1ZNWA

Crystal structure of unliganded form of mycobacterium tuberculosis guanylate kinase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
VGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
publication title Unique GMP-binding site in Mycobacterium tuberculosis guanosine monophosphate kinase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 60
structure length 182
sequence length 182
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1znwA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1znwA01
2QPOA 2AD1A 1G21E 1G41A 4MGYR 1Z83A 1FFHA 2EU8A 2GRJA 2XTZA 4FMDF 4HLDA 3JZMA 1UBEA 2E87A 4JL6A 1Q12A 3PUYA 4TLAA 4B35A 2HYDA 1G17A 3IBGA 3KJHA 2GCOB 4JL5A 4M0LA 3KL4A 5EE9A 2VHUA 1BOFA 4B48A 1MABB 4Q01A 5K8IA 3QKRA 1NVVQ 2VF7A 2JLVA 2ZE5A 4V02A 2ZJYA 2JJ8A 1UEJA 521PA 3V00A 3FHTA 4KBFA 1NN5A 1I2DA 4EIWA 4JBWA 1JPNA 3U60B 2ZS8A 1KSGA 4D0GA 4OI0A 3PEYA 2CEAA 5CB6A 3CZQA 3H4MA 2G9NA 3GP8A 3KDSE 1KNQA 1BO6A 2J5XA 3WBJA 3ECCA 2FFQA 1Z6TA 4JKIA 3K0AA 2WOOA 4MITA 4PX9A 4MGZR 3C16C 2ZJAA 4I4LA 4P32A 3TUJC 4HUTA 4GMXA 3I32A 2FZ4A 2CLSA 2ZREA 4DBLC 3K0EA 4PPFA 2RCNA 1SVKA 3A8TA 1KSJA 2FPMA 3AF2A 4DWJA 4TSFD 1XCPA 2FZLA 4UQOA 1OH7A 4YXWD 1HY3A 2OCBA 5FOXA 3TGPA 3TVTA 1WQ1R 4Q1DA 4W5WA 2B7CA 4AK9A 1OFUX 1UKYA 3W34A 1HUQA 2ZR9A 3R7WB 4YMVA 5UKDA 4F7WA 1G8GA 1IAQA 4MKHA 3S1AA 2UZ3A 4KITB 5KNDA 2R62A 3PUWA 4NDZA 1W2GA 4BFYA 1NVUQ 2OBLA 2OLKA 3WYAA 1XEFA 1G3QA 1TMKA 2WPDA 3C14C 2XXAA 3WMGA 3PR1A 4OHWA 2OAQ1 3K0CA 4D82A 2C03A 2O8DA 2V4ZA 4LY6A 5C2JB 3IIMA 1IN6A 2IS6A 4JVMA 3AH8A 1JXOA 1SVMA 3GLIE 1ZU4A 4QJ4A 1FX0A 2QM7A 1BKDR 1Z6XA 3PIRA 4HUQB 1R5NA 2ODWA 1NIPA 5FOVA 4EFMA 5JI2E 1QHGA 5B2ZA 1E2FA 2ZXUA 5KSZA 1TUEA 1W0KA 2OCPA 5CJPA 4XSGA 2JJ1D 1JNYA 3EC2A 3IIKA 4MYTA 2QROA 2QMOA 4O25A 3SI7A 1AZSC 3OEHD 2GDJA 4QBFA 1P7CA 4QGHA 1XD2A 4WZ6A 1XZPA 1II8B 3GJ4A 4TL7A 3KX2A 5CDFA 4I1OA 4C30A 2ZROA 3C15C 4FXPA 1Z2AA 4WOPA 1XTJA 2E1RA 2PT5A 2DYKA 1DO2A 1NBME 3LD9A 3RABA 2YVUA 5K8LA 3RS2A 1CRQA 3G5UA 2QTHA 1G64A 5HE9A 3RRNA 3PEUA 3PFIA 2QPAA 3VX4A 2IYYA 1GNQA 1RPZA 2FE4A 3CPJB 3RS7A 2Q9CA 3EXAA 4JLMA 2F1JA 2VHCA 2ZRGA 4LJYA 2C9OA 2Q0HA 2V7QD 5FOUA 2PZGA 1QHNA 1PV4A 1U9IC 4JT2A 3ASYA 2HEIA 1CIPA 1OXUA 3LLUA 2QP4A 4Q7LA 3EA5A 3RYTC 2V1UA 4BFWA 3N5CA 3ONWA 1GKUB 1K5GA 2VHQA 4MDFA 1CJKC 1KMHB 2JLSA 2ZEJA 3SYKA 4NCHA 2AD5A 4YONB 5E3HA 4QXAA 1JAIA 5EQTA 2IS4A 1ZD1A 4OJQA 1KGDA 3TAUA 2CHGA 1T8TA 3MMPA 4DIDA 2P6UA 1SVSA 1COWD 1WRBA 1Q21A 4M1KA 2A7QA 2XZOA 3RS4A 1NIJA 3GJ6A 1YZLA 2WV9A 3A36A 2XAUA 1FTSA 3NVAA 2IUSA 4HLCA 2ZRDA 3B13B 4B32A 4P4TA 1KI3A 4IDNA 4Q03A 3AF4A 2GKSA 4Q9IA 3RC3A 1E99A 2KJQA 3GEHA 5AJVB 3T35A 3U3MA 4BFUA 3RANA 2QT0A 2V8OA 4TL9A 1IQPA 4Q4HB 1NY5A 1W36C 1E4YA 2ORVA 3H0KA 3KKMA 1QBKC 1G1MA 3PQCA 1YE8A 2GXUA 2QRNA 4LJ7A 2Z43A 4GI7A 3KUDA 4AY2A 3CIOA 4Q9JA 3P20A 4PO8A 3NDPA 3AKCA 4NYMQ 3AVYA 1U8ZA 1XD9A 4QOSA 2GEVA 1W49A 2D4HA 4I1SA 4URUR 4V0ME 4AURA 3SJBA 1Q0UA 4LBVA 2G83A 3LAWA 3GLFB 2QQ0A 4RFSB 1W7AA 4C2UA 1EFHA 1VPLA 5SZIA 4QKQA 4AC9A 2O8EB 1P72A 1FNMA 1S3SA 1TEVA 5KO2A 1L2TA 1S0UA 1QHIA 1UJ2A 1X6VA 4HZUA 3AUXA 3A37A 1ODFA 2RKOA 8OHMA 2BEJA 1MR3F 2ZRNA 2OCYC 1YVDA 1OB5A 5BN5A 4ZO4A 2WZQA 1HQCA 1U99A 2BC9A 5HR5A 1R4AA 4PHTA 5TVKA 1G8PA 3EA0A 1MO6A 4TMVA 3VTKA 2WWHA 2IHBA 4TSFA 3KXKA 4F4CA 1E1RD 2NG1A 2GF9A 2ZRAA 721PA 4YXWA 3CNNA 5FPYA 4QM7A 1CS4C 1K6MA 2WSSD 5BXQC 1DELA 2J0QA 4MRVA 4M21A 2EWWA 2OSBA 3ZVMA 4ILEA 4U00A 2RH5A 1Q1EA 2EFHB 2P5SA 4DUGD 3ADCA 2ZETA 3I4LA 5B58C 1NVXQ 1Q22A 1SVIA 2F6RA 3A6PC 4MYUA 2O0JA 4XVRA 1G9XA 3ZD6A 5KPJA 2IYXA 2LKCA 4NHOA 1GDDA 2H92A 2PCJA 1D5CA 4IOLA 3CONA 4DT1B 5KPDA 4OHYA 3I8SA 5B30A 3SHFA 1OXSC 3Q7PA 4IDOA 5FL3A 1X8JA 3C8UA 3RSLA 1JJVA 3K0FA 2VP2A 1XU4A 4XTRA 4O2LA 4LI0A 4E22A 1NVVR 1VYTA 3PJRA 1BH2A 2XB2A 4C7OB 4OBEA 2ZAOA 3FB4A 3A58B 1XEXA 3U7EB 4BGDA 2WBLC 5CLLA 1G3RA 2J59A 4DLSA 2REXB 1RYHA 2WJGA 1ZM9A 5DLQC 4PAQA 4XIGS 3AF0A 4B6FA 2OLJA 3SNHA 3K0SA 4WZAE 2XZPA 3QPWA 1E2QA 4A8JA 1IONA 3CM0A 4ZI3A 1ZNWA 3OEHA 2C9YA 4B3FX 2PLRA 4MA4A 2WVJA 4R98A 2KSQA 5TY0A 1KOFA 2ZSDA 4IOJA 1P62B 4IDHA 3B8HA 4KFSA 4L5BA 4BWYA 1ELOA 1M7BA 2W83A 4UXJA 3KQKA 2NGRA 2QU8A 5J47A 5CM8B 4DSOA 3CB4A 1QHHB 1YZQA 5KNBA 2HLDD 2IYTA 2V9PA 3GJ7A 3AKEA 3R8FA 1ESMA 3IPYA 2V7QA 1KKMA 3U61B 3RAPR 4BLSA 2BCGY 3HU1A 1YR9A 1US8B 2W2TA 4H1VA 1GTVA 5EE1A 4X8HA 1M7HA 4LJ5A 4YLGA 1AK2A 1F3OA 1Z6AA 1ZAKA 2VP4A 4QL3A 4OQMA 2R6CA 3BC1A 1NJFA 4QFMA 4BFVA 2XZLA 4BLTA 2HCBA 4HAYA 4GFDA 3WNDA 1GRNA 1G7TA 2J45A 2QMUA 4BUJA 1DAMA 1E2PA 4TMTA 1TEXA 2AFIE 3HWSA 1COWA 5FUVA 4AYTA 3PV0A 1I4DD 2BV3A 1KO5A 3K8YA 5FI0B 3SS8A 2D3WA 1AKYA 1OXTA 2ZVPX 2JASA 2FGKA 1TNDA 4O2RA 1RC8A 3VKWA 421PA 4QBGB 3OFND 1Z08A 1U0JA 1U8YA 2V1XA 5F98A 3C5HA 1VHTA 3NBYC 5GJCA 1ZM4A 4DLWA 1W0JD 2X8AA 5CIWA 1HE1C 3OESA 2WKPA 4S2EA 3A1SA 3GMTA 2AKAB 5JCPA 4ESHA 4JSTA 1HA3A 4V0NA 2J0UB 1BMFD 1VG8A 1XEWX 2ZRMA 3B60A 3FMPB 1ZCBA 3BB3A 4UNPA 3U3KA 1NLZA 1E94E 5L3SB 1E2EA 2QORA 4MH0R 2N46A 3ZZTA 2WWGA 3MJHA 1FPMA 2ZU0C 3JVUA 2VPPA 3ZD7A 1R6BX 1F2TA 2OXCA 2FN4A 2WSMA 4QRHA 1ZNZA 