1ZNWA

Crystal structure of unliganded form of mycobacterium tuberculosis guanylate kinase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
VGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Guanylate kinase
publication title Unique GMP-binding site in Mycobacterium tuberculosis guanosine monophosphate kinase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 60
structure length 182
sequence length 182
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1znwA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1znwA01
2QY9A 3C5HA 2FU5C 1UKEA 2PZFA 4LV6A 4B71A 2ZUCA 1A2BA 3FKSA 5JSZA 4LHXA 4OQNA 2YV5A 3KUCA 1H8ED 2GWHA 3FHCB 2ODWA 2ZJ8A 2ZRHA 4Q4AB 1ZMXA 4G01B 5G53C 4Z54A 1PJRA 3CF0A 4F4IA 4TZ0A 1L2TA 4D4KA 1ZNXA 1ZU4A 3QKUA 2RGCA 1E2MA 2J59A 1KI3A 2WJJA 3FMFA 3U6KA 4A36A 1LV7A 1OH6A 4PFSA 3PENA 1IONA 3B1YA 1KI7A 4E03A 1IM2A 5C46F 3FPAA 3EAQA 3CZPA 1W1WA 3SE0A 1SHZA 1E9DA 2X77A 2ZJBA 2ONKA 4JKIA 1W36B 3DZDA 3GLFE 1HUQA 2WSMA 3LQRA 2J0SA 4KI0A 5DSZA 4UKDA 3KJGA 1M6NA 4N0EA 4WZBE 1DPFA 4A2PA 4YC7A 1W0KD 4TTRA 4B3GA 3LA6A 4C7OA 4WXRA 4ZIRA 1FP6A 2WKRA 3IHLA 2J5XA 1SXJC 1YR7A 5TVKA 2JLZA 2Z83A 2ANCA 1XPUA 4HAUA 4NU0A 1BKDR 4IFEA 2P65A 1P2VA 3K9HA 5L3SB 2JLRA 2XXAA 2W83A 4A8JB 1EFHA 2ZROA 4KLZA 3IHWA 1G8PA 3A6PC 3NHBA 2CLDX 3TVDA 2QA5A 4XD7A 1GSIA 4EJSB 2DCUA 3EA5A 1N5KA 4O3MA 2ZAMA 3BH0A 1OE0A 4M1KA 3KKQA 5FL7A 4TMXA 1SHKA 1CU1A 1KOFA 5AWFC 1FX0A 4A2QA 5BN3A 2GBLC 3GLGA 4Y0AA 4UNQA 2OCBA 2IS1A 1E9AA 1G5TA 1NN5A 3GLHB 4OK6A 3REGA 4Q4JB 2V8OA 3PUYA 1VHTA 4RVCA 5LDDC 1AS3A 2WPDA 4DLUA 4WW0A 1E0KA 2NPIA 3D6TB 3W8RA 4XVUA 1YZNA 3I8XA 2QMEA 3QQ5A 3R20A 4JLOA 4JYCA 3BBPA 1DBSA 1ZD1A 4XWKA 1J8MF 4LK2A 3GFTA 4R7ZA 2NZ8A 4DZZA 1E1QD 2B7BA 3CKLA 4PSAA 5JHHB 4ACAA 2ODEA 1JEDA 4ZCLA 1AKYA 4C30A 1XXHA 3U3KA 1YRAA 2OO7A 3QKSB 3NDBB 4M8NE 3QEJA 2CL7X 5CK5A 2C04A 5FUWA 2VHTA 1E2PA 1A7JA 2VRWA 1LF5A 3EPHA 2WJYA 1J7KA 1P60A 1FW6A 4TZ6A 1Z47A 1PLJA 2ZE6A 4PANA 1P7CA 2W2XA 2FMXA 2ZJ2A 4NYJR 4DSTA 3I92A 1KDOA 5TB5A 3DOFA 4IVPA 2YOHA 1PZNA 2V54A 2DHRA 2WMNB 2WVJA 1MT0A 1GWNA 4F4CA 1BYUA 3OIVA 5AUQA 3U5ZB 4ZKEA 1D9XA 4JBWA 2PZGA 5EXPA 2BM1A 2OAQ1 4DDUA 1N6RA 4AYXA 2CDNA 5JS8A 1TF7A 1NVWQ 3U44A 2G77B 2W00A 3IQWA 1EK0A 1J2JA 2QGZA 1JXMA 3QBTA 2I1QA 2ZU0C 4ESVA 1E99A 2F1HA 2I4IA 4QHSA 1FZQA 4E22A 2XOKA 1OT3A 4LUCA 5FTJA 5FUYA 3RLFA 2J0QA 2B21A 2IUTA 3QJYA 3NKVA 4P31A 4K81B 2BCGY 3OE7D 4QM7A 4DCVA 3R9XA 1E2DA 4HLUC 4FN5A 721PA 1KMHA 1X6VA 1YVDA 4B3CA 4ZDKA 3OEHD 5F9HA 1QHNA 2Q21A 4PQYA 3QSYA 2IWRA 1ZINA 4MYHA 4A0RA 4OK5A 2ZRGA 1HE8B 3VKWA 2O8DA 5A0FA 5JFGA 1Z22A 1DELA 3K9LA 2GF9A 2J0UB 1JB1A 3R9WA 2A5JA 2GKSA 5DI9A 3RRNA 2OCAA 5DO9A 3RAPR 3IILA 4BRUA 1EWQA 1P3JA 5CB8A 5F2EA 4US2R 1CRPA 4TLEA 1D9ZA 2BM0A 4Q1CA 4TMWA 3A1UA 3ZD7A 3AKEA 3EW9A 1O87A 1GG2A 2RGDA 3ZQJA 1JPJA 3OF5A 4ZO4A 3A1SA 3GLIA 4JT2A 3UG7A 1UF9A 5A5GA 4K8OA 3SBDA 2WWFA 4P4UA 3EASA 1XX6A 1NF3A 2RGNA 3N70A 3AUXA 3G0HA 4Q7MB 5JCZA 2VP4A 3TW8B 1TADA 3CM0A 3CX6A 3MJHA 1YZKA 1AS0A 1XNJA 2F43B 2ZJZA 2WWIA 3EC1A 1Q1BA 1T5LA 4TYQA 4DLWA 2XNSA 3K0SA 5FPSA 1P9RA 3GEHA 3WP0A 2W6JA 2QP4A 2OBMA 4WAUA 2Q3MA 4NCIA 2IWHA 4NONA 1N5JA 4B6EA 1KI6A 1U0LA 1PLKA 5FBRB 1VCIA 2CCJA 1N6IA 2BMFA 3SQWA 1JQLB 3QXCA 4IFBA 2IXFA 2V4ZA 3ONWA 3A4NA 5AJWA 4I4LA 3AM1A 3DKPA 4OBEA 1ESMA 4ZKDA 4IOJA 2R65A 3QG5A 1M7BA 3RS2A 4LHVA 2ZI5A 1CJVC 2A5DA 2RGBA 3K0FA 5G41A 4TLAA 2WICA 5J40A 1U8YA 3RC8A 3TAHA 5F9FA 3IEUA 1EWRA 2FV8A 2E9SA 3KXKA 4LDJA 2N1BA 3SHWA 2ZI9A 1DARA 2MSEB 2GESA 1KK1A 3TW4A 1ZNWA 1XTSA 2IHYA 4UQOA 4EQ6B 3B9PA 3QKRB 1VG8A 4QGHA 4JLNA 2CXXA 2PLFA 2A5FA 3CW2A 1XCGB 2A7QA 4NYMR 2PX3A 1BIFA 1RE0A 3I5YA 3K70D 2RGXA 4P4TA 3CF2A 4EPXA 821PA 3CRQA 2ZRCA 1OPXA 2WBLC 4ZV4A 1OFTA 2XXAB 5JECA 1IAQA 2ZYVX 4KFSA 1Q1ZA 3ICEA 3ND8A 3HDTA 2ZI3A 3RHFA 4CT4B 5SZJA 1CRQA 2QG6A 3QF4A 3A4LA 3I72A 4QM6A 1XD9A 3UG6A 3VAAA 4YQFA 2IYWA 4HEJA 4JYBA 4JKYA 2WZQA 4TSFD 1WRBA 2QMUA 5JWRA 4B75A 1R5NA 1E9SA 3MCAA 3LRPA 3AVVA 2LCFA 3ZZ0A 3KQLA 4XSGA 2NO9A 3KKMA 1F5NA 1KSGA 1VYUA 4Q19A 4B32A 4PHHA 3WYFA 1DG1G 1U8AA 2HLDA 1LNZA 5EP1A 3FTQA 1BMFD 3SFVA 1E4VA 1K5DA 4BWYA 4ASUD 1U98A 4AYTA 4RKEA 3EZ6A 4NZYA 1D5CA 2GAAA 1W0JD 4IOKA 2J46A 1NVVR 1XB2A 3C7KA 3MWJA 2GJ9A 3VR5A 4KJZA 1Z8FA 2ZRAA 2ATXA 1KJWA 4MGIR 1XTRA 1ETUA 1XXHB 4LJ6A 1NY5A 3QG1A 4B47A 1OF1A 1OHHA 4LJYA 1OFUX 1T8TA 1JEEA 4PQRA 1TEXA 2XSZD 3O47A 2REXB 2BEKA 5KSYA 1OXUA 4JBXA 1CKEA 3NH9A 1SKYE 1SVWA 2A5GA 1RVDA 2ZI6A 3U3MA 1A5TA 4POAA 4WA7A 1TPZA 4EAQA 1JR3E 5DIFA 1CTQA 1NN0A 5JJLA 1WQ1R 1ZAKA 5CIQA 1CJKC 4TN1A 4FW9A 4C3ZA 3QOFA 3PEYA 2JJ2D 5GVRA 1P2TA 1RRPA 2UKDA 4ZDWA 1NMYA 3RWMB 4JL6A 4W9MC 2QROA 1VTKA 1YRBA 4U7DA 1FPMA 3LVQE 4NYMQ 2WWGA 4Q9KA 4HUTA 5SZKB 3LY5A 1E2KA 1KI4A 2YC2C 1GL7A 1KIMA 5LPNA 4HAZA 2O8CA 1N0VC 1OV4A 1RZ3A 1ZBDA 4HATA 2ZS7A 2XGJA 1U0JA 2CBZA 1J99A 1VG9B 3D7MA 2QUZA 3HYTA 2F1IA 1SVKA 4OJQA 4C4PA 2YNMA 3H84A 3JVUA 2UZ3A 1Q22A 3IIMA 4D4LA 2BKEA 221PA 2FEOA 5CB6A 5EE9A 2O8DB 1RRFA 5DN6A 2J45A 1G3QA 3RRMA 4BFZA 1E3MA 4HI0E 4BGDA 4V0ME 3THXA 3CX7A 2FEMA 4KV9A 1M7HA 