2ZTSA

Crystal structure of kaic-like protein ph0186 from hyperthermophilic archaea pyrococcus horikoshii ot3
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
216
Chain Sequence
PVRRVKSGIPGFDELIEGGFPEGTTVLLTGGTGTGKTTFAAQFIYKGAEEYGEPGVFVTLEERARDLRREMASFGWDFEKYEKEGKIAIVDFNVDNFLRYIYRVVKAINAKRLVIDSIPSIALRLEEERKIREVLLKLNTILLEMGVTTILTTEAPGKLSRYGIEEFIARGVIVLDLQEKNIELKRYVLIRKMRETRHSMKKYPFEIGPNGIVVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Atp-binding protein
molecule keywords Putative uncharacterized protein PH0186
publication title Crystal structure of KaiC-like protein PH0186 from hyperthermophilic archaea Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 73
structure length 216
sequence length 239
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ztsA00
3VNUA 3EC1A 3UATA 3DHWC 2ZE5A 3FHTA 5EE9A 4PC7A 4Q4HA 5TV2A 3ICQB 3HDTA 4TQ9A 3FKQA 1U2RA 3CZQA 2QMUA 1BO6A 1W4CA 5ELXA 5J4HA 4D80A 4OHXA 2CCJA 4JYBA 2DB3A 1XD2A 3BRWD 1OW3B 3SHFA 1CJVC 2WJYA 3FFAA 3HU3A 4I81A 2ZRAA 4ZCMA 4DLXA 2BBOA 3RRMA 4RY2A 1X3SA 2G1KA 2QA5A 2Z83A 4CVNA 1EWQA 4IHQA 2FSGA 1G8HA 5G40A 4FCVA 3GEEA 2C9YA 1KK1A 4GZMA 1CS4C 4HDCA 4LPSA 1G6OA 2J9RA 2HV8A 1XB2A 2ORVA 5FOVA 4TYYA 3LV8A 3QIAA 5FL7D 4RKFA 1CLUA 3I92A 4FW9A 3ADKA 3EXAA 3REFA 1G5TA 1XZPA 3JZAA 3QXJA 1EG7A 2X19A 5K8LA 3NKVA 4ASUA 1N6OA 1QVRA 2ANCA 4PQYA 4Q01A 4DIEA 5KSOA 1FOEB 4Q9JA 5E7MA 2FPMA 2W0SA 3TUJC 1T4GA 1KGDA 2ZE6A 2ZRJA 4NCIA 1MRNA 3LLMA 2RGNC 2Z43A 3NHBA 3AKCA 1ODFA 4LJ7A 3L0SA 4QGHA 5A4JA 1IJEA 4GDFA 2IUSA 3BB1A 1DAEA 4IEIA 4DLWA 3CX7A 3Q85A 4QBIA 4M1MA 2VP0A 3M4YA 3OIVA 3SNHA 1SXJD 4XSGA 3KKQA 2PEYA 3D31A 1M7GA 2C78A 4UJ5A 5CK5A 4MGKR 4OK6A 3SZRA 2F3RA 3W8NA 1G7CA 1NIPA 3E1SA 5E3HA 1JR3A 3GFOA 2ZRBA 3NTUA 4GT1A 3RS3A 3NDPA 4UXJA 2HEIA 4CIDA 5KNCA 1AKYA 1AS3A 1T8UA 3HYTA 3TE6A 2QG6A 2ZRCA 3BFVA 2O8EA 2NMVA 1XJQA 1WXQA 4H1UA 4BFVA 1GSIA 1VHTA 1XWIA 4Q1BA 3GMTA 1ZCBA 2FFQA 3LBHA 1W5TA 3O8BA 2R6AA 5AJZA 2CL7X 3UWOA 3UK6A 3PV0A 4TYNA 1WB9A 2DY1A 3R8FA 1NMXA 3VTKA 4DCUA 4YLGA 1UBEA 2ATXA 3L0IB 5DGXA 5HE8A 1W49A 5TARA 1RRCA 1SZPA 1FNMA 2BC9A 4YMUA 4D4JA 3REGA 1I2MA 3B9QA 2IYSA 3DM5A 4II7A 4R7ZA 4OQFA 3QKSB 1YRAA 5FUWA 1OHHA 3A1TA 3EX7C 2C98A 821PA 1OFUX 1SKYB 1ZIOA 1K6MA 2V4ZA 3WBKA 1ZUNB 4BPBA 121PA 2OLJA 4J0QA 3K0SA 1KNXA 2RB4A 3B7GA 2GDJA 4MKGA 1SVSA 4PZLA 2ZRIA 4WBSA 3EPJA 4Z1MA 2GEDA 1OF1A 2QE7A 3CNNA 5JECA 4B3CA 1XTIA 2FFBA 1SXJC 1ELOA 2OCYC 5DN6D 2W0MA 4TWZA 4IRUB 1DOAA 3ZS9A 1BMFA 2H7VA 1XEXB 3AP2A 1E9AA 1GNQA 1DO2A 1XDBA 1P4SA 2OCAA 2JLRA 3QBVA 1UF9A 2IC5A 5FOUA 3N5CA 1QDEA 4AYTA 4W5WA 1KI8A 1ZW6A 2BMFA 3HU2A 4Q9KA 4WXRA 4E07A 1N0VC 1KSFX 3MSXA 3MWYW 4NU0A 2N1BA 5FTLA 2CLCX 2F6RA 4BECA 3NHAA 4WXPA 3U3RA 4PC3A 1DAFA 4PTLA 1CJTC 3Q72A 621PA 4TL6A 3DOEA 2G83A 3DZ8A 3BXZA 4JL8A 3ZGXA 4DDWA 1JR3E 3BWDD 1A7JA 3GLIA 2KE5A 2JJ1D 4JSTA 5FOXA 3GLFA 3U3KA 4QNMA 4MKIA 2K5UA 1KO8A 1NN5A 3CBQA 4P4UA 4GNKA 4IOLA 1JPNA 2RGAA 4GOKA 3SDZA 3LVRE 3LQQA 5C2JB 1FMLA 4UQOA 4B74A 1KNQA 3CWZA 3U7GA 1RIFA 2QQ0A 5KSYA 4B44A 2AWOA 3SJZA 2FDCA 1E1RA 4IOMA 1GKIA 2YC4C 2QAGB 1IY1A 3SBEA 1II9A 1WF3A 5AR1A 4D6PA 1EFTA 3B5JA 1KO5A 1NVXQ 4UNNA 3GFTA 1DS6A 1KY2A 1Z0AA 1ZBDA 4A0GA 4A4DA 2QPTA 4UNPA 2O8CA 1CRQA 3D6TB 2GA8A 4Y0AA 1XJ0A 3LAWA 1ZU5A 4LHVA 2DBYA 4BFZA 1ZNZA 2IS1A 1Z28A 3EA0A 3GD7A 2JCSA 3F5FA 3VKGA 2ZE7A 2YOGA 2W2VA 3A4MA 3FHOA 1F2UA 1AN0A 1XMJA 4G3XA 2XTZA 2ZRDA 5BN3A 4M0LA 3TKLA 2ZXUA 1R0XA 1XTJA 3LX5A 2R44A 1AZSC 1YZKA 2BJWA 1AK2A 3O8RA 4EJSB 3GCGA 2FSHA 1G7RA 3FYHA 3LLUA 3T15A 1N5LA 5L3QA 2YWHA 4BLTA 1XD8A 4OBEA 2GJ8A 1R0YA 4I4LA 4AKGA 3QSYA 2C9CA 1YKSA 4IOKA 1NY6A 4KYUA 2KI5A 2LKDA 2W2XA 2WWXA 2W6IA 4KODA 5BYKA 4JLAA 4PANA 4EPTA 4Q7LA 1JXMA 1GZSA 2NZJA 2ERXA 5FR1A 1Z63A 2RAPA 5LB2A 2C03A 1R6BX 4YMWA 1TQ4A 4H1VA 2WWFA 1FZQA 1C1YA 2BOVA 3LA6A 4A8JC 4BGDA 5BQ5A 2HLDD 2J7PA 3K09A 2XZLA 4AYXA 1VIAA 2GNOA 2GWHA 4Q48A 5E7IA 1E2HA 1JECA 3HPRA 2IYXA 1XTKA 4LJYA 3TJZA 3GLFE 1VYTA 2BJVA 4RD1A 5FBRB 5CM8B 3TSZA 1GOTA 1U0LA 3CW2A 3BJIC 5EP3A 4KBGA 1D2MA 1NVUQ 3CKLA 4C0KA 2NO6A 1DBSA 4ERNA 1N6KA 3ZQ6A 3AVVA 4DBLC 1QBKC 4OQLA 1D5CA 5FPHA 3UIEA 2WWYA 3VNVA 3T12A 4IFEA 3K0AB 4Y0VA 4P4SB 1YR9A 3NC1C 4ZI3A 5KUTA 1Q3TA 3WYFA 4PXAA 1DELA 1G64A 2JIZA 3KTAA 1U8ZA 3KKMA 2FH5B 2J0VA 3KQKA 2FN4A 2NZ8A 5EQTA 4RZ3A 4EPRA 3F8TA 2O8FA 1COWD 1Z8FA 4KLZA 2AD1A 4R9UC 1OB2A 2GXAA 5KDOA 3MMPA 5HKKD 4JYCA 4KITB 4MGZR 4CEHB 3IHWA 4NCKA 3ZD7A 4URYR 1QG4A 4HAYA 1KI3A 2FWRA 3AKYA 2ZM5A 2IT1A 1ZNWA 4EKDA 1IN6A 1IBRA 3EIHA 2AL7A 2P65A 2PH1A 3EARA 1E9CA 4R98A 1NLYA 1Z0JA 3V4RA 2CNWA 1G6HA 4QC2A 4GBMA 3NBYC 4QRHA 2IX3A 1HA3A 4Q4HB 2PMKA 2R9VA 3LFUA 1TTTA 3IIJA 1ZMXA 4IJMA 1S1MA 3THYA 2IXEA 2JJ2D 4LBZA 3TK1A 1H8HA 2Q21A 3AB3A 4P32A 4A2PA 1RRFA 2J46A 4BLSA 1M6NA 1XD2B 2QI9C 4LI0A 5JHGB 2VHUA 3P1JA 1KHTA 4B3XA 3QENA 1KO7A 4B47A 3IBGA 5FUYA 2GXUA 4B43A 1KKLA 5JEEA 3KJHA 1DVRA 2RGDA 2O0KA 3TNFA 1DARA 2Z6VA 3KX2A 2ORIA 5AUQA 4QHTA 1E9RA 3A1VA 5HE9A 1NKSA 3RS7A 1HEIA 1CJMA 1ZVQA 1S4QA 2HCBA 3CPEA 2HT1A 4YDHB 2Q9AA 1OYWA 4IVQA 2ZITA 1JI0A 1O3YA 2GVZC 3OEHD 5LBIA 4LJ4A 1IQPA 