2ZTSA

Crystal structure of kaic-like protein ph0186 from hyperthermophilic archaea pyrococcus horikoshii ot3
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
216
Chain Sequence
PVRRVKSGIPGFDELIEGGFPEGTTVLLTGGTGTGKTTFAAQFIYKGAEEYGEPGVFVTLEERARDLRREMASFGWDFEKYEKEGKIAIVDFNVDNFLRYIYRVVKAINAKRLVIDSIPSIALRLEEERKIREVLLKLNTILLEMGVTTILTTEAPGKLSRYGIEEFIARGVIVLDLQEKNIELKRYVLIRKMRETRHSMKKYPFEIGPNGIVVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0186
publication title Crystal structure of KaiC-like protein PH0186 from hyperthermophilic archaea Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Atp-binding protein
total genus 73
structure length 216
sequence length 239
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ztsA00
1JR3E 1SHZA 1KJWA 3IEUA 5E95A 4DUGA 3I3SR 1OH6A 4IHQA 1AGRA 3QKUA 2BJWA 3VKWA 3J81k 3AKYA 5EE0A 2RH5A 4KODA 3ICQB 4NMMA 4U02A 5EP4A 2OSBA 5CK4A 1CBUA 2PCLA 3BERA 2F43A 1VG9B 3UIEA 1S1MA 2W83A 4JJKA 4DJTA 1CRQA 4Q9HA 3QBVA 3EPLA 1TADA 1CJUC 4FCVA 2BCGY 2UVQA 4UNQA 1SXJA 4MYCA 1FOEB 3C15C 3QKRA 1I2DA 2QNRA 1KK0A 3B9PA 4LGMA 2IW3A 3THOA 1Y3AA 2VF7A 4ZO4A 4A0FA 3P27A 4DLUA 4F4IA 3BC1A 3GJ0A 1HY3A 1ZUIA 2H5EA 4PC1A 4ZIRB 1IJFA 3P4XA 3CO5A 4LJYA 3OIYA 1EG7A 1FZQA 5JWHA 4QGHA 5KSYA 1KSGA 3A1SA 2IUUA 3SNHA 3UWKA 3ZZTA 4TN1A 1SHKA 3NDBB 1AKYA 3CUEF 3O8RA 2ZRGA 3RNLA 3T61A 3VTKA 4DEXA 1DG1G 1G1MA 4FI3C 4QJ3A 4I4LA 1XTKA 1CJMA 4O2LA 2VO1A 2JATA 3C7KA 5G40A 3TUJC 1ETUA 5BN3A 3C16C 4WW0A 4MGKR 4CT4B 5J47A 1AQYA 4JLOA 3GLFE 3RS2A 3A8TA 4PHGA 2EFDB 2CNWA 1KI7A 1E32A 5CYPA 2EFCB 1G18A 1P2TA 2XGJA 1AA9A 3CRMA 2QSZA 3CZQA 421PA 3RRNA 2I4IA 3ZYCA 3TQCA 1RW4A 5IK2A 3OIVA 3PUVA 2QE7D 2NO6A 1ZM3A 2V7QD 3NC1C 3OEED 4TTRA 3QE0A 5AWFC 2G0NA 1W46A 4GBMA 3MJHA 4JKIA 1VG8A 1HUQA 2YOGA 3I92A 3T1QA 3P1JA 3VFDA 1T8TA 2KBEA 3X1YA 4WA7A 4O3MA 1H8HA 5HTKA 1G291 2GBLC 1II9A 5ELXA 2CLDX 2R6AA 2DB3A 3D7MA 4W5HA 2ZJBA 3RVBA 2GWHA 4F7WA 4G01B 2GETA 4TSFD 5G3ZA 1LNZA 1R8QA 1VCOA 1W4RA 2ZITA 4IVRA 5B64A 1E2MA 2GILA 5KHOC 3HWSA 2QENA 2REXB 1NVWQ 1TEVA 2ZE8A 4US0R 4QC2A 1MH1A 5JFGA 2IC5A 4QXAA 2VA8A 4LHYA 2K5UA 3UK6A 1Z3IX 2H17A 1CKEA 3RLFA 2JLZA 2C9OA 1CS4C 1YKSA 4B48A 1KI6B 5A0FA 4C0KA 2D2EA 3OEHA 4JLBA 2QZ4A 2VTKA 1OW3B 1ZNWA 2KJQA 4D0GA 1TPZA 1XMSA 4P3YA 3RC3A 1KSHA 5CM8B 1QDEA 1XMJA 1G8HA 1HQYE 2FFQA 3IKJA 4FMCB 1MO5A 1TL7C 4FMDB 2AWOA 3ND9A 1KMHA 4JKYA 4A0GA 4C7OB 4BRUA 1DTSA 3K8YA 2FPLA 2XITA 2Z5FA 4UNRA 5A5GA 3NTUA 1XWIA 3AVWA 2QN6A 2GXSA 2WPDA 4GSYA 4BASA 3A4NA 3VR5A 1NN5A 4FCWA 4V0NA 4AD8A 4C4PA 4DUGD 2NTYC 1KJZA 4GZMA 4EPWA 4XVUA 5JCZA 3I5XA 3K70C 3Q72A 4D0LB 4B3GA 1BYIA 4B43A 4CRWB 3SOPA 1R0YA 1X1RA 3FHTA 2QP3A 1GITA 1P2VA 3BB4A 3GMTA 4JT2A 3WMFA 1ZBDA 2GBLA 4YDHB 3B8HA 1T8UA 4PC7A 1SXJD 2ODEA 1W0JA 2VP0A 2W6IA 4OHZA 3LQQA 1G64A 2P6NA 3PCRB 2W2XA 2VHQA 3KB2A 2WJVA 3UMFA 2D06A 4MRSA 4PX9A 1E4YA 4BZQA 3QIAA 2FPMA 2I1VB 1Z06A 2X2FA 2QG6A 1ZD8A 4V0LA 3MD0A 1HYQA 1BYUA 5DLQC 1CF4A 1IXSB 3NH6A 4F92B 4TZ6A 3QEOA 1Q12A 4A0HA 2C98A 2WWXA 1UM8A 3N2IA 5EJEA 1E69A 3GJ5A 1SZPA 4CYMA 5JRZA 2NO9A 2EW1A 2H18A 4A6XA 2G77B 1E2PA 3NKVA 4XWAA 2WKQA 3ADDA 2CNWD 1DOAA 4KLZA 1SXJE 5JHHB 4B73A 1IM2A 1VCIA 1EXMA 4F38A 2OBMA 3FMPB 4IOMA 1GWNA 2RB4A 2J0QA 5IK2D 2F3TA 4O25A 3I61A 5F9HA 2B92A 1W2GA 2G0TA 2R2AA 3H0KA 5FTLA 3AM1A 3A1TA 4TMZA 3TR5A 1OF1A 3QEJA 4KXFB 1E1QA 4I1VA 5FPTA 3TSZA 5JJKA 4ILEA 2QT0A 3LY5A 5L3QB 1YU9A 2WTUA 1H8HD 1HT1E 1VHTA 2ANCA 3QVUA 3UMRA 4DT1A 1Z8FA 1KO8A 5FOSA 3B5JA 3F0TA 1YHNA 5F9FA 1V5WA 3FPAA 1W0KA 1W44A 3R20A 3KL4A 2YWGA 2WKPA 1D2MA 3ZQ6A 2VLIA 1Z6GA 4CZ2A 3SE0A 3GPLA 2X77A 1EESA 1KI9A 2HCBA 1T0HB 3O47A 2FU5C 4IOLA 3KXKA 1W2HA 2C99A 1P9RA 4M1WA 1IN8A 3R9WA 4TYWA 4FIDA 3RYTC 5B30A 4M0LA 3WNBA 1OFIA 4TL7A 5H8WA 2Q9CA 3L2OB 3M6AA 4DSOA 4EFLA 5KDDA 2WAXA 4ZIRA 2O52A 4HEJA 3WNDA 2VHUA 4HAWA 5FH9A 4H9GA 1AQUA 5H1YA 2WWYA 2XXAA 1YZQA 3T35A 4ZI2A 3NBYC 3W6PA 1RYHA 1PUJA 5CJPA 1N5LA 1ZP6A 3LLMA 1JB1A 4M9SA 1TQ2A 3ND8A 1KI3A 1VG0B 1G21E 4TQAA 4AKGA 3S1AB 2AFHE 1U9IC 4B2PA 4NU0A 1BO6A 4URZR 2GXQA 5FR2A 2B8TA 4DIDA 4JT4A 2WPDD 4Q1BA 2BM1A 2KSQA 4YMSA 3Q8XB 1JEEA 2BHRA 4LWZA 4NKRA 1XXHA 5A4JA 1ONBA 3LNCA 1FNMA 2OG2A 2ZI9A 1X86B 5L8VA 3EWSA 2QTVB 3LH5A 1U94A 1N6LA 3DO6A 4LYAA 5DHFA 1RPZA 4RD6A 2QAJA 4HZUA 3I62A 2ZRJA 2PL3A 2ZROA 4LBYA 1JNYA 3E2IA 1G9XA 2CVHA 4ZDIA 5TMPA 1OLOA 1S9DA 2DFLA 3AVVA 5L3SA 5TARA 1BOFA 5EZ6B 1W0JD 2W6ID 4KFSA 2IYUA 4NCHA 1UPTA 4TL8A 4DC9A 1A5TA 2F1IA 3AVQA 3RC8A 1D2NA 3CONA 3VX3A 2ZYTX 2IUTA 4XWOA 5C4MA 4CF7A 3D6TB 3BOSA 1KNQA 3C4JA 4II7A 4L4UA 4R9UC 1RVDA 4YMWA 4WIAA 4HAVA 1WBDA 5FBQB 4TL6A 4Q02A 5DISB 3GLIE 2C77A 4B3CA 1VMAA 2ZRDA 3SS8A 1NVVR 1ZUHA 4AI6A 5AUPB 5D3MB 3CX6A 2XZPA 3CRW1 3TRFA 3FHOA 4TQUS 4BLRA 4DLYA 5LB4A 4QL3A 3AF1A 2IYRA 4LV5B 2R62A 2GVDC 3SR0A 4U00A 4EDHA 3AV0B 2RMKA 4DSNA 1GRQA 1W5TA 4YDSA 4FWTA 1U9IA 2BWJA 1XNJA 1UKYA 3OIUA 3IHLA 3TNFA 2JIZD 2CHVA 1W4AA 3W9YA 2AK2A 1WB9A 1P62B 4EPTA 4P33A 3PIRA 4S35A 1J8YF 2GZAA 3ETLA 4PSKA 2C78A 1R0XA 2CLCX 1FUUA 4IFBA 4UNSA 3PG5A 4D6PA 3K70D 3V4RA 1IJEA 3L82B 1N5JA 1J7KA 2QPTA 3QXJA 1E1QD 