2YWEA 621PA 2EU8A 1P6XA 2ZSAA 4KVGA 2BKUA 2GA8A 4MGYR 5BW8A 4AKHA 5IRCD 4PSVA 2GZDA 2OCPA 2BCJQ 1RFLA 2WJVA 3KKPA 2F1JA 3FFBA 4MGKR 1W5TA 2IYUA 3SBEA 2OXRA 1Q1QA 2ZYWX 1QHXA 1TQ4A 3ETLA 3TKLA 1E2NA 1F48A 3GLIB 4B76A 2GNOA 1OH7A 1LTQA 2D62A 4US0R 3HU1A 2IYXA 4B35A 1AN0A 1VECA 2D7CA 3SOPA 4DLTA 3MWYW 1E94E 2ODNA 3Q72A 1JALA 4FMDB 4PC1A 2CJWB 2PH1A 3DMDA 1Z0FA 1YZUA 4LJ7A 1DO2A 3HJNA 4QC2A 3GLHE 1DOAA 1E2GA 5FFMA 3T61A 3W90A 2P6RA 1E2IA 5AJYA 3SYLA 2WHXA 1RW4A 4RFSA 4V02A 4ZCIA 2V3CC 3AVTA 1ZW6A 4TL8A 4PO9A 4CGZA 5JJKA 2IEZA 3O8DA 2JDID 4B3FX 2ZUDA 1NRJB 1E79D 4UJ5A 5DI3B 3X2SA 2X8AA 3ND9A 5J47A 1P75A 4M9QA 1NBMA 1W2HA 1BS1A 3NBYC 3PUWA 1E2FA 5CM8B 5FI1B 3QI2A 1N6OA 5FR1A 2YOFA 3ZS8A 5FOUA 2C98A 2R6DA 3THOA 3GMTA 2O5VA 2FGJA 3KL4A 4HDOB 4PSKA 5EZ6B 1N3BA 3GJ6A 3QVVA 4IJMA 2A2ZA 3VFDA 4JLBA 4JLPA 2Z4SA 2NO6A 4Q4HA 3L0IB 1D8TA 3K0FB 2IX3A 2PL3A 1Z5ZA 3PV0A 3TSZA 4XJXA 1GNRA 4DBLC 1ZNYA 1Z0JA 5CDFA 3KXIA 3LBNA 4AG5A 2IF2A 5CLLA 1GVNB 4NH0A 1GKUB 3W6PA 4GBMA 3X1YA 2G83A 3VR2A 5CJ2A 1LS6A 3OAAA 3BOSA 4QJ3A 4FMCB 3U3RA 1D6JA 1OLOA 3ASYA 3VR1A 3CLVA 1BOFA 4DCSA 4YMTA 1PVOA 3VTKA 5E7JA 4OL0A 4F38A 4KFRA 3GJ7A 2AK3A 1WE2A 4DEXA 1P9NA 4JSYA 2V6JA 4Q01A 4D0GA 4AI6A 3N2EA 4M2LA 4PPNA 3UXMA 1ZNZA 1DTSA 2LKDA 3TR0A 3MWLA 3A37A 3CNNA 2VTKA 1IN7A 3QF4B 1II0A 4KITB 4TT3D 4V03A 4LI0A 3RS5A 3ZYCA 2QRZA 2ZI7A 3WHLA 4B3XA 1XMVA 2P67A 4M1TA 4QHTA 2EYQA 2XTZA 4KLNA 2DWQA 1I4TD 2KJQA 5TXGA 2D2FA 1Z06A 2C9YA 4HB3A 1L4UA 4I1SA 1T9HA 4L5BA 1GTVA 4D81A 2WMOB 1AQYA 4XWAA 4Q7KA 3V4RA 3AF1A 6Q21A 4OHVA 3U4QB 3BERA 3LQQA 4C0JA 5KNCA 4BLRA 4IOMA 4LHZA 1J70A 3FB4A 4HSEA 1UPTA 1YZGA 1OXVA 3AVPA 4KO8A 1KNQA 4MUAA 4CEHA 1TEVA 1G7TA 3AP2A 3E5HA 3BJIC 3MSXA 5D3MA 5KSZA 2EVWX 1OKKA 2PEZA 4X8MA 1EFUA 2OZEA 1E9RA 2IC5A 1UBGA 1JR3D 4I1UA 4OHZA 2K5UA 5J4VA 3CRRA 3TJZA 1MO3A 3WXMA 3CWZA 5KUTA 1ZCBA 1JI0A 3O8CA 1VG1A 2NO0A 2EFGA 4P32A 1JR6A 1F2TA 2XTNA 4IRUB 4GMDA 5HZKA 4QGFA 2QQEA 4MRPA 4OQLA 1MABA 3K0CA 1G7RA 2P6UA 1OB5A 1VDZA 4JLMA 4HLQB 4NL4H 4M21A 1JPNA 3DVLA 4M9XA 2AFIE 3O8RA 3WMEA 5B2ZA 1YHNA 2REOA 4PPFA 5FUXA 2QP3A 1QHGA 2Z4RA 1G1MA 1RC8A 1N6KA 4NCKA 5E7MA 3HU2A 3IIJA 1E0JA 3RS7A 3A8TA 5JI2E 1G6OA 2ZJ5A 3TK1A 4EPTA 1XZQA 1KY3A 4KCGA 4A2WA 3RS0A 2IYYA 3ZLJA 2C95A 1E9CA 3TMKA 1DADA 1P9WA 4FMBB 5JJIA 4C2UA 1N6PA 1RRGA 1XJCA 4XIGS 5FOVA 3FKQA 2AKAB 2RGEA 4ZCMA 1FNMA 4CIDA 1OXXK 5IK2A 1NVUQ 2QL6A 3BWDD 1XEXA 1X1SA 4H1VA 1OIWA 5EQTA 4LRWA 1FUKA 1GOTA 3KX2A 2MSDB 1H8HD 4JMPA 2J41A 3QF7A 4KBGA 3IKJA 4P0TA 2I1VB 5LBIA 1II9A 2QMOA 1Q57A 1U0HC 4GP7A 3VR6A 3KJHA 1AZTA 3OIYA 1AQUA 2FA9A 2OXCA 4QNMA 2D7DA 4BLTA 2PJZA 4TQAA 1ZU5A 2HYDA 3SJBA 4Q7LA 5GADl 1FUUA 3CUEF 2X1VA 4YMWA 4C0HA 3KQUA 4L15A 4YDSA 4TYWA 1ANKA 4CEIB 4XH9B 2GEVA 2HT6A 4AKEA 4CDGA 1IN5A 2XITA 1NIPA 4QKQA 1CLUA 5E3HA 2JATA 4D4JA 2J87A 2BOVA 3VKHA 1NKTA 4DCNA 4LYAA 2D2EA 3U61B 1QDEA 1YE8A 3SR0A 2ECKA 2XJ9A 4ZPXA 3ZVLA 2DFKB 1UKYA 1I4LD 3TUJC 1G21E 4DEYA 5HE8A 3WY9A 3GCGA 4MYUA 4GMXA 2W6ID 3LW8A 4MKIA 1FQJA 4GZLA 3GLGE 3T34A 1SVIA 4G5GA 2JA1A 5L8VA 2NQ2C 4WZAE 1N0WA 1ZIPA 3SZRA 1N6LA 3BC1A 1W5SA 2BHRA 3E2IA 1Z6AA 1CR2A 4RFSB 1XZPA 2FH5B 4OI1A 4GI7A 2JJ1A 3B6EA 2YOGA 5H68A 1R10A 5LD2B 3N5CA 4PPGA 3QVUA 4BLOA 3TLXA 3CR8A 1KZGB 3H86A 2NOAA 4QOSA 1XEWX 5FOWA 5JHGB 2VHQA 2JCSA 1JJ7A 2VSOA 3B1VA 3UPUA 3P20A 4QNRA 3REFA 1XXHE 2H18A 4S35A 2SHKA 1KK3A 2PMDA 4FCTA 4OHXA 5P21A 3HU3A 3GLFA 1QHYA 4Q4HB 1W4RA 4D6PA 1ZUNB 3WNBA 1E0AA 1TNDA 2CE7A 2ORVA 4BEBA 4M22A 3NBZC 4OHWA 2D74A 1EX7A 3TH5A 1NI3A 1S3GA 1EFCA 1E2EA 4CW7A 4FI3C 1W36C 2PMKA 2IL1A 2ZRPA 3TUIC 4DVGA 3QXXA 3PCRB 4B6FA 1FTNA 1DAFA 1I2DA 1US8B 5KNDA 1OKKD 2VIIA 1XPRA 1DG3A 2XZPA 1I2MA 4MRVA 1BO6A 3AVXA 1FNNA 4PAMA 4Q1AA 3CONA 2V1XA 4OK3A 2OFXA 3CH4B 3L8YA 3HR8A 4M9SA 2JLWA 5ELXA 3U60B 3WYAA 4C0LA 4QFMA 4A8JC 3KXLA 3AVYA 1EFRD 5G3YA 2KSQA 4RJLA 1VYTA 1GAJA 3EG5A 3PEUA 4Q5IA 4DC9A 1G8GA 4PC3A 4EJSC 4LBYA 3SS8A 2BEJA 1HV8A 2O0JA 2QAGA 2WAYA 3EZ7A 1CJTC 1HE1C 1X8LA 1CBUA 2ZSFA 3RVBA 4BFVA 3KQNA 2C2HA 2ZYUX 1W4CA 2NPFA 4PQFA 3S1AA 5HR5A 1KJZA 4U5XA 4U02A 1ZD9A 3PFIA 1N5LA 3LO5A 4CZ2A 1G4UR 2YWGA 3VX3A 5FTNA 3SI7A 3ICQB 2XAUA 5GVSA 2PJRA 2RGGA 4CEHB 1KDRA 4Q9LA 5H1YA 1Q0UA 1W46A 4FWIB 4L4UA 3GJ8A 1DAMA 2WIAA 1Z83A 3LNCA 4AC9A 4MRRA 4C0QC 1CS4C 1JAIA 1G7CA 1Q20A 1ZYUA 4GOXA 4ARZB 1KI8A 3RRZA 2AR7A 5DNYB 1DAKA 1TTTA 4DUGA 2XNDA 1F2TB 2DY1A 4L8GA 2HYIC 3GLIE 1G3MA 2QNRA 4MYTA 3FKSD 3SHFA 4YDHB 3OHMA 5KU1A 1OYYA 3B82A 4IW3B 1NJFA 3W3AA 4NPHA 5DHFA 2W2VA 4YMUA 1MABB 1OXTA 4TQ9A 2JAQA 4Q21A 1MRSA 1R5OA 1FTSA 4QGAA 3Q9LA 2FFQA 3GFPA 1M2OB 5CYPA 4Q9HA 3OEEA 1P61B 4A4DA 3M0EA 4IEIA 1KNXA 4JT4A 1CJMA 2PX0A 5L3QA 521PA 4UNNA 1GUAA 1L4YA 1DVRA 2WV9A 4RD3A 2BBOA 2W0MA 1OH5A 2V7QA 3GEEA 3NTUA 3QBVA 4TMKA 3QPWA 4FMDF 4W7SA 5TMPA 1ESNA 1IY2A 1AZSC 1CF4A 4V0NA 4HB2A 2GXAA 1UBCA 2BMEA 4BLQA 1YR8A 4EDHA 1Z0IA 2RB4A 1KGDA 2VO1A 2D06A 2YZ2A 2ZRIA 1IOZA 4W5JA 3VR3A 4D82A 2IBMA 2ATVA 2ODBA 4ZDJA 5EE5B 1FQKA 1MR3F 3AB3A 2GAOA 2N42A 3C41J 4JVSB 5CIWA 3UANA 5JZVA 5JS7A 1IBRA 3PUXA 1T3SA 4JLDA 3L0OA 2JGNA 