1ZNWA

Crystal structure of unliganded form of mycobacterium tuberculosis guanylate kinase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
b'VGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title Unique GMP-binding site in Mycobacterium tuberculosis guanosine monophosphate kinase
pubmed doi rcsb
total genus 60
structure length 182
sequence length 182
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1znwA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1znwA01
2GZAA 3I5YA 1CBUA 4RJLA 3CZQA 1KK1A 3QQ5A 2VP0A 2OE2A 5JFGA 3OIUA 3GLFB 2QE7D 5CM9C 4OI0A 4XWKA 3KB1A 4TQAA 1KSGA 4FCWA 4H1UA 4EPTA 1D5CA 2BHRA 3R9WA 1PUIA 4Q19A 4FD2A 4L9WA 3J81k 2CCKA 2F1IA 1YZNA 4HLQB 4OJQA 2VHCA 4Q1FA 2SHKA 4JKIA 2H8KA 2YC2C 4RZUA 1TUEA 2QP3A 1KTVA 3PEUA 4U02A 2HJGA 2VF7A 1ETUA 3U7EB 3PEVA 3RAPR 2H57A 4CEJB 1XZPA 3IGFA 1Z0KA 3EC1A 4AYXA 2YC4C 4Q18A 1FZQA 3CNOA 2VHQA 1NIPA 5F3WB 1RRGA 3PXGA 2WJHA 1Y3AA 1G3UA 2REXB 1BMFD 3EIEA 4UNNA 5LB4A 2RAPA 5EP1A 3OHMA 5HZKA 5KTYA 3GLFA 4YXWD 2PEYA 1LTQA 2VO1A 4IOKA 2D2FA 1G18A 2QM7A 4Z1MA 3JZAA 3W6OA 3DL0A 1R2QA 2CE7A 2QTFA 4Q1BA 2W2VA 4JVSB 3ZVLA 3H4MA 3QUSA 4HAVA 3OF5A 4LX0A 5CLQA 3HYRA 4EKDA 2UVQA 2VF8A 4PO8A 1E1RA 1XCMA 1UDXA 2DWPA 4Q00A 4S35A 4KLNA 1HV8A 5DI9A 1Q57A 3PG5A 4DDTA 4BLSA 1EXMA 1SXJD 2A30A 4URXR 3B6EA 4GSYA 1HA3A 2LCFA 3IIJA 5CYPA 2A2ZA 2O0JA 3MD0A 4CGZA 4PC7A 1S9HA 5KSOA 2WAYA 3M6AA 2X77A 3S1AB 2JLWA 1SGWA 3NH6A 1Q3HA 2ZI9A 2IXEA 2QMHA 3T1TA 2BOVA 1WRBA 2J1LA 2WICA 1W44A 1KNXA 3QVVA 1TF7A 2QPAA 1M6NA 3A8TA 1R0WA 2Q3MA 2FPMA 2ZU0C 5D3QA 2PX3A 1JJ7A 2VSXA 4EJSB 1FX0A 3FHOA 1VECA 2QGZA 1J8YF 2R2AA 4LBWA 3V9PA 1M74A 1T8UA 2PH1A 1TPZA 2QN6A 1KJWA 1UAAA 1GKYA 3WMFA 1TF5A 1EX6A 3OEED 4NU0A 2H92A 1DADA 3WHKA 1GSIA 3TUZC 4LYAA 3VAAA 2FJUA 1TADA 3L0SA 3VR3A 2KBEA 1EFRA 1Z06A 3GJXC 4LYJA 5G3ZA 4KHZA 2JLZA 4TQUS 3SQXA 2QMEA 4GBMA 1SHKA 4A0FA 2XGJA 1KAGA 4OHVA 5JBQA 2FH5B 3ADKA 3EPKA 1ZD8A 1HTWA 1P2SA 3IHLA 4PXAA 3NDBB 5FTNA 4MDFA 1TUIA 1ZUNB 1P7CA 3U6BA 4TTPA 3FHTA 2ORVA 5BW8A 1ZUHA 5LDDC 2WSMA 1N6RA 3FMIA 1T3SA 4Q4HB 3EAQA 2WOJA 3QKSB 2JDIA 2V8OA 1KHTA 1KO1A 4LHZA 4G3XA 3K53A 1OV4A 3SBEA 2WWIA 1UM8A 3Q8XB 2ODWA 2HV8A 4A15A 2IC5A 2JLRA 4C0LA 2C9OA 2FSFA 1XD9A 3E2IA 3I4LA 3X2SA 3R7WB 5KDDA 2XNDA 1Z0JA 3L0OA 4OJKA 2QUZA 3TJZA 2BMEA 1JR3D 2ODNA 1Q1BA 3DEFA 2IYLD 3LBIA 1NKSA 3MGCA 4DHEA 2HLDD 2YJTD 5L3SB 1IM2A 1W0JD 2VP2A 5B58C 4GPTA 2H5EA 1FTSA 3GFOA 3W8RA 3T15A 4Z51A 4WOPA 1OIWA 2OM2A 3KKMA 2ANBA 1W36D 4O2LA 3KL4A 4JS0A 1JXOA 2ZI6A 1GUAA 4QGFA 1WDTA 1JR6A 3D3QA 2Q9AA 1ESNA 2KBFA 2ECKA 4Q01A 4C2TA 2GA8A 1XCPA 3REFA 2EWWA 1E2KA 4OQXA 3Q85A 5DYGA 5EE1A 3OAAA 1M2OB 2ZQ5A 3GQBA 1CJVC 4Z54A 1CR0A 3ECCA 3EG5A 4QXAA 1QHHA 3HDTA 1ZD1A 3MUFA 4RD0A 4B75A 2OO7A 5LBIA 3WBJA 1B23P 4B3XA 2GXUA 2G88A 2JJ1D 4GFDA 4JL8A 1VIYA 2CL0X 1U94A 2B21A 5E4FA 3TKLA 1U8AA 2ZE6A 4V0NA 1BYIA 1X1RA 2QT1A 1SZPA 5FUWA 1JECA 2O52A 4KFUA 2BBWA 2R6DA 4LY6A 4WXPA 2RGBA 1QHYA 3SFVA 1Z3IX 2Z6VA 3QKUA 4Q66C 4LJ8A 3R8CA 3SYLA 3BOSA 1P62B 4Q03A 1S96A 3ZVMA 1F48A 2IW3A 2ZI4A 1JPNA 4EPRA 1VMAA 1MKYA 1UKYA 1W0KA 1ZM7A 1K5DA 5TARA 2Y8EA 1PLLA 4Y0AA 4AD8A 3B1XA 5JWRA 5L8VA 3QPWA 1G5TA 2WOOA 2AK3A 4Z8YA 1E2DA 5DSZA 5JS8A 1G5PA 4FW9A 4B76A 4NYMR 3RHFA 4P4SA 4OK6A 2FPKA 1ZC4A 4NE2A 2WAXA 2OXCA 1OLOA 4JBWA 1T0HB 3FGNA 2BCGY 3CRMA 3ETLA 4PPQA 4RCYA 4LYFA 4ESVA 2MMCA 3K8YA 4KBGA 4PQYA 4PZYA 4A2WA 2YVUA 2CXXA 1XZQA 1TQ6A 2FEOA 4TMTA 4URWR 3TUJC 1XCGB 3B13B 3PFIA 4E09A 3DPUA 5IK2D 1FPMA 3OEHD 4Q7KA 2J59A 2JLQA 2IX3A 3THOA 1CULC 3LW8A 2ZSFA 1YJ5A 3K9LA 1S3GA 4G5GA 4KI0A 2PZFA 5C4MA 2JLYA 1OH5A 4JJZA 3M0EA 5IHPA 4IDNA 4Q1CA 1GNRA 3SEAA 1NBME 4GOKA 3KFVA 2BBSA 4M4SA 4LHVA 2BMJA 3MWLA 4LJAA 2A5YB 4LC1A 3EZ6A 4TMZA 2XSZA 1WMSA 1Q1EA 1YKSA 1DG1G 3OIVA 5H70A 4OHZA 2ZR9A 4MA4A 4BFZA 3MWKA 2JLVA 1DG3A 5FOXA 5TMPA 221PA 4MUBA 4JVNA 3U3KA 4A2PA 1SVMA 1W5SA 3ASYA 3T61A 1SVKA 4CF7A 5KDOA 2ORWA 1E98A 3KXLA 4BLTA 4DSUA 3T1OA 3LLMA 1AZTA 3PUXA 2QTVB 2DFKB 2C98A 1VIAA 4JLPA 5EP3A 2F3RA 4E5UA 2IYYA 1LVGA 2GAOA 4H9GA 3IQXA 2OCBA 1HYQA 1YRBA 2FSGA 3BH7A 4MKIA 4HZIA 2G1KA 4POAA 3A1UA 1T5LA 1MRSA 4D26A 2OFXA 1Z0IA 1XD2A 1G64A 4GMXA 1YR8A 2FGJA 3RWMB 4DWJA 4ACBA 1US8B 3F3YA 3IILA 4JLBA 4TT3A 1NIJA 3K0CA 3RVBA 3UWOA 3CRQA 4NYIQ 3CNLA 4TYYA 4KFSA 3GJ6A 3UWKA 2B7CA 2V54A 4LDJA 4Q9JA 1E2GA 1NN5A 2VBCA 1RZ3A 3SYKA 2GKSA 3X1WA 5D3MB 3GJ4A 3FHCB 4C0QC 3EC2A 1FTNA 1OE0A 4B6FA 2CNWA 2ZR0A 1J7KA 1NLYA 2VHTA 4TMXA 2AWNA 2ZYWX 2PLRA 3CX6A 3NBXX 1JB1A 3UK6A 5HTKA 1QHNA 4JMPA 4NL4H 2P0EA 1W5TA 3C5CA 3FMFA 4QKQA 1E1QA 3WNCA 1G8PA 2XTNA 4QGHA 3CF6R 5KPDA 3R8FA 4JL5A 2H7VA 1FOEB 2UZIR 1NI3A 2F43B 1WB9A 1SXJB 2FMXA 3QSYA 1KNQA 4AK9A 2PZGA 2QORA 4P4UA 3GLGE 1VPLA 2PCLA 2Q3FA 4MUAA 5K8LA 2BKEA 3WYGA 3EWAA 5L3QA 1OH6A 1LF0A 1IY2A 1XEWX 1NMYA 3U7GA 5AJXA 1CTQA 4Q4AB 4NYMQ 4OHXA 2P67A 3ONWA 3P4XA 2ERXA 4JKYA 4LWZA 3UG7A 2BWJA 4B2IA 5A0FA 5L3SA 1G8GA 5JI2E 5CDFE 3TNFA 4TZ0A 3ZD6A 3DM5A 1UF9A 4KITB 1YZUA 3AKYA 2F9MA 3OAAD 4M0LA 2JDID 1ODFA 1R10A 2FG5A 3C7KA 4A8JA 4QGAA 1GWNA 4A0HA 3B9PA 