4NDZA 5JWRA 5JFGA 5K8TA 5FOTA 3TQFA 4JIMA 4ARZA 1NBME 3WNDA 1XCMA 4G5SA 4DLZA 1A2KC 2IL1A 3OE7A 2O5VA 4YMTA 2VHTA 5J4LA 4PO9A 1ZC4A 3W34A 1OPXA 2PT7A 3WNBA 5F9HA 1D9XA 2GBLA 1XTSA 5EP2A 4WOPA 5FTNA 4BZPA 4W5HA 4C0JA 5BN5A 1FP6A 4LHXA 3VR3A 4BLOA 3LNCA 4B6FA 2C99A 1ZNYA 5E95A 1E2FA 2HYIC 4DHEA 5EE1A 3AUXA 3VR2A 2JAQA 2CDNA 4L8GA 2DWQA 5L3RA 3R7WA 3RAPR 1E94E 2Y8EA 5A0FA 3ZH9B 2C96A 3WP1B 4PSAA 3KQNA 4Q7JB 3CRRA 4LC1A 5AUNB 1J90A 2XJ9A 3ND9A 4M1SA 4TQUS 2O8EB 2XAUA 1L2TA 4Q1FA 2VO1A 2XNSA 1EK0A 1VHLA 2FE4A 4HB3A 3VHLB 4JBXA 1ZU4A 2C77A 1R4AA 1UEJA 3TGPA 3GLGA 5TB5A 1MKYA 2GRJA 4NZYA 4EQ6A 3WRYC 4ZDKA 2OG2A 4YXWA 1E0SA 1OH6A 1H8EA 4JJZA 1EESA 3I61A 3LW8A 2ZYVX 3GEHA 4NCHA 1PLLA 2FF7A 1KKMA 4G0NA 1DG3A 2GCNA 1N6PA 3CNOA 3PUYA 3QNUA 1E32A 4FIDA 4O2LA 1YVDA 1RVDA 2J45A 4B71A 3C41J 3AVOA 2FEOA 1Z5ZA 3DPUA 1GL7A 3UG6A 2XSZA 1DAIA 3JVUA 4Q21A 2WJGA 4TLEA 1OYYA 1AIPA 4XD7D 3AVWA 5CITA 1Q1BA 5KSPA 1A82A 1W4AA 1NN0A 1G21E 1CJUC 4EDHA 2DWPA 4FMDB 1G8PA 3X1ZA 3JVVA 1KAOA 2OFOA 2JEOA 3W6NA 1R5BA 3EPKA 5FR2A 4JSYA 1Z06A 5CYPA 2XNDA 1E4VA 2ODEA 4MITA 1OH8A 4MRPA 2QP3A 3SR0A 3T1VA 4W7SA 4CT4B 1E2NA 2QU8A 1YHNA 4JLMA 2CK3D 3I32A 1OH5A 1QVAA 1UFQA 4LPKA 3N2IA 4N0DA 3MAAC 2PX3A 1E0KA 3IO5A 1TL7C 2OESA 3ZDQA 4KO8A 4BEBA 4JLKA 5JS8A 4QM6A 5KSZA 4UXHA 1U99A 4Q9IA 2PCJA 4U7DA 2QAJA 2UKDA 4TLCA 3NBZC 4GRAA 1JAIA 1CIPA 2ZRFA 4M1OA 2ZANA 1N2CE 3N70A 4LUCA 1T3SA 2KSQA 3L0PA 2Q9CA 4KSCA 1OFIA 1XEWY 2MMGA 4DSTA 3GLIB 4Q00A 4DLYA 5AK0A 3GLFB 1G18A 2XOKA 4M9QA 1P2UA 4KFTA 2D74A 2PLRA 2ODWA 4N3NA 5L3SA 2I3BA 3EZFA 2XZOA 1G291 2EFCB 4GPTA 3LRPA 1XP8A 2GF0A 4Q4AA 1KO1A 3BBPA 3MJHA 1TU4A 3B2EA 1LY1A 4M8NE 4WZ6A 4KHZA 3GLGE 4LRWA 2WWGA 4LDJA 3MWJA 3CM0A 3J81k 4UXIA 3DO6A 3T34A 1QHSA 5DI3A 1KSJA 2UVQA 1SVMA 3WMEA 4F92B 3D7MA 2OCBA 3KZ1E 2J5XA 2C5LA 3KJEA 2VP5A 3C5HA 1QG2A 1J2JA 1QF9A 2QT1A 3MFYA 3T35A 4EFNA 1NRJB 2O8CB 1WP9A 2ZRNA 1SHZA 2WPDD 3KJIA 2V7QD 3PUXA 2QM7A 2CCKA 2ONKA 3QXHA 4HDQB 1T0JB 3BB3A 4DB2A 2OHFA 3U61B 1LTQA 1XBTA 2HCJB 3OAAD 1LB1B 4N1AA 1HE8B 4CYMA 2REOA 1KI7A 2OXCA 2FV8A 3GJ6A 4UJ3A 5BN4A 2NO9A 1F2TA 5J5CA 2EYQA 4ZI2A 1P73A 2BBWA 2P67A 2VQSA 5CM9C 1F2UB 1OKKA 1W47A 2DHRA 4KV9A 4PO8A 3QJYA 5BWMA 2AX4A 3G5UA 1VCOA 3EPLA 2AWNA 1PUJA 4MYTA 3GFPA 1LNZA 2JDID 2DFNA 4HLCA 1GTVA 2RCNA 5KPDA 5L3QB 4OJKA 5F9FA 1F48A 1NVWQ 2ZR0A 2WSMA 3BH7A 4HLUA 3IPXA 2ZIAA 4B3FX 3RDPA 2VSOA 1X86B 2GCOA 1OH7A 3PVSA 2JLQA 5BW8A 4Q7KA 3CUEF 1XRJA 2D06A 2QTFA 1WQ1R 2ZJAA 4C0QC 3SI7A 2NIPA 2C2HA 3P27A 1GG2A 4GZLA 3U6KA 3Q3JB 3HP1A 1II0A 4MRVA 2EYUA 2EVWX 5DH9A 2OEPA 1KK0A 2J0UA 1Q1EA 3QUSA 2NOAA 5CYOA 4E5UA 5EP1A 1A2BA 4PPFA 2BKEA 4MDEA 2WIBA 3FVQA 2ZI6A 2G77B 3OFND 2JASA 2FOLA 1IN5A 2ZI4A 1P7CA 3GLHA 2QN6A 3L43A 2J0QA 1X1SA 3MLEA 2EFDB 2QMOA 5L8VA 4AURA 3KUCA 2O8BA 4PO1A 4BE7B 4GFDA 1ZUHA 4XTRA 3R9WA 3AGPA 1SGWA 2BM0A 4FD2A 4PQFA 2BMDA 4PSKA 5B30A 1EFUA 1T6NA 3A6PC 1UEIA 2ZRHA 3KUDA 2F9MA 1Z47A 3VR6A 4K81B 4OJQA 1E1QD 3KTAB 2GZHA 2A5DA 1GL6A 1X8LA 3IEUA 1E2PA 3NH6A 3WBJA 4LWZA 1CR4A 1E96A 3TVDA 1FFHA 4HB0A 4M9ZA 3X1XA 4O2RA 4BASA 5JZVA 2O8FB 5GJBA 1XCPA 1NVVQ 1ZD9A 1ZD1A 3QXSA 1WBDA 5CIQA 2V6IA 2OAQ1 1NSFA 2CCGA 5KYKA 2BMJA 3A4LA 2FFHA 2FX3A 4OHWA 5CLQA 1AGPA 3QPUA 2FA9A 3FDIA 5DLQC 3HR8A 1KJZA 4LYFA 4NYMR 3SU8A 2P6RA 2Q3HA 1G3QA 4IOJA 1NMYA 3PITA 1KDOA 4JLPA 3ZZTA 4DCNA 4Q47A 4DLUA 4YC7A 3QEOA 1TUIA 3LO5A 2REBA 1X8KA 1D2EA 2E9SA 5AJYA 1Z0DA 1PUIA 3THYB 1YR8A 2BV3A 1DAGA 3JZMA 3CH4B 1B0UA 2ZRMA 4IXNA 5IRCD 221PA 2ZJ2A 2B21A 1UAAA 4GMXA 1UDXA 3TSWA 1OXUA 3NVAA 1IONA 2WJJA 3QF4A 4GOXA 3QPVA 2IUUA 4GL2A 4F4JA 4RZXA 3ADCA 4LJ5A 5FTJA 2OM2A 4RZ2A 2I1QA 3B8HA 3ASZA 4RCZA 1E69A 1DO0A 2FZLA 3TR5A 4GP6A 3U7HB 3WYAA 4IW3B 4EJSC 4C0BA 1PV4A 1W0JA 1FTSA 1IN4A 1UADA 4DT1A 2WTUA 2WBLC 3BERA 4HEJA 2AK2A 2V9PA 2ZSEA 1W48A 4FMBB 4R2HA 2VBCA 2B7CA 3FTQA 3Q5EA 4F4IA 4DEXA 2VPPA 4ILEA 4NYJR 3TW4A 2KWIA 2Q0HA 4BQSA 5B64A 1NI3A 2ATVA 4QGAA 4QJ5A 4ARZB 1BS1A 2A5YB 2GHIA 3EIEA 3GLHE 5AUOB 5E4FA 3Q9LA 721PA 2REXB 5EUMA 2ZYWX 3CRW1 5FI1B 4HUTA 3AP1A 2SHKA 4DC9A 2IS4A 1XCGB 4B6EA 1TUEA 4X8HA 3EWAA 4MGYR 1NIJA 4KI0A 2H5EA 2N42A 3G0HA 4ZDIA 3NH9A 5DN6A 4PPNA 4LK2A 2ZSAA 5EXXA 3EC2A 2VSXA 1G3MA 4H9GA 1GITA 1ZM4A 2YHSA 5DE3A 5K8UA 3CIOA 3R7WB 3PEYA 4PHHA 5C4GB 5SZJA 1DE0A 2FPLA 1RRPA 2IYLD 4CEIA 2QROA 2OUKA 4US2R 3CWQA 1LV7A 1W2GA 3DKVA 2IUTA 3DOFA 2GKSA 3NG1A 1E9DA 2P6UA 1U0JA 3AVXA 2D62A 3W8RA 1JR6A 5G53C 5DYIA 1LW7A 5JHHB 5FUXA 3GLGB 4AKEA 2F43A 3PUZA 1K8RA 4M53A 1R0ZA 2GTPA 4P3YA 1GAJA 3I1FA 4EQ6B 4US1R 4A92A 4TTRA 5JSZA 2CMKA 3V00A 2HYDA 2MSDB 3EAQA 4TT3D 4OI1A 2FSFA 2A7QA 1U8AA 2F7SA 4ASUD 3NBXX 2OAP1 5EE5B 4NHOA 1P61B 4Z54A 3IPYA 3IUYA 4DCTA 4OHYA 2WJIA 4LOAA 4PPGA 2OLKA 1Z6XA 1W36B 5F98A 3ICEA 2XGJA 4MKFA 1J70A 4B3BA 3E2IA 1Q1ZA 1PLJA 1EFRD 1Z6GA 2L0XA 2D3WA 1YRBA 1C4OA 1NSTA 3BOSA 4L15A 3LXXA 2DCUA 2ZI3A 3DVLA 1HQYE 1SHKA 2IWRA 1GIAA 3K9HA 3RS2A 3VR1A 2AFIE 3ZZUA 1TQDA 4JLNA 3RRZA 3EZ2A 1US8A 3B1VA 1HY3A 4L5BA 1G5RA 2B8WA 1F6BA 3SEAA 2AFHE 3QKRA 4JL6A 1CRPA 1U81A 1TQ6A 3LW7A 1JR3D 1QHIA 2AXPA 1M7BA 1XTRA 3B13B 1E2QA 1E98A 3B60A 