5JSZB 2OEPA 3R9IA 4PR0A 4MRSA 5B30A 3LLUA 4JSTA 1G5PA 3VNUA 3C4JA 4PZLA 2CK3A 3T35A 3BORA 4BFXA 1E69A 2OAP1 2E87A 1GNQA 1OJLA 1KYIA 4QXAA 2ERXA 1Z6TA 5FI0B 4Q48A 3E1SA 2C9OA 1NJGA 1UM8A 3EXAA 1ODFA 4M53A 4XD7D 2NGRA 1F60A 4LY6A 1CR0A 5FL7D 5K8TA 2PT7A 2ZRBA 5CK4A 4B2PA 3WYGA 1P4SA 2ZXUA 2O8FA 2V1UA 2AX4A 2F3TA 3M4YA 3AVOA 3K9NA 4DJTA 3ZDQA 3TQCA 3ECCA 3LVRE 4E09A 4PO8A 1RRCA 1FMLA 2WPDD 4FMCF 4HYYA 4IKEA 1KO1A 5B57C 1HA3A 3PR1A 4TTQA 1MO4A 1TX4B 2R6GA 3D8BA 4C7OB 5G40A 4JLKA 4ZIRB 2IS6A 4EFMA 3L2OB 3T1QA 5FTLA 4URWR 1M1YE 5ANRB 5H70A 2R6FA 1P2SA 3OZXA 2C78A 2YWHA 2FJUA 4I99A 4NDZA 1KI9A 2FF7A 1G9XA 2OV2A 4PX9A 2FZLA 1NN1A 4F91B 1R0XA 2Q3HA 3KUDA 4FCVA 1NMZA 2ZRFA 2ZAOA 3ZZUA 3QY0A 4RCYA 2AK2A 1X86B 2HXSA 1FP7A 1XTKA 3VQTA 2P0EA 1KK2A 1GKIA 1RYHA 4DKXA 4DLRA 2AL7A 1N6HA 1X8JA 1XF9A 3VKGA 3B85A 1E1RA 3AP3A 4EPVA 1A4RA 1FX0B 3M6AA 2R62A 2OBNA 3RWOA 2XZOA 4XVRA 3GLGB 4KFTA 3THWA 5JCPA 3L0PA 1NLZA 4V0KA 1KAGA 2HDNB 3KB1A 5HKKA 3V9PA 1GP2A 3U3OA 3W6NA 2NIPA 4RD1A 1KSHA 3T12A 1KSFX 1KO5A 1KKMA 3AGPA 1ZJ6A 3R8CA 3RS4A 2C77A 2F1RA 5J4LA 2GCPA 2QTVB 1NKSA 1VKJA 2BJWA 1P2UA 4TLCA 1W44A 2WJGA 2FG5A 1QG4A 2KBEA 3V00A 5IF9A 4CEJA 4Q18A 3LW7A 2ZJYA 2AFHE 1TQDA 2OSBA 3W9YA 4QBFA 4MITA 2XOKD 4W5HA 1JNYA 1W2GA 2BVNA 2QRNA 4KODA 5DE3A 1U99A 3T1TA 4NYIQ 5BYKA 4P3YA 4PZZA 4FCWA 2A78A 4I1VA 4UNRA 4BPBA 4A6PA 5FPTA 2ZJOA 1S9HA 3F5FA 3X1XA 4G5OA 1KK0A 3CPHA 5BYJA 1UADA 1GL9B 1P5ZB 3P4YA 1RJ9A 3WRYC 5J4HA 3FFAA 2ZIAA 3DEFA 1VIYA 2F9LA 4R71A 4Q47A 5FTKA 4DLVA 3FMPB 4NP6A 4Z51A 4JS0A 4F7WA 1IN4A 5DISB 5M04A 1R4AA 2QAGB 1HQYE 2TMKA 3ZD6A 4TQUS 2GETA 4BLSA 4LBZA 3U44B 5JWHA 2BMJA 1QVRA 3OIUA 2EWVA 4JLJA 5AJXA 1G19A 5GJBA 4BFTA 2Z5FA 4C0KA 1IY0A 4MKFA 5BQ5A 2WTUA 3CBQA 2IYSA 3H2YA 1K8RA 2CL0X 4A6XA 1S96A 2PCJA 5D3QA 1E2QA 3TBKA 1G4AE 1MOZA 5JRJA 4AKGA 4GPTA 1VYVA 1B0UA 2IHBA 2EFCB 2JJ8A 2VP9A 1E9BA 2J9RA 2G1KA 2QMHA 4UXJA 4Y0VA 2CHGA 4HB4A 3WRXC 1CXZA 3FHTA 5EP2A 3U3JA 2IW3A 1KMHB 3AF3A 2ZITA 3IEVA 4KXFB 1WXQA 3CPJB 3K70C 1G3RA 1SXJA 5E4FA 3VU9A 4IXMA 1IXSB 2AKYA 1S1MA 2GXQA 4HZUA 2R9VA 4MA4A 4MKGA 3FDIA 4PTLA 1XJQA 2AWOA 2CE2X 3KTAA 4U00A 3SYKA 2OG2A 2ZE8A 2WIBA 4B2LA 1ZCAA 3X1DA 1AK2A 1XEWY 1DAEA 2OCYC 2O8EA 2W6JD 4B34A 1ZP6A 2WSSA 4NCJA 5FR2A 4G5RA 2CK3D 5J4KA 1VMAA 2GXSA 1FOEB 4D80A 2J0VA 3EARA 4DT1A 4Q4AA 4DDVA 2D4HA 2J7KA 3H0KA 1E2JA 4QBHA 1UKVY 1SZPA 3ZZTA 3W5JA 2J7PA 1TUIA 2G0TA 1N6NA 3K09C 5CJPA 2PT5A 2JIZA 2ZYTX 3VR4A 4E5UA 2GBLA 2HCJB 3FMOB 3QEOA 3OESA 2WOJA 3GQBA 2XJ4A 5DLQC 1S3SA 2EFDB 5FUVA 3GJ5A 2RKOA 2BJVA 4Q9JA 1NBME 1LB1B 1G291 1E98A 3PG5A 2RHDA 2RGAA 1KZ7B 1DE0A 4HAYA 4OI4A 4URZR 4N0DA 3KFXA 3R7WA 2G6BA 4PC6A 1R0YA 2QE7A 2B8WA 3K0EA 2B92A 2JEOA 3Q7PA 2QENA 2G0NA 2XTMA 4KBFA 2VBCA 3OFNA 4DB2A 3TNFA 3ZVMA 1GITA 5CDFE 1EESA 2JLSA 3NEYA 1IY1A 1KI6B 4PC7A 5C4GB 1NP6A 3MAAC 1H8EA 4MRNA 1Z2CA 4V0LA 4D0LB 1EGAA 3ASZA 3Q3JB 5L3SA 2XEXA 4XOIA 3PJRA 2WWWA 4Q4LA 3FYHA 2V6IA 2VHCA 5DHAA 3THYA 3MRSA 4NHOA 4OQFA 3VNVA 5FBQB 1MH1A 3MD0A 4A15A 2A30A 1QF9A 1PUJA 3AKCA 4PC2A 2O8FB 4QBIA 1JQJC 5BWMA 3TQFA 3DOEA 4LV5B 4AIIA 4Q9IA 3T06B 4DIEA 3LBHA 3E70C 2HLDD 4KYIB 2J3EA 2QAJA 2P5SA 4JZKA 3VHLB 1YZTA 3C16C 1XTJA 3ZS9A 2GDJA 3EZ2A 4AD8A 3MG9A 3GLHA 3TUZC 3LDAA 1CJUC 1XMSA 3VMFA 1FL9A 1H65A 2OESA 2QU8A 4KHZA 4LC0A 4Q1BA 5TY0A 4LJ4A 1W0KA 2QP9X 2GILA 1QHSA 2LKCA 3EZFA 1XP8A 3DZ8A 1P62B 4XSHA 4II7A 1T0JB 1COWA 4Q02A 4HLUA 5FBLB 1ZM9A 1OHHD 1N2CE 3SJCA 2GXUA 2R6AA 3LXXA 4KSBA 2GF0A 2WWXA 4UXIA 5EXSA 4KSCA 3W6OA 2OLKA 4Q00A 1IHUA 2EQBA 3ZH9B 1KMQA 3GD7A 3A4MA 4BZPA 3U7HB 2O8BA 1NN3A 1P72A 3TE6A 2H1LA 5EP3A 2ANBA 2GVDC 1WDTA 3QIAA 1ZUIA 4PO1A 2VYFA 2Q0HA 4BFWA 4EIWA 3IQXA 5EJEA 1U8ZA 1EXMA 1UEIA 1XJ0A 2ORWA 4GT1A 4A0HA 2YJTD 4GP6A 1XMIA 2QI9C 3T5DA 4JBYA 4WBSA 4LBWA 3B5JA 5HZHA 3B60A 3Q8XB 1XBTA 2QBYA 1AGRA 1JJVA 1GDDA 3NH6A 1NLYA 1J8YF 3I4LA 8OHMA 4KAXA 5KDOA 1WBDA 3Q5EA 2Z6VA 1CR4A 1DS6A 4RCZA 4C0BA 1VG0B 5UKDA 4EFNA 3C5CA 1S2MA 1U2RA 3C14C 1XTQA 3MLEA 3WHKA 2MMGA 4BE7B 4OI0A 3CRVA 5F3WB 2IEYA 1Q3TA 1AIPA 2XZLA 1E1QA 1FMJA 2GRJA 1X8KA 3A36A 1T8UA 3BE4A 3UWOA 3MGCA 4EPRA 1SKQA 4YXWA 4RZ3A 3TSWA 2VP0A 3AQ4A 4C9BA 2VF8A 4TYNA 3BD9A 1HT2E 5KSOA 4Q7JB 5DN6D 1T0HB 3LFUA 4TMTA 4LPKA 2YINC 4HDQB 4MGZR 1RPZA 4LWZA 4ZI3A 4DIDA 1E2HA 3PUZA 3DMNA 3FOZA 2ZANA 1VCOA 4LCBA 1WF3A 4EUNA 4DHEA 4D0NA 4LC1A 2J0UA 1AGPA 3K0AA 2ZRKA 1A82A 3DO6A 3U6BA 4ZI2A 4D2IA 2QTFA 2E1RA 1C1YA 1II8A 4BFYA 4S2EA 3LXRA 1WBBA 2DR3A 2J7PD 4DWJA 3QE0A 5C4MA 4HAXA 5K8LA 2O8CB 1IN6A 3C15C 4OYHA 3K9GA 3TAUA 3GPLA 2RCNA 4GSYA 5CM9C 3ADBA 3LAWA 2JLVA 1GIAA 4EFLA 1E6CA 4RKFA 1T91A 4P4SA 3GJ4A 2QORA 3K53A 3TGPA 1R2QA 2WWYA 1X1RA 3U2QA 4URVR 2G3YA 1Z0DA 5FTMA 1EG7A 3IBGA 2I3BA 5CLQA 3UWKA 4N1AA 2ORIA 3F3YA 1SXJB 2LWIA 4HLCA 3X1WA 1WCV1 2EFEB 5IDVA 1VCMA 3NBXX 3OE7A 3KTAB 3WMGA 1TF2A 2UVQA 3UMRA 4WZ6A 3OEHA 1GNPA 2WJIA 3CRW1 1O3YA 1ONBA 2F9MA 3RSLA 3SN6A 1HTWA 1PLLA 1GKYA 4YONB 2O8EB 3THXB 4CVNA 1SULA 2HT1A 1KO4A 1NIJA 4OQXA 3T1OA 2GJSA 2QT1A 2VHUA 2VSFA 3NDPA 1G8HA 4Q1FA 3EIHA 2O52A 1NBMD 3VHXA 5AUOB 4LPSA 