1ZNWA

Crystal structure of unliganded form of mycobacterium tuberculosis guanylate kinase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
VGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique GMP-binding site in Mycobacterium tuberculosis guanosine monophosphate kinase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Guanylate kinase
total genus 60
structure length 182
sequence length 182
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1znwA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1znwA01
5FH9A 2AWOA 3CO5A 4TZ0A 1M34E 2REBA 2ZJOA 2ZU0C 5A4JA 2K5UA 2QG6A 2AX4A 4JLBA 4HLUC 3H1TA 1U99A 3REFA 1LFDB 1LS1A 2CVFA 2CHQA 2XNDA 1ZU4A 3CF0A 3DVLA 2HJGA 2IHBA 2QMHA 3O47A 4BGDA 3VKHA 3QF7A 1G3QA 4ACBA 4TQUS 1ZUIA 4F92B 2CHGA 3TBKA 2XEXA 3RRYA 3ASYA 3LNCA 1AIPA 1P2UA 2GTPA 1S2MA 1IHUA 2W2XA 2QMOA 3BD9A 3M6AA 3QJYA 4URVR 1K8RA 4B71A 2JDIA 3W5IA 4DSUA 4WA7A 2ZSDA 1IAQA 4PXAA 1SXJE 1XTIA 3R9XA 2J0UB 5AK0A 4MRPA 1I4LD 1HA3A 2VP6A 3DZ8A 4RKFA 1P61B 3ZZUA 2IHYA 521PA 1G6OA 2ZR9A 3ZS9A 4B73A 3L82B 4M8NE 4Q1DA 1COWD 2ZRJA 2F3TA 4GOKA 3T12A 2IS1A 1EX7A 4Q7LA 2QI9C 4ARZB 3KQLA 1P3JA 3X2SA 2PEYA 2BJVA 2WICA 3ZIAD 1F60A 1IN5A 4UXIA 4DZZA 3ZS8A 2DFKB 4Q4JA 5H68A 4C4PA 4Q1CA 1YZLA 3ONWA 4O2RA 2ECKA 5A5GA 3FVQA 3UG6A 4AKEA 3P4YA 5TXGA 2R6CA 2IYYA 3B1VA 1WRBA 1CP2A 1X3SA 1NL3A 1AQYA 1NJGA 1SXJA 1HE1C 1OIWA 2ANCA 1NLZA 1YR6A 2GDJA 1CLUA 3Q85A 1S3SA 3QNUA 3REGA 3Q5DA 2ATXA 4P4SA 5KSYA 2AD1A 1GRNA 1PLLA 3KUCA 4AWXA 3QPWA 2ZYVX 3F8TA 1HT1E 2A5FA 4W5WA 2F1HA 2XXAB 2Z43A 4AYTA 4IDOA 4JYCA 3NHBA 2FPKA 1JBKA 1DTSA 3I1FA 3QKSB 2HJVA 3RAPR 4TWZA 3T15A 4YMUA 2ZANA 2VBCA 3NDPA 2AXPA 3NH6A 2HDNB 3OE7D 1ZCBA 2ORIA 2J59A 4KAXA 5IHPA 3KXIA 1VIAA 4TLCA 1GNQA 4C0BA 2GCPA 4R98A 4G3XA 5E3HA 1U8ZA 5DI9A 4KITB 4RD2A 1NMZA 3QF4A 2H57A 1D2EA 2FH5B 3QEOA 4OHVA 3LV8A 2GJ9A 3D6TB 1MT0A 1KI7A 4JJZA 4FXPA 2A5DA 3TRFA 3FKSA 3GLHE 2RKOA 4PZZA 4RVCA 4B33A 2QROA 4IEIA 2QQ0A 3B1YA 1CR0A 3DM9B 2MSEB 2XOKA 1N6KA 3CPJB 4JKYA 121PA 2QU8A 1G4AE 2GILA 3C41J 5EP3A 1NKTA 2F43B 1H8ED 2ZRCA 1KI1A 1U90A 2QT0A 2W0MA 1UKYA 4LBVA 2VO1A 4GNKA 4AD8A 4PC6A 1IONA 4GPTA 4KYIB 3NTUA 3QBTA 4KBFA 2B92A 3BAFA 3EPJA 1XCPA 2WKPA 2RGEA 1KAGA 4LJ5A 1W36C 3JVVA 2OZEA 3NHAA 4EIWA 1E2LA 4I99A 1QDEA 2O8FB 3W6NA 4XH9B 4D25A 5DHAA 1FNMA 1N5IA 4DLZA 4MRNA 1YQTA 2Q3FA 5JJIA 1Z0JA 5JEEA 1N0WA 4KCGA 4IOMA 3LFUA 5A0FA 3ICQB 4EPWA 2GZHA 1DAMA 1NBME 1XTRA 2GA8A 2GVDC 3EC1A 3LRPA 5C2JB 3QBVA 1GKIA 2BEJA 2W00A 4BECA 2JLZA 2NIPA 3OFND 2J5XA 4O2LA 2Q9AA 4R7ZA 4U5XA 4A0FA 4RD0A 4JSTA 2B8WA 5TVKA 3ADCA 3QKTA 1QZXA 3BWDD 4HLCA 2JLUA 3FFAA 4MRSA 1OW3B 3FHCB 2WV9A 5EXPA 3GLGE 5J40A 4M1OA 2QGZA 3NBYC 3T1VA 3T1TA 1A1VA 1PV4A 2F9MA 3K09A 5F9HA 3KXKA 2QAJA 1G8PA 4RFVA 5FL7D 2DFLA 1Z28A 1RE0A 1Z07A 3BC1A 4XWKA 4P33A 2X77A 3K53A 1GM5A 2RB4A 4BZXA 5HTKA 3QENA 4Z8YA 1CBUA 2HXYA 3PG5A 1IXSB 1G291 2XB4A 4GP6A 2NO7A 4ON9A 4E07A 2C03A 1A5TA 5JMTA 2AN9A 3GJ6A 4LJAA 1X6VA 4HUTA 5C18A 1TQ2A 1XCGB 3WYAA 4BRWA 2WMNB 5FOUA 2C04A 5JWRA 1GSIA 1CRPA 3C14C 3WNCA 5F2EA 2VHQA 4Q1AA 4LJ7A 2D7DA 2OCBA 1W5SA 2QM8A 3WP1B 3TE6A 3ZDQA 1XMSA 1R2QA 4NDZA 4G5OA 2CLSA 4G5QA 1JB1A 1HURA 4HLUA 4TSFD 1T8TA 3KTAA 4IHQA 3RHFA 3HP1A 2KBEA 4W5JA 1OFIA 2H92A 4X8OA 2ZRFA 1KK1A 3R9IA 1JR3D 1YVDA 3WY9A 3H84A 2WTUA 2DWOA 1LF5A 2ZI7A 4A8JB 3ZD6A 4Q00A 4CEJA 2KI5A 2XAUA 3UPUA 1WBBA 2QBYA 3RRNA 3R20A 5FI0B 1HQYE 1T91A 3DM5A 2ZU6A 4RY2A 4C0JA 2VIIA 4IEEA 3O8CA 4QC2A 1IJFA 4TYWA 1N0UA 5KPDA 4PAQA 4PO9A 3NDBB 1E0AA 1TUIA 2FX3A 2QAGA 2VHUA 2VP9A 2F1JA 6Q21A 4RD4A 1LY1A 2CMKA 1X1SA 2YNMA 3VX4A 3HR7A 4MUBA 4BLTA 3SQWA 1P72A 3L43A 4F7WA 4WIAA 2RGXA 4PHGA 2XOKD 3VQTA 1G3UA 1G7RA 5ANRB 3IHWA 3CUEF 1AS2A 5EUQB 3BXZA 1R5NA 5EXTA 4M0LA 2ZJAA 2YJTD 3UATA 4PO8A 2YOHA 1SXJC 2A5JA 3TKLA 1M74A 1MKYA 2OV2A 2OBLA 5LPNA 1XEFA 1TUEA 2R6FA 3CW2A 4PPNA 1Z6TA 1ZD9A 5CJ2A 3V9PA 3EPKA 1CXZA 1CJTC 3KB2A 2QORA 1T3LA 3CRRA 4MYCA 4QJ5A 5KSPA 5L3RA 5JI3E 5BXQC 1FMLA 1W44A 5AUQA 2XTMA 3GJ5A 4UNQA 2DWQA 5J4LA 1H8HA 1CU1A 2ERYA 4EKDA 3AVQA 2BMDA 1FNNA 4JLNA 4RJLA 2BKEA 4I1SA 2OHFA 2VP0A 3PFIA 4Q4HA 1KO8A 1M2OB 4EQ6A 5GJVC 4Q01A 3HJNA 1Z0AA 3MUFA 2OXRA 2QSYA 2ZE5A 1JNYA 4OI1A 2ZI5A 3I5XA 1DAEA 4Z1MA 5C1BA 3B2EA 1S4QA 5J47A 1E2KA 2P2LA 3EX7C 2NGRA 3G0HA 1ZM4A 1H65A 1N6IA 1R10A 2YC2C 3W90A 4Q02A 4W5HA 5FTMA 3VU9B 4MGZR 4E22A 3H0KA 4PTLA 1XP8A 3FMIA 2ODEA 4B6EA 5AUPB 4NMMA 1OLOA 3FMPB 4A6PA 3QI2A 5DH9A 2PJRA 1FUUA 4MUAA 1NY5A 2F7SA 1NG9A 3C16C 1U98A 4B2IA 2P0EA 4HDCA 2DWPA 4DUGA 2W58A 2OCAA 2JLXA 1KOFA 1E9AA 3NC0C 5JWHA 3WRYC 3IEVA 1U0JA 3CRMA 3GFPA 4MKGA 3CWQA 5JLJA 1LTQA 2G3YA 4TMZA 4B2PA 3P1JA 3P4XA 2HLDA 4A36A 2Q9CA 5CYOA 3K0FA 5E7JA 4Z51A 2CLDX 4C0QC 4L8GA 3OE7A 4C30A 1OXXK 3K0CC 3GLGA 4JLVA 1XXHB 1DARA 3WYGA 2GXQA 3MWYW 1E2DA 4KFSA 4A1FA 5F98A 1TQDA 3M4YA 3MMPA 2O8CA 3KKNA 2HYIC 3BBPA 3AH8A 4PPGA 3WYFA 2OM2A 1VG9B 4D4MA 3ADKA 3CH4B 4N0EA 4NYMR 3TW8B 3W34A 1KDOA 3SFVA 2IK8A 4LJ6A 5BQ5A 3VAAA 3RSOA 2ZI9A 4EJSB 4LC1A 5KHOC 2B21A 3LQQA 4U00A 2WAYA 1ZMXA 4C0AC 1COWA 1U0HC 1KO4A 2AD5A 1NJFA 