3QY0A 4LZZA 5C18A 4KVGA 4DLTA 2CLDX 1SQ5A 1Z6YA 3BFKA 3CRVA 4JKIA 1YZLA 4S35A 3I4LA 2G9NA 4LSGA 2RH5A 4JVLA 4TSFD 1CU1A 1M7HA 2QTHA 3MD0A 1IN7A 1E2LA 3FMIA 3VHXA 2D7DA 3DEFA 4JZKA 3SE0A 1T5IA 1XMVA 2YC2C 4JLDA 4RVCA 1TQ2A 1R7RA 4KBFA 5F3WB 1OXSC 4Q9HA 2LCFA 2R2AA 4A6PA 4HAXA 4HB4A 1TX4B 3FKSD 5JJKA 4ESVA 1IJFA 4OQNA 4LY6A 3KKOA 5AJXA 3SS8A 4LV6A 1ZAKA 1KDPA 1CKEA 3RS0A 1FNNA 5FTMA 4MUBA 1Q0UA 3T06B 1P60A 2BBSA 2HUPA 2WSSA 2WMOB 4JLJA 1R10A 3CF6R 1OHHD 1E2EA 1OLOA 2QQEA 4JJKA 2IYTA 1NL3A 4KYIB 4DUGA 2QRZA 4V0MA 2NQ2C 2ASEA 1U9IA 3KXIA 3VU9A 3MGCA 2YWGA 1MV5A 4D2IA 1E3MA 5IK2A 1VPLA 2ZSFA 2QL6A 2WV9A 3K0CA 4XWKA 1ZD8A 3EWSA 2EFGA 4Q7MB 4CEJA 1VCMA 4Z1MD 1OXVA 1GDDA 2VEDA 4Q4AB 4UNQA 1BYUA 4BFUA 4EFMA 3NIBA 4TLBA 1Z22A 2DFTA 3RSOA 1AKEA 1BMFD 4XWOA 4EPVA 5DI3B 3BK7A 4PC2A 3T61A 5CK4A 5FI0B 3UMFA 3QXXA 2C9OA 2OSBA 2CBZA 2RGCA 1KI2A 4HAZA 5KNBA 2PZFA 4L4UA 3D8BA 1Z2AA 5JCPA 2CVFA 1GRNA 4D82A 3QBTA 3RRYA 3HU1A 5FPSA 4M1KA 1U90A 5J40A 2WOJA 2CVHA 2Z4SA 2PBRA 5DSZA 3NEJA 1E6CA 1QHNA 1F2TB 4LJ9A 4LC0A 1OT3A 1KJYA 2AD5A 1PVOA 2VH5R 2GAOA 4TLDA 4KU4A 3RYTC 4B2PA 2PL3A 2WKPA 1KI1A 2ZVQX 1E9FA 5KPJA 4PZZA 5FOWA 2G6BA 2YINC 1S1CA 2FJUA 1JB1A 1KMHA 4DXAA 1RC8A 3VQTA 3W5IA 1AZTA 4JVMA 3M6AA 3MWKA 2R6DA 1P9RA 4C9BA 1SVLA 2VYFA 1MO3A 2WJHA 1TAGA 4OYHA 4TQAA 4MKHA 4JLVA 4D26A 2GCOB 4LHWA 3RS4A 4U00A 5E7JA 4DLRA 4QGGA 3UG7A 3GJ7A 3LVQE 1E1RD 4TMKA 3CO5A 4X8LA 2WVJA 3THXA 4I99A 2QP4A 3LBNA 2ZJBA 2ZS9A 4F38A 1NBMA 1NLFA 1OIVA 3QVVA 2ZR7A 1GKYA 2J0UB 5LDDC 1S3GA 1D2NA 2Q6TA 5EUQB 4CDGA 4LBYA 3WHKA 4MDFA 3H86A 4NCJA 2KB0A 2QENA 3AQ4A 4V0ME 3SYLA 5EP4A 2W6JA 3GLHB 4KSBA 4KJZA 3VKHA 4DB4A 1Z6TA 1G3IA 1P5ZB 2W58A 2O8BB 4M2LA 3ECCA 1WRBA 1V43A 1Z29A 4D4KA 4XOIA 2B7BA 3ZZ0A 1IAQA 3WMGA 5J4YA 4M9XA 2ZSDA 2KJQA 5SZIA 3KFVA 1DEKA 1P3JA 2O52A 4HAVA 2VHQA 2JLVA 2W6ID 2R6GA 3GJ0A 2GZDA 3DKPA 3AH8A 4FN5A 3A1WA 4OL0A 2FU5C 3QVUA 1N6IA 3TLXA 4DDTA 3B1XA 3K0EA 2BMEA 3IBYA 2N46A 3PR1A 1FQKA 1OIXA 3B1ZA 4HSEA 4HUQA 4MYHA 3FMPB 1YZTA 4NYIR 2H8KA 1B23P 2QEQA 2J7PD 3SQWA 3C14C 5JMTA 3K8YA 2WWHA 4MQBA 1JPJA 3LY5A 2BCJQ 1N5JA 4QBHA 2BM1A 1SVKA 2Z5FA 2DFLA 1KK3A 3U7EB 1J8MF 1CR1A 4HLQB 2FG5A 2H57A 1PLKA 5EXPA 3RWMB 2GF9A 1AM4D 3O47A 3ZVLA 1YZNA 4A36A 1N6NA 3ASYA 2YYZA 3ZVRA 4ACBA 5IF9A 4Z8YA 4G1UC 1P2TA 4QHSA 3QF4B 2QP9X 3FPAA 3I72A 3NC0C 4EUNA 4QKQA 2JLXA 2QGNA 3GJXC 1E9SA 3KB1A 1M34E 5TXGA 1F60A 3DZDA 2I1VB 3P26A 4L9SA 4P0TA 2JIZD 3DMDA 1W5SA 4DEYA 4YMVA 2F1HA 2ONJA 4B34A 4TYWA 5HR5A 5FFMA 4DT1B 1QHXA 4JBYA 4URWR 4QL3A 2ZROA 4URUR 2ZUDA 1ZM3A 1Z0FA 4BLRA 1VMAA 4BZXA 1LS6A 5GJCA 2P3SA 4U02A 3ZLJA 3SFVA 5KO2A 5JS7A 2TMKA 3AM1A 2IWHA 2GAAA 4RD0A 3KQHA 3TR0A 1ETUA 4A82A 2BVNA 1JQJC 2ORWA 2AHOA 2GK7A 2GESA 2CNWD 2OCPA 4ZDWA 2JGNA 2BDTA 3X1DA 3BIFA 4G5QA 3IO3A 1MABA 3K09C 4K46A 1T0HB 3ETLA 2VP2A 4R71A 3PUWA 1H8HD 3C5CA 3EASA 1ZUIA 4OQMA 4NKRA 1CTQA 1S8FA 3QF7A 4O3MA 1JEEA 3T5GA 2PZGA 3LQRA 4HZIA 3PFIA 4ZKEA 3KQUA 4PR0A 3O8CA 1Z0IA 5FPYA 4HB2A 3KFXA 4RFSA 5CLLA 1VG0B 1DAHA 5KNDA 2ODBA 5GJWC 1T8TA 2EFEB 2V6JA 5FBQB 1X1RA 4TZ6A 1M8PA 4A15A 3HPQA 1KI4A 2G0TA 2F43B 1E79D 5KDLA 1UBGA 3W3AA 3R8CA 2IXGA 2YOFA 4I1SA 5C4MA 3K70B 5JSZB 1L8QA 1AQYA 2FZ4A 2CXXA 2VP4A 4D25A 2HT6A 4M9SA 2J7KA 2VF7A 3KXKA 2VP9A 1QHHA 5LD2B 4JLOA 2DPXA 2RHDA 2PLFA 3TMKA 5EZ6B 4C0AC 2JLWA 3OE7D 1E99A 1OXTA 2O8DA 2Q3MA 4WZAE 2VTKA 4TL8A 3U5ZB 1FUUA 1JNYA 1N0UA 2R65A 2Z4RA 5FUVA 3WRXC 3ZQJA 2EWWA 4FXPA 3IHLA 1KSHA 3RC3A 4LV5B 421PA 4IXMA 1US8B 2EW1A 2PT5A 4IDHA 1OFTA 4QNRA 3R20A 3BH0A 3QKRB 4RKEA 2HJVA 3SQXA 1CXZA 2CEAA 1G1MA 2GCPA 1K5GA 2RGEA 4MRSA 1KDRA 4WAUA 1TNDA 2ZS8A 2G3YA 2A2ZA 2VP6A 4YONB 4Q1EA 2V3CC 4Q02A 1GKUB 1KK2A 3C4JA 1GILA 1JALA 5TDHA 1HTWA 3NXSA 5JI2E 1EXMA 2RKOA 1W0KA 3GJ8A 1OE0A 2EWVA 4I1OA 1LS1A 5CJPA 4M1WA 2A5JA 2IEZA 3OAAA 4IDPA 1JQLB 3ZIAD 4EAQA 3S1AA 2GXSA 1W4RA 2IBMA 4QFMA 1M74A 3N2EA 5D3MA 1VECA 4BLPA 1FQJA 4C0LA 4YXWD 1H8ED 1WE2A 2VHCA 4OHZA 3MG9A 1N25A 2F1IA 2ECKA 2EFHB 4XH9B 3OIUA 3KB2A 1P2VA 5KOYA 3QXCA 1W36D 3L8YA 2DR3A 4NYMQ 1FW6A 1I4LD 2D7CA 4AG6A 1XPUA 5KTYA 3SYKA 2R6FA 3Q7PA 3X1WA 3VU9B 1D6JA 4LV8B 3ADBA 4WW0A 1KI6A 1HUQA 1KTVA 3QQ5A 3GPLA 1A4RA 2XSZD 4YQFA 1E2IA 4LJ6A 2G88A 4YDSA 2MSEB 3H2YA 3RVBA 1P75A 5JI3E 4CEJB 4C2UA 2EU8A 1KAGA 2XXAA 1R2QA 2GBLC 3DL0A 4OQXA 4IFBA 1AGRA 1EX7A 3BE4A 3KDSE 3A4NA 3UPUA 1XD9A 3BAFA 2XNDD 4FWIB 1N6HA 3L82B 2IYVA 1CR0A 3B1YA 4RCYA 4AI6A 1D8TA 3E5HA 3OHMA 4Q4JA 3AVTA 5FL3A 3KKPA 4A6XA 4FMCB 3UMRA 1T5LA 2HF9A 1ANKA 2ZRLA 4NTZA 5DHFA 1CEEA 1D9ZA 3B9PA 4B2IA 5J47A 3QEJA 1UPTA 1VG9B 1G7TA 2RMKA 4NMMA 4DZZA 2QMEA 1TADA 5IHPA 1E2KA 1G5PA 5GJVC 3T1OA 4XVQA 4N0EA 1PZNA 4CF7A 4EIWA 1S9HA 3CF0A 4IVRA 1YQTA 2GK6A 2HJGA 2ZTSA 4C30A 4GSYA 3FMFA 1HE1C 1SULA 1U98A 2YV5A 2IS6A 4JT2A 5SZKB 1II8A 2RGNA 5BXQC 1WBBA 4TMVA 2H17A 1P9NA 1KMHB 3OEED 3PEVA 2XOKD 1ZM9A 2IYUA 1E1QA 1Q3HA 4W5JA 4A2QA 5CB6A 5JWOA 5JEDA 1W36C 1P6XA 3M1IA 1N6RA 1L7VC 4IKEA 4D0GA 2WZQA 1E9EA 3P20A 4JMPA 4DLSA 2P5TB 4BFSA 3KJGA 4K8OA 1P62B 1GWNA 2ZI7A 1BYIA 4PSVA 1C9KA 2H92A 1G16A 1G41A 4QXAA 3SHWA 5EE3A 1RFLA 1GNPA 2QRNA 3NEYA 