1C9KA 2IYRA 3QNUA 4BFUA 4YLGA 5EXTA 1Z6XA 4DT1B 5FL3A 5J5CA 1G20E 1BH2A 2QT0A 3NWJA 5AUNB 1S9DA 4X8OA 1S4QA 4M1YA 2V55B 4ERNA 4ZDIA 2CL6X 2IXEA 1LW7A 2HF9A 3T5GA 3ZGXA 1E2LA 3LX8A 1Y3AA 2HJGA 3B13B 5KYKA 2Q6TA 4LYFA 2ZSDA 5K8IA 4EKDA 3QKTA 3I61A 3VX4A 2DWOA 2AXNA 2J1LA 5FOSA 4BZXA 1NG1A 2C96A 2BV3A 1F3OA 4GDFA 1GZSA 4CF7A 1U9IC 1IXRC 1RKBA 3OAAD 4GFDA 5C2JB 3R7WB 2CNWA 4UXHA 2ZS9A 3L0SA 2VA8A 4HDCA 3TR5A 2DFNA 4LHYA 4BQSA 2HJVA 3EPKA 4RY2A 5GJCA 5KSPA 1ZM2A 5FPHA 1G3IA 3X1ZA 1YU9A 4R98A 5JMTA 3WP1B 3QPVA 1NMXA 3P27A 1CP2A 2FFBA 4EQ6A 4TWZA 1NSFA 4M9ZA 4DLYA 3QKRA 3EPJA 5KHOC 1COWD 5E7IA 1XD2A 3AF2A 3T15A 3AUYA 121PA 1Z0KA 3HP1A 5L3RA 4IDHA 4PPQA 1K6MA 1XEFA 1AA9A 2R6CA 3THYB 5TARA 2IYQA 2GJAA 3L82B 5HE9A 2C9CA 1ZRHA 2IUUA 4TL6A 1XTIA 5B58C 4QG7A 5KTYA 2GJ8A 2L0XA 3FGNA 2VSXA 1YR6A 4QL3A 1JECA 5TV2A 3CF6R 1A1VA 1KI1A 1WMSA 1Q44A 1QZXA 1MKYA 2NTYC 2WAXA 1W4BA 4LOAA 2IYZA 3G82C 2AWNA 2H5EA 2CHQA 1Q1EA 3KDSE 1E4YA 3QUSA 4B74A 5C1BA 2JLYA 2DWPA 4TYYA 1KO8A 1R5BA 1ZC4A 1KSJA 3MUFA 4TL7A 4DRZA 5FBVB 3KJIA 3DM5A 2OBLA 3I3SR 1G41A 1R7RA 3PEVA 4JVMA 1R0ZA 4DLZA 3BGWA 1UAAA 2OE2A 3QENA 4A9AA 5HCNA 1XFAA 3P4XA 2VHJA 2FSFA 2ZREA 3H1TA 4IXNA 5EXXA 2AXPA 3TSOA 4AG6A 1QHHA 1UBEA 3L43A 2G9NA 1Z3IX 1G6HA 4LGMA 4M4SA 2Q3FA 3N2IA 1SVLA 2FFAA 2QPTA 1TQ2A 2YVUA 3PXGA 4AWXA 5C18A 2BIFA 4RD4A 3RYTC 3JZMA 4NMMA 4YXWD 5LD2C 5EZ5A 2O8BB 4B3BA 3PEWA 4IDPA 2CVFA 1YQTA 3U7GA 1Z08A 1ZM4A 3CH5A 1SGWA 2Q9BA 3NBFA 1HT1E 3GFOA 3GP8A 2X2FA 4D4MA 1J90A 5E95A 3RSOA 5IT5A 3AKYA 3IPYA 4LYHA 4TSFA 2A9KA 4GNKA 4LX0A 2QSZA 4FWTA 1R8QA 4LJAA 5AR1A 4BZQA 3NG1A 3BB3A 1HY3A 3UATA 3Q85A 2H7VA 4OI2A 3K09A 2QN6A 3SNHA 1Z6GA 4JIMA 5EP4A 2QBYB 4G5SA 4B33A 2PBRA 1HURA 4WVFA 5D3MB 1BMFA 3AP1A 1T6NA 1KI2A 4LSGA 5G3ZA 3TRFA 4R2HA 2NZJA 2QPOA 1PUIA 1SVOA 2P3SA 4KVAA 4ASUA 3QPUA 4Q1DA 4O0MA 3ZQ6A 3UK6A 2KBFA 2JLQA 1W0JA 5IK2D 1R0WA 2BMDA 1OB2A 3ADCA 3MWKA 3MFYA 4P33A 3CRMA 1Q3HA 5H8WA 2HF8A 5KOYA 2IT1A 1YZQA 1D2EA 3EWSA 3RS3A 5SZHB 2CMKA 3AGQA 1WA5A 2VP6A 4GOJA 2GEDA 5KDDA 2OHFA 1IJEA 2XSZA 1S1CA 1T3HA 2GCOA 5FPKA 2H57A 4NBSA 4HUQA 4PHGA 2OUKA 2WJHA 4QGGA 3BS4A 5AJZA 2ZRMA 2IS4A 4MKHA 3LBIA 4F92B 1G18A 2G88A 3IGFA 3F8TA 2GHIA 1Q12A 2HXYA 4TMZA 3K0AB 3I73A 2JJ2A 1I4DD 3AF4A 3HR7A 5LB4A 1II8B 4HAVA 2RHMA 1Y63A 3GJ0A 3GJXC 1MRNA 2IYTA 5K8UA 1L8QA 1XCPA 4H9GA 1MV5A 1XEXB 2FNAA 4B43A 3NHAA 2IXGA 3O8BA 2ZU6A 5DYGA 3G5UA 4P4SB 2QEQA 5JWOA 4AKIA 2ZR9A 4QRHA 3CR7A 4B2IA 1OH8A 1UEJA 2GZAA 2OFOA 5FOXA 1WB9A 4O2LA 5KO2A 4DLXA 2YHSA 1RYFA 2CNWD 2OM2A 1Z2AA 1K5GA 4GL2A 4PAQA 4EPWA 3BAFA 4IEEA 1GRRA 2W58A 5TDHA 1X3SA 2CJWA 3A1VA 4NYJQ 2JJ1D 1KDTA 1YZLA 4MYCA 1HYQA 4NYIR 1KO7A 2WWHA 3NC0C 3I5XA 5AJVB 4O2RA 3UMFA 2X19A 3K0CC 4KFUA 4TMVA 4LJ9A 1IJFA 3SU8A 5AK0A 2DBYA 1CR1A 2ASEA 4G5QA 4KU4A 5DI3A 5GJVC 2FFHA 4CT5A 4C0AC 3BK7A 1BYIA 1KY2A 1S0UA 3FMIA 4QJ4A 4AY2A 2JLXA 4TLDA 1R8SA 2BBWA 2O0HA 4AYWA 3DDCA 4X8LA 2H17A 4V0OA 3RABA 3RRYA 2ZE5A 4NCHA 2BBTA 1OW3B 1ZUHA 3NEJA 5CYOA 1ZD8A 3H4MA 4MUBA 5KDLA 2EW1A 2BWJA 1W49A 1Z0AA 4NCNA 1E32A 1JAHA 1M34E 2QPAA 2NMVA 2Y8EA 1NY6A 5EE1A 2PCLA 1OXSC 4JJZA 3AV0B 4LV8B 1XWIA 2H16A 2ERYA 2PEYA 3LX5A 2QQ0A 1IXZA 4DSNA 1YR9A 1E9EA 2ZI4A 3DHWC 4XTCS 5JI3E 2JLUA 2ZVPX 1CULC 3W8NA 2EYUA 1TAGA 1XMJA 2YYZA 4RD0A 2QM7A 3L8ZA 1U81A 4M1SA 2FSIA 1L7VC 3Q5DA 3HWSA 4LHWA 2FN4A 1GL6A 2BC9A 4XVQA 1XD2B 2JDIA 1G7SA 3C8UA 5FPYA 1E79A 2GTPA 2VPPA 2FPKA 1RIFA 4RD2A 1CEEA 3BB1A 1KJYA 3WNCA 3T1VA 2OILA 3D3QA 3P1JA 3V4FA 1KDPA 3GLFB 4IHQA 1G16A 4OKSA 1ZIOA 4MQBA 1GRNA 1G3UA 4OHYA 1VIAA 4IVQA 5DGXA 1ZM7A 3CWQA 2O0KA 4L9SA 2WOOA 2XB4A 3PITA 3QXJA 4DLSA 4HAWA 1KHTA 3CB4A 1AM4D 2GZHA 1Z63A 4HLDA 3AEZA 3U4QA 2FOLA 3DM9B 1OIXA 4ILEA 4EPYA 5JLJA 1U94A 4DB4A 2IF0A 4E07A 3CX8A 2OFWA 1E0SA 3GJ3A 5BN4A 3KJEA 1HH4A 4A82A 3TVTA 3B7GA 2KE5A 5F98A 2F6RA 3AVWA 2VP2A 4D25A 3AH8A 4O25A 2B7CA 1QHHB 2KWIA 4I1OA 2REBA 4DUGD 4X8HA 3ZIAA 2XNDD 4Z8XA 2VLIA 4AK9A 3K70B 3P32A 4TTPA 3CO5A 1LS1A 2C99A 4OQMA 2FSHA 1KKLA 1YKSA 1W4AA 3BFXA 1XDBA 1OFHA 2DFLA 2IS2A 3LH5A 3BH7A 2YC4C 3QXSA 4FIDA 2B6HA 3CIOA 4TT3A 1MO5A 2C8VA 1T3LA 4A0FA 1XU4A 3OEED 1SXJE 4URXR 3S1AB 1ZC3A 1Z28A 5BXQC 1QRAA 2ZSBA 3M1IA 4DXAA 4AURA 3ADKA 2ZSEA 1KAOA 3DL0A 3BXZA 1G8YA 4W5WA 2VL7A 4BECA 3EWAA 2EWWA 2PLRA 2QTHA 3KQHA 2NO7A 1N0UA 2V7QD 3AF0A 1G5RA 5FH9A 4WOPA 3FE2A 4G0NA 4GZMA 1GM5A 421PA 1NVXQ 3PVSA 2AHOA 3EZ9A 4PZYA 1QG2A 2ZQ5A 3PIRA 4WXPA 5DYIA 2D3WA 1F2UA 2AD1A 5HPYB 3SFZA 3NXSA 1G8FA 5JRZA 2DB3A 1GFIA 4M1OA 1M74A 4IVRA 2HEIA 2VP5A 4ITRC 1U9IA 4TYPA 1JR3A 3UKDA 2XX3A 3AVQA 1E9FA 2XB2A 3FHOA 2GVZC 3LV8A 1V43A 2W0SA 4PHFA 4ABYA 1TL7C 4GRAA 4B73A 4G3XA 1P73A 1FFHA 3B78A 2GCOB 2ZPTX 4RZXA 2F7SA 4MDEA 5JEDA 4US1R 1UKZA 2IK8A 4HUQB 3SEAA 2NO1A 3U7EB 5EE0A 1TMKA 4JL8A 4M1MA 5FBWB 2HUPA 5LB2A 5L3QB 1TF5A 2ZR7A 3MJRA 2PZEA 1S8FA 3EIQA 4IDNA 4M0LA 4GOKA 3RC3A 2FE4A 2B8TA 3AKDA 2QAGC 2ZRLA 3B1WA 3BIFA 4MH0R 1AS2A 4CEIA 5DH9A 1NSTA 4WIAA 3K8YA 3LD9A 2ZJAA 4PXAA 1QBKC 2QM8A 1NLFA 1VCNA 1TUEA 3WNDA 1TU3A 1U90A 2ZR0A 4DCTA 4CYMA 4Z1MA 1NVVQ 2CEAA 4FINA 