2ZS9A 4GFDA 2A7QA 3VNVA 5KU1A 4C7OA 1R8SA 2VQSA 2J0SA 2X8AA 1PUJA 2WWXA 2E9SA 2BVNA 5K8LA 2V6JA 3K0FB 2VYFA 1NMXA 1NN3A 1JPNA 3U7FB 1KYIA 4Q18A 3UMSA 1SVSA 1Q20A 2HCBA 5TMPA 2FDCA 2OFWA 4ZCMA 5FPKA 2A30A 2DR3A 2QTFA 3CH5A 1KZGB 5FBVB 4FWIB 4FMDB 4M1WA 1P6XA 2C5LA 2ZM5A 3PJRA 4Y0AA 1QRAA 2J0UA 4TL9A 4H9GA 4QBHA 4RSGA 1GL6A 2NPFA 3W8NA 2VA8A 4DLYA 4PC1A 2XJ4A 3RSLA 3SU8A 4OHYA 2MMGA 4TYYA 3KJIA 5FPYA 2J0VA 1EWQA 1LW7A 3AKYA 4JL6A 4GT1A 3A37A 4JIMA 1US8A 2VHTA 4ARZA 1XD8A 4KV9A 2WOJA 1XFAA 4KHZA 1OHHA 1XRJA 4KYUA 1E2PA 1Q1ZA 1ZM3A 1QHIA 4LDJA 4CYMA 4D80A 5AJVB 3C4JA 4HSEA 2IWRA 4B75A 1Y63A 5JCZA 3LW8A 1XMIA 1RRPA 1N6OA 1XWIA 4F38A 3WMEA 4DDTA 1WDTA 1E2FA 2G0NA 3TR0A 3FYHA 3JZMA 1DADA 3H4MA 2J9RA 1Z0KA 4FD2A 4KVGA 5DO9A 1G64A 4ZKEA 3W6OA 2W6IA 3AF0A 1Q44A 3QXSA 3U61B 3R8FA 2XTZA 3V00A 1ZU5A 3UMRA 4AC9A 3GEIA 1FW6A 1DEKA 2D06A 2PCJA 3OEHA 5KPJA 1G1MA 2BCJQ 3NEYA 2IYSA 2Z6VA 4Q9LA 3MLEA 1AKYA 3GJ7A 3IBGA 1OF1A 3KFXA 3EG5A 1HV8A 2ZVQX 3VMFA 1G20E 1NBMD 1NP6A 2X1VA 3GJ3A 2ZR0A 4FCTA 5JWOA 5JSZB 4MITA 1QHSA 4R2HA 4AKHA 4Q7KA 2ZREA 1TL7C 3PUVA 3IDQA 1VYUA 2FSGA 1VCIA 1KSJA 1XZQA 3OEED 2QP4A 1XTKA 2BV3A 5JRZA 2F1IA 1J90A 4V0KA 1GP2A 1G5TA 3AUYA 2CL7X 4DKXA 1UBEA 5IT5A 2A3RA 2I1QA 1YRAA 2L0XA 2KSQA 4KLZA 4R2IA 4IXNA 2GZAA 1P9WA 3B78A 2Q9BA 4XOIA 3K9GA 4NU0A 3U44B 3R9WA 1AK2A 3KB1A 4DRZA 1YR7A 4RFSB 1ZIPA 3SYNA 1KTVA 3LVQE 4URWR 2PX3A 4BLQA 2WAXA 5HPYB 4DVGA 3CRQA 4MYUA 2C96A 1A82A 2NO9A 4LHXA 3Q5EA 5FBWB 2IYLD 2YWGA 2ZETA 3U3RA 2R65A 4B44A 4R71A 2R6DA 2A9KA 4OL0A 4P31A 5SZIA 3U4QA 2WBLC 1K5DA 1ZNWA 2G0TA 3IILA 3GFTA 4QKQA 5DISB 3AVVA 1YU9A 1MRSA 1M7HA 3RC8A 5CM9C 2FFQA 1DAHA 1EG7A 2JATA 3CF6R 3BOSA 2D3WA 4OHWA 1BIFA 3I32A 1X86B 2ZRGA 4Q7JB 1U94A 3OEHD 3SNHA 3ZZTA 1DO2A 4GP7A 4UNSA 1P9NA 3C7KA 1D2NA 1ZUNB 1N3BA 2YYZA 2O8EB 1QHGA 2VHJA 1SULA 2VSFA 2GEVA 4D82A 3VR4A 4M9XA 4C7OB 1YZNA 3AVTA 3TW4A 2GJKA 3KXLA 3KFVA 3RVBA 3ADBA 4Q9JA 1UEIA 2VP5A 2VP4A 1XD2A 4BFZA 2CHVA 2X2FA 5KDDA 2C8VA 1WQ1R 4URZR 2WKRA 2ZE8A 1OT3A 2PZEA 3D8BA 2VHCA 3F5FA 3TVDA 4IJMA 3W8RA 2LKDA 1Z2AA 3OESA 4B43A 3S1AA 4LSGA 3TUIC 4LHVA 3TSOA 2ONKA 2VL7A 3FKSD 4ESVA 4QG7A 2IEZA 4JMPA 3W9YA 1RVDA 4K46A 2V6IA 4JYBA 2ZAOA 1SVWA 2NTYC 3BB1A 1UDXA 3T35A 3R7WB 4BWYA 2BDTA 4B2LA 1OHHD 5FOVA 1GOTA 2IUUA 4QBFA 2FE4A 1G8HA 3U2QA 4IDHA 4TLEA 3MRSA 1O3YA 1CEEA 1H8EA 5FPTA 1V43A 2CCGA 3U7EB 3QXXA 1OFHA 2O5VA 3LH5A 2O0JA 2GXUA 2VRWA 3Q9LA 1B23P 1L4YA 2PCLA 2ONJA 2ASEA 1UKEA 5H70A 5JJLA 4JZKA 5G3YA 3B13B 3RWMB 3D3QA 4UNPA 2YOFA 2QE7D 2MSDB 2R9VA 5G53C 221PA 3P20A 3QVUA 3QXCA 2A78A 2ZSBA 3OAAA 1XU4A 5AJYA 3RS2A 4F4JA 2GHIA 5CB8A 5DN6D 1ESMA 3AVWA 1XBTA 1S96A 2Q21A 1GAJA 3VX3A 2FG5A 4ESHA 1NN1A 5J4YA 2O8DA 3SQXA 2QA5A 4GL2A 2ORVA 2OBMA 3GFOA 1VCMA 4KFRA 3AEZA 4XWOA 4J0QA 2C98A 4FIDA 4LRWA 1A4RA 1T8UA 2H18A 2BC9A 4UNRA 3NC1C 4FI3C 2NMVA 1TEXA 4B3DA 2IS4A 4UQOA 3ZVNA 4ABYA 3GMTA 1J7KA 1SXJB 4NCKA 2Y8EA 3TJZA 2VF8A 1GZSA 4OQNA 4PSKA 4US1R 2DY1A 3X1YA 2WWFA 4B34A 4BFUA 4I81A 4GDFA 3AQ4A 4IDPA 2GK6A 4JLKA 2BCGY 4PZYA 3LBHA 2ZITA 4AKIA 3TVTA 3MD0A 4M53A 4X8MA 2FEMA 3VNUA 1JXMA 1UM8A 5CLLA 3LX8A 5LB2A 1ZC3A 4ZI2A 1Z22A 2KBFA 5K8IA 3K70D 1L4UA 4ZKDA 1DELA 3EPLA 5JRJA 2YC4C 2J7PD 1RRGA 1IBRA 1KI3A 2EFDB 2GRJA 3D7MA 3LW7A 5KO2A 2BMEA 4I4LA 3VKWA 2ZI3A 821PA 1G19A 1S8FA 1NBMA 2D2EA 1E79A 4TYPA 4QL3A 4B32A 1P2TA 4IOKA 4EPYA 3AGQA 4JVNA 3AP1A 4BFSA 1JPJA 2G1JA 4A9AA 1HH4A 1OH7A 2QY9A 1GRQA 5D3MB 5J4VA 5L3QA 3ZYCA 3QQ5A 2ZRAA 1AS3A 2GAOA 4KVAA 2WKQA 4GSYA 4LV8B 1ZAKA 4DDVA 2WPDD 2WJYA 1ZRHA 2WJIA 3ZIAA 3IQXA 4GOXA 5HR5A 4DHEA 1IXRC 3IQWA 4NYJR 1RRFA 1BO6A 2BKUA 2WWGA 1F2TA 2AHOA 5CIWA 4MYTA 1HEIA 2FJUA 5LB4A 1GWNA 1DVRA 2V1XA 4ZDJA 1L7VC 1K6MA 2H1LA 3PENA 4BEJA 2HEIA 2C9YA 4TTQA 4D6PA 4NH0A 4QJ4A 1TAGA 5DN6A 2GCOA 4YC7A 3LY5A 4Q66C 1EFRD 2FSFA 1XTSA 1ESNA 2BBSA 1R0WA 2RGGA 2UZ3A 3EXAA 3HWSA 4LYJA 1KSGA 1Z0DA 3RS5A 2B8TA 5IRCD 2P5SA 1M6NA 1VCOA 5AJZA 1I2DA 1D9ZA 3LXXA 2ZSEA 1W46A 4OHZA 3WNDA 3NIBA 2ZRDA 4UNNA 4TMTA 2G77B 1W36D 1UBFA 4LJ4A 1KDTA 4X8LA 3FGNA 2GCOB 3LA6A 3CM0A 4XVRA 1FZQA 5L8VA 2J7KA 4NL4H 3CNLA 4I1UA 2CE2X 4WBSA 1UFQA 1UPTA 1UF9A 4FW9A 4ITRC 5J4KA 1GILA 2EFEB 2IEYA 3MJHA 5KUTA 3GLIE 3RANA 3B9QA 1W4CA 1K5GA 1N2CE 3MWKA 5IDVA 4EAQA 5DE3A 2FA9A 4S2EA 4ASUA 2D62A 4POAA 2WHXA 2FZLA 1KK0A 1N5JA 1SVLA 3CX7A 4JLMA 2ODNA 4CW7A 4BEBA 2ZIAA 1S9DA 4YQFA 4M9SA 3KL4A 4YMSA 2CCJA 1AM4D 3MCAA 3A6PC 3SC3A 1BYUA 2NO1A 721PA 3KKMA 2IYWA 4IXMA 2WJVA 5DGXA 3K0AA 3GLFE 4AYXA 1IN4A 3C5CA 1F3OA 3SJBA 1U8YA 4CT5A 2ZS7A 4DCVA 2O8BB 2IXEA 1KJYA 1UBGA 1DBSA 1NI3A 1E0JA 1XJCA 2C9OA 4HZIA 4IFEA 4TMXA 1R8QA 1FUKA 3WRXC 1KKMA 1FQKA 4IDQA 1AGPA 2QPOA 1QHXA 2PBRA 1GNPA 1L2TA 2NOAA 4ERNA 4IVPA 2RMKA 2IA5A 3PCRB 4A15A 3G82C 4NPHA 4B47A 4OI4A 4TYQA 1CR1A 1PLJA 3KDSE 4V0MA 1QVRA 2ZR7A 1TADA 3S1AB 1NLFA 3K8YA 3K70C 2DBYA 2SHKA 4IW3B 4PSAA 1JI0A 3I3SR 4CRWB 3F3YA 4QGFA 3TUZC 2V8OA 2IF0A 2W2TA 3EZ9A 2GVZC 4UJ5A 5HE9A 4XSHA 3ZH9B 1KJZA 2V1UA 1D9XA 2GCNA 1AQUA 2QPTA 2G1KA 1QG4A 3WXMA 2QENA 4M2LA 3Q72A 4RKEA 4XTCS 4Q48A 4OQFA 1RC8A 