3PXGA 3GEIA 4TTQA 1EWRA 4KBFA 3H2YA 2P0EA 4KITB 3KJIA 4LCBA 3BGWA 1E9BA 1AN0A 5B57C 3PENA 4UXHA 4EQ6A 1XEWX 1MT0A 1NLYA 4MKIA 4M9XA 1YR6A 2OO7A 3H86A 3LW7A 2PLRA 1NIPA 1W0KD 1KHTA 2QBYB 2V54A 3CX7A 4WBSA 2WWGA 1KK2A 4TYPA 4C30A 4DLZA 1E2IA 5B58C 3TSWA 1QRAA 1Z6TA 4HAYA 1KI8A 1Q21A 1TU4A 2VP9A 1DAGA 1ZM9A 3EZFA 4OQXA 3TJZA 3GP8A 1ZNZA 5AR1A 2FPKA 1OXXK 4N1AA 1IN5A 2ORIA 2MMGA 1E9EA 1MO4A 3VU9B 2G6BA 1ZC3A 2V1XA 4V02A 3R8CA 2ERXA 3W34A 4TMXA 2HYIC 2A7QA 3DOEA 2OCPA 4PR0A 5HPYB 2A3RA 3KKQA 1W5SA 4GL2A 1KYIA 4F91B 1N2CE 3ZVMA 1DG3A 4ZKDA 2F6RA 4MYHA 1S0UA 1HURA 1AZSC 3A4MA 4XSGA 4OK6A 3CNNA 4JMPA 4Q18A 3ZIAA 1D2EA 4XTCS 4ARZA 1G20E 1KTVA 3BJIC 2BKEA 5JSZB 1G17A 4US2R 1GL6A 3BWDD 2FSFA 4QM6A 2O8EA 4K8OA 5EE5B 4WZBE 4DZZA 1Q22A 3GFPA 1P61B 1IONA 4MGYR 2MSDB 1HA3A 1SGWA 4CDGA 4HATA 1QHNA 4DLTA 3BRWD 4LC1A 3G5UA 3HR7A 4KV9A 2ZI6A 2WJHA 3VR2A 4JSYA 4GRAA 2H1LA 2P6UA 4Q4AB 1GKUB 4GMDA 5EE3A 4OI0A 3B85A 3QG5A 5EQTA 4UXJA 2ZE7A 3K0AB 1Z0JA 2Q3FA 4B74A 4BEBA 2V8OA 4Q9KA 4M1MA 1N6RA 4RSGA 2IX3A 1GVNB 4OI1A 3KTAB 4XJXA 4EPYA 1XEFA 4JZKA 3SFZA 4EJSB 1G8FA 1K6MA 1XD9A 1UKZA 1JR3A 2BEJA 2GCOB 4A9AA 1NSTA 2RGNC 3DDCA 2ZSFA 1TQDA 5CLLA 5DN6A 3MWLA 5C2JB 1KO5A 1ZIOA 1T3HA 3GLGB 1T0JB 3WMGA 1FPMA 5GJVC 3QKSA 4FN5A 2WWHA 4NYIR 3C41J 2ZVQX 1E1RA 1U81A 2LCFA 1KKLA 3BBPA 2P67A 5EUMA 4NPHA 1JEDA 3MSXA 3PUWA 2P65A 4DRZA 5BXQC 3TR0A 1A82A 1JALA 4QHTA 1N0WA 3SJZA 4Z1MA 3N5CA 2VP2A 3RRMA 3R9XA 4JYCA 4C2UA 4IVPA 2PEYA 3A1VA 3W5IA 5JEDA 2AXNA 2ZJAA 2N1BA 2ZRKA 5TB5A 4BFYA 3PJRA 3DKPA 3GEEA 3I72A 4QNMA 4PAOA 1ZD9A 3EIEA 4KVGA 2PEZA 1E99A 2J3EA 2ZE5A 3U44B 5IDVA 1VHLA 3OZXA 1XJ0A 1IN4A 2IK8A 2PX3A 1D6JA 3QPUA 4M1OA 4NL4H 1JJVA 4ZDJA 4Q4HB 1P73A 1KK3A 1YZLA 3NH9A 3AP1A 4PPGA 2BCJQ 1T4GA 2HF9A 2REBA 1ZCBA 1J8MF 3C5HA 5LBIA 1CP2A 1G19A 1QHHA 1G4UR 2QI9C 3NC0C 4E22A 4B2LA 5HE9A 3GLFA 1CJVC 2NZJA 1SVOA 3AUYA 1VIYA 3CH5A 4DCNA 1TQ4A 2QGNA 4AKIA 3U2QA 1ZMXA 5CK5A 2PJZA 1HT2E 4K81B 5JLJA 3LQRA 3KKPA 1E0JA 4HLDA 4X8MA 4OJKA 1U8AA 2YJTD 2RGNA 4MDEA 1P5ZB 4LBWA 3DZDA 3KQKA 2OHFA 4TLCA 5F3WB 1YR8A 3BB1A 3FMFA 2E9SA 2GZDA 1Z0FA 1DS6A 1US8B 3GLHB 1U98A 3Q9LA 2YZ2A 2ZJZA 4PQYA 4Y0VA 1II8B 1E2KA 1CR0A 4CEJB 2NO1A 2NOAA 2HF8A 1P3JA 1F2TB 3FOZA 2HV8A 2F3RA 3ZIAD 2IYVA 3SYLA 2PH1A 3WHKA 1EFTA 2VRWA 4UQOA 5LD2B 1M2OB 5ANRB 3T06B 2GF0A 4OHVA 1TNDA 2V6JA 3GJ3A 2N46A 5DYIA 3X1DA 4YMVA 1KI2A 5KNDA 5JZVA 2Z4RA 5EUQB 1MKYA 3B13B 4N0DA 5FBWB 1ELOA 3RANA 2O8CB 2ZQ5A 2FFHA 2XSZA 3OE7A 5J4YA 4G5RA 2HXSA 2WV9A 5DSZA 1Q1QA 3IIKA 2FFBA 2CK3A 1OFHA 5P21A 2BOVA 2C95A 4B3FX 4KLNA 4BLSA 4C3ZA 3IO3A 2H7VA 2D2FA 3AVPA 4P31A 3OFNA 1ZRHA 1E94E 4MDFA 2XZLA 4RD4A 2JLYA 1P72A 2YVUA 4TL9A 2DFNA 1KDRA 2JLQA 2RHMA 5H70A 4AWXA 1A1VA 1Z07A 3L0IB 4Q1EA 4W7SA 3KDSE 3FDIA 3MG9A 3RRZA 3QXCA 4A2PA 2RCNA 4M4SA 1XCMA 2F9LA 3BIFA 4MRVA 4XVQA 1ZIPA 3FMOB 1G7SA 3WNCA 3NBXX 1QHGA 4MYUA 1TX4B 3ZVLA 1CJKC 4KYIB 4RFSB 5G3YA 4D4MA 1NNEA 1ZC4A 1HQCA 1HE8B 5DN6D 1F2UA 2HJGA 3AQ4A 5K8TA 4DCUA 2D3WA 4LOAA 1DAHA 2X1VA 4QGGA 1F48A 2OFOA 1LV7A 4ASUA 2DWOA 2X2EA 2EU8A 4L9WA 5AJWA 1E1RD 1RYFA 3P20A 1DAIA 1OJLA 3B82A 4UKDA 4U7DA 2WSMA 4C9BA 4FCTA 3OAAD 2BVNA 5EXPA 1WRBA 3ECCA 2MSCB 4M1KA 4Q47A 4RD3A 2FSGA 3B1WA 4LBZA 3VX4A 2PLFA 3BAFA 4Z1MD 1U2RA 3MGCA 4M1SA 2WHXA 4URWR 4NYMR 5KUTA 1R0WA 2Z4SA 4TYYA 3JZMA 1AS2A 2HLDA 4GP7A 3KQHA 2RGGA 4I1SA 4QNRA 4NZYA 3L43A 4BZPA 2GZHA 5GJBA 2WZQA 3T1OA 2FMXA 1XEXA 4WXPA 2Q9AA 4EFNA 4DXAA 1WF3A 4B44A 1KO1A 4RZ3A 2BEKA 4TZ0A 1QHXA 3NBZC 3NEJA 1XCGB 1YRBA 4MRRA 3CX8A 4HDOB 4D25A 1BIFA 3CPHA 1XB2A 1LS1A 2JJ1A 2Z83A 5KSPA 3UPUA 3HU2A 1ZM4A 1GP2A 4Q4AA 4HAXA 3REFA 4R71A 1DADA 1DBSA 4LJ8A 3Q7PA 4PSAA 4JL5A 1ZAKA 1OH5A 1E0SA 4M1TA 1TU3A 1UBGA 1XD2B 2ZU0C 3SYKA 2O5VA 1X3SA 1IY1A 2VHCA 2PZGA 3K9NA 3B1YA 1UF9A 1YE8A 2H16A 2NGRA 4KCGA 2FWRA 3KUCA 1NKTA 4ABYA 3KTAA 1JXMA 1SVSA 1UDWA 4IW3B 3B60A 2Q9BA 1RJ9B 4D80A 1RRCA 1BMFA 1N6PA 2ZSEA 2F1JA 2JASA 2YNMA 1FX0B 3I1FA 2OCYC 2WWIA 2ZI4A 3LDAA 4QGAA 2E1RA 1E2GA 2YC2C 1PVOA 2F7SA 4A0RA 1FMLA 2JGNA 3ASYA 1RC8A 3SJBA 5DNYB 3N2EA 1F5NA 1NL3A 3QJYA 3QNUA 4DKXA 3U61B 1S1CA 4GP6A 5TXGA 1XTQA 2OLKA 3NWJA 2OXRA 5HE8A 4JLJA 2IEYA 5KPDA 4ZDWA 1NVUQ 5DI3B 2TMKA 1B23P 1OIVA 4LJ5A 1VKJA 4P4SA 4IEIA 5LD2C 1G8YA 2O8BA 4HB2A 4OHWA 5JECA 1OE0A 3QKTA 1W49A 2XSZD 2ZSBA 3OE7D 5G53C 4RY2A 2JA1A 1FUKA 1EK0A 1FNNA 2IEZA 2KI5A 3EIQA 3H4MA 2CK3D 4OJQA 2OLJA 2JLVA 3BH0A 4Y0AA 3I4LA 2VSFA 2GKSA 2ERYA 2FF7A 3M0EA 4LJ4A 3OFND 4NP6A 5JS8A 3ADCA 2IS2A 3CF2A 3U7FB 1U99A 4F4CA 3THWB 2VIIA 2NMVA 1EX6A 3C8UA 3EPHA 3U7GA 4MKGA 1QVRA 2O0JA 1CXZA 4JLVA 2FNAA 4BWYA 2IT1A 1Q1EA 1RZ3A 3GJXC 3LA6A 5JI2E 2PBRA 4NBSA 1K5GA 2PT7A 3Q7QA 2CJWA 5TDHA 1DEKA 1XBTA 3HU1A 4PHFA 4HZIA 1HV8A 4Q9LA 2XEXA 2IUSA 2QGZA 5JBQA 3E5HA 4ASUD 3SDZA 2GEVA 2FDCA 1S3GA 3IGFA 1W36D 3PUZA 3THYA 3QXHA 1JJ7A 3LW8A 2QPAA 3IIJA 4POAA 1CU1A 2ZRBA 4QG7A 3WRXC 2I3BA 1BKDR 1SQ5A 4PC2A 1A2KC 3U3KA 1J2JA 1XTSA 1P2SA 4JVMA 1IN7A 3VHLB 1SVMA 3U3RA 1KSJA 2FEMA 4BFVA 4QM7A 4CEIB 2HLDD 1A2BA 1M6NA 3VMFA 3U7HB 4OQLA 3RDPA 1WE2A 4XTRA 1LF0A 3PFIA 5FI1B 1P9WA 1VIAA 1RIFA 3UANA 