KJWA 2AFIE 1KOFA 1U94A 1E2NA 3OESA 1U98A 1E2LA 1R5OA 2ZUCA 3PR1A 3QBVA 4LSGA 1XBTA 3EA0A 2EVWX 3U7EB 1EXMA 3EPKA 1U9IC 2O0KA 2CHQA 4IRUB 3GLHB 1XCGB 3OF5A 3ICQB 4E07A 1HT2E 3ZIAD 3THXA 3QKSA 1G9XA 4IOMA 2FFAA 3BD9A 4PZZA 4EJSC 1X8KA 2DHRA 3LXRA 1F48A 1OYWA 1EFTA 1NNEA 2MSDB 4MDEA 1TQ6A 1Q57A 3KKQA 3NH6A 4IVPA 2ZEJA 2IYLD 4DWJA 3NBFA 3QKRB 4QBHA 1OSNA 5FL7D 3FTQA 3U3KA 2YWEA 3THYA 1TUEA 3NKVA 4GT1A 4M1KA 3K0FB 4HUQA 2XXAA 1JALA 1XMSA 2OAP1 5IDVA 121PA 2QBYB 1L2TA 2IYQA 5IRCD 4D82A 1VG1A 1P7CA 1O87A 1XP8A 2IYWA 3C5CA 4PAMA 4B73A 2X2EA 1PJRA 1HA3A 4MGYR 5K8LA 3X1ZA 4C2UA 2ZSDA 2OFOA 1G64A 3E2IA 4LJ9A 4RZ2A 5HE9A 5HKKA 3NEYA 4XJXA 2KI5A 1R0XA 5EE1A 3ND9A 4NHOA 5ELXA 5G3ZA 3K0AB 4CF7A 3HYRA 5KHOC 3X1WA 2WJVA 5FUVA 3B2EA 1CJUC 1A82A 1CBUA 5FOTA 2QN6A 3CNNA 3HPQA 3VAAA 4BFSA 1GL6A 2NOAA 3U2QA 3GLHA 5TXGA 1AZSC 3CRQA 4DDVA 5KDOA 5K8UA 3U61B 3WNDA 1I2MA 3SJZA 1RRFA 1U0HC 2A5FA 1PZNA 3G82C 4AIIA 2FU5C 2ZRAA 4L4UA 1W47A 1BOFA 2GESA 1E79D 5DHFA 1WA5A 5H70A 3G0HA 4NKRA 4JZKA 1Z3IX 5FL7A 2CMKA 2X19A 3CKLA 1ZYUA 1YZQA 2ZJZA 3PCRB 2ZU6A 4QOSA 1KO1A 1Z47A 2BKEA 3ZH9B 3I4LA 3LW7A 3CRRA 4TQUS 3A1WA 4OI0A 3K9HA 4LBVA 1QRAA 4W7SA 821PA 2WVJA 1E0KA 4CT5A 4MYHA 4RD3A 1PUJA 3W5JA 1ZM9A 3N2EA 1TQ2A 3VQTA 3OFND 1QHYA 4Q19A 3WHLA 4A0HA 1OT3A 1R10A 3MG9A 2ZTSA 3SR0A 2QMOA 4BLTA 4PO8A 2H92A 3AH8A 2PZFA 1T8UA 2UKDA 1ZMXA 1Q1EA 3LV8A 3VTKA 4WXPA 4A0RA 4ITRC 1YR6A 4N3NA 2BC9A 2BCJQ 1W0KD 2O52A 3W90A 1NIJA 2B21A 1QG4A 2H7VA 4PPGA 2XTZA 3GFTA 2JJ1A 3T34A 3BH6A 3GFPA 5KDDA 1XB2A 4RD6A 3TSZA 4ZCMA 4KVGA 4BFUA 1IHUA 1E79A 5LBIA 4IXMA 2ERYA 4BQSA 4O2LA 2P67A 1LV7A 3QSYA 3BC1A 1VHTA 3B9QA 4TSFD 2FA9A 1VCOA 1CULC 5CB6A 3MUFA 2O8FB 2ZETA 4I4LA 4DCNA 4RJLA 1XJCA 5G3YA 3O8CA 1IJFA 3P1JA 4RKFA 2CK3A 3F3YA 2OFXA 4NE2A 4EPVA 2C96A 2VTKA 3ZQ6A 5AJVB 4C0LA 3TAHA 4CW7A 2JJ8A 1S1CA 1DG3A 2GEDA 4HEJA 1JR6A 4DCVA 1E2JA 1WQ1R 4KLNA 1DAFA 4JS0A 1GFIA 1X8JA 3V4RA 2ZRDA 4B48A 5A5GA 3R9WA 1C4OA 4G5SA 4W5WA 1E2EA 1KDPA 2VEDA 4M0LA 3MRSA 5FTNA 3TLXA 2RGBA 4F4JA 1LB1B 2FOLA 2Q9BA 5FH9A 4EPWA 3SHFA 2Q3HA 1N5JA 3PEYA 5JBQA 4PHHA 3T5DA 1MO5A 2GZDA 1E9SA 2ZI4A 1W0KA 3DKPA 4PC3A 3L0IB 3CH5A 5TV2A 3WRYC 2B7BA 4ZDIA 4TL9A 2GKSA 4GMXA 1SVOA 2NZJA 4TMKA 4OHXA 3UIEA 3PUZA 1KZ7B 1SQ5A 3MWKA 3SNHA 2C9CA 1XFAA 2WWXA 1NLYA 4TSFA 2N46A 3V4FA 5AJYA 2WJIA 1U8ZA 2OLJA 5DI3A 2BHRA 4ARZB 1UDXA 2AX4A 2PCJA 3RAPR 2P3SA 2CE2X 4C0HA 2GXQA 2YC4C 5P21A 3NBYC 3W6OA 4PX9A 4V0OA 3CZPA 2GTPA 1XTQA 1MABA 1HH4A 1GWNA 2D06A 4CT4B 3KQHA 4JIMA 4P4UA 4FIDA 1QG2A 2HF8A 1AKEA 2UZ3A 4JLJA 1WRBA 3OIUA 4QBGB 2JLYA 1X1SA 4R2HA 3WMEA 2GAOA 1UADA 3QF4B 1Q1BA 4A6XA 2Z4RA 1S8FA 2KWIA 4KITB 3U4QA 3NXSA 1XXHE 2D3WA 1D8TA 4MRNA 3MGCA 2RGEA 2YV5A 2N42A 3IO3A 3T5GA 1KI8A 2ZSFA 4RD2A 3IIMA 3ZZTA 3A8TA 4UNQA 1E94E 3BFXA 1G5TA 4A82A 4YQFA 2IT1A 1TEXA 4ZI2A 4AURA 4OQLA 3JVVA 4Z51A 1R8SA 2YOHA 3CR8A 3MFYA 3PITA 1ZP6A 4Z54A 2GETA 1HE8B 3T35A 1R5NA 2IWHA 3CW2A 2W6JD 5H68A 3ZVRA 1FMLA 1QHSA 3FMPB 1E96A 2WPDD 3ZVLA 2EFEB 1G8FA 3LNCA 2GCOA 4QGAA 2F6RA 4A2PA 1T6NA 2VA8A 4ACBA 1H8ED 3K09C 1VKJA 2Z6VA 2ZRBA 1R4AA 4WW0A 1BS1A 2J0UA 4D4KA 5JI2E 3GMTA 2IS6A 4QRHA 4HAVA 1P9RA 4RZ3A 3AEZA 2ZR0A 4QBFA 2ZRKA 1G41A 5LB4A 2JLWA 1GKYA 1RW4A 1KIMA 1ZNXA 1X86B 1W4BA 3A6PC 1Z63A 1A5TA 2DY1A 3SQWA 2ZVPX 4QJ3A 1X3SA 3VU9A 2A78A 5CYPA 1OPXA 2G3YA 3AUXA 1KMHB 3UK6A 3ADDA 1SXJE 2WBLC 3GLFE 3ZGXA 3A4LA 3Q72A 2IXEA 2WJGA 2HV8A 4LV8B 4Q7LA 1GM5A 2GVZC 2DFTA 2PJZA 3SN6A 5B30A 4PXAA 3CB4A 3IEVA 2ZS7A 5KSYA 1Z0AA 4BLRA 3RLFA 1DO2A 4P4SA 3OEED 3A4MA 3CWZA 3PEVA 4IVRA 4MUBA 1IM2A 1II8B 3AB3A 1E9RA 1E98A 2W6JA 4M1SA 2XTNA 3FPAA 1AK2A 3K0EA 4XIGS 3B1XA 3OIVA 3TAUA 2WPDA 4Q4HB 2GDJA 5EP4A 2ZREA 4FCVA 3SEAA 1NN0A 3TH5A 2PLRA 1N6NA 3GLGB 2ZUDA 5EZ6B 2IS2A 2BKUA 4MUAA 2RGNA 3K9LA 1H8EA 2QG6A 1MR3F 3JZMA 2QP4A 