2IXGA 3NBZC 1G4UR 2FFHA 3BFKA 1VHTA 1VTKA 4V0LA 1W0JA 1Q1BA 3NBFA 2FMXA 4P4UA 2MSCB 5FTJA 5GVSA 5DYIA 2G88A 3IIKA 1TPZA 1XPRA 5GJBA 1WF3A 3OIYA 3I4LA 4PPQA 4NBSA 3RS3A 1W4AA 1EFTA 2XNDD 3MAAC 1QF9A 2HF8A 2R2AA 5FBQB 2XZOA 1UBCA 1T3HA 2J41A 3EC2A 5LBIA 1WP9A 3CPHA 1E2MA 2OLJA 4MA4A 4N0DA 5JHHB 2PH1A 4PC3A 3SDZA 1E2GA 3UWOA 2Q6TA 1E9RA 5EXXA 3EZ6A 2PZFA 4KU4A 5JS8A 1NN0A 4PZLA 3K0EA 1XXHE 2N46A 3IIJA 3A1UA 1RJ9A 3C15C 2CXXA 3DMNA 3AV0B 4P32A 5KOYA 4TTRA 1YZGA 4EJSC 1ZM9A 2GBLA 1TQ4A 3L0OA 4XJXA 3SR0A 3DDCA 2FFAA 4BLPA 1NY6A 3X1DA 3HU1A 3TAHA 1FTSA 4TZ6A 3QKSA 4ZIRB 2FSHA 4PX9A 1T9HA 2FV8A 4QHYA 3D31A 3UKDA 3A8TA 4WZAE 2Q3MA 5LD2C 4G01B 3I62A 3WMGA 3KQKA 4L5BA 1Z6XA 4XWAA 4O3MA 3X1WA 2AL7A 3AVUA 4RFSA 3NKVA 2FU5C 4KFTA 3BIFA 3IO5A 1YR9A 2UVQA 3AF1A 5JBQA 1G3RA 2LKCA 3Q7QA 3CX6A 5HCIA 5TY0A 1MABA 4NYIR 2Q0HA 3KX2A 4A4DA 1LV7A 2J45A 2ZEJA 3NH9A 5DNYB 2GAAA 3KZ1E 3NWJA 5CB6A 4HZUA 5CDFE 1NF3A 3L8ZA 3VTKA 1ZYUA 4LHZA 1KI9A 4DEXA 1ZVQA 3FTQA 1DS6A 5KNBA 1DAGA 1UKVY 4ZV4A 2F1RA 1VG1A 2I4IA 1X1RA 1MV5A 2FF7A 4D0GA 4B3CA 4L16A 3BH7A 1X8KA 1E98A 2YV5A 3NXSA 4F91B 5GJCA 1EFRA 4JVSB 1E9FA 1OE0A 3NG1A 1GNRA 4HB0A 4MYHA 1XCMA 1NSTA 1Z5ZA 1NLYA 2ZYWX 4YDSA 3SHWA 2IS6A 1PZNA 1G16A 4XSGA 1NVXQ 2CE7A 5AUOB 2CK3D 2WIBA 4HDOB 4HAYA 2RH5A 3K0AB 4L15A 5ELXA 3RC3A 3GLFA 4HAZA 1CF4A 4Z54A 2FGJA 2ZRIA 1W1WA 1Q0UA 1SQ5A 4OK6A 4KODA 4S35A 2WZQA 4Q4AB 1N6PA 3ASZA 3FE2A 2H7VA 4LX0A 4EPXA 3PUZA 3HYTA 1XEXA 3QG1A 4IVQA 4NHOA 1E2IA 5DYGA 4MGYR 3ZJYA 3GPLA 4YXWD 1EESA 1P9RA 2W2VA 2N1BA 3FFBA 3FMOB 4ZDKA 1ZD8A 3IUYA 1KIMA 1Z29A 3E2IA 4UXJA 4MKFA 3U3MA 1KMHB 4HLDA 2ERXA 2R44A 3IIMA 3OIVA 3R7WA 3L0IB 1Z47A 2HCJB 1QBKC 1KO5A 4QM7A 5H1YA 2JCSA 4NCIA 1Z3IX 1VG8A 4YONB 2GJAA 4K81B 4DLXA 1U8AA 4DC9A 2CCKA 2CLCX 2GF9A 3LAWA 2ZJYA 5UKDA 2A5YB 2ODWA 3AVPA 2DHRA 3VR3A 3EARA 2OG2A 1ONBA 3B8HA 3G5UA 5IK2A 1YHNA 2J3EA 2W83A 5G40A 4FMBB 2EWWA 3SYLA 3ICEA 4WZBE 3KUDA 3RRZA 5KSOA 1KJWA 5AJXA 1YJ5A 2WJJA 1TF2A 2HLDD 4I1VA 3UMFA 3AM1A 3QEJA 1S3GA 4QGAA 1XF9A 1Z6AA 4ZCLA 4M9QA 1N0VC 2RGDA 5D3QA 4B35A 3A1VA 4BLRA 2IYUA 1R5BA 3PIRA 3TR5A 1R0ZA 5GADl 3ZZ0A 5LDDC 3BGWA 4B74A 1L8QA 2IYQA 1FX0A 3A1TA 3FHOA 4LC0A 2WOOA 3BH0A 3GJ4A 4AI6A 1JEDA 3K9HA 4OBEA 2FZ4A 3DKPA 3OIWA 1JR3E 2ZPTX 4WXRA 2XXAA 1E2JA 2CJWA 1OFUX 5E95A 4ZO4A 1KY3A 3EZ2A 3LXRA 1OXVA 1GKUB 3THYB 2XJ9A 4Q7MB 4XD7D 1SHZA 4DCTA 3CKLA 2BHRA 1OIXA 4FCVA 4EDHA 2C95A 3RRMA 2HT6A 1E4VA 5CITA 5HKKD 3TK1A 4CEJB 3EASA 1ZM2A 2C2HA 2QBYB 4OI0A 5TB5A 4NCNA 2F3RA 3PR1A 1Z0FA 4OKSA 4M1YA 1CJVC 4DLWA 5L3VA 3VHLB 2TMKA 1E1QA 1BH2A 1Z6GA 1KNXA 1T3SA 1II8B 4US0R 4XTRA 1BKDR 3FHTA 3BE4A 4KI0A 1EFHA 4TLBA 1Q21A 1WBDA 1SGWA 1XTQA 3AVOA 3V4RA 3M1IA 3CLVA 1N5KA 1P5ZB 1T6NA 2NPIA 1E32A 3RS0A 4QBIA 4F4CA 3AKCA 4DSNA 1WMSA 2EFCB 1XTJA 2WWYA 2R6GA 5KSZA 1WE2A 4Q47A 3UANA 4BRUA 3E1SA 3BB3A 3THXB 2GETA 2VSOA 4AG5A 3ZQJA 2Z83A 5TDHA 1E3MA 4PHTA 4WVFA 1MABB 2P6NA 5G41A 4G0NA 3FWYA 1P2SA 1XD9A 1DAFA 4HB3A 4RZ2A 3AVYA 1JQJC 4HZUB 3IGFA 3L0SA 5EXSA 3U44A 4KBGA 2QN6A 1IN7A 5F9FA 3HU3A 3H86A 2H5EA 3MSXA 3NBXX 1ELOA 1OKKA 1EFUA 4HAXA 2BEKA 1KI6A 2OBNA 3CZPA 2EFGA 1OH6A 3THWB 5CM8B 3RLFA 3CIOA 4JVLA 5BYJA 1SKQA 1IOZA 3CR8A 3A36A 1W47A 4P4TA 1CTQA 4CDGA 1F48A 4MDFA 4U02A 1R4AA 3AKEA 3K1JA 2JLQA 1T0JB 4JLOA 2CK3A 1RJ9B 1N6RA 2V9PA 4W7SA 4L9WA 1XJ0A 3B1WA 3RNLA 4AYWA 3AF4A 4CEIA 5BN5A 4PQRA 2EVWX 2E1RA 4LYHA 1JR6A 1ZUHA 1VCNA 2ZJZA 3V4FA 4YMVA 2W6JA 1Z0IA 3U3OA 4D81A 3W3ZB 1GVNB 4GBMA 2QM7A 3QVVA 1D2MA 2CL0X 2ZSFA 3GLHB 5JFGA 2CBZA 1W0JD 2ZJBA 1AN0A 2B6HA 2GNOA 2QTHA 2WWIA 4II7A 1P75A 4YXWA 1G3MA 2Z4RA 2KE5A 2ZTSA 3GEHA 4JS0A 4ZDWA 4L9SA 4RZXA 2VF7A 3I72A 5EP1A 3IPYA 1KO1A 2O52A 3L0PA 1KK3A 4CEIB 4NE2A 2WWHA 3VU9A 2D7CA 3EIQA 3QXJA 4QM6A 1IY0A 4B3FX 5GVRA 4MKHA 2OAQ1 4BFVA 2B7BA 1W5TA 3HDTA 3TIFA 3MG9A 3CRVA 2ZUCA 3U7GA 5EQTA 5B64A 1D5CA 2GBLC 3N2EA 5P21A 1QG2A 2ZRPA 4QNRA 3EA5A 1QVAA 3A1WA 3CBQA 2YKGA 1TNDA 1ZW6A 2EU8A 3GJXC 3WNBA 1LVGA 1TMKA 1VDZA 4MRRA 2AFHE 1US8B 3CNNA 2QT1A 4PAOA 3IBYA 4A2WA 2QZ4A 4V0NA 3BFVA 3HR8A 3QG5A 3B5JA 4TT3D 5B30A 4RD3A 1SXJD 3BJIC 4QRHA 2JA1A 4HB4A 1WCV1 4CIDA 2BMFA 2FEOA 1N6HA 2BM1A 2IYRA 3LDAA 3PITA 1T5IA 3UIEA 2AFIE 4M1TA 1RPZA 3KTAB 5KNCA 3PEVA 1KSHA 2P6UA 4D4JA 1FMJA 4ACAA 3E5HA 4IRUB 2QQEA 3K9LA 4KSBA 2JASA 1Z2CA 1FX0B 1IQPA 1EGAA 1NSFA 1AZSC 2ZJ5A 4P3YA 5JHGB 3KQHA 2BBWA 1NNEA 3TSZA 2QRZA 4D0LB 2P3SA 1JALA 2UKDA 1SVOA 1HTWA 1ZNZA 1E96A 2VH5R 1N6LA 4PPFA 4Q4AA 3SBDA 4W9MC 1W7AA 1G8GA 1ZC4A 3KJGA 4PQYA 3EIEA 4IFBA 1GTVA 3SZRA 5CLQA 1TTTA 2ZJ8A 5FOXA 5C46F 1Q1QA 3JVUA 4JSYA 4QHTA 5AWFC 1ODFA 3PVSA 5SZKB 2GWHA 4LK2A 4V0ME 1U9IC 2BOVA 2EFHB 3B9PA 4NCHA 2JJ1D 3U7HB 1KMHA 5DIFA 1TQ6A 2X19A 1HQCA 1QHYA 1E2NA 3OZXA 4NP6A 4XVQA 4PHHA 3AUXA 4RCZA 4EPTA 4ILEA 4GMXA 2G6BA 3KKQA 4Y0VA 1AA9A 2PLFA 1KAOA 4LBWA 4IOJA 4LWZA 5FL3A 4PO1A 4ASUD 3TAUA 3EPHA 1TF5A 1DPFA 2A2ZA 3OF5A 2XTNA 1OXSC 5H8WA 3N5CA 2NZ8A 3SE0A 5CK4A 4R9UC 1NG1A 3HPRA 3B85A 4JLDA 1E4YA 4RD1A 2GJSA 3AF3A 1J99A 4E03A 4EFNA 1KI8A 4WXPA 2OO7A 5FBRB 3DKVA 5IF9A 5F3WB 3I73A 3SJAA 