1CP2A 3BGWA 1DADA 3WY9A 3THXB 1RPZA 3U44A 2NTYC 5FBLB 4JBWA 4TMWA 1G8YA 1A5TA 4DCSA 1ZCAA 4TTPA 1YR7A 2FGKA 4Z51A 3IDQA 3V4FA 2OBNA 5JLJA 4PC6A 1OV4A 3CONA 4Q5IA 3WXMA 3ZJYA 2H16A 4D81A 5KU1A 1UDWA 5AJWA 5J4VA 1Z83A 4LCBA 3PQCA 2NO7A 1W1WA 5FL7A 3P4XA 2VL7A 1OKKD 1VTKA 2ZJOA 5FBVB 1Z07A 2QBYA 1E0JA 3WNCA 4QBFA 4G01B 2NO1A 1VCIA 3VKWA 4OK5A 1UKYA 2LWIA 1CF4A 3B78A 1J8YF 1SVWA 2CHQA 1FL9A 4Q19A 3FHCB 3GJ3A 1FX0A 3SOPA 3OZXA 2FSIA 3R9XA 2A78A 3PIRA 1VDZA 3AF1A 2A5GA 2I4IA 3FWYA 3Q5DA 4DDUA 3FFBA 2QM8A 1ZJ6A 1QHGA 2J1LA 2QTVB 4HAUA 4G5GA 4MGIR 2QAGC 3I5YA 1SXJA 5P21A 1MT0A 3U4QA 2FGJA 2Z0MA 2ZUCA 2R62A 1G7SA 1TMKA 3SYNA 4HUQB 2YWEA 2JA1A 1G8GA 3IGFA 2QPAA 2WHXA 5DISB 2PJZA 3EPHA 1Q57A 2WICA 2QNRA 4TTQA 2ZPTX 4KCGA 2X2FA 5EZ5A 2H18A 5K8IA 5G3YA 1NF3A 4JS0A 3W5JA 2ZAOA 4JVSB 5HPYB 3H4MA 3GQBA 1SVIA 4TN1A 1FTNA 3GJ5A 1NLZA 1O87A 4MYCA 1IOZA 1EFHA 2GZAA 4B3DA 4ZKDA 2XZPA 2ZRGA 4GOJA 3RHFA 1G20E 1S96A 3RANA 1IM2A 2BIFA 5TY0A 3AVUA 2R8RA 1AQUA 1XNJA 1R8QA 3DM9B 1VKJA 1T9HA 2ZJZA 3TAUA 4DLVA 3U6BA 2ZQ5A 1OB5A 4GMDA 1G9XA 4P31A 4NH0A 3A1UA 3HJNA 3IKJA 3A58B 1S0UA 4FI3C 2MSCB 2X2EA 1G8FA 1R5OA 1U0HC 4TT3A 2G1JA 2D4HA 2HXSA 4Q18A 3W6PA 3I3SR 2LKCA 1FP7A 2GJ9A 1GM5A 1NMZA 2YWFA 4HLUC 2FFAA 5M04A 2XEXA 1ZNXA 4B32A 3T5DA 1TEXA 2A30A 5C1BA 2QZ4A 3VX3A 4DWJA 3U60B 1EFRA 2DWOA 5EJEA 2HF8A 3FB4A 1GRQA 1Z3IX 1N6LA 2PZEA 4NCNA 2IF2A 1P2SA 3WYGA 4MA4A 4EPYA 4B2LA 4FWTA 3RWOA 1A1VA 1EGAA 1SVOA 1MABB 5AWFC 1AA9A 1YZGA 3VMFA 1FUKA 4NPHA 2CL6X 5HCIA 4GP7A 4ZIRA 1HH4A 1NG1A 2QPOA 4QBGB 3IEVA 2BCGY 4EPWA 4URXR 2XTMA 2RGGA 4TSFA 3C16C 3HYRA 1N5IA 2JJ8A 1QRAA 3H1TA 3W6OA 1KZ7B 2J41A 1GL9B 1SXJE 4HAWA 4RFSB 3VX4A 1GUAA 1CR2A 3IIMA 3PEUA 4URZR 1NN3A 2PX0A 4LBVA 4JT4A 1XMSA 8OHMA 2OBLA 4KFUA 1T3LA 2ZUBA 2O0HA 3K9LA 2JJ1A 3FKSA 4OHVA 4V0KA 1W0JD 3HWSA 4MYUA 3X1YA 1VG1A 4ABYA 2GXQA 5BYJA 1ONBA 3TSOA 2YZ2A 1DTSA 1L4YA 2QSZA 4CZ2A 1Q44A 2P6NA 1QHHB 3QG1A 2KBEA 2C04A 1G4AE 1DG1G 4A8JA 3MUFA 1TF5A 2V54A 3TQCA 4A0HA 4HZUA 3UANA 1ZINA 4TMXA 3THWA 4C2TA 2IYQA 2XB4A 2O8DB 1YJ5A 2O0JA 2QORA 5H70A 2YJTD 4FCTA 2IHYA 5HTKA 1OIWA 1XZQA 2AKAB 2WWWA 1M1YE 2CLSA 1NJFA 2YVUA 3EW9A 4LYAA 1Q20A 4E09A 2J3EA 2XITA 4OKSA 4JVNA 3SC3A 3SJBA 5JRJA 1NVVR 4RSGA 4F91B 4PAMA 4R2IA 3U3JA 2RHMA 2IS2A 4D4LA 2B92A 2WJVA 2FPKA 1KYIA 1XFAA 2BEKA 3VR5A 1R8SA 1KOFA 3TIFA 1HV8A 4V02A 5LB4A 4BRWA 1BOFA 2VRWA 3AEZA 1ZRHA 2VSFA 4KVAA 3RS5A 1TEVA 1P9WA 5IDVA 3KL4A 4NBSA 4OI4A 3E70C 4UNRA 4PHFA 4KXFB 3S1AB 3C8UA 1YU9A 4C0HA 2EQBA 4QHYA 3K70D 4JLBA 5D3MB 1KI9A 5GADl 3CPJB 3GP8A 1AJEA 4PQRA 1RRGA 2ZI5A 1JXOA 4LHZA 3NBFA 3F0TA 2B8TA 3AVYA 4NYIQ 4WIAA 2ZJ8A 2PEZA 2AXNA 4F93B 2QE7D 5LPNA 1UBCA 1NNEA 4PFSA 3A8TA 4TMTA 2IK8A 2C8VA 6Q21A 1XPOA 1RJ9A 1KI6B 2HLDA 3TW8B 3AP3A 4Q1CA 3RSLA 2JLSA 2ZJYA 1IY0A 2CJWA 2OE2A 4FCWA 4KAXA 3G82C 4Q1DA 3L2OB 1ZYUA 2XXAB 1VYUA 5CDFA 2IXFA 5EXTA 4RZUA 2NPIA 4CW7A 2W00A 3PJRA 3T1TA 3RC8A 3OIWA 5F2EA 1J7KA 1S9DA 5G3ZA 4CT5A 1E2JA 4TYQA 3NDBB 2DFKB 3CH5A 2Q9BA 1TF7A 2WWIA 1XPRA 2JATA 5JWHA 3PEWA 3CB4A 4Q4JB 4B48A 2XTNA 4TYPA 2A9KA 4V0OA 3BC1A 4C3ZA 1S3SA 2ZJ5A 5UKDA 1W4BA 4ZPXA 4NONA 3ZS8A 4X8MA 4LX0A 3B82A 4WVFA 1E4YA 4Q4LA 2ZREA 1UJ2A 1UM8A 2ANBA 3CPHA 4AWXA 3A37A 4B73A 1E2MA 3K70C 1X8JA 2WSSD 1COWA 3RRNA 4BFTA 5HKKA 4NL4H 3TRFA 3EG5A 5LD2C 1II8B 1L4UA 4B35A 4DUGD 3OIYA 1E9BA 4G5OA 3KXLA 4TLAA 5IK2D 3ZYCA 3ZVMA 3T1QA 2FMXA 3H0KA 4UNSA 2RGXA 2Q3FA 3X2SA 4BUJA 2H1LA 3IIKA 2BKUA 2GJKA 1N0WA 5CJ2A 3W9YA 4BFYA 2ZYTX 4M1TA 3Q7QA 1ZM2A 3IQWA 2JJ2A 2ZYUX 4B76A 4LYJA 4QOSA 1I4DD 5IT5A 3U44B 1NY5A 4C7OA 4HDOB 4OK3A 1U8YA 3FE2A 1JJ7A 2OZEA 3AF0A 2X77A 3V9PA 3FMOB 1DAKA 4AD8A 3TUZC 1G3RA 1XXHA 4URVR 1RZ3A 2GILA 3GLIE 4DVGA 3FOZA 4DCVA 2OILA 3KKNA 4U5XA 2QMHA 3UMSA 1HYQA 3I8XA 4M1YA 2QY9A 1GVNB 1TPZA 1FPMA 1Y3AA 2GJAA 3M0EA 4DSOA 5EE0A 3LH5A 5GVSA 3K0FA 3CF2A 2OFWA 1T3HA 4PZYA 2YOHA 3GJ4A 3TBKA 2QBYB 4O25A 5CDFE 1KIMA 3OEHA 4JKYA 1MO4A 4L16A 2MMCA 4L9WA 4F7WA 1UBFA 1IN8A 1RE0A 1R0WA 1Y63A 3AV0B 1XX6A 3GEIA 1FX0B 2GEUA 2WKQA 1WA5A 2V1XA 3QKUA 3TVTA 3H84A 3CRQA 3SJAA 2P0EA 1U9IC 3BB4A 2NG1A 3ND8A 1P72A 1LF0A 4DSNA 1IXRC 2WAYA 4US0R 3AKEA 3K1JA 4NP6A 3K0CC 1SXJB 5DIFA 3UXMA 2R6CA 4PAOA 3U4QB 3VAAA 4TL7A 2BWJA 4IDOA 1LF5A 1W7AA 4QM7A 5HZKA 1G3UA 5TVKA 2QT0A 2WIAA 1NBMD 2ZEJA 2V8OA 2WKRA 4D4MA 1Q22A 4TZ0A 4A0RA 3AVQA 2NPFA 4WZBE 3BORA 1MR3F 3Q8XB 1AS2A 5CIWA 3CZPA 5B2ZA 4A9AA 3AF4A 1KMQA 2QUZA 4HLDA 4POAA 2PMDA 2IA5A 2W6JD 4D0NA 1PJRA 3PUVA 3NWJA 4XVRA 1GRRA 1MH1A 2A3RA 3AGQA 4EFLA 2AR7A 1NP6A 4KFSA 5DNYB 4E03A 1WMSA 3VR4A 1CJKC 4A1FA 4ZCLA 3W90A 2G0NA 1W44A 2IYRA 3MWLA 4Q9LA 4BFXA 1E79A 1I4TD 1U94A 4CRWB 1S2MA 3QOFA 3CLVA 5B58C 2CHVA 3O8DA 4TMZA 3I73A 1JEDA 3QPWA 1MRSA 1XXHE 3B1WA 4AG5A 3AF2A 2JLYA 5AJVB 1RKBA 4IDNA 5D3QA 1Q12A 5DHAA 4HYYA 3LWNA 4XD7A 4ESHA 4JL5A 2IEYA 4I1UA 4V0LA 1E2GA 1JJVA 2OO7A 2QSYA 5JBQA 2X8AA 1EFCA 3PG5A 2BHRA 2BBTA 5EXSA 4B33A 2NGRA 3L0OA 1QHYA 3RLFA 1G17A 3K9GA 4XWAA 3SFZA 1JBKA 4LJAA 3BH6A 2IYZA 1Z08A 4F4CA 1OSNA 3IQXA 3LX8A 3LXRA 3CR7A 1KY3A 4LBWA 3ADDA 5FBWB 2GETA 3C15C 4OI0A 2C95A 4E22A 3WMFA 