2YHSA 1EGAA 4QGFA 4JKYA 5BQ5A 2PMDA 2PX0A 1HYQA 1N0UA 2GZHA 4G5QA 2IHYA 2WWWA 2PT7A 2QSYA 2PJRA 2P5TB 3F5FA 4US1R 3SJAA 3M0EA 2JGNA 4GFDA 1D2EA 4GDFA 3FFAA 3U6BA 2C04A 1LNZA 2DFKB 4LK2A 2IS4A 3K8YA 1I4DD 3ZVNA 1KY3A 221PA 3V9PA 2BMFA 2WMNB 3H1TA 2XJ9A 4MRVA 4X8HA 3DPUA 2BM0A 3DMDA 2DBYA 3I73A 1DAGA 5AUOB 1VECA 3H0KA 2P6RA 3LXXA 2C95A 4EPRA 3EWSA 1QHXA 3KB2A 1TF2A 3OEEA 1F2UB 1FP6A 2TMKA 1QF9A 4Z8XA 3PEUA 1WP9A 3FWYA 2IA5A 3VR4A 4DDTA 5IF9A 2G6BA 1RC8A 1N5LA 4D4LA 1XXHA 1G7CA 3RWMB 5JMTA 2NMVA 1SXJD 3KFXA 3AVTA 3AV0B 3PJRA 1GVNB 2IYVA 1KNQA 2CHVA 1VIAA 3OAAD 5FPTA 4YMSA 1PLKA 3BB4A 4LBYA 3Q8XB 1OLOA 4LPSA 1V43A 4K46A 3C16C 4OBEA 3L2OB 4OI2A 2F1JA 3IQXA 1T5LA 4LHXA 3UWOA 3B1WA 2GBLA 5AUNB 2ORIA 2ZAMA 4RCYA 3ZDQA 2G0TA 2F1IA 1RRGA 3RRZA 2W83A 2V1UA 1HTWA 3TRFA 4GI7A 4ESVA 3KQUA 1XTRA 2E87A 2V6JA 3CWQA 1NKTA 4HLQB 5DYIA 3UMFA 3WY9A 4ZI3A 3GPLA 2G0NA 3LLUA 1JAHA 2A5JA 3CX7A 3JVUA 1NY6A 1P9NA 2BVNA 2AK2A 2NZ8A 4DLYA 1HUQA 2VSOA 3KKPA 4IJMA 2GXSA 1YZKA 2C77A 1SXJA 5FTJA 4NYMR 3GLFA 4Q03A 3ZVMA 3EC2A 3A1SA 5KNCA 2J0SA 4DCTA 1Y63A 3M1IA 2XX3A 3LRPA 4Y0AA 2HXYA 2NG1A 3OAAA 3VKHA 2QPAA 2UZIR 2A9KA 4A36A 5AUPB 3ETLA 3L8YA 1BMFD 1J8MF 1KI6A 2W6ID 2W2VA 1Z28A 5FPKA 1MO3A 4LJ7A 5HTKA 2AHOA 1S0UA 2ORVA 3L82B 1G8HA 1KKLA 4CEHA 3W8NA 1CF4A 1IXRC 5IHPA 4FW9A 4ESHA 5A4JA 1NKSA 2OV2A 4BUJA 4WA7A 5FFMA 2H16A 1RJ9A 2CEAA 1YZGA 4UNPA 4PFSA 4POAA 1LTQA 1PLLA 5DYGA 3EX7C 2ORWA 3U44B 1W0JD 2A2ZA 4IOKA 3ZZ0A 3SYNA 1U8YA 2EFGA 4IW3B 1ESNA 1ZD9A 3QEJA 1E0SA 1HY3A 4Q18A 4KSCA 5KOYA 2YJTD 3A36A 2NO6A 5C2JB 2C78A 3FMIA 4HAYA 1X6VA 2F55A 3QENA 3L43A 1BYUA 5CYOA 4BLQA 3AKDA 2ZQ5A 3NTUA 3I32A 2A7QA 1Z6AA 4E09A 4HB2A 3SE0A 4LHVA 1SKYB 3WHKA 1FQJA 2CNWD 2O8EA 2V8OA 2R6FA 1W5SA 1NN1A 3TMKA 4PQYA 2OBNA 2VHJA 3W3AA 4FWIB 4LZZA 4HLUC 1VIYA 1WXQA 1GIAA 4NYJQ 1AGPA 3TE6A 1GL9B 3C4JA 4IHQA 4PSVA 3U3JA 2N1BA 3LD9A 3KQKA 2QSZA 3BK7A 1BMFA 3Q9LA 1Q20A 2FSGA 1M34E 2DYKA 2W6IA 1XZPA 4PAQA 1T4GA 4XTCS 4TT3D 3BJIC 4FWTA 1R0ZA 3EIEA 2RH5A 1JQJC 3CNLA 4UNNA 1U9IA 2NO0A 1RYFA 4OK5A 4JLPA 4F7WA 1SVSA 2YVUA 4DT1B 3GJ4A 1TAGA 4EJSA 1W0JA 2GZAA 2WSSD 3SC3A 4JYBA 2Z5FA 2X77A 4X8LA 3KQLA 1QHGA 2GA8A 4NCNA 1JXOA 1N5IA 1G4AE 3EA5A 1GAJA 4P3YA 1R0YA 5FI1B 1XPRA 1RFLA 2HYDA 2QA5A 3ZS9A 3TKLA 2QAGB 3SU8A 4DLRA 1OE0A 1NJFA 5FOVA 5JHGB 2QM8A 4Q1CA 4D26A 3LLMA 2ZI3A 3H84A 1KSGA 1HURA 5GJVC 3TSWA 1EESA 2F1HA 3AGQA 4NL4H 4C7OA 2FJUA 2OSBA 3KL4A 5JEDA 1ZNWA 1D2MA 3DVLA 4EPTA 1UBEA 2GAAA 2J9RA 1Z2AA 1NMXA 2QMEA 4QKQA 1Q1ZA 2B6HA 1US8A 2JATA 1KK0A 2IL1A 3QXSA 3QXCA 3SDZA 4DKXA 1M7HA 2LWIA 1P75A 2VIIA 1W36B 1W2GA 2ZYWX 1W1WA 1P3JA 4PR0A 4RVCA 2GEUA 1T3HA 2BJWA 2JLSA 4HB3A 4TT3A 5FTKA 3UKDA 3C14C 4D81A 2CHGA 3GLHE 1VTKA 5CITA 2QMUA 1LY1A 1C1YA 1E0JA 2SHKA 3BS4A 1XTSA 2AD1A 4UNRA 1R0WA 4QNRA 2J87A 1KAOA 2OZEA 3CONA 2Z4SA 4D2IA 2WSSA 5J4HA 3SS8A 3HR8A 2OCAA 1HEIA 1MO6A 4I1OA 4PC7A 1N6PA 2LCFA 2VP6A 4WBSA 2CLCX 2WJHA 1AN0A 5CIWA 5EP3A 4QHTA 1T3LA 4BZXA 4HAXA 1NSFA 1BIFA 1KNXA 4JBXA 4NCHA 4Q00A 4UXJA 3FB4A 2FMXA 1F2TB 1E9DA 1N6LA 4DLVA 5G53C 3EPJA 4TYWA 3C15C 4HATA 5BN5A 2V1XA 2PCLA 4U5XA 2J0QA 2WWGA 3B60A 2YOGA 2NIPA 5JCZA 2YKGA 3HPRA 3ICEA 4JVSB 3EAQA 2Z83A 1XTIA 1Z5ZA 3EIQA 3PQCA 4H1VA 1UKEA 2R2AA 1OJLA 1DPFA 4IEIA 2CL7X 1E2QA 3BERA 2QPOA 3AKEA 3KXLA 4W9MC 1XZQA 4Q9HA 1U0LA 2ZJ2A 3O8DA 1OH7A 3VNUA 4O3MA 4TL6A 4ON9A 421PA 4URVR 4UQOA 2BBSA 1ZINA 5JHHB 1OXUA 1LS6A 1E2GA 1N6OA 3A37A 3BBPA 2ASEA 1G17A 2I1VB 3F8TA 4DSOA 2PBRA 3S1AB 3I3SR 3T1VA 3WMGA 1IAQA 5DE3A 4TMTA 4B6EA 4CEIA 3DOEA 2O8DA 1JXMA 5CLQA 4DLWA 3AVYA 3VX3A 3LFUA 4OK3A 2IW3A 5L3SA 3LH5A 1E9BA 1FQKA 4GOJA 3B13B 2OE2A 5BWMA 3BGWA 3KJIA 1YKSA 2XZOA 4AKGA 3IGFA 3Q85A 5B57C 2WWHA 4LJ5A 2QE7D 4DLUA 1CS4C 4GZMA 3R7WA 1UF9A 2PMKA 3HWSA 5D3MB 5EJEA 3RDPA 3KJEA 1I4LD 1G3IA 4IXNA 1BO6A 