1ZNWA

Crystal structure of unliganded form of mycobacterium tuberculosis guanylate kinase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
VGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
publication title Unique GMP-binding site in Mycobacterium tuberculosis guanosine monophosphate kinase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 60
structure length 182
sequence length 182
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1znwA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1znwA01
4ABYA 2ZRDA 4JJZA 1AZTA 2EFHB 1MO6A 3HYRA 4LBZA 1CBUA 2C95A 1ZM2A 3LBIA 4UNQA 1T6NA 3BORA 4BZQA 1R8SA 1IQPA 1GNPA 4Z1MA 4W9MC 4AK9A 4M1TA 4NONA 3GJ4A 3EIEA 5FOTA 2VP2A 5JS7A 4A0FA 4AC9A 5FTNA 3RS3A 5FBQB 4C0LA 4UXIA 5DI9A 3R7WB 1OIWA 3BGWA 5HTKA 4EFNA 3RYTC 4CGZA 5EE1A 1WRBA 3W6OA 2YC2C 1GDDA 3ADKA 3FYHA 4KSBA 3VR2A 5JLJA 2OLKA 5J4YA 2OZEA 3T5GA 1MABA 1SHKA 2FSFA 4XTRA 3ZZ0A 2ZAMA 2G1KA 4DIDA 1KO1A 2WWFA 1EESA 4BGDA 2DFKB 2EW1A 3Q3JB 3THOA 1U81A 4AY2A 4E03A 4Q01A 4RZ3A 1P9WA 3GLGB 2A30A 3IKJA 1A82A 4TZ6A 4QBIA 1G18A 4DDTA 1D5CA 2QG6A 4FMDF 1IAQA 4FWIB 4C2UA 1GNRA 2FE4A 1GITA 1NP6A 3S1AB 4LOAA 3THWA 3KB1A 4QOSA 4DLRA 3I61A 1S96A 2HF8A 2IEYA 2ORVA 3EIHA 3RS2A 3O8CA 2UZIR 4PAMA 4B44A 4NCHA 4BFZA 1YZQA 3CRQA 5E7JA 2JLYA 2JLZA 1AN0A 2R62A 4B6EA 1QHGA 2ZRCA 1T8TA 3WYFA 3U7EB 2IYVA 3BFVA 4GZMA 1UBFA 3BRWD 4QKQA 6Q21A 2AWNA 4AG5A 4IFBA 1XZQA 3AP2A 2BM0A 3HR7A 4I99A 4V0NA 821PA 5AJWA 4DHEA 1SULA 2F43A 1E9EA 3X1DA 1TADA 2ZXUA 1FX0A 5CLLA 4M9QA 1OH7A 1NVWQ 3ZIAD 5KDOA 3PXGA 5FR2A 3DO6A 3AUXA 3QXJA 4FMDB 3G0HA 3AKEA 3K9LA 3REGA 2H18A 1W36B 2IS2A 2A3RA 2FJUA 2VP4A 4MITA 4P4UA 5IT5A 5DH9A 4F91B 4B6FA 4BFYA 5J4HA 1QBKC 1Z63A 4ARZB 2W6JA 3M6AA 2YKGA 4RZUA 2EQBA 3AP3A 3QJYA 1KK1A 1KKLA 4II7A 1UEIA 2HXSA 2HYIC 3WRYC 1XF9A 1V5WA 2FPLA 