4DEYA 3LQRA 1W49A 4HUQA 3SJCA 4DUGD 2I3BA 2ZUDA 5JI2E 4EQ6B 1DG1G 1TU3A 1Q12A 4H1UA 4DIEA 5JEDA 2F6RA 4BFTA 2XITA 2Z0MA 1J70A 3B60A 3THOA 5FPSA 1R0YA 1BOFA 1E9BA 1S1CA 4Q9IA 4V02A 2DPXA 5DHFA 3TNFA 3KQUA 4LV5B 1ZM7A 1V5WA 1NVVQ 5IK2D 4Q4LA 4QNMA 3IKJA 4FN5A 3TUJC 1KSFX 4DLTA 1G18A 4BLSA 3SI7A 3FPAA 5AJWA 2O8EA 4YMWA 2O8FA 4P4SB 1NMYA 2CDNA 3U3JA 4TMKA 1W48A 3LD9A 4OQLA 5FUYA 2KWIA 1KKLA 1JECA 2YHSA 1OKKD 1FFHA 1GG2A 3CR7A 4I1OA 3HYRA 3AB3A 2QSZA 2H16A 3QXHA 4Z8XA 5TARA 3AP3A 2QP9X 2JIZA 2JJ1A 1AS0A 1XZPA 1OYWA 1I4DD 1DO0A 1G7SA 1KDPA 3ND8A 4TL7A 5DI3A 1OB2A 3L8YA 2J0QA 3I92A 2YWFA 3GLGB 4A2PA 4O25A 2OCYC 2J7PA 1WXQA 4OI2A 1W4RA 1MRNA 4TN1A 3UWKA 2FGKA 1XDBA 3OEEA 2RGBA 4OK3A 2E87A 4G5GA 4QOSA 3QSYA 4CVNA 4B3BA 1S9HA 3DOEA 3FB4A 2WIAA 4UXHA 3KQNA 1KI6B 3OIUA 4LV6A 1E1QD 1U9IA 4V0OA 3PQCA 3THWA 2BM0A 2P6RA 3IPXA 4C0LA 3BFXA 4A0GA 2GXSA 2O0KA 2WSSA 5LD2B 3EZFA 1S0UA 1MH1A 1RW4A 2O0HA 1ZINA 3U60B 4Q1FA 3WBKA 1NVUQ 1NN5A 1OSNA 2PT7A 3A58B 2EYUA 2QMEA 4GMDA 5KNDA 4DLVA 3I8SA 4JLAA 2VP2A 4ZDIA 1E0SA 4BFXA 421PA 1TU4A 2LCFA 5EP4A 4XVUA 1MO4A 3P26A 2O8DB 4L4UA 4QXAA 1CS4C 2ZXUA 4DJTA 2IX3A 1T5LA 3O8BA 4CT4B 1XEWX 2OAP1 3WHKA 2QUZA 2PT5A 1SZPA 4HLQB 4JBWA 4IVRA 2RAPA 2XZLA 1E9DA 4AY2A 1YZQA 4B6FA 4JVMA 4NONA 4C0SA 2ZROA 2W0SA 5KDOA 2GXAA 4AG6A 3Q7PA 5EZ6B 1G3IA 2QEQA 4OQXA 3T5DA 4A6XA 3A4NA 5K8TA 1OFTA 1CR2A 4LJ8A 5FTNA 3C8UA 1CJKC 1G7CA 5EE9A 1LNZA 2AXNA 1VMAA 2EYQA 1MO5A 2R8RA 2R6AA 4OYHA 4XD7A 2QNRA 3OFNA 5AR1A 1XPUA 2FWRA 4LCBA 2REOA 3U5ZB 3PUWA 1SVMA 4KXFB 4LJYA 1OJLA 3SBEA 2QL6A 1NKSA 4D4KA 2UZIR 1E2EA 4URYR 1PJRA 3QOFA 1PVOA 3I61A 3SS8A 2V7QA 4ZI3A 1OB5A 1Z83A 3X1ZA 3WBJA 1N6NA 1RFLA 1LS6A 5FR1A 1BMFD 2FFBA 3MWJA 2FN4A 2NO0A 1FP7A 1NVVR 1YKSA 3LVRE 4RD6A 3N70A 3SYKA 4B3XA 1NIPA 1II0A 3Q8XB 4UKDA 1W0KA 4A2QA 1EFCA 2A5GA 1P60A 4BZQA 3ZGXA 1CRQA 2H8KA 2GJ8A 3QPVA 2WSSD 5CJPA 3VHXA 1FQJA 1EXMA 3WMFA 2HV8A 5JSZA 4Q9HA 3UXMA 2IYXA 3EZ7A 4G5RA 3VR1A 4Q03A 1ZBDA 4LUCA 4BE7B 1OH5A 1C9KA 4LGMA 3QIAA 3OHMA 4AK9A 2DYKA 1II8A 3T1QA 1EK0A 2ZVPX 3EWAA 4GZMA 2XB2A 1XNJA 1Z06A 1KGDA 4Q4HB 5GJWC 1ZNYA 1G21E 4OQMA 3T34A 1T4GA 3GP8A 4LYAA 2QP3A 3OAAD 4A8JA 2KB0A 4M1KA 2IBMA 1CULC 2FSIA 4M1SA 2PZGA 5EUMA 4HEJA 1JR3A 1Z8FA 3EA0A 2RGNC 3AVXA 5BN4A 1W4BA 3GCGA 1VG0B 3CF2A 1NIJA 1TX4B 5L3SA 4LJ9A 2QAGB 1CJUC 4DXAA 2P65A 2HUPA 1G7TA 2ZRHA 2P5TB 3U4QB 1XPOA 2V3CC 2ODBA 1KO7A 4DT1B 2F55A 1BS1A 4FINA 1GFIA 5FTLA 5HZHA 1PUIA 2W6ID 3DHWC 2J87A 2ZUBA 1HE8B 1E1RD 1G41A 2C77A 1OPXA 2OT3B 2WVJA 4PANA 3C5HA 5L3SB 2OXCA 2QTVB 1JJVA 1YZKA 4WW0A 2YWHA 3RS4A 3T1OA 4B76A 3VFDA 2WSMA 1UJ2A 2QGNA 2GF0A 4DT1A 1AZTA 1M7BA 1X8LA 3DPUA 1F2UA 1AJEA 2GEUA 3RWOA 1C4OA 1I2MA 2ZRNA 3MFYA 1OIVA 5B58C 1MR3F 5TV2A 5JCPA 2EW1A 3IHLA 3RDPA 2WJGA 2OFXA 4BQSA 2JIZD 5HKKA 1GUAA 2YOGA 3BS4A 4LBYA 3HPQA 4TL6A 1QHHB 3M0EA 1IXZA 1ZJ6A 4UJ3A 4FCWA 3W5JA 1D8TA 4TSFA 4M1MA 5E4FA 1RZ3A 4D4LA 3A4MA 1RKBA 3R8CA 5KYKA 5KTYA 1H8HD 2WM9B 3HU2A 3QKUA 2DCUA 2CVHA 3TQFA 5M04A 2JLWA 4DCUA 2GKSA 1E94E 1FL9A 2D2FA 3DL0A 5DLQC 5C4MA 4DB2A 3FOZA 4DLUA 4TYNA 2V54A 3CRW1 3GLFB 1E99A 3VKGA 1Q22A 1U0LA 4NYJQ 5CK5A 1ZCAA 2WPDA 3TH5A 3K09C 4PFSA 1CKEA 1TF7A 1HUQA 4PQFA 3LLUA 1G8YA 5EE0A 3BH6A 2QPAA 1A7JA 1G6HA 4QGGA 1GKYA 1DE0A 4LHWA 4C0HA 3EW9A 5FTKA 4A0RA 1QHNA 1CIPA 1JEEA 2IYZA 5EE3A 1II9A 2IYTA 3K70B 1WB9A 4P0TA 2OUKA 2HXSA 3GD7A 3SOPA 1BYIA 5DSZA 4KFUA 4IDNA 4HB2A 3GLIB 5HE8A 4D0NA 4EUNA 4ZPXA 5HCNA 4LPSA 4MGKR 4Q9KA 1XX6A 2G83A 5J5CA 1HYQA 2AK3A 2XNSA 3DOFA 5CDFA 3O8RA 4CEHA 1LF0A 2BWJA 4TTPA 4LYFA 5B57C 4HDQB 2NZJA 2ZJ2A 1ZIOA 3EAQA 4DBLC 1SKYE 2ZYTX 2WWWA 2GEDA 5CIQA 2ZI4A 2ZS8A 2JGNA 2OCPA 4DLRA 4AKGA 1G8FA 1P4SA 3DMDA 3ECCA 3AGPA 621PA 2DFTA 4MDEA 2PEZA 3QKRA 5AUNB 4LOAA 4NYMQ 3K9NA 4HAVA 1W2GA 4FMCB 2IC5A 3NVAA 2IWHA 3X1XA 4U7DA 1Z08A 5BYKA 1E9EA 2AKAB 2JLVA 1VPLA 4MH0R 3KJEA 4X8HA 1O87A 1GITA 4NZYA 4KLNA 4BASA 2IUTA 5FR2A 1GIAA 5KDLA 3TLXA 1KNQA 3THYA 4BZPA 4DLSA 1W2HA 3J81k 2VEDA 5FUXA 3SEAA 2CEAA 1JQLB 2JJ2A 1RRCA 1NVWQ 1R5OA 1A2KC 1G9XA 4WOPA 1J8MF 1N5LA 2VTKA 2REXB 4RCYA 3NEJA 1UEJA 1JXOA 3QUSA 5FFMA 4JT2A 4TT3A 4NYIQ 5JJKA 4RZ3A 3FMFA 3N2IA 2OSBA 1IY2A 2BBTA 1VYVA 2KJQA 1Z6YA 2EQBA 3ZLJA 4NKRA 3W6PA 1ETUA 1HT2E 1A2BA 3Q3JB 2XZPA 5EE5B 1U2RA 2B7CA 4Q5IA 2CNWD 1ANKA 4HUQB 2D74A 2J1LA 2C99A 1XMJA 2OESA 1R0XA 1P62B 2ZRLA 3VR6A 3K0SA 1G17A 3MJRA 4WAUA 3VR5A 3B1ZA 2RCNA 2ANBA 1E0KA 4DSOA 2Z5FA 4BFYA 2N42A 4G5SA 2ZSAA 2ZRKA 3L2OB 4K8OA 1RYFA 2MMCA 4M21A 5CYPA 2JLRA 4BFWA 1U81A 4N1AA 4TL8A 3AKDA 1MO3A 4URXR 4O0MA 1TEVA 5SZHB 2BIFA 2I1VB 2JJ8A 2PMKA 5EE1A 5J4HA 1IY1A 2GZDA 1X8JA 3PEWA 3GEEA 1KI2A 1CJMA 3BB4A 2QRNA 2XSZD 2RGNA 5EZ5A 4ZIRA 1QHHA 1OYYA 1WA5A 3A1SA 2OE2A 5L3QB 2GK7A 4OK5A 1YE8A 1VKJA 1YR8A 4TQAA 1FTNA 4TMVA 3BK7A 4FWTA 3P27A 3T61A 2R62A 4PAMA 3LLMA 8OHMA 1KHTA 4B48A 3CZQA 3CNOA 3CWZA 5DI3B 4A8JC 2XGJA 1KMQA 4AIIA 3UK6A 3ETLA 3QE0A 4IKEA 3ZVLA 3WP0A 2ZRBA 4JJKA 1M7GA 1XD2B 2V4ZA 1E79D 2JAQA 2X2EA 2ZYUX 3QY0A 3TSWA 1AKEA 4EPRA 5FUVA 5K8UA 5FOTA 4JLPA 4Q1BA 4LI0A 4Z1MD 1SHKA 1YRBA 1DOAA 3B7GA 5EP2A 