4P4SB 2PZEA 3I8SA 1ZJ6A 3GCGA 3TUIC 3EWSA 2D7CA 2J5XA 4Q9KA 1KIMA 1R8QA 2HCBA 2GBLC 5FOWA 3OZXA 3AUYA 3HU3A 2IL1A 2WHXA 3QJYA 2ZJOA 3B85A 5TV2A 3IHWA 3BC1A 3QXCA 2FOLA 1X86B 3AVOA 1XEWY 1S8FA 1ZU4A 4LZZA 2OLKA 1EFHA 2I1QA 4YQFA 3LD9A 4HB3A 1E4YA 1QHXA 4FMDB 3U3MA 3GEEA 4JLMA 2GK6A 2F9LA 4A9AA 2ZE5A 3P4YA 3WYAA 3ZQ6A 1EX7A 4TMKA 2QROA 3HU2A 4A6XA 1FQJA 2R44A 1E2IA 2VH5R 3QKRB 3UIEA 1F6BA 2CCJA 2AXPA 3K09C 2CVFA 4IEEA 1N5LA 1KK0A 4B2PA 2G0TA 3Q5EA 4YMVA 1E9SA 1Z6TA 2H1LA 3KQNA 3ADDA 1N5KA 1Z0FA 4FWIB 2IS2A 4IDHA 2JJ1A 4NCNA 2WJGA 5EE3A 2ONKA 1NVUQ 2QAGA 4HUQA 4M8NE 2OBNA 3CR7A 1LV7A 5CK5A 5JS7A 3EZ7A 3QBTA 1A2KC 1RYHA 2CNWD 4YMSA 2WKPA 4PHFA 2EFDB 3IBGA 4NP6A 3LV8A 5AJWA 4G5OA 1OXVA 3GJ0A 1SKYE 3OEHA 2IYUA 3KTAA 3SHFA 4UNSA 3AKDA 3U7FB 3PCRB 2EQBA 4IOJA 5GJVC 4PZLA 2OEPA 5IK2A 3BS4A 4N1AA 3FFAA 3T5GA 3L82B 4D4MA 3O8RA 2MSEB 4MKHA 1M34E 3BB4A 2WWXA 5JCZA 1J2JA 3U44B 1Q20A 4MGIR 1U99A 2G1JA 1G7CA 1KOFA 1XMIA 4W9MC 1MO5A 2VP5A 2X8AA 5KSZA 3TH5A 1NL3A 1T9HA 1ELOA 2XOKA 3P1JA 5E7MA 4OL0A 3TE6A 4IHQA 2W2TA 4M1KA 2IYQA 1XWIA 2CCGA 5IRCD 2GF9A 1TQ4A 1X1SA 2D3WA 3GLHB 1P61B 1SHZA 1T0JB 4FMCB 4MITA 1XMSA 4IXMA 4DSTA 2YKGA 5AWFC 1KI3A 3SU8A 4Q9HA 5B57C 1GFIA 1YZGA 4B33A 3RYTC 4BFSA 3K70D 3Q7PA 4BPBA 2FSIA 2QBYB 2D06A 3SC3A 4NPHA 4FCVA 2W6ID 4FXPA 1N6LA 4OYHA 4IVPA 3LVQE 1UEJA 1IBRA 3QPUA 2V1XA 4HAUA 3TVTA 1PJRA 4IOLA 4QHYA 3B7GA 1D8TA 1L7VC 1BS1A 1W4BA 2IT1A 3C16C 5SZJA 1SVLA 2W2XA 2ZM5A 5TXGA 1M7HA 2HXSA 4I1OA 2PL3A 3D7MA 2GZDA 4LJYA 2N1BA 2VLIA 5KUTA 1TAGA 5ELXA 1IXSB 4IFEA 2VP9A 3NH9A 4TL7A 4B3DA 4MDEA 5H68A 1G8HA 421PA 1E9EA 1NVWQ 3BORA 5FI1B 1JALA 2ZJ5A 3E1SA 4B6EA 1XTIA 4BZPA 4TTRA 1Y63A 1NN3A 1G17A 4JLAA 2J0SA 1PVOA 1EESA 3L8ZA 3THXB 2IYWA 3MWYW 3KQKA 1SULA 2IWHA 3GLHA 2BM0A 5CLLA 3SJZA 2J41A 4PSKA 1W7AA 5FH9A 4O3MA 3DOFA 1N6NA 2GTPA 1IOZA 3K0AB 4DBLC 2V4ZA 5HKKA 1OIXA 5B2ZA 4OI1A 3U7HB 4L8GA 3AF0A 4L4UA 4HUQB 2RGDA 4O0MA 4TYWA 4C4PA 4CEIB 5EE0A 4EAQA 2WTUA 1OFIA 1TQDA 2XNSA 1E96A 2VYFA 1K6MA 4C3ZA 1F2TB 4RKFA 4RCZA 4KSBA 3ZVNA 5EP2A 1BO6A 2QENA 3AKEA 2ZJ8A 4IVRA 3IKJA 3U6KA 3I92A 3BIFA 3IIKA 1JAIA 1T3LA 1L8QA 5KDLA 3CLVA 3QOFA 5EE5B 1H8HD 3K0AA 2OAQ1 4DKXA 2ZJZA 2OG2A 1UDWA 3G0HA 1M1YE 2DHRA 2OBMA 2FFAA 4GZLA 4QJ4A 4PHGA 1BH2A 4KCGA 4CDGA 2O8DA 3BERA 1SXJE 3QEOA 1ANKA 1JR3A 4F4JA 3A1VA 4Q5IA 821PA 4Q7MB 1JEEA 2FNAA 3IIMA 2OXRA 1CR4A 5H8WA 1XMJA 2XOKD 4C7OB 4XWOA 3FKSD 3TW4A 2DBYA 2ZRBA 1ZVQA 2QEQA 1P75A 2MSCB 2Z4RA 4L16A 1C9KA 1KMQA 4FI3C 3FWYA 4OK5A 3R7WA 1UKVY 4Q1EA 4I1UA 1WQ1R 3VR6A 5G3YA 4PSVA 2GCPA 2NO0A 1ZW6A 1XEFA 2GDJA 3LAWA 1JNYA 2GCOA 3N2EA 4B34A 4LHXA 1NRJB 2PCJA 4HEJA 3RWOA 1MABA 4G5QA 3ZZ0A 1DAMA 3VFDA 1Z0DA 2IHYA 4A0GA 3E5HA 4GT1A 2IWRA 2CE2X 3I61A 2JGNA 2VPPA 1NLFA 2CHVA 2IS1A 1E2LA 5FL7D 3EPHA 2EW1A 1MOZA 1G1MA 3EZ9A 3T1QA 2CLDX 3RC3A 2OHFA 3T34A 4A0RA 3LRPA 2XZOA 3ZZTA 2HF8A 3PVSA 3ZJYA 4KYUA 5HZHA 1KK2A 3CNNA 1OFUX 1CJTC 3N70A 4Q4HA 1XEXB 3UMRA 1YHNA 1KKMA 1JPJA 4MYUA 5TY0A 3QI2A 4AKIA 2YYZA 3BB1A 1MO3A 3IBYA 3QEJA 4M1MA 1CKEA 3VKHA 4YDHB 5G41A 1E1RD 3ZIAD 2ZRPA 1G5RA 2ASEA 2EFGA 2GK7A 3CKLA 3G5UA 4WZBE 5AUNB 3BFXA 4D6PA 2W6JA 4I4LA 1ZU5A 1KDOA 2Q9BA 4JLDA 1CJKC 4JYBA 2XX3A 1CU1A 1A7JA 4GOXA 2IEYA 2O8EA 2RKOA 1RRFA 2KB0A 4II7A 5J4KA 3HPRA 1F2UA 4TLAA 1AN0A 5JLJA 4ESHA 2R65A 3CONA 3RC8A 2EWVA 2GJAA 3GLGA 5FI0B 1QHSA 4W5WA 3KJEA 3MJRA 4KYIB 1K5GA 1EWRA 1T5IA 1YE8A 1YZTA 2WKRA 3A4NA 2AWOA 3TIFA 5C4GB 1ZNWA 4D0GA 1CRQA 5FFMA 1E79A 3AVPA 1G4UR 4U5XA 4GP7A 3K9NA 4LC0A 3LQRA 1EGAA 4HYYA 4URVR 1F2UB 3HWSA 4DLSA 2D7DA 1RJ9B 4XOIA 1TEXA 4UNPA 4YMTA 1DAHA 1L4YA 2PT7A 5BN4A 2O8EB 1ZCAA 1E6CA 1HQYE 1PUJA 2G9NA 1OXSC 2QMUA 4A82A 1Z47A 3OIYA 1NG9A 4QHSA 2F1HA 5FBWB 1XF9A 2BCJQ 1AKEA 3A58B 5J4HA 3L0IB 2GESA 3VR5A 2JLUA 2VHJA 3FMOB 2HT1A 1XD2B 1NJFA 2ZI5A 4JVLA 1M7GA 4LYHA 4NZYA 4TWZA 3OEEA 1SQ5A 3U3RA 2QE7A 5HKKD 4M21A 1U8ZA 3FTQA 4US2R 1QG4A 2Q0HA 1HQCA 1V5WA 1R0XA 3RANA 1ZM4A 3FB4A 4DEXA 4NH0A 2BMFA 2CHGA 4EFNA 2NTYC 4CVNA 4R2HA 2GHIA 5KO2A 4MRSA 4RZ3A 4XVQA 1IXZA 2QQ0A 2WJVA 4NYJR 2V6JA 4HAYA 3RRZA 3EASA 1YR9A 2QQEA 4BFUA 3A36A 2YZ2A 2YWEA 4TLDA 3Q5DA 2CVHA 3I8XA 4FINA 4GL2A 3K0FB 1ZYUA 3L8YA 4HLUC 3KJIA 4WZ6A 1KJZA 2ZU6A 1WA5A 4FMDF 5A4JA 1T3HA 2JIZA 1GKIA 4LGMA 4RFVA 1HY3A 1ZM9A 4PAOA 1AJEA 2GAAA 1UBGA 3DKVA 3REGA 3R9XA 3IPYA 3I5XA 5HCIA 1COWD 4OI2A 1D2EA 2G0NA 4JLVA 4OKSA 2ZUCA 3SQWA 1SVSA 5AUPB 2AR7A 2F7SA 3EX7C 2BMDA 5GVRA 1NY6A 2VEDA 4BWYA 2QSZA 3MCAA 3LX8A 1HE1C 4ERNA 2RGGA 5DE3A 1BIFA 1VCOA 4RZXA 5K8TA 3NDPA 4KXFB 4LCBA 4AKGA 2CEAA 4AWXA 3QPVA 3ZS8A 4YLGA 4RFSA 2ZRGA 4BFWA 2ZRFA 1M8PA 1HE8B 2RHDA 3O47A 1DS6A 3KZ1E 4RY2A 5SZHB 1IN4A 3VHXA 1W36C 1AS0A 2D2EA 3PUVA 3K70B 1ZC3A 3U4QA 4XWAA 3B9QA 1G8FA 2W83A 3FVQA 1IQPA 5EJEA 1HT1E 1NY5A 3AEZA 4M22A 4BASA 1TNDA 3Q3JB 3Q7QA 1LB1B 2R6GA 4MGZR 4DSNA 5FBQB 1RKBA 4URYR 3CRRA 4A36A 2ZS9A 1EFTA 3VX4A 1XXHE 2BEKA 1IN5A 4QOSA 3PIRA 3W6PA 3K1JA 3RABA 3EZFA 2CBZA 3LQQA 5L3QB 3TGPA 3OE7D 1KO7A 1W0KD 3N2IA 5AR1A 4R98A 4C0HA 3THWB 3AP2A 1VKJA 4DLVA 3THYB 2GNOA 1DELA 3WXMA 4JBXA 