3QF7A 4P31A 4RFVA 5ANRB 1RZ3A 1P2VA 1KI2A 4TTPA 4ARZB 4N0DA 2DFLA 4EPTA 5EUQB 2CNWA 2B7BA 2HV8A 3O8BA 4QM6A 1NN3A 2GAOA 2JLRA 4FMBB 4Y0VA 4JBYA 2HF9A 5J4VA 2QG6A 3GJXC 5E95A 2JCSA 4HAUA 1Z29A 1NBMA 3P26A 3QEOA 1GG2A 3TSZA 1Q1QA 2WIAA 3GLHB 1NP6A 3CRRA 4OHXA 1E1RA 1L4YA 2H8KA 1G8YA 4IOKA 4IOMA 3QBTA 1T91A 1I2MA 2WSSA 3GLGB 3B85A 2GK6A 2GF0A 5H1YA 1K5DA 1OB2A 4HATA 4DXAA 4DUGA 1R7RA 1ZW6A 4L4UA 3BD9A 1VCOA 3WNBA 1NN0A 2OFOA 5JSZA 4GDFA 4NTZA 4TTQA 4UXHA 1TL7C 3SHWA 3QKSB 3SBEA 5KDDA 4F4JA 1GFIA 4OJKA 2ZRPA 4LV8B 2QEQA 3CUEF 4L9SA 3M4YA 4I81A 3P27A 4TYQA 5G41A 1UAAA 2DWOA 2FNAA 2J9RA 1D6JA 4LPSA 2P6RA 1Q57A 4FWTA 3WYFA 4BFXA 1T0HB 2GBLA 4IRUB 1KK3A 3GFTA 4M53A 4GRAA 3RWMB 4B3GA 4NYMR 4OK6A 3PITA 4PQFA 5FTLA 2GVDC 4RJLA 5GADl 1KO1A 2BMDA 4GMDA 3T61A 3QJYA 2VF8A 2PT7A 2F43B 2V55B 2Q6TA 5J4LA 2BVNA 4PHFA 1CJMA 5EXXA 3WHKA 4PHHA 2GWHA 2PX3A 1YU9A 4TL6A 3SYNA 4HAZA 3UMFA 4A92A 3FE2A 1TX4B 4NCNA 5FPSA 2BJVA 3N2IA 4GOKA 2PMKA 3KXIA 1QG2A 1DS6A 2MSDB 2BBWA 2Z6VA 2GA8A 3B78A 1GNPA 2EWVA 4W5HA 1N6KA 3SQXA 4OI1A 1AQYA 1AIPA 2AWNA 2AHOA 1H8ED 1N3BA 2FA9A 5DGXA 4PQYA 5GJBA 1ANKA 3EARA 3IHWA 1IHUA 3W8NA 2ZYWX 2HYIC 1G8HA 2HLDA 4EFNA 2QTVB 4FI3C 1N5KA 4PXAA 1JQJC 4DDWA 1NNEA 3KFXA 4RD0A 4BEBA 1HURA 3VR6A 821PA 2JLZA 5EXPA 1J90A 2AK2A 5JRJA 1Z6GA 1U9IA 2C9CA 3W3AA 3I72A 4M1TA 5BN3A 1XNJA 2ODNA 3SC3A 4TYPA 1GVNB 5KSOA 1JEDA 3O8RA 4B2IA 1I4TD 2W0SA 4LSGA 2G1JA 2AL7A 2CJWB 4HAWA 4FN5A 1XB2A 2R9VA 1DAEA 1SXJB 3FMFA 2F3RA 4NP6A 1R0ZA 2JATA 3QVUA 4DLUA 3TUZC 4URYR 3T5GA 1G4AE 3UKDA 4I1UA 3DMDA 4CYMA 1E79D 2ZJ8A 4Q18A 5JJLA 1KYIA 3RNLA 2GJ9A 4A4DA 3AVXA 1JI0A 3RS3A 5LD2B 5KSYA 2ZRKA 2ZRHA 4LJ8A 3OFNA 2F1HA 4G1UC 4GPTA 2GTPA 1N5IA 4YDHB 4KFUA 1LW7A 1XFAA 2YINC 4WIAA 1W0JA 5CLQA 3MFYA 2FSIA 2UZIR 3NHAA 3M1IA 4Q9LA 4ASUD 5FL7D 1C1YA 3AGPA 3MWJA 2PJZA 2ZS9A 4QHTA 1IY1A 1GITA 5TDHA 1FMLA 1M2OB 3CF2A 1BMFA 2BHRA 4AWXA 2O8BB 1VECA 3V4FA 1TF5A 2CHQA 1KDPA 4HYYA 3U7GA 3EZ9A 4Q19A 4N1AA 1CULC 1PUJA 3KQHA 5DI3B 2YKGA 2OBNA 4MUBA 3U44A 4TQUS 2AK3A 2W6ID 2ZTSA 4Q00A 4ZCLA 2E9SA 3I92A 4CT4B 4CEJB 3SR0A 1KO8A 1E96A 3KJGA 2RGNA 5EZ5A 2GXQA 1BYUA 2VL7A 1XEWY 4DSNA 1T6NA 1TPZA 2GJAA 4KO8A 4TWZA 2QZ4A 4DCTA 2R65A 3AB3A 3BE4A 2D74A 2WJYA 2FPLA 2R8RA 4PQRA 3REGA 3H86A 2IYWA 1KIMA 2MMGA 5KNCA 1ZM7A 4DDTA 2P67A 1SQ5A 4XJXA 3NC0C 1LTQA 3EG5A 3CF0A 1S96A 5DIFA 1KJWA 4CVNA 5H68A 2NTYC 1E2MA 4IDQA 4MRRA 4JJZA 5IHPA 4DLZA 1QHYA 4I99A 3DKVA 3THYB 2FFBA 2QAGB 4Q4JB 3BERA 2Z4SA 3MD0A 1BIFA 5CITA 1FTNA 1E0SA 1EFUA 1G6OA 1OIXA 4FMCB 2IEZA 2VA8A 4E07A 4EJSA 3ZVRA 4EDHA 4P4SB 5BYJA 4OQXA 1Z8FA 2ZYUX 4C9BA 2O8FA 2CK3D 2QQEA 4D80A 3CPHA 4BEJA 5JS8A 1P61B 4LYJA 2OFWA 2XNDD 4BZPA 2YYZA 3T06B 4V0LA 1HEIA 4LHVA 2YJTD 3IIJA 1J8MF 3GEIA 2CL6X 4Z8YA 4BZQA 1OE0A 3KKOA 3X1ZA 4JBXA 1AA9A 3OIWA 2C96A 2NZ8A 5DHAA 1FQKA 2DY1A 4JLAA 3GD7A 4LX0A 4NBSA 2O8CA 5FBVB 4JLNA 2R44A 5JHGB 2IX3A 3RC8A 4KXFB 3AP3A 4LHZA 4PZZA 3WNCA 1OIWA 3BK7A 3LW7A 4TLCA 2W6JD 4JYCA 2AN9A 2PCLA 3WYGA 5DH9A 2DFNA 2J0VA 1JB1A 2ZIAA 4Q4LA 3QKUA 3SJZA 5HCIA 4IXMA 3CRMA 4ITRC 2GILA 3AVUA 3T1OA 2GNOA 1AS3A 5FR1A 3BJIC 3IKJA 4ZDIA 4QG7A 4UNSA 3M6AA 1KHTA 1KTVA 3BAFA 4NCKA 4Q4HA 1H8EA 1GP2A 2C2HA 4XVQA 1JQLB 2ZPTX 2BMEA 4R2IA 1G6HA 1X8LA 3MGCA 1IN4A 3U3OA 1TTTA 4ZDWA 1G4UR 2VRWA 4RD1A 1XXHB 1KI1A 2HT6A 2ZE6A 2ZRBA 4EQ6A 5JEDA 3C4JA 3KXLA 1SKYB 3GLFA 2BCJQ 5CYPA 2W00A 3B2EA 1RW4A 2IYUA 3OIVA 2ZITA 4XTCS 3NC1C 3EX7C 1DADA 1B23P 2IS2A 4GZMA 4LOAA 4EPVA 2O8EA 2O5VA 4ZCIA 2QUZA 3LVQE 1OLOA 1P2TA 4A9AA 2CXXA 5BWMA 2N1BA 3GCGA 3JZAA 1XTSA 3LWNA 1XJCA 5AUNB 1KK2A 5M04A 4BLRA 2GCPA 4AKEA 3LRPA 1K8RA 5KHOC 1AS0A 3VMFA 3WP1B 3QUSA 1MOZA 4Q02A 3VX3A 4JVSB 1SULA 4NZYA 2ODBA 2GVZC 4EUNA 4BRWA 2GEDA 3U2QA 4RSGA 1YRAA 3ZLJA 1R10A 1Z47A 1GL9B 2RGEA 3KQLA 3VR2A 2ZVQX 4PSKA 4CDGA 4C2TA 1FNNA 4ASUA 1ZIOA 1GOTA 5FL7A 5BQ5A 2G88A 4PC1A 1E2GA 1EFRA 2A78A 2AXPA 4ABYA 1O3YA 3CWZA 3Q5DA 4DC9A 4KLZA 3BH0A 4ZIRB 5C1BA 3CRW1 1W46A 2H17A 4B74A 1HTWA 4BECA 2C04A 2WJHA 2XEXA 3VU9B 1NRJB 1XD8A 2GBLC 4Q4AB 5DO9A 1VDZA 2JAQA 3NG1A 4BLOA 2W6IA 1S1MA 1GUAA 4US2R 1W5SA 4DSTA 3U4QA 4C7OA 4B34A 2O52A 1VCNA 4L9WA 3MG9A 1W36B 4TMZA 2A5YB 1KJYA 2AR7A 3NTUA 1LB1B 4B44A 1Z28A 2EFEB 1PZNA 4JSYA 3LX8A 4QBIA 3UIEA 4TLDA 1RJ9A 3GJ0A 3KKQA 3MJRA 3UWOA 2X2FA 4M1WA 2VH5R 1OF1A 1AGPA 3K9GA 4N3NA 3RLFA 1JR3E 2H57A 4W5JA 2ATVA 3OIUA 4RZ3A 1NSTA 2ZJ2A 4H9GA 2R6GA 2GJKA 3BWDD 3L0SA 3I5YA 4V0OA 1WE2A 3EWSA 1UKZA 3THXA 1NF3A 1WCV1 1ZNYA 3P1JA 5DI9A 1V5WA 4FD2A 1VIYA 2QTFA 2ODEA 4JT4A 1AKEA 1II9A 2YOGA 4ZI2A 1N6HA 4XWKA 5HPYB 4BFTA 1ZRHA 3KKPA 2CK3A 2F1RA 3C5CA 1KI6A 3VR3A 1P73A 2LKDA 4M9ZA 4NU0A 5LB2A 1YR6A 2BJWA 1UBGA 2XNDA 3MCAA 3DPUA 1Z0FA 2ZI9A 1DARA 1US8A 2BDTA 3HP1A 2QNRA 4GNKA 1M1YE 1CP2A 1KNXA 4C0HA 5JWHA 3IHLA 4US1R 2EFDB 4YMTA 3KZ1E 5JEEA 4TMKA 4LWZA 1XCGB 3PEVA 4QGGA 4JLVA 1R0YA 2QP9X 2UKDA 4PC2A 4IKEA 2DWQA 1TADA 2IYQA 5P21A 2EW1A 1Z06A 4RD4A 3FFAA 1N5JA 5KDOA 1B0UA 5H8WA 1E9SA 1JAHA 3AEZA 2W6JA 4OYHA 1ZINA 4EPWA 1NI3A 3TW4A 2NZJA 3THWB 2JEOA 4Q47A 3B7GA 2ZI3A 4FMDB 2KBEA 5HTKA 