2O8FB 1N6OA 3BE4A 4LPKA 4EIWA 1W48A 3P4YA 3SQWA 2J0UA 3GLIA 1PLLA 2NIPA 3TGPA 1YRAA 2DPXA 1SKYB 1UEIA 2FZLA 4RD0A 5E3HA 4IXNA 4R7ZA 1E9SA 1T3SA 2JJ8A 4M9ZA 2JJ1D 3DMDA 4URYR 4M8NE 2BJVA 1D5CA 1U90A 3UG7A 1UKVY 1YZUA 3PR1A 4TTPA 4OI4A 3L8ZA 5SZKB 4URVR 2WIBA 3TLXA 1X6VA 1MRNA 2OFXA 1UBEA 3CR7A 3BH7A 4ZPXA 1C9KA 4FW9A 5E7MA 2XOKA 2ATVA 2QSYA 4MGIR 1ZU4A 3G0HA 2IYQA 3MCAA 4XD7A 5HR5A 4KHZA 5LDDC 4X8OA 2ZSDA 4H1UA 1BMFD 1YR9A 8OHMA 5KU1A 2BBSA 1NVVQ 2AX4A 3KXIA 3PUYA 1COWA 5E7JA 2F1HA 1G3MA 3B7GA 4O2RA 1IY2A 2BMDA 5FPYA 1GILA 1KDTA 2B21A 4B34A 2GJAA 1E6CA 4CT5A 4I1UA 1E2DA 1J90A 1IN6A 4Q4JA 4ZCIA 2LKDA 3IBGA 2GJ9A 3B2EA 2ZXUA 2QM7A 3B6EA 3TK1A 3BD9A 1Z83A 2WSSA 1KSFX 1JQLB 1UADA 3HPRA 4M53A 3AGPA 3QPWA 2JIZA 5K8IA 2C2HA 2QT1A 3RSOA 3VR6A 3HDTA 4L16A 3NXSA 3PEYA 3EWAA 1CLUA 1EFCA 2XTNA 5JCPA 1JPNA 1SVWA 4CEHB 1K8RA 2ECKA 3TKLA 4BLTA 3RS4A 1PZNA 1MABA 1NG9A 2GXAA 5AUNB 4TYNA 2GK7A 3P26A 1NKSA 1G3IA 2QROA 4L9SA 1TUIA 2YWEA 4V0ME 3OESA 1HE1C 1HH4A 3R7WB 2VQSA 1T9HA 5AUOB 2OV2A 3U3JA 3SBDA 2DR3A 3B1XA 4OHXA 1E2JA 1WBBA 3GLGE 121PA 3X1WA 1OYWA 4DCSA 3EX7C 1GAJA 1GKIA 2FG5A 2AR7A 1UFQA 2QQEA 1R5BA 2GK6A 3X1XA 1RRFA 2PX0A 1Q3HA 5AUQA 1E9RA 2B8WA 5JWRA 3D3QA 3O8DA 5EXXA 5DHAA 1KAGA 2IBMA 1D9XA 2GNOA 4RJLA 2FV8A 4QHYA 1QHYA 2QL6A 1FQKA 2ZU6A 4B35A 1GM5A 1G6OA 2D7CA 3QPVA 4DCVA 1V43A 1WDTA 2ZYUX 4LJ9A 4RCYA 4XVRA 1XZPA 1DAFA 5KNBA 1DPFA 2CCJA 2QUZA 5CJ2A 1BH2A 2A78A 5AJXA 5CDFE 1NBME 4DSTA 2EWVA 4JLKA 3VNVA 3WMEA 3E1SA 4DLWA 5FPSA 4B32A 1N5IA 3KFVA 4DB4A 4L15A 3UWOA 1OH7A 1P6XA 3VHXA 4PPFA 5DI3A 3ONWA 2ZI5A 3MWJA 1G8GA 2UKDA 4YLGA 5BWMA 4I99A 4XWKA 4OL0A 4FMCF 2YWFA 2F55A 4FMDF 3QSYA 2JEOA 3W8NA 3QI2A 2QAGB 2BV3A 4S2EA 1R7RA 3NIBA 3SC3A 5JWOA 3GLHE 2RGXA 3I8XA 5L3RA 5CIWA 4ZCLA 5GVSA 4E5UA 4E09A 3CWZA 1U8YA 1RFLA 4JLNA 3QG1A 3AUXA 2FSHA 4IDOA 3THXB 2XOKD 3PEVA 2G1JA 1S9HA 5DYGA 1QBKC 4XD7D 4PZLA 2ZRHA 2KWIA 1N6NA 4YQFA 2DWPA 2GEUA 2HJVA 1E96A 1TF5A 1I4LD 1S96A 2VSOA 3AKDA 1KNXA 3I5YA 1COWD 2WM9B 1WMSA 4W5JA 3TW4A 1G41A 1N6HA 2IXEA 1KI6A 2XZOA 3C14C 1AGPA 5EE9A 2B7CA 2VL7A 3NHBA 3MLEA 1AZTA 4LJAA 1AIPA 3GJ6A 1XMVA 5CITA 4LY6A 4NYIQ 2ZVPX 3A1UA 2RGCA 4LZZA 3SJAA 2WSSD 2FGKA 2PZFA 4DDTA 5JRJA 4EKDA 4LSGA 1GZSA 1M34E 3BS4A 1ZJ6A 3CIOA 3FMIA 1E2FA 4C7OA 1R8SA 1DAKA 3LVQE 1PLJA 3DMNA 3AH8A 5SZHB 5JMTA 1OXUA 4Q1DA 1GIAA 4DLSA 2NO0A 1YVDA 2NO7A 3BH6A 2FA9A 4KO8A 1N6KA 1PV4A 1OYYA 1PLKA 1WA5A 3FFAA 3TAHA 3WP1B 5C18A 2DFTA 4AYTA 4IOKA 1LF5A 1XJQA 2ATXA 2IHYA 1LW7A 2PMDA 2W00A 2HDNB 2AFIE 3ZLJA 2GAOA 1J99A 2OM2A 2GJ8A 4NE2A 2Q3HA 3RHFA 4RFVA 3O8BA 3U4QB 4Z51A 3CR8A 1HTWA 1KI4A 3AF3A 4LI0A 2P5SA 2P2LA 5G41A 3CH4B 3VAAA 5M04A 1LFDB 4X8LA 4JLDA 5TY0A 2BC9A 4CVNA 5H68A 1X8JA 5J4VA 5FUWA 3DVLA 1MR3F 1E2HA 1TEXA 4V03A 3CW2A 2VBCA 2WOJA 1GNRA 1VYUA 3FGNA 3K9GA 4IXMA 4NH0A 4Q4LA 1UEJA 1Z6AA 3QF4B 4CW7A 4TMKA 2IYXA 2G88A 3UXMA 5BYJA 3AKEA 5CB8A 4QGFA 3GJ4A 2WOOA 3QXSA 1Z22A 4TQ9A 4PXAA 4UJ5A 1JECA 3ZJYA 4JS0A 3EASA 4A8JB 1NLZA 1Z5ZA 3FVQA 5FL3A 3WYFA 3KZ1E 4OKSA 4BFUA 4KJZA 2JLWA 3EZ7A 2ASEA 2IHBA 4Q00A 5L3QA 5CB6A 2C04A 4QBHA 3DKVA 2YINC 5FTNA 1LY1A 1LVGA 2QTHA 3I8SA 4PHTA 1C4OA 3F5FA 4KFRA 5KNCA 2FEOA 3U6BA 2Q0HA 2A30A 5HKKD 4JL6A 4D26A 3FHCB 1P60A 1XEWY 1ODFA 1M74A 5KOYA 4MKHA 1H8EA 1Z29A 1GUAA 3QQ5A 1B0UA 2KB0A 3AF0A 5SZIA 2OCAA 1X8LA 5L3VA 3QUSA 3OF5A 1FP7A 1OXSC 1CTQA 2F43B 3CB4A 1VECA 2QQ0A 4GI7A 4NDZA 4PC6A 3RABA 4AURA 1XTIA 3KXLA 5BQ5A 2P3SA 1SXJB 2AKAB 3WXMA 4BECA 3U6KA 2XTZA 4G0NA 4A36A 2XB4A 3QKRB 2GRJA 4W9MC 2ORVA 4RZ2A 4A15A 1WXQA 2CXXA 3AB3A 5FOUA 3LX8A 5LB2A 1CIPA 2GDJA 3K9HA 3W3ZB 2YOHA 3OAAA 3S1AA 2Y8EA 3IBYA 3LLUA 1GL7A 1SVKA 4NYMQ 1VCMA 4ZDKA 2QMOA 1XTRA 4E07A 3ADKA 3EA5A 5BN5A 3E70C 3VQTA 2CCKA 1EX7A 4WAUA 1NN3A 2EWWA 2WMNB 3LV8A 3B1ZA 4LDJA 2ZJOA 3TH5A 1EFUA 1ZNXA 2FGJA 4LHZA 4E03A 3A6PC 1L4YA 4TLAA 4DIEA 2J45A 1FW6A 1JQJC 4TWZA 3DPUA 1LTQA 4DVGA 2BBTA 2ZJ8A 3CRVA 1ZM7A 1M7GA 1TF7A 3NEYA 3OIWA 4F93B 1G5RA 1NY5A 4KFTA 2H57A 3VR1A 4AG6A 3CRRA 1CR1A 1XF9A 1G4AE 1CRPA 2X19A 3VNUA 4GMXA 2OE2A 4BE7B 5KYKA 2IYTA 1DE0A 2QM8A 3D31A 3F3YA 2ORWA 4A82A 4PZYA 1GSIA 4OYHA 5AK0A 2RAPA 2HT6A 1MOZA 2A2ZA 3OHMA 3RAPR 4PAQA 1N25A 4TLEA 4B47A 1OXTA 1P2UA 2XX3A 3RWMB 2UZIR 5D3MA 3EZ6A 5GADl 2ZAMA 1SKYE 4FMBB 2ZRLA 5JJLA 2QMEA 3CLVA 4Q1AA 3GCGA 2VHTA 3JVUA 3LXRA 3LAWA 2J5XA 4JLMA 4Q5IA 1FP6A 1Z2CA 4ESVA 4HDCA 3RSLA 1KI1A 2V9PA 1CJTC 1ZCAA 5DE3A 1MO3A 4K46A 3SHWA 3DEFA 3GJ8A 1G16A 2ZS9A 2QORA 2JLUA 4B33A 4MGZR 4IJMA 2EVWX 1GFIA 3HYTA 4TLBA 2WVJA 2JLXA 3UMSA 4A2WA 4PQRA 3RS7A 2AXPA 4A8JC 2IS1A 1ZW6A 4C0JA 2NPIA 5AJYA 1KMHB 3TIFA 5FTKA 2IYZA 4KFUA 1KDOA 4BLOA 3REGA 5FTMA 1OFTA 2YWHA 4IDQA 5K8LA 3NVAA 2VPPA 3K0FB 3DHWC 4HB3A 1G3UA 2NG1A 2OEPA 3KFXA 1XJCA 4G1UC 2QBYA 3K0EA 1QG2A 1AS0A 4LRWA 4AKEA 2AD1A 2GTPA 1IXRC 4R98A 1H8ED 3ZH9B 1DVRA 2GHIA 4DDVA 1VDZA 2IYYA 4PC3A 1D8TA 2ZS8A 3CF0A 1YR7A 2GXUA 2XNDA 3RS0A 1E2LA 1OXVA 1ESNA 3L0SA 4O0MA 4C0AC 3G82C 4Z54A 1KGDA 3IDQA 4QBFA 3PVSA 3Q5DA 4P4UA 4EJSC 4PO9A 3I32A 4M2LA 1NF3A 3VU9A 5BYKA 2W2TA 1ZD1A 1CULC 1FMJA 4Z8XA 4IFEA 1H65A 1M7HA 1P7CA 2B7BA 