4PHTA 1D2NA 3ZJYA 1OIVA 1OSNA 4BEJA 3CZQA 4DDTA 1WP9A 4UNPA 3GEIA 2CHVA 3KQKA 2Z43A 3SDZA 2ZVQX 1QHIA 2FDCA 3EX7C 2A5YB 4HB0A 3MMPA 3NC1C 3JVVA 4NE2A 3RDPA 1UDXA 3PQCA 4XTRA 2GK7A 3IO3A 2VEDA 1M7GA 2VQSA 3F0TA 3SQXA 2GCNA 4V0MA 2Q9CA 1D2MA 3BRWD 2ZEJA 1H8HA 3K1JA 3SC3A 1A2KC 2HCBA 4JLVA 1KTVA 1Q21A 3HPRA 4Q1EA 2WM9B 3A1TA 3TIFA 1DEKA 2RMKA 2NG1A 2FPMA 2X2EA 4JVNA 4J0QA 5EUQB 1HEIA 4BFSA 4DSUA 2P2LA 2IUSA 3BB4A 2ZE7A 3NIBA 3KB2A 3DPUA 4LJ8A 4D26A 4A8JA 4C2TA 2KB0A 3EA0A 3BFVA 3OIWA 2IYLD 5JBQA 3IO5A 1E1RD 4TL9A 2ZUBA 5KPDA 4EJSA 3ADDA 4BRWA 1SVMA 2YWFA 1EX6A 1AJEA 1TQ6A 4M1WA 4BASA 5HKKD 1TU4A 2ZETA 2MMCA 1EFTA 4RFVA 5AUPB 2GEUA 1SVSA 5J4YA 3RANA 4H1UA 5KNBA 1F6BA 4ON9A 2H92A 4LZZA 4RZ2A 1B23P 3PUVA 1UJ2A 4DCUA 1NG9A 4Q4JA 4QJ5A 1T4GA 4G1UC 5GJWC 2GJKA 2ZS8A 1C4OA 1JBKA 2HV8A 1XD8A 4KYUA 1YJ5A 2RGNC 3KKNA 3IBYA 3BH6A 1V5WA 2AD5A 4LBVA 1M8PA 5A4JA 2VF7A 3Q7QA 5JEEA 2W6IA 4PAOA 1XCMA 5BN5A 1DAHA 2FGKA 1ZVQA 1HQCA 2RH5A 3IPXA 3U7FB 3KZ1E 2W2TA 2MSCB 1N5IA 1T5IA 4YMSA 2N46A 4R9UC 1OYWA 3BFKA 2GK6A 4URYR 4A92A 4NKRA 3QKSA 1US8A 3EC2A 1ZM3A 2P5TB 2ZRJA 3CNOA 4HZIA 2FSGA 2F3RA 3B1ZA 3ZIAD 1VPLA 3CPEA 3FVQA 4L9WA 4NTZA 2WKPA 4R2IA 3SJAA 4TLBA 3THWB 1XPOA 2ZTSA 4B3DA 1PV4A 1OFIA 2KI5A 1UFQA 1DAIA 2CCKA 2G1JA 2ZRDA 1IN8A 1Z07A 3QXHA 4JJKA 4A1FA 2DPXA 3ZVRA 4A0GA 3ZVNA 2YKGA 4UNSA 1LFDB 2UZIR 1XRJA 1MO6A 2CVHA 3B1XA 1N25A 2H8KA 2CLSA 4F93B 4Z8YA 1NNEA 2V9PA 3HPQA 1G64A 3I32A 2EFHB 4CEJB 2ONJA 4UJ3A 2BBSA 2C5LA 2R2AA 3CNLA 3A58B 3WMFA 1QVAA 5EE3A 1CIPA 3NVAA 2C03A 3SYNA 4B48A 3W5IA 4FD2A 4RSGA 1NL3A 3R8FA 1W7AA 2A3RA 1GRQA 3I8SA 3W34A 1DO0A 1W47A 2ZRNA 1R6BX 3FWYA 1UDWA 2RAPA 4ACBA 1JXOA 1LY1A 3AVUA 3HYRA 2JASA 1Z29A 3KKOA 4Q66C 3SJZA 1SXJD 3D31A 4FXPA 4IDOA 1RJ9B 4DDWA 1IQPA 3J81k 1VHLA 2FX3A 2CLCX 3JZAA 2OT3B 4BUJA 4LYJA 4LJ5A 4XWOA 4CRWB 3UMSA 4IOLA 4BLPA 2ZM5A 3EIEA 5IHPA 4ARZA 3EPLA 4F4JA 2WSSD 1EFRA 2WKQA 5FOTA 2F55A 1AKEA 2VH5R 3LLMA 3W3ZB 4MDFA 3B8HA 4JLAA 1Z6YA 2FZ4A 4DSOA 1W48A 5B64A 5HCIA 4C0SA 4B44A 1ELOA 2CCGA 2JIZD 4YMVA 1LF0A 2QZ4A 2DYKA 3B2EA 1G17A 4I81A 3P26A 4N3NA 3RNLA 4ESHA 2AN9A 3IDQA 2DFTA 4IDQA 3IIKA 4L16A 4RZUA 3DKVA 4K46A 4URUR 5HTKA 3KFVA 4RD6A 2BDTA 3I62A 2R8RA 2P6NA 2OLJA 3UIEA 4QBGB 5KPJA 2R44A 4JL5A 1GILA 2FPLA 5L3VA 3WBKA 3IUYA 2QGNA 4Z1MD 1SQ5A 1F2UB 3VU9B 1SKYB 3A1WA 3WBJA 4HZUB 4JVLA 2IYVA 4OJKA 1DAGA 2QE7D 2QSYA 3B9QA 1LVGA 1UBFA 4QHYA 1W36D 1E96A 4Q03A 5EUMA 5CITA 2IA5A 5SZIA 2FWRA 2Z0MA 3I1FA 2Q9AA 3LWNA 3OFND 2F43A
chains in the Genus database with same CATH superfamily
1L1RA 2QY9A 4J0IA 1UKEA 3X0DA 4LV6A 3TDKA 3EVAA 2R8PA 2XHEA 5BVHB 2P2NA 1JQEA 4LHXA 3VU0A 5KAPA 4OQNA 4TM7A 2YV5A 5AO9A 4CMIA 3QEBZ 4O1HA 3UFXB 3FIJA 2ODWA 2ZJ8A 4XZ3A 3IP3A 1Y0BA 1YV9A 4PN3A 1ZK1A 1AKNA 1BZYA 1XU7A 4PGHA 4WUVA 4W9NC 5ELMA 3RVRA 4XPZA 3I3OA 4Y6PA 3V6MA 4CQMA 1A50B 1I9GA 2RGCA 2PWZA 2FUEA 4LMPA 1N2XA 3WO1A 4DUZB 3U6KA 2FE1A 3WISA 2IIQA 5JXHA 4QUEA 3PENA 4H7JA 3QX3A 4BNTA 3M82A 1U6IA 3DQPA 3JRWA 3M6UA 5HDQA 5C46F 5K4HA 2X5NA 3FPAA 5DJ5A 3KQYA 3JSXA 3CZPA 2UYCA 1W1WA 3MUEA 3Q0EA 1HYHA 1K4MA 4HDNB 3SE0A 3AI1A 3H19A 4GI3A 4DWVA 4EHDA 1E9DA 1EX1A 2ZJBA 4JKIA 4N5HX 1W36B 3DZDA 2HSGA 2Q8NA 2CLEB 1O2DA 2HWXA 1KEZA 1MJNA 4UKDA 4I3HA 5EIHA 3LT2A 2VDQB 5A0TA 1DPFA 2W2QA 3WL5A 1P1HA 4BIIA 4F84A 3HN2A 4TTRA 4ES6A 1PD0A 4IRXA 1F3LA 2B9EA 1F51E 3HFGA 2HK7A 2XLCA 3G7NA 3IHLA 3PBKA 1DB3A 1JPVA 1SXJC 3H3XA 3LHFA 3L77A 4TXMA 1S7GA 4NU0A 3PXAA 1LJLA 4F45A 3L1VA 4DV6B 2AA3A 5CEJA 1BKDR 1EJ0A 5D1HA 3SLGA 4IFEA 5ITVA 5KQPA 2P65A 3H5VA 3K9HA 3BMNA 1ZA2A 3A2MA 4HXEB 5L3SB 4CMKA 1NQ5A 3U3XA 2XXAA 1QP4A 1EFHA 2Y4NA 4KDEA 4Z9BA 4F8JA 2EKLA 3TVDA 3S1LA 2NUAA 4G0MA 1TTPB 1FFGA 1ONPA 1BCSA 4DE5A 4CQNA 1N8SA 1HRDA 4AMUA 1GSIA 1OX6A 3HB0A 4O3MA 3HL4A 3CX4A 2ZAMA 3TQSA 2IXTA 3FZNA 1A8IA 4M1KA 1NBHA 1NU6A 2XOEA 5FL7A 3E7WA 3BQNB 1DKQA 1IXYA 1CU1A 1KOFA 3PA8A 4C2AA 4AP6A 4ZAYA 4A2QA 3DV9A 1KAEA 3DE4X 4XEHA 4Y0AA 2A84A 2OCBA 2IS1A 4Q4DA 2DT5A 5JSHA 4G09A 3O4FA 1ZMRA 1W73A 1QPBA 3ORYA 1BWPA 3VJRA 4ZPJA 2BY4A 2MR6A 1GO2A 4LI3X 2OCGA 2GPJA 3RRXA 5EJ7A 1JWBB 1LDGA 3E8MA 4M7OA 5IDQA 1W85B 1SUBA 4E31A 3OHSX 2IHKA 5TPZA 3UAOA 2AZDA 4R69A 1UT5A 2YFKA 4L7VA 5A5DA 3QQ5A 2PYZA 4UVDA 4JYCA 2Y71A 3KWLA 2E4WA 2IITA 1Y3DE 3EIXA 1DBSA 1REQB 4F11A 3CG0A 3QX8A 2Q5IA 2NZ8A 4KAFA 5AP9A 2B7BA 1DJOA 1HPLA 4TV8B 2AC4A 1JEDA 1WUYA 3PR2B 4ZCLA 2H63A 2QM0A 2Q46A 1TUBB 1WKCA 3U3KA 4AU1A 2B69A 5CA1A 3KNZA 5HIAA 4LNUA 2YIMA 4M8NE 3WQHA 4G0UA 5DGIA 3QY9A 2HCFA 2C04A 1RCTE 2PHZA 2I2DA 1A7JA 4HQNA 2VRWA 1UZMA 2O07A 4JT9A 1HYGA 3C1AA 3KVOA 1Q7BA 1ZR4A 5LP6A 1H66A 1P60A 1Z25A 1N92A 2X0IA 1Z47A 3ILHA 2ZE6A 4FFNA 1YRWA 5DX1A 3HUDA 1OGJA 4NYJR 2IDKA 2W2XA 3ZE2B 4DSTA 3AFNA 1CQIA 3A6JA 3DGEC 3F90A 2O8NA 3ZE8A 4IVPA 1PZNA 4EY3A 5HQ3A 4X1YA 1I94B 3HKDB 3U5ZB 5AUQA 3MELA 1EZ1A 4ENVA 2PZGA 1T2UA 1A8UA 2HQRA 4RZSA 2ONYA 1T2CA 2F4VB 4C06A 1PEAA 2CDNA 4EUEA 1A5AB 1I8TA 1PGOA 4BVLA 1E63A 4O4JF 1X2EA 1VLLA 4TRRA 4N49A 3IQWA 1O7JA 3A6DA 3MJTA 6YASA 4C4TA 3LUHA 1EB8A 4YQYA 2QGZA 3UC5A 1S3FA 3QBTA 4AICA 2E4ZA 