5HCNA 1ZC3A 3KQLA 4CEIB 2OFXA 2CK3A 4DIDA 4RD3A 2OV2A 2CE2X 4V0NA 4ZIRB 3P32A 4Q03A 4BLQA 3CX6A 2ZAMA 1EWRA 1NG9A 1NN1A 1XJCA 4AC9A 4ZDJA 5A5GA 1Q1QA 1XEFA 2UZIR 1ESNA 3U3MA 3ZIAA 3OF5A 3QKSA 5C46F 1XTQA 1I2DA 3AF3A 3THOA 3EZ7A 1UKEA 3QG5A 2ZI9A 1MO5A 1TU3A 2J87A 3LBIA 4DRZA 1F5NA 4M21A 3PXGA 4XTCS 4P33A 1MOZA 4LHYA 4RFVA 5DI9A 2E87A 2FNAA 4ON9A 4A8JB 4EPXA 5KDDA 3A1SA 4HZUB 1W46A 3THWB 1CBUA 3QKTA 1F3OA 1XEXA 2IHBA 2ZE8A 3I62A 3F3YA 3U3OA 5JRZA 2AN9A 2HXYA 5FPKA 1YZUA 2P2LA 2OXRA 1MO6A 4C4PA 4DJTA 2WPDA 1BIFA 2GEVA 2W83A 2V7QA 2VHJA 2WAXA 4XSHA 2WM9B 3WHLA 4PAQA 2A5FA 1BH2A 2CHGA 3DMNA 3MJRA 4AKHA 4BWYA 2ZU6A 4P4TA 4Q66C 4Q1AA 4IDQA 4MH0R 5JCZA 4LYHA 1G19A 2AK3A 3AUYA 2VA8A 1G4UR 3B6EA 4XJXA 4AY2A 5JJIA 4MRRA 2J0SA 2X1VA 3W3ZB 2AKYA 2OBMA 2ZVPX 3AVPA 2E1RA 4AKIA 1OFHA 2VLIA 3EIQA 4QJ3A 4D0LB 1SKQA 1IXZA 4LJ8A 1YR6A 4PHTA 1NJGA 2JDIA 3QI2A 4CGZA 1OXXK 1VCNA 3ZD6A 3D3QA 2V55B 3MRSA 4PC1A 4OI2A 3EA5A 1J99A 2IW3A 5H1YA 5JJLA 1YE8A 4KFRA 3SJCA 1GNRA 3BFXA 3CX8A 1HT2E 4B3GA 3EZ9A 3OEEA 2ZSBA 3UKDA 1XU4A 4RD6A 5ANRB 2ZR9A 4YMSA 4BRUA 3FGNA 2RGBA 2YKGA 2QAGA 1EX6A 2PCLA 1RYFA 3HR7A 3K53A 1H65A 1RJ9B 2VF8A 3P4YA 4MRNA 5H8WA 1T91A 4AIIA 1HURA 3K9NA 1JAHA 3R9IA 1N5KA 3CRMA 4I1VA 3OESA 1LVGA 2CJWB 2OT3B 4PX9A 2WOOA 3DDCA 4FMDF 3ZVNA 2W2TA 5AUPB 5KHOC 2CE7A 1SKYE 5J4KA 2ZETA 1DAMA 1YZQA 2IF0A 2NO0A 3OFNA 4MUAA 1Q21A 3PCRB 4G5RA 3MCAA 2P5SA 4Z8XA 4M4SA 1E2DA 1UKZA 5FOSA 4NE2A 4B75A 1ZM7A 2IYWA 3WP0A 1RW4A 4NYJQ 4QGFA 2XX3A 1ZIPA 1W0KD 2QGZA 4HI0E 4HATA 2ZRKA 2GVDC 4ZO4A 4EJSA 1HT1E 1AS0A 3BS4A 5L3SB 5DO9A 4IEEA 3LDAA 3SBDA 1RYHA 2ZRPA 4O0MA 2V1UA 5SZHB 1KSGA 4C0SA 1ZP6A 3VFDA 4UKDA 2JLUA 1XF9A 4BEJA 1R5NA 4W9MC 3U2QA 1VG8A 1Z2CA 1XEWX 4QJ4A 4S2EA 3RNLA 3TAHA 521PA 3TUIC 4DDVA 1N3BA 1TF2A 3SN6A 3L8ZA 2FEMA 3IILA 1FMJA 2F9LA 4DKXA 4LGMA 4AYWA 2YNMA 4KLNA 1DPFA 4PPQA 5TMPA 1X6VA 2ODNA 3QE0A 2VIIA 1UKVY 4GI7A 3ONWA 4BFWA 2BEJA 4WA7A 2DYKA 1KO4A 2B6HA 2KBFA 1WDTA 3I8SA 5FTKA 1VYVA 5H68A 1HQCA 2J59A 5B57C 5CB8A 1BKDR 1IXSB 1V5WA 4RD2A 3A36A 3CNLA 1CULC 2UZ3A 3AKDA 4A2WA 1M2OB 4XIGS 2IYYA 1IHUA 4AK9A 1WCV1 4C7OB 2XJ4A 3UWKA 1E0AA 4DSUA 1ESMA 2ZS7A 2CL0X 2JLZA 1Z6AA 3C7KA 3CR8A 4ZCIA 1XXHB 5DYGA 4QG7A 4RD4A 1GFIA 3RABA 4A0FA 3U7FB 3K0AA 1GP2A 4P4SA 1W2HA 4ZV4A 5L3VA 4M22A 2XB2A 4ITRC 2D2FA 4V03A 2F1JA 3TH5A 2D2EA 4XVUA 5FH9A 5HZHA 1NKTA 2ZU0C 4FMCF 5FPTA 4FINA 2F1RA 3K0FB 1IY2A 4X8OA 4BZQA 2F3TA 1LFDB 1OJLA 5G41A 3LD9A 4PHGA 4RJLA 3I5XA 1KZGB 4CEHA 2ERYA 4TL9A 1Z0KA 3B85A 1KJWA 2HDNB 3PENA 2F55A 3BD9A 2GJSA 1XMIA 5GVRA 1QZXA 1K5DA 2WMNB 1KDTA 2PJRA 3EZ6A 1VIYA 4ACAA 4IVPA
chains in the Genus database with same CATH superfamily
3D4PA 2L18A 2I4LA 3C8HA 4HQOA 4RLSA 2G4CA 3I83A 2X0IA 3LLCA 4P4GA 1U8FO 1OV6A 2ZE5A 4Y1FA 2ACKA 4PC7A 2A5LA 5DLPA 5TV2A 1SCKA 3HKEA 4PZDA 3V6LA 3VDQA 4CR7A 3OH8A 2Q2VA 3LQYA 1BCRB 1BO6A 1W4CA 4RHFA 3ITDA 4IIGA 4M46A 4P3XA 3RSGA 4OHXA 3U3XA 2CXUA 3B51X 4TKMA 4EHBA 1HZJA 3VYRB 3COJA 1XVVA 1B42A 3BRWD 5IPFA 2X1HA 4RV4A 4YV1A 5HFJA 4OIFA 4FLMA 4I81A 2NU7B 4U2EA 3D6VA 4D8YA 4IUDS 3JQGA 3GY0A 1E4EB 1UK6A 2ZWPA 4HJXA 4TRJA 2G1KA 5KI6A 5BT8A 2XWBF 5B36A 3T3OA 4FCVA 1KK1A 4LPSA 2I8AA 2XQJA 1TRHA 3BREA 1LDBA 2DVMA 2HV8A 2ORVA 2QPLA 3G5TA 5A6SB 2CJPA 4J16A 4XM1A 4JI8B 4RKFA 1L9KA 3P8ZA 5EHQA 5TF4A 4DM4A 1CLUA 4FW9A 3EXAA 1YB1A 4KIFA 3QXJA 4GGMX 4WOCA 5E1OA 1I0LA 2FJPA 3DFMA 4N5DA 4DZRA 4I6JA 2X19A 1SC4A 4RY0A 3H8JA 4BUCA 5K8LA 4ASUA 3RBXA 4BTEA 1QVRA 2P5YA 4DIEA 2XGMA 3KLMX 3IDAA 4DWWA 1R6UA 4Q9JA 5I4CA 2FPMA 4KDRA 1E1NA 1CERA 3AFHA 3S2EA 2O3TA 1KGDA 2FW6A 2MYPA 2ZRJA 4HNAB 4G5FA 4FX2A 5KS2A 3N2NA 4BNVA 1HL7A 4EJMA 5GZ1A 3A14A 4ZTZB 1J25A 2XIQA 4G56A 3L0SA 4QGHA 3IBTA 4K7JA 4LTDA 4MP6A 2IUSA 4G65A 3WQHA 5BSEA 1VJDA 2Q5HA 4M1MA 1QP7A 3ZHCA 3OIVA 1WDKA 4BL5A 4XSGA 3D31A 2Q1TA 3D2LA 4MGKR 3W06A 3LYUA 1NIPA 3O84A 4FOSA 4J0IA 5IZCC 1JR3A 5JY6A 1U3TA 4GT1A 1ST2A 3IOYA 2JG3A 1ZD4A 4MYSA 3RS3A 3V2GA 3HDJA 1U6JA 4CIDA 3AXTA 2IU0A 1L7BA 1WCYA 1T8UA 3C6MA 3H75A 4W1RA 5DWDA 3K9WA 5HA5A 1XTVA 3FCOA 2NMVA 1XJQA 1WXQA 4EUEA 3KPYA 4HGZA 1XQVA 2B20A 3WGTA 4YBZA 2FJ0A 3LBHA 1XAHA 3SIPA 2R6AA 3SP1A 1XT6A 1OMOA 2CL7X 1RM5A 2C4TA 4IWYA 1YS6A 3PV0A 3UWOA 4E1BA 2B1JA 1JG2A 1R1DA 3G0GA 3JQPA 3LFTA 5GIPE 4GPAA 1RLIA 5T6BA 5AHXA 1NMXA 2QMQA 4AP9A 3K9BA 2R3SA 4OV6B 4TVBA 1JXQA 5A3JA 3ICCA 4YLGA 3ZGZA 3OZCA 3W1WA 3L0IB 2H7CA 3NT2A 1W49A 4O2BA 2GN1A 5FULA 1J5XA 2NXNA 2BC9A 4UBOA 4D44A 1WLYA 2AFRA 1I2MA 3B9QA 2DHQA 1PZGA 2ZTHA 3ETHA 3GLKA 4TKUA 3ZU6A 1YDEA 3JVIA 3P0HA 2VWGA 1ESCA 4QTTB 3U26A 3I0NA 2P9JA 4M7PA 4MHTA 2K2QB 1XA4A 1UDRA 3IVAA 121PA 2VKTA 2XDYA 3WG9A 5JD6A 4MKGA 4Q24A 1I6MA 3JV7A 4WH0A 2YJGA 4G26A 1RXIA 3PTZA 2JJYA 2C3MA 3QU2A 3OT1B 1YUNA 3CNNA 1WEKA 3IUMA 3A32A 3HB9A 3TNYA 4AMGA 4D96A 1AV7A 4OX9Y 3GFBA 5H3HA 2Y1WA 4IRUB 3GEBA 3O0TA 4KN8A 5LZ7A 4ZARA 3RHTA 2J31A 4EL5A 1WUYA 2YWBA 4KQ1A 2F4NA 2KHZA 3L8GA 3BIOA 1Q11A 4G5XA 1E63A 1GZ5A 4MWDA 2BI8A 1L7XA 2QTGA 4J3FA 5REQA 3N5CA 5AW2A 3RJMA 4AYTA 1RHJA 1Z2NX 1H1DA 1KI8A 2BMFA 4EP1A 2Y2VA 2NZVG 4YRQA 1FLNA 1NONA 4CCSA 2IPXA 4NU0A 4A7PA 5JR3A 