4TLEA 3VFDA 2ERXA 3U7HB 2WJJA 4LK2A 4PPNA 1D2MA 2ZI7A 5K8UA 2QSZA 4HB4A 3QQ5A 3AQ4A 5KSPA 3B1VA 2OG2A 2YWFA 2IC5A 3WBKA 1BS1A 4LBZA 2P65A 4MYCA 5GJVC 2NIPA 2ZQ5A 3TK1A 621PA 3BIFA 3RSOA 5DHFA 3ASZA 1E9DA 4A6XA 2AKYA 3HU3A 3QBVA 3EPHA 2J0UA 1F5NA 2FGJA 3P32A 1QHXA 3B1ZA 3BBPA 3FYHA 3SJAA 5JMTA 5HZKA 1VHLA 2ZRJA 2ZU6A 4DEYA 1P9NA 1EGAA 2OEPA 4IVQA 3BXZA 1WA5A 3E1SA 5HE8A 1T9HA 4XD7D 3QIAA 2J41A 2AX4A 2F7SA 4JIMA 2C99A 4EAQA 3G82C 3BFKA 4ARZA 1Y3AA 1G8FA 3EPKA 2RGNC 3REFA 4IVPA 3WHLA 1T0JB 1JR3D 3UG6A 2ORWA 2GHIA 4C0JA 2ZSEA 5FI1B 4HEJA 2BBSA 4LYFA 3W6OA 4D2IA 1KI7A 4TQ9A 3VR1A 4V0KA 2H18A 1M6NA 4GOJA 5DISB 3SFVA 5F9FA 3TQCA 3W90A 4DCVA 2OBMA 3R8CA 4C0QC 4HB0A 2YV5A 1W2HA 4M1MA 2QPTA 1PUIA 1J99A 1FL9A 2PZEA 1LF0A 4NMMA 2GAAA 4LC0A 4O0MA 4X8OA 3PUVA 1J7KA 2C98A 3WMFA 5KUTA 5LPNA 5J4HA 5LB4A 5TV2A 4PHGA 1MO5A 4AG6A 5FUYA 4EJSC 3K9LA 2L0XA 5FBLB 3J81k 1U90A 4K8OA 2ERYA 2XJ4A 3B9PA 4NH0A 1E9CA 2WTUA 2C5LA 1IY2A 1PLKA 2DFTA 1D8TA 4Q9HA 4NYIQ 2FSHA 4F91B 4FW9A 3VAAA 1PJRA 4C0BA 3RHFA 5D3MA 1N0WA 4C0SA 1NSFA 1XMVA 5KTYA 2IEYA 4CZ2A 4KVGA 4YMSA 4NKRA 4F38A 3I8XA 1TQ2A 2A5DA 1E98A 3LNCA 1KDRA 3NH6A 2BM1A 4Q9KA 4XWAA 2FX3A 3H84A 4NYJQ 2PJRA 4XOIA 3I61A 4G01B 3WY9A 4GSYA 5K8TA 2P6NA 1D9XA 4D4MA 2X77A 2ORIA 2IF0A 3FVQA 2I4IA 5FBRB 2Y8EA 3PXGA 2BEKA 2J7PD 2JJ1A 1UBFA 2XXAB 3Q8XB 4UKDA 3OF5A 5JI3E 3UMSA 2O8DB 1ZM3A 5H70A 2QN6A 2CE7A 1D2EA 1T3LA 1XBTA 3GFPA 3MSXA 3IO5A 4US0R 1YZGA 4PSVA 1CKEA 1J2JA 4Q7KA 3NKVA 3CLVA 5E7JA 4POAA 4PANA 1UM8A 4LC1A 4OK5A 5IK2D 2GXAA 4HB2A 2CHVA 3W5JA 1EFTA 4P0TA 5FTKA 4DCUA 5JHHB 2QT1A 1EWRA 3EASA 3FMIA 4JLPA 5JS7A 2FFHA 2XGJA 1GIAA 4D25A 3AV0B 2A5FA 4UNNA 4E09A 1P9WA 4Q1FA 1XD2B 2XSZD 4IEEA 4A0FA 3HJNA 1E1QD 3F0TA 4MKGA 4MYHA 4ZDJA 1Z0JA 3LLMA 1M8PA 3H2YA 4YDSA 1Q1ZA 4RKEA 5EZ6B 1LS6A 4KSCA 1EWQA 4L15A 3U7FB 1U0LA 1HE8B 2C78A 2VP5A 2HJVA 2X19A 3TMKA 2JLXA 4M9QA 1E9AA 2Q9AA 4NCJA 2QMHA 3ZVNA 2PL3A 2Q3FA 2VP0A 3DZ8A 3QXSA 1U0HC 1JALA 4RZ2A 2VSFA 2GZDA 5LBIA 3AGQA 1DAIA 2IWHA 4BZXA 2P0EA 2ZJOA 2VQSA 2DPXA 4ON9A 3LXXA 2KE5A 1P60A 3DHWC 3CX6A 2VSOA 4MGKR 3Q9LA 4DEXA 1WXQA 5AUPB 1N0UA 1ZUNB 3M0EA 4CEIB 5JFGA 3I1FA 1XTRA 5AJWA 3TKLA 3TLXA 1NL3A 2OILA 3CH5A 3LBNA 5JECA 1A7JA 2QM8A 5E7MA 3B1XA 2CCKA 3A1UA 3U5ZB 1E0KA 1GRRA 2FG5A 3BOSA 1LFDB 1ZUHA 1ZIPA 1P2UA 1WP9A 2PZFA 1S3GA 4LDJA 2D7DA 2HXSA 1OSNA 1VMAA 4JYBA 4TZ0A 1N6RA 1FP6A 2EVWX 2FSGA 5B57C 3I73A 1OYYA 2DHRA 3EPJA 4XD7A 3L0OA 1YJ5A 4IHQA 2FEMA 5J4YA 4MDEA 1R0WA 1SVOA 4PAMA 5JZVA 4CEJA 1YZUA 1VYUA 2YZ2A 4E03A 3ZQ6A 1JR3A 5FBWB 1YKSA 2D62A 1R5BA 2F55A 5KDLA 1FQJA 3E70C 4KBGA 1NKTA 1VYVA 4LCBA 1CR2A 2QE7D 3P4YA 3VKHA 3GLFE 3THOA 5KOYA 4AKIA 1W48A 2JLUA 4LYHA 2ZYVX 3RRMA 1UBCA 1N6LA 2CE2X 5E7IA 5FOTA 4RD2A 4B3CA 2ZM5A 4RVCA 3DM5A 3WMEA 1OPXA 1SVLA 5EJEA 3DKPA 2EFCB 2EYQA 4G5OA 4ZCMA 1AS2A 1MV5A 3QXCA 3FOZA 121PA 3THYA 1QRAA 1T5LA 1CR1A 4IXNA 4JLDA 4RD3A 1V43A 1R2QA 5DYGA 5TARA 4URZR 5J5CA 4P4SA 1NG1A 1KK0A 1XMJA 3NBXX 1N25A 4I1VA 5FOSA 1CTQA 2JLQA 3D31A 2OXRA 5L8VA 4N0EA 1RYFA 1G5PA 1MRSA 4LHXA 1XTQA 4Z51A 3LX5A 3Q85A 1I4LD 6Q21A 2NO7A 1DPFA 4F92B 5FTNA 4FINA 2Q3MA 3T15A 5FPHA 1GILA 5HKKD 3RRZA 2YWHA 2A9KA 1ZNXA 3U3JA 3AVVA 3BFXA 3CNLA 3K70B 4EPRA 2QRZA 2J7PA 3HR7A 4HLUC 1E32A 1F2UA 3AVWA 1DE0A 1S9DA 4L8GA 4PFSA 3CX8A 5JCZA 1XPUA 3AVQA 1G3IA 4CRWB 1IY0A 1R0XA 2RGAA 3G0HA 1E2IA 2VP6A 2WM9B 2QBYA 4OQFA 2N42A 2IL1A 2GZHA 3BFVA 4DKXA 3K53A 4M9XA 4CEHB 1N2CE 2WJVA 5ELXA 3CKLA 1QZXA 1XRJA 3TVDA 3TBKA 5CJ2A 4D4JA 3ZZ0A 1XEXB 1TU3A 4Q1CA 5IK2A 3BH7A 2WKQA 1KY2A 1EG7A 1ZC4A 4JMPA 2B6HA 1G18A 4GZLA 1SVWA 1W47A 1JBKA 2GCOA 4X8MA 1E6CA 2OT3B 3KJEA 3DMNA 1MABA 4A8JB 1GL7A 3PVSA 1DAHA 5C4MA 2G3YA 5JWOA 1FUKA 2H5EA 1G19A 1WDTA 3TIFA 4KFTA 4Q66C 2HDNB 2O0KA 4NCIA 1SHKA 3ZVLA 2ONJA 4B3XA 2BM0A 3OEED 4X8LA 2ANBA 2D2EA 1G5RA 1TU4A 4NYIR 3EPLA 3B1WA 3IEUA 4KV9A 1XX6A 2QENA 2YC2C 3ZJYA 3T1TA 3B82A 1Q1BA 4DLTA 1KDOA 2ZAMA 1E3MA 5A0FA 1TQDA 3DM9B 3WRYC 3E2IA 3QEJA 1P6XA 3FKSD 5L3QB 2JLYA 2QSYA 4G5GA 3LV8A 4NYJR 1NMYA 2A2ZA 4Z8XA 5FR2A 4BLQA 4ZPXA 1NKSA 3IILA 3QXHA 5GVRA 3I5XA 1CEEA 1TQ6A 1XMSA 2WWWA 1Z6YA 3T5DA 3ZIAD 2RHDA 2X2EA 2BKEA 4B47A 1IM2A 2XJ9A 3F8TA 1XPRA 5F2EA 4OHZA 4M1YA 4KJZA 3R7WA 3CNOA 3QOFA 4UJ3A 3PCRB 4BE7B 4NPHA 2P3SA 4D4LA 1CRPA 5EXSA 4R7ZA 3AF3A 2Q21A 5GVSA 3BRWD 3QI2A 2VP9A 4KYIB 2NO6A 3TW8B 1LS1A 2NO1A 3QXXA 1KZGB 1YR8A 3U6BA 3ZDQA 1KO7A 2HT1A 3UXMA 4QGFA 2QI9C 4DB2A 1OKKD 1YZNA 4IEIA 4TYYA 1A2KC 3IO3A 3O8CA 2Z83A 4HUQA 4WXRA 3K09A 3KJIA 4QNRA 2H1LA 2QE7A 4OQNA 3W8RA 3GLIB 1XZQA 5LDDC 3AVOA 3FFBA 3LQQA 3OIYA 1EX7A 2REBA 1FOEB 1DVRA 4CIDA 1S1CA 1UDXA 3R20A 1LV7A 2A5JA 2H7VA 5FBQB 1OJLA 3ZH9B 4BQSA 3X2SA 1II8A 2C77A 1VG1A 3H1TA 3W6NA 1IJFA 4ESVA 1Q20A 3VNVA 5CK4A 3OZXA 3GLHE 2LWIA 4LBWA 4D0NA 2IA5A 5KU1A 1G7CA 4KHZA 3OE7D 4XSHA 2NMVA 5SZJA 1VTKA 2RGBA 3GLGE 2I3BA 1M7GA 2PEZA 5JRZA 3ICEA 1HV8A 2ZJBA 4TTRA 4TN1A 5G3YA 1LVGA 4H1UA 4RCYA 3ZZUA 3AP1A 2MSCB 4LV6A 4Q7MB 4Z1MD 2ZJ5A 1DOAA 1S2MA 1Z0IA 3RRYA 3NXSA 4DIEA 2V3CC 2GEUA 2VIIA 2XNSA 4GOXA 1KO4A 1KMHA 1XF9A 1E2JA 3HR8A 