1TNDA 2REBA 4B74A 1R8QA 5KSOA 1XF9A 3D6TB 4Q1EA 4RFVA 2JAQA 2GILA 1Z2CA 5BXQC 1JPNA 1VG9B 3EPLA 1P2SA 1OFUX 1Z0JA 5HZHA 1P73A 4EDHA 2DR3A 3EIHA 4RSGA 4GP6A 5C46F 2BMEA 1NMZA 2AD5A 3DDCA 3KXIA 1E1RD 3CIOA 4QXAA 4C3ZA 4QGGA 2F9MA 1VG8A 1W4CA 1ZUNB 2CLDX 3CRW1 4EKDA 1U8AA 5E7MA 4YMVA 1YZLA 1SVMA 2D2EA 3C5HA 2OCPA 4TYNA 1C9KA 3PXGA 2FSHA 2A5YB 2HLDD 3Q7PA 5KSPA 1UEJA 5JJKA 1M7BA 1VCNA 1RE0A 3CM0A 2ZXUA 5F98A 2FZLA 1YRBA 5GVRA 4D25A 4B43A 2CJWB 1KO8A 2Q9AA 2ZRGA 3RABA 2WJJA 5C18A 1LF5A 5DGXA 2H8KA 4M1YA 5EP1A 2QORA 4EQ6B 5JS8A 1E3MA 4NP6A 1E2PA 2QE7A 2QENA 1JEDA 4LC0A 1D9XA 4UNSA 3SQXA 2KJQA 1XD2B 2QP9X 2JJ1D 4KV9A 1D5CA 1JNYA 3AVOA 1FX0B 4IOJA 3AF1A 4GBMA 4H1UA 2JASA 2QT0A 3RSLA 1SVWA 4WZBE 1EFUA 1OIXA 1T3SA 3MJHA 4WXRA 2VLIA 2R9VA 4D4MA 4UKDA 3ZLJA 5TVKA 3C41J 2EFDB 2WTUA 4LUCA 5UKDA 2QAGC 4GSYA 3QKRA 1YE8A 2Y8EA 3K0FA 1E1RA 5CJ2A 5BYJA 3IHLA 4XWAA 2CK3D 3Q5DA 4HB0A 1OFHA 3VX4A 4XVUA 1FW6A 2QBYA 1GNQA 2WKRA 3RC3A 2Q3MA 3FOZA 1W2HA 4UXHA 3VR2A 4DZZA 2IK8A 2QY9A 4AG5A 5HPYB 1U0JA 3K70C 2LKCA 4G01B 1NN3A 4JYCA 1GKUB 4Q4JB 2HLDA 2CL6X 2JA1A 3Q7QA 2BBTA 2G83A 3MSXA 4HDCA 3EZ2A 2YWFA 2KE5A 1W7AA 3K0AA 2RGGA 1N6IA 4Q9JA 721PA 4QGHA 1W36C 1OHHD 3B9PA 4FINA 4F91B 3TQFA 5DO9A 2OCBA 3RS5A 2ZM5A 1CR0A 3SJCA 4F4CA 3ECCA 2OCYC 2IS1A 1QHHB 4QBIA 4LHZA 3CPEA 4L9WA 5AWFC 3WYGA 1NVVR 1Z0IA 3TQCA 1NIPA 2GWHA 3L0OA 1CIPA 2FEOA 2RB4A 1RKBA 3W6NA 4B2IA 2OG2A 1G18A 4PPNA 3K09A 5GJBA 1K5GA 4TYQA 4X8MA 3SBDA 2FX3A 5F9FA 5EZ5A 5JCPA 2P5SA 3WYAA 1O3YA 3O8BA 1W46A 1GTVA 1G8PA 3GQBA 4DIEA 2A30A 4KFTA 1VYTA 3CX6A 5FOUA 2A5GA 2OM2A 1ZC4A 4DDWA 2YWGA 1W5TA 1E2MA 2QQ0A 3DZ8A 521PA 5DISB 4W5HA 1D9ZA 2ZJ8A 4JVLA 1IBRA 3J81k 1HV8A 4EFNA 1OXVA 2QAJA 3QI2A 1JPJA 1H65A 2ODEA 4IDQA 1D2NA 1EFHA 2GJAA 4LX0A 1QDEA 1S3GA 4LWZA 2JLZA 4BGDA 1NMYA 1KSHA 1P72A 2C03A 1OHHA 1T0HB 4LDJA 4KYUA 5LDDC 5EE3A 3TUJC 3QBTA 4PC6A 1ZM4A 3UG6A 4II7A 3PUXA 3I5XA 2ZYVX 3QOFA 4KVAA 2XEXA 2VBCA 3KKOA 5KDLA 3SZRA 2Q0HA 1OH8A 3AF0A 3FFBA 3KUCA 3ZD7A 3KQNA 3E1SA 4AC9A 4HAWA 3AVUA 1OYYA 4AKEA 2HCBA 2HDNB 2EWVA 4JLKA 1CJVC 4DIDA 2RMKA 1WMSA 1GRRA 3RNLA 3RS4A 2JDID 3FYHA 2EYQA 2YINC 4A2WA 3NBXX 1G1MA 1AZTA 2O8FA 2VH5R 2HT6A 5JWRA 1KDOA 4MITA 3GJ3A 1V5WA 1N6RA 2P6UA 2V54A 4M1MA 4U7DA 2L0XA 1HQCA 1KZGB 3N5CA 1Q44A 1AS3A 4G5GA 5J4YA 1KJYA 1DBSA 2GNOA 3AUYA 5LPNA 2XZLA 2ZIAA 1NLZA 2ODBA 1VCMA 4PZLA 4Q47A 1DADA 4QJ4A 4L15A 2MSEB 1A2BA 2OT3B 1KDTA 4QFMA 3RRMA 3TW4A 1S2MA 4OQNA 1ZC3A 1RRPA 3VR3A 3KDSE 1XU4A 2P6NA 1XMVA 2OAQ1 2WIAA 5FUWA 5J4LA 1MRNA 1L7VC 5BN4A 1L8QA 2VHCA 3KJHA 3QPVA 3I62A 4HSEA 5FTMA 1A2KC 1LS1A 1XPOA 1TU4A 1UFQA 1TQ4A 4RY2A 3LWNA 4OHWA 4ACAA 4TYYA 1E9CA 3KB1A 1KK3A 2QPTA 3FDIA 3X1DA 1ZU5A 1UEIA 1NJGA 4FD2A 4OK6A 4UJ3A 4H9GA 3ONWA 4OI1A 2HYIC 3EW9A 3QXHA 1F6BA 3VHLB 1UKYA 4E5UA 1J8YF 3NIBA 6Q21A 2YOFA 2F7SA 1QZXA 3D7MA 2JDIA 1ANKA 1Z0KA 2ZVQX 2ZROA 2BEJA 1P60A 2DCUA 1DVRA 5B64A 5KNBA 2ZI6A 4O2RA 1G5PA 4ARZA 2ZUBA 2WOOA 4N0EA 5TDHA 1G5RA 3GEEA 1CR4A 2HF9A 3QUSA 4D80A 4FN5A 4PC2A 3IEUA 3KZ1E 3WRXC 1G3RA 2WV9A 3QQ5A 1S96A 2J7PD 3LVQE 4V0NA 5GJWC 4K81B 1KK1A 3X2SA 1WBDA 1G3UA 1Z83A 2JLVA 2H5EA 2GJKA 4EIWA 3GEIA 3WNCA 1GP2A 3U3RA 1JR3E 2IF2A 4M4SA 4R9UC 1B0UA 3QF4A 3EWAA 4OKSA 5ANRB 1DARA 1P9WA 2FFBA 3GLIB 1TPZA 1LVGA 4M8NE 4Q5IA 3IILA 4URWR 1OFTA 4Q7JB 2VL7A 4BECA 5J4VA 3BXZA 4JSYA 1P2TA 5FR2A 3SFVA 1YR7A 1DE0A 4ZDKA 3CF0A 2IEZA 1COWA 1YRAA 4M9ZA 4O25A 4URYR 3PV0A 4DLXA 2D7CA 3M6AA 3KX2A 3VR1A 1M74A 3AM1A 3NDPA 2G77B 4IVQA 4TMVA 1ZU4A 4AD8A 3B5JA 1JJ7A 3GEHA 5G40A 4CIDA 3CPHA 2ZRMA 4I1SA 4LJ4A 1GZSA 3K0CC 2GEVA 3KKMA 1OF1A 1UKVY 1Q3TA 3AGPA 1E69A 1SHKA 2F9LA 5DSZA 4YMUA 4JJZA 4CZ2A 2J7PA 2IXGA 4C4PA 1P61B 4URZR 2BEKA 1NSTA 1G3QA 2A5DA 2ODWA 3MJRA 2X2FA 1ZCBA 1HE1C 2GK6A 2WJYA 1AIPA 2OLKA 2G1JA 2H18A 2J0VA 3T61A 2GJSA 