2ZEJA 1OV4A 2A5YB 3C5CA 2R6DA 4OBEA 4KU4A 2VSXA 4BUJA 4PFSA 4Q66C 2QPOA 3KJHA 4EUNA 1Z0DA 2IL1A 4RZXA 1NMZA 5DI9A 2BBOA 3FKQA 5HCIA 3SYNA 5IHPA 1R6BX 2ZJYA 5JSZA 2PMKA 4OK5A 5BN4A 4ZV4A 2QP9X 4C0BA 2IYWA 1IAQA 2OUKA 2LKCA 1NN1A 4ACAA 1R10A 3VR3A 1KY3A 1M7BA 4J0QA 4D81A 3K9LA 4M1YA 2A5FA 2BMFA 2W6JA 2J41A 4GT1A 4PANA 5KO2A 1YZGA 2GVZC 1XCPA 4Q9IA 4KYUA 3U60B 1EFRA 6Q21A 2H8KA 2O0HA 4ERNA 1OIWA 4IDHA 5FPHA 3K70B 2ZPTX 1QF9A 4P32A 1W1WA 3ZVRA 2HT1A 4LHWA 1DARA 2WKRA 2ZSAA 3TMKA 1L7VC 3K0AA 2IXFA 4NCJA 5EP2A 1KZGB 2A5GA 1VPLA 2XJ4A 3T15A 3W6NA 1TMKA 1OKKA 1U0HC 4DT1B 3PUXA 3AGQA 2OZEA 3GJ7A 1OB2A 4EJSA 1T5LA 1GL9B 2BM0A 2DWQA 4V0MA 2GCOA 1Z0KA 2KE5A 2P6RA 2J87A 2AK3A 4PO1A 1E4VA 2JLRA 3R8FA 3MWKA 2PZEA 4PPQA 3A36A 3BFXA 4C0LA 2FE4A 3CZPA 2VEDA 1G3QA 4HB4A 3U3MA 3GLGA 3HPQA 4DLVA 2OBNA 1KK1A 1UBFA 2R44A 2R9VA 4NYJR 3T34A 4QRHA 5KTYA 1ZUNB 1R5OA 1YZTA 2GESA 2CE2X 2OXCA 2MSEB 2Q6TA 4Q1CA 5E7IA 3QBTA 1XRJA 2C5LA 4BQSA 1X1SA 2XXAB 2C9CA 3ASZA 2IA5A 4XSHA 1T3LA 4LV8B 4OQNA 1AS3A 4YMTA 1D9ZA 2OFWA 4NHOA 3T5DA 4GOKA 3SJCA 2YHSA 3EPJA 621PA 5FUVA 1R4AA 3Q3JB 1XU4A 3U44A 3ZD7A 1C1YA 1NY6A 4RD1A 2EQBA 2FH5B 5CDFA 1NBMA 2OILA 2ZREA 4Q4HA 1ZINA 4MUAA 4YONB 4LUCA 3W5JA 1XXHB 5K8UA 3V4FA 2J46A 5EP1A 2FN4A 2O0KA 2H92A 3LVRE 2CCGA 3SFVA 4HZUB 4RCZA 2XNDD 4R2HA 4URUR 3WP0A 5J4LA 4KVAA 4LJ6A 1R5NA 2OAP1 4W5WA 2J0SA 4BFSA 2QA5A 3KJEA 3MJRA 5L3SB 3R9IA 1GTVA 1S8FA 3LFUA 4MKFA 3EIHA 5FOTA 1YZNA 2CBZA 1Q44A 2FX3A 3T5GA 4C2TA 2IF0A 2HYDA 1L8QA 2I1QA 1EFHA 2VYFA 2D4HA 1G5TA 1E9CA 1US8A 3DM9B 3GQBA 4HLQB 2KBFA 3TE6A 3PITA 3GLHA 1YQTA 5FOWA 2BDTA 2BMJA 3VKHA 1FTSA 1II8A 4CEJA 1NG1A 3MWYW 1F2TA 4BEJA 1NSFA 2J7PA 3T1VA 3ZDQA 1NJFA 4EAQA 1AJEA 2Q3MA 1Q0UA 4OK3A 2PCJA 4WOPA 3EW9A 3VR4A 2ZRCA 4ZKEA 4IDNA 4D4LA 3K1JA 2CDNA 2IF2A 2O8CA 2MMCA 5FPKA 2W6JD 1ANKA 1OFUX 3BB3A 3EARA 4NTZA 1FL9A 1EFRD 3SZRA 2VP5A 4LX0A 2IXGA 5CYOA 1G7CA 2RKOA 3A58B 2R6FA 5TVKA 1SVLA 1U0LA 2SHKA 2ZR9A 1NIJA 3KQLA 821PA 1JAIA 2FJUA 3K0FA 3BK7A 5SZJA 3M1IA 3ZD6A 1UKEA 3HP1A 1XX6A 4JJZA 3F8TA 4PAMA 2ZUDA 4Q03A 2CHGA 4A1FA 4XH9B 1PUIA 3AVUA 1OIXA 1F60A 2WAYA 1OKKD 1A4RA 1EGAA 2OESA 2WJGA 2J1LA 3IUYA 4JIMA 4EQ6B 1I4DD 2JJ2A 4GZLA 4MRNA 4EPRA 3IQXA 4EFMA 4BZXA 3H1TA 4TMTA 4RFSA 4DBLC 4UXIA 4US1R 5J40A 3ICEA 2WIAA 4RD2A 4ON9A 5AJZA 4YXWA 3CWQA 3NHAA 2DBYA 3K09C 3QENA 3BFVA 4G3XA 2EFEB 4Q7LA 1E9FA 2B6HA 3LBHA 4A2QA 1L2TA 4Q1FA 4DDUA 4IEEA 3FFBA 4DLXA 1KKMA 5KDLA 2IS6A 2L0XA 1OT3A 2A9KA 4LYJA 2HUPA 2JDIA 2BIFA 4Q9JA 1E2QA 2G9NA 3CF6R 1XD8A 1GKYA 4GPTA 4M9QA 5E4FA 3RRYA 3TAUA 1E98A 1I4TD 2V3CC 2REOA 4HI0E 4M22A 1XPRA 1GNQA 3CM0A 4HUTA 4JBYA 4TLDA 4ZI3A 4UNPA 3QXXA 1NRJB 3P32A 2ZRPA 3WY9A 3IPXA 1NBMD 4RKEA 2ZM5A 4KI0A 4ARZB 1RE0A 221PA 4RZUA 1JI0A 5J5CA 3MRSA 4X8HA 3TW8B 1SULA 1XFAA 3SBEA 1KZ7B 4NCKA 1TF2A 4P0TA 4AK9A 1JR6A 2O8EB 1Z63A 1QVAA 3GEHA 2XB2A 3MMPA 1KAOA 1MO6A 4IOJA 3TVDA 4AG5A 1ZU5A 4C0HA 3WYGA 2NQ2C 4QBIA 1XD2A 2ZE6A 1M8PA 1N5KA 1CR4A 2ZR7A 4B2IA 4B76A 4C0QC 1KJYA 1J70A 3Q5EA 1W4BA 1TQ6A 1E79A 4PQFA 1G7TA 1RJ9A 1E0KA 4TMWA 3KUDA 4HUQB 2R6GA 3U7EB 3ZZUA 5JI3E 2F1RA 1FX0A 3K09A 1Z28A 1KIMA 3AEZA 4HAZA 4AYXA 5KPJA 2O8DB 1MRSA 4FXPA 1KOFA 1Z08A 4PTLA 2AD5A 5TV2A 3KQUA 5CM9C 1WQ1R 5AJVB 2J7PD 1U0JA 1PJRA 5EZ5A 3AP2A 3IIMA 2ZANA 4HSEA 3K0CC 4JSTA 2IWHA 5JS7A 1AK2A 1Z6YA 4PHHA 1W47A 3PV0A 3OEHD 4UNNA 3WHLA 1LS6A 3CPEA 4DDWA 2LWIA 4C0SA 4PO8A 4PPNA 3KKNA 4QHSA 1VYTA 4B6FA 2WWWA 3M4YA 4JLPA 3CNLA 4A92A 3UKDA 2R8RA 2XTMA 3TSOA 1E2EA 4V0OA 2OBLA 2YOFA 3QKSB 2XAUA 4RVCA 1KDPA 4BFXA 4UJ3A 5GVRA 5F98A 4BFZA 4TYQA 2F9MA 1IOZA 1CR2A 1LB1B 3RS5A 1S3SA 2VH5R 4B3XA 2ZIAA 1K5DA 3THWA 1GOTA 4YC7A 2ODBA 4L5BA 4D4JA 2PT5A 2Q21A 3ZVNA 3FYHA 2RGDA 1JBKA 3QVVA 1GRNA 1JXOA 3RS3A 3IEVA 4DSUA 4OQFA 1Q20A 2JJ2D 1Z0AA 3AKCA 4B71A 3PQCA 3T12A 2GJKA 4D2IA 1KY2A 2EYQA 3HJNA 2P5TB 4LJ7A 2WJIA 4B3DA 4YXWD 3NDPA 3SU8A 1QHHB 2IWRA 2ODWA 5F2EA 3GLFB 3BORA 2AHOA 4KSBA 5FL7A 4GFDA 2QP4A 4LYFA 1XPOA 4D0NA 1O3YA 2BKUA 4OHYA 2J59A 4OI2A 1NN0A 5BW8A 1F6BA 1ZNYA 2C9YA 2JDID 3EC1A 3L0OA 4G5GA 4JYBA 3DM5A 4Q48A 3K53A 3K0CA 3LRPA 3SI7A 4IDPA 2UZ3A 2D7DA 5C46F 3TUZC 2V1UA 5JEEA 5KSOA 2ZYWX 2J0VA 4CEIA 2QRNA 5D3QA 1UJ2A 1QG4A 3B1VA 521PA 1KO7A 5B2ZA 2O8FA 1G5PA 3DZ8A 3W8RA 1OHHA 2W2VA 1YZKA 2G3YA 1O87A 2R65A 3EC2A 3W90A 3SN6A 2CL7X 3HR8A 3WYAA 1N0UA 1HEIA 1KMQA 4IRUB 1NJGA 4QFMA 1IHUA 1N6IA 2CL0X 1W4CA 3SQXA 1RRGA 2ZRAA 2ZJ5A 2CLSA 4WVFA 4CIDA 1R0ZA 1ZM2A 1F3OA 5FI0B 2RHDA 2DHRA 4LYHA 5FR1A 2OT3B 1S2MA 3B9QA 4AKHA 1WP9A 3U3OA 1DELA 5EE1A 4HYYA 4M21A 2AL7A 1IBRA 2DFKB 1NI3A 4MITA 1XMIA 3FKSA 3FWYA 1E79D 2JAQA 5EXSA 2GAAA 3DL0A 2FSIA 2G1KA 3AF2A 1G6HA 1RKBA 2Z43A 1P4SA 4U5XA 1G7RA 2AKYA 4WZ6A 3JVVA 4XOIA 4MH0R 2AWNA 3N70A 3EZ9A 1Q1BA 4JVSB 3UATA 1L4UA 3Q85A 1A7JA 3U5ZB 2DY1A 3QOFA 4TT3A 5FBVB 2YKGA 5IT5A 4MQBA 3LO5A 3ADBA 3EZ2A 4ESHA 2QTFA 1ZVQA 4MRPA 4MYTA 1DO0A 1F2UB 1G3RA 1XP8A 2RGAA 4WZAE 5J4KA 5DIFA 2NPFA 4DCTA 4AIIA 3A1WA 4HLCA 4GDFA 1GRRA 2WWFA 1ESMA 1W36B 4CEHA 1GDDA 2GA8A 2AN9A 2ZR0A 1NMXA 2E87A 1W7AA 5JJIA 2D62A 4Q7KA 3R7WA 2G83A 3AP3A 3UG6A 2QMHA 4BLQA 