2ATXA 4LRWA 3RS3A 4GDFA 4AKHA 3QIAA 3SNHA 1LW7A 2ZYUX 1GAJA 1NSTA 1G6OA 4QHTA 1IHUA 3TRFA 4MYTA 4HZUB 2ZJAA 1YRAA 4QG7A 4TTQA 5JJLA 4I1VA 4QGGA 4RZ2A 4BLRA 1KMHB 4L15A 4B44A 1G41A 2OT3B 5BN3A 4LJ4A 1IAQA 2IF2A 1XRJA 2CJWA 2B6HA 4P3YA 3CB4A 3ZIAA 1VG8A 3QXJA 3RS0A 1X8LA 3E70C 4EQ6A 2PMDA 2FFQA 4LV5B 5DISB 3QVUA 2G83A 1J70A 1OFHA 2Z5FA 1N0VC 721PA 4FWTA 1XXHB 2N46A 3I73A 2AD5A 2P2LA 5BQ5A 2WJJA 2WSSA 1V43A 2C8VA 4JT2A 1E9FA 2OV2A 2REOA 3LXXA 1G3RA 2Z4SA 3B2EA 1HT2E 5EZ5A 1SXJC 4M9ZA 4BLPA 1II0A 3BRWD 3TR0A 3DO6A 2ZEJA 4C0JA 3FFBA 2DB3A 1LNZA 4B73A 4TYQA 4FIDA 4EQ6B 1TTTA 3OESA 3AVUA 1W46A 3OFNA 1IJFA 5BYJA 1XXHA 1VCIA 2WWFA 2J0VA 1GG2A 3NTUA 1GILA 4NDZA 1WBBA 4LPSA 4TLBA 5F98A 4TMVA 2I1VB 4HDOB 3AVXA 3MAAC 1CF4A 4BECA 5DGXA 2QAGB 5CB6A 4V03A 3MRSA 1Z6GA 2XEXA 4LOAA 3A4MA 4P32A 2IUSA 2XAUA 4J0QA 4KFRA 1OT3A 4LV8B 2VP6A 2QPOA 3THYA 3TBKA 2IXFA 1II8A 3GFTA 1R7RA 3KTAB 1E1QD 4HLCA 2CLSA 2BDTA 2ZITA 3K0EA 4RD1A 2OBLA 3KDSE 3VR2A 3O8DA 2GXQA 2ZUBA 1E0JA 1RE0A 4IEIA 2XZLA 3GJ8A 1JXMA 1E0SA 3AVVA 2ATVA 2DCUA 1KMHA 4BFVA 1VG1A 3AB3A 4GZMA 1QVRA 4TLEA 3NKVA 2OCAA 1FQKA 2F55A 2ANCA 1GNPA 1E94E 4DT1B 5GADl 3NC1C 4Q48A 4HI0E 2KJQA 3SDZA 1Z2CA 2YHSA 5EP4A 2NO7A 3MJHA 3A6PC 5A5GA 4UJ3A 4XVUA 2F1JA 4G01B 3CPHA 1D9XA 2FWRA 4PC3A 1S2MA 1YZLA 2NO9A 4NCIA 2ZI7A 2GF0A 1YU9A 3KB2A 2FZLA 4ZKEA 2WMNB 2ZSBA 4NHOA 1ZNZA 3CR8A 2JEOA 1GZSA 5FUYA 1G3IA 2XJ9A 3BK7A 3NC0C 2GXAA 3CX7A 2BV3A 2E87A 2C99A 5HE8A 3X1DA 4ZI2A 2NG1A 1P2VA 4DLUA 1N2CE 3RRMA 4QJ3A 4ZDKA 5JI3E 1H65A 4ARZA 4OQMA 3W8NA 4EPYA 3UKDA 4GMDA 2B8WA 4GNKA 1EFCA 4PPFA 4B3GA 4A8JB 2ZS8A 3O8CA 3QKTA 1SKYB 4FCTA 2XSZD 2AD1A 4HAZA 3T5DA 4MYCA 1N6PA 1W47A 1E2JA 1OXTA 1IY1A 4LPKA 1B0UA 2OFOA 1WBDA 5AUQA 2OUKA 1P2TA 2IYXA 2BKUA 1UBCA 1D2MA 2ZR7A 4PPGA 5F2EA 1Q0UA 2JATA 1WXQA 4W5HA 4WZAE 3SR0A 3LXRA 3TSWA 2R9VA 4C0SA 1CRPA 5JCPA 2MMGA 1E2PA 2WWWA 3C14C 3LA6A 2VSFA 2ZI3A 1TMKA 2FDCA 2ZPTX 3CIOA 2IUTA 3KX2A 2RGXA 1Q1QA 1D6JA 2ORIA 1R4AA 1W49A 3M1IA 4MGKR 1MT0A 1KI4A 2E1RA 2ZRCA 1VCNA 1LF5A 5CJ2A 1T91A 5TDHA 2W58A 1W4RA 3HU1A 3K0FA 3W5JA 2HF9A 2DFLA 5KOYA 3K70C 2C78A 3X1XA 3AKCA 3U2QA 3SBDA 1N5IA 3MSXA 2D62A 2ZRJA 3U61B 2N42A 3JZMA 4UQOA 5D3MA 2PJRA 1CEEA 2I4IA 1ZIPA 4D2IA 1DBSA 1DO2A 2Q21A 1DAEA 4EJSA 5EXTA 1A1VA 3NHBA 1NBMA 1P9NA 4PZZA 1ZNXA 4EPWA 1BOFA 1NJGA 1AS3A 1U0HC 3EXAA 1RJ9A 4OI4A 1KDTA 1DPFA 3WYFA 6Q21A 2YV5A 4PO9A 2B7BA 2QTHA 1CS4C 1XP8A 2QY9A 4GI7A 2C04A 3VX3A 1TX4B 1FFHA 2ZIAA 2O8FA 4JLJA 2PT5A 3W9YA 4XVRA 3MMPA 2QRNA 2O0HA 2XJ4A 5C2JB 1ZM2A 2KSQA 1KK3A 2R6CA 2HT6A 4V0LA 521PA 2WJYA 4XD7D 2AKYA 4M53A 4HAWA 1OH7A 1NN1A 1E2HA 1TU4A 2IYSA 4NTZA 1KI6A 2CL6X 3CWZA 3SN6A 3VU9B 1FMJA 3R9IA 3GLGB 4LJ9A 4MRNA 4B35A 1RC8A 4DUGA 2C03A 2ZRDA 1JBKA 2H17A 3GJ7A 1UPTA 4TYPA 3SS8A 3VKGA 1ZNYA 4DZZA 5C1BA 5G53C 1CJUC 4Q9LA 3SFZA 5IF9A 5J4LA 4IFBA 5DN6D 3IEVA 5FOVA 1S3SA 2A5GA 1S1MA 2GRJA 3I1FA 4HB2A 3CH5A 3FYHA 1QZXA 2RMKA 4C0KA 2P6UA 3ZS9A 1KO8A 3C15C 3W90A 1LS1A 1AA9A 5FR2A 2IA5A 3TAUA 2WIAA 3ND9A 3SJCA 2C2HA 2V55B 1A4RA 1WF3A 4KFTA 4MRVA 3WY9A 3ZGXA 3V4FA 3AVYA 2YWFA 2IYZA 4QFMA 5FBLB 3VMFA 5FPYA 3ZYCA 5KNDA 4CEJA 1VG9B 2VL7A 1Z5ZA 4D80A 1KO4A 2DFNA 1KJYA 1N6OA 1ZM3A 2PEZA 3FKSA 4YDSA 1F5NA 5CITA 4YMWA 1U2RA 4RKEA 3UPUA 1HUQA 3AVTA 3WNDA 3EZ2A 4HZUA 1XJ0A 5CIQA 4N0EA 4I99A 4JIMA 4IJMA 4TN1A 4Q7JB 3GFPA 3KXKA 4D4JA 1GM5A 1KO5A 4OQFA 1HEIA 4BLQA 3FE2A 1XD8A 2LKDA 5DYIA 1SVWA 4RD3A 2FU5C 2QAGC 4ITRC 3VR4A 1IONA 1HH4A 3KUCA 2ZYTX 3NXSA 4F4CA 5EE9A 4X8OA 2ONJA 1GNQA 4BRWA 1LFDB 2RGNC 3ND8A 1G7TA 2RGEA 3NIBA 4F7WA 1EK0A 5P21A 1MH1A 4JYCA 5FL7A 1DARA 2NGRA 4M1WA 4QRHA 4JBYA 3RLFA 4BFYA 2VSOA 4IOMA 1F2TA 3P20A 3W3ZB 2ZROA 4UNRA 2KE5A 4RVCA 1WCV1 2CK3D 2FZ4A 2NZJA 4NMMA 4DC9A 3TMKA 4Q4JA 1E32A 1ONBA 3BH6A 4M1SA 1P5ZB 3BD9A 3B8HA 3LX5A 4Q47A 4TT3D 1GIAA 1UFQA 2FPLA 2DWOA 2CK3A 4IDOA 4LBVA 2NIPA 1P72A 2CMKA 1XBTA 4DCNA 4MRRA 5EZ6B 4QBGB 5LB2A 2GVDC 4DUGD 2G77B 2GEDA 3ZH9B 3R20A 1RPZA 3LH5A 4M9QA 1ESMA 2K5UA 4ZI3A 4TYNA 1OF1A 2LKCA 3GP8A 5JJIA 5F9FA 4NCJA 3QXHA 4QJ5A 4BLOA 5BXQC 2O8BA 5K8UA 4BZQA 1E9DA 2FEMA 4PC1A 2FX3A 2ZSEA 4MGYR 3U5ZB 2AHOA 4D25A 2P6NA 4RD4A 2ZVPX 4C30A 1GKUB 2P5TB 2CL7X 1X6VA 1A2BA 4MKGA 4OQNA 3CX8A 4QM7A 1S0UA 1GVNB 4CW7A 2OILA 3PQCA 3ICQB 5DH9A 5FR1A 3U3OA 3B1WA 1GRQA 5DIFA 2WWGA 4JLOA 1QHHB 2ZAOA 2XXAA 3ZDQA 1AQUA 3WMEA 1AQYA 4M1YA 1FP7A 2OFWA 3CPEA 3K0SA 1P4SA 1Z0AA 1E2QA 1Q1ZA 3U3JA 3KKOA 1KY3A 1T6NA 2IBMA 4N0DA 1OHHA 2IYTA 4KJZA 4CRWB 5J47A 1OYWA 1NG1A 2WWHA 1CLUA 4IW3B 5KHOC 1AKYA 4FN5A 3MLEA 2QL6A 3TLXA 4A92A 4G5SA 1IY0A 1ZRHA 3P32A 3L2OB 5DLQC 3NEJA 1TU3A 4RSGA 4URZR 1JQLB 2DY1A 1GL6A 4LJ5A 4NKRA 3OE7A 3BBPA 3QXSA 4M9XA 2QGNA 2IYRA 2HDNB 1PLJA 3EA5A 3QENA 5JWHA 1XB2A 4KODA 3SHWA 5KNCA 4G1UC 4UJ5A 1G19A 1C1YA 1OSNA 3AGQA 5CM8B 5ANRB 1U90A 4Q4LA 4TQ9A 1E2FA 1W2GA 1RVDA 3EARA 3QKSA 2O8CB 2C95A 4TL9A 1RRCA 3AV0B 3KQUA 4PFSA 3EIHA 3P27A 3FDIA 3ZLJA 4ON9A 1NP6A 3UG6A 4EFLA 5GJWC 5BYKA 3W5IA 2V6IA 2R8RA 4IXNA 4DB2A 3ASZA 2AFHE 4YC7A 2HYIC 4F92B 2BJWA 4R71A 3KQLA 4CYMA 1DAKA 3VU9A 1VHLA 