5JSZB 1VCMA 3L8YA 4G0NA 2VBCA 1VKJA 3QVVA 4WW0A 4F4IA 1AJEA 3GEEA 3N70A 2WWYA 2PX0A 1EX6A 1JEEA 4AYWA 2A5GA 1UFQA 1L8QA 1OXXK 1DG3A 2CMKA 4MKIA 3L82B 3CRQA 4CGZA 3W9YA 2F9LA 5AK0A 2DBYA 4A0RA 5LD2C 3THWA 4JJKA 1NG9A 2WWIA 1X3SA 2JDID 4WAUA 4KLNA 4YQFA 5A5GA 1LY1A 2NPIA 3QF4B 1J8YF 4ACBA 3IBYA 1WF3A 2QMEA 1W4RA 1EFCA 2DCUA 2FDCA 2V6JA 2FJUA 4IVRA 3KFVA 2FEOA 1HQYE 1N6IA 4UNRA 1ZD9A 4TMXA 1UDWA 1E0JA 2RGDA 221PA 1RFLA 1ZM2A 3OHMA 5D3QA 2VSXA 3D8BA 1QF9A 3LO5A 5L3VA 4LYAA 2JA1A 4ZV4A 3FHCB 1VG9B 2R6AA 3LXRA 1EK0A 1R5OA 1XWIA 3SEAA 4C0KA 1E9BA 1KZ7B 3EWAA 4EPYA 3CR7A 2NPFA 3OEEA 3AKYA 3TRFA 1ZD8A 1SKQA 1TQ4A 4RFSA 1ZJ6A 1G3MA 4GT1A 1JJ7A 1P75A 4HSEA 5F3WB 4JKYA 1HT2E 3FTQA 4RZXA 3MWKA 1AM4D 2UVQA 5SZKB 2IYSA 2F1IA 4RZUA 4D6PA 2I1QA 1PLLA 4DCSA 3KQUA 1OYWA 5IT5A 1CF4A 1E79A 3FKSA 1A1VA 3EIEA 3FMOB 4TZ6A 2ZRIA 1U98A 3TSOA 4UNQA 4PZLA 3GJ3A 1IN8A 1N6PA 1RRFA 2OFXA 4QHSA 1SXJE 1GNRA 2OHFA 3ZIAA 4JLKA 4LRWA 3RS5A 4LJ6A 4LUCA 4V03A 5C4GB 3I62A 3HU2A 4JZKA 2OUKA 3GPLA 1G16A 1D2NA 5FPTA 5FFMA 2QAGC 4Y0AA 3SU8A 1J70A 2KWIA 5IF9A 3CF6R 3AKDA 4M1OA 4NL4H 4R9UC 3BS4A 4LHWA 4LJ4A 3DOEA 1R8SA 2DB3A 2IS1A 3Q3JB 2ZUDA 2YWGA 3LW8A 4OQLA 4FCWA 3L0IB 2Z5FA 4YC7A 5DYIA 4DT1A 4AKHA 4C4PA 1IXSB 3W3ZB 2IXFA 1C9KA 1P9RA 2ZSBA 1DAGA 1Z07A 4F93B 1EXMA 2ANCA 1OKKA 3IUYA 3NDBB 2XITA 2G0NA 3SYLA 3IPXA 3FPAA 4MRNA 1CLUA 5AJYA 3VNUA 1TF7A 2DWPA 1H65A 3HPQA 4BASA 1KAOA 3W5IA 2F9MA 3B6EA 3K70D 1YZKA 1F48A 3RDPA 2W0MA 1IXZA 5EP3A 1Z0DA 3A1VA 4MGIR 2YC4C 4ZDKA 3U44B 3CBQA 2FWRA 4OI2A 3PUZA 3SE0A 2XTNA 5CIQA 4O3MA 5JJIA 1ZVQA 4LPKA 3LVRE 2JIZD 4OKSA 4C0LA 4S35A 1N6NA 4KODA 4A2QA 1XP8A 2IYLD 2CCJA 3TJZA 1T3SA 3TNFA 1IN7A 2GZAA 2FMXA 4A2WA 3OE7A 3HYRA 2JGNA 2VO1A 5TXGA 1CJUC 1QHHA 1ZUIA 1E2LA 3FGNA 1TUIA 1H8HD 2BMFA 5TB5A 3UG7A 1ESNA 2IK8A 1ZYUA 4D0LB 4KAXA 2FF7A 4OI4A 1L4UA 3VHXA 3KTAB 1R8QA 3SZRA 4U7DA 5IDVA 2F3TA 2REOA 2PBRA 3ZYCA 3A1TA 3EIQA 4Z1MA 1EESA 2JLWA 1KMQA 3A1WA 1NMXA 3MWLA 4YMWA 2OESA 5FTJA 3FHOA 2LCFA 1S8FA 4MRPA 3X1XA 3ND8A 4G5RA 3QG5A 1U81A 4OK3A 2ZRFA 3TUIC 4URXR 4EJSB 1O87A 2IXEA 3E5HA 1E9FA 1SXJD 1RIFA 4NE2A 4RCZA 4PC6A 3MRSA 2ZR7A 4AG5A 2O8FB 3F5FA 1UF9A 4HAVA 4HLUA 3ZS8A 5JLJA 2HCJB 2JDIA 1VIAA 1T8UA 4ERNA 2WOJA 3DL0A 5CK5A 4B6EA 1GKYA 3L43A 1E69A 3NEJA 3MLEA 1NMZA 2J87A 3NHBA 3SDZA 4DSUA 4CEIA 3AM1A 4YMUA 2RHMA 4IW3B 2O8CB 2I1VB 3EIHA 4B3DA 1FW6A 3BB4A 1CR0A 2R6FA 1AN0A 2V54A 4A36A 1A5TA 3DO6A 2VTKA 1OH8A 1W44A 2DR3A 4B73A 5L3SA 2P2LA 3D3QA 4PAOA 4PC7A 1OXVA 1YZTA 2OCAA 2BBOA 2V6IA 4E5UA 2WAXA 1W5TA 3X1DA 1CR4A 2K5UA 1KDTA 5CB8A 4C3ZA 2EFGA 1S9HA 2WJIA 4JLOA 1ZBDA 1Z0KA 4B33A 2B8TA 4Q5IA 3K09C 5F9HA 2YOHA 3FKQA 3PG5A 1XXHE 2CDNA 3Q7QA 1G3UA 2D7CA 4HB3A 2IYVA 3UWKA 1DAKA 1NN1A 3NH9A 1SKYE 5G40A 3QKRB 2BIFA 2VHJA 4HZIA 4AIIA 4EQ6B 1ZMXA 2A3RA 5HCNA 3GLHA 2J0SA 3RVBA 2ZI6A 1XTKA 3WXMA 4Q48A 1XCMA 3T1VA 3GLGA 2RMKA 4NONA 1NVWQ 5B64A 4B75A 5EXTA 2O0HA 4Q21A 1DAFA 3ICQB 2JJ2D 3PENA 1Z0AA 2CNWD 2QP3A 2IT1A 1Q3HA 4RY2A 4FIDA 4TQAA 1E2NA 3UATA 5J40A 1AQUA 3K0AB 4BLPA 2ECKA 2YWEA 3QKSA 2WICA 1IN5A 2OO7A 1RRCA 1NBMD 2D06A 3L8ZA 2NOAA 1UPTA 1U94A 4UJ5A 2HF8A 3IDQA 4PPQA 1FUUA 4A0HA 2B92A 4P33A 3X1WA 2AXNA 1QVAA 1NY6A 4TT3D 1OT3A 4M8NE 3PEWA 2GESA 3RWOA 1WB9A 2C8VA 4BPBA 2QL6A 3S1AB 2BWJA 2F43A 1KAGA 3QE0A 4K46A 1RKBA 1Q3TA 3ZGXA 1W4BA 3D6TB 3QPUA 3NBZC 4P3YA 4DHEA 3B5JA 3O8DA 1QHSA 2QA5A 1YR7A 1Z3IX 5EE5B 1CU1A 2ZE8A 1T3HA 1P2SA 4CEHA 3U4QB 1FX0B 4MUAA 2JIZA 3L2OB 3SOPA 1E2HA 3W6PA 1E2KA 3BB1A 4Z54A 2MSEB 3HYTA 2EQBA 4KVAA 3F3YA 1JR6A 3EW9A 2QAJA 2ZRCA 5FTMA 5EE3A 2MMCA 2IF2A 3K1JA 1ZC3A 4KU4A 1E9RA 1H8HA 2G77B 2VEDA 2WWFA 4B43A 1OH5A 1G291 5FUXA 1NJGA 1Z22A 4DJTA 1RJ9B 1YRBA 1KK1A 3SBDA 2OV2A 3B9QA 5DN6D 2FOLA 3LBHA 1OHHD 4DLRA 2RAPA 3BGWA 1E0AA 1NLYA 2WWXA 1X86B 3THXB 2RGGA 3EZ2A 4FCVA 1YQTA 3KUCA 2WKRA 3NIBA 2ASEA 2CJWA 4Q1EA 4KSBA 1MT0A 1SXJA 2ZYTX 1HT1E 4GP7A 5EE0A 2A30A 5CM9C 4KYUA 4DVGA 4DLVA 2WMNB 1KI6B 3K9NA 1DBSA 2NQ2C 4U02A 5L3QA 5GJWC 5J4KA 1DO0A 1GSIA 1M74A 2ZANA 2W2VA 4KFRA 1XJ0A 5A4JA 5DE3A 3UMRA 1RVDA 1M34E 4XH9B 4LBYA 1ETUA 4QHYA 1T4GA 2GJSA 2IXGA 2IYRA 2IBMA 4CT5A 4AKGA 2VLIA 4PO9A 3IEVA 2KB0A 1MKYA 4PPGA 1GKIA 3QSYA 1G7SA 2SHKA 3L0PA 3LBIA 4M1SA 1OIVA 4CW7A 3T34A 1TF2A 3QNUA 4M4SA 2PH1A 2O8BA 3QPVA 2AFHE 4Q1AA 4R71A 2KBFA 1OFHA 3AP2A 3QKTA 1NLFA 2HXYA 3A4NA 4PC3A 1Q44A 2Q3HA 5DI3A 3LH5A 2J1LA 4PZYA 1KSFX 2BOVA 1SGWA 2W2XA 2YHSA 4IFEA 4PO1A 1Z2CA 1ZCAA 3GFOA 3VR5A 1GL6A 4QC2A 1KI9A 4QBHA 1UKEA 2W58A 2WIBA 4JL8A 4BRUA 1N5LA 3AVPA 1Z5ZA 1KKLA 1W36D 3WP0A 4DB4A 2J3EA 3GLIA 3UPUA 1II0A 3BORA 4CF7A 1XMIA 4B2LA 1KI4A 1U2RA 2CL0X 4LJAA 1OV4A 4XWOA 2FFAA 3WRXC 4B71A 1OH6A 3K0CC 4W7SA 2CCGA 4Q7JB 1ONBA 1Y63A 3U3RA 5JBQA 3R9WA 2ZRLA 2ONKA 5AUOB 2ZSFA 2RGCA 4U5XA 4EKDA 1U8AA 1XDBA 3EC1A 3K9HA 2FU5C 2JJ2A 2XOKD 4QJ3A 4JS0A 5C46F 3OAAD 5FH9A 4HZUB 1IJEA 5G53C 4XVUA 2QAGA 4Q4JA 2Z4RA 4A1FA 3Q72A 3CO5A 3IQWA 1DTSA 1HH4A 3BH6A 2GCNA 4JVNA 5HZHA 4KCGA 5AJXA 3LFUA 3TSWA 4JVLA 2HJGA 2R6DA 2B21A 2EYUA 5BW8A 1FZQA 3TE6A 4BFSA 4G3XA 5EP2A 1GM5A 3Q5EA 3SQWA 