5CEFA 2ZU0C 4ESVA 3OWHA 2ZR8A 2I4IA 2EJBA 1WV0A 4I6EA 5BRAA 2XOKA 3WL3A 3JV7A 5C7IO 5BR1A 4OQZA 4Y6GB 3RLFA 2HBYA 1N8NA 3U0BA 3ZIUA 5C52B 2IUTA 4EI2A 2BTOA 1Y33E 1XHEA 4RE5A 2GYUA 3VSAA 1K5HA 2BKXA 4QM7A 2I7VA 3GELA 721PA 2DPYA 2IZ6A 1JA9A 1YVDA 4KJXA 1H9BA 5JS2A 3OEHD 2UZ0A 3BA1A 4JB0A 5FF9A 4E15A 3ZKWB 1GA4A 3DMTA 4ZGBA 3BD7A 1PQYA 3PPWA 1QGED 1HT3A 3ZWYA 2IWRA 4IIEA 4ALNA 3IERA 4QDJA 5FFFA 4EELA 5B5SA 2F9FA 2ZRGA 3L8GA 3NB0A 3VKWA 3VVBA 3WWCA 3HYCA 1A9PA 2M6RA 4QVKA 5F7JA 1CVRA 2PD6A 3B6KA 4RPKA 1Z22A 4CFYA 1NYTA 2J0UB 1GSAA 2A5JA 4PRKA 4WBNA 5CFMA 3C8ZA 4OLFA 3KS9A 1SOUA 2OCAA 1M6VA 2VYCA 5DO9A 4GC5A 3IILA 4BRUA 2R7MA 1P3JA 3AYXB 2X86A 4GVLA 4BBJA 4BMVA 2D1YA 3ZCSA 1M67A 2YASA 4DXHA 3AKEA 4C4RA 4ER6A 4BV3A 3OC0A 4PPYA 2VK8A 1JPJA 5ABPA 2D1SA 2FSSA 3EDRA 1A88A 4ZO4A 2DH6A 3ABZA 3S2ZA 2WIFA 1UF9A 4M98A 3KRTA 4C3OB 2WFZA 4K8OA 4OAOA 5K0BA 3CPSA 1CRZA 3TMAA 4LDRA 3G2IA 4P4UA 4QRIA 4HR7A 4R1MA 1XX6A 2PS3A 4IDAA 3QBEA 1L8OA 2ZBVA 3NFRA 3RYHA 3HK2A 3WMXA 3OLZA 3H9EO 2VHWA 3AUXA 3WRVA 5JCZA 2IE0A 2QHXA 1V8DA 2H9YA 2JHCA 2QUJA 2V96A 2PZAA 1HZJA 3UHJA 5AVQA 2DEUA 1TADA 3RK0A 5CB0A 3IDOA 2AFIB 1YZKA 2JF0A 1AS0A 2F43B 2PA3A 2Y92A 3CVYA 4GO1A 2C2MA 4QRDA 2GARA 1NP7A 1AE1A 3CY6A 4TYQA 2QRGA 5AM1A 4J4BA 3K0SA 1L5WA 2OSVA 2EKPA 3Q3HA 2PIDA 2OBMA 1VJCA 2EKQA 3DTVD 5JTTA 5GONF 4NZ9A 3Q8MA 2VS1A 3R0ZA 3Q1LA 2IWHA 3SIPA 2QX9A 4HBGA 2O5CA 5HBRA 1USUA 3QW4B 1MENA 4FYIA 1U0LA 3UJ7A 1LI5A 3FTDA 2WVHA 3T95A 4QQFA 2Q3LA 1MB4A 2V4ZA 3LK6A 3ONWA 1U9ZA 3R3YA 3DKPA 4OBEA 4MQEB 4WNCA 4ZKDA 3TB4A 4P9NA 3E9MA 5IXJA 4EKNB 9LDTA 3MJSA 2FPPB 3RS2A 2AOXA 1M1NB 1QVZA 1NYQA 3JRXA 1GFZA 4JB2A 4LS3A 1FXSA 3K0FA 4JBLA 2Q6VA 2RSLA 3IMFA 3EDQA 2AG8A 4TLAA 3WYEA 3ZHTA 3RC8A 1G0NA 4G1EB 1P29A 2DQYA 3ZHOA 4LDJA 3F5SA 4YJ3B 2DUJA 3K31A 3TMYA 1EJ6A 1K7XB 3LA8A 5KOIA 1DARA 3QV2A 2MSEB 4QUDA 4Z9YA 4C07A 5SYAA 2PS9A 3GOQA 4W6QA 3TW4A 1YC2A 1YIOA 3FOCA 1GN9A 3AG6A 4J4TA 4QGHA 4P4GA 5FXMA 4PR3A 3MJDA 2PLFA 2SCUA 3CW2A 5DNAA 5C8VA 3RUIA 1RE0A 4JEMA 3DTVB 3B20A 2JGDB 3CF2A 3G9TA 3OD1A 3PTZA 1NXQA 4C5BA 4EPXA 4OQ4A 4ZV4A 1V9CA 1QH9A 4YWJA 4HS4A 3ND8A 1JDZA 2RH9B 3HDTA 3JQ8B 4WJLA 2AVDA 2Z95A 1GQRA 1QYCA 1DRVA 3I4CA 4RPCA 4RVSA 2CLFB 5MFPA 1SHLA 1XD9A 3ET5A 4FLEA 4ARSA 5F1OA 4YQFA 1G59A 4EY7A 4HEJA 4JYBA 3PIIA 5TLSA 3W8DA 2WZQA 4RELA 1WRBA 1KZ9A 5JWRA 2ST1A 2VDRB 3FTNA 3AVVA 4ZVTA 3PQ5A 5AT1A 1KSGA 1WLYA 1UBLS 4TTIA 4JX8A 4KWCA 4PO3X 4XGKA 3O1LA 1YJ8A 2JIQA 3M6WA 3NONA 5AESA 1GCUA 2HLDA 1LNZA 2VJMB 4O4HB 5EP1A 1HSZA 1RACA 3VYUB 3U19A 3SFVA 1K5DA 3BRSA 3W1WA 2QTTA 4BWYA 2WJAA 4ASUD 3IE2A 3ZCPA 2FETA 2KHZA 3EF1A 3GBVA 3EZ6A 3DLIA 2H59A 2X2OA 3G9UA 4DR7B 1QZUA 3E53A 5CA0A 3IDFA 4JI5B 5J2TA 1XQVA 4H35A 4OHMA 2I1LA 3CXUA 4RJKA 3WGTA 4G07A 2D8MA 4LZWA 3GRCA 4KJZA 4NMHA 3FCCA 2XIQA 4QJIA 5I9TA 4MGIR 1RQRA 1KPGA 3V4OA 2VQEB 4JI4B 3WGGA 1ETUA 2BE9A 2WSYB 3NV7A 1VP9A 5JD6A 1QIFA 4LJYA 2Q1TA 4CIWA 3OFSA 1E2UA 4DWOA 2XSZD 3A3NA 1GKKA 1YQDA 2B1QA 5LSAA 2GTIA 3D3JA 2KYRA 2YMPA 2BEKA 2IKQA 5JLAA 1CKEA 1F4PA 1X70A 4Z99A 4AZSA 1SVWA 3CQ9A 4J0HA 3V4SA 1ODJA 2F90A 4EX6A 4HXYA 3NEAA 4EAQA 4MVJP 5DIFA 1ZRNA 4J2HA 4GEKA 4G0YA 2OV8A 5JJLA 1RJGA 3BEDA 2NXJA 5CIQA 4UU8A 3L04A 5FNVA 4L74A 3V8BA 4RFLA 4DN6A 3ZJ5A 4ED9A 3IEKA 4TN1A 3R5SA 4FW9A 4W9NA 4BC0A 1Z73A 1N7IA 1YJBA 3C3YA 1M76A 4M6WA 1Z9BA 1Z26A 2UKDA 1T3GA 1NMYA 3EGCA 2VEOA 3RWMB 4JL6A 4C01A 4MV3A 4EVQA 1PWHA 2G67A 2B3DA 2V6FA 4U7DA 3I6MA 1HL3A 4NYMQ 3BL5A 2YY7A 2YYYA 3EIWA 2WWGA 3QOYA 4V2IA 5F9MA 5BV0A 5KB3A 3TRKA 3QYAA 1XPJA 3NKLA 1PNTA 1PR0A 5SZKB 1SQGA 1QVWA 1E2KA 1B00A 1KI4A 1GL7A 1KIMA 1ND6A 1O96A 1UXKA 2VBFA 2WG0A 4KWHA 1BH6A 2O8EB 2H31A 1OX5A 5INTA 3IKTA 1M3SA 1ZBDA 1QH8B 3DEJA 1PT9A 4HATA 2ZS7A 7ADHA 1LPPA 4CMJA 3TZHA 3D7MA 2QUZA 3K6SA 1QHFA 2AOTA 2F1IA 2R1ZA 1NPTO 3NTRA 4GM0A 4OJQA 4RS4A 1IH8A 4C4PA 4EF4A 5D8DA 3EK2A 1FNCA 4WD3A 1D09A 2HIGA 2J0EA 2JNWA 2UZ3A 5THXA 5ESDA 3QE3A 3ZUPA 1J24A 3I52A 2BKEA 5K3OA 5BY2A 3C39A 1NSYA 2Q3CA 3OT1B 3TVYA 2FSUA 1XSEA 3D6AA 5EE9A 3UK7A 5DN6A 5DP1A 1YQXA 4A03A 2EHDA 3FNEA 4K6FA 3ZQ4A 1K6JA 1JWLA 1N2BA 3A4YA 2QJTA 3COPA 3LUCA 1A04A 3OPVA 2L82A 5DGDA 4RPJA 5HXAA 5KSWB 2O3RA 1PS0A 4KV9A 4N41A 1Y1QA 3PZBA 621PA 3JRNA 2VJLA 1MD9A 2ZSAA 4I55A 4MGYR 4WKCA 5A7GA 5IKMA 2ZQZA 1Z2EA 2ODTX 1PVDA 1LTKA 3Q12A 3T94A 3V4LA 1YB1A 4I50A 2Q2WA 4MLPA 1ISHA 1L3CA 4HNQA 3JQGB 2E21A 1N4AA 3FFBA 1OILA 4JH0A 1W5TA 2IYUA 5KOHB 4PFQA 4WSOA 3SBEA 3CLTD 3IP7A 1I3CA 1TJPB 3PHCA 3JXEA 3LGAA 4Y2GA 4HFRA 4B76A 2GNOA 4NE9A 3S8YA 1OYOA 5KX5A 3PSAA 1SCBA 2WPNA 3HU1A 2EF0A 4DA8A 1LLDA 3SOPA 3QSGA 2VQFB 3Q72A 2VUHB 1IE3A 1BGWA 2CJWB 1O89A 1HRKA 4R2JA 1NDQA 4LJ7A 1DO2A 2W98A 1T9CA 4PBSA 1THZA 4E3WA 2ZULA 4J6EA 1I7QB 4NMWA 3ZU6A 5AJYA 4JC0A 4ZCIA 2V3CC 1I01A 2RGWA 4IG9A 4TL8A 4LEIA 2PL1A 4PO9A 3K16A 3V2GA 5JJKA 3ETJA 1FVXA 1V1JA 3MEQA 3WGLA 1P2GA 4KO2S 2ZUDA 4UJ5A 4O2BB 4IRMA 5DI3B 1GUYA 3WS7A 5CBPA 1EBUA 3K32A 1P75A 3DC7A 4M9QA 3NBYC 1BS1A 1ACLA 4P7KA 1GRCA 1E2FA 1NLMA 4AXBA 5CM8B 3P5BA 3OZTA 5FI1B 3RGWS 5CGQB 5FR1A 4C22A 3OMLA 4DXDA 4UUQA 