2ZE8A 1VYUA 3U3OA 1E2KA 2QTFA 4V0ME 5J47A 4HZUB 3RS3A 3VR6A 2QQEA 2X1VA 2OXCA 4L5BA 1N2CE 4PHTA 2GVDC 3LY5A 4AY2A 1KMHA 4JL8A 1OXXK 4RFSB 4DCUA 1GNRA 4MKHA 3IDQA 2MMGA 4CDGA 1DG1G 5C4MA 5E7IA 5FL3A 5TB5A 3SBEA 4DLTA 1MV5A 2C98A 2O8CB 1G6HA 4HLUA 4LHWA 2ZRFA 4AG6A 2JEOA 1JR3D 2F3TA 4BE7B 2H17A 2MSCB 4RD4A 5KU1A 5FR1A 3MWJA 1II8A 1IY0A 2O0JA 2O5VA 4ZIRB 4DB4A 2FG5A 4Q4HA 2P0EA 3GLGA 3LX8A 2CVHA 3NWJA 2IX3A 3U60B 1J7KA 2BBOA 4N0DA 3TUZC 1KSFX 3WNBA 4LYHA 3WP1B 4LI0A 1R2QA 1VG0B 1XEWY 2EYUA 2R44A 2V7QA 1XCPA 1E2HA 2IYRA 4LJAA 2J1LA 3ZJYA 1DAMA 3QIAA 2QRZA 1W49A 3AVXA 4TQ9A 4TZ6A 2XJ4A 1TF7A 1DS6A 4HDQB 1L4UA 4JLMA 3QEOA 2IF0A 1SGWA 4UJ5A 1ESMA 2ZYTX 4E22A 1YJ5A 2FWRA 2RKOA 1SKYE 2WKPA 3DM9B 2XSZD 3BIFA 2XNSA 2IEYA 4M9SA 1N25A 2GXAA 5CM8B 5IK2D 5J4KA 4F92B 2QU8A 4GOKA 5JSZB 3SYLA 1XMJA 1P6XA 2Q6TA 1AS0A 2O0HA 1GG2A 1NRJB 2OBMA 1JBKA 1JR3A 2ANBA 2F43B 1NL3A 2CLSA 4IDOA 4C0JA 1F2UA 3AVVA 4HB4A 2NPIA 3RHFA 5AK0A 2IUTA 1Z07A 4JLAA 4NYMQ 1TEVA 3CO5A 1FZQA 1GSIA 1CR2A 4ILEA 4PHFA 4Q7MB 4IDNA 4BLSA 3TNFA 4BEJA 1Z06A 3ADCA 2ZSAA 2GRJA 3ZQJA 1YR8A 2DB3A 4OJKA 4NZYA 4MYCA 2NGRA 4XH9B 2QP3A 4Q4AB 3KXKA 4QHYA 4LYJA 4TN1A 3RVBA 5TARA 4CEJB 3DO6A 3MCAA 2E9SA 2FGKA 2FN4A 3U3MA 4DRZA 1RRCA 1BYIA 1ONBA 4HYYA 4NYIQ 4WAUA
chains in the Genus database with same CATH superfamily
4LRSB 3SHOA 2Q99A 2GCPA 2ONKA 4CIBA 3S81A 2BN4A 5B4TA 2KBFA 1KIFA 2C7VA 3EF3A 4FT2A 4F9FA 3OCXA 1C0PA 3IIJA 4R3NA 4E5NA 1KS9A 2R6AA 4W5OA 1KEUA 1BFDA 4I1YA 3GGOA 2Q27A 2VYCA 4K9PA 4KQJA 2P69A 4DN6A 1L5MA 1IHDA 1OWPA 3O47A 4EYOA 3DF7A 1F9EA 4GNKA 3LVBA 5IK2A 3V8PA 4YAIA 3UT0A 2RB5A 2Z6QA 1NG9A 3AF4A 4PRZA 5DCWA 5H4HA 4P4NA 1PO7A 3KEFA 4IIDA 2FOXA 1JHVA 1IN4A 1KH2A 3O75A 3THWB 3R6LA 4IF6A 5JE8A 3PIIA 1UKAA 2WM9B 1VJ5A 4J0KA 5EJ6A 3T5MA 1E5XA 1QGUA 2A0UA 1TL7C 4KE8A 5HBGA 1G20E 5CA1A 2MOKA 3BH0A 5DSXA 1N2CA 3KFVA 1E32A 3DAOA 3RANA 2QDKA 1L1EA 1HPLA 4PRYA 4CCAA 5JRZA 2VXOA 1KI4A 2NNWB 1S9DA 2V55B 2GD2A 3X1XA 4DABA 1R88A 2IPMA 3I52A 4IH9A 2WMOB 1ULTA 3OPYB 3I83A 1DMRA 1KEEA 1U8UA 3L6EA 1N0VC 1D8AA 1E9FA 1P91A 4GVLA 1P5JA 4JLBA 3FHCB 1N3LA 3NHYA 2VYVD 5CVDA 4RADA 5B58T 5CXXA 3F90A 3VHXB 3PIRA 2REXB 4M1WA 4MWOA 1EE2A 1Y98A 1V1MB 2HNAA 2J6CA 4U7GA 4QEZA 4D0LB 1CVIA 4JT2A 4I1UA 4EI7A 3FCCA 3D64A 4KSBA 1ADJA 5T6MA 2PR2A 4X6UA 3EQZA 2G88A 4ISBA 3Q3HA 5LIPA 3U5ZB 1L1RA 4NAVA 5L7TA 5DXJA 5D00A 3UPUA 3GLTA 1L8LA 1FS5A 4W1PA 2YWRA 2UXDB 4O63O 1Y5IA 5AHOA 4E2YA 5K4AA 1AG9A 1DBPA 1VKZA 3NWEA 3U44A 1A27A 5IFLA 5JBIA 1CEEA 2BISA 4DJEC 3X1YA 2O6HA 2EKQA 1YQTA 3OQPA 5HP4A 1DSSG 1KYZA 4E51A 1UXKA 4M22A 3MLAA 5C9ZA 1LEHA 5A9SB 1Q21A 3ZU4A 4U9HS 3AW9A 2HEIA 3RVOA 1IDN1 2PAAA 1CR1A 2H1WA 2PWZA 2VFAA 3AYZB 1M8KA 1ZM3A 3NM5A 4EBBA 2RFLA 3EDMA 4HKTA 2C58A 4ARSA 1YBHA 1PG0A 1WUIS 4HWTA 4NQZA 4S2EA 3ZW8A 4ZA2A 3LF2A 2PQ6A 1Y48E 2YJ3A 3C3KA 3GNTA 3GLUA 2I4MA 3EASA 4D7AA 1C7IA 4B3DA 3AJRA 3EOBI 1GEEA 5JS7A 2NUBA 3SSNA 1WF3A 2AFHB 4M1OA 4ML3A 2JLRA 2A3NA 1ML3A 3T3NA 1NLUA 3HH8A 2VYVA 5DHPA 5FO0A 3GPDG 2ZG6A 3O8OA 2XMCA 3JX9A 5BSUA 2RGRA 2AJCA 2CJPA 1MT0A 2ECOA 2FI1A 1FYXA 3A58B 3N2KA 3P45A 4M8IA 4BGIA 1U8CB 1UDBA 5CB4B 1D0VA 1LQ2A 3MLEA 2OCLA 4HFMA 1GA1A 1NE2A 3RC1A 2ZJ6A 4Y2VA 3IXLA 1LV8A 2CXTA 2GFQA 3MEQA 3WMRA 4AKHA 2RHWA 2FCAA 4L50A 2R00A 1KAGA 3D2CA 2YZNA 4QG7A 1HX7A 4FHFA 1IB6A 3FPFA 4DTIA 2HK8A 1OLUA 1PZHA 1UXHA 2ABWA 5FOXA 3VYWA 1AKNA 3NAQA 4CMJA 1JTFA 3DB1A 4R81A 3KV1A 4YRRA 1YZTA 4DEXA 3RB8A 1XNJA 3U4AA 2FRDA 3BSFA 2DZDA 2CDAA 4XEHA 1K63A 3IIKA 3SJUA 1W34A 3CPJB 2Z0MA 5K6AA 4QZVA 1JXQA 4FOOA 2GD1O 2HDWA 2JGFA 3DNMA 3VPFA 3F71A 1QVAA 2OENG 4UCXA 3WL8A 4JJ7A 3OSZA 4BAZA 3VVBA 4KIUA 1G19A 2C3OA 1NVWQ 3LL7A 4KUGA 1XD9A 4P2BA 4YJKA 4ARAA 2D4HA 2ZUTA 3COPA 3S55A 1BDJA 3DVRX 2XA2A 1ABBA 1ES9A 1YHNA 1SQ6A 4OYLA 4AT1A 3MC1A 4F21A 1KHHA 3DUFB 