3LA6A 3N2EA 3QENA 1ZP6A 4ZKEA 3TH5A 3KQNA 4A15A 3UANA 2ZE7A 1ZU5A 4TT3A 3MAAC 5FUWA 1S4QA 2OAP1 4WA7A 2GXSA 1TAGA 2FSFA 3VHLB 5JWRA 4MQBA 2NO9A 3HDTA 1OFIA 5E4FA 3O47A 3VKGA 2ATXA 4HDOB 4LGMA 2FPKA 4RD6A 3QY0A 1QG4A 2BKUA 2ZI5A 5AWFC 4DLYA 2ZR0A 3DDCA 2CBZA 2WAYA 3CPEA 5SZHB 4GL2A 2B8WA 5D3MB 4QNMA 2FV8A 4FMCF 3K0FB 4AYXA 1W4CA 1KJZA 3QF4A 1PLJA 3A4LA 4OL0A 3TR5A 5FOWA 4G5QA 1C4OA 3CH4B 3SFZA 1GZSA 2GK7A 3LY5A 4C0AC 1GAJA 1W4AA 2IYZA 2QGNA 5EP4A 1G7RA 5JJKA 3HPRA 3KB1A 3CX7A 1PVOA 3TQFA 2H16A 4G5SA 4URVR 1A4RA 4IDPA 3UK6A 3DOFA 2OE2A 5DN6A 1CJTC 2WHXA 1OHHA 3C41J 1XXHA 4L16A 3D7MA 3A4MA 1P4SA 3T1QA 4LJ9A 4B2PA 2XSZA 1WBDA 4DZZA 2CVFA 4M9SA 1E1QA 1SHZA 4PR0A 4TMWA 3V9PA 3IQXA 4FWIB 4A2PA 1W1WA 4DLXA 1IBRA 4QJ5A 4ACAA 2J46A 5AJZA 2XTMA 2PEYA 1JECA 3FDIA 4V0MA 3DVLA 4P4UA 4A6PA 1LF5A 2IUTA 4WVFA 2YNMA 2YOFA 5CDFE 2AWOA 3RS0A 1GWNA 3MWYW 2CLCX 2VYFA 1X1SA 4HAXA 1KSHA 1BYIA 1FMJA 1RRGA 2XB4A 4AI6A 1MH1A 2GJ8A 2VHTA 3SJCA 3I3SR 5C18A 2TMKA 3LQRA 4LHYA 4W9MC 4R2HA 3IGFA 1XPOA 1P3JA 3AF1A 3NWJA 1T5IA 2D2FA 3CZPA 4IJMA 4OHVA 5IRCD 2J7KA 4A82A 5AUQA 4BFZA 2HUPA 1MO3A 2FH5B 3TR0A 1E9EA 2RGXA 4UXIA 5EUMA 2XX3A 4HLQB 4ZIRA 4KI0A 3T12A 4EFLA 4JLBA 2BBTA 3KKNA 3ADKA 1JPJA 3VU9A 1UADA 3NEYA 5DNYB 1RE0A 1P5ZB 4Q4AA 4D26A 4DDUA 3X1YA 4II7A 1QDEA 3DZDA 1E4VA 4PSAA 1AGRA 1WBBA 3ZS9A 2IWRA 1KI8A 2IHYA 1CJVC 3MUFA 3ND9A 1EFRD 3KB2A 4HI0E 3K70C 4K81B 2OM2A 5KYKA 4D81A 3EZ7A 3FWYA 1LNZA 2KI5A 4MRSA 1MO4A 2GETA 4WBSA 1D9ZA 2WPDD 3P4XA 4EPXA 1VCIA 2X1VA 2QGZA 1Z63A 1OW3B 2OZEA 4DRZA 2G0TA 3EZFA 4M22A 3C7KA 1F2TB 3CWQA 2P5TB 4AD8A 2PMDA 1L7VC 1MRNA 2Z0MA 1G20E 3PUXA 3CRVA 4URWR 1QVRA 2XOKA 2RB4A 3TAHA 3OAAA 5AR1A 3ADBA 4HDCA 1X1RA 4A0GA 4IFBA 1FP7A 1OFTA 1UEIA 2ZS7A 2IUUA 5G3ZA 1F60A 4PTLA 4QGAA 4B76A 4WXPA 4TLBA 1W0KD 1E2DA 3EZ6A 4A8JC 4B3BA 1G5TA 3QG1A 3CR8A 2G6BA 4FCTA 3U6KA 3KTAA 5FPKA 1F6BA 3ADDA 1DEKA 1A2BA 1AZTA 2ZJZA 4RKFA 1RRPA 3JVVA 4HDQB 3GQBA 5L3RA 4TYWA 2CVHA 5HKKA 3VQTA 4MKFA 2DFKB 2R2AA 1KY3A 1SXJC 1VG0B 2C95A 3VR4A 3CW2A 4JLJA 3R9XA 3AUYA 4GP6A 5BN4A 1XJQA 1IOZA 1GRQA 2BMJA 2IW3A 4D4KA 4ZKDA 3QXJA 2QY9A 1SZPA 3EAQA 4WZBE 4GBMA 4J0QA 3ZQJA 1N0VC 3AVTA 4LZZA 1UKVY 2G1KA 2CL7X 2ZUCA 1WMSA 2NO0A 4LV5B 3V4RA 1DG1G 5CYOA 5EP1A 2WMOB 5TMPA 4M2LA 3ETLA 1XTIA 3NBFA 4Q1BA 1N6OA 3R9IA 4DCNA 2ZSAA 5DSZA 2Q9BA 1F2UB 1HYQA 2CLDX 4TYNA 3LDAA 2PLFA 4TL8A 1IXRC 1CXZA 2ZUBA 3GJ5A 1CBUA 1A82A 2QBYB 5BYKA 1JXMA 4DDVA 3B1YA 1X8KA 3SN6A 3DEFA 1YHNA 3GJ8A 2ZI4A
chains in the Genus database with same CATH superfamily
2QJOA 1TU0A 2J85A 3ZV3A 2JFZA 3ZLUA 3PRYA 3DD5A 3A27A 3ZI7A 2YWXA 4YT2A 2BP7B 4FMDF 5BSRA 1QBGA 3JZMA 4JL6A 4TLAA 3RT9A 4C6TB 2DH6A 3UT5A 1Y8QA 4ENPA 1V9CA 4B48A 2QVZX 3PCXA 1GLVA 1EXDA 4RLQA 3FPSA 4R41A 1NVVQ 2VF7A 3CUVA 3M5CA 5KAPA 2JLVA 2VWHA 1WKCA 1MJHA 1U5CA 4NG5A 4EABA 2ZJYA 4IIJA 2PQMA 1UEJA 4DWOA 4KRFA 3NRJA 2WUVA 2EDCA 2YASA 1SBCA 2H5LA 3KXDA 2P4QA 3P5BA 3V00A 3ZN2A 1NN5A 3TTVA 4EIWA 3U16A 4UEOA 4KPYA 1T8WA 1KSGA 4UUMA 4ZT5A 3FB1A 3PEYA 3NEAA 1BGXT 5BWOA 3GIDA 1JDBC 4LZOA 4EX6A 4F1JA 1SWWA 3BGDA 4DMKA 1KNQA 1HL7A 2OC4A 3ECCA 5K8VA 1T0BA 2BDEA 3P7MA 5DHRA 2PFKA 2X0JA 3GGJA 1IWPB 4MITA 3T41A 5BXYA 1F0YA 3FF1A 4MGZR 4WOKA 2GM5A 4I4LA 4ETIA 4HJRA 4HUTA 1WCYA 3R6WA 4GMXA 5EAIA 4X62B 1JA0A 1CZKA 3W9BA 1QGED 2PD4A 2C7QA 2HA3A 4JT9A 2FPMA 2RIRA 3VPXA 5BYBA 1QLWA 1RLJA 4EA7A 1VXOA 4YCNA 4ZZ0A 3WLQA 2Z6UA 2MSNA 3EQZA 1HY3A 2OCBA 4LZPA 3UJ6A 4DQUA 2PA3A 1KC1A 5EL0A 2B7CA 5EMLA 1JSRA 4IIJF 4RDCA 3W34A 3VPDA 1RM4A 2ZR9A 3G2QA 5UKDA 5JY6A 2FMUA 4PYQA 1UJ5A 1QONA 1O95D 2B30A 1FVXA 3U4MA 1W2GA 5EWJB 3F9IA 3OX2A 4AJ4A 4DJFC 2OBLA 1PHPA 3EVBA 3OU6A 4J94A 4KQXA 2IBSA 5TLSA 3K31A 3IT0A 3WTCA 3IQFA 4YJHB 1IBSA 1YVEI 1W73A 1XNGA 4LY6A 4U63A 3SQLA 3SKYA 1NJ1A 5C2JB 1J22A 1TVMA 2WZCA 3GA0A 3IIMA 4JVMA 5E0KB 5H4HA 2QUBA 4EYOA 3W06A 5BOSB 2JCVA 3OFVA 4CGYA 2QM7A 3F5QA 2YZ7A 3GNQA 3MZ0A 3LY9A 3IHKA 3MSCA 1T6BY 2VSYA 4J1SA 4KXYA 2VNKA 3IV7A 2PUGA 2CSUA 5CX4A 2PMCA 3EIFA 5ICFA 1TA0A 4RLFA 4QECA 3L7CA 1A04A 3MTGA 1YBVA 3DL2A 2Z9DA 4NBKA 5B2ZA 3WGJA 4ZGGA 2AF4C 4NEHB 2ZXUA 1LQUA 1TUEA 1W0KA 4MS1A 3KLPX 5ALEA 1XMQB 4L6AA 3D3EA 3MT9A 2JJ1D 3EC2A 1TZCA 4MYTA 4PNZA 4JB2A 1GUYA 4EHLA 2CHFA 4G4JA 3SI7A 5KVSA 3GPCA 1QYVA 3PHGA 3OEHD 1K3FA 2H08A 2IE8A 3THRA 4NZZA 4RNCA 3MRXA 1MC5A 1RSZA 3F7NA 4MQFA 4WZ6A 2C1EA 1II8B 1KVTA 2V7TA 3KX2A 3MELA 1QGUB 4TL7A 1V48A 3LJKA 2XQIA 1L5FA 3JQEA 4FXPA 4H3SA 5CVCA 5DMHA 3ZU2A 3JAMA 1IY8A 2PT5A 4URFA 1IG0A 1QANA 5BSFA 4N3GA 3LD9A 4JBGA 1U7ZA 5K8LA 4ME6A 4I08A 3RS2A 4DR4B 3OOYA 2Q62A 1CRQA 1MNAA 2QTHA 3BA6A 4FFNA 4I0WB 4OHUA 3NIGB 3PEUA 5HE9A 3VPHA 3PFIA 1X94A 2QPAA 3PQDA 1U0NA 2IYYA 2NU6B 3PXXA 5GP1A 1HDOA 2FE4A 4PIPA 3RS7A 5ITZB 5GV7A 4R1NA 3QX7A 2Q2VA 2NXCA 1SD2A 2WV7A 3IBTA 3BTOA 2C9OA 4CCYB 1U7DA 3NJRA 3D4LA 1XDUA 2AZDA 4C4YA 1U9IC 4FNMA 1PV4A 1ZVVA 1R8JA 2HEIA 1CIPA 1P77A 3LLUA 4IKPA 4Q7LA 1QQTA 2BGIA 2V1UA 4HEQA 2O2JA 3IB6A 3I45A 4RTJA 2TRSB 3E82A 4O4LA 3Q2IA 3N5CA 4BFWA 3IPAA 3ONWA 1PFWA 4CFZA 1CJKC 3SYKA 4AS1A 2AD5A 1JIXA 5E3HA 4QVIA 