4HATA 1TQ2A 3CUEF 4Q02A 1XMVA 2W00A 4PC6A 3DDCA 2ZS7A 5GJBA 2QG6A 1R0YA 3QG5A 1VDZA 1IN7A 2CLCX 4B71A 3ICEA 1Z08A 3MG9A 2NPIA 1GTVA 2C9YA 1OKKA 5CK4A 2JLXA 3K0CC 2ZJBA 3O8BA 4LSGA 3NEYA 1S1CA 1RW4A 2ZVQX 3TSZA 2FF7A 3WMGA 2EFEB 1FL9A 1P6XA 3CW2A 3PENA 1DE0A 1QHIA 2J45A 3KXIA 4EUNA 5DHFA 4F93B 2IEZA 1OFTA 2WV9A 3KJHA 5DHAA 3RS2A 2JIZD 4B3FX 5TVKA 3AVWA 4PHHA 1Z28A 4DVGA 3U4QB 2J87A 3QXXA 5FPSA 5LD2C 2HLDA 1UJ2A 1E69A 1N0WA 1NVVR 3PEWA 3QBVA 3AP1A 2BVNA 4ZDIA 3AF1A 2W0MA 5JEEA 3MWJA 2NQ2C 1NNEA 1Z2AA 4BEBA 2YWHA 5KNBA 1Q22A 4IDQA 1F60A 4LK2A 4JL6A 3Q9LA 3GLIB 5F9HA 1VG0B 5JHGB 3B78A 1W2HA 2FSHA 1QBKC 2ZRHA 5C46F 2WIBA 3W34A 4PHTA 3F8TA 2ERYA 3NVAA 4DJTA 5C18A 3NBZC 1OB2A 1BMFA 5L3RA 4A4DA 5HPYB 4TZ6A 1X3SA 4QBFA 3VTKA 3QY0A 1I4DD 4C9BA 1VCMA 2RGCA 2OAP1 3VQTA 1QRAA 2G3YA 3DHWC 1ZD9A 4P4TA 4JT4A 5E7IA 4Q1AA 1E9RA 2NZ8A 3GLIA 4RFSB 5FOTA 2ODEA 1P73A 1N0UA 4M1TA 3TSOA 1XTKA 3K09A 1N3BA 1N6IA 3TVDA 3IQWA 1Z83A 2R6FA 1JAHA 1NN0A 4X8HA 2ZANA 2ZRNA 3HR8A 2P5SA 4DLWA 2A5FA 2RHMA 1UEIA 1OYYA 2J7PD 3AUXA 1NMZA 3RNLA 4EPVA 4P31A 1SXJA 3DZDA 1VHTA 5CIWA 5JEDA 1TEVA 2GBLA 3QG1A 2QNRA 4TL8A 3GEIA 2IUUA 1QF9A 3WP1B 2NOAA 3LNCA 5AJZA 4AKEA 4CIDA 2WSSD 4BQSA 5KYKA 2GJ8A 4PAQA 1ZAKA 2AK2A 5KU1A 4ASUA 2NO1A 121PA 4JVMA 4HSEA 2V3CC 1P3JA 2C96A 4Q4AA 4F4IA 2O8DB 1MR3F 2OCPA 1T8TA 2WPDD 4MQBA 1MRNA 5DNYB 1G6HA 3D8BA 4AG6A 4PPNA 2A3RA 5FUXA 4DCUA 1QDEA 4P0TA 4WBSA 4U7DA 5DI3B 4X8LA 4DIEA 2Q6TA 3RS4A 4AG5A 4BE7B 2YWGA 1KI9A 4AIIA 4XIGS 2GETA 2AKAB 1QHGA 1G3MA 2JJ2A 2ZRAA 4GP6A 4OBEA 4V0ME 2NPFA 5E3HA 1KY2A 3AVQA 3T06B 1KGDA 4OQLA 1NSFA 2FGKA 1IN8A 2A5DA 5K8IA 2PLFA 1FNNA 3T12A 2Q9CA 1US8A 4A2QA 4JZKA 4PQRA 4B43A 1H8HA 3VR1A 3VNUA 1W36B 3TQCA 2O5VA 5FBRB 5JECA 4D0NA 3C4JA 2CHQA 4TSFA 2J9RA 3GLIE 2VTKA 3B1ZA 5SZKB 3EPJA 3G82C 2HUPA 1R5BA 4YMUA 4DLXA 3CZPA 3CH4B 1EG7A 1T4GA 2GILA 2KI5A 3BGWA 3W6NA 1RIFA 1DEKA 3K9HA 3B1YA 4M1OA 1U0JA 4XSGA 4NCHA 4CT4B 5J5CA 2YNMA 5AUOB 1DVRA 1S9DA 3A4LA 4XD7A 1UKEA 5AJVB 3F5FA 1KI1A 1YQTA 2P6RA 4WXRA 2QZ4A 2F6RA 3OIWA 1XPRA 2V9PA 4LBYA 4DSOA 2JLSA 3B60A 1C4OA 1G7RA 1XTRA 4WW0A 3C5HA 5EUQB 3DVLA 1SVIA 2QSYA 4EDHA 5JZVA 4AYTA 1E4VA 1OJLA 1ZINA 4TMWA 1A82A 1FMLA 1VYVA 2ZYVX 1W0JA 1OXUA 4QL3A 4Z1MD 5LD2B 2JASA 3IO3A 1JJVA 4PC2A 3VNVA 2BC9A 2Z0MA 1KSJA 2IXGA 3RRYA 3PJRA 2AN9A 2IF0A 2XITA 2NMVA 1UBEA 2LWIA 1G9XA 4O25A 2FFHA 4XSHA 2J0UA 1E9AA 4K46A 1RYFA 4D81A 3SE0A 1XEXA 1KI8A 3D6TB 4OHWA 2AX4A 4V0MA 3SZRA 1I4TD 2RGAA 3UXMA 2HXYA 1GRNA 1G16A 1ZBDA 2P3SA 3LY5A 1NKTA 1G3QA 5BWMA 2GCOB 4ILEA 4DCTA 4ZV4A 1U8YA 4DDVA 3ZD7A 1KYIA 3WNBA 4BZXA 1W4CA 4DRZA 5AK0A 5FPHA 1H8EA 1MO6A 2VRWA 2ZUDA 4WVFA 3RRNA 4ZIRB 1XPOA 4DCSA 3AF2A 1G8YA 4H1VA 1XTSA 2V7QD 1NBMD 4V0OA 4US0R 2O0KA 3QF4A 5E7JA 4KVGA 1E9CA 2AL7A 4PR0A 4YXWA 3LBHA 3A1WA 2WPDA 4FMCF 2EFHB 1EWQA 2TMKA 1AIPA 4KVAA 4XJXA 5DO9A 1XU4A 2A9KA 3TK1A 3EA0A 3KQHA 1U98A 4B74A 1FUKA 4JSYA 3AF3A 5EXSA 2ZJYA 3UATA 5CDFA 3T35A 2BBOA 2RB4A 3THWA 1N25A 4ZIRA 1OB5A 1CR2A 4Q4JB 3T1VA 1D2NA 3GEHA 3HYTA 3I32A 4OHYA 2OZEA 3LVRE 2P65A 1NVXQ 3BB3A 4KBFA 4TL6A 1PLKA 4C7OA 2F1RA 2GCNA 4LJ7A 5FL3A 2F43A 2PBRA 2OSBA 1AZSC 4EFMA 3EW9A 3ZQJA 1R8SA 1XTJA 3NHAA 3TW8B 4A1FA 3BH0A 1COWA 1LS6A 1Z6XA 2GXSA 3QF7A 1SKQA 1JQJC 5CYOA 2J0QA 4AYWA 3HJNA 2A7QA 1GDDA 2GJSA 3BFVA 4XTRA 4NONA 2GJKA 4R9UC 1E79D 3B1VA 1YR6A 2G6BA 2XZPA 5CJPA 1II9A 2WVJA 5G40A 2DYKA 2Q3HA 2W6IA 3QNUA 5KPJA 1G21E 1YZQA 2YOHA 3HP1A 2BBTA 3LDAA 1KDPA 1R6BX 4G0NA 2J7PA 4F38A 2JJ2D 2REBA 5FOSA 3RS5A 1N6HA 4V0KA 1IN6A 2HEIA 1NF3A 3ZVRA 5GVSA 4IDPA 3H2YA 1U9IA 1KI7A 2WM9B 4HLDA 4XH9B 4EIWA 2JAQA 3JVUA 1AGPA 4V02A 3LO5A 3AH8A 4G5RA 2AFIE 4S2EA 3EIQA 1J90A 4XTCS 2XB2A 3KJGA 3UANA 2OCYC 4DT1A 3GPLA 1R5NA 1E3MA 1Z22A 5JRZA 4PO1A 4ZDWA 2ZRMA 5HR5A 2BJVA 1P9WA 3M4YA 4YONB 4A8JC 1Q44A 4L9SA 1E2NA 1KSFX 2EYUA 4L5BA 3L0PA 3PITA 4BFXA 5GJCA 2QP9X 2EYQA 3WRYC 2QP4A 1BKDR 2W0SA 3AM1A 4N3NA 1DTSA 2VIIA 4NCKA 2YOFA 3UMFA 1AGRA 1II8B 3CO5A 1G291 4HB0A 4DDUA 1OH8A 2X1VA 4K81B 1WE2A 2WWYA 3TR5A 1L4UA 2D4HA 2JJ8A 3FPAA 3TQFA 2X19A 2H16A 5HE9A 1S4QA 3LWNA 2CJWB 3NBFA 3CRVA 1CXZA 1CJMA 1JR3E 2QA5A 2WMOB 3S1AA 2J3EA 1FUUA 3SOPA 3IUYA 4UXHA 1ZMXA 4UNQA 8OHMA 3AF4A 3V4RA 2F3TA 1NLZA 2VP4A 5EUMA 3LBNA 2O8FB 2R6AA 1ZUIA 3DMDA 3NBYC 2QMOA 2RCNA 5HCNA 5FBVB 4DXAA 1FX0B 1KZGB 4IKEA 4PX9A 1GOTA 2PX0A 4U00A 1KI6B 1G20E 1GITA 4QNMA 3ADCA 3W3AA 3BAFA 4Q21A 4I81A 4LHWA 2BIFA 1X8JA 1DAIA 2IK8A 4QM6A 1H8ED 1VYUA 3V00A 1UBFA 3GLFE 4PAMA 3FOZA 1I2DA 2WBLC 1IJEA 2B8TA 1RFLA 1ZIOA 5J4VA 3BXZA 2O8CA 3GMTA 2BM1A 4KLZA 1G7SA 1F3OA 1GL7A 1P60A 1YVDA 2HJVA 2UKDA 3FMPB 4IVQA 1U0LA 2GJ9A 3F0TA 3H86A 4DLRA 4Q7LA 4RD2A 4UXIA 621PA 5LPNA 3ADBA 1MV5A 5FUVA 2I3BA 1UADA 3GLHE 4P33A 3H0KA 3L43A 2VQSA 4US1R 4B47A 5JSZA 1MO4A 4HAXA 3H84A 2WZQA 5E95A 1CP2A 3DKPA 2E9SA 4IRUB 4KSCA 5KSPA 3FKQA 4HDCA 4E07A 2ODBA 2Z43A 1PV4A 3BJIC 1IXRC 1I4LD 1E0KA 3AGPA 4WAUA 3HR7A 4UKDA 4Z8XA 2V7QA 4C2UA 4D4KA 4ZCMA 1K8RA 3IPXA 4B48A 1QVAA 3I62A 2FFBA 4R2IA 1G4AE 3X1ZA 4A6PA 2JA1A 2X2EA 4LBZA 4B32A 1DO0A 1DAGA 1AS2A 1OIVA 