3DEFA 2C78A 3ND9A 2YWEA 3GJ8A 1OV4A 1Q3TA 1C1YA 3LBNA 1PLKA 4JBXA 1XJQA 4G1UC 1IJEA 4PR0A 3GJ0A 3GLIA 3MWLA 4JBYA 3IEUA 4OHXA 2HT1A 2O8CB 3TGPA 2VSXA 4HI0E 1DAKA 2RGCA 1LB1B 4JL5A 3LBIA 1OXTA 3EWSA 3CPEA 4MRVA 1F2UB 3U3KA 1E69A 4DIDA 4EJSA 2J46A 4B3GA 1FOEB 4TLAA 1SVKA 1SVIA 1UKZA 1R7RA 2ZRMA 4QJ3A 4Q4JB 2RHDA 4HYYA 3I8XA 4JT4A 3T5GA 2CNWA 3I5YA 4JKIA 4M22A 3EIHA 5SZJA 4C2UA 4M4SA 3UG7A 2ORWA 1UAAA 2IYVA 2CJWB 3CB4A 4A82A 1P73A 2OILA 4BLOA 4BUJA 4DDWA 2IT1A 2JLYA 2FOLA 4Q1EA 1XEXB 1Z63A 1E1RA 2YVUA 4HATA 2IF2A 3AP2A 2XSZA 4EFMA 2LWIA 5FOSA 1VYTA 3U6BA 3AF2A 1HY3A 3B1XA 2P67A 2FPMA 2PL3A 1KDRA 2HYDA 1KZ7B 1XMVA 1JJ7A 3F0TA 2OLKA 2RGAA 3PEUA 1RYHA 4V03A 1RIFA 2Z4SA 2RHMA 3TQCA 2NO6A 1E2HA 1E9CA 2PX0A 2PJZA 2V55B 4RZUA 4OJKA 2WMOB 4Q19A 5BWMA 1IN6A 3DZDA 4FMCF 4MQBA 5E7IA 3RS7A 5FBLB 1W36B 5BN3A 1JAHA 3KKOA 2ATVA 1M1YE 4DWJA 4PSVA 4DDUA 3LO5A 2XX3A 4TMWA 1DAIA 5FUWA 4US2R 1J8YF 1ZNXA 1FPMA 1XB2A 2IUSA 4AURA 3KJHA 2JDID 3P32A 1UADA 3B6EA 2D4HA 3PUYA 4URUR 3PEYA 4DCNA 1JAIA 4CEHB 3E70C 4LY6A 3BRWD 1IM2A 4PC7A 4WZ6A 3SJZA 4D2IA 4N3NA 3LWNA 1GDDA 2NG1A 4F93B 5B2ZA 4A92A 2C9CA 4A0HA 5JS7A 4JL8A 2G9NA 4KJZA 2JLSA 4QBGB 1ZP6A 2F43A 3QPUA 1YZTA 2PMDA 5JZVA 1GRRA 2IS2A 4YDHB 2JJ2D 4GI7A 4NTZA 2H17A 3ZQ6A 4GZLA 3K0CA 2FNAA 4EFLA 1NRJB 4GOJA 3QKRB 2W6JD 4LHYA 5D3MA 3VR2A 2DB3A 4GRAA 2QE7A 3PV0A 1VHLA 5G3ZA 1P2VA 1VIYA 3LX5A 2AKYA 1GL9B 5FPHA 1Y3AA 2ZQ5A 2QAGC 3W3AA 4DCSA 1G5PA 1G5RA 5FI1B 1OH8A 2VLIA 1S1MA 4D26A 1UDWA 3B82A 3RYTC 3MGCA 3WHLA 3O8DA 2OFOA 1F5NA 1I4TD 4PHFA 4QGHA 2YZ2A 1Q3HA 5FL7A 3ZVMA 2EWVA 2QMUA 4LBZA 1E2QA 5E7MA 3CONA 2VPPA 1VECA 4XIGS 1CR4A 2WJHA 1SKYB 3KKPA 4MGIR 1AGRA 3PXGA 4YMTA 4FMDF 4CF7A 3U6KA 4CGZA 1E9SA 1M8PA 1YZUA 5HZKA 2Q3HA 3H2YA 2AK2A 4C3ZA 3T06B 4JLJA 3SN6A 3FDIA 2AR7A 2ZI6A 4HAWA 5EJEA 2V7QD 2FPLA 2HF9A 1Q1EA 4OJQA 1GL7A 5FOWA 3QF4B 1EX6A 4YLGA 3THXA 1MO6A 3BERA 2YINC 1DG3A 1BMFA 3GQBA 3JZAA 2NQ2C 1J2JA 3BORA 1KI4A 1Q57A 3SFZA 1W0KD 1EWRA 4KO8A 4DSTA 1B0UA 4DB4A 3RABA 4TQ9A 4C2TA 4KSCA 4QHSA 3PUXA 3ZVRA 3A4LA 2JEOA 4ZCIA 2IL1A 4NCJA 1N25A 5C4GB 4BPBA 5JECA 3CX8A 1R6BX 4CZ2A 2BBOA 4LZZA 3FKQA 2DFNA 1MOZA 4EPVA 1D6JA 3IO3A 4IOLA 1P7CA 2OEPA 1KK2A 4PC2A 4MKIA 3SHFA 2IXFA 2GESA 5BW8A 1FP6A 4C9BA 4LPKA 1KY2A 2ZE7A 2ZAMA 4QFMA 4HAUA 2IW3A 3DO6A 1XXHA 4E09A 2ZE6A 3GLHA 2BMJA 1E6CA 1F2TB 1XEWY 4H1VA 4F4IA 2BJWA 3ADDA 2O8BA 2F9LA 1T0HB 3ZD7A 1F6BA 4Q21A 2AWNA 2PLRA 1OXUA 1ZD1A 2CL6X 4M9ZA 4C0KA 4E5UA 1IN8A 3TMKA 4TLDA
chains in the Genus database with same CATH superfamily
2ETVA 3CO5A 3BIOA 3LKBA 1M34E 3L1UA 4Q05A 1DNPA 4Z3DA 3N39C 4B6GA 4JA2A 4XFJA 1AVTA 1HTTA 1VKZA 5K3CA 4HLUC 4UHKA 2Q3EA 3N74A 3REFA 4QPJC 1LFDB 1LS1A 2C7OA 3D0KA 3UAYA 2BEVA 3T38A 2QMHA 5CB4F 1T6XA 3UH0A 2CHGA 1ABBA 3L4JA 1Q14A 1X15A 2XEXA 3TBKA 3AYZB 3T0FA 1P2UA 3VR4D 4BHTA 1LDNA 1LVUA 2WNSA 3BCHA 2JDIA 4RV9A 4DSUA 5FNVA 4YRIA 3CU5A 4PXAA 1SXJE 3VYWA 1WHSB 4OHFA 3WLPA 3R9XA 2JGIA 4MRPA 5LDGA 1I4LD 4Y9RA 1HA3A 2O3SA 2VP6A 4M7RA 4UNIA 3DZ8A 4RKFA 3D7KA 3WGLA 1NZFA 1P61B 2PX6A 521PA 4EGCB 4XUGB 4YRAA 3UGJA 2R3SA 1JW9B 4Q1DA 1E4EB 4GOKA 3R3HA 3T12A 4Q7LA 4EUSA 4HADA 2A1TR 5IYZA 1H1DA 3DOUA 2UDPA 3AHGA 3CZ5A 1P3JA 5LBUA 3X2SA 1MOSA 1Z6QA 4AP6A 1CJSA 2FW1A 1F60A 4UXIA 2LR0A 2PRIA 3QWBA 4S1VA 4IZIA 3AXTA 1AXGA 4RY0A 1GGNA 4PNEA 3JQEA 4IHJA 4Q1CA 2C42A 4O2RA 2NVBA 5ALIA 4Q3BA 4AKEA 3WK7A 2EX4A 1CPYA 4ZEVA 1VE5A 5AW1A 4QEZA 3IDZA 4NQRA 3PYXA 2GB4A 1DRKA 2NYAA 1N9GB 5LFAA 1TCUA 1NJGA 2NUAA 4DAOA 1VLMA 2QD2A 1FSSA 1YS2X 4I50B 1TM4E 1YR6A 1JI3A 4RFLA 2N1MA 3PRJA 3OETA 2JH8A 1PWXA 1AT1A 1S3SA 3REGA 4K7JA 1MC1A 2HSDA 4H0NA 4IWYA 1D4ZA 1EJ0A 1GRNA 2JI7A 5JADA 4AWXA 1U0GA 4IF4A 2A5FA 4W5WA 1M5UA 4K86A 3GZNB 4JYCA 5DK4A 4F8EA 1T9BA 2FPKA 4K0KB 1DTSA 3QKSB 4FXOA 2HJVA 1L5GB 4TWZA 1N2CA 2ZANA 3WBBA 2ORIA 2Y1XA 3R3ZA 1Y4ZA 4FONA 4UHHA 1DC4A 4IIXA 4N5MA 1WPRA 2GN2A 3JQRA 3BKXA 1LRLA 4R98A 1GSOA 3DEYX 1I5OA 1INLA 1U8ZA 2IH2A 1HXHA 2C58A 2DHDA 3SF8B 2MSLA 3C5VA 3MERA 4IL5A 1NMZA 3G8AA 1ZJWA 2YVQA 4Y6LA 4U2KA 4TRRA 2QMYA 5BWCA 1QX4A 3KZKA 3LV8A 3D6TB 3MGAA 2BFFA 2AN3A 5EXEA 5BNWA 1R4MA 3LLCA 1MBZA 2PZ8A 4JJZA 5AXAA 4MVXA 4FXPA 4XPZA 3F1LA 1AKUA 1T0UA 4PZZA 4IRMA 5FA6A 2IP4A 1Y37A 3EF1A 4GPZA 5P8WA 3RC2A 2X3FA 2ILVA 1CR0A 1CJCA 3U39A 3VYSB 4ENPA 3LT5A 4OOFA 4Y2VA 4RV5A 3KO8A 4PW0A 3EGCA 4R1UA 4RJKA 5GZ6A 1XZJA 1A72A 4ZZ3A 3USES 121PA 1I2BA 3EVBA 3N2KA 2C7QA 1JHPA 3JXEA 4F8JA 1U90A 1R0BA 2W0MA 4LBVA 1GUZA 5IN4A 1TKAA 3O9VA 2F8SA 5I7EA 1OC2A 4P83A 2BE7A 2HFKA 5I7UA 4B5LA 4C14A 4A2CA 4MI6A 5ITZA 2CVPA 4AU1A 2B92A 2Y2UA 3VOBA 3NM5A 2YRFA 3EFBA 1E2LA 1PF7E 1QDEA 2JIQA 3BMXA 4IJQA 1W88A 4C3OB 2O8FB 1DC7A 1DXYA 1VPVA 2I99A 2P4QA 2YXBA 4XH9B 5AIAA 1AHNA 3GT7A 3HI4A 5I3ZA 2PKYX 4DLZA 3SLRA 2BFDB 2HJRA 2JAPA 2JW5A 1YQTA 1Z88A 5JCJA 3RRBA 3VPGA 2PRSA 4PLHA 5JEEA 1SCDA 3TYXA 1QZ3A 3RSGA 1R18A 3QE2A 3V8NA 1FFWA 1BCRA 2CVOA 3M1YA 1MJGM 1DAMA 2GZHA 4IPTA 4BWVA 3HCWA 3JX9A 5C2JB 1YTUA 3GJYA 2N75A 1GKIA 2BEJA 4F7WA 3AETB 1Y8CA 5F2KA 2JLZA 3P94A 1XG5A 2BE9A 2Q9AA 3I6IA 3GH1A 2E4AA 4U5XA 