1JAIA 1H2XA 3TMYA 2IS4A 2YS6A 2HIMA 3G49A 4X6UA 3W5VA 1OFUA 1QMGA 3A70A 1T8TA 2HPAA 2XYHA 4QFCA 4KQGA 1HSOA 2XKAA 1P2DA 3FPKA 5DCUA 2H4JA 1WXWA 4CODB 5ESDA 3RS4A 2I7TA 3GJ6A 1YZLA 1XOIA 2EX0A 4Z3KA 2R8ZA 2VTDA 3W2TA 4HLCA 1V47A 4B4UA 2ZRDA 4OTZA 5DTMA 4B32A 2V7BA 3ZGNA 4IDNA 1QM5A 4Q03A 4LGYA 4EG7A 2YJ4A 4Q9IA 4XWWA 2VTVA 3REOA 1KBQA 4FNOA 4R1MA 4PLVA 4GOOD 3OJEA 3GEHA 3BHNA 5AJVB 4KE6A 4L95C 3U3MA 3RANA 2DFVA 4BFUA 1GQYA 2V8OA 3V3TA 4L51A 1ZN9A 4RTMA 1W36C 3E9MA 4WK6A 3IBCA 5DLPA 1RWWA 1EGHA 4RK6A 2IYAA 4US2R 4EGAA 1XZJA 4HP8A 3GOQA 3IUBA 3GJSA 1HGXA 1UDCA 4O4LF 4YLEA 5GZ3A 4GI7A 1CUSA 1L8LA 3BWYA 1RWBA 2PGXA 5ALIA 3CIOA 3CLKA 3P20A 3T38A 2Y0BA 2F4VB 3AKCA 1QFMA 4M7RA 4RHTA 4CUKA 1C9JA 1XD9A 4TOIA 4HTAA 2DLNA 2GPAA 1KFEB 4ARBA 1RHMA 4URUR 4V0ME 3G02A 4AURA 1Q0UA 2G83A 3LAWA 2Z1MA 3MUNA 1ESCA 2IUYA 4RLSA 1W7AA 4C2UA 1AGNA 2POCA 2QRUA 2YXDA 3QWFA 4I46A 4LMPA 1P72A 1S3SA 1BRMA 5KO2A 3COSA 2O7VA 1L2TA 2J9ZB 1QHIA 4MQEB 4S04A 1X6VA 1M2VB 2PKQO 3A37A 3PQ6A 4LMAA 5K3FA 1DTEA 2BEJA 3H5AA 4GR9A 5ERXA 3AG6A 4JB8A 4CKYA 4EI2A 1Z0SA 3QJ5A 5EKTA 2Z3WA 3H9EO 2VBIA 5HR5A 2IDKA 3N6XA 3LPCA 2G5GX 1BQ4A 1CEEA 4MQUA 2ZJ0A 2I87A 2WWHA 3FSRA 2QJRA 1BAPA 2CNOA 4KOEC 2NG1A 1F8GA 3UJHA 2P4EA 4C0XA 721PA 4KQKA 4M60A 4YO8A 4YXWA 4LRYA 3ESYA 3GFQA 4FLMA 1K6MA 1Y1RA 1DELA 2J0QA 5ENZA 2EWWA 1QH1B 4EF4A 4U00A 2IEGA 5EQDA 1Q1EA 3VV3A 4UFOA 3N8KA 1XZLA 5K0JA 3KT6A 3NPMA 4I4CA 4MV9A 1PJ8A 4I4NA 3JQ9A 2IPLA 2CJFA 4DUGD 4F97A 3RYCB 1Q22A 1HDEA 5HQ3A 2XNJA 2F6RA 1CSEE 4MYUA 2BI7A 1DUSA 2O0JA 3NZEA 1YIOA 3FROA 4YRMA 4H0CA 1QGAA 1Q16A 1UWVA 2C2WA 4FP9A 4NHOA 2PCJA 4CMEC 3CONA 4OHYA 1LLDA 5B30A 2IHNA 3GXBA 2J4CA 1KVSA 4KH1A 2GTHA 4BL5A 4ABTA 3RSLA 3SP1A 5DEIA 3STXA 3K0FA 2VATA 2WG0A 4EFKA 3L8GA 2WQ7A 3AYZB 4MR7B 4XTRA 1J8FA 1FS4A 1KJ8A 1IC6A 3DMRA 3SEQA 5LXTA 4IP0A 4U1RA 2FEPA 1NVVR 1VYTA 4J1QA 4C7OB 3TQOA 3IJRA 1NYRA 3A58B 4E1BA 2CD7A 3U7EB 4IZHA 1BZYA 3OHSX 1P5RA 2WBLC 5CLLA 1G3RA 2WB2A 2RJOA 2ZWPA 1RYHA 2OVFA 1ZM9A 3ESAA 5B1IA 1O08A 4B45A 3QY9A 3PGVA 3AF0A 1WCIB 2FZKA 4RE6A 3BMXA 1PNTA 1Y98A 2BRUC 2OLJA 3FLEA 4G1EB 2QWXA 1MJGA 3G2IA 2XZPA 2HIGA 1OAOC 3EBLA 3KPVA 4ND5A 3UPDA 4BS9A 3CM0A 1P1RA 1IZ9A 3HC7A 4M87A 4B3FX 3SIWA 1XNRB 4M7WA 2PLRA 4MA4A 2WVJA 4OXRA 5CT4A 1XMXA 2KSQA 4ZJZA 5J2UF 3T3NA 1PJ3A 5TQ2A 1WZIA 3DXFA 5T5QA 4U7PB 2ZSDA 2VTBA 1RAFA 1KKUA 1SBIA 1SURA 5GZ6A 1ATZA 1B8UA 2F4NA 5TR9A 3WE7A 4BWYA 4CHGA 4UXJA 4IDEA 4EWLA 2Q6IA 4R2XA 3DFFA 1P1JA 2WF6A 2W2NA 4W8HA 3OI7A 5CM8B 3TNYA 5LXTF 1CERA 1X80A 3CB4A 2QX7A 3EYAA 2J30A 1YZQA 3N3BC 1HNXB 4ZYYA 1WHSA 5J59A 3DBLB 4UVDA 4UBOA 3IAHA 2QD4A 3KZMA 1ESMA 2QX4A 1GPH1 4QE3A 3WWPA 3K5PA 3UMCA 3WLMA 2PUHA 2BCGY 1YR9A 4KAAA 1US8B 3EDYA 5C7YA 2ID7A 1T8RA 1W1UA 5FFFA 4G0VA 3TPCA 3GC6A 1F3OA 1Z6AA 2VP4A 3MTEA 1NQOA 1QHEA 2R6CA 3ABZA 4QL3A 1AX9A 3RJMA 1PYOA 1RMQA 1ETHA 2HCBA 3J7TA 3EIOA 1M76A 2BTQA 4R9NA 3HY4A 1HLFA 5YASA 3VSDA 4D8WA 9GPBA 5HYVA 5KYTA 5F7JA 1TEXA 2P75A 3HWSA 1KEUA 3IIIA 4AYTA 3ZDFA 2H5JA 4GPAA 4KO2S 2JJMA 2ZDQA 5JC8A 1NXOA 1EEXB 4M0DA 1Y48E 1QCDA 2ZVPX 1AKYA 3C1OA 2J3DA 1I1OA 1Y4ZA 3A2NA 3P9RA 3OFND 3TGWA 3KKZA 3AXSA 4A7PA 1U0JA 1U8YA 2V1XA 3HBAA 4YQZA 5A1JA 2IYFA 2NU7B 5F98A 1VHTA 1XNHA 4QUHA 1JJAA 4RSHA 2W8BA 1EE9A 2VK2A 2G9RA 4OLFA 4BE9A 4KIJA 5IH3A 3OJCA 3OESA 3FIJA 4UVHA 4W6ZA 4S2EA 3EBPA 3A1SA 2AKAB 1J2RA 1JAYA 4ESHA 4JX9A 3KQPA 3L6BA 1HA3A 2F3PA 1NF8A 1VG8A 4UNPA 2ZRMA 3CINA 3FMPB 4ZCPA 1ZCBA 2A9FA 4UTPA 4K2AA 1E94E 1ZITA 3OLXA 1E2EA 2HOQA 3UCFA 5BRAA 1E8NA 2N46A 3ZZTA 1PZFA 1TK3A 5BNWA 2GK4A 1E59A 2WWGA 3H99A 1FJXA 2GX6A 3PPWA 4RDIA 2VPPA 4M8KA 2ODAA 4JYPA 3ZK8A 1R6BX 4EB8A 2OXCA 4Q39A 2FN4A 2DBRA 4HQLA 4QRHA 3R9KA 3L4KA 2V0GA 1ZNZA 4P31A 1BXRB 5ANRB 2OFPA 1RZ3A 4ZYUA 5KQRA 1MEJA 1Y5MA 4WK4B 1M73E 4B8YA 3V46A 5EUQB 1F2DA 1XALA 1N2XA 4MARA 1NN3A 2DQZA 2GAOA 2K2QB 2R1ZA 4BNFA 3SX2A 5JSUA 4FMBB 2FYTA 5T4FA 2G8NA 3ANYB 4C04A 4ENUA 3UB3A 4WKCA 3HS3A 2GNPA 1PAUA 4WNAB 1DFGA 4WD3A 1CNFA 3PP8A 4N0MA 4W63A 1Z29A 1NBMA 3F4LA 5FUMA 4DUYB 1LVUA 1GG2A 1TJNA 3BE6A 5TE9A 4G4IA 4RY9A 2H2WA 1ZH6A 1A98A 3VBEA 1G8YA 3PNSA 4IOMA 4TMYA 3NM5A 3QBTA 1YR2A 4ALKA 5ITVA 5JALA 5MN6A 3P0FA 3P9YA 3WK8A 3MQ2A 4GBGA 2FLWA 2GK6A 5IU6A 1D2GA 4FE7A 4TS1A 4HATA 1RKUA 2B3TA 1RXSA 4I3HA 1PS0A 2CUNA 1PJBA 4DSOA 3SQNA 1WZUA 3WNBA 1E5VA 2OFOA 3JZDA 5I9SA 1APBA 3VSCA 4ARSA 1GR1A 4NTZA 4UXHA 5DYNA 1GG9A 1TL7C 2XWQA 5IVDA 2JH3A 2O2HA 5KVVA 4OJKA 5KOJB 4LV8B 5K7SA 1QE5A 3PNKA 3M4YA 4I81A 3P27A 4L9SA 4XARA 3VYRB 1DAOA 2DWCA 4D99A 4Z4IA 2PQ2A 4C6RA 3IKTA 3D5EA 4BFXA 2GBLA 3MEQA 1E60A 3VV2A 5AK4A 1KQGA 2OORA 3ZCVA 5K0ZA 1KK3A 4HYQA 1ENZA 1AC5A 2P8SA 3IYLW 4GRAA 4KIFA 3DFIA 3URKA 4G5FA 2E5WA 4B3GA 4ND8A 1RBMA 4FDVA 3V7UA 4BN5A 1HE2A 3DV0B 1HYGA 1OREA 1KO1A 4GMDA 3T61A 3QJYA 2UVPA 1HFKA 2PT7A 2F43B 2V55B 4FDTA 3VPBA 3WHKA 4I9NA 2FQQA 2NZWA 4NDAA 3OJWA 4Z9FA 1Q0SA 3ON5A 2VYCA 2P78A 2ZIEA 3OPYB 3WYBA 2PX3A 1YU9A 4TL6A 2RHCA 4FFVA 4A92A 3AR2A 1O94C 3PC7A 4UUBA 3NKLA 4XXHA 1FFEA 3MC1A 3WLPA 1F8FA 2NYAA 2C5AA 2BJVA 5DNYB 3KXIA 3UC5A 3B78A 5EMMA 