2B1JA 5F9HA 2JLQA 3CIFA 3HO8A 4IDCA 4TL8A 1U5BB 3WGYA 4HZIA 3EBOA 3R44A 4ZZ3A 1HQYE 2FDCA 2FJPA 2EFHB 1JLLA 5ESDA 4FR5A 3O9ZA 3IOYA 4N3CA 1YBAA 3AEYA 3B3GA 3H65A 3HJFA 1PK9A 2OQVA 1AKVA 5IH7A 4QASA 1YIDA 2IHNA 2J46A 2I7DA 3QFHA 1HF3A 1JQLB 3THYB 4WY8A 1PJ4A 3HRHA 2XXAB 5FV7A 5HMMA 1RDFA 1MOZA 1Y3IA 1BW9A 4OGLA 4BRZA 3ONDA 4H35A 1AGNA 2YYZA 3FSJX 5EZYB 1GUFA 5LWQA 1KK2A 5J2TA 1SQFA 4YRBA 3EZLA 1KI2A 4URUR 5DM70 5KYKA 3DLCA 3MXOA 3AP3A 4OLFA 4CVNA 2QUZA 3O8LA 3T12A 4P31A 2WM2A 1PJ8A 2UXBB 2R4QA 2JHFA 1LD3A 1Q84A 2VDJA 4GOXA 2G4CA 1QR6A 3IV9A 1A9ZA 2ZSEA 3AC0A 2P2GA 1BKSB 4Q39A 4BO6A 1FMCA 3D8HA 4C01A 3C1OA 4AK9A 3R9KA 3QA9A 1VPWA 3EXIB 2H63A 1Q50A 2W2PA 4AKIA 5TMPA 3H0CA 3NKFA 4QU9A 4AJKA 5JLJA 4OEHA 1SXPA 2ZRJA 1NQVA 4S35A 2NU6B 1KI3A 2SCUB 3UM9A 3P0RA 2A9VA 2Y9PB 2IIQA 3ZLTA 1DGQA 3OJLA 4N7BA 3KKKA 2QXUA 4IEFB 4AWXA 4IIVA 1KH1A 1ZUIA 3GCGA 2V6IA 3QTLA 2XQJA 4GLBA 1YOBA 3K53A 3W8EA 3LRXA 3UAVA 3JXEA 3OEWA 1V4BA 5KCMA 5EGSA 5FOQA 2P9ZA 5CDFE 4XYGA 3I72A 3N2LA 4S1NA 2CV1A 1HEUA 4OLJA 5EZYF 3T4XA 2CMFA 3ZK7A 2I03A 2EBWA 1P18A 4DJTA 1BHO1 3PQ4A 3QFSA 1GZ5A 1YDMA 3HWRA 2XCRB 3GG2A 4DR7B 5CLJA 3LCUA 4V3BA 1Q7EA 3GEBA 4P5DA 2WE8A 3WBBA 4JXKA 4B44A 2P6OA 5B55A 1ILEA 3JAKB 1M6WA 3ZQUA 3AHGA 3T9EA 3MJDA 2PV0A 4G41A 1ZNYA 3SR3A 1KMIY 3SDBA 3PGXA 4MH0R 4QWMA 2I9PA 3VFDA 2J5RA 1H23A 1GNPA 1YB4A 2V74B 5BVGA 4ME6A 4ARCA 1E7WA 1JHDA 3NJ8A 3NBZC 4PO9A 1OBFO 4FGLA 1DELA 4HG2A 1SN7A 1U2QA 2YW9A 1P9OA 1EWKA 5EAIA 2VA9A 4BKUA 2FFJA 4CTNA 3IUNA 4X61A 3WJAA 1DBRA 2YUTA 3HKCA 4P08A 3E22A 1Y4UA 2GF9A 3IVCA 4I46A 3WIDA 3FR8A 4PX2A 1XYVA 3VSDA 2XRZA 2X76A 1BH6A 1CEXA 1NI4A 1T0JB 1NQWA 1Z4LA 1ZUNA 3LPAA 1Y3DE 4KBGA 4CYMA 1J9EA 1S2DA 1PFVA 4RE6A 2EHJA 4I8DA 2ERXA 2GPTA 4C7KA 2JIBA 2QS9A 3N7TA 1ND5A 3L0CA 1GRQA 2Q1SA 1QIJA 3UMBA 1E9EA 1JKMA 5BYAA 1WPRA 3NX4A 1FTSA 3IOBA 4FLMA 3TX2A 1ZUHA 2DJ5A 3ODGA 4R9SA 4R8VA 2DM6A 3IT1A 2V4ZA 1JIJA 2VVTA 2G71A 2Z3ZA 4Y6RA 1A5BB 2C88A 3BWBA 1M1YE 3GX1A 2BOVA 4AFNA 1K89A 2VS1A 1M2OB 1YR9A 5JYDA 1GGNA 3CE6A 4KREA 5EJ7A 3IEXA 5D5PA 2DT8A 5DN9A 3EXAA 3MMXA 1EX1A 2HNKA 4A9AA 3EYAA 3FVQA 1SKQA 4XLZA 1P17A 2XAUA 3HYTA 1FVOA 1X2BA 2O2HA 3AP1A 1PNTA 3AHJA 3H4MA 4RU1A 5HS6A 4QLBA 1W1UA 3EC1A 2AN1A 2O14A 1WKCA 4MW2A 1LH0A 1AJEA 3D6NB 4EGAA 2AOXA 2P4UA 4II2A 4D45A 2A86A 3BAFA 4Q4DA 2IOHA 1NWHA 2B7CA 2WUDA 4BEWA 3DR3A 1JLRA 3DKRA 2AWNA 1M0WA 3N2GA 4Q16A 4PRLA 3WBKA 5TJHA 5KVVA 4D9GA 5KTYA 1G7RA 4WIAA 1TZMA 5T3UA 5GIOE 4F1KA 4PN3A 1J33A 1W9MA 5IXJA 1CDEA 1O96B 1UWKA 4Q3CA 4FDMA 1V47A 3QNUA 4U7HA 2P75A 1QCCA 3CGWA 3G5UA 2EU8A 1GRNA 3HNPA 2V7WA 3VC7A 3WL3A 2YJGA 4PEVA 4WFIA 4XGIA 5HGXA 4MUNA 4E15A 3IVRA 1ATZA 2V98A 4DSNA 3GJXC 1Y42X 2FQQA 4ZEXA 1L5SA 3B6JA 3USES 4C07A 3LKVA 4MR8B 2JIRA 1ZM2A 4C0KA 3MS2A 1PFUA 2QX6A 1LK5A 2CNKA 2PQ0A 3SIPA 3WICA 2QQGA 3S8YA 1NBAA 1LBQA 1Z7BA 1TU3A 1Z8HA 2CLLB 4R8LA 3LDFA 3C48A 1IQ0A 2EXXA 1MABB 1QM5A 3IBFA 4QWWA 5CDTA 3CW8X 1LSUA 1SVLA 2C2WA 1RLMA 4X0EA 4BNJA 4ZDWA 3UBTA 2JIPA 2YMQA 3IDAA 3H9CA 5JSYA 8ATCA 2H54A 3K0CA 2J07A 5E7JA 2PEZA 3TSOA 4NCXA 4EKGA 2CBZA 1LJUA 3LP5A 2L42A 1K98A 1YDHA 3RIHA 4Q1BA 2O57A 4QARA 3ZS9A 1B16A 1WXDA 4KRXA 2X1MA 4XPZA 3W3ZB 1NM5A 4O4JA 4PG6A 3H5IA 3GOQA 3EQ6A 4GWKA 4NENA 3ZQ4A 4LE0A 1WDMA 3OUUA 4QDJA 2Q5QA 4FI3F 1RPTA 4FYWA 1JB9A 2JRLA 4BFZA 1BVHA 1Z68A 2EF0A 1U2DC 2GK7A 1OW3B 4OXIA 5DT9A 2VJBA 1NXWA 1CQJA 4HN2A 1RJEA 1Z88A 2WTAA 4MV1A 4Z86A 2ZRNA 3U7RA 2C5AA 3TW0A 2A14A 4BBZA 1LFDB 1NUQA 5K2OA 4UZSA 2J3EA 3RADC 1IJEA 2GPWA 2GOYA 2QN3A 3K0BA 1ONOA 4HMOA 4QULA 2H9YA 2VF2A 3HDGA 3E3LA 3ONVA 4CQMA 4W4TA 4S2UA 3PFFA 2XMQA 3T7RA 3HFRA 1UFRA 1XVIA 2YMLA 3FRHA 3AUSA 3F7MA 1NVGA 1EXWA 4G9EA 3OBBA 4X00A 4XVQA 2QTGA 1ITZA 4QECA 1JI3A 3L0PA 3GWGA 4OFXA 3I4CA 3BWVA 1NTOA 2ZZKA 3BREA 4CKEA 4G85A 4DLPA 2VDOB 2WMYA 3S68A 