3LWNA 1IXZA 5CIQA 2QAGC 1NP6A 2ONJA 4ITRC 2QEQA 4CGZA 2J9RA 4Q7JB 1Q57A 2CVFA 2DCUA 2BMEA 5FOVA 1M1YE 2XJ9A 1XEXB 5FBRB 3LXXA 2IYSA 4RKFA 1ZYUA 3EG5A 4AY2A 1Q1ZA 2V55B 4JBXA 2WICA 2ZYVX 1NMYA 4Q21A 4D4KA 2ZUBA 4LK2A 4EPVA 1KO4A 5GJWC 5J4HA 1OH8A 1T91A 2DYKA 2EYUA 1XTJA 5DO9A 1UBCA 2W0MA 2ZI3A 3W3AA 5FOXA 1QHSA 4ACBA 1JAHA 2RGEA 3T1TA 5EXTA 4BRWA 5FL7D 5KDOA 3CKLA 2PJRA 3GFOA 4BFTA 4HUQA 4WXRA 2VF8A 2W58A 2NZ8A 1RRPA 3CBQA 2O8DA 2ONKA 3GFTA 1EWQA 3TBKA 1IY0A 4NONA 2W0SA 2A5JA 2X8AA 3QF7A 3QY0A 1UDXA 2JLSA 1NLFA 2GEDA 1XXHE 2J7KA 3X1ZA 2R6CA 2QU8A 1G8PA 2WJJA 2VHJA 2ZTSA 4HDQB 4GNKA 4Q19A 3ZGXA 2JCSA 1Z0IA 3IPYA 3H84A 4D82A 1GG2A 4KAXA 5IRCD 721PA 3IHWA 5LPNA 1T5IA 4G5OA 1X8KA 4G5SA 4Q01A 4QJ5A 2GCPA 2CE7A 2ZETA 3NBFA 4QBGB 4HB0A 3AVOA 1I2MA 1OHHD 4P4TA 1OB5A 1QZXA 4LPSA 2ANBA 2VP6A 3FE2A 3JZAA 4H1VA 3MFYA 3SEAA 2C8VA 4V0KA 5DGXA 2VP4A 5HZHA 3PEUA 1CEEA 3AVYA 1P9NA 5C4GB 4R2IA 2QAGA 1N0VC 2ZRFA 2YC4C 4P4SB 1GNPA 1WCV1 3MAAC 4QJ4A 4Z8YA 1E2NA 2O8BB 3GD7A 4AC9A 5CLQA 3A37A 1T6NA 3IO5A 2ZUCA 2Z0MA 4BPBA 4BFWA 1DAEA 1Z6XA 4FINA 2GCNA 2ZS7A 4JVLA 4B6EA 3THXA 3HYRA 3KB1A 2ZJ2A 3D8BA 5HKKA 4N3NA 3FKSD 2WJYA 4GOXA 3BFKA 4DB2A 5C1BA 4FWIB 3LBIA 3KKOA 1E0AA 1NVXQ 4ZCMA 4JL8A 4FD2A 1FTNA 4B3BA 2C96A 2FZ4A 3NG1A 1TTTA 1MV5A 3AVXA 1JPJA 4QOSA 3VKGA 4DEYA 2WMOB 1II0A 3I73A 2HCJB 3AF4A 1SVIA 4TT3D 1XZQA 4DHEA 3PEWA 2CJWB 1FQJA 2IS4A 4NYJQ 3TVTA 4LHXA 3KKMA 3W6OA 2WBLC 4BLPA 4JBWA 5FFMA 1Z2AA 1FFHA 2ZI7A 3SHFA 2ODNA 1P75A 4YMUA 1AM4D 2C03A 2EFGA 4KBGA 4TMVA 3THYB 3ZQJA 4IVQA 1XDBA 3FTQA 4IKEA 3IQWA 1VCNA 2CHQA 3WRYC 4DLRA 4BGDA 3ZZ0A 1W36C 3RWOA 3FB4A 4PZZA 3ZS8A 2YYZA 1DAMA 1AKEA 2V6IA 4LC0A 2Z6VA 3V9PA 2CMKA 2N42A 3IILA 4AYWA 1N3BA 1Z47A 1OSNA 4KSCA 4JLAA 1VG1A 1BS1A 4OQMA 2IYLD 5FUYA 4XIGS 3LBNA 3BXZA 1OPXA 2CL6X 4G5QA 3MUFA 2J0UB 4HLUC 5GJCA 3TUIC 3U4QA 3GLIB 1TAGA 5JHGB 2ZRIA 2EFHB 1VTKA 2HXYA 2QE7A 5KSZA 2V7QA 3OEEA 1IQPA 1VYVA 4HAUA 3CPJB 3WBJA 2HEIA 5FUXA 1DO2A 5HZKA 4L8GA 5FBLB 2A5DA 4LBVA 5DH9A 1U8ZA 4PSVA 3TQFA 4JVNA 5IF9A 2D74A 5FTJA 3KQNA 3LD9A 4I1OA 1Y63A 2FFAA 1SXJC 2ZRNA 4TSFA 2V4ZA 1E9DA 3WBKA 1Q3TA 3EPKA 3QF4A 4MA4A 5HCNA 3HU3A 1E9AA 1JR3D 2OCBA 2QMUA 3V00A 4URXR 1E3MA 2QY9A 5UKDA 2BBWA 2QRZA 2XNSA 2ZRMA 4EPXA 4Q7MB 3CNOA 4A4DA 3AVTA 3X2SA 1UAAA 4Q4JB 4LV6A 3L8YA 4N0EA 3DOFA 4A8JA 4A6PA 3EAQA 2GJSA 4GOJA 3KX2A 1TUEA 3EA0A 4B75A 4NCNA 3B78A 3EXAA 3A4LA 1SKQA 1QHIA 4DWJA 4I81A 3LX5A 4LHVA 3K0SA 1XPUA 3KJGA 4MUBA 2RGBA 3O8CA 2GF9A 4F4JA 4NCIA 1YJ5A 2OAQ1 3L0PA 5EP3A 2CEAA 3CRQA 2FOLA 2ZAOA 3ZS9A 4HLUA 2YV5A 1S4QA 1MABB 1R2QA 4QKQA
chains in the Genus database with same CATH superfamily
3IS3A 3QE4A 4JA0A 4KO1S 4KDRA 5E2BA 1N5DA 3BL8A 3A3KA 3HA7A 2H4FA 1QUFA 1P77A 5EMNA 4EVQA 2ZUEA 3OZWA 1PWXA 2DUMA 3OTHA 2Z95A 3V8BA 5EE0A 5A71A 2X23A 3U80A 4C03A 4YB8A 3ICQB 4U02A 1DCKA 2BM9A 2PCLA 4NLLA 5E0KB 2YRWA 2F43A 3E9CA 2ZIEA 3I28A 2OECA 1S1MA 2W83A 3PJEA 3TQOA 5KQPA 3LWZA 1YDHA 4RSHA 2HU8A 1Y9AA 4YJ3B 3EPLA 2LVBA 5BT9A 2BCGY 4IQ8A 2C3UA 4NOLA 4O6VA 1W5BA 3DZIA 4PCUA 1LPOA 2VDLB 4JC5A 4K6MA 1SCDA 4G0QA 1ZOOA 3NGMA 4LGMA 1IEVA 4QTUB 4XGNA 3TLKA 5FFNA 4DLUA 3VU1A 1W8IA 3K6RA 4XW2A 3ODGA 2GRUA 1LPPA 2OYCA 2H5EA 3LUBA 4RZIA 4PC1A 1IJFA 3RS9A 4OQ4A 3PDIA 5AXDA 2FPPA 2QTGA 3TEMA 3UJHA 4BKPA 1BGXT 3PHLA 1MO2A 1QORA 1KSGA 4Y2SA 1B6RA 3RAJA 3S2YA 3ESRA 1SHKA 3ZZTA 4DUPA 2VA9A 3R3WA 4ECAA 5I45A 3O8RA 3RNLA 3VTKA 1DG1G 4FI3C 4DBVO 4I4LA 3OOHA 1ZHHA 4O2LA 1LEHA 3CKMA 1UT5A 1V7CA 3PRHA 4I14A 4KX3A 3SF8A 4R1LA 4WW0A 4MGKR 2OHXA 1NT2A 4KGVA 1AQYA 2OQIA 1WOYA 2YYSA 1WD5A 4BMNA 2C3PA 3A8TA 3GLFE 2VJMA 3OU2A 4BB0A 1HT3A 2CNWA 2NNLD 3AK4A 1QCCA 3EFHA 3PP8A 4RS3A 4XCQA 5CYPA 2ZIVB 4LCEA 2EIHA 1G18A 2XGJA 1AA9A 3OHPA 4DR7B 3D0QA 1ZLYA 1CNMA 4FOSA 2ZUTA 2XODA 1WCIB 4HFRA 2XADA 2I4IA 3MQ2A 5D86A 3ZHOA 4D6YA 3B9RA 1U4SA 4XB2A 1U04A 1RVV1 1WPQA 1PYGA 2QD1A 4GBGA 4DR5B 5HM8A 1ECGA 1T9GS 2V7XA 3NC1C 4FW8A 4GU5A 1NXVA 2YHIB 3T7KA 1YQ9A 3UFXB 1Z36A 4B6OA 4JKIA 4LXTA 1N7HA 3QV2A 3IEMA 4IQ4A 1Z6ZA 5PGMA 1T8TA 4XYMA 1DZ3A 4A73A 5K3FA 4O3MA 3VHRA 4DCGA 5HTKA 1VM6A 3GLQA 1II9A 5DMHA 2CLDX 2R6AA 3N8KA 3TQSA 4DAOA 2DB3A 2PLNA 3ZXIA 2GWHA 4F85A 2HMVA 5CFZA 2YDYA 3MT9A 1F38A 3TPFA 4YRSA 3BFPA 1CE8A 1IUNA 1RAFA 4D8YA 2CBXA 5B64A 3HXQA 2CUNA 2REXB 4XEUA 1PJSA 1TEVA 5U4XA 3PFWO 4MW7A 3WIEA 5L6MB 3BRSA 4WLOA 3CSUA 1TB4A 2IOQA 2A8YA 4YA6A 1K4YA 4NBKA 1ZESA 1ODSA 4B48A 1W59A 1NP3A 1JZQA 1O97D 2NO5A 3AFOA 1OFGA 2Z8XA 3DPSA 2Q62A 3MJSA 4JLBA 2QZ4A 1IZ0A 2IITA 5FNZA 1OW3B 3ZCRA 4D9JA 3N2GA 4P3YA 3ZWKA 1DNPA 1NXXA 5HA5A 4GG1A 2Q3BA 1WUKS 4D8UA 1OC4A 3AQIA 5TVGA 1ITZA 3KWFA 2ZULA 1J5PA 1HQYE 3CE6A 4HY3A 3IKJA 3QMMA 4PYNA 3A2KA 1T9AA 4FMCB 1MQ8B 2AWOA 4A0GA 4C7OB 1WMFA 4UUAA 1FDUA 2QSJA 4MI9A 3I30X 5LZ5A 2XMRA 4EW3A 2UXBB 4F06A 3AEXA 3FPEA 4D98A 1F4VA 2FPLA 4UNRA 3NTUA 2QN6A 1GPJA 3H5RA 3VR5A 1NN5A 4FCWA 2WQ6A 4AD8A 1X7GA 4P4GA 4C4PA 4DUGD 1RYNA 4UFNA 3LSYA 1C2TA 3NOOA 4M0EA 4W9NC 1TKCA 3Q72A 4D0LB 1VBKA 3A11A 4YV1A 5D1HA 4CRWB 1OZAA 1R0YA 4IMPA 5T3UA 5C8YB 3P96A 4G2NA 2QP3A 3URKA 1U1FA 4JT2A 2Z1MA 2MR5A 4ZEVA 1ULBA 