3KR2A 2N1BA 3LCMA 4KXLA 2F6RA 4GXTA 3NHAA 3WBFA 1Y4SA 4D0SA 1IOWA 1BEZA 4YAFA 1VE3A 4O4IB 1CJTC 4TROA 4ND6A 1OA1A 3Q72A 2G40A 3WA7A 4TL6A 4HKTA 2C2OA 3BXZA 1EYZA 3ZGXA 3NO4A 4WEOA 1JR3E 3TIGA 1WXFA 3N2ZB 2DJ5A 2R5NA 3GLIA 1B73A 2JJ1D 1WMEA 3RGWS 5JU6A 1QRDA 3GLFA 3KU1A 1SXQA 3U3KA 5E0OA 4BC1A 3H9JA 3W3AH 2G9QA 4Z1OA 1KO8A 1NN5A 2PZLA 3B1KA 4P4UA 2VPQA 4GNKA 4IOLA 3M5CA 2RGAA 3W05A 4KDEA 2AJDA 4CM4A 1PV1A 4PTYA 1YJBA 2XUHA 3CLTD 1KNQA 4JITA 4YI3A 4EJFA 4F71A 1Z17A 3CWZA 1LLQA 4NMLA 3U7GA 3PHCA 4B44A 1VLMA 2FDCA 1NXPA 4MX8A 1Z8NA 1E1RA 3T8YA 4XGRA 5P8WA 1OZGA 2YQ4A 1UBUS 3NWBA 4JC4A 1ZW1A 3WAGA 4KDCA 4L4XA 1NF8A 3TF5A 5DBHX 5AR1A 4YO7A 4D6PA 3VC3A 1A7UA 4FWBA 3K6SB 3GFTA 4R16A 3L6RA 4GX0A 4UMEA 1EZZA 3ED1A 3U4HA 1RAAA 2AHRA 1OR8A 4O8CA 4EYOA 1XJ0A 4GO1A 4MV4A 2R1VB 2LV8A 3A1CA 4CNBA 4EYSA 2DBYA 2PXXA 2ZT6A 5T8KC 1ZNZA 1E2UA 1EDDA 1Z28A 2D2IA 2C1XA 2Y1FA 3F5FA 5FJIA 3VKGA 2W2VA 3QYJA 4I4TF 3FHOA 1GRCA 3HXTA 3FTFA 3WFZA 4G3XA 4M0LA 5JSKA 3SJUA 3V1KA 1GCGA 4BU1A 1NPDA 1XTJA 4UMVA 1EE2A 2J3KA 3W6UA 1XL0A 1P2GA 1YZKA 1U28C 4O4LF 2Q5QA 5FWXA 4EJSB 3GCGA 5BORA 4MR8B 5EKUA 1G7RA 3K7EA 1FTQA 1IB0A 1U6KA 1T8WA 2C4HA 2OV4A 2ZIVB 3FYDA 3LNTA 1BCSA 1TFRA 3G7NA 4BLTA 1N4AA 2GAFA 4WACA 4DA6A 4DQDA 2X0RA 4AKGA 1QGDA 3SF8A 4DY4A 2NUPB 1YKSA 4IOKA 5I9SA 4CBVA 3KSRA 4A27A 2W6IA 3RC7A 3LKZA 2ZBQA 4PANA 1KC1A 1V37A 2FQXA 1RCUA 2ZKIA 3VVMA 2EKBA 2ERXA 4QUKA 5LB2A 2C03A 4OUKX 4WA8A 4PNHA 5C4IA 4J1TC 2EW2A 2NO4A 2WWFA 1FZQA 4JR1A 4MS3B 4A8JC 5JZSA 2O2IA 4IO0A 3TBHA 1GTG1 1VIAA 1K6EA 3IMEA 3O74A 1UC8A 4RNCA 4ETIA 4P92A 2XYVA 2J4DA 3H8WA 1M8KA 4KZKA 1JECA 1ZVMA 1Y6GA 2XUKA 4XRRA 1N75A 1PWZA 3DHNA 2A86A 1MB0A 1J2TA 3GLFE 4PLGA 2BJVA 4RD1A 5D3KA 1Y7LA 5CM8B 3TSZA 4UHBA 4DA9A 4LHSA 3PQ5A 1GSHA 4MI1A 5K8VA 3LC2O 2IYEA 3COZA 1FSZA 3EQ2A 4GOLD 3ICPA 4HXGA 3SXPA 3WO0A 4EF6A 3Q3IA 2NO6A 5E0KB 4WOKA 1BVYF 2IEGA 3ZQ6A 1QM5A 2W98A 4PN3A 2GO7A 1CUXA 2XWPA 4D41A 4MHOA 1QBKC 4DR3B 3MAGA 3PCTA 3G8YA 3JQ6A 1Z5PA 3LQFA 4P4SB 3TSOA 1WDWB 1RNLA 2J33A 3GFQA 3P2KA 3RSFA 4ZI3A 5DNUA 4UEJA 5KUTA 1MB2A 1EA5A 2NSDA 3OVMA 1T2CA 2FEWB 4FZRA 1DELA 1G64A 2JIZA 3KTAA 4NG4A 5CDUA 2LR0A 5CG1A 1YXMA 1SUBA 2Z5GA 1B8PA 5EKTA 1UP7A 1EP3B 4YUZA 2O8FA 4ZHSA 1IY8A 1ZIYA 4WHMA 1Z8FA 2CNNA 3DE6X 2AD1A 4NBNA 1FP2A 5KDOA 4C6SA 1BDIA 3G49A 4JYCA 1BVHA 5EQFA 1EFAA 2WAAA 2NQ8A 5GGYA 1QKIA 4GVPA 2ES4A 3V3TA 4HAYA 3CLSD 1FUIA 4E6EA 5LUBA 5HQ3B 1C81A 1KQPA 2XUDA 5ALIA 1PNTA 3WWOA 1GD1O 4GVXA 1ZNWA 1OFGA 1UJBA 3UHFA 1JNXX 1IN6A 3DKRA 2YV1A 1VHWA 4C76A 2P65A 3LY9A 1W76A 5DSXA 1T9BA 4QC2A 3PP8A 4GBMA 1XVIA 1ADCA 1T2FA 2R9VA 4Z4IA 3KQMA 4IJMA 1S1MA 3THYA 5CVJA 2LRHA 1H4SA 1AUPA 3D1VA 2I6XA 3WLAA 2CZQA 5KQRA 2RBKA 3IP9A 4UTVA 3C8ZA 2J46A 2FHPA 2F00A 4LI0A 3SF0A 2QX7A 1HDCA 1QQ5A 1NMQA 2PWPA 3PLRA 4FR5A 2WP8J 4UEKA 1Z73A 5FOQA 1THZA 5EPOA 1LDMA 2H85A 5K6AA 2VXYA 4GXRA 5FUYA 3J7TA 4B43A 2V7UA 1KKLA 4WCFB 4D98A 1MW9X 1P2BA 1D1SA 1MG0A 2RGDA 2B6NA 3PUHA 5CCBA 2Z6VA 5AUQA 2ORIA 3T4UA 3TB4A 3KOZA 1PD0A 2HF7A 4QHTA 3GQVA 4YECA 3X0DA 1JHMA 3FTEA 1QG6A 2XUAA 1PIWA 3RS7A 1KFKB 1VCHA 2B1RA 3CVJA 5AI5A 3SHTA 4BO3A 5KOHB 1F51E 1CIVA 1TCCA 3E4DA 4YDHB 4Z9YA 4IVQA 1NU6A 1WXIA 4EJ6A 5G1OA 1E6WA 1Y89A 1O3YA 1ZX1A 2HK9A 4MV3A 4LJ4A 4BGVA 2A59A 3CHYA 5K8TA 1FX1A 4P4LA 3EGXA 4ARZA 1UBNA 2JGJA 3I2GA 1H3EA 3OZIA 5KWJA 4G5SA 1JA9A 1A2KC 2IL1A 4AY2A 3OE7A 4ND8B 4YMTA 2ZAGA 1ZC4A 3PNSA 3UMCA 1IEVA 3IDOA 4HN9A 4J0EA 1RAEA 4ZXPA 1G5HA 5IJWA 5F9HA 2A9JA 2D00A 3OEYA 2QNIA 3F67A 2GBLA 1XTSA 3B6JA 4QU9A 2DH6A 3NONA 5FTNA 4C0JA 3FCSB 2P9HA 3A3YA 3R5JA 2Y05A 4LJRA 1SUWA 1RYZA 1TA9A 4H6WA 2UU9B 2BL4A 2Y6VA 5ITWA 1MZPA 5ABPA 4LCEA 4IIFA 4QATA 2PSEA 4Z0PA 4TKZA 1RKXA 2JAQA 3R7WA 3RAPR 4QFCA 1E94E 2VJKA 1B8NA 5A0FA 9MHTA 1P9LA 2C96A 4I8XA 4K86A 4PYLA 4Q7JB 2YWRA 3TE7A 4W1QA 3WMWA 3OQVA 3CJTA 2NU6A 4M1SA 2XAUA 5CXSA 2AF4C 3N5KA 2W2NA 1OTYA 4Q1FA 5I01A 2XNSA 4BTLA 3DAFA 3NWPA 2PSDA 2WU4A 2PSSA 3OTWA 3VHLB 1H5UA 1QK3A 4JBXA 3SM9A 2AN3A 4IUBS 4QOHA 3TLKA 3H1PA 1R4AA 4DANA 3H3JA 4E12A 4B0PA 3HDYA 4EQ6A 1SCNE 4ED9A 2DQYA 2O5EA 1VIMA 3DTNA 3NBMA 1MP0A 3AZQA 1HTBA 1Z62A 2GFQA 4HGYA 4YXWA 1XNHA 2EQAA 1G5IA 1V95A 2GDZA 4RHCA 5K9ZA 3I61A 2ZYVX 4NCHA 2FF7A 2Q5CA 1QCCA 3U7QB 5HKAA 1DG3A 1S2LA 4CI0B 3CNOA 4D9MA 4ER7A 1XHLA 4G36A 4X1IB 1YJQA 4AN0A 4O2LA 3H17A 1SVNA 3VKUA 3TZLA 4KIJA 4I50A 3RVDA 2C1ZA 3W8DA 3C41J 2HTEA 3SZOA 1H1LA 2NPOA 1Z5ZA 3DPUA 3ITEA 4KNWA 1DAIA 2H4WA 4YRDA 1ZN9A 3CCBA 2HRCA 1OYYA 2QL7A 5JBNA 4RELA 1ECJA 3WB0A 2JAPA 4CKBB 1A82A 5FIUA 3MZ0A 1TUBA 3KFLA 4H1TA 3E15A 1VPVA 2WFLB 4EDHA 1OD6A 1C4XA 1YOVB 3G1UA 1KAOA 5H7XA 2JEOA 4BAZA 5CCXA 3PGMA 3EPKA 1TQ8A 1P1BA 3ILYA 3STWA 5B7PA 7AT1A 3FNHA 1WNFA 3GA7A 3NC4A 3R40A 2YYAA 4KIUA 4GR5A 1E7YA 4MRPA 2PRKA 1NTOA 2CLMB 2QP3A 3SR0A 3WIBA 5CTAA 3OOYA 4TTAA 5DM2A 1TA4A 3T1VA 4F1KA 1E2NA 1WP4A 1JA0A 3Q3CA 1FFYA 1E6EA 1WZNA 3GLQA 4N6GA 3MAAC 1U7WA 2ZYHA 1GPBA 3HYLA 3ZDQA 5CA0F 1CQXA 4NMWA 4HRXA 5JO9A 3JD4A 1GU7A 4Y3UA 3TO5A 3ZXYA 4EQZA 4Z49A 3B53X 4LISA 5AKIA 4QM6A 2PL1A 3LX6A 2ZAYA 4R3WA 4JKOA 4G2TA 1TW3A 2GN0A 3IP6A 1V9SA 2IZ5A 4K87A 