4YYEA 1CUEA 2ZBVA 4RL4A 4XA8A 3T3MB 2NT3A 1I3KA 3HGMA 5JWOA 1SEVA 4BKQA 4RY8A 3L46A 2XQKA 3HBMA 3U56A 1BEEA 2JH9A 4RKQA 4AMGA 2PZGA 4PPFA 5JFGA 1D2GA 2EBHX 1M2KA 2AG6A 1MPXA 3PGMA 3KUXA 1COWD 5IKOA 3T3EA 3UJ8A 3DOOA 5LQMA 2Q1UA 1B23P 3B7PA 2VDLB 3KJZA 1RWNA 3NJ4A 4K26A 2AEFA 5AFSA 4IDGA 2IV7A 4JSTA 1UBNA 3USZA 3LG2A 2G06A 4R1QA 4E2FA 3RK0A 2NVUB 2YVLA 3TXYA 4P0TA 3B6MA 3CURA 1I2DA 4JUIA 5JFOA 2R0QC 3AESB 3DLAA 2C82A 1GUAA 1D7AA 4P4SB 3G02A 4TOIA 3G1TA 1FPMA 1BKDR 1ZGGA 3L4SO 5A2GA 1DCKA 1GILA 1CJTC 1UOOA 3LY7A 3PIDA 1N5MA 2X5XA 3U6KA 2PUEA 1DAHA 3DZDA 5HQ3B 1G38A 2Q3FA 1ISMA 3OZIA 3JQGB 2ZYAA 3EQ2A 3CUWA 3MT0A 1NXVA 2CXRA 1U7HA 2XRYA 3M4ZA 4U1RA 3W6PA 2I6TA 3R7AA 4D5GA 1DJPA 3TZHA 1ZVQA 1TO2E 4G25A 1VHDA 5HCUA 4L78A 5K4HA 5CHEA 5CCDA 3H1EA 5BUCA 1IEWA 4QQKA 5F73A 3T1YB 3G13A 1E1DA 3ESAA 1ZOOA 3R0VA 3RC2A 5JEEA 2OL4A 3P9NA 3GJ0A 4GYKA 5AKHA 4YCAA 3NCTA 2C0CA 1R9NA 3LQYA 2XT9A 5IM5A 2XB4A 4CG1A 1JJVA 2YHIB 2YUIA 5LJLA 3QNMA 5MHTA 3AHIA 1U28C 2WNIA 3FDJA 4NK4A 4ODIA 4FN4A 4QUIA 4XD7D 3FXAA 4YI3A 3TQIA 3U0VA 2HT1A 2EEZA 1PV4A 1ISSA 3OPQA 4GP7A 4G0VA 1CRPA 4L5AA 1ZZEA 2D2FA 2GN8A 1KC1A 5CB0A 1ZXXA 3IHWA 3VTAA 3WHPA 4ID3A 1F1BA 1QFSA 2VBIA 1PD1A 1THGA 3IOEA 5EMJA 3C70A 3SKYA 1A7JA 3I8SA 3PRHA 1FJXA 4BZQA 1YONA 1FFSA 2RHMA 2YVKA 3B2QA 3ZDCA 2YCBA 2QI9C 5T4FA 5LD2B 1P2GA 1JIUA 3ND7A 4KIGA 3R20A 1C4XA 1QIGA 1MOPA 3GGDA 4LTMA 5TQ2A 1QFYA 1CUAA 4TWIA 2DHQA 1HE3A 2BBWA 2HZBA 4RYDA 4EM6A 4C6TB 1PNQA 5H7XA 1C80A 1E1QD 2JCSA 1J0XO 4U0KA 4NJEB 5AJXA 5EMKA 2KHZA 1J2YA 3WIBA 2VJMB 4BUCA 3JQGA 1HLFA 1K8RA 2Z09A 3OC0A 2ACEA 3ASYA 4H7JA 3GVCA 4H60A 4H59A 1ZM7A 5K5EA 1V7CA 4B3IA 1YNSA 1P0IA 4DM4A 4DC9A 2PT9A 1PR0A 3TSAA 1JH9A 3WV5A 3AM5A 2B6NA 5AIAA 1DV1A 1YCHA 2WW8A 3KQQA 4LTNA 2YFQA 4UXIA 3ADBA 2IBMA 5H5JA 2FVXA 2GTHA 2HZ7A 3LO8A 4L27A 5L4NA 1GFWA 1LQTA 1M2HA 1Z22A 1WZEA 1JKFA 4XD7A 3V6MA 4WFJA 3ZDEA 2FPIA 2PYIA 5AHXA 1XCMA 4XIJA 1V8BA 5G4KB 4B46A 4UHJA 2OPBA 3WLSA 3HA5A 1MV8A 4PLTA 2ZGVA 3IALA 4QFDA 5B7QA 3ANLA 3K16A 1AF4A 4FILA 1D4AA 4UM7A 2DWPA 3OF3A 2JFYA 4L75A 4LNUB 4YAWA 4PLVA 4EHHA 4IKOA 4I6EA 2X41A 1P62B 3MWYW 2DFPA 1O89A 2XQIA 3MOGA 5TQVA 1SG0A 4X95A 4EWLA 4YRMA 4JJKA 1MXFA 4G1FA 4J4HA 3LOPA 4X1YA 3M7IA 3MJEA 1QIIA 5ITWA 1Q1GA 3S6JA 3G0BA 2C7QA 5F76A 4GZ3A 1E1QA 2VNIA 3SOPA 3LW8A 4U00A 1GPJA 4J9VA 2EBFX 5C8YA 3SIXA 4BQRA 4EHBA 3K4PA 4AZWA 4CTOA 1WB9A 4ZQGA 1J22A 4UTVA 2V45A 4P7KA 1IATA 3SSAA 2H3EA 2NU7A 1JW9B 2R7MA 5ITZA 1UBFA 1YZUA 5ERGB 3C7DB 3TDMA 3LDAA 2VP5A 1I4WA 1Z34A 4IWYA 4WACA 1MH1A 3K5HA 2TECE 3EEFA 4A0FA 4CN8A 5E2AA 1X92A 4F56A 4QRDA 4ZDJA 4B3MB 3GJZA 4QU8A 5SY6A 1AB5A 4CWAA 2KSQA 1KDRA 1KO4A 1LBTA 1X1EA 2P5UA 5DYNA 3BMQA 3KR1A 2IHVA 4QX6A 1BE0A 5AYVA 3WXMA 3ZWQA 4BKRA 3P0JA 4MAAA 3VJRA 5IKXA 3BFKA 4P5PA 2HBQA 3LUAA 2BIFA 2MMCA 3P52A 4W7IA 3TVDA 1EH5A 3PEWA 4B3BA 4FM9A 1CX9B 3FKQA 5JALA 3P4XA 4HNQA 1G5IA 3GJ7A 1G7SA 4LGMA 3SEQA 3WWDA 2A59A 4QU0A 3F3MA 1JP7A 4HNTA 1M10A 2VF7A 3H5LA 1B2RA 3H9QA 1ZN8A 1ZD1A 4Y2YA 5K01A 5JJLA 2OXRA 3H2SA 5TMDA 3IT2A 3AL2A 4A10A 2J4DA 4IQFA 5IAOA 1V5IA 1TECE 1LX6A 1LPSA 2DTEA 3LL4A 5D6NA 3JASA 2QRMA 1O08A 1QH8A 2OMKA 1KYVA 2NM0A 1A9SA 2W7TA 2XQVA 2GR9A 3CEJA 3GB9A 3HUTA 1XZEA 1QP7A 1D09A 1KZHA 3SXUA 3EF1A 3LI2A 2MJLA 1R7RA 4B8ZA 2ZPTX 5K20A 1CXZA 4Z1MD 4QQNA 1NQOA 1DWUA 1F6WA 1TZJA 2PUJA 1QKIA 3CEMA 5CB8A 2WAAA 5DN6D 1L7NA 2HH9A 1Q0PA 1OC2A 3JQEA 3QMPA 1O94C 3T7AA 4LY0A 1K5HA 1F51E 4WVLA 4BP9A 3IKMB 4CE6A 4B33A 2OBLA 4EVSA 1MEOA 1EZZA 1YJXA 3QVLA 3V00A 2BWJA 4DE5A 1NW6A 2EFCB 4IIBA 3REQA 1YZ3A 4A2QA 4BE4A 4KO8A 2AOWA 1G4UR 3JCZA 4O0LA 2RGNC 1HKHA 4GPEA 4BIMA 3IVAA 4RIFA 1KWGA 3NHPA 1LBHA 4M8KA 4DNQA 3CVWA 2P4QA 4KODA 1WD5A 3LX5A 4P86A 1VHLA 1X80A 4K0RA 3VJMA 1VDZA 3EK2A 1T0IA 2OOKA 3WI7A 4CM4B 2QKYA 1XQVA 4HNRA 4IDPA 3HEAA 