3RWOA 5DI3B 3A4LA 3B6EA 2RKOA 4PC3A 4HAVA 2NGRA 4GL2A 3UXMA 4EJSA 1W5TA 3C14C 4AIIA 1J2JA 1NKTA 2BWJA 2PT7A 2C99A 1YRBA 2VF8A 4KV9A 4G5SA 3TKLA 4C0AC 1Q3HA 4P0TA 3CPJB 4DT1A 2Q3FA 5F2EA 5HCIA 5JEEA 4AYWA 4D0GA 1Y63A 5K8LA 1EFCA 2FA9A 5JWRA 4KYUA 2F1IA 1P4SA 1OFTA 2GJ8A 2ZROA 3SNHA 1F2UA 2J3EA 5EE9A 4QNRA 3CX7A 4JS0A 2FEOA 4N0DA 1KYIA 4RY2A 5JRZA 5FOSA 4JL6A 3GLFA 4Y0VA 4A6XA 5G41A 1LTQA 4ZCIA 4PQRA 4LRWA 2OCPA 1CS4C 1TF2A 2CCJA 4G5QA 5J40A 2ZM5A 2FSGA 2HT6A 2PX3A 2XJ4A 4MGKR 1G7RA 1XD9A 1H8EA 1ELOA 3MWYW 4EPXA 3NDPA 3GEIA 5FBLB 3CNNA 2XSZD 1AS3A 4OL0A 4DXAA 3WHKA 3OIVA 3TAHA 1N25A 3OIUA 1IN6A 3U2QA 2IEZA 3MMPA 3UMFA 3PCRB 4E09A 2RGEA 3C8UA 2GVDC 2PZGA 4NYMQ 4E22A 1UM8A 2G83A 4DB4A 1XJQA 2ONJA 4QJ5A 2HF9A 1TNDA 3T1QA 4A9AA 3LY5A 2IHYA 4BFUA 4CEHB 2NO1A 1XMVA 3R7WA 2XITA 1KSGA 3W3ZB 1YZUA 2GILA 1IXRC 3H86A 4B3BA 3I72A 2A5GA 4CEIB 1Q21A 2ORWA 3T06B 1VECA 5KDDA 2XB2A 2C98A 1CJTC 2XAUA 4S2EA 2G9NA 2WKQA 2ZRIA 2AD1A 1DAFA 3GLGA 2H57A 5JBQA 5EZ6B 4M1KA 2ZJBA 2YOHA 4RCYA 4HLUC 4E5UA 1KJZA 1C9KA 1R8QA 1XCGB 2Q6TA 4B3CA 2F55A 1NN0A 4G3XA 2F9MA 4KLZA 1G21E 2PEZA 3LBHA 4D82A 1AM4D 4LX0A 4D0LB 2ZR0A 3UWOA 3S1AA 221PA 1M8PA 2GTPA 4MDEA 4M21A 3NG1A 1MKYA 5J4VA 2H5EA 3RSLA 2AKYA 3UATA 4RD1A 2NPIA 3J81k 2R6CA 2ZRMA 4GOXA 4HB4A 3ZVRA 2IUSA 4OI2A 1G17A 3THXB 5GJBA 4HEJA 4CEJA 1RRFA 4ZDIA 3QXHA 4MRNA 3QSYA 2ZI6A 2ZANA 2IHBA 4FW9A 3U7FB 2H16A 3C5CA 2GBLA 3VR6A 3DEFA 4LSGA 4LZZA 3TK1A 1R7RA 3C16C 3LRPA 1P9NA 3TW8B 3AH8A 5AJXA 2IF0A 4Z54A 1Z5ZA 3LWNA 2XEXA 4B47A 4ZIRB 3FMPB 4TL6A 2YOGA 2PEYA 3H1TA 1E98A 4LPSA 1YZLA 1G19A 1BO6A 1KMQA 1E2IA 1CRPA 1I4DD 4PC1A 1KK3A 4PQFA 4D6PA 4C4PA 5GVSA 4ARZA 2H8KA 4ZI3A 3BJIC 3F3YA 4U02A 5F9HA 4WXRA 1PLLA 1EWRA 2WV9A 2JA1A 2IBMA 3TNFA 3BK7A 1VCNA 4QGGA 3CM0A 2I1VB 2CE7A 2QT0A 4DDWA 5A4JA 3K70B 3P4YA 1I2MA 2VA8A 3CR8A 