4L22A 2VRCA 5BQXA 1PT8A 2VJAA 4KOEC 3DZHA 4QSMA 2B5VA 1GEGA 4I5EA 4CIAA 4M1ZA 2Z1NA 1D5WA 4GHWA 1NOKA 1CX9B 4NWIA 1VHWA 1T8UA 3FUTA 4PWYA 1ECPA 3D59A 3PFBA 1KOLA 3FOEC 4DMGA 4JJAA 2H1CA 5U1PA 2VP0A 1NXWA 3L6EA 4PICA 2G4CA 3BL6A 3EGEA 2P6NA 3PCRB 5DYWA 2BFMA 4YXFA 4BXOA 2W2XA 3BCHA 1V4BA 1AMNA 2Q1UA 5EUBA 1GGFA 5REQB 3L04A 3PD1A 5JCOC 4YPOA 3OHSX 4PX9A 2FPMA 5IC6A 1BE0A 3FJOA 1Z06A 4ZALA 4F2PA 1KPHA 1NKVA 1Z0UA 1DUIA 1M6VB 1ZD8A 2G67A 4IX1A 1WPGA 3AHFA 3RM3A 2QHXA 5HIIA 3ZWDA 4F92B 3NH6A 2ZIZA 5EIHA 1GAXA 2VI5A 4A0HA 4AJOA 4HX2A 2JCGA 1UM8A 4MPPA 4PNEA 1XOIA 2FN3A 1E69A 5ALLA 1XELA 3HB1A 4NV0A 1P1JA 3C1TA 2NO9A 3FZGA 1IPHA 2H18A 4A6XA 1U11A 5JJCA 1E2PA 1OX6A 4B4VA 3CSSA 3IEKA 2M1ZA 4HTAA 2BFFB 1SXJE 4RIFA 2F4NA 5JHHB 3IAAA 1UQTA 2GPWA 2HMSA 4X24A 4B73A 3K35A 1D2CA 2P8SA 2ZPUA 3IQGX 3PXXA 4F2WA 4QUHA 3FMPB 2H6EA 3HBLA 1GWNA 4H3KB 2RB4A 2ISSD 3L9WA 1K08A 2F3TA 3LU1A 4MIKA 4O25A 5TF4A 5IK2D 2B92A 2XA1A 5KNLA 1P8AA 3QBEA 1EVZA 3HJBA 5FTLA 3HADA 2YXBA 3PTLA 4XM2A 1FYWA 4KXFB 4JXZA 1E1QA 3TSZA 5FPTA 3M2PA 1T8WA 5JJKA 3KALA 4EHBA 1C1XA 3BWCA 1UFOA 4ILEA 5I7WA 1H1TA 3ED1A 3LY5A 5IZCC 1U9ZA 4CDRA 3D3KA 1YU9A 5BY2A 1B2LA 2P4QA 3TZLA 1V6CA 1U2QA 1VHTA 3G5TA 4EI8A 1Z8FA 2GI4A 3KPYA 1QIKA 3B5JA 1EHCA 3F0TA 2Y2UA 4X90A 4ZV9A 4L9RA 3RS8A 1V5WA 3FPAA 1ID1A 1W0KA 3R20A 4OLJA 2GN8A 3CU5A 4L8LA 2WKPA 3NT4A 4C4OA 1N7JA 2W4MA 2O8NA 5GP1A 1Z6GA 4CZ2A 3SE0A 1T36A 4OQYA 1V26A 3I2KA 1WZCA 1C9MA 2FU5C 2HJ9A 1W2HA 2SNIE 5AH0A 2O7RA 1EINA 1FTGA 3DYBA 4JP1A 3RYFA 1ACLA 16PKA 3KEQA 3R9WA 2VWHA 4ZA2A 4QTYA 4G0XA 1Y1RA 5ITZB 2IODA 1OFVA 3OSZA 3M6FA 3M6AA 5G4KA 4CKCA 1M1YA 1L7BA 2BZ0A 1Z4KA 4Y2YA 4OIMA 3MHTA 4ZIRA 3N2YA 1RQNA 2WJ6A 4A8HA 4HEJA 2DSTA 5FWXB 3WNDA 3VYSB 1DRJA 4RPHA 2YFKA 1AG9A 4CCYB 1OD6A 3DL2A 4J0IA 2B61A 2OKGA 5EHXA 1C0EA 1VSVA 2AYZA 3B3JA 3OZSA 4O29A 2EBFX 3ACCA 4L5YA 1RYHA 1PUJA 4S12A 1ZP6A 3LLMA 5G0VA 5BNTA 2W11A 4M9SA 1TQ2A 5JO0A 1KI3A 3VUFA 4H7PA 3DWIA 1VG0B 4O2BF 3GLKA 5HJEA 2NXCA 3L1KA 3S1AB 3BL5A 1FRFS 2R6ZA 2F1OA 3NBKA 1BO6A 4KQKA 4NJMA 4B2PA 5K05A 3VVBA 2FR0A 2WPDD 3G0BA 1NFQA 2O14A 4D3SA 1XZFA 4S1VA 2QMYA 1PQPA 3NEAA 3UOAB 2F2TA 2QK4A 2SCUA 3ETCA 5A4JA 1RKUA 1ZSNA 3OPYA 4ZYVA 1S2OA 4HWSA 3LH5A 4RD6A 5LOVF 2CD9A 2QAJA 4HV4A 1JJIA 2R5FA 1P1KA 2PL3A 1B0ZA 4Q3EA 4WL0A 1G9XA 1C7JA 4DARA 2XYQA 1YNSA 2XB9A 4QT0A 2DFLA 1DDIA 2PKCA 3G6KA 3IOMA 4JASB 4B3IA 2YW9A 5DPMA 1ZVVA 3U48A 3VNSA 4B4UA 1P4JA 3O1HB 1H4VB 1C7QA 3EFEA 3AJ9A 5LKAA 5M3BA 3QPBA 2ZYTX 2ZSHA 1PJ3A 3LJKA 3WGVA 1V39A 2EZ4A 1B74A 1E1CA 2FF5A 4Q4CA 3UXHA 3UJ3X 2AF4C 4H7JA 5U4QA 4EA9A 2W8BA 3UUGA 1I7PA 3HJTA 5KOJA 4YCDA 1KNQA 1BAPA 1RVDA 2V59A 2NMVA 4YMWA 4UUQA 5CDHA 4WIAA 1E64A 5JNLA 1AXEA 1PQYA 5DISB 2LV8A 4QPPA 4BMCA 2C77A 2I99A 1NV9A 2ZRDA 4AI6A 1P4RA 1ZRSA 4QJIA 5D3MB 4OREX 3TRFA 2XNHA 2OHIA 1KEUA 2ECFA 2QYTA 4QL3A 3ZI7A 3ZWYA 2WVGA 4C21A 4FGKA 1SQSA 3LY8A 3SR0A 3FYDA 1XU9A 2OK7A 2V0CA 1WY5A 1W5TA 4FWTA 4R8RA 1U9IA 4KE8A 5BYAA 1UKYA 3TNFA 2NZ2A 2OHHA 1KAQA 1JQ3A 1T8SA 2CHVA 1ZN9A 2ZKIA 5KWEA 2OG1A 2IFTA 2H1SA 4RABA 4P3PA 2F9FA 4EPTA 4P33A 4FSXA 3WLHA 5JAOA 2DTDA 5EWMB 4XYEA 4IFBA 2XBUA 4KQMA 1L8LA 3PG5A 5CPBA 4D6PA 5HUQA 3V4RA 2OTCA 1N5JA 1YRHA 2CT8A 2QPTA 4BE4A 4UBKA 3PXGA 2QRQA 3H97A 3K92A 4TTQA 4BNIA 2C5HA 4Q3KA 4PX2A 3TLZA 3NOVA 3T4PA 2GN9A 1T4DA 1DKRA 4M9CA 2K4MA 5E2IA 1E9BA 5B57C 1LRLA 1KEVA 4UXHA 2ZT8A 3STYA 4C4TA 1NLYA 2UUBB 2X58A 4K7JA 1YR6A 1JDBC 1M5TA 2CYAA 2OZVA 1SCUB 3H86A 2PLRA 3QQPA 2PGNA 1BE8A 5DLDA 1U0OC 1CS0A 4NU8X 5AW3A 3UJBA 4WBSA 3KKLA 5EHNA 3RC9A 2Z9CA 3GUYA 3ID6C 4X20B 4YAWA 1NVFA 1EB9A 4C30A 4J8PA 4DLZA 4RA9A 2C7PA 2JFXA 5AI6A 1Q0LA 2HK6A 1QRAA 5A4DA 2XE7A 4RPGA 1KI8A 4DRXB 2B8EA 3DVQX 2VP9A 2R1UA 5EJ7A 1QE5A 4M38A 1KDVA 1SC1A 1ZI9A 3WGHA 5J5VA 2G5TA 4I50F 1OXXK 4G5XA 5DM1A 2V65A 3PXDA 4GZ6A 3FBGA 2ORIA 2M32A 3EUEA 5KZMB 1E9EA 1MO4A 2Y1GA 3T1YB 2VJDA 2G6BA 3VU9B 1U7UA 3KV1A 4PBRA 4V02A 2D6FA 5FFFA 4CL3A 4TMXA 1HSZA 5AOBA 1AKTA 2HKIA 1QIHA 1Q2UA 2P9YA 1PS9A 3TCKA 1BCRA 1DUSA 4ZOCA 5JARA 3E6AA 2PXXA 2HCTA 4MROA 2JFNA 2GPJA 1X0XA 4DC0A 3ZCPA 2D3TA 2V6BA 3A4MA 1A5BB 3BK1A 5KKNB 3MIIA 3ZIAA 2Z5LA 2WSBA 4QREA 1D2EA 2AZTA 4MIEA 2HJHA 4XTCS 5F2OA 1G20E 3Q6MA 1TCCA 2JL1A 1HDRA 1D6SA 1YJBA 3PKJA 4LYDA 5BV8A 3FGOA 3TW8A 5HUHA 1X2EA 4MUFA 1N2JA 4XGIA 4D45A 2DMRA 4QM6A 3TBHA 5EE5B 3W0LB 1UZUA 5L40A 1VHJA 1IBCA 3D3WA 3IEXA 1RR6A 4K6FA 1P61B 1IONA 1O94C 2AYXA 1K63A 3AUTA 1WZIA 3V8NA 1H2XA 1PR0A 1KQGA 3K6JA 3MJVA 4GMGA 1SGWA 4F12A 1Y9JA 5KJ6A 4J94A 1FFYA 1QHNA 4GOMD 4DQVA 2C88A 3G5UA 4KV9A 4ZT5A 4F5ZA 2PKEA 3CNEA 4U5QA 4X1KA 1SNYA 1OASA 5FLKA 4L50A 2J30A 3VR2A 4B3HA 4CPDA 4C14A 2P6UA 4G4GA 1U4NA 1VMDA 3K72B 4G81A 5EE3A 1JLHA 1E4OA 1H66A 3X0DA 4B1FA 1S89A 3H11B 1TYAE 3P0EA 3QG5A 4IQFA 4J1SA 2QLNA 4NG4A 4P81A 2R4QA 1NW3A 2I1LA 2ZE7A 3AIIA 4UXJA 4QVGA 4B74A 1O0CA 1ULZA 2EZ8A 4AMVA 1GVNB 2JPDA 4NE7A 3KZOA 3QFHA 4OI1A 3ONNA 2Q2QA 5AK5A 3ZOZA 4EPYA 1CEXA 4C87A 1G8FA 5G0WA 1UKZA 5LMCA 1E1KA 2BEJA 2O2CA 3AUAA 2C9MA 3AJAA 3SZUA 1V4VA 2RGNC 1X9GA 2WW8A 2ZWAA 1QNFA 2X5JO 4R40A 4ZO8A 3EULA 3GG9A 5C31A 1PSDA 