1J4AA 3WDMA 1E61A 3EUFA 2J6CA 3EPRA 3ND5A 2AOWA 3PHJA 4KQIA 4C3UA 3LDGA 4XCXA 2WILA 2FGJA 4QFCA 4HDOB 1WZ2A 4CI0B 4DDMA 4PSKA 2IOYA 2JARA 3VSDA 3LC1O 3QTLA 4ZI7A 2IIPA 2NO6A 4Q4HA 3L0IB 3EVEA 3V8QA 1YDGA 2OB2A 3IE1A 5E8RA 5EYPB 3HUEA 5M29A 1GNRA 3IKLA 4M36A 4DBLC 1ZNYA 4JI8B 1B8OA 1D3AA 2JZCA 1GARA 3GV0A 3WBFA 5CLLA 4TV8F 4AG5A 4BUZA 4FGLA 3X1YA 4W7IA 4PRYA 1X1CA 3BWYA 2P5UA 3KELA 4POOA 4Z1OA 2QRVA 3DOUA 2WTNA 1K6EA 2OZLB 3OLQA 3LPAA 4FUQA 5FWNA 4HH1A 1ZI6A 2AR9A 4QJ3A 3M1YA 4QQRA 2L69A 4FMCB 3U3RA 3LF1A 3LYAA 2UXDB 1V5GA 1EE2A 3KT6A 2NUPB 2CKDA 3OG9A 5DBEX 5IFKA 4OL0A 2VDPB 5K6TA 4KFRA 3ZHCA 4MIOA 2QN2A 2WNIA 3KT8A 4JSYA 4N6NA 4D0GA 5IJ9A 1EVJA 3DB1A 1WOMA 2QLJA 1L7MA 2QLNA 3KQMA 5F2KA 1V3UA 3TR0A 1A27A 3E5RA 1F8XA 2X9NA 1SVUA 1SUCA 2XLBA 1IN7A 3MWLA 4AY4A 4H60A 4B81A 2I6SA 4DCJA 2XNCA 5BSGA 4KITB 5T4EA 2G82A 1X80A 2QRZA 2ZI7A 3FN4A 3WHLA 2BH2A 4PTYA 2ESRA 5AVUA 4H3HB 1HNZB 2XTZA 2DWQA 2NVOA 3BHJA 1M1YB 1Z06A 3BZWA 2C9YA 1VL5A 1P1RA 3FPBA 3L4SO 1O77A 4L5BA 3L1HA 3FCXA 4TKVB 1KHHA 4B3JA 1KERA 2WMOB 3D3WB 4BWFB 1KFEB 4Q7KA 1OJ7A 2V5VA 4OHVA 4BGUA 1QS0B 3P2OA 3LQQA 4I14A 3M6LA 1TA0A 4BLRA 2R60A 4XA8A 1SB9A 2E4YA 5AM0A 3DQZA 3IP5A 4H7KA 4R05A 3PL1A 4JI6B 1N2CA 1YZGA 2JGLA 4MVJA 2IOQA 3OLYA 4MUAA 4UTXA 2RAUA 3CSSA 4AZ0B 1O4WA 4BFUA 5KSZA 4DAOA 2WQ6A 1VSVA 2OZEA 1ZK0A 1M0EA 1P1KA 3B6JA 1E9RA 4ZTBA 1H4QA 3MBOA 1VBFA 2OD7A 1JR3D 2A9JA 4FIZA 3AUTA 1CUWA 3E27A 3QU5A 4OHZA 3G7SA 4LZOA 4ND8A 4NEHB 1IRIA 1MO3A 4NG4A 3O38A 3CWZA 4BNWA 5KUTA 5C32A 5L45A 1JI0A 2R7KA 1QP7A 2EFGA 4P32A 4PINA 2XHZA 1JR6A 1F2TA 3L8DA 2XTNA 1JG4A 2PV0A 2R8XA 5EZYF 1JEQB 3KCNA 2DXIA 4RHYA 4PSDA 3T9DA 1V1MB 3DL2A 1TB4A 1UCFA 3K0CA 2JCYA 2DY0A 3EEFA 1RQXA 3IJEB 3KQSA 3NWBA 1OB5A 1TK3A 4HWKA 1GTSA 2I54A 3CS3A 1NQUA 4JLMA 3SXPA 5TT1A 3LFHA 4HLQB 4RDCA 2ZG6A 1FFCA 4QWMA 3DVLA 1AZLA 3EVGA 1H1TA 2AFIE 4MJ3A 4U7PB 1GYRA 1F20A 3PL5A 4HMOA 4ZAFA 2G9ZA 5FQNA 5FJIA 5PGMA 5FLYA 1U0EA 5TRTA 3N07A 4FU0A 2C92A 4LF4B 1J0CA 1YCDA 1XHLA 4NOJA 5KYXA 2HL6A 2ZJ5A 3FTPA 4F8EA 2O54A 3NT4A 4NCAA 1PK9A 2JEYA 4WERA 1V8BA 2J33A 4Z9AA 3ZLJA 1FJGB 1DKLA 2CFOA 4NJMA 4TKZA 1P9WA 1Z4PX 2VP3A 5JJIA 1Y8QB 3PC6A 2OGSA 1N6PA 1TM7E 1XJCA 3HLYA 3PXXA 1VJRA 2BZGA 1QU2A 2P90A 2GBPA 3ISJA 4ZCMA 4BMOB 2VAWA 3LXUX 3BWDD 1X1SA 5KHLB 1HNXB 4H1VA 1JL3A 1X7ZA 2I6TA 2DQZA 4OU4A 2JFFA 4FFBA 2J41A 4KBGA 1RQPA 1D7AA 1ZMOA 4BY9E 1OXBB 3T4PA 3O9VA 2QX4A 5LWQA 1II9A 4Q3BA 5I6DA 1U0HC 3H2JA 4RETA 1JJAA 3OIYA 1HDYA 2OXCA 2WIDA 3KR1A 1SC9A 1XZJA 3AQIA 1TQ8A 2AOUB 4QNMA 4Y2XA 4MUXA 5AI6A 3QLEA 3AUFA 3S44A 5GADl 2VYND 1YAHA 1DJPA 4RA9B 1BWQA 4ZO9A 3FBTA 3KQUA 1FJ2A 3ANMA 5IYZB 4UCWA 3RCBA 1KR5A 1BA3A 5KTOA 4TYWA 3ST7A 4INZA 5I5GA 2LR0A 4MPDA 3HBJA 1TRHA 1Q0SA 2AN4A 1IEXA 1X3LA 3DHVA 3HV0A 3QFFA 4TWIA 4Q24A 3V4PB 1NRIA 3M34A 3ZDEA 4CIBA 5K01A 1S2DA 2QXUA 3NDRA 4N03A 3AL0C 4QKQA 1ZLYA 3L02A 1FDTA 2A1TR 4EJFA 2CY0A 5I4KA 2CNDA 3WLNA 1AO0A 4JXKA 4ZVVA 1P4RA 4D4JA 5K9ZA 4KC0A 4WNIA 3GEPA 5JNRA 3KCQA 4YJ3F 5LU8A 10MHA 3PFWO 2PE5A 1NULA 3L7YA 4F3TA 2FP4A 3UYKA 3U61B 4YRPA 5DK6A 3QKWA 1RC1A 2J5BA 1BHO1 3RTGA 3G2PA 4JJEA 1T5HX 4FNMA 4F5DA 2XJ9A 3T4EA 1HR0B 4K9PA 4MMXB 4Z4FA 4ZPXA 5ESXA 1UKYA 3TUJC 4DEYA 1MEEA 4ND3A 1G42A 1DSSG 2VNJA 3GCGA 3PD1A 4J7XA 4L28A 4PIMA 3FNGA 4X1KB 4P3OA 5J9FA 3SGLA 1FQJA 3GLGE 3L0CA 1NKVA 3T34A 4G5GA 1H69A 4UASA 4DLPA 1XNQB 1ZIPA 4ZYUA 4DMGA 3DMFA 4IZOA 4EITA 4EVRA 2Z5GA 2BTQB 4NBLA 4HTFA 1Y89A 2BHRA 1P3DA 3SFTA 3WYDA 1Z6AA 4YUWA 1PSZA 4RFSB 5KYNA 2UDPA 3A3KA 4P5DA 5H68A 3H2GA 4WADA 2QR2A 1RIIA 1ECLA 2ZKLA 1XDWA 4TGLA 2H1RA 5AIAA 3VDXA 5A6VA 3PYXA 4MW0A 4REMA 4G0VA 4BLOA 4PICA 1CETA 3HGQA 3L6OO 4FLMA 2WUWE 4OFWA 3CLRD 3OTIA 4U9UA 3W2EA 5CLJA 1RZRA 1KZGB 4KRYA 2NOAA 3FH0A 3NNDA 4MTCA 1JJ7A 1XKQA 3JWJA 4J0FA 4NS4A 4O4HF 2VSOA 4B0PA 1YCFA 1GXSA 1HF3A 1P74A 1L5FA 2PX2A 3AR5A 4H59A 1C1XB 1KDYA 1JNXX 3HU3A 1I6LA 3GLFA 3F6SA 1J2YA 4IMRA 2IV7A 2AJCA 2OZVA 3B6MA 5FWAA 1P4AA 1W4RA 4D6PA 4WZBA 3SC4A 2CE7A 2ORVA 2YYAA 4XXHA 5DF1A 3EFEA 1S2NA 3CN9A 4R2LA 1ISRA 1GG8A 4Q12A 4IM7A 1YI1A 5KYWB 4C7BA 5LP1A 2HFJA 3TH5A 1UZLA 1S3GA 2X9LA 2CC2A 3PI6A 3DFFA 4GYWA 1RMQA 5FD8A 2P2GA 2PMKA 2BFFB 2V9CA 3K20A 1TM3E 3GWZA 2ZRPA 3KOUA 1YBAA 3ODPA 5ALIA 4D41A 4DVGA 4NQZA 3VO8A 4B6FA 2ZT7A 3ASVA 1TXGA 2PXCA 5BMVA 5IEBA 1WHSB 3DWGA 1OKKD 1U3VA 2VIIA 1DG3A 5KMGA 3A26A 4QOJA 4ANFA 5K6AC 4TKLA 4DMMA 4FW8A 3UW3A 5K03A 3ULKA 4MS4A 4WNYA 2V1XA 3R40A 3CH4B 1QO0D 1ZDMA 2YJ3A 3QP9A 3HSKA 3HR8A 4R3UC 2JLWA 2O06A 1LH0A 3WYAA 4C0LA 4QFMA 4CR7A 3WWOA 3M5WA 4JY7A 4XIYA 3GRYA 2JIDA 3OCYA 5G3YA 3V33A 4G5HA 1RM3A 1FFSA 5ED0A 3A1CA 3BSYA 3QH4A 2WJ4A 5AVVA 2ZBPA 4Q5IA 4CLOB 1KVUA 4KRFA 1GU7A 2JFYA 3RF6A 1H2EA 2BEJA 1XZFA 2O0JA 4WCFB 1L5HA 1HFWA 3EZ7A 5IASA 1UM9A 3RAGA 1CBUA 1Z13A 3EWIA 4HDAA 5TMEA 2Q4RA 4B17A 4B3SB 2NPFA 1LKZA 2OZPA 3S1AA 5HR5A 1KJZA 3V2IA 5K3EA 4U5XA 4CL0A 2YJ5A 3MMNA 1W8DA 5JAOA 3ZWKA 3LO5A 3VC2A 4QFBA 3MERA 4WNAB 2EJTA 2HWKA 4UBMA 2WYHA 4ZT7A 1MJHA 3FDZB 5C7OO 4OL9A 3VX3A 1DDOA 2RKBA 3AZPA 4BZWA 2XAUA 1VIVA 3GBPA 1E5QA 5GVSA 1CFZA 