2UKDA 4U7DA 3CUTA 2ACVA 3NBZC 2V4UA 4GRAA 3ZGYA 1JAIA 3KEMA 2ZRFA 3WKEA 5AW0A 3DZBA 2NXCA 2A0YA 4LUCA 1MW8X 3T54A 2KSQA 3L0PA 3TOZA 4YP0A 4W5RA 1BGVA 2YY6A 4FKMA 1Q2UA 3EBPA 4DC0A 1PI3A 1Q7TA 2GEFA 4CIWA 4Q00A 2QL5A 4PRLA 5AK0A 1O08A 2ZJ3A 3B70A 3IQHX 4KFTA 5EVCA 2ODWA 4F1JA 5BNIA 2HJ9A 4N3NA 2Z6QA 4JELA 1PJ2A 4ECEA 1XAGA 3IA7A 3WNZA 5E8RA 3EVEA 2EW8A 3MTJA 2Q49A 1I30A 3OQJA 3K5WA 1N1DA 4BS9A 4GLOA 3A04A 4BYGA 1LY1A 3LDFA 4C43A 4KHZA 1H0HA 4E2YA 1NJ8A 2WWGA 3R0IA 4LDJA 4EY7A 1GO2A 1SU4A 5CB4B 3DZGA 3ZE7A 5GONF 1KSJA 3CE9A 1SVMA 4ZCPA 4F92B 3D7MA 4KR9A 3C4QA 3HEBA 3KZ1E 4XQGA 8ADHA 1EUDB 1QG2A 1J2JA 3T35A 4MCJA 4DA4A 1AX9A 3I9V1 2FSSA 1MNAA 1H9BA 2O8CB 2ZRNA 3AY3A 4ZYXA 4ROTA 3TECE 3UYKA 2C0PA 4P7GA 4WXHA 5BW6B 5IJ0B 4DB2A 3SYTA 3DFUA 1LTQA 2GSWA 2JFPA 3B7PA 4CQMD 4LZAA 2OXCA 4MQEB 2FV8A 1P0IA 1SZCA 2NO9A 4G25A 4C7XA 4EHDA 2AN5A 5CA1B 2HMAA 1P73A 2P67A 2VQSA 1UBHS 3E2PA 1DT5A 2I2BA 1QPBA 2HFJA 1OYVA 1W47A 2DHRA 5FLXA 1BN6A 1CC1S 3GI1A 3QJYA 4GWKA 5BN3B 1JG6A 3HE3A 1KQNA 4BE9A 3B3AA 2W2KB 3CU5A 1XRLA 4RVHA 2H7XA 3SKXA 4F04A 2GR9A 1TVEA 3K15A 1G0NA 1ORDA 1X74A 4H77A 5L3QB 5F7XA 1QVWA 2SCUA 2ZR0A 1YI8A 5DULA 5EWLB 2Q62A 3JRXA 3WIEA 3TYXA 2ZIAA 4L0CA 4LYYA 2P8JA 2PQMA 4CKWA 1E8DA 4HEA6 1OI3A 4XYLA 1DSSG 4Q7KA 3W7VA 1L7RA 1JIVA 3R0VA 3CUEF 5K0ZA 5LR6A 4GR4A 4F2DA 2ZJ0A 3PEFA 5C37A 3RYCA 4QBKA 2CSUA 3WYDA 4NR0A 4C0QC 4ENPA 2V5VA 1PQYA 2EZTA 4II3A 2M98A 4BKPA 2P9TA 4GPZA 2C2HA 3PC3A 1E20A 1GG2A 4FYKA 4GZLA 4IHJA 4ECAA 1E60A 2WKSA 3HP1A 1XLUA 3BCHA 3DPIA 1NURA 1PFKA 3LZCA 2EYUA 4NZNA 5G4KA 5BQPA 4KPYA 5THKA 1HDRA 1KK0A 1RLMA 1RZVA 2OEPA 3DB1A 3QUSA 4I08A 1A2BA 4PPFA 4TN5A 3NGLA 1ZCFA 4MDEA 4AZ3B 3VJRA 3Q41A 2BR3A 2G77B 3OFND 3B3GA 5CAEB 1VKNA 3VU8A 4BDSA 2CD9A 2GZMA 4BBJA 1IN5A 1A69A 3ZKAA 2J5RA 3OQPA 3A1EA 3T94A 5F9MA 2K87A 3L7KA 1L5LA 3TOVA 3UZUA 5CD1A 2MR6A 1XQ6A 1AU9A 3RK1A 2GPNA 4IFIA 2G9VA 2O8BA 5FLKA 3UJBA 1FQWA 5KMGB 1X1CA 3ZN2A 2X0NA 2YCBA 1S3IA 3BXHA 3FVVA 4W5OA 1B1AA 4ARBA 3TSYA 2XKAA 3HJHA 3VMMA 3A9VA 2F8LA 2B8EA 4JJ7A 4UUAA 1MOPA 4W99A 3N7TA 1EFUA 4MROA 1KQGA 1Z13A 5IVPA 5F21A 2ZYGA 2CY0A 3I2HA 4M3NA 1QYCA 4K81B 3N0XA 1GU0A 2BEWA 2CDBA 2C2MA 3IUBA 1E2PA 1C80A 4WGFA 1E96A 2FPPB 3TVDA 5JZVA 4FGKA 3L4EA 2Q3JA 4O2RA 3Q8LA 2VCHA 1FFAA 4NU8X 4ZOQI 4CLOA 3MFQA 1R74A 2OVFA 4F11A 3NCTA 4AM8A 4HTAA 4XYBA 4Y2HA 2Z09A 5H5JA 1NSFA 5HIJA 5KYKA 1K9VF 2FX3A 1L1QA 3DW1X 2XE8A 3K2IA 4FDMA 4JROA 2YNMD 3T5TA 3RBAA 4AZ0A 1KJZA 4RMIA 2ZCVA 4NYMR 1GG5A 2DCMA 4XPIB 2WD8A 5E6SB 5CIYA 2P6RA 1Y9DA 4JLPA 4KE8A 3RF7A 1JH8A 4E4YA 4DLUA 4YC7A 1APBA 1N33B 2X41A 3IEXA 1TUIA 4ZOBA 2P69A 4MI3A 3LO5A 4FYMA 1N3YA 1L6IA 4GMKA 1Z0DA 1O96A 2XW6A 4RM3A 1YR8A 3OPMA 2QVGA 1WCIB 1DAGA 3L7YA 4JUDX 4YX9A 5DW3A 1NW6A 2XUQA 4HQKA 2ZRMA 1MJ5A 1Q14A 2WUEA 4A26A 3A3NA 5IRCD 1CCWA 2G25A 1L6RA 2GBGA 4AG3A 4IRXA 4AU1A 4HH3C 1XJWA 4OY3A 4GMXA 1AGXA 1MV8A 4GOXA 2VDVE 3QPVA 1QGUA 3WYEA 4DQLA 4LXTA 1Q77A 4LJ5A 3H65A 1M6YA 3NASA 5FTJA 4HDMB 5DTMA 4AUKA 4LDPA 4DIFA 5CBPA 4ZQGA 3ASZA 2PGLA 3N59A 1DO0A 1NZFA 2FZLA 2XR1A 2YRFA 4C3OB 4C0BA 2OC4A 4OH7A 4OSEA 3B5EA 4R1QA 5K45A 1AK9A 1H2XA 2AR9A 5JD3A 5AK4A 2VDWB 3H8SA 3ZCTA 4D1YA 1EHIA 1NUHA 2ZSEA 4YCBA 4EJ2A 5LVAA 2VBCA 1GN9A 1FDUA 4GYYA 5EJ9A 4F4IA 5IX8A 5A4MS 1AB6A 4NYJR 3GUHA 5DEOA 3GGPA 1NI3A 1NUSA 2EJVA 1TKCA 2IVFA 2Q07A 3HGTA 3R3UA 4N7JA 4QJ5A 3X1KA 1YR1A 3IQFA 3ISJA 721PA 2H11A 2WG2A 3FCCA 2ODAA 3FZQA 2UYHA 1U2DC 5FT9A 3PS9A 4DC9A 4EHJA 1BE6A 4K05A 4BQNA 4LF4B 1U5BB 2X22A 5BN5B 1TUEA 2AG5A 2AYZA 1WY5A 2I2FA 2JGMA 3EUFA 4WKBA 1NIJA 4DMLA 3PQ4A 4ZVUA 2H5EA 5K0FA 1F0KA 3KC2A 2PUEA 1S3FA 3D5EA 2Q28A 2YVAA 3EGVA 1VFPA 3IQGX 4V3CA 5EXXA 2VSXA 1G3MA 2GA9A 2YHSA 2ZBUA 1U0TA 5CMLA 3PEYA 2PL9A 4D9KA 3OMXA 5SZJA 5TJHA 4GL4A 2FPLA 5ALWA 4CEIA 1FVFA 2R7MA 2VRBA 1U2SA 3AIIA 3F71A 2B8NA 3NHLA 2C2BA 1EHCA 3CWQA 1NI4A 1ZI6A 3DKVA 3NG1A 3C7DB 5HS6A 3NXKA 4G4JA 4OQZA 3PB3A 2D62A 4MIEA 3GGGA 5IP5A 1DQZA 3PI7A 5I3ZA 5DYIA 2HJRA 3EY4A 3G2QA 4AKEA 1H05A 2F43A 4UQPA 2Q3CA 2QTCA 5AH0A 1R0ZA 2DRIA 2GTPA 4AP5A 4P3YA 3I1FA 2J4CA 3UK2A 1BRTA 3LUAA 1D7AA 5JDIC 1WETA 4K6FA 4UMDA 1P1FA 4EARA 3BMCA 4J3JA 2RD2A 3NBXX 4NENB 5MHTA 3P9XA 3WJ1A 2R1ZA 1IHDA 1R64A 4NDNE 1CUBA 5AKGA 1V16A 1UC5B 2WJIA 1EVQA 3ZY2A 4LOAA 5HZGA 2OLKA 2ZM6B 4OHYA 4H7JA 1EUCA 4CMEC 1XELA 3L7LA 1W36B 2IIVA 3V48A 4FN4A 2H63A 1YF3A 1PJTA 1KEKA 1MAHA 1D0VA 2ZR8A 5CG2A 1JYSA 2Q1YA 1Z6GA 2D3WA 1C4OA 1FMTA 4L15A 1VE5A 3LXXA 4Y1EA 4DMCA 5TARA 4BVBA 3T7DA 3W78A 3ZZUA 3CG0A 3GELA 3RRZA 3BAZA 4DV0B 2IGTA 2I5PO 2O7SA 1EQ2A 3QKRA 3HLKA 4WLOA 3LW7A 1JHDA 3ZTWA 3ZY5A 1V71A 3B60A 1M7BA 4L95C 2CFIA 1A7KA 1A9SA 4KVGA 5DHTA 1KPHA 3FNQA 2D54A 3UM9A 1DL5A 3CRVA 1W87A 4JKIA 3I9JA 2HZBA 1K7FB 1KU6A 2QN3A 4I4TB 3RVNA 4HJRA 2REQB 3D2BA 2O7QA 4OVKA 4O59O 1M7HA 2R8ZA 4HN4B 5DGDA 5K6TA 2A58A 1QH9A 1SB8A 3NTXA 3GA0A 1XMVA 1N2JA 3DFKA 1REQA 2BTEA 2VK8A 1QH8A 2P6PA 4HG2A 5DBEX 2WY2D 3K92A 1TQ2A 2GYYA 2II6A 2P2CA 2QIPA 4KBFA 1OXSC 5HWSA 3HYSA 4Q9HA 2C4VA 1HFKA 5LWQA 2MT9A 3JARA 4X20A 4JI4B 4PYKA 3C3JA 4U2DA 1ZHHA 3GV0A 5MGNA 4OQYA 3KKOA 1K2WA 5B3JC 4DGQA 