5DEIA 3OCVA 3EVTA 4L3WA 3ERCA 4CG2A 3AHFA 2B8WA 2QZJA 3M4JA 5TVKA 3ADCA 1VBFA 3E1KA 4DMUB 4YX9A 3FFAA 3W79A 4RQUA 4QFDA 3JASA 4BQQA 2L18A 1EWYA 1PYOA 3ORFA 1MZVA 2W22A 5EYPB 3RIYA 2B34A 4M1OA 2QGZA 4Z9AA 1A7KA 4MIOA 1Q16A 5KOJB 1D09A 5HFAA 3O95A 4K6GA 5CCEA 1RXUA 2G5TA 2P2YA 4OCZA 1G8PA 1JT2A 4YAUA 1JKIA 3U9TA 1VFNA 2HBQA 1RE0A 2Y1WA 1Z07A 1YQXA 3LU1A 1I94B 1ML4A 2X77A 2A5LA 1T2CA 3GC6A 5TIIA 5EQJB 5HTKA 5CW1A 4AZTA 1KERA 1R6XA 2B2XA 1V3QE 2H00A 2C92A 2FWBA 4R9SA 4TV8B 5BR4A 1YFJA 2C07A 2HXYA 2C5FA 5ECDA 1IXSB 4BU0A 4L74A 1G291 2XB4A 1SQSA 2XHEA 4WFKA 2Q5LA 3W2FA 3LLVA 4HTFB 1Q92A 3M5DA 5JMTA 2X7JA 1JYSA 4HUTA 2L19A 1TQ2A 1Z2EA 1YJXA 1CUXA 2WMNB 4JI0B 2XYVA 5JWRA 1GSIA 1PIWA 5AXCA 4ZEXA 1F8FA 5CVEA 1CRPA 5JZBA 1GO2A 1IATA 1ZFNA 1EEHA 2C97A 4LZAA 5ER6A 2RD2A 4JBGA 4LJ7A 1XR3A 2GK4A 3I09A 3KOUA 4LXTA 5CLGA 4AF7A 2PHZA 2XYRA 4KTVE 1NVBA 4MQ4A 4NDNE 2DC1A 3BEOA 4Y2HA 3TE6A 1R2QA 1RPNA 3NETA 5LNK6 1Z36A 4P7JA 3V4SA 1T6ZA 3SR3A 4ITVA 1ST3A 1ZWKA 2CLSA 2GF2A 2W43A 1JB1A 4G67A 3Q3EA 1KIAA 1N1GA 3R3YA 3AZPA 2ZRFA 5DCLA 1CS0B 3GN2A 4GD3Q 3X43A 1BHO1 4DBVO 1X1BA 3SVLA 2X2PA 3ZD8A 1RYZA 4LOIA 2ZI7A 3RQIA 4R6WA 3RAJA 4A8JB 4GR4A 5IT4A 2FHPA 4CEJA 2JFPA 4UE6A 3KQQA 4E5DA 3HQ4O 1TMOA 4JEMA 3GELA 3TLKA 3RRNA 4YLYA 2QBYA 5F76A 5IZCA 1XGKA 1P5RA 3IKVA 1MAHA 2Y6UA 2CFOA 3E3OA 1ITZA 1IJFA 2C2GA 2YHUA 1U9CA 1N0UA 3GUHA 4XGIA 4ZA2A 1T9ZA 3BRSA 4PAQA 1E0AA 1JSCA 1TUIA 2E1PA 3TLYA 1IFXA 2QAGA 2P2SA 5JCOA 2Z8ZA 4C5CA 2CMKA 1DJLA 1PWYE 4QDTA 2DVMA 2OK8A 3MJCA 1AKTA 2BHSA 2YNMA 3NP7A 4ZI7A 3A27A 3EZNA 3HJRA 3HR7A 1JKXA 1K75A 2SCUA 1TIKA 4H2DA 4UMVA 1UR5A 2E5LB 1BW9A 1J9EA 1X42A 1CETA 4OFZA 4DNPA 4BX8A 4EVQA 4WIAA 2RGXA 4FK8A 4Q16A 5EKTA 2Q1YA 4ZGBA 2V6BA 5BR8B 1HX7A 2Q4BA 1G7RA 2QK4A 1NVFA 3CUEF 1C4XA 3GRUA 1GTL1 2Y2VA 3MTGA 4CDMA 2IYFA 2VHXA 3AUJB 2WHPA 4NJEB 1SK8A 1Q11A 3NT4A 4Y3UA 5B7NA 4A91A 1XDDA 2OV2A 1NR5A 1S2GA 1L5QA 2PWPA 1PFKA 3MYYA 3OU7A 1ZGAA 3HZZA 1XEFA 1ZD4A 5IBPA 4YYEA 3ZCVA 5AD1A 2B1GA 1JVBA 2AOVA 4PPNA 1ZD9A 3L8FA 3A7DA 5COBA 3V9PA 1CJTC 4D02A 2QORA 4TKVB 3UMJA 4QJ5A 5EJ7A 3HE3A 2FEWB 2Z5LA 1NTRA 1T2AA 3N86A 3SZGA 1GRCA 1GNSA 1NW9B 1AZLA 3GJ5A 1H8HA 3TRJA 2XIQA 4EZBA 1JJFA 3EY4A 1SEVA 4FHDA 4JLNA 3ZXYA 5AVXA 2H7YA 6GPBA 1P1IA 1DAOA 1SFRA 1W94A 4C7BA 1DKMA 4RPCA 1BE8A 1TO6A 4N8EA 4EQ6A 1WLYA 1F2VA 4HXYA 5C37A 1IYZA 1IHDA 3W1WA 4YAKA 3PXEA 4C4YA 1EP1B 3LJKA 5AM0A 4JHLA 1P7YA 2B1JA 4EB0A 1PSZA 3B2EA 1S4QA 1E8DA 3T41A 3HB9A 3BDAA 3L0YA 3F73A 5BVGA 2NGRA 3G0HA 1KBOA 1UK6A 3A4TA 3R3XA 4QT4A 1T5SA 3HUFA 2PBFA 1USGA 1E61A 4MVYA 4Q02A 3PWZA 2H9YA 4D3XA 4KPUB 4WGFA 4BXOB 3C8HA 1K2WA 3KUUA 3TZQA 1M76A 1C0LA 4QOFA 5AUPB 3LX4A 2RBKA 2H2FA 3LT0A 3FMPB 1RYNA 2FSPA 3D8TA 5DH9A 4IY1A 1FUUA 4DY6A 1NY5A 1U5CA 3QYFA 4MICA 3BXEA 2AEJA 2J31A 1C7EA 5HOQA 1U98A 2PNFA 2WTMA 3GOQA 3PKIA 4JFRA 1Z5OA 3KQPA 3LPLA 4K9SA 4CV3A 1CEXA 2F62A 3ZU5A 4OU4A 2R1UA 1H2HA 2FUG1 2EXXA 2W58A 4FEEA 4NY1A 2C82A 5M5BA 1GUDA 3OZ7A 3PFKA 5JWHA 3WRYC 4DQLA 4FGKA 1U0JA 3O7MA 1J22A 3BQ9A 1W4ZA 4LIPD 1X39A 1N77A 2XUQA 3P4XA 4KO4S 5CYOA 1TJ5A 3C1AA 1GZDA 5DHQA 3PCXA 4Z51A 4NF2A 3Q3HA 4B6JA 1OXXK 2V6MA 3PIDA 4D3FA 2RHJA 2XOXA 4IGFA 4KFSA 5F98A 1QYVA 1MG5A 3IP7A 3KKNA 4G2TA 3BBPA 3COJA 1KMMA 1ULBA 3AH8A 2ZCJA 3WYFA 2Q62A 1PHRA 1PR9A 2WDPA 3CH4B 4N0EA 4D4MA 4CKZA 3IE2A 1T15A 3W34A 3ZLBA 1G63A 2FW9A 3PEWA 3NV7A 1Z4IA 4QTTB 3F90A 3RE1A 4LC1A 4BIIA 5IF3A 2BW0A 5DBOA 2CD7A 3R7LA 2BONA 4NJOA 2WAYA 4RSHA 1ZMXA 3VNQA 1V5IA 4YI3A 4C0AC 3CLRD 1U0HC 2C2WA 4IO0A 1NJFA 4GFDA 3VNVA 4EDFA 2PYDA 5HA5A 5TGDA 1SU4A 2J5KA 2VQSA 4TM7A 2X8AA 1PUJA 1RWMA 3I01A 2BVNA 5KNCH 2H65A 3R3UA 4HEHA 3K0FB 3VZQA 3MJEA 3OECA 4PU0A 1Z5WA 1BFDA 1NN3A 1TLFA 1FMFA 1M10A 3EVEA 4Q18A 1Z75A 1M1YB 3KUKA 1Q20A 4YT8A 1V2GA 5TMPA 2FDCA 3FI9A 2I7CA 3A6GA 2QTFA 2DR3A 5IBCA 2RJ3A 3IR7A 5FBVB 3KHUA 4FCCA 5JO0A 2ZM5A 4RGBA 4CLHA 4E12A 3LOUA 3KUXA 3SQMA 3NHUA 4Y0AA 2B7LA 1QRAA 3ZV5A 4AN4A 1DC5A 2ZP1A 3B6KA 3JARA 1FDOA 1VHQA 1A98A 1FRZA 1SCKA 3A2LA 2VUSA 3F8WA 4QBHA 3BX1A 4RSGA 2NPFA 1WMBA 3EJWA 5KVAA 3FZEA 2XXJA 4I46A 2XJ4A 3CTMA 3SU8A 3SF0A 4TYYA 2X58A 5DZSA 4KWCA 3HGMA 4ARZA 4JJ6A 2VHTA 4WKPA 1VSTA 4X6XA 5TS3A 2XQFA 2UAGA 3S44A 5E9JA 3ZW8A 4BC0A 4BNVA 1CUDA 1Z4MA 1OHHA 3IT2A 3ID6C 4KYUA 4Y2RA 5AVUA 4FGJA 1E2PA 4Y1FA 1Q1ZA 5DVZA 1CQPA 1V5EA 3GFSA 3OQHA 4MUEA 3OZRA 4S1PA 3H6GA 4ENSA 4S12A 4CYMA 6NULA 4OL9A 3DZGA 3GAFA 2I7DA 3D5TA 4S1WA 2OGZA 3FNIA 1XMIA 1RRPA 2PVPA 1XWIA 3CX3A 3IKMB 1JQAA 2IZ7A 3JZMA 5EWJB 3KCQA 3H4MA 2J9RA 1LEHA 1Z0KA 2WJPA 3E81A 4KVGA 5A6VA 1AK1A 3W6OA 2P79A 3CXUA 4QYMA 2QYOA 5KBYA 2V45A 1E2UA 2XTZA 3L7OA 1ZU5A 1I14A 1UXOA 1WNFA 4GPIB 4XLLA 3GEIA 3UMRA 1V96A 4C3VA 2PCJA 5KPJA 2IY8A 3MUEA 4OQZA 1M2VB 4CL8A 4AUEA 2H85A 4E94A 3JD1A 1RM4A 1PT6A 2O23A 4OQQA 2P7IA 5FUBA 1OF1A 3D3WB 3ZGOA 3U3ZA 1HV8A 1KJ8A 2Z95A 3VMFA 2O2XA 5BSWA 3PA8A 2QQ5A 4YJHB 1LX6A 3QFRA 5T57A 1V8PA 2HJHA 2ZR0A 3IAFA 5JWOA 4AXBA 4CTMA 1QHSA 3IOBA 1K5HA 2M6RA 4AWAA 3TINA 1X87A 3AWIA 1UFOA 1EH5A 1Y1PA 3QV1A 2OFFA 1VCIA 4IM7A 4UVHA 1HDYA 3SYRA 2Q7OE 2QP4A 