4JJKA 4URUR 3IDQA 3PV0A 3TAHA 1NMXA 2ZRKA 2EVWX 2O8BB 2YINC 5EXXA 1KI2A 4ARZB 1XNJA 1TL7C 4AC9A 4ZO4A 4ZKDA 1Z29A 4AI6A 4EJSC 1XTQA 5SZIA 1OW3B 3CF0A 3DMNA 4MH0R 4PSAA 2OESA 2XXAB 1W48A 5CB8A 4MKFA 3PEYA 4HUTA 4FMBB 4HDQB 4HLUA 1QG2A 5FTJA 1XJCA 1Z6YA 2DWQA 2H18A 2AXNA 3P26A 4LUCA 1Q12A 2ZTSA 3SJAA 3DZ8A 1J8MF 1YZKA 2ZRLA 4ZCLA 5FTMA 4ABYA 1U81A 3CRW1 2R62A 5TB5A 2XB4A 3SJBA 4DLYA 3A1TA 2QPTA 1YR7A 2WKQA 4C0BA 5JSZB 2ZETA 3CM0A 3UMSA 2MSDB 2GEUA 3GJ3A 4ZPXA 4CEHA 2NO6A 4ZDJA 1WP9A 1SVOA 4GOJA 2C9CA 3DOEA 2QU8A 4W7SA 5UKDA 5JWOA 3PUYA 1XX6A 2J0UB 4TLCA 4DEYA 1VYTA 1KZ7B 3K9GA 4W5JA 4NYIR 2B92A 1E2EA 1TF2A 3A37A 4JLKA 2IS4A 1HURA 5FPKA 3EPLA 1M7BA 1N5JA 4MYHA 3KFXA 4AY2A 4LV6A 2ZE7A 1X8KA 1EFRD 3BE4A 3PR1A 1O3YA 2J46A 2W6JD 2C77A 4R7ZA 2HYDA 4D82A 4B2LA 2GZHA 4HB4A 1OKKD 4QNRA 1PZNA 4TSFD 1P9RA 3AQ4A 2YOGA 1W1WA 3RS7A 2FN4A 2QM8A 2V1UA 2D74A 3RSLA 3CF2A 3SYNA 2PMKA 3PUZA 1KDRA 2IHBA 4DLZA 3WP0A 3QF4B 3CBQA 1DAFA 1Z8FA 3VKWA 2XTZA 5DN6A 1EFUA 2GWHA 3GJ5A 4CT5A 5B64A 1U9IC 3D31A 4ZCIA 4KAXA 4F91B 5JRJA 5J4YA 3QE0A 4GRAA 4ACAA 4C0AC 1Z07A 5JHHB 4DCVA 3IEUA 4Q1DA 4BUJA 4BEJA 2EFCB 2XNDD 2ZE8A 2ZRIA 2FE4A 4MRPA 5J40A 5JJKA 2DR3A 1JI0A 2GEVA 2L0XA 4Y0VA 4B3CA 4KO8A 3A1SA 2DFTA 3PUWA 4B3BA 1FNMA 1VTKA 2IYVA 4OK3A 2RH5A 1Q21A 1FW6A 1NVVQ 3VHLB 3N5CA 3THXA 2FV8A 2Z83A 3DM9B 1P2UA 4JSTA 3NWJA 4UXJA 1XFAA 1GP2A 2UZ3A 2QBYA 4M9SA 4D4LA 4E22A 4DLTA 5EXPA 4KV9A 1OXXK 4X8MA 1KSHA 1XJQA 3U44A 3RDPA 5IDVA 1A5TA 2RGNA 2X2FA 3NG1A 4M2LA 1OHHD 1LY1A 1XDBA 3HPQA 4PTLA 4PANA 1R0ZA 1W4AA 2KWIA 5JMTA 5M04A 5B30A 4NYJQ 2QT0A 4LJ6A 4RD6A 4DB4A 3MFYA 3B82A 3JVVA 4JLNA 3I72A 2QAJA 1AK2A 3CWQA 1N6KA 2A78A 1E9BA 2A5JA 3LW7A 5H1YA 1DOAA 5KSYA 5L3VA 4DIDA 1L2TA 2XTMA 5FTLA 1Z6AA 3LLUA 2VA8A 3GD7A 1BYUA 1OPXA 5AJYA 3C8UA 2OLJA 3KKNA 1I2MA 3RSOA 2JCSA 2ZSDA 1GRRA 3OFND 1CR1A 4BFTA 2C5LA 4AURA 4DDWA 1JEDA 5FOUA 2ZXUA 2DPXA 4D0LB 1E2MA 2EU8A 2ZSAA 3KUDA 4LI0A 2IS6A 4E03A 3B5JA 5BN5A 4WIAA 4EPXA 4BGDA 1Z63A 3C41J 3BWDD 4QC2A 4QBHA 1MABB 4K8OA 1KKLA 3IO5A 4ASUD 3X1YA 5DI3A 3BFKA 3WHLA 4CEHB 3QKRA 4BRUA 3H1TA 1XPUA 4NBSA 3KKQA 1E0AA 3SI7A 1AM4D 4Q9IA 2HCJB 3Q72A 2ZAMA 5FTKA 4WA7A 2ZJ2A 4PQFA 1J99A 1RRPA 5EQTA 4LHYA 1CIPA 3CPJB 2PJZA 2BEJA 3U60B 1E99A 2QI9C 2WJIA 4QBIA 4I1SA 4KU4A 2FA9A 3WBKA 1ZP6A 1O87A 4O2RA 2GVZC 2J7KA 3KKPA 1Q3TA 1GL9B 1KAOA 1ZCBA 4CEIA 3ZZUA 5IT5A 1UKZA 3AP3A 3WRXC 3LFUA 1FP6A 2ZREA 3I3SR 2VHUA 1R5OA 5FPTA 1D9ZA 4CZ2A 2CDNA 2QRZA
chains in the Genus database with same CATH superfamily
1Y34E 5JCXA 2G07A 2NU7A 4RJLA 1HDYA 4MKZA 1KS9A 3R9XB 3ZQKA 4G81A 5AVSA 2VP0A 4J1NA 3UW1A 1ZK3A 3OQNA 2QE7D 5G0SA 1DFIA 2A9QA 4MIEA 4KGDA 5JZMA 2BHRA 3U81A 3FFWA 1EQAA 3L49A 1Z56C 1Q3KA 4R2KA 2N0SA 2CCKA 2F1IA 5KYXB 3FUCA 1A7UA 3N1UA 3A9TA 3OSZA 3U62A 3I05A 1PHRA 2H11A 1WKVA 4JC8A 3S40A 1SK9A 2B4AA 5BORA 3L3BA 4OD0A 5KNLA 1ETUA 3VYWA 3FHLA 4WJKB 2ZB7A 3RAPR 2JS7A 2H57A 2AUMA 1XZPA 4CEJB 4LE0A 2C7QA 1GTZA 4HQ0A 4PNZA 3DKRA 1H0HA 4Q15A 1FZQA 4JBIA 3CNOA 1O58A 1O6FA 2ZULA 4KNVA 1GZUA 4GPZA 2WJHA 3PXGA 1L8OA 4C4OA 5B4UA 5IF9A 4LNHA 5LBTA 2AG1A 2REXB 3EIEA 5ALWA 1SUIA 5EEGA 4LF4B 1QAMA 3OHMA 5KTYA 4PLTA 1JHZA 2QZZA 3L0ZA 4IJ6A 3CSDA 3ZCXA 4C7MA 2HC9A 4YXWD 5JDIC 1IBKB 2EQ5A 2NZWA 2YBEA 3E2PA 4RPHA 3JQEA 4IOKA 1SQFA 4UZSA 3UKJA 1RYNA 2QUHA 4IIJF 2WHPB 4HQFA 4QRDA 1Q19A 1FEZA 2W48A 2YIMA 3JZAA 4DIOA 3TZLA 2CE7A 3O4JA 4D43A 1XC7A 4X92A 1GXSA 4EG3A 1QYXA 3DGEC 3SAJA 4EKDA 4PO8A 2B3TA 4DA4A 2O0LA 3DBRB 4Q00A 3PG5A 3WGGA 4DDTA 2I62A 1DJOA 4X6UA 4BLSA 3TSAA 2WSYB 3QA9A 2R4UA 1OXKB 5FHRA 5J2UF 4ZTZB 4NAUA 3HNPA 4MJLA 4OB6A 4YAUA 3WGNA 1HA3A 2LCFA 3G8YA 3ED5A 2GYYA 4I50A 2A2ZA 3RADC 2O1EA 3NX4A 3RIGA 2PZBA 3PL1A 4P22A 4P5PA 3M6AA 4KQ9A 3S1AB 4B6SA 4F5WA 1QQ5A 5EG5A 3RJ5A 1O6BA 2W6ZA 4FEGA 4GC9A 1KOGA 1XKTA 3IJEB 3PX7A 2ZOSA 2PRJA 3IQGX 3JVEA 4O4LA 2QTLA 3EXFB 1WRBA 1TKBA 3JCZA 3DLBA 1KNXA 2FXIA 2VYCA 3QJ5A 3E61A 1M6NA 4XB6B 3A8TA 4PSUA 2N47A 2Q7XA 1NPYA 1WWKA 3W2FA 5JQGF 5LU9A 2FPMA 1AO0A 4OJYA 3KT6A 3AT1A 2BEWA 2VSXA 5CAEA 5IUNC 1K4YA 3V2IA 3BEOA 3PPIA 2QGZA 1UDCA 3CV3A 4DY4A 5CCXA 5E4YA 1M74A 3LYAA 4FSDA 2PH1A 1YBHA 3CRNA 4INJA 5FD8A 5AW5A 3T7EA 3WWCA 3OZTA 1UAAA 1BE6A 3HXLA 2PRSA 2C4MA 1XI2A 4KSYA 4B7CA 3OEED 1KEUA 2YNMD 5A4MS 2AOWA 4ROSA 1TADA 3VR3A 4OM8A 4BE9A 1X7HA 3TLJA 1Z06A 2JLZA 1IUPA 1YQUA 5ARCA 3L02A 3R7LA 1SHKA 3PRHA 1RRKA 3ZDBA 3A1NA 4F5DA 2IHJA 3S6JA 1G60A 2XE6A 4OLJA 2PA0A 1KPIA 2P3OA 2VHEA 4CR8A 3VKFA 1FRQA 1NW4A 1UXHA 3HCBA 3ZR4B 1Y3FE 3O2SB 5ADUS 5EZYB 2NADA 5FTNA 1Z4NA 3VUFA 3BZBA 1C8BA 2GO7A 4X1YB 4YAJA 1P7CA 4G25A 3U6BA 3GJQA 3WE7A 3TQSA 1ISJA 2ZQYA 3D6HA 2D1RA 2H7XA 4HFNA 2C20A 4Q37A 1EM8B 1IZ0A 1DP4A 2BM8A 5CNJA 1SM4A 5ALDA 1ZUHA 3KYDB 2WSMA 3M9LA 2J5QA 4PNPA 5DNEA 3FMIA 1L5WA 3EAQA 3LECA 2WOJA 2WUEA 5K09A 2QQ5A 4OLAA 2VDPB 1QVZA 4DQXA 1E59A 1VPVA 4G3XA 4IDGA 4M88A 3GFQA 1WW3A 3OJLA 3KOMA 3VPSA 2QJWA 2QXTA 1YZHA 2ODWA 2HV8A 4YCAA 4KRYA 3JVDA 4ZU6X 2FN8A 4FB4A 2C9OA 2FSFA 3E2IA 1XDSA 2QX6A 2OCLA 3X2SA 3M4ZA 5CLFA 3R7WB 4RDXA 2P35A 2XNDA 4RQAA 1JMKC 