4MSUA 4EARA 3DEIA 2W0MA 4P7BA 2FEMA 5F3DA 1FYDA 3HFGA 2G63A 2HSWA 3ABRB 1JRLA 3NLLA 4I9NA 2FVYA 3LUCA 4JLOA 4BWYA 1TUIA 4JEIA 3MWGA 3BHIA 3O8QA 4ID9A 4XWOA 5K8JB 1TM3E 3NAZA 2YX1A 2Y66A 1MLDA 3SC4A 3WKCA 3BGVA 3D31A 3L6RA 3WLKX 3ZE8A 3PL5A 3HYSA 5G1PA 1JJFA 3AJAA 4Z1MA 5BSGA 3PUKA 4MYSA 3UMRA 4Z9FA 3N8GA 2O7QA 4QYWA 1XF1A 1GGMA 2BL4A 2JD2A 2RC5A 4JKIA 5DN6A 4YAKA 1E3QA 4XQGA 1IHYA 1V41E 3A3OA 1J5XA 3K0HA 2C2GA 4K9OA 4Y0NA 3B85A 3MZ0A 1JQKA 1A98A 1BDMA 1CE8B 1H4VB 1W76A 1FFCA 2OY0A 5DI9A 1RQPA 4WZAE 2AV6A 4LY9A 4WOCA 5L51A 2I2CA 1EAMA 3NC0C 4ETWA 4ETNA 1JT9A 1YJAA 2IY7A 2OFWA 3NVKI 5EIEA 5CLIA 3FAZA 3NBKA 5ELMA 3NV7A 3H2YA 3BICA 1FB5A 3JSAA 3TUIC 1N34B 3KU1A 3CUEF 3AKZA 4LRTB 1AQNA 2WIDA 1Y7HA 3V7NA 2HC9A 2GD0A 1JS1X 1AA9A 1E64A 2AKYA 2XECA 3FYUC 4M1QA 3Q7IA 5AW4A 5IC4A 2ERCA 3C3AA 3JS5A 3RYHA 2HMVA 3D2BA 1UJMA 3T99A 4OLAA 4L51A 3IO5A 4TTQA 1DJNA 2AR7A 3GBSA 4CODB 4EAQA 3OPYI 5IJ9B 4L8GA 1N9KA 3AF2A 1XD8A 2RGXA 3EVAA 3N7UA 4MEAA 2BE9A 3X2EA 5BQXA 1KAHA 2H52A 2JFWA 3JR3A 3MWDA 3HV2A 3DV2A 2Q5CA 1HMYA 2ICAA 3A6ZA 3ZCXA 3PNQA 1UJ5A 4DGQA 1FMJA 1KMCA 3MUOA 1YK1A 3OOHA 4ZCLA 3TQHA 3V2IA 4RA9B 2GKOA 3LOUA 4QM6A 4NH0A 3O91A 1NVUQ 4HPJB 1WXGA 2I4OA 5BOSA 2I3GA 4WH0A 1C0KA 4KXMA 1G0NA 3VDQA 3KEMA 1LBEA 2P27A 2FSFA 2OV1A 4WK6A 3LCMA 1GFZA 3PENA 1U1EA 5H02A 2RKWA 4GI5A 2QTVB 1K4YA 1W59A 4L9RA 2L19A 4NARA 3JQFA 4UHCA 5DM2A 1JFFB 2B8NA 1KDYA 3HG7A 3V3KA 1ID8A 5A6SB 3K9CA 1NJ5A 3URKA 1QYXA 1CR6A 2KMLA 2TSYB 2GPYA 1NFRA 5A0FA 5DF1A 2O1WA 3RBVA 2P3OA 3F0TA 2PTGA 1QG6A 1FUKA 1Q12A 1XZFA 3OU7A 2FFQA 2GM3A 5CK4A 1XQ9A 3K9NA 3ISVA 1L5YA 5EUQB 1BXGA 4CEIB 1KXJA 3B1VA 1IH8A 1T5DX 2HKIA 3LRTA 2IYEA 2G7MC 3LO5A 2ZSBA 4YA6A 2VT7A 3LPDA 2LGJA 5F33A 1NR1A 3UUWA 3KEGA 3N6RA 1U2GC 1M34B 1J2JA 2IYNA 2WG1A 4B76A 3FE2A 4B4OA 1PGQA 2VXCA 1GHTA 3FOBA 3HADA 4TMZA 4CKXA 4AAYA 2Y9MB 3CU5A 3FTPA 4RK6A 1E4EB 1XDBA 5AT1A 4MVJF 1OI2A 3OC6A 1VPLA 1WEHA 3QH4A 3QLUC 4R1NA 2GI4A 1CRWG 2RONA 4B09A 4B47A 1V8DA 2I1QA 3GJRA 4ZO9A 5KVSA 4DEYA 1ESDA 3K6JA 4DCJA 4XD2A 1OV6A 4KIFA 3FMFA 4IEEA 4FS8A 4GZ6A 4JZYA 2ZYIA 3JVEA 3T8YA 4E32A 4B6FA 1CEYA 3CRVA 3F4KA 5IVIA 1OB2A 2JCVA 4HAUA 3IE1A 1P5HA 3DONA 2RGDA 5BV2P 1TT5A 1NYTA 2MT9A 3CNQS 5FBWB 2Y1EA 3FVVA 4RIEA 2O8BA 3UAZA 2G1PA 1XU7A 1NW5A 2K4MA 3RVRA 1UOQA 2QROA 5DPMA 4YEDA 3Q8KA 3I9JA 1GKIA 1SCAA 4NCJA 4N48A 1H6AA 2PEYA 3DMTC 4JYMA 4ADSG 2YQ5A 5ALVA 3VOSA 2I3DA 2VJYA 3A9CA 2BMVA 3AF3A 3PFNA 1D0SA 2R62A 4ND3A 4YPFA 4AUEA 4DIMA 5A0VA 1CY6A 4I9GA 4ND1A 1C8LA 2JFNA 4H3VA 4DC1A 4O1IA 4BRWA 2WV7A 1KJWA 1S3IA 4FOLA 3RSFA 3OESA 4XASA 4ESEA 4D0RA 3LHKA 3PR1A 2O3UA 4E5PA 3RIXA 3PFHA 2EVWX 2PQMA 3U7EB 3ZHZA 4UHBA 1W4ZA 3DWFA 3P2IA 2NZWA 4PIPA 1U9IC 3VU1A 4E7PA 2CHQA 2PMBA 4IRUB 1XCGB 1Z7GA 2JGKA 4E07A 1Z45A 3ZIAD 2M1ZA 1X70A 3LF1A 4MWSA 2P79A 2YJ6A 3PPYA 5GZ3A 1BX0A 2PU5A 2H7YA 2Z5LA 3BD9A 3GLQA 3IVMA 4NPCA 4ZEVA 1U3DA 2DHRA 2P40A 2QW0X 4JOSA 4OXRA 1F48A 5HW0A 5CYFA 2CXHA 5TGZA 2V6GA 5L40A 2WABA 5DGDA 1EFVB 2HJ9A 5E3IA 3ZKWA 3KKQA 3NH6A 4RMIA 4IVPA 2ZEJA 2RH8A 3OD1A 1DFHA 2Y4NA 4DWJA 3QKRB 1JSLA 4U7DA 1TUEA 3E7WA 4M1KA 2BFNA 1FU8A 3O92A 4HDMB 1JALA 1GXSB 4HUQA 4DR4B 4D9JA 121PA 3FDXA 4MPRA 3W7AA 5KB3A 4GKJB 2IYWA 1FFXA 4KWIA 2BGLA 4B73A 4GLOA 1O6ZA 4G8CA 1PJRA 4GVPA 2Z30A 3T5BA 3NNNA 4B6PA 5KQRA 2VNJA 3GP3A 3JVIA 2V3VA 1B41A 5K8LA 2YWDA 4M3NA 5HHTA 1G64A 3E2IA 4M60A 2AUNA 3DD5A 4JSRA 1QXSA 1K7EB 2KI5A 3TW8A 1YMVA 4HDKA 1R0XA 5F2KA 4NHOA 4I3GA 1E3SA 5G3ZA 5KNLA 3TFOA 4C89A 5CBPA 4LY3A 1U2DA 1PGPA 5CCBA 4RTRA 2XVMA 1Z25A 3F78A 3B20A 4IJ6A 1CJUC 1MOSA 4OSEA 3AR5A 4LHEA 3WMWA 4EW6A 4TRJA 5ARDA 4ZARA 2B69A 5FOTA 1ORTA 5JQGB 1ACLA 3T1HB 5MFPA 4D96A 2NOAA 1VSTA 3BTVA 5TXGA 4E4YA 3CRQA 4B1FA 5FAKA 3L92A 3WNDA 2QRLA 4IMRA 1SFRA 3OZWA 4HQKA 1U0HC 4HX9A 1PZNA 2UV8A 2M1XA 1T8YA 3G82C 