1Q17A 1UAYA 5G02A 1T3HA 1BCSA 3GLGB 3WMGA 5KMGA 3LPLA 5GJVC 4Z4HA 3WRWA 2WWHA 4NYIR 1FFXA 3CZ9A 2ZVQX 2V3WA 4WK0B 4AZ3B 3T41A 1WPXA 4S05A 2P67A 1AF4A 2ZDGA 3AHJA 2GKGA 3MSXA 4IO0A 4NPHA 2WIFA 4LTNA 2VQFB 4DJFC 4N48A 1A82A 1E6KA 4RK1A 1RC1A 1JFLA 3HEAA 3BYZA 3TL6A 3RTEA 3ZTYA 3RRMA 2VP2A 2WUGA 3K94A 5DJ5A 1KH2A 4EMBA 2NV6A 3GJQA 1Q6ZA 3GEPA 3IUBA 2XF2A 3C3WA 3QLVA 3HMKA 4IVPA 3O8QB 1U7PA 4PGHA 4V2UA 2WB2A 4TXMA 1D04A 1HFWA 2AXNA 2JLCA 1OGJA 2IUYA 2PNFA 1P5JA 2PS3A 2Q5FA 2ZRKA 4NBWA 1EEHA 3MELA 2QRGA 3HI4A 3T3PB 4ZMBA 1PL7A 2GBPA 2IRWA 1KH3A 5A9TA 5JXWA 2C8KA 4J7CA 4KVGA 2E0IA 2ZE5A 2J3EA 3U44B 1PN3A 3OZXA 5CYFA 4C7VA 1NR7A 3SVZA 4W1RA 3PPXA 4NL4H 2C4MA 5TE9A 4ZDJA 1KK3A 3NH9A 1BJKA 1PQUA 4PPGA 2DERA 1T4GA 3O9ZA 4L8YA 1J8QA 3TG2A 3F1KA 5LBIA 4YMHA 1CP2A 1G19A 1QHHA 2JKYA 3BILA 3DLIA 4KWHA 4QPZA 5IN5A 3U39A 2QJWA 2ZLBA 4RVOA 5HE9A 4B2LA 4BX0A 4YAUA 1N2SA 1SVOA 1WJGA 2NZJA 3TKAA 1QFMA 2FWAA 1SKUA 2GYYA 1RS0A 1I4EB 1ZMXA 3EB9A 1FSZA 1KY4A 4TTIA 3U2QA 5CK5A 1WUYA 4Z7NB 3ZJ4A 5JDIC 1HT2E 1UZNA 4JBIA 1PL6A 4K81B 4O4JB 4R8SA 5JLJA 2AJDA 1E0JA 1PNQA 1GY8A 3ONDA 4C05A 1GZDA 5AHKA 1U8AA 4B8WA 4DZTA 2VPQA 4ETWA 1P5ZB 2JZOA 5H9VA 3KQKA 1VZ2A 4OJTA 4RF3A 4OLHA 5F3WB 1U1EA 3WMXA 4LJSA 4BO9A 4RX1A 1R0LA 3LYUA 1NAHA 3GLHB 2FDXA 2IPOA 5DTJA 4HDNA 3TXAA 3UWMA 1IVSA 3Q9LA 2YZ2A 4EKYA 3WWZA 1E2KA 3JQ7A 3Q87B 3U4GA 2NOAA 5BR1A 2PZMA 3FOZA 2WHPB 5G0UA 5A4FS 1EDDA 2F3RA 3FZNA 3F9RA 5JZBA 3U62A 4UQOA 2HRQA 5JYBA 5LD2B 5ANRB 4Y30A 1EVKA 2SKCA 3VSAA 1VYHA 4OAPA 4F1WA 2I65A 1C3VA 2P9CA 3DUFB 4MCHA 4ND8B 4JB3A 3ENKA 4DIUA 4ZQIA 3FNHA 2E5LB 1XZEA 1E7RA 4CR6A 1KP3A 1N8TA 3W04A 1AT1A 4LRQA 3F71A 3FNEA 3SDBA 2F48A 4E31A 4QQFA 4G5RA 3RODA 1BVRA 3WKAA 1PFGA 3CMMA 3MB8A 4UFPA 1KYZA 3NNSA 2CK3A 2XRFA 4N7JA 5P21A 3U81A 1GLVA 4RCVA 3GJZA 4BLSA 1XN1A 3U49A 1EFKA 2D2FA 2FHSA 3ZU4A 4DSAA 2O23A 2X6QA 4MQEA 3G0IA 5TNXA 1VBNA 1XDGA 3ZZ1A 1FF9A 4K9QA 2WDZA 1XROA 2YVUA 3P52A 1LSJA 1R88A 5AW4A 1T5DX 4L5CA 3S2IA 2DFNA 2RHMA 1C3EA 3DHYA 3U19A 1JS1X 1A1VA 3MCUA 2VF4X 3MD9A 1ZRMA 3WWPA 1WEKA 3IYLW 5I3CA 1JXQA 1Z07A 3L0IB 1COZA 2FR8A 4X5OA 4YQZA 1F9AA 4XQGA 4CQLA 2ST1A 3S81A 1HBJA 5BW4A 5CG2A 2BMWA 3BIFA 2X0NA 4M4SA 4MQMA 4XVQA 1ZIPA 1JFFB 1YIOA 4AUMA 4EECA 4IINA 4ZHQA 5A4IS 1O08A 4G5YA 3L4SO 4RQTA 3W1EA 2P3QA 4I9UA 5BR7A 1QHGA 1E1NA 2HR1A 2CDRA 1N57A 4IHJA 4PFQA 3ZVLA 5G3YA 5TQ0B 4D4MA 2VDOB 2WIKA 2OZLA 5JAHA 5DN6D 2OPHA 2UYOA 2JZNA 1TK9A 1XNQB 2YNMC 1UJ6A 2D3WA 1BFKA 2RIRA 4HBGA 2F67A 4MUXA 1AU9A 1VL0A 4ASUA 2JKVA 3SYTA 1LGYA 1BMTA 5AJWA 1RQ7A 1OLUB 3QOWA 3TM5A 4BVHA 5JNRA 3MFQA 3B82A 2JIOA 4HNGA 4UKDA 4MQFA 4U7DA 3OAAD 1QE0A 1MOQA 1ZH4A 1YB5A 2MSCB 4M1KA 1TI7A 4RD3A 2FSGA 1QIFA 4BAUA 3ZGYA 1YBMA 4Z1MD 3KYCB 2PO7A 2O7QA 3MGCA 2RBGA 2WHXA 3RB8A 4NYMR 5KUTA 2R0QC 1MNQA 1PFUA 1R0WA 2RHRA 4PE5B 4TYYA 4KMOA 4HDSB 3RWBA 1AS2A 3TJRA 4GP7A 5C80A 4MIYA 2POCA 4NZYA 4O4LA 4HN2A 2VDKB 2GZHA 5GJBA 4DLKA 2VDWB 4AQ7A 1WF3A 2OB2A 2NU8A 3PDJA 5DCUA 2BEKA 4F86A 3VYWA 3VJKA 2C94A 3PC6A 3S2ZA 1XCGB 3Q3IA 4S0ZA 5CCEA 5JAPA 3DO8A 3HJCA 1E8NA 3M83A 2PR2A 3GGSA 1BIFA 5EXDA 1XB2A 5TPWA 4FZ5A 5E6UB 3PXCX 3C7CB 3H87A 2O0MA 3HU2A 1K68A 1NDHA 4GWKA 4KDCA 4KQJA 4HAXA 4KQEA 4CLXA 1DADA 3JW8A 4PSAA 3AHDA 3L92A 1ZAKA 1IBMB 3V8VA 2FEXA 1R9MA 5ICCA 3USZA 2XHEA 1AO0A 3FFXA 3SYKA 1JQEA 4I3HA 2O5VA 3RK1A 2CVPA 2VTEA 5DW3A 3FPHA 2OBFA 2PZGA 2AI3A 3B1YA 1JAXA 2H16A 2RJ3A 1MQAA 3KUCA 1NKTA 1RWVA 2P78A 1JXMA 3N53A 4V0QA 4CCWA 3H5LA 3DZJA 3E48A 2IZ7A 2Q9BA 3MRTA 2WHYA 3FWZA 1VE3A 4G23A 1N6PA 5FNVB 1H5NA 3I1FA 3GNLA 1GZ5A 4PZUA 2OCYC 2WWIA 3VYRB 3J7AC 4QGAA 2E1RA 4BY9E 1PVOA 3QYPA 1RC8A 1NQVA 3SJBA 5BVHA 4MS4A 1NL3A 5EJIA 5A02A 2Q1XA 2VSQA 4ZTZB 3U61B 1UXGA 2BFDA 4Z0PA 4O02B 4V1CA 4PNPA 2A59A 4JLJA 4EHLA 2A9JA 3UY4A 3TZ6A 1XV5A 4FB5A 1WXXA 4ZDWA 1NVUQ 1JR2A 2X8LA 2NO4A 3E9DA 3BK2A 3HVIA 4YUZA 4P4SA 4DWOA 3WAKA 4FE3A 3WLTA 4BQEA 4HB2A 4WOCA 3F7NA 5JECA 1OE0A 2BZGA 4TZKA 1GR1A 2Q4OA 3OMXA 3R3JA 3NJ4A 3VC7A 3H5VA 1KQNA 1AD2A 4K9LA 2DECA 3DXXA 3NETA 3W5SA 4CMGA 1KFJB 1N2EA 2D1YA 1RAGA 5FPPA 3LQYA 3I12A 2QIPA 1JEQA 4LJ4A 5AI0A 3WNQA 3OFND 4NP6A 2OA0A 1HRDA 1W93A 4F4CA 1U8UA 1GHTA 4NFHA 1V9LA 4YFVA 5FRDA 3V97A 2JBHA 3LUKA 3R6WA 1QVRA 1Y3HA 2O0JA 3Q8WA 4R8KA 4W1SA 1CXZA 1F4PA 2IOHA 2AFHA 3QJGA 3K5WA 1GA1A 3ZD9A 4BWYA 2IT1A 1I2ZA 4QOEA 1Q1EA 1RZ3A 4UAGA 5JANA 3U4MA 1BEZA 1RWOA 5DT2A 5KJEA 4NICA 1YCGA 3Q7QA 4J0FA 1Z39A 2CJWA 2GBIA 4MVJF 2RONA 3JWIA 2CDAA 1S3IA 4J16C 1HNWB 3HU1A 3MOSA 3BZBA 4JJGA 4PHFA 1CUJA 4RA6B 4JQOA 3RVPA 1HM5A 4N5LA 3ELYA 3BMOA 5JBQA 3NI2A 3F6RA 1M6WA 1FFSA 3T9FA 3RRBA 1ND6A 2FW6A 3FCYA 3MBKA 4Q39A 5C1PA 2WF9A 4LE1A 3LW8A 5K6AC 1A98A 1PNOA 2AH5A 2GZ1A 3L0YA 3OZBA 1M76A 4OKNA 3DWGA 3DDZX 4IS2A 5AIAA 1KU6A 2HA2A 4H60A 3WRXC 1QH1B 2EQAA 2C2XA 4M55A 4MVJM 4PC2A 1P5FA 3W3AH 3U3KA 4FEGA 1XTSA 1P2SA 2WSIA 1DCFA 3D64A 3PHJA 2UZ0A 3VJRA 1LSUA 3JQPA 4QYIA 5EXEA 4CEIB 2HLDD 1A2BA 2C42A 1M6NA 1E3DA 1Z88A 2QMZA 2W6ZA 4OQLA 3RDPA 3BVPA 3KR2A 2FKNA 2XR1A 1RI1A 3AY7A 3TX6A 2O8FB 1XFDA 1KAMA 4ENUA 1C81A 3BE4A 4LPKA 4EUHA 4EIWA 3SQWA 2J0UA 1P0MA 2IW1A 