1DIOB 2AN4A 3A1DA 4LV6A 3SS8A 1ZAKA 5FQNA 3SC6A 3UOWA 4IKPA 5FD8A 1DQYA 2A14A 2RH8A 2QY6A 1Q0UA 3GAZA 3H1AA 4RF5A 4I4IA 2WMOB 4W1PA 4N82A 1R10A 4K9PA 3DBLA 4CMJA 4WLEA 1GCOA 2QQEA 3FPBA 2GZ2A 3JR3A 4KYIB 3ONDA 421PA 2QRZA 3CUYA 4V0MA 3VU9A 1LLFA 4OBBA 3I09A 3F49S 4D2IA 1E3MA 3NS7A 4R9VA 5IK2A 3TQSA 2XMBA 3RSQA 2QL6A 3G02A 1MENA 3EWSA 2EFGA 3STUA 1R0CA 2QXYA 3VOBA 5JH7B 4YT4A 2PQ6A 2QRHA 4Q4AB 5C34B 4QOFA 3CCFA 1T9CA 4MDHA 5B4TA 1XKXA 1GUYA 2AGVA 2DBVO 3F96A 4AT1A 4BFUA 2PVSA 3DO5A 4TLBA 1MD9A 1WZ2A 3RSOA 4RJTA 5LM3A 1E3WB 5HX7A 5DI3B 3BK7A 4CL2A 3T61A 5I4KA 5CK4A 1D6NA 5EAIA 3UMFA 3QXXA 5CHEA 4HAZA 4L4UA 3RYIB 3R5KA 4LRYA 1GRNA 1XR3A 2H5IA 4RAQA 2ENUA 4D82A 3HU1A 1FYVA 3MWFA 4N3AA 1G6Q1 3EMKA 3DVRX 3NT4A 3BWBA 3CLUD 3IB6A 3HKCA 3QNWA 5EMKA 1Z88A 2CVHA 2GQ0A 5DSZA 5JDCA 4FC7A 3LZDA 3WIOA 1YL5A 4YPOA 3Q7SA 5ENVA 3EOAI 5B37A 3IUEA 1JAYA 1F2TB 4HQLA 1N57A 4LC0A 4LJ9A 5EHGA 2JKZA 4IF6A 5EMJA 4TLDA 1A4UA 3N9IA 1V11B 3P2IA 2PVCA 3RYTC 2QRVA 2PL3A 4IYJA 3KHSA 4B2PA 1T9KA 4BNFA 1ZMTA 2VYCA 4QFBA 5ECWA 1TQHA 1R0LA 2BGRA 2G6BA 5FOWA 3EY9A 3PHLA 2RFLA 2FJUA 3Q15C 1O0CA 1KMHA 3DUWA 1UL1X 2AXEA 3R5XA 4FFRA 5DBFA 2X4GA 3M6AA 4JVMA 3ZDCA 4ZT2A 3VSAA 3DMTC 1NAHA 3MT0A 4WJLA 1USVA 1QP8A 3PQEA 3FJYA 2QSJA 3M6WA 2BFPA 2F8TA 3H6GA 1LGYA 2IRWA 2PMBA 4E5PA 4ETNA 4PYIA 5KYGA 3WWZA 1Q74A 2AUTA 4OYHA 4RTRA 4TQAA 3O03A 1W8IA 4B6OA 4D26A 2GCOB 2H6EA 1Y8QA 3RS4A 5BSFA 2AA3A 2QVLA 3EXHC 3LUPA 1NJ5A 1PJQA 1UZAA 3KQTA 4BP8A 5E8JA 1DIBA 5AESA 3BM5A 3ZVKA 4WY8A 3THXA 1DG9A 1EHYA 4Q3OA 1OPRA 2BSXA 2ZJBA 2JW5A 4QULA 4W8GA 4WZZA 2XTJA 3EXEA 1QO0D 3NYWA 3QVVA 2LP4Y 1GKYA 3G9ZA 2GBFA 5ARCA 3VPDA 3KVVA 2J0UB 3GT3A 3OQIA 4RM2A 5KYNA 1OAOA 1PTKA 5LDDC 4AQDA 4FYYA 3R7LA 3ZDBA 3GRAA 5L4NA 3LRTA 3STHA 1P80A 4PCVA 4JUAA 1QRRA 2PBFA 4G2NA 1IQUA 2P79A 4TV9F 2IOFA 2QENA 4JOCA 4R3NA 4V0ME 2P9EA 4KPFC 3A3PA 3SYLA 3ZWKA 3OTHA 4I55F 2FUG1 4WNYA 3GLHB 1E5LA 1Q83A 4AAYA 3HCCA 3AY0A 2EKLA 4JA2A 1I9CA 2W58A 4WBNA 3QVMA 3DNFA 2JVIA 1JWAB 2JB9A 3D3WA 4M2LA 4UAGA 1EIWA 1WKBA 2VJYA 3WO1A 3WRYA 2A3NA 2ST1A 4KQWA 1EFKA 4K1XA 3QUAA 1U4NA 1I4EB 1HLFA 4DJ5X 2G80A 3U1VA 1U9CA 2B2XA 1EVLA 1A2OA 4I1YA 3EFHA 3TQIA 2I4NA 4C5BA 1JIIA 5KEIA 1P3JA 5JFOA 1Z4PX 4FFVA 1P1RA 2VHQA 3G2IA 4HAVA 4C7KA 2A9VA 1IVYA 1DCKA 2AMFA 2JCVA 5AO9A 2PUBA 4ZVQA 3HZRA 1PL7A 4PBTA 4PS1A 4FN5A 3C48A 4XX1A 4ZI5A 4OL0A 3T5PA 2FU5C 3B1XA 3K0EA 5AXCA 3P4UA 4DR6B 1I6KA 2N46A 3MPUA 4CUKA 3QLVC 2YMLA 1FQKA 5HMLA 4CLXA 1A9TA 3D0QA 3FMPB 1IFXA 1QWOA 3EMBA 2DX7A 1L1FA 3SQWA 5F51A 3WR5A 4G9EA 3K6KA 4DPMA 3PC8C 4IVNA 3K8YA 4MP8A 4XQ9A 3EISA 4QBHA 2BCJQ 1QLJA 1KMIY 2BM1A 4Z7QB 1KK3A 3U7EB 4TMFA 1J8MF 3H3FA 1WXXA 1YL7A 2HB6A 2IDZA 4HLQB 1BVRA 4NMHA 4YLYA 1ACMA 1ONPA 1PLKA 2I34A 4MI6A 4L51A 2GF9A 4RGQA 4RYLA 5EKDA 3TRHA 4BMPB 1ZVKA 5ICSA 4IIJB 4FEEA 5BY2A 1AMOA 3TZQA 3DLAA 1N6NA 4PYNA 3H1EA 2Z2ZA 1D0IA 1GR1A 2B25A 2PBLA 3AESA 3KIPA 4R1UA 3NV9A 3WGVA 1P2TA 5JCPA 3QF4B 1XXLA 1XV5A 1ZHFA 2GRUA 2HIAA 1MMFB 2H2HA 5C5DA 1KZYC 3NYRA 3Q6NA 3GJXC 1T36A 4DADA 5TXGA 5LQDA 3S81A 1XU9A 4FHFA 3ANNA 1T35A 4TYMA 1SQGA 2JD0A 2HU5A 3NU1A 3OJWA 3PVCA 1PT7A 3F3MA 3UB4A 2HFKA 3DMDA 4DABA 5BV2P 2CLIB 1QYIA 1PJ4A 3A9SA 4B34A 4BX0A 3OZAA 4TYWA 3CRZA 5HR5A 2IXDA 1ADBA 4DT1B 1HFWA 3VZDA 3M9LA 3WXBA 4DJEC 1QR6A 3GH1A 1H4TA 4URUR 2ZUDA 2C5SA 4CM7A 2WJZB 1VMAA 2IELA 3S5UA 5GJCA 5GM2A 5K3OA 2POQX 4EH1A 5B55A 4IG4A 4B09A 5KO2A 2TMKA 5HKLA 1TC2A 5J63A 4W8OA 7MHTA 4RD0A 1G2QA 1SC6A 5CX1A 4DY6A 3UV7A 1JQJC 4AJPA 2ORWA 2AHOA 1KAHA 2VS1A 4RPGA 1BS9A 2CNWD 4R7GA 3UUWA 2BDTA 3BIFA 5G0TA 3FLBA 2X3FA 4BMZA 2RJNA 5B1IA 1OASA 1YRWA 3K09C 4FFPA 4YFYA 1CZKA 2HWXA 5LNK1 2YIJA 5DCUA 4NQZA 4BX8A 1KXZA 4D4IA 1H8HD 1HSZA 4C7VA 3EASA 3SYMA 1ZUIA 4ZVVA 4JQCA 5ARDA 2ORED 2V7GA 1NM5A 2QM0A 1HFEL 3Q87B 3QF7A 4MUJA 4R2LA 4HZIA 3QYPA 3EFEA 1EJBA 3WIDA 3O8CA 4LGCA 5DHSA 2XCRB 2C0QA 4A23A 3IR6A 1K75A 1VSQA 2SNIE 4IO1A 4L2IB 1JHPA 2VYQA 2Q6OA 3CO0S 4RFSA 4FS8A 1FFSA 1VG0B 4P2GA 4QXMA 2AC7A 3WKBA 3HC7A 1MJGA 2EBUA 4Q6BA 5FUBA 2P4EA 3SAJA 5JNRA 1O97D 2V6JA 5JCJD 4EG4A 4ITVA 2BZSA 1AH2A 4EEZA 5ALFA 1OTHA 4A15A 1QB7A 3HPQA 4RNDB 1SC9A 4R1TA 1MOQA 5LMZA 3R8CA 5C4MA 2NAFA 2P2NA 3PFFA 1BX1A 1AQYA 1RI2A 4D25A 1QVVA 3DBIA 2OV1A 2VRNA 3ICWA 1JEYB 1P1CA 1KEZA 2OKGA 3TMKA 1JIUA 2ZUFA 1HLDA 4Y0NA 2X8WA 1ISGA 1W581 1RADA 1VBKA 2H2FA 4LS3A 3P52A 2ON6A 3D8TA 3USZA 3H5NA 3ZHYA 4BMDA 4UHFA 2I99A 4F97A 1SELA 1HKUA 5CFMA 1FFEA 3AINA 2ZWVA 2R65A 2Z4RA 5FUVA 3HVKA 2JKYA 3WRXC 5FBZA 4X0EA 5LOVF 1CUFA 1VJ1A 3BE5A 5GV8A 4EWLA 5AVVA 3KUXA 3M5WA 1X92A 1TD9A 3Q3GE 4X1KB 1US8B 3GCDA 2PT5A 4IDHA 5K3SA 3OM1A 4QNRA 2HR1A 4S24A 3L7OA 1ZA2A 2B36A 1JZTA 1RWMA 2ZYAA 3IAHA 3GT7A 1FJXA 2R66A 1G1MA 3L7NA 1DV2A 1K5GA 2RGEA 3IVGA 4IQ0A 1XKLA 4WAUA 1TNDA 4ZAZA 3S40A 4F6RA 2G3YA 2FSVA 2RAVA 4YONB 3DZJA 4WKNA 1I94B 1SO8A 1UXGA 5A05A 1DKMA 1GILA 1JALA 4E3ZA 2H1SA 4V0RA 4PYMA 5EY5B 1DMSA 5JI2E 2RKOA 2PSHA 1JIQA 1P8AA 3QU4A 4I1OA 1LS1A 4QEKA 1TB4A 3KEOA 2IEZA 1JQLB 4EAQA 2HSZA 2VPYA 3S1AA 3BDAA 3T7SA 3VJMA 2IBMA 4OMCA 4QFMA 4PG8A 4EKYA 3I9OA 3FPFA 1W93A 4CQLB 4K0RA 4EY4