1DINA 1G8JA 4BV8A 3D9QX 5AW8A 2G1AA 1EUCA 5FLYA 2VT2A 4B17A 1DWOA 2ZBQA 4TV8A 3NHWA 1IOWA 1AQYA 5BT9A 2AWNA 3O1HB 4ZU6X 1DQSA 4U9HS 1H8ED 1LRKA 2B4QA 2AGVA 3OBBA 1RXWA 5LQSA 5GJBA 4EKYA 1JDTA 1SUIA 4C4RA 2HYIC 1GZUA 2GYYA 1FC0A 4LYEA 4RD3A 2GPSA 1FDWA 3GLQA 4RPGA 1NNEA 3NC4A 5H3CA 3DJYA 4MI1A 4BEBA 3VR6A 4XD2A 3GARA 1SBYA 5AVVA 2AK2A 3ELYA 2NYUA 3KDPA 1P17A 4IS2A 1Z6GA 3BRSA 4M9CA 3W3AA 3WLOA 3I72A 2Y1CA 2ZYIA 1L3IA 4ZCRA 2RC5A 3EQ7A 4FU0A 5JAMA 5IVIA 5KSOA 4DDKA 4E5PA 1M3SA 2G1JA 4LSGA 3CKYA 4XDHA 2EERA 4HAWA 2GLXA 5HS6A 2GO7A 5EJ4A 2Y1KA 4QXOA 4NP6A 1L7QA 1Y6JA 3AERB 4BCBA 2OYRA 3EF3A 5EI5A 1TAHA 1QUFA 2VQEB 4RFLA 5LUAA 4LVNA 1X1AA 4AY3A 4TV8F 4X66B 3RNLA 1N9KA 4YUZA 1QTRA 3O8QB 5IX8A 5EPEA 1RXIA 2ZRHA 4N5MA 1H4SA 3OOSA 3V7WA 2DHQA 2ZWOA 4ND6A 4R81A 2Q4EA 4RWEA 4BO5A 1CUUA 4KFUA 2GPBA 4PG5A 4XCXA 1XFAA 2QD2A 4WIAA 1W0JA 5EIBD 3JQBA 2C83A 3ZWWA 4PM4A 5BSEA 3IKVA 3UK2A 3VR2D 5KHLB 1N1DA 4P08A 4Q9LA 1RQ7A 1T9AA 1C1YA 1PTKA 1XU7A 3Q1LA 2X5KO 3BRCA 4H4CA 4KWIA 1I8TA 1L5OA 1IEQA 4IG4A 5EFZA 1O95C 3UV3A 4BBJA 4C4OA 1QGYA 1O54A 4AWXA 1NR7A 3KJNA 1FMLA 1BMFA 4HQ0A 5A4DA 4XPZA 1VECA 4UTZA 5BR7A 5CCEA 4QBTA 4DR1B 3M3DA 1Q1AA 4J16C 4Q19A 4FJ0A 2FPPB 2JLBA 1PUJA 2O06A 1LLFA 3KR9A 2OZPA 3IR6A 3W79A 2R1UA 4S3MA 5KYUB 1JPUA 5GOTA 4MUBA 3U44A 1U5AA 1JE1A 2K6GA 2W6ID 3M4NA 2FSVA 2E9SA 3KZXA 1E18A 2B8EA 2GN0A 3ERCA 3OZUA 1N3YA 2XMGA 3ROKA 3GH1A 3BIXA 2RGNA 3OE5A 4HMPA 1OAKA 1G8SA 1W4ZA 1XEWY 4DSNA 5C1DA 4V3BA 2JI8A 3GB9A 4IMJB 4DM4A 4DCTA 1NYTA 2PQ6A 1SB8A 1SK8A 4DTIA 4YDQA 1VGVA 2D74A 1J06A 2FPLA 2MMGA 4NULA 2NU9B 1XYYA 4DDTA 2JGDA 4XJXA 2VXYA 2B78A 2Q5FA 2OD9A 1ZHHA 3WGTA 1TCAA 1LEHA 2HY7A 3TNJA 1FDRA 5IAAA 1S96A 4C22A 4CVNA 3WO0A 4IS3A 1R4NB 1E2MA 2FR8A 4IDQA 4MRRA 4Y30A 1RYEA 3RK1A 1T5DX 4I99A 3FYUA 2XZDA 3DKVA 3C4QA 4NJOA 2I91A 1HE4A 4QPPA 2R6JA 3AINA 3MD0A 2WTMA 1FTNA 1J2EA 3F7OA 1YCFA 3HRKA 2QSJA 3TW0A 3UMVA 3LYUA 1W76A 2VA8A 4XGIA 5JIBA 2PSEA 1JU9A 1ZVJA 4OLJA 1AUQA 4QQ8A 2TECE 3MHPA 4C9BA 6GPBA 3C39A 1KWKA 2BEVA 3VR3D 4D3ZA 4MLCA 1P61B 5D3ZA 1Z17A 2IU3A 1FNSA 2PIDA 3ZHCA 3IIJA 2EEZA 3U7QA 1MOPA 3GEIA 4BIMA 2CL6X 1NVBA 3UH0A 3S55A 4BZQA 1OE0A 3L7JA 2LVBA 3CHYA 4INAA 2JGLA 3UVEA 4BBZA 3O91A 4Y3UA 3X1ZA 1XVIA 1AA9A 1Z33A 4LJSA 5BVGB 5DHAA 3DCJA 4JQZA 3GDFA 2X58A 4OOEA 4MVJM 1GQ2A 2AS0A 3GROA 5FBVB 3SCZA 4HH4A 5JHGB 3RC8A 3HBJA 3BK7A 7GPBA 4LF5B 4R0VA 3WQSB 1AUOA 5DMXA 2O5EA 4DIUA 5I7OA 2AN9A 1VPTA 2PCLA 2R3SA 2NSHA 3GN1A 4TWIA 3VPSA 4DMFA 1XCBA 4RTOA 3Q8LA 4XCQA 3I6BA 2Z09A 2ZIAA 1HDYA 4Q4LA 2P2SA 1H2FA 3LMKA 3U9SA 3AVUA 5L7WA 2ZAYA 5FR1A 1PK8A 3N8IA 3BICA 3LHDA 3L5KA 2FOIA 4QG7A 3W6ZA 4RV4A 2VF4X 5ECWA 1G8AA 1KTVA 3LUGA 4Q4HA 3RYIA 4QJBA 2JI6A 2IH5A 3CSUA 1T36B 4WY5A 7AT1A 2FAXA 1WXIA 4LN1A 4M8SA 4JK3A 5LDGA 4Q3DA 2P35A 1LDEA 2H4ZA 1E1DA 4R2IA 5FCDA 1RQXA 3LOPA 4WE3A 1X8LA 1RCTE 2FUEA 3UJBA 3QHQA 3QLUC 3VHRA 3LECA 1D07A 2HC9A 4RD1A 4FJ2A 2J3LA 5HNKA 2ZE6A 3MGBA 4EY7A 1CZRA 1XPJA 3W4IA 2PGOA 3C4JA 3O9ZA 1H6CA 2WDZA 3KXLA 4WWHA 2IKQA 3SIRA 4C7JA 2BCJQ 3MT8A 4CLDA 3PTZA 1HK7A 3OIVA 1VJRA 4AK9A 3JQGB 3NC1C 4XTCS 4LYGA 4NU5A 5EIAA 2Z8YM 2C4UA 1GDTA 2J31A 2PWYA 4B4KA 5J63A 5BWMA 1P2TA 4E5NA 1BD3A 1RQNA 3GCGA 5CG2A 3JWJA 2G82A 2J9FA 4WJKB 1XTSA 5H82A 1X7YB 3TTXA 8ATCA 1KK2A 5E7QA 5M04A 1HMPA 4BLRA 5FT9A 2H85A 1GA6A 2RBEA 5IKXA 2CV0A 5KHOC 1GAWA 3VX3A 2WIFA 5JDCA 1SULA 5AVJA 5EPUA 3CUKA 4UTOA 4G0MA 1C4XA 2G4VA 4CMAA 1SFRA 1YL5A 2GPYA 2AG5A 2XGOA 4JGBA 4X9XA 1BA2A 1ENOA 2QZSA 4X85A 4IMPA 5FL7A 4B40A 4LHSA 2G88A 1K92A 4BKQA 1WXHA 2W2PA 4W8GA 3HVIA 4TXMA 1TCCA 1Y0BA 2SICE 2WE7A 4NABA 1YJQA 3P2YA 1OVMA 5C32A 2R1VB 3MUOA 3CWZA 3L5OA 4OL9A 1X7ZA 1O8CA 3I1JA 2V9CA 3ZXUB 2Q7XA 4PX2A 4BECA 1EVLA 1FFGA 2C04A 4QDKA 2VJPA 1GYQA 3JD0A 1NRJB 1U2ZA 2FP3A 4Q4AB 2D5BA 4KREA 5DO9A 5JG7A 2JAQA 5B1DA 1S1MA 2GCIA 5CT9A 1GUAA 1FYXA 1X1EA 3PYMA 1IQRA 1DAPA 3CEHA 4CM4B 3DP7A 4NV3A 4AN1A 3OZGA 3RFTA 1P9OA 4P1ZA 3ANTA 1UMBB 3GRFA 2C59A 2NTVA 1SC1A 4HT3B 5A3VA 5IJZA 2RFLA 3LUHA 1KZ1A 1YULA 4UHEA 1M72A 4O4JB 1MP0A 3F67A 2KPOA 3OPVA 2WB4A 3N2YA 2FW0A 2XGSA 4L4XA 4ZQBA 2ZCVA 2R2GA 2VH5R 1CUWA 1SA0B 2QB5A 3RW9A 1F9AA 3G23A 3RLFA 4UOEA 2CUTA 4CUZA 1NSTA 4NFYA 2R6GA 3L0SA 1KP2A 3RTDA 4CM9D 1B6RA 3AHFA 3EWSA 3THXA 2EV9A 2KQUA 1L4HA 1ZNYA 3NUGA 2C82A 3NTOA 4D3FA 5JO0A 4L28A 4FFSA 1UCFA 1C0LA 4U3JA 4UTXA 3D4PA 1AKEA 3BTSA 1LFAA 3E3AA 1N6HA 3EGXB 3PUJA 1RIIA 3QNMA 3V8NA 3HXPA 4F71A 5FWNA 3I2JA 4HLNA 9ABPA 1ZRHA 3KKPA 2CK3A 2ZPAA 1J56A 3C5CA 3Q9NA 3UUWA 2LKDA 3OLCX 3ESDA 4X94A 3AUSA 2XNDA 1F7UA 1Z0FA 4PN3A 5HUQA 2QOEA 2WEKA 2ZI9A 2I2BA 1LPBB 2BDTA 2QNRA 4KOAA 1NBIA 3HP4A 1KNXA 3LP8A 1RTTA 3D6NB 4JUFA 2IEIA 2YN0A 3QJGA 4JAVC 5JWHA 3ESXA 4WY8A 4KK4A 3GQBB 3BSWA 2BJHA 2WF8A 5DOZA 3VOSA 4JLVA 2QP9X 1P19A 3QYJA 2HMVA 4IKEA 3BWXA 4Y2QA 3WX0A 1UK6A 1O6GA 3ZJTA 1BEZA 4WBXC 3FFAA 1W93A 3OJ0A 4BQEA 2O4CA 5D00A 2GN4A 1B0UA 3G1WA 2QTBA 1OILA 4EG6A 3F7MA 1CDDA 1AB5A 3AUAA 1E9SA 5JT1A 1JAHA 3AEZA 2W6JA 4HPXB 1QDLB 1X1QA 5A4MS 2ZULA 2X6TA 1D2CA 3SXUA 1NI3A 3TW4A 2NZJA 3THWB 3EXEB 1QCZA 2PWBA 