2Y2VA 2QUJA 3NGMA 5T64A 1FDTA 1Z0JA 3L0OA 3Q8WA 4C6TB 3WKAA 4JROA 1I1QB 1O08A 3HZZA 2YZKA 2IYLD 5D01A 3KUXA 4DHEA 1SMKA 4Q1BA 2IOYA 4OYRA 3R5HA 1Y8RA 2H5EA 2C3MA 3H2BA 1FTSA 2XMGA 2PRZA 2P2SA 2JCBA 3GFOA 2R1TB 4JFRA 1OIWA 2FHPA 3IP1A 3KKMA 5DM60 3KL4A 2G9UA 4JS0A 3U37A 4OX9Y 4CN8A 1C81A 4BVAA 4UHEA 1GUAA 3KZXA 3P2IA 3KKKA 1WDTA 3LVFO 4F3CA 3A04A 4C2TA 2OMKA 1B00A 5T5QA 3PXBA 1KH2A 2ZQ5A 1JE0A 1CJVC 5J4KA 3TGLA 1CR0A 4O4IB 4RAOA 4RMIA 5FT9A 1WPXA 3DL2A 4QXAA 1ZAYA 4NCXA 3DT9A 1Z2DA 2PX6A 1NI4B 1WW8A 4HWKA 3C74A 1GGNA 4P5DA 1ZCZA 3LCJA 1Y7LA 2ISQA 4RD0A 4TKZA 5SICE 4B75A 4AX8A 1JHOA 2FEXA 2PUGA 1YT5A 4TKLA 1SG9A 1Y1KE 2AOVA 3T3GA 4Y6LA 1PTJC 4B3XA 2GXUA 2B78A 3UJHA 3L18A 2YN2A 1A76A 3PD1A 4G5YA 2XUAA 1L5HA 2IYEA 1U94A 1N4AA 4PZUA 3KS9A 3TKLA 4AW9A 2DCMA 1EJ6A 2ZE6A 4NE9A 1X1RA 2QT1A 1SZPA 3KWFA 3Q87B 5FUWA 2P9JA 1HETA 3IXLA 2IPXA 3NLLA 1KZ1A 1WSDA 3H5WA 2O4CA 3I9MA 3KJZA 2RGBA 3LCRA 3WKBA 3ZPXA 3C3XA 3U1TA 3QKUA 1HDOA 4H1HA 5TS3A 3SYLA 5KX5B 1P62B 2JIRA 1PDWA 5C0OE 3ZVMA 1WTCA 1E1NA 1F48A 2H48A 2IW3A 3M6MD 2QN9A 1VJ0A 2PKXA 1MKYA 5TQ0A 2R7NA 2AG0A 3KLMX 1Z17A 2UDPA 1ZM7A 5DYWA 1K5DA 3CT4A 2AIRA 1VJGA 2Y8EA 1PLLA 1T5TA 3TX6A 1MD9A 5KWJA 4UCXA 3W9SA 4Y98A 4EYKA 5JWRA 7ABPA 5L8VA 3QPWA 1LGYA 4M0CA 2DFVA 1EPUA 2Y0DA 1G5TA 4NZPA 5GQSA 4L74A 1N0IA 2AK3A 1E2DA 3JRXA 3MWFA 4O63O 5IWCA 2YS6A 4B76A 5IFLA 4NYMR 2OKGA 4TM7A 3RHFA 5AVZA 1M1XB 3VAYA 4FIZA 2I3AA 1YDEA 1OLOA 4JBWA 1T0HB 4EUFA 2C7VA 3IOYA 1U2DA 1IY8A 3Q1LA 5JNLA 1JAYA 3QH4A 1WXEA 4CFYA 4O5AA 2XVYA 3A25A 2C4HA 4J91A 3NTLA 2JFBA 1TJYA 1SQGA 2D1QA 2QW8A 1F14A 3KT8A 5J2UA 1RPNA 4Y2UA 3AI2A 3TUJC 4URWR 2QR2A 3DAGA 5HHTA 1RACA 4ND1A 3ZNPA 4C4TA 1S01A 1FPMA 3OEHD 4Q7KA 2J59A 4UMFA 1ULUA 3SP1A 4DJEC 2Q3EA 4YWJA 3GDHA 3THOA 1GCUA 5FBKA 1V3QE 2XWBF 5T67A 1PNRA 4KHPB 2JHFA 4W1QA 5KTMA 2ZVJA 2PZFA 4KI0A 5CVUA 1OH5A 4JJZA 1R6VA 3LGXA 2C29D 2FMFA 4M37A 2Y1FA 4M8KA 2D1SA 1EUDA 4AUKA 5KHLB 3ZK8A 1ONPA 1I2ZA 1D5WA 5KQPA 3K2EA 3FTDA 2WKSA 3L7MA 3P9RA 3KFVA 3W78A 3ZE6A 4YAGA 2ZBDA 4ZYUA 5JSUA 5CGQB 3FI0A 4CDMA 2DBZA 4EW6A 2V6MA 5DWQA 3QLEA 1G20B 2RGWA 4TMZA 2XSZA 4JQYA 2MSNA 1GQFA 2Q0QA 4EYEA 3OIVA 2VWHA 4ARSA 3V5NA 1RP1A 2G17A 1IUOA 3IEPA 3CEMA 4L6CA 4F3NA 3ORRA 3KJNA 1PFGA 1DG3A 3DLTA 4HTFA 5FOXA 4BDTA 16PKA 1HSOA 4KYVA 1OC2A 4U7WA 1L7AA 3JZDA 4GOOD 3B3GA 3MVEA 4JVNA 2H0RA 3T61A 4A2PA 3ZCTA 4C6TA 5CPBA 5SY9A 1OXMA 1Z13A 3ZTWA 5A3RA 3MT0A 3LLMA 5KYNA 2GHQA 4JLPA 4LOLA 2F3RA 2IGTA 3QE3A 1FYXA 1V3TA 3I0MA 3IQXA 3CEAA 2D13A 4G09A 4I1YA 3UBMA 1YRBA 3GLKA 3W04A 3LX4A 3IFSA 2LTAA 1U7TA 2QU7A 1F8GA 4PGGA 5KVAA 1XEAA 4NXNB 4X7BA 2G1KA 2FW7A 4LW8A 1T5LA 4EG6A 3O93A 2X5OA 4QPZA 5LZ5A 1Y6GA 1G64A 2GPWA 1UFVA 3PPWA 1VKZA 1SU8A 1RQPA 2FGJA 2HH9A 2IQ5A 2PUDA 2CYBA 3SZGA 4ACBA 1ZMOA 2C4UA 2ODPA 3COZA 3IILA 4MSUA 4NDNE 3M3DA 4W5RA 3DOJA 2XOEA 3INGA 3BFJA 5EKUA 3IDOA 5AYVA 4UTZA 1EUCB 4ZOQI 5HUJA 4LDJA 2PGJA 1E2GA 1PK9A 2FZGA 1NN5A 4LZJA 4Q3DA 4QTZA 3V1UA 3UXEA 2FK7A 4PX5A 1KQPA 5F3DA 4DC1A 1FJ2A 2CDCA 1QYCA 3E9CA 3IKMB 5JZ9A 4D4IA 3OWXA 1C1XA 2X0IA 1NLYA 2VHTA 3STVA 1JB1A 1TJPB 2B1IA 1U9ZA 1D6SA 5JXWA 1DV2A 4BAZA 1XYYA 2GD2A 2IDJA 2P0EA 1W5TA 3P9PA 3WOHA 4IKOA 5BR1A 1RC0A 4IMPA 3BMQA 4GM1A 2XTNA 4QGHA 3CXUA 1VBNA 3AHCA 2BEWB 3VO9A 4FDTA 3HV2A 1FF9A 5GMOA 3P2OA 2CJPA 5C1DA 4HDAA 1ZESA 3G9UA 4M87A 1KNQA 4AK9A 1IBMB 5ENVA 1PFKA 1DRUA 1RM4A 2HMTA 1I7PA 1VPLA 1HDGO 2I6UA 3PQ2A 1L7MA 5K8LA 3WYGA 3EWAA 1OH6A 2QLMA 2XUZA 1OGIA 1O97C 3OTGA 3NM4A 5JFOA 3UB2A 5FFNA 4NV0A 3HN6A 2PY6A 4JJ4A 4Z2YA 1A97A 2BD0A 1LNSA 1U2SA 2AYXA 3AJRA 2R00A 4JKYA 3A2LA 3ADOA 2YWRA 4JC0A 5A0FA 1M6YA 2VBFA 3DVRX 4RZIA 2I54A 2JW5A 5DBEX 5BVGA 3W6UA 2CFOA 2EG9A 3UHOA 5FWAA 3JYOA 1I1OA 2DJIA 1Z68A 3DM5A 2IBTA 1ADYA 3AKYA 2F9MA 1ZRSA 4RHCA 4DBVO 3L0YA 1ODFA 4JX9A 2FG5A 1WV1A 2FUEA 2JD0A 3F5QA 4BO2A 1GWNA 1KXZA 2V6FA 3S70A 3B9PA 2ACEA 3VBCA 2OBXA 2NSJA 4A0HA 2P69A 4QDXA 1J1UA 1WPRA 2XWJI 3WL3A 3TUIC 3I39X 3ER8A 3OJXA 1KIMA 2GBLC 4MQUA 3AUYA 4D8WA 1H5QA 1H2EA 5TV2A 2Q6OA 1NQ5A 1XZHA 1KFCB 3BC1A 2PAFA 1VP3A 2BFEA 2CW5A 4TKVB 2Z6AA 2FOLA 4E2FA 2VDNB 1X86B 3U16A 2YZ7A 2VUIB 1ZGGA 4JEMA 3WLJA 4LZZA 2J9FB 1EFHA 4ND7A 1J8QA 3ZY5A 1SCUA 1FY2A 1REQA 3DUFB 2OD9A 4HB3A 4MRAA 3HMQA 2Q41A 4FMDB 2VT7A 3U3MA 1JLSA 4F3KA 2W2PA 3DFZA 1GGHA 1R15A 5B4TA 2H3HA 4MRMA 5ECDA 5FQNA 4B80A 1RBQA 4DSZA 4KP7A 3ZQ6A 1TU0A 1JA1A 4CHTA 4DDMA 4U7TB 1FQJA 2R44A 4RTLA 5H80A 1C3LA 1F6BA 3WXBA 3WGUA 2QB5A 2PWAA 4FKBA 2P7HA 3MGBA 2CVFA 1N5LA 1QK5A 3Q5EA 2QAIA 3BDAA 1Z6TA 2FP4A 5K9ZA 3ADDA 2WM8A 3ONDA 1N5KA 2EFJA 4NCNA 4LN1A 2WJGA 5EE3A 4HUQA 1E1YA 4G36A 4DCCA 5FDFA 1LV7A 4HRVA 5JS7A 1A7KA 4KDCA 2XGGA 2Z58A 2REQB 1RYHA 1EZZA 3TNYA 3NHWA 4V1CA 5ICMA 2PMBA 3MA0A 3SIXA 4UASA 2X7HA 1J23A 1OXVA 1TI7A 2QX8A 3RU2A 1KBQA 2X9LA 1P80A 3KTAA 2OCXA 3SHFA 1YTUA 3KSUA 3AKDA 3QQPA 1JFVA 1PEKE 1FTGA 3UT5B 1XZAA 4P2BA 5B3LA 5GJVC 1SKUA 3JQ8A 4H3KB 1ZGHA 3N2GB 4RADA 2VH1A 4E5NA 3BS4A 3RSCA 2J3KA 1HE5A 3EISA 3HMKA 4D4MA 1MC5A 2MSEB 4IXWA 4MKHA 2W4MA 4N9QA 1EUQA 5DCYA 1C14A 2PIDA 2CC2A 1X38A 1OWMA 