1J8DA 1HE2A 2VDLB 3ASUA 3GGPA 2GEBA 4UCXA 5EQFA 3W7VA 4UOQA 3R3UA 2WIAA 2Q4DA 3D4BA 1KIAA 1KZ4A 1Z88A 2JKVA 2E3JA 5MN5A 4FGJA 1CS4C 2ZBQA 2I1WA 2QB5A 4GOXA 5I01A 4X92A 4BQQA 1WDLA 4X5OA 3WNQA 4ENWA 5LJIA 2HF7A 4L8GA 4Z4CA 1U7PA 1G3MA 1LPNA 3FKSD 4MB0A 4YDHB 3OHMA 4DJDC 4D96A 1XHFA 3B82A 4IW3B 1NJFA 4NPHA 4EA9A 1MPXA 1OXTA 3WDLA 4BBZA 3ZWVA 3JWGA 2BISA 3OTGA 2CLLB 5DLYA 2GT1A 1GFWA 2A1UA 2GSDA 2JCVA 3H2SA 4G0WA 1J39A 3V7FA 4IDEA 3DL4A 2PX0A 3BIJA 3I1YA 5L3QA 4IQ8A 4P3KA 4EK9A 521PA 2Z2IA 1DVRA 2WV9A 1MVOA 3BZBA 4Q7QA 4EJ2A 3QBVA 3GEEA 3JWEA 1A77A 1X1TA 3NDIA 4FD3A 1IY2A 4WGGA 4NEGA 2Q6OA 1X42A 4V0NA 5TMPA 1CF4A 1EDZA 3ELUA 5CH3A 2GXAA 2TSYB 4JMLA 3AUSA 1X87A 2RB4A 3O8QB 5JZSA 2VO1A 2YZ2A 2QN7A 2ZRIA 4JT8A 1QCDA 3DV0B 1H2WA 4FX5A 4MR8A 3RIHA 2IBMA 1RWVA 2PRKA 1JTVA 5K5EA 1MEOA 4D45A 2ODBA 1FQKA 1U0BB 3UANA 2N42A 5CIWA 5GMOA 3F6CA 4XX0B 4ZI5A 1E5XA 4CMAA 5JZVA 4O2BF 3O7MA 4O02B 3L0OA 3TJMA 4F4FA 5CCDA 2YXNA 5L51A 3EW7A 3ODGA 2W48A 4MRSA 3IE0A 2UVPB 3LLUA 1G5PA 3TFQA 3C4JA 2QD1A 3CKMA 1ID8A 1D0SA 4PBRA 1C9DB 4PQEA 3V8EA 3AJAA 3FYDA 1TC1A 2OAP1 1OJLA 3C3XA 1FTGA 4QXAA 5IWAB 3EQZA 3IRUA 4ETNA 1QYDA 5FI0B 4HK4A 1H5NA 4DLBA 1ISIA 1YI0A 2B7LA 3I09A 3LOUA 1MC8A 4A7PA 4UEJA 2GN0A 4B9EA 2Y1OA 3OQOA 3DW1X 1M2GA 4OMUA 2D59A 2ZCJA 5CK4A 5DHSA 3W5SA 2RIRA 2W42A 5HWSA 3RKSA 1UBUS 2FW1A 3HQ4O 3K35A 1OI3A 3KLMX 3S2YA 3JW8A 4JJFA 3ECCA 3LVRE 4E09A 2QOEA 3OKFA 2K2QB 3BJMA 2OCLA 3HY6A 3K9BA 4FMCF 4HYYA 4REQA 3Q7EA 4U7WA 3ZQKA 4C4YA 4CMBA 3N05A 5B57C 3DUFB 5JVDA 1ZKMA 1N9KA 2JZNA 3IUJA 4J0JA 4DUPA 3DPSA 4ZIRB 1AOXA 3T1QA 4EFMA 1M1YE 1I4EB 5KKNB 1NZJA 3PHHA 5ANRB 5TQVA 4QXPA 3ZYZA 1QPZA 4QVIA 3OZXA 2C78A 3Q3IA 2FJUA 4NDZA 1STOA 2I2FA 2MSNA 1KI9A 4GWGA 1DXYA 3ZE9A 4F1WA 5C53B 4XGIA 3OWXA 3CYFA 1KXJA 3AZOA 4PX9A 1U0SY 1ZOLA 1KF0A 1LFAA 3WB9A 2CYAA 1R6TA 4RY9A 4RIHA 2Q3HA 3KUDA 3E35A 3EGWA 3UPTA 2ZAOA 2WM8A 5KNDD 3ZZUA 3SIWA 4Y0NA 4HO1X 3VQTA 3OLCX 1SBIA 5A62A 1GKIA 1ZMBA 3WLJA 1L8LA 2AL7A 2ES4A 4PCAA 3VKGA 1VLMA 3B85A 2AQIA 5CXUA 4Y6RA 3KJZA 3LY8A 1HE5A 4KFTA 2XW6A 3DZIA 1IB0A 2TMYA 3L0PA 3FTCA 4J7AA 3C1TA 3N74A 4PU0A 5MN6A 2QUBA 3MNFA 4I8XA 2HLHA 5LKAA 2WR8A 1XLWA 5E6SA 2O3UA 2CB9A 2V7TA 1XROA 4L4ZA 1FCJA 3FF1A 4N0MA 3WB0A 2PFKA 1EGQA 4IJUA 3T12A 1KKMA 4B7UA 1U8EA 1ZJ6A 2BH9A 2ON6A 1R6DA 4FSXA 2F1RA 3PWKA 1NQVA 3UBMA 1GUZA 1C3JA 2GCPA 2FQYA 1JTEA 2I78A 2QTVB 5TQ0A 2QJWA 1W44A 3RYFB 5IF9A 2A7XA 4QUBA 4DC0A 3V00A 2PWPA 1BCRA 4Q18A 4UUPA 1Z6QA 4IH1A 3NBAA 3VV2A 1ISSA 2PYDA 4ARVA 4JDPA 1VJTA 1YL7A 2H54A 3AHCA 3DMGA 2QRNA 1X7WB 3RS8A 2ZB7A 3RH0A 4P3YA 4PZZA 5HYVA 1NVEA 2QVCA 3C85A 3KYCB 2A78A 3NZEA 4RJJA 1EP2B 5DCLA 1JDBB 1ZY2A 3PR3A 4BPBA 3UJ8A 1ZL0A 5IM4A 2FXVA 3AHFA 3H16A 3JQAD 1U2ZA 4WK4B 3C3MA 4Y9UA 2O2CA 4B6RA 4TXHA 4G5OA 2H2WA 1J20A 1O0SA 1PWYE 2R85A 3VSEA 4DAEA 5KCMA 5AOCA 3UCFA 4E5YA 5J4HA 4URHA 5KREA 3PQ6A 4B3RB 4ARAA 4R71A 4Q47A 4RESA 4RIEA 1IG0A 3OPYB 4TRJA 1DWPA 3FMPB 5JYBA 4BVHA 3VPHA 1A8HA 1HDIA 1B42A 4EBFA 2AC7A 1GPKA 2WZBA 3C70A 1Z82A 3L0YA 1R4AA 1OFGA 1RD4A 4MS3B 3ROZA 2VQ6A 1R6XA 5EGNA 1MGPA 1R4MA 2TMKA 5EFOA 4TQUS 3ZD6A 2GETA 4EA8A 3ZXSA 3LTNC 3U44B 1YB2A 5JWHA 3W04A 2Y3IA 3TI7A 1MVNA 2J32A 1KP2A 2VQDA 3C43A 1QX4A 1XQWA 2EWVA 3N8IA 4K87A 4M86A 5AJXA 1G19A 4QUHA 1AA6A 1EZZA 1WMBA 1QE5A 2LDBA 2Z5FA 3OIGA 1QQ7A 1IY0A 5GJBA 4TROA 2WTUA 1C4XA 2IYSA 3CBQA 3IAXA 3K73O 2XH8A 3W8FA 1OTYA 1S96A 2HW8A 4GIBA 3PGVA 5IJXA 2Q9UA 3LUPA 1NVTA 3MWDA 1KOJA 4GPTA 4BVJA 2IHBA 2EFCB 1PK7A 9ATCA 3GFQA 2WB2A 2G1KA 4HB4A 3WRXC 4DA9A 4YVFA 4ZC8A 2WG1A 3OQHA 4TXJA 3UMMA 3JQAB 4K1LA 3STYA 1RBZA 3C24A 4MAFA 1GU0A 4GGPA 4WPGA 3OEYA 1JR2A 4JGGA 3K70C 1J33A 1V6CA 2Z58A 4JLSA 1H0HA 3TBFA 1T13A 2IXBA 1NWCA 2E4UA 3QWAA 1JLKA 2O4UX 3AIOA 4MA4A 4TKUA 5IYZF 3B3JA 3PQ2A 3O8LA 2YJGA 3HB5X 2CYBA 1A9YA 3LG2A 4IXTA 5B3AA 2ZE8A 3BKWA 4HWGA 4B2LA 4HPXB 2JD0A 3X1DA 1HM5A 4AN0A 2OCYC 4DQVA 1V41E 5A4AA 2WIGA 4B34A 1ZP6A 5K0ZA 2WSSA 4RIGA 1I2ZA 5BSTA 5FR2A 1RKQA 2H9AA 1C29B 2GXSA 3SKYA 4CN8A 5AH0A 3W4KA 3E4CA 3O9MA 1MDBA 3EARA 4LRQA 4Q4AA 4KOEC 1Q7TA 1QAQA 4G63A 3O0DA 3ZGVA 5ALTA 3UCEA 1FPQA 8LDHA 4BKOA 2YXPX 1T1GA 1ZH8A 2IEIA 2LBPA 1H2BA 2H1WA 2O2GA 2PT5A 3VR4A 4PLFA 3V1KA 3RC9A 2HCJB 3GHHA 2H1HA 3BXFA 3ZI4A 1THTA 3CW8X 2EQ5A 2WOJA 2QX7A 2XJ4A 2JD1A 5DLQC 3IMCA 3JARA 5KWEA 5IW8A 3TZCA 3AEYA 4LZAA 1S2OA 2JBAB 1PZFA 3HNRA 2RKOA 4A6DA 5E6UB 1CF2O 1LB1B 1IDN1 2VC2B 1AH2A 1E98A 1TJ5A 4Z7JA 1FYWA 4ZVRA 5JV5A 5IAJA 2Z1NA 4GKAA 1UIRA 2FXIA 4HAYA 4RL4A 2AI3A 4OI4A 1BKSB 3GARA 5B1HA 2OV6A 1T15A 3PC8C 2BGRA 3MJ4A 2G6BA 1R0YA 3AM4A 3PKJA 2UXBB 2QE7A 2QF7A 1JHAA 1UJNA 3EQ7A 2YS7A 1E8DA 2XTMA 2PX6A 5K0CA 1O0CA 4CM4A 4KAAA 4Z0TA 1SHUX 4MWCA 3GGJA 2IXDA 2GASA 1PW7A 3EAGA 3EGDA 1MMFB 4X3PA 2Z3WA 1JTFA 3CLUD 3T3EA 3V8NA 5BVGB 3ZVMA 3G6KA 3U4IA 4TN5A 3ZW8A 1JWAB 4D9FA 2O59A 4BU1A 2YS6A 2JLSA 3NEYA 1MA3A 1ZXLA 3CNHA 2XUKA 2JVJA 3LGXA 1NP6A 2R00C 5C4GB 1TE2A 1BHJA 1G5QA 1Z2CA 4PEVA 4V0LA 3CGGA 4Y2SA 3ASZA 4C6TA 4CT0A 3MQ4A 3PDIA 1PD1A 2XEXA 2ZW9A 4XOIA 4I5EA 2CHEA 4QXQA 4QUKA 2D1FA 2ZKIA 3FG9A 5EMLA 4L9RA