1G42A 2VT7A 3ABIA 4BJHB 4ZFNA 3ICVA 4YJHA 4V0KA 5JOQA 1LLCA 5CR9A 4GXNA 3ZR4B 2JGFA 2HMAA 3NHMA 3GF4A 4FU0A 4KYVA 2A3RA 1UC4B 2I1QA 4K40A 1JHRA 4X41A 1YRAA 3BULA 2E3JA 4LZOA 3BMCA 4RHXA 4BP1A 4KLZA 5NLLA 4U2BA 2XKKA 3ESQA 1ZQ1A 4JODA 3TLEA 3RPEA 4AMVA 1L7PA 3B78A 3X1MA 3N1UA 2Z8YM 2WF7A 2R68A 1Z34A 2ECPA 4XOIA 3K9GA 1X7XB 4R4JA 3R9WA 5CP8A 4ZEWA 3G59A 3SIRA 1L8AA 1L5KA 2HWKA 4O4HA 2WJ6A 4RFSB 1ZIPA 1CUCA 3OZTA 4QXQA 4WA8A 3K1YA 1Y4SA 1KTVA 1SO8A 2I2AA 2YV3A 3DL4A 2J85A 2WAXA 1ZXBA 4DVGA 3IQHX 2XTJA 2E89A 1CUWA 2FUNB 3FCAA 4MYUA 3T3DA 5BUCA 1IVNA 2ZDQA 3D0OA 1RWPA 2YWBA 5E4YA 2R65A 3QWIA 1XVUA 3PFHA 4YCAA 1H4QA 1M9NA 3KAQA 3ZDRA 3RJTA 3P9RA 1DINA 3AERB 1KJQA 3NATA 5KEIA 4K9DA 2G0TA 4B3HA 3GFTA 3AVVA 3ANLA 2YXLA 4ZV9A 1YU9A 3OQIB 1MRSA 3D64A 3OIDA 3P2YA 1Y3IA 2BUAA 2FFQA 3EB9A 2BFNA 1DAHA 1F0KA 2J67A 3DP9A 3IUBA 3RIGA 4DIFA 5JXGA 3FCOA 3AHCA 2CLIB 1GA4A 1KP2A 2CLHB 2D3WA 3CF6R 3DV9A 3GRKA 4OHWA 2FPSA 4FT4A 1X86B 2PXXA 3GAAA 5BQ3A 1P18A 1RYMA 3PXXA 3OEHD 3NV9A 4KV7A 4UM9D 2QV7A 5ES4B 1G1AA 2B5VA 3B2NA 4GP7A 3WDMA 4R2LA 4XEHA 3RBVA 3O2SB 3MLAA 2HSGA 2FQQA 2DH6A 2PJDA 1SUAA 4M46A 4EYQA 1SUWA 2EZ4A 3GNQA 4LOLA 1SULA 4D82A 3VR4A 3INRA 2O2DA 3P0IA 4M9XA 2BGNA 5CX4A 4C7OB 3AVTA 3TW4A 1V48A 4RTPA 2PGJA 3KXLA 1FYFA 3BE6A 1XZBA 2WUFA 2HO4A 4Q9JA 4E2XA 5GMOA 1YRHA 1FP1D 1JT9A 2R5WA 2DFPA 1MIOA 2VP5A 1JHUA 1TYCA 3AY0A 3VPCA 4BFZA 1Z2DA 4BKOA 2C8VA 1Z73A 4URZR 5D3KA 4EYOA 2YDYA 4HGPA 1PJ4A 1OT3A 1SUBA 1ZK4A 2VHCA 1WDKA 3O9ZA 4IJMA 2LKDA 2YHAA 5C4IA 2YY5A 4LW8A 4TZTA 4NVRA 2ONKA 4NEGA 3TSOA 1RR6A 3AUUA 2IEZA 4JMPA 1RVDA 4D8UA 2V6IA 5HBRA 3IAXA 3WQRA 4ZAZA 5CT6A 3T35A 1VBNA 3R7WB 2CMDA 3NBKA 4MR8B 1TTQB 3RQSA 2W8BB 4QBFA 3I1JA 1XRNA 4BUZA 4UCQA 5KAMA 1J1IA 4TWBA 2GEBA 5HUQA 1CEEA 5M7EA 2KPOA 3E61A 1ZL2A 3EYAA 5DM4A 4G5YA 4PE5B 1C8LA 3FGZA 2P1ZA 4YK7A 2ISQA 9ATCA 1BHSA 4HDRA 1L4YA 2B82A 1JN0A 1MZPA 1SCAA 4MRMA 1AUOA 3VXKA 4UNPA 2MSDB 2PYIA 2R9VA 5G53C 2GZ3A 4GDFA 1GGEA 1MG0A 1QQ5A 5HIMA 2M9MA 3K8QA 3NPAA 4BKUA 1FUYB 3OO1A 5AJYA 3AJ9A 1N5MA 4F4JA 3I6BA 4JC0A 2LUOA 1BE1A 3W5DA 2X6QA 1XBTA 4RORA 5DX8A 5EAIA 4XQ0A 3NWBA 3VX3A 2FG5A 2ZCUA 3PT5A 2HA6A 3M2PA 3TTWA 4KFCA 2QA5A 3SQXA 2QG4A 5EPEA 2FP4B 4D3ZA 2OBMA 4D8WA 1QQAA 1VCMA 2QXUA 3AEZA 4KFRA 4TKMA 2R7NA 1XNRB 1QIMA 1BQ3A 4CU2A 2I54A 8AT1A 1A4RA 2MYTA 1Q17A 2NZYA 2H18A 3KLMX 4QODA 4YASA 4B09A 4C5AA 4UNRA 5IM4A 3K2QA 1TEXA 3C85A 2CEKA 2NNLD 2NMVA 4UQOA 4D8TA 1N8SA 4ABYA 5K8TA 3AWDA 5CTAA 1J7KA 1NE2A 2WABA 2Y8EA 3TJZA 5CD9A 1GUFA 4PSKA 1PR4A 2HQRA 2DY1A 3X1YA 1ORRA 3LYAA 5IAJA 1T29A 4I81A 5E4JA 3AQ4A 4IDPA 4RPGA 3DW3X 2GK6A 3C3XA 4R9NA 4BO2A 1VIMA 4ZANA 2HEGA 5JNUA 2BMWA 3LBHA 3TB4A 4AKIA 2PGLA 3TVTA 4WECA 3RROA 2EBWA 1ECPA 4KQKA 1V41E 1XDWA 3I64A 3L8GA 1L7QA 5IS2A 3SM9A 4JB2A 1B73A 3PNOA 1Y7PA 3AOGA 4L57A 3OLQA 5ALKA 1ZC3A 3QU2A 5BN4B 4EI9A 1Z22A 1LLDA 2KBFA 3CUTA 3OZFA 5DXJA 2PM8A 3AFIA 3K70D 4FNAA 1L4UA 3UA4A 4CF6A 1ULAA 4J07A 5JRJA 3VTAA 3ORRA 1NVTA 5K6AC 3CE9A 1RRGA 1KI3A 3BAZA 3D7MA 4MQUA 1TB4A 5C8DA 1EK5A 3DZIA 2KS6A 1QV7A 3LZDA 821PA 1G19A 3INYA 1HMYA 3PX3A 4WRRA 1I2CA 1ZR4A 1E79A 4GMHA 4MGEA 2QVGA 1VRVA 2VJDA 2UXBB 1C41A 4Y9SA 1QIIA 1WDMA 1M6YA 1P9LA 4K9KA 1HTBA 4BFSA 4PS0A 3AQIA 4NJMA 4UFOA 3TR6A 4DMMA 3RJ5A 2AN1A 2QY9A 4O5AA 5JE8A 4J16C 1QPGA 4UPVA 5L3QA 3N2LA 2H06A 1U2PA 3ND5A 4TVOA 3NNNA 2PQ2A 3ZVKA 4L0QA 2WW8A 4GSYA 1U2QA 1QIEA 2YVAA 4EY7A 3JALB 2XGSA 3C1TA 1RWKA 5KU7A 5AMXA 2WJYA 3ABRB 3A3OA 4MAMA 3RH0A 4F8YA 1U1IA 2WJIA 3U7RA 1ACMA 3BZWA 3ZIAA 3HO8A 3IQXA 3KQOA 2NNWB 4BV8A 1G5QA 4D57A 2C2MA 2D4AA 4E1VA 3IQWA 3OTGA 5JYDA 5LP6F 1UZNA 1B1CA 2WWGA 2AHOA 1KEEA 4FKMA 4G1MB 1X1AA 1GWNA 1DVRA 3WXBA 4W5NA 1L7VC 1K6MA 2J3DA 3PENA 3LHDA 4BEJA 4CI9A 2C9YA 4YRJA 3JD0A 3CRZA 3FYSA 1D8AA 2ZZNA 2LP4Y 1E66A 2BFAA 2QLNA 3LY5A 4Q66C 3UJ9A 4BNTA 3C6BA 3RFFA 1VPWA 3P9XA 4BKQA 4AS1A 1R0WA 1F17A 4MDYA 5IXJA 4QXOA 1LZKA 1F0NA 1JMVA 5IRCD 4N47A 3RJZA 2W4MA 3JV7A 3LUGA 3TNJA 2FMFA 5GOTA 3QWFA 1SKMA 2ECQA 2GLXA 2G77B 3EDRA 5CGQB 2V5VA 2BKXA 1AHHA 1UBFA 3OCWA 4LHEA 1OWPA 1GQ2A 2B35A 5JFOA 3AETA 3LA6A 4EJ0A 4XVRA 5L8VA 2A1TS 1KC3A 1MD9A 2W8ZA 3VO1A 1ZGHA 4FDAA 4ITRC 5J4KA 3MJHA 2V7PA 3RANA 4LRYA 1K5GA 1U0OC 3MWKA 3NO4A 2I03A 3N7TA 4M0FA 5DE3A 5IDVA 4DQUA 4EAQA 3R77A 3G2NA 4JYAB 1P8AA 3TRHA 1VSVA 3EW7A 2UYOA 2WHXA 2VQ3A 4AZ3B 1T24A 3KELA 3CX7A 1QFSA 4L4ZA 1Z5PA 3HJHA 3F49S 4JLMA 4G0OA 1LD3A 1EINA 5EWLA 4C7KA 1S9DA 4X90A 1AM4D 3MCAA 4FQ5A 1TK3A 4P35A 1QLJA 1XQVA 4ZXPA 1AZWA 3A6PC 5J2UA 4CQNA 3KKMA 4IXMA 4S1NA 3C39A 4J3NA 3PGMA 3RADC 1BN6A 5DGXA 1ZVJA 4JUAA 4NEHB 1IN4A 1YCFA 3MMSA 5GV8A 3L06A 3C5CA 1YKFA 4CT5A 1C7RA 3FG9A 1GYPA 3CUUA 4DCVA 2QN7A 1R3DA 3KR2A 4UMFA 2Y1LA 1UBGA 1DBSA 3QOWA 2FOIA 1WUIS 2AR9A 1ENOA 2XAAA 3ACDA 3IRVA 4HZIA 2G17A 4MR9A 1R8QA 5DNEA 1Q95A 2IHKA 5K3AA 3GZJA 4IDQA 4P08A 4WLFA 3UAXA 1DIBA 4H7HA 1MJHA 4GKJB 4UEWA 1ZZGA 4WKOA 2OHHA 3WK5A 3IP6A 2PS0A 2RMKA 4Q3NA 4NZZA 4F12A 4L6IA 1A96A 1ZG3A 3FDZA 3A4IA 3G82C 4NPHA 1Y8ZA 3HJAA 4Z99A 5DBFA 4ZEMA 2F4NA 3UK1A 5JCJD 4G0XA 5A0VA 3T1YB 3NORA 4KWEA 