4FGZA 1UXJA 3B7GA 3TBHA 4LZLA 2IKSA 3PIIA 4ROTA 3KAJA 4D4HA 2XODA 2IP1A 4R83A 2WJJA 4PPNA 2DP4E 2JFQA 3QUCA 1ZI9A 2AFHB 2BFDA 3DKKA 3ZZNA 3QQ5A 4ZZIA 3AQ4A 4G37A 4UU8A 3B7PA 1I2CA 3C6YA 3FLBA 3RQSA 1DSSG 2J3JA 4JT8A 1QIIA 1XAGA 2CB0A 2IC5A 3WBKA 3S81A 4LBZA 3PZBA 1JHOA 4YRIA 1JKIA 1QNLA 1NX9A 5GJVC 2X4GA 3TK1A 3GFSA 2HCTA 3EISA 4NBUA 3FDZA 2OGZA 3QBVA 4K6KA 3GFVA 2VUTA 3N05A 2P2ZA 1MUUA 1JILA 3PYXA 3EFEA 1E3IA 1I7NA 2QIPA 1U2EA 4OY3A 5E1DA 3SJAA 3FGPA 4K6MA 2ZRJA 4ZZ1A 5HZKA 3G79A 1EGAA 1REQA 1Q15A 3QA9A 3HBMA 2GAJA 2A9OA 2J09A 1Y7IA 4EG4A 4GMFA 2QVLA 1Z4OA 2G5TA 2F7SA 4L7QA 3W04A 3LC7O 2HSDA 5IASA 2BR4A 3G82C 1AGYA 1JFRA 1EZ4A 2CXRA 5E6RB 3KETA 4ARZA 1XLTC 4LGCA 1LNQA 3EPKA 1JHUA 4ZRDA 2GBGA 2H3EA 2O1WA 2WD7B 1X7DA 2GHIA 2ZRQA 2ZSEA 3NHLA 3RGGA 2GH1A 5MFZA 2BBSA 1K6IA 2GN8A 4MKXA 3J81A 3L8EA 1YQEA 3DLAA 4D2IA 1HTBA 4TQ9A 3MM4A 4UCFA 1Q6YA 2B2NA 5DTJA 3BGVA 1H1TA 2H4YA 2H18A 3EUEA 3LT4A 1M6NA 5EOVA 4RQAA 5BO5A 4D8YA 5FEUA 3ZQ4A 4C7MA 5I7UA 3SFVA 5KREA 3WKAA 5F9FA 2EJUA 3TQCA 2J6CA 4GQBA 4P36A 4C0QC 3KKKA 4XFDA 4HB0A 1N8KA 2YV5A 4X91A 3F47A 4M1MA 5BWNA 4PICA 1PUIA 2AVNA 5I45A 2GAAA 4LC0A 1U0OC 2COEA 3VM6A 4B6OA 1HKHA 3H83A 1NYLA 5AHWA 5K0EA 1XZCA 1P4RA 4AG6A 1E7WA 3H5WA 3OCYA 1L7RA 2WNHA 2L0XA 4E70A 4EJSC 3J81k 3SVLA 1U90A 3CNQS 4RTKA 3ZJUA 4MK4A 1AKRA 1B43A 4L22A 1VPDA 4DPLA 1XQ6A 3KKLA 4NH0A 2YWBA 4RV9A 1B8VA 2DFTA 2QM0A 1D8TA 3IOMA 4Q1VA 4Q9HA 3UW1A 1EDEA 1AOXA 4F91B 2CNKA 3VAAA 4Q93A 4BKOA 4FBLA 1N0WA 1Z38A 1NSFA 1NONA 1VDMA 5SY9A 4CZ2A 2HXGA 2ZIVB 4YMSA 1YA6A 1T9KA 2ZIGA 5HCUA 1I6KA 2VJLA 1QK5A 4LG1A 5A02A 3IULA 3S4YA 1E98A 1XR3A 3NH6A 1BOOA 1KDRA 3F71A 1NNUA 2BM1A 4XWAA 3HYLA 4QDJA 2XUIA 1MAWA 3WBBA 3NOVA 2MJLA 5K6RA 5CD9A 2YVLA 3P97A 5JPCA 4NI5A 2FRDA 2DBZA 6REQB 2FR0A 2Y8EA 2FDRA 2Y71A 5NLLA 3PXGA 2J7PD 1HG0A 4XDGA 5JSQA 3T7SA 4J9VA 1UBHS 3N39C 4H18A 3UMSA 4GYWA 1C5KA 1K6XA 1UOOA 1Y8RB 2QN6A 4US0R 5H70A 3UXHA 3TSAA 2XBUA 1T1RA 1JR2A 2I6TA 4HVTA 2OGUA 5BV0A 4JDUA 3HDQA 1BFKA 3JYLA 1JMVA 4AO8A 3HDVA 4JJGA 4OK5A 1RWKA 3M1LA 3NW9A 4HB2A 2CHVA 4JLSA 4QDXA 3IDAA 1EFTA 4DCOA 4DCUA 2XNCA 3MLAA 3U26A 3VC1A 3EASA 3FMIA 1A71A 3VOBA 2M32A 4YJ3B 2XGJA 1U7HA 4GOMD 4D25A 1VIMA 2GUWA 3ET4A 2H31A 3K1TA 4CWAA 3MERA 1XQXA 3R1IA 2EP8A 4P84A 3V4PB 1Z2OX 3VTZA 1C50A 1FTQA 1PNVA 1NUTA 1XD2B 1ZN2A 4KO4S 3VH1A 4A0FA 2MU1A 2G9QA 4MYHA 5CW1A 3GW8A 1Z0JA 3KIPA 3A04A 1U7UA 1Z5NA 4EMBA 4D9CA 1Q1ZA 4RKEA 1RI1A 1LSUA 3L1VA 2CVOA 4OQ4A 2DSNA 1LBIA 1U8EA 1EWQA 1W5BA 2F8MA 1N3LA 1UFKA 5AOCA 4JI0B 4WL0A 2X0NA 2C78A 3R6LA 3GH3A 4KB5A 2X19A 4YI5A 5A03A 2I66A 3O83A 2Z98A 4M9QA 3E9CA 2QMHA 4NCJA 4O2AA 1NAHA 4KWHA 2OQVA 5KTSA 3DZ8A 1GARA 4ZV7A 5LQRA 2YW9A 2WFLB 4BFLA 3LZDA 1QCYA 1G55A 3AGQA 4IVNA 4ZT6A 3EVZA 3SHQA 3B53X 1UXHA 2ZJ4A 2I33A 4F4HA 4LY0A 1GGFA 2VQSA 1F14A 1P60A 3DHWC 3CX6A 2VSOA 2RGWA 4HX2A 4L5CA 4KPFC 3R5FA 5EIBC 5BQPA 1HT0A 5DRYA 2WFMA 3NYWA 5JFGA 1CUYA 2WT9A 2Z6AA 3E7PA 4LNUA 3T4XA 1NL3A 3CH5A 5ERGB 2D13A 4NXMB 5K99A 4YP1A 2BFBB 2ACWA 1MEOA 2CCKA 1E0KA 3O8NA 4HNGA 3WLSA 1QP4A 1U8FO 4KJXA 1ZUHA 2X1LA 1ZIPA 4N47A 3PDIA 3R6DA 2D7DA 2G9ZA 1T43A 2IZ7A 1E4EB 1E2UA 2JD0A 4LOJA 4N9WA 2R0QC 2EVWX 4MV8A 1GGJA 4F2HA 2DHRA 5CX1A 4XD7A 3BTVA 3LBAA 3ENWA 4N5IX 3W2HA 1YJ5A 2JIMA 3DJFA 1E8MA 1JH8A 2FEMA 1R0WA 2PTHA 4IHQA 4OAPA 5J4YA 4LF4B 4MS4A 2YZ2A 4E03A 1K9VF 1JR3A 2F55A 2D62A 4CIWA 4DMCA 2JK0A 1XQYA 1FQJA 3L1IA 1C7EA 3E70C 3IT1A 5E6SA 1G20B 1CR2A 2GZMA 3P4YA 5INTA 3W78A 4QDTA 4MPPA 1KC3A 2XMBA 5KOYA 4V2IA 4EW2A 1X7XA 2AI1A 4K2HA 2JLUA 2ZYVX 1B3BA 3AEXA 1UBCA 3C3DA 3RRMA 1AB6A 3T9FA 1T4BA 4E30A 4EA9A 4B3CA 1DBIA 5CVUA 3U39A 3DM5A 3ESCA 3N28A 3EB9A 3KELA 1VI2A 1SVLA 3U0BA 5AVSA 3OZAA 3H4IA 3DKPA 3OP4A 2DMRA 2HNBA 3E5MA 3PC4A 1T6XA 2FUCA 4RMNA 5CT5A 4A5OA 121PA 4ZCMA 1JIIA 3A6EA 3DMYA 4JUBA 3MTQA 3U4CA 3WV5A 3T4PA 1OAAA 4JLDA 1BHO1 1H2AS 2FETA 1YK1A 3AI3A 5DNCA 4NNJA 5D87A 1FX1A 4HDKB 1PG0A 2JPDA 1K8YB 1I7PA 1I13A 1KK0A 2HJRA 3NBXX 4DHWA 4EHBA 4ZV9A 4I1VA 4OLHA 1CTQA 3A1NA 4L0DA 4ZVNA 3WMXA 1CUHA 1YU6A 3H6HA 4P8RA 4V0RA 3RASA 5AI4A 5JMPA 2Q3DA 2R87A 4QYWA 1MRSA 2YWCA 4J91A 3HR4A 1N32B 2W71A 4H7IA 4DV3B 3VJKA 2PS9A 1D6SA 3BSSA 3Q11A 1DPFA 1KYWA 4FX5A 1SBNE 4WZBB 4JNCA 4NQRA 2XKBA 1F6WA 2Q3MA 3KYIB 3ML1A 5FPHA 1GILA 1DRVA 5HKKD 3CVWA 3LYAA 2NSJA 2JGAA 1QR2A 2R66A 1PO7A 1DQYA 4OM7A 3W1VA 3BFXA 3BCRA 3RU2A 4B5KA 4Z2AA 1Z18A 2PSFA 1JDJA 5GOZA 1W29A 5IXJA 1RI4A 1IM5A 4HLUC 1Q14A 1EFAA 4E3WA 1F2UA 1DE0A 1F17A 2G25A 1XPUA 4QTYA 4YUYA 4PWZA 3E18A 2GMWA 2UUCB 1E2IA 3C24A 1B0PA 5LOVB 3L77A 3GZJA 3MCVA 4L74A 1QNFA 5H0IA 2QV7A 3B36A 2ECQA 5AJUA 3NIFB 4LDQA 3K6SB 3MWFA 4P7BA 2H1WA 2JAPA 1QZXA 2YJ6A 4ZT7A 5KX5A 4XQCA 4H6WA 3VUEA 4CF6A 1QXSA 2ARKA 3P2MA 1KY2A 3W5BA 3T99A 2DEUA 2YV1A 4JX8A 1PWEA 4GZLA 1H93A 3GCZA 1JBKA 2GCOA 2PQ0A 3CEPB 4JN6B 5SV2A 5IAGA 2OT3B 3EVGA 4H7PA 3DMNA 3PHBE 1GL7A 1DAHA 4TZTA 2BM9A 2G3YA 2OHIA 3BWBA 4PONA 4X3CA 3W05A 3SBXA 2G1UA 2N0SA 2Z2KA 1G19A 5JS2A 2D54A 3ZV4A 4G84A 1SHKA 5F52A 5GZ1A 2BM0A 2IEDA 1G5RA 1TU4A 1SUEA 1SVUA 1FTYA 5CNKA 5BP7A 1DHTA