4E7OA 1Q1AA 3GLIA 1AGXA 4TOIA 1YRAA 3I5AA 1SIWA 5HIKA 2OVFA 2QUIA 5B3LA 1UEIA 2FZLA 3WGYA 4LEIA 5TC4A 2VDUE 4R7ZA 1E9SA 1T3SA 2JJ1D 2XEDA 4IG9A 4QYTA 4B0OA 1Z75A 3KOMA 1BMQA 1EZ4A 4TTPA 4OI4A 4CQMD 4YLYA 1FDSA 2JCYA 2UYGA 5D7BA 3TLXA 4F8JA 4URVR 5MN4A 1F4LA 3MINA 1Z15A 1NUUA 2BD0A 3BH7A 3NDIA 3O3CA 4FW9A 3QU4A 5E7MA 2BH2A 2ATVA 3B8EA 3HJAA 4A10A 1ZU4A 5HXAA 1MOSA 4REQB 2E49A 2I3DA 4AX8A 2AVDA 1SQ6A 3ABIA 4G1BA 1UPFA 4XD7A 2KLHA 4J03A 2AFVA 4R31A 4RHXA 4X8OA 3CW9A 3UGKA 2E4AA 4V2IA 1BMFD 3LFTA 2ID8A 3RF6A 3AR3A 3PUYA 1CUAA 2W8ZA 3B7GA 4DDTA 1KDTA 4OEHA 5AK6A 2GJAA 3VOBA 4B34A 2GLTA 3V42A 3WWOA 1QQ5A 1E2DA 1J90A 2JFQA 1ZN8A 5LP6B 5ALGA 1MDFA 1R1DA 4JDUA 1C2YA 2QM7A 1EI9A 5T4BA 1J7JA 2AFIA 1ZFNA 2VKTA 3HP4A 3TK1A 1GUYA 1YS4A 2FHPA 3L7DA 2WSSA 4E4TA 1UADA 1JQLB 2WV7A 1MDBA 3HPRA 5K8IA 2IY9A 3T3GA 1V8FA 2FUEA 4MWBA 1C0IA 4D41A 2DBRA 4ZOLB 1JT2A 1G1AA 4K86A 3PEYA 3GBPA 1TVEA 4ILKA 5CVVA 3DTTA 3QA9A 4QXPA 4ZZ1A 5JCPA 1KYVA 4MW5A 1Y6QA 2ECKA 1VMEA 2HHAA 3RS4A 5H80A 4GZ3A 1Z62A 2QUKA 3O2SB 2Q5EA 2GNAA 4J49A 5C37A 3TBFA 2E4XA 2B35A 3P26A 1G3IA 2Q2VA 1TUIA 3Q6NA 5U9CA 3OESA 1X38A 1CB7A 1T9HA 2NXWA 2VQSA 1YDMA 3R3XA 5I9MA 3R7WB 3ZU6A 2V7BA 3ZY4A 3B1XA 3IR6A 3LUPA 3F7MA 2IXBA 2CKMA 4I55A 4E4RA 2JFPA 4YDQA 1EFVA 4DCSA 2QUHA 1GKIA 5EKTA 2VDQB 3NNNA 5I6DA 1VCHA 2O1WA 2B37A 2PVPA 2PQ2A 1R5BA 2GK6A 2IE0A 4MUNA 3C97A 1RRFA 2PX0A 1ZEMA 4WK6A 3JV7A 2OL4A 5KQMA 2B8WA 4ZC8A 1YTUA 4MWEA 3L7AA 2EP8A 2AZDA 2IBMA 1MVLA 2JANA 4GPIB 3TKYA 1U2TA 3N7UA 1Z4PX 2OZKA 4RMGA 5AJTA 5IC4A 3QPVA 1B3RA 4UDYX 3OU7A 5JMWA 4Q3DA 1ESCA 1ZK4A 5IXSA 4L7VA 2QNBA 5GONB 3RVRA 4J9UE 4DWVA 2CCJA 1ZWKA 5CJ2A 1EJ2A 1OWOA 1NBME 1IMJA 4DSTA 1XU7A 2PRKA 2EWVA 4JLKA 5ALYA 5IG2A 2BUCA 1FVFA 3RLIA 3WMEA 2PG3A 4FC7A 1TUBB 4DLWA 2FSPA 1QP8A 1Q0RA 3GZJA 5CIYA 5DM2A 4PBSA 3KFVA 4F60A 3O73A 4R3WA 5DNAA 1TTQB 1OH7A 3JTMA 4PG4A 1P6XA 1IHXA 5DI3A 2AN5A 3VR4D 2PSEA 1HYBA 2K7ZA 3MWJA 3WLMA 3M34A 1RPTA 4TKZA 2KHZA 3HVRA 4ZVOA 4YLGA 5GZ1A 1PWYE 3L40A 4TUYB 3F4LA 5AKYA 1ISGA 3LHSA 4RXUA 3O82A 4L02A 2Y77A 2BI4A 4RPKA 2B2XA 3CN7A 2J3JA 1FMCA 3EF0A 4S0XA 2P90A 3TFWA 3UT5B 5KB3A 4S2EA 3SC3A 3BHMA 3BIWA 2HBRA 2AJLI 4JB2A 5L3RA 1TD9A 4MVJD 1PKXA 2ACKA 3BHNA 2YV2A 1PSZA 1ZJYA 1NURA 3CWZA 1U8YA 1RU3A 1PS8A 1RFLA 4B87A 1EWKA 3QG1A 3L01A 2NQTA 4JC0A 3PNMA 4H4DA 1XXLA 4IDOA 3DE4X 3PEVA 4BCDA 2FPRA 2G1JA 2C5AA 4YREA 3ZE9A 1YJQA 2PTHA 1C7EA 3P0IA 4L9AA 3S0JA 3CB2A 1N6NA 1Y7IA 2G09A 3TEJA 2IH5A 2GEUA 2HJVA 4P7BA 1E96A 4MPDA 3TMYA 2VSOA 3W06A 1TJPB 5BV2P 1WAMA 5IU6A 1COWD 2SECE 1RLMA 1AUVA 2R60A 4WOKA 5I7AA 1V5FA 4CKBA 1BSVA 4IGEA 1M73E 3RE1A 4AXXA 1EUYA 1DAOA 4JIGA 1KI6A 4FOLA 1Z6QA 2XZOA 3HM9A 1AGPA 3V2HA 2JJYA 2VL7A 4QLAA 4XVHA 4JI5B 3WHIA 2Q3LA 4LJAA 4RELA 3GD5A 3LQFA 3ZIDA 3GJ6A 5IJ0A 2XYPA 1UFVA 5EMKA 5CITA 4NYIQ 3COJA 1I4OA 5HDQA 1Q50A 4HADA 4UBNA 1FUIA 4MLPA 2PZFA 2HMTA 3H8VA 3R2JA 3DT8A 1GZSA 1SUWA 4LJKA 3ZY6A 3FYUC 3ZOKA 1G8KA 5LMUB 2XCSB 2TECE 2C83A 1R8SA 2WTEA 1I33A 5ER6A 3JYQA 2E3JA 3PJGA 1FY2A 2RCYA 5FO0A 4MB6A 4ZAFA 1ZK3A 1PR3A 1VBFA 1DJOA 1QTIA 2AB0A 3WQQA 5B1EA 3N2LA 4DLSA 4DW8A 4INJA 4JAVC 4WA8A 3ETJA 3FM9A 2WP0A 4GWLA 4R9SA 3AF5A 1BXZA 1QC5B 2FA9A 1A1SA 3E3LA 1N6KA 2MR6A 3STHA 4DHWA 1PV4A 3TAHA 3WP1B 5C18A 5A6VA 3O2QB 5KJFA 4L6CA 4AYTA 3W2FA 3PC3A 2H5LA 3LVFO 1Z5OA 4PYIA 2ACVA 4IF4A 1P2GA 1VP3A 2PMDA 3C48A 1LW7A 2XCIA 4TWRA 4DCCA 5D5HA 1H69A 2QQFA 4FX5A 4RXMA 4CUJA 1DWPA 4CGYA 2VHYA 1T6ZA 3AT1A 3LY7A 4CV3A 4O2AB 5E6RA 4UMFA 3N8DA 2I7VA 2Q3HA 4FC6A 3RFFA 2OGSA 1R16A 5JBNA 1E7WA 4MI3A 4KN8A 1DT3A 4LI0A 1O77A 2P5SA 3CV3A 2P2LA 3KWMA 4RORA 5G41A 1UL1X 2RBKA 4N3CA 1BVYF 4F5EA 2IEGA 3AJRA 1C9JA 4V0RA 3N3AC 5BW6B 4R2LA 3T3DA 4HCJA 4I1IA 3UA3A 3CVWA 5KNBD 1DTWB 4UM9B 1V5EA 4MV0A 3OOYA 3FD8A 4GXQA 1HX7A 1MR3F 1E2HA 3Q41A 1FK8A 3C8MA 3WE7A 4HT3B 4ML3A 2Q1WA 4MS1A 4Y9TA 1X7XB 2ZT6A 1LX6A 1NZJA 4TTJA 5T8KC 3HCDA 4CG1A 4O0LA 3H9UA 3WL4A 4GXNA 1CETA 1YXMA 3D3NA 4MKRA 4MUIA 3ZE2B 2PBLA 1EVLA 2G88A 4FGUA 3AKEA 1XDDA 2BGTA 2YVAA 5CB8A 2XNJA 2YXEA 4LJLA 1T10A 5CA0F 2PSSA 2D1QA 2WOOA 2BJHA 1ZH6A 2XOEA 3SS7X 2C2KA 1JECA 4JS0A 2WYVA 4PYMA 5E3IA 3T7SA 1GZ4A 3A6JA 3ENNA 5LXTF 1JLLB 3GK3A 3S5JA 3D6JA 1JIXA 5JXJA 1Q6YA 5DMXA 1JHZA 4BB6A 3KUUA 2BUBA 4QBHA 1VGQA 2HY7A 3PQ4A 4E30A 4FEYA 1F6WA 2HIHA 2Q0SA 3WK7A 5CBPB 1XHFA 2QR2A 3IQHX 5K9ZA 3KU1A 1NQAO 1OVGA 2ZGVA 5BQOA 2FEOA 3ZV5A 3TD9A 2GASA 2Q0HA 2A30A 5K5EA 4JL6A 3G0OA 3A3PA 4NNJA 5B36A 3FHCB 2IU0A 3FZYA 3OJLA 1ODFA 5ABPA 3GVCA 4MKHA 2RGRA 1Z29A 4G0WA 1B0UA 3AF0A 4RGYA 1MX9A 2Z3VA 4GOOD 4ZU1X 3W8FA 5L3VA 1EHIA 5FULA 3HEBA 3PPIA 4Q3OA 4XLZA 5IKXA 2F43B 4J1NA 1UBRS 5D5QA 1C4WA 3DXZA 3OVMA 4JQSA 5E4TA 1MZPA 3F3MA 4Z3KA 4FNAA 1XTIA 3UYLA 2XKJE 1W6UA 5BQ5A 1O95C 4IJWA 3WXMA 2H3HA 2YCLA 3P94A 2CLHB 3GG2A 1U3GA 1R27A 4ENWA 3G2OA 3AB3A 3RFTA 5EJ2A 1UXOA 3ZDBA 2QL9A 3D4NA 5HKOA 2NXNA 2GDJA 3IP8A 4LQ4A 5AHWA 4IDCA 1WDKA 1SCQA 1EVJA 2OGZA 3D0KA 3W3ZB 5LYYA 1HTTA 2EFYA 2YOHA 3OAAA 4ZVQA 5HIJA 2I33A 3LCRA 3LLUA 1GL7A 1ULUA 2FPPB 3PDIB 2QZPA 4NYMQ 3TGLA 4EKNB 3UJDA 4E07A 3ADKA 3EA5A 3MS4A 5BN5A 2HW8A 1CZRA