1E2BA 1JL3A 1U8TA 5DW0A 1E79D 4MJ7A 5DHFA 4IHJB 3I6BA 3VO2A 4NKRA 3DDWA 4O1MA 1Z3IX 5ECYA 5ENDA 1GCGA 1HRKA 5JAOA 4ZOLB 3PCRB 1KO1A 4RMHA 1M2VA 2DF8A 4JI5B 2H2DA 4CR8A 2QJTA 3RAFC 1F5SA 1M8GA 4WNCA 4NZPA 1GTJ1 3WJ2A 3GFSA 3ILVA 1Y1QA 4OI0A 1CUBA 821PA 3ZCPA 2VNSA 4HNSA 4ZU3A 3ZI7A 1AURA 5CD1A 1T0BA 4FGZA 1OREA 2W9XA 2ODTX 5K03A 3JAWA 1ZM9A 3H04A 2AZDA 3TZKA 4U39A 4H1HA 4WK0B 4NV1A 1SCUA 4MR7A 1OT3A 4DFDA 3MG9A 4LFCB 5C1DA 3HDYA 4KC0A 4GGMX 4DM3A 5JVDF 1D1PA 2QMOA 4HC4A 4OHCA 4AJOA 2UDPA 5JVDA 2O2DA 5JH7A 2V7BA 1I33A 1PJCA 1XLUA 2PVCA 3HVJA 3BIXA 1XSEA 1FUIA 1XI2A 1ZMXA 3WS7A 4V1CB 2JVKA 1ZJYA 3WRXA 5E2IA 1E6UA 1P0QA 5JQGF 5SYNA 1T36B 1YR6A 4ITRC 4PR3A 1YDFA 4XDHA 6GPBA 2O52A 3E8MA 4HNAA 1QPGA 2AX3A 2B21A 1QFMA 4OG2A 2H5JA 2H7VA 2PSDA 5DZSA 4DQUA 4J43A 2BH2A 2I6GA 4D43A 1LK0A 3PXBA 4B4VA 1XB2A 1AOXA 2Q5LA 5EMLA 4QIHA 1K5PA 3TMAA 2AFIA 3FTDA 3F98A 3BQ9A 4KVGA 4BFUA 1USVA 1E79A 1PX2A 4QXRA 5DK4A 4IXMA 4CCYB 1VSQA 1EBBA 1Q5PA 2WFMA 3SP1A 4O2LA 3DWEX 2P67A 3F8WA 4IHJF 5JS2A 3P9SA 3O82A 4V0RA 3ZDAA 2VT3A 1A50B 1PD0A 4Y2JA 1MT3A 1ZEJA 2D1TA 4GPIB 3QLTA 3MUFA 4ZOLF 5CB6A 4RULA 4DCNA 3K6SA 5G3YA 1IJFA 3P1JA 4RKFA 2C8KA 3KEQA 1TCBA 2OFXA 1XVUA 2BI7A 1KQPA 3F9IA 1U28A 4OXXA 1HZJA 2VTKA 3AI7A 5ENZA 5HILA 1UP4A 1EB9A 3PFKA 3RJMA 4C08A 1JYFA 1BU8A 2D5LA 1F12A 3C3CA 2IZ1A 1B6TA 2IXBA 1GQFA 4AKSA 1S01A 4CMHA 4Z7JA 2EKLA 2ZRDA 4B48A 2PMEA 4L8LA 1C4OA 1I5EA 4RIIA 2FSVC 1KVSA 1Z8NA 2L18A 4U2BA 2VKTA 1E2EA 2NUAB 2IEDA 3C4VA 3MRSA 4M0LA 2QI9F 2WNHA 5K99A 1LB1B 1LBIA 2FOLA 5JAIA 3WK6A 1WG8A 1UBKS 3GYBA 4B7AA 3TTUA 3ELBA 3EOZA 3FZGA 4PHHA 1OY1A 3HI4A 4TVOA 1SBCA 1GQQA 4LKOA 3TRKA 3ZHUA 4OJNA 3O38A 4RAQA 1VGQA 3A4TA 2ECQA 4PC3A 5TV2A 3WRYC 2VRNA 2ISSD 3HS3A 4ZDIA 4EF6A 1C8KA 1ZIXA 2LV8A 4GMXA 3KPUA 4H7PA 4MB0A 1QGOA 2J3JA 1L7AA 3WIVA 4KXUA 4TMKA 5I7SA 3DO5A 3UIEA 3PUZA 1SQ5A 5DGHA 2WWXA 1F4LA 1GPH1 2HL6A 5AXCA 3V4FA 1P81A 2OLJA 3GIWA 5DI3A 2Q6VA 4I5DA 4P3NA 4M9UA 1Z56C 4ARZB 3AUKA 3O1JC 3WJ1A 4EHKA 5EHXA 2YRFA 5ALYA 4EGFA 5BVHB 3RAPR 2GXQA 1B0ZA 3ESZA 3AERA 4WY2A 3MUNA 5KC8A 1YCGA 3CZPA 1CETA 1ONPA 4FIZA 1JQ5A 4L9AA 2PRKA 3W77A 6ADHA 1G2PA 1HH4A 5KZMB 2ZQZA 3VRHA 1RU3A 2I4RA 3BMNA 2HF8A 1SBNE 3JD2A 2Q5HA 4OH1A 2O3SA 3B52X 3DDZX 4I1RA 3PSAA 5I7HA 3H1GA 3OIUA 4F6RA 2YY6A 2JLYA 1RI1A 5AHKA 2GAOA 2QTLA 2Z4RA 2FEAA 1U0FA 1OMOA 2JBHA 1TIBA 3IP8A 4W8OA 4BAGA 4CM8A 1EUCA 4Z4CA 3WL7A 1TC1A 3NT5A 2B83A 1XXHE 3FX2A 1D8TA 3NXSA 4MRNA 4X1KA 3U4QA 3IO3A 1CQIA 5DBGA 4RK7A 3I9V1 4RD2A 3IIMA 3ZYZA 3O6VA 3A8TA 4UNQA 1AXEA 5JCXA 4NAUA 1G5TA 3K35A 4KUEA 4ZI2A 1TEXA 1JZTA 1K7SN 3FBTA 4R1OA 5JAQA 5LU8A 1GPDG 5K6TA 1T5SA 1O94D 4EK9A 4Z51A 1CCWA 4YPVA 3MFYA 3E61A 1E6EA 2XF8A 4Z54A 4U5QA 1N2GA 3T35A 1LDEA 3ROEA 2PFKA 4RSHA 2IWHA 1FDVA 3ZVRA 1FMLA 3D4IA 1E96A 2WPDD 3GWZA 3IS3A 3ZVLA 2EFEB 3LNCA 4F5WA 3DAGA 4JI7B 1ZKMA 3VBCA 2F6RA 2XA1A 2Q7OE 4A2PA 4MQEB 4BBJA 3K8QA 2I22A 2XKKA 3ORYA 4M8LA 1NDHA 4ACBA 1H8ED 2HDOA 2IUFA 3K09C 4JBIA 3W4KA 2DY0A 5IVDA 1J9ZA 3HCBA 1C8BA 1I24A 1OX4A 2VLBA 3N9IA 3GMTA 1EM8B 1JEQB 4Z2YA 1ECCA 2ACVA 4L2IA 4XPIA 3RAEC 3G23A 2ZRKA 3MVEA 3WYBA 3GAFA 2H4WA 1B15A 1KIMA 1I51A 1Y7TA 3LPMA 1T13A 1A5TA 5A7FA 3VZBA 4W63A 1N8TA 1VP3A 2MYNA 1M6HA 1UJNA 5F21A 2X2PA 4ZXPA 3UW1A 1X14A 3OEYA 2II6A 2IOFA 1ZGCA 1SHUX 1KMHB 2Y0EA 4G5HA 4TN5A 3UK6A 3S40A 1SXJE 2WBLC 3LIIA 2XIJA 1R0KA 3PCTA 1LXCA 1UK8A 5EHIA 4G67A 2PXHA 4Q7LA 4R69A 3KYDA 3WB2A 3ZHSA 1GM5A 2J85A 2Y1LA 3FHLA 4GPAA 4HN4B 4QYSA 2R5NA 1YOVB 4L9SA 2P4SA 3H3XA 1O94A 4MEJA 4BLRA 2BHLA 4IMPA 5BR8B 3WFIA 1HE5A 4KO4S 4JQOA 2CDRA 4YROA 4IVRA 4INPA 4LWOA 4K2HA 4WDQA 3THSA 2D1FA 4OP2A 1E98A 2PA0A 5HCNA 4BNDA 3FPAA 4U7PB 2DC1A 4BO1A 4B3XA 2HR1A 2WPDA 1QGAA 2ZREA 4CM6A 4RVUA 1SRRA 4H3SA 2RHCA 3U49A 3UAGA 2IS2A 3QVMA 2RGNA 1H8EA 3DLTA 3OJWA 5LBTA 1FTYA