3OD1A 5BMVA 1U99A 4CE6A 5FHQA 4CUZA 3OTHA 4W9NA 1DB3A 3I6MA 3I9KA 4OU5A 4OTZA 4Y9DA 1WLYA 1XMIA 1MO5A 1ZZGA 4W9MC 2VP5A 4P35A 3TH5A 1K8XB 2PBZA 4O4JA 3M1YA 4YXFA 1ELOA 2XOKA 2YV1A 3NQ41 4H2DA 4EHJA 4EG1A 1ZJZA 2QSJA 3SIWA 1VSTA 1X9IA 1XWIA 2UYQA 4A1OA 1TQ4A 2PQ2A 4YQEA 1Z45A 2JRCA 1P61B 1SHZA 3O03A 4ZI5A 1PS0A 1T0JB 2H63A 1PNTA 3IODA 4FMCB 3RYFB 3EEBA 4GBJA 2YKGA 4Q9HA 2CFRA 5B57C 4GYJA 4FHEA 1TUGA 2VSYA 2XUJA 3F4LA 4LWQA 5L6MB 2G9RA 3Q7PA 4KLAA 3DV0B 4MHOA 1J0BA 4FCVA 2W6ID 2LGJA 1N6LA 2JI9A 1PFWA 1CZHA 2ONCA 4IVPA 4LX8A 4W82A 2WILA 2CLKB 1NRXA 2FUCA 4LMBA 5ITVA 3K4QA 2IUEA 2VUUA 1I0LA 1PL8A 1D8TA 3E8SA 3KWLA 1CR6A 1CZNA 2IT1A 5FYQA 1CV2A 1NQXA 3UQZA 2W2XA 3AUTA 4WPGA 4N8DA 3ROZA 1P9OA 1ZICA 2QYSA 3UMMA 3OX4A 5TXGA 2CMDA 1M7HA 4FFBB 1ZZEA 4KZPA 3IKVA 5BPFA 1QYVA 2VHZA 3R7BA 3RSZA 3BICA 2JI4A 1P0QA 1MJ5A 2BGIA 2Q99A 3BXFA 3NH9A 3T3IA 3EODA 5H68A 3U3ZA 2RK3A 2IIBA 3UPTA 1G8HA 4YJFA 1E9EA 2WJZB 3IVXA 4LA4A 3I2HA 3BJEA 4N3CA 1WHTB 3AC0A 3CCCA 4BZPA 3TXXA 2ZCVA 1U1IA 1Y63A 3ZNQA 3RK1A 4D9HA 1X7XB 4TZKA 2CNNA 4LXXA 3ZXUB 1PVOA 3O84A 4OIFA 3WZ2A 3THXB 1OBVA 2ZSHA 2IYWA 1R4MB 1HMPA 3HSSA 1SULA 2AH5A 2OQRA 3OVMA 3F6EX 4GVXA 1NW6A 1L7DA 4Y2VA 4PNEA 2V4ZA 4ZVTA 5HKKA 1OIXA 2LNDA 4KN9S 4JJ7A 4ALJA 4OI1A 4CFSA 4YLEA 1XNGA 2EFYA 2IYAA 2AN5A 2JIMA 3AF0A 4L4UA 4CKEB 3ABSB 4CEIB 5EE0A 5D3KA 2EARA 5ADWA 1SCNE 4KL8S 4GPAA 1BXRA 4RA6A 2AB0A 3C6BA 1V35A 2CYAA 4RCZA 3IAEA 5EP2A 1IG3A 2C0QA 1BO6A 2O57A 1FS6A 5E2IA 3AKEA 1ES9A 1E6EA 1ETHA 3BIFA 2YV3A 5I9NA 5A03A 1IZ7A 3MGKA 1U0EA 4FFNA 3E5NA 2QL9A 3DULA 2RC5A 4IIJB 3GQBB 3IPLA 1O6ZA 1YR3A 1C8LA 3K0AA 4Y67A 1UWKA 2V7VA 3R0JA 5KIAA 2OG2A 1F8YA 1K7YA 4P36A 4R1SA 5GAJA 3G0HA 5JD5A 5IVIA 1RQNA 4UM5A 2WFLB 4QOEA 4GZLA 1VIVA 2WSLA 2FWNA 3ICPA 4QJ4A 3E23A 4A16A 4EECA 3SJ7A 1SXJE 1GEGA 3IE1A 1ANKA 6AT1A 1JR3A 1EI9A 3PNMA 3WBBA 1GQQA 821PA 3RBZA 1NXPA 2EZUA 1Z12A 3OCJA 4Q7MB 3HFSA 3NT4A 1WW2A 2FNAA 4F3RA 3AG6A 2OXRA 1CR4A 1XMJA 1X8XA 4OXXA 4XWOA 5EJIA 3A6GA 4LDAA 4XUGB 2ZRBA 4D56A 1E5QA 1MBZA 2QEQA 1P75A 5EJ9A 3A4IA 2Z4RA 4C4RA 2NP6A 2BFCA 2FN3A 4FI3C 2JD1A 2GBCA 2OGUA 4Q1EA 1MN6A 4EDFA 3HN7A 1CQZA 1PJAA 4MVWA 3ICVA 2BEUA 3VR6A 2PTHA 3WFJA 4RJIA 1YB5A 2GDJA 1XEFA 3SSMA 1JNYA 1O1YA 5AW2A 4LHXA 2UZAA 5D7NA 5L3ZA 3U56A 4DKJA 4QULA 3ZWPA 4HXFB 2VEOA 1UWCA 1QG6A 5FULA 1EUZA 4J43A 1EDOA 4KKVA 5I9SA 4B4DA 8ATCA 1AHNA 4O08A 4XQ0A 3VV3A 3QVKA 1S7GA 4GT1A 5TSDA 4ZJPA 5CFOA 2CE2X 3K4PA 1JT9A 4G37A 3HYCA 4YLYA 5DBFA 2I34A 4GPIB 4J07A 1E2LA 4QATA 3V8MA 2YWJA 5EZYF 1OVGA 3EZ9A 3RC3A 3UEOA 3W3AH 5C7IO 1SUPA 4WCFC 1DL5A 4XWWA 2O48X 4WXYB 5DNVA 3HKEB 1Z4MA 3VR6H 2X23A 3F1KA 3TEFA 3O75A 4J0IA 4FZVA 1CF9A 4MYUA 3SC4A 3CGGA 1C0EA 4AKIA 1T0UA 2QDKA 1YCHA 3KXPA 4CQMA 2WTMA 3K8ZA 2UUCB 3BB1A 3W8FA 4ZVPA 4KMMA 3PDWA 1MO3A 3IBYA 1DC5A 2VJQA 4MHTA 5G41A 3NYIA 2FG7C 1E1RD 2VCEA 3RC7A 3ZIAD 1HC7A 2ZRPA 2B4TO 1U2GA 2ASEA 3E0XA 3A26A 3JQAD 5K3DA 3T7AA 3CKLA 1MEOA 5AUNB 1ZD2P 1VPWA 1JQDA 1SIOA 1KDOA 2Q9BA 1USGA 3BWCA 3NTOA 2ZSKA 1A7JA 1F12A 1LDGA 1ZH4A 3K30A 5GM2A 1QRTA 2PUFA 1E5DA 3VZQA 4B6QA 4EKYA 2KB0A 4II7A 1I3LA 3IQDB 1HDXA 3E3MA 3RHTA 4O2BB 2R65A 3CONA 3DE6X 4I9NA 3RC8A 4M8IA 3FPFA 2CF6A 2A3NA 3MJRA 4P0PB 3A1CA 1K5GA 3A4NA 1T5IA 3DC2A 1YZTA 4D4HA 2AWOA 1G66A 4LDPA 4BGVA 1ZNWA 4EG0A 1CEYA 2Q2NA 4R2XA 3AVPA 1G4UR 4U5XA 4GP7A 3K9NA 3CNQS 1J22A 3Q1KA 2ZAIA 2VTBA 4HYYA 3H18A 3VKUA 2YWDA 3T5TA 1W19A 2Z1DA 5C7YA 4L3OA 5MF6A 1L4YA 1K75A 2PT7A 2VYVD 1HQYE 3BDVA 3RRJA 3NJ8A 2QMUA 4A82A 1Z47A 5I5GA 4LYGA 4HUJA 3UVEA 1GTRA 1NG9A 1S3IA 5FBWB 1E5LA 3I1JA 4NFSA 1KIFA 4E7OA 2PS0A 3A58B 4RXUA 4EI7A 4JOSA 7YASA 2GESA 4BVHA 2VTBB 1YVRA 1PNQA 1XLUA 2CNKA 5BMVF 1WXWA 4IJWA 4YEDA 2HT1A 2IZ0A 3OLVA 1NJFA 3SMVA 2VK8A 4TWZA 1I6WA 3C8HA 3OEEA 2CNBA 4JYAB 4M21A 3BWYA 5EA2A 4IV8A 3LY7A 4FWBA 5EHIA 3A6LA 1FUIA 2YHAA 3UJ7A 3HLTA 2Q0HA 3QHPA 4R6WA 1V8DA 4WKNA 1ZM4A 2GPSA 2HN9A 3FB4A 4NH0A 4PLZA 2BMFA 3H11B 1YRHA 4PR3A 3TPFA 4DEXA 4DJJA 1HZJA 3JS5A 2NTYC 1X7ZB 1OTHA 1XZKA 2HWKA 3LT1A 2A86A 1WCYA 1VE3A 2YN0A 4HFMA 2VKQA 3QU2A 3OOWA 5CVDA 1S5PA 3OHSX 1U0RA 2AW5A 3CHYA 4N01A 5IUKC 2JVKA 4UATA 3ZYZA 3T3DA 2YZ2A 2YWEA 4V0QA 1R6AA 3M4NA 4INAA 5DLPA 2JB9A 3DUFA 4JH0A 4GL2A 2IIQA 1ZS9A 2HK6A 5IAAA 1ZYUA 1MG5A 1TXGA 4JXJA 5CA1B 1EXVA 4WZ6A 2H06A 1IE3A 4V38A 1WA5A 5A4JA 1JDBB 2C9ZA 2JIZA 3DE0X 4LGMA 4RFVA 3PQ3A 1I7SB 3UENA 2BFEB 3G2PA 4ZT6A 1JMYA 1UBGA 3DKVA 3A7EA 1SEVA 3IIEA 3RUDA 4PQGA 1F9AA 5HQTA 2GYUA 1SHTX 2M1ZA 1COWD 3MWEA 4NV1A 2ZYDA 1YTLA 3EZYA 1IIBA 2HXGA 4QVKA 3JQFC 5CXQA 5SY6A 4JY7A 4EF4A 1NY6A 2RG1A 2O7NA 3GXOA 3IV7A 3MCAA 1YZFA 2P9GA 3OY2A 3ZV3A 4MEBA 4OB7A 1LBEA 1THMA 2E4WA 4B3HA 5JU6A 1XVLA 3NDPA 3L7JA 4LCBA 5BT8A 3KHUA 5L7WA 4FR5A 4AWXA 3T9EA 2P2DA 3ZS8A 2C61A 1LDMA 1A9TA 4YLGA 2YHIA 4QTYA 2ZRFA 3WL8A 2KQUA 3WR5A 2WQZA 3RUIA 4ER7A 4IIUA 3M2TA 4RBNA 4BP1A 1T24A 1BA2A 3K70B 4E13A 4P80A 1UBSB 1EWKA 4XWAA 4OO3A 4EY7A 1YFKA 1U6KA 3H75A 1EGQA 4B3TB 5IZ4A 5LZ9A 3EQ2A 4AWAA 1XT6A 1PD1A 3T4EA 3EW7A 4M22A 2FMUA 2JGJA 4BASA 2G1UA 1TNDA 4YJKA 4MGZR 4D9GA 5FBQB 