3DBLA 1EYZA 1GTMA 3PDUA 4PSAA 4CRWB 2AOTB 3W5HA 3TUZC 5JZOA 2YBDA 5DMXA 5G1OA 2CLKB 3HLTA 3FYUC 5D86A 3EZ9A 4UJ5A 1KJZA 3AUKA 2V1UA 2XE7A 4HEQA 1AQUA 2MSNA 4OX9Y 2QPTA 2G1KA 1M1NB 3FYUA 4N48A 3I45A 3Q12A 1RLUA 3Q72A 3ON5A 4M2LA 1LGYA 4MS1B 4OQFA 4QWMA 2CL5A 4RKEA 1W85B 3W0LB 1RC8A 1LSOA 1VHTA 4Z4CA 3SSNA 1N1DA 2ZBFA 3B8EA 5FNVF 5K3OA 1U0RA 2MSCB 1OXMA 2TSYB 3IIKA 5DJ5A 3PXBA 4F3TA 3GUZA 4PPQA 4NBSA 5EJ6A 5JBNA 2IU3A 5C1IA 2XUGA 3T1NA 1ADGA 3BMQB 1DEAA 3EC2A 3V42A 2W2OA 3CPHA 3ZNPA 5C5DA 2QRGA 2DGDA 2ST1A 2Z5GA 3CSDA 5LBTA 3SDZA 5JHHB 2W6CX 4NAVA 2YVKA 3LM8A 1HE2A 4P4NA 5EXXA 3SMQA 2I29A 4LYDA 1YB5A 2PZFA 1ENPA 4AMGA 1NN0A 2CUZA 2B4AA 4ATNA 3ZJUA 4RVGA 4YCNA 4NBKA 1XXHE 2N46A 2HW8A 4LMRA 2VTBB 4A5SA 2SBTA 3DMNA 2E4XA 1C0PA 2O4UX 3AV0B 3JYPA 4ISBA 4P32A 4QUAA 4Y1EA 4F4HA 3C6ZA 1I3LA 3WISA 1X1EA 2VNIA 4XXHA 2G04A 3L0OA 4OHUA 2EG9A 1B15A 1F8XA 3SKYA 3VZPA 6ADHA 4BLPA 3NJRA 4CHGA 5LU9A 1Z3CA 1NY6A 1NVDA 3SNKA 4DDMA 1GPLA 1CYEA 1M6WA 1CG6A 1A9OA 1LDEA 3HGQA 3TAHA 3CVUA 1RQLA 3C6KA 3QKSA 4OA5A 4ZIRB 5C8YB 2I91A 4MVJD 1T35A 2YUIA 4MHSA 4EFKA 4QHYA 3A8TA 2H7XA 2BFWA 4HTAA 4J4TA 2XCIA 2I78A 2IBSA 3KOOA 2C0CA 1U3DA 3NAQA 3UMYA 1T2NA 2O2EA 4J03A 4B4OA 4O5OA 1TM5E 2G4VA 2FCRA 2JAUA 2J3IA 3IAUA 4RFSA 4C1BA 4KFTA 3ME5A 1GGVA 3BIFA 5E2BA 3VNSA 3IO5A 2DULA 2D1RA 3CG4A 3IUMA 2ACWA 1YBMA 1Z39A 2XWPA 3AF1A 1ULUA 3BRWA 2XODA 1G3RA 1YB1A 3KV3O 3STXA 5TY0A 3U7IA 5T3UA 4ES6A 4FDMA 3QPBA 3FAZA 3WGNA 2Q0HA 3KX2A 2IPAB 2ZEJA 2VTVA 1C2YA 2F1KA 2GAAA 4O63O 3F6EX 5CM2Z 3WYNA 5CDFE 1NF3A 2OP0A 3ORSA 5ALOA 3AERA 4LWOA 5DW0A 3DS8A 4RUKA 2B8JA 4COKA 5K6AA 4C6RA 3ET4A 2R85A 2ZIGA 3UPDA 5KVCA 1DRWA 1G59A 4MUKA 1VP9A 2P75A 1DAGA 3ELWA 4XRRA 4ZV4A 3K0BA 1CUZA 3BK2A 3D6AA 2HCTA 3NHZA 1QOQB 2BHLA 1DBQA 2I7XA 4B3CA 4L4XA 3TI7A 1NOIA 3CEHA 9ABPA 2YV5A 3NXSA 4TXNA 5LMUB 1RZRA 4MUIA 5GJCA 4MUJA 1EFRA 4FYWA 4PZ9A 4F5WA 4JVSB 1GNRA 1NC1A 1DRJA 2C2KA 1NSTA 1Z5ZA 4GUAA 1YTLA 4KR9A 5EGNA 3IESA 1G16A 4XSGA 1USVA 3QYPA 3DAGA 1NVXQ 5T4FA 5AUOB 3G89A 2WIBA 2OGUA 4RSMA 4HDOB 2TYSB 4CMGA 1OGYA 3K0AB 1KETA 3DUFA 3OM0A 4NQZA 4HAZA 4KGDA 5DSXA 5A3VA 1Q0UA 4OK6A 1PNTA 3L4BC 4L6AA 3HYCA 1O6BA 2DTXA 2WZQA 1N6PA 3ASZA 2H7VA 1J0BA 1GTRA 1TKBA 5ALPA 1CR6A 4IVQA 5B58T 1X9GA 1GRVA 1LLQA 3FRHA 3Q9NA 4OX9B 4IV8A 4MGYR 4W1RA 3WRWA 1KPHA 1ZWLA 4ZZ1A 1ULSA 3GPLA 1BCSB 2HC9A 2N1BA 4KQ9A 4GOLD 3V4PB 4EG7A 3QE4A 1USIA 1ZD8A 2HMYB 2ZW9A 4EEKA 3EEFA 1SBIA 4HN2A 1ZLYA 3DWFA 4O1HA 1PG0A 4K6OA 1MRZA 2MIIA 1K7FB 2GSWA 2QTRA 4B4KA 4Y2YA 3U40A 3G2OA 5BPFA 1R0SA 1Y82A 1JR4A 1Y8RB 2R44A 3OBBA 4IHAA 4LYEA 3WL5A 4YQEA 2FX2A 4KE9A 4WFJA 2RCYA 3GEDA 1M1YA 4QDKA 4MA0A 4NBNA 4NCIA 1UM9B 2OCXA 3W6NA 1MDFA 1U8AA 3AI7A 1OREA 3L92A 4OSEA 1FYXA 2GF9A 3LAWA 4PG6A 5EJAA 1BDIA 4EY3A 4KEAA 2IEAA 4U3JA 3MTJA 1E4OA 1I4OA 5EN4A 3EARA 3PNLA 2ZSIA 4OLJA 1PGOA 1T8WA 2Y4NA 2Z30A 3GJSA 3TB6A 4CCAA 4NBVA 3SS9X 3G5UA 3TSAA 4Z0HO 4YP7A 3TZLA 3HV2A 3OQMA 3HLYA 4WZBE 3LQ2A 1BXRA 3RRZA 5AJXA 2ZBVA 4A10A 1X92A 2O1EA 1YJ5A 1UP4A 2WJJA 3PQFA 3PRKE 1SOMA 3AOEA 5FWDA 1J21A 3AM1A 1EU1A 3DXZA 1Y7TA 2OORA 3WC4A 3RAEC 4IFIA 4KB5A 1N0VC 5D3QA 2PT9A 2YUTA 2IYUA 1R5BA 3UKOA 5KJFA 3BGWA 4JYMA 4LC0A 1FX0A 1YL5A 4ZYYA 2PX4A 4BP8A 5AKJA 3GGPA 5TRTA 2XQVA 4OBEA 3DEHA 4RGYA 2PA0A 4DIBA 4TKVA 1R8JA 5FD8A 1JR3E 5JD6A 1TTPB 4XJVA 4NU6A 3BSSA 1H1TA 1MV8A 1CQZA 3R24A 5DTJA 3ROGA 3WA7A 1KY3A 4HDMA 2OC9A 3EZLA 1OXVA 3LXRA 3VYVA 4WBNB 2R8YA 2WINI 4KBYA 4P9NA 4KXYA 3UJ8A 4DIKA 4X3PA 3OD5A 1OIXA 2HA4A 5BSTA 2DR0A 2C95A 1WNTA 3KB6A 3MUOA 3KBOA 1DEOA 1E4VA 2YHBA 3MS4A 3RI3A 3D6FA 4KOEC 5D87A 4BY9E 4OXRA 3ZDEA 4GEGA 1QLHA 4N9QA 4ARIA 4OI0A 1Z18A 2PSFA 1Z0FA 4DLWA 4M1YA 1KJIA 1XAJA 5L3VA 1G2IA 1MO2A 2QV0A 3F7NA 3VHLB 2D1YA 1P6QA 4IG4A 1Z6GA 1Y81A 4GXRA 4XSVA 5FQOA 4DPLA 3QBJA 5C7LO 3GO4A 3ESDA 1L7EA 1J1UA 3PNQA 3O8LA 5JU6A 4TVKA 1BGVA 1Q21A 3M8KA 4GVLA 1XTQA 3AVOA 3F6PA 4W9NA 3TD6A 3CLVA 4CIWA 2DPGA 4RK6A 1D2RA 1T6NA 4HYTA 3P19A 2W2LA 3BN3A 3RS0A 2D5AA 4ARBA 4F4CA 4DSNA 2ZBEA 4EVIA 1PR0A 3CCCA 3GRPA 4Y18A 3RV3A 3ZBUA 3EBOA 3B53X 5FULA 3E1SA 3DKRA 5CUQA 2XB8A 2GETA 2ISSD 2VSOA 2WUGA 1LH0A 1FDTA 2GMWA 2Z83A 2BFBB 1VL1A 4RA9B 5ICEA 3FN4A 4IYRA 1QRDA 1MABB 1CZUA 2P6NA 1YB4A 1N7JA 1P7WA 1T0BA 1V26A 3FWYA 3WB1A 3M1AA 1E89A 3PDHA 1JQJC 2Q2VA 4HZUB 3L0SA 4KN9S 5EXSA 5F5XA 4EJMA 3I5AA 2QN6A 1IN7A 1HYEA 1QS0B 1L7RA 2Q0XA 1UC9A 3EHDA 2H5EA 3HKDB 3HU3A 4BTVA 1OKKA 3VYTB 1IPFA 4HAXA 5HKBA 5KQLA 5F2OA 3DVAB 3CZPA 1RTTA 3ZWMA 4BO5A 3EMKA 2DPLA 1ODLA 3C6XA 2OLEA 2BGRA 3PFCA 4RMHA 5LZ9A 1IOZA 5DT9A 3IUNA 5DNCA 4CDGA 5GQSA 3N8GA 5BW6B 2JLQA 2CGEA 3I9V1 3G1WA 4NABA 2C4KA 2F3SA 1ZA1A 3ZXUB 1E1CB 3PTLA 4B3IA 3B1WA 4MWBA 4AYWA 3NRJA 3NTVA 1TJNA 1MQSA 1JR6A 4PY2A 2ZJZA 4MQMA 4O1IA 1FVFA 2W6JA 3FNHA 4X54A 1TZCA 2P9YA 2O6LA 3A6DA 2AYXA 3K9QO 3ZX5A 1P77A 3VMMA 2WC1A 2D0OB 3GLHB 4DMFA 2ZJBA 1E7MA 4XJSA 2G71A 1WTAA 2WWIA 5EIEA 4JN6B 3ELYA 1V9LA 4HNGA 3GEHA 3PHCA 2JK1A 2Y99A 3IALA 4DLAA 2O52A 3L0PA 4CKXA 1HRKA 2D7CA 3NTLA 4YCCA 2VAWA 3EIQA 5BSHA 5CA1B 2Z2KA 2JZOA 1IY0A 5DHSA 4ZALA 4IIUA 2E5FA 2WFMA