4PYOA 4URYR 2ECFA 4R83A 3ZW8A 4BZWA 1A8UA 2R48A 4BN0A 2BEKA 1DCFA 2FWBA 3BG5A 3PXAA 4P92A 1EHIA 3MMSA 2EV9A 4FSXA 3W6PA 3K1JA 5FO0A 2HHAA 2PMEA 3RABA 1QHFA 1TECE 3EZFA 3GGJA 4PIMA 5L3QB 1RHMA 1DCTA 3OE7D 5CP8A 1KO7A 1W0KD 3N2IA 3UMJA 4ARAA 5BNWA 2HU2A 5HIAA 5AM5A 2QQGA 2DP4E 4DLVA 4FTWA 3OX2A 3THYB 1DIRA 1CDEA 3WXMA 4LRWA 2ATXA 1U0FA 2XWSA 1L5HB 3RFVA 4UDXX 2QR3A 4IUYA 1NSTA 5MN6A 1KYYA 1FZTA 1CE8B 3VPXA 4F96A 4PYJA 4MYTA 1A71A 1V39A 4UCWA 4D5EA 3IUEA 1IMOA 1G5QA 4CV2A 1AH2A 3HS3A 3PFFA 2AR9A 4BC0A 3WRVA 4NEGA 4B87A 1A77A 4JGIA 1CYDA 3KV3O 4BVKA 2C97A 1CSEE 3SDSA 1MB0A 2XYHA 3UAOA 4L4SA 2WPNA 5DT9A 1SZCA 1WBJB 5DYTA 3WQRA 1GCOA 3DCJA 4YJDA 2BISA 3ZZMA 2B6HA 2XYGA 4KTTE 1ZWLA 1TT5A 4WWHA 2Q7OE 4X7PA 3UCXA 4EQ6A 4LK3A 3JQAA 3RASA 3QVUA 5DCWA 1S02A 1J70A 4F9GA 721PA 4FWTA 3IAM6 2OOSA 2IV3A 3HA5A 4G4JA 2BMWA 1JKFA 3MQ2A 3TZHA 2R86A 3BMXA 3CJRA 4N5IX 5K0TA 1VSQA 3TQRA 4C6RA 1NAHA 1ZEMA 4RMJA 3I53A 4UEOA 2ATEA 3LXXA 5D2CA 3UGQA 2Z4SA 5IM4A 5EZ5A 2VWPA 4J0FA 2F3SA 2JVIA 3BRWD 3DV9A 3NM6B 1XTBA 4YJFB 4BZZA 3LG2A 3FFBA 1AKQA 1TQ8A 4BGUA 1QM5A 3HM2A 4UHHA 3IV6A 5EPOA 1GDTA 1TTTA 1P91A 5A9SA 1KMIY 3OESA 1R8JA 1UMBA 5ECGC 3T95A 5B55A 3LYUA 4AUMA 2HPHA 1OU0A 1VCIA 1TM1E 2I76A 3V1YA 2J0VA 2E4XA 2IPOA 4K6CA 3AQIA 2XEDA 4NDZA 1RMQA 2WA1A 3BKWA 3HBJA 4HNGA 1WBBA 5F98A 4TMVA 1F4PA 2I1VB 4YRSA 2Q3CA 1ZXLA 2QRPA 4JFAA 5T4BA 1E20A 3A05A 3SXUB 1RKVA 4C04A 1CF4A 1Z35A 1EM8A 4BECA 1HYEA 1CDOA 4FP9A 1FSGA 3LU1A 4MVJH 3HKDB 3KQVA 4P32A 3M34A 2FP4B 3T9CA 3U9LA 3COYA 1VA5A 2VP6A 5DMXA 3W2HA 3RJ9A 3TBKA 3DNMA 2IXFA 1JIXA 1V96A 2IW1A 3H2SA 1K8QA 2C57A 2CLSA 3HEMA 4HLCA 4L27A 4N76A 2Q5CA 4RD1A 2NZ2A 3CO0S 5IJZA 3OJFA 5JNRA 3GBPA 2GXQA 1K86A 2ZUEA 5AICA 3OLXA 1T5SA 2KW5A 1NQVA 2ADFA 3GJ8A 4KGVA 5ILOA 4OJNA 4DJDC 2ATVA 1KMHA 1K7FB 2ZUUA 1RZVA 1VG1A 4HKTA 4ZODA 4GZMA 4PBRA 3NKVA 2OCAA 2GD6A 4UUMA 1GNPA 4CQMB 3SD7A 1E94E 3ZJVA 1BN7A 1JKXA 3MRVA 3M1LA 4FHGA 4Q48A 4MVJA 1L4GA 1T2NA 2E3JA 4G23A 1TIBA 4ITVA 4BB5A 4D6XA 5K0GA 4ZZ2A 1Z2CA 1UBOS 2HJSA 2JGKA 5EVJA 2NO7A 4C7XA 3M5WA 2QW0X 3TWOA 3CPHA 2FWRA 2QYHA 3WICA 1QF6A 4WN3A 1WTAA 2IODA 2VZ8A 3IP5A 2GF0A 3JQDA 3QUTA 1YU9A 3DZIA 1CUUA 3T3NA 5FWXB 4X94A 4ZKEA 2WMNB 4BRZA 1FRFS 3GVPA 1ZNZA 2JEOA 3BXPA 3LFHA 5JIBA 2EKDA 2PH5A 1BW9B 2GOYA 4YDRA 4PFKA 3HI4A 4B1FA 5IF3A 2GXAA 4HVLA 1PSDA 2E87A 2C99A 2PV0A 1S2NA 1ZJ4A 1P2VA 2OD2A 1Y9DA 3BF7A 4A8HA 3RRMA 4QJ3A 4HYTA 2I4NA 2AI3A 2ATIA 4M6WB 2PFSA 2H85A 2I99A 1DLJA 3EOBI 3KAJA 3QYFA 3UKDA 4DIKA 3UXYA 3GUVA 1AHHA 4C08A 4GMDA 4E46A 1EH5A 1ULZA 2HUNA 3CKYA 4PPFA 5KVVA 2AYYA 4A8JB 3ND5A 4B3GA 2Z8ZA 3K16A 1E4EA 2P6MA 5E1BA 1PR0A 1RKQA 1ST3A 3H5LA 4MA5A 1SKYB 1MX5A 2YUIA 1VE9A 2XSZD 2EZ4A 2AD1A 3K8OE 3P9ZA 4HAZA 3EEFA 5DN9A 2JBAB 1OXTA 1IY1A 1ST2A 1YB4A 2XVAA 3H11A 4QYTA 5DTQA 1WBDA 3ZDAA 2OUKA 2O05A 2IYXA 3SYTA 2QRJA 2XOXA 1UBCA 2V7XA 1XWFA 4PPGA 5CVTA 1O4VA 3BVPA 3SR0A 2I3GA 2QUBA 3LXRA 1D07A 3MZ0A 3ZX4A 2BCEA 5KC9A 1GKKA 4Y1EA 4OQZA 3NVMB 4M0PA 1T8WA 2HLHA 3ELBA 4JELA 3C14C 3DNFA 3A6KA 3K7EA 4DEVA 2VSFA 5KWIA 1AGYA 1A72A 4CG3A 1FJHA 2ZPTX 3INTA 2HJWA 4BVLA 4Q3NA 2B6NA 1FQOA 2BGUA 1XZBA 1T35A 2JGIA 2ORIA 1PJ4A 1W49A 4MGKR 1F0KA 5EI5A 1I2BA 1MT0A 3DBOB 4G1CA 1JVNA 3K73O 2JCXA 4XFKA 1KORA 4ZC1A 4NBLA 3COVA 3N8IA 4W8OA 4L07A 5AKKA 2Q4DA 4OLFA 3K0FA 2SCUA 4Y7DA 2HF9A 5KOYA 3NGXA 4TMFA 3CEJA 3X1XA 1K4MA 3JQ7B 3QVTA 1K06A 3AKCA 2H00A 3NIFB 3GJYA 4REMA 2ZWMA 5HGJA 3U2QA 4D42A 2D62A 2QRHA 3UOAB 2JVJA 5CFZA 1WKCA 4EY8A 1CEEA 5D3MA 1Y1SA 3AFOA 2WE8A 3K5PA 1ZXBA 3QE2A 5ALOA 1W8IA 2FW0A 1NQTA 4NBUA 1GSAA 3AG5A 1SA0B 4ACAA 3GRRA 1A1VA 3UTCA 4ZEVA 4QUGA 1ZNXA 4F4DA 4HK4A 1KJ8A 5ULLA 2RC6A 1NBHA 3Q4GA 1VL2A 4E3ZA 4CIVA 3EXAA 2ZZKA 3NHKA 1DPFA 3K20A 5HS6A 4P58A 3CEPB 1KEVA 1RJGA 2NYVA 1ISGA 3BGDA 3IX7A 2VS1A 3BJRA 2QTHA 4EHNA 1R88A 2NAPA 2V5UA 4J16A 5F1YA 4G1FA 2I80A 4RJKA 1M6VA 4KZKA 1Q0PA 4RTOA 3DD1A 5HUQA 5AK6A 2O8FA 2LR0A 2QQFA 1MB2A 2G4VA 4ND6A 1T2VA 2OTCA 1J2YA 2IQIA 4WXHA 3H5IA 5DXFA 2C5HA 5C2JB 2KSQA 3ESYA 4V0LA 2HT6A 4UEWA 521PA 2WJYA 1OZGA 1PRYA 3KKLA 3AM5A 3N07A 4OXYA 3SK0A 4PRYA 1TM7E 2IYSA 3OUUA 4Q3AA 5JPIA 4A8PA 2GT1A 2J48A 3FDXA 1FMJA 3HCRA 4MVXA 4ZVMA 1GV0A 4R2LA 3NOVA 4L0QA 3GLGB 1RC8A 4JR1A 4DUGA 2C03A 1TJ4A 1WUJS 2WA2A 3TJRA 3GIDA 4JJAA 2ZIUB 4FONA 4TYPA 5EQDA 1IM8A 3L7NA 1Z26A 2Y2UA 3I23A 1IZ9A 4C29A 4Q9LA 1XN4A 3JX9A 5CG1A 3ANMA 3IEVA 1Z2PX 3FPHA 3L77A 2GD1O 1QANA 4CMAA 1SVUA 2GRJA 1T4CB 3CMMA 4L6AA 4HWSA 3LK7A 4LJRA 4QDKA 3CB2A 3OPYB 1H2WA 2C54A 1KO8A 4ZOCA 3R3XA 2Q1YA 2DBQA 3STYA 3WDLA 3VYTB 5MFZA 2P40A 3ND9A 2WIAA 3OUTA 5G0VA 2WYIA 3D4NA 4JP1A 5C3UA 4JEUA 2ZG6A 3QFFA 2Y9MB 2V7UA 3QMPA 3V4FA 3M6XA 3W4JA 3AVYA 1AY0A 1HF3A 3MXOA 5FPYA 3MOSA 4ECEA 1UANA 4CEJA 1A04A 3GT4A 2ZUWA 3IMEA 4MP6A 1PS9A 1KO4A 4QWMA 4D80A 2F8SA 4CIXA 4YDSA 1V7CA 2PEZA 2IHUA 3FKSA 3OICA 4YMWA 2J3JA 1JKJA 5MFPA 3WNDA 2YHIB 1XV5A 4N0EA 3DQQA 1OD6A 3WGMA 4JIMA 3K96A 4D3DA 4GGMX 1K98A 4PY2A 3WGHA 1GQRA 4TN1A 1Y6ZA 4Q7JB 3GFPA 2FYTA 3PD0A 3QEAZ 4OQFA 5CEJA 1UPBA 1J39A 4P34A 1I32A 1JZQA 5ERYA 1C3XA 1XD8A