2ZS7A 1R10A 4Q66C 1XTSA 1E1QA 1LF0A 4K46A 2MMCA 1GRNA 2JASA 2R65A 4TL8A 5DI3A 3AVPA 4M9XA 2GXAA 1DEKA 2C9YA 1OB5A 1V43A 3K8YA 1S3GA 2J45A 2JIZA 2C04A 3RHFA 5FTJA 1G3MA 3CR7A 4WXPA 2WSMA 3BD9A 2KWIA 2W6JD 2VSXA 4IW3B 4B73A 5KDLA 2QNRA 1F2TB 3M0EA 4HAUA 2WBLC 1KK2A 4NMMA 1Q57A 3T1VA 4M2LA 2PJRA 2ASEA 3EA5A 4NCIA 3SS8A 1MRSA 3SHWA 4HAXA 2H17A 4KFRA 1DO0A 4Q7MB 1MO4A 1IY2A 3W8RA 2QAGC 4HZIA 1E94E 4X8HA 3R9WA 3WRXC 3F8TA 3N5CA 3ZJYA 4HUQB 2WAXA 3I4LA 4NYIR 1XMIA 3QF7A 5L3VA 3LVQE 1M7BA 4JLBA 1T3HA 4URWR 2GETA 1SVKA 4FWTA 3UK6A 4C7OB 4O3MA 1II8B 1SVWA 3GLIB 521PA 2BCJQ 5AUQA 3AQ4A 4TYPA 1LY1A 3KKPA 2E9SA 1E2DA 1RIFA 2QMEA 2CHQA 4QRHA 1NSTA 2QPAA 2WICA 2X8AA 2ZVQX 4JYBA 1JB1A 2B92A 4CEHA 1W49A 4NDZA 4RVCA 2O8FB 1U9IA 1A7JA 3U6KA 1UBCA 1YJ5A 1R0ZA 1COWA 3FE2A 2GF0A 4KSCA 2O8BB 1VDZA 3GLHA 1H8ED 1WE2A 1XZPA 2WWGA 3L8YA 3MUFA 3HPRA 1OT3A 1HURA 2G6BA 2ZS9A 4BEBA 5AUOB 2AHOA 1FL9A 3B5JA 2Q0HA 3CPHA 5EXTA 1MO3A 1VPLA 2JCSA 1GRRA 1S3SA 5FOVA 4FN5A 5KNDA 2PCJA 2ODEA 4HSEA 4IVRA 1E9SA 4Q4JB 4YMSA 5JCPA 4US1R 1K5GA 3VHXA 2V55B 3F5FA 2V3CC 1SQ5A 3PUYA 4EPWA 3QOFA 3IQWA 2IYYA 4QG7A 2BBOA 1Q0UA 5FPTA 3FMFA 2XZPA 3LXRA 4HLCA 4RZ2A 1XPOA 4KO8A 1UADA 3WMFA 5CB8A 3L0OA 3V4FA 2D4HA 1NN3A 4RCZA 4TL7A 4B76A 1G3UA 4M1SA 1QVAA 1SZPA 3THXA 1TPZA 1EX7A 3SC3A 1ZCAA 3AF0A 1XRJA 2IYWA 1ETUA 1EG7A 2OSBA 4BLRA 3EPJA 2XZLA 2BDTA 3CONA 4OQLA 3NH9A 5CK4A 5JWHA 2W2TA 4DLVA 5EP4A 1XJCA 2FF7A 3LW8A 4PPQA 2TMKA 1DE0A 4Q02A 3EAQA 4HZUB 4C9BA 4ZIRA 1Z28A 1B23P 2QMHA 3FB4A 2C03A 4TMZA 5KPDA 5GJVC 4Q1CA 3T12A 4M1YA 5GJWC 3NWJA 4PO9A 1WQ1R 3SR0A 5FOXA 1RJ9B 1U94A 4W5JA 2X77A 2VHJA 3OE7A 4CIDA 3LA6A 4PANA 3A6PC 1IN8A 2FV8A 1E99A 1W47A 2RGGA 1E2KA 2C9OA 5JEDA 1E4YA 3K0EA 4YDHB 3VR5A 1N5KA 2GBLC 4V0MA 1QHYA 5HKKA 4D4JA 4MYHA 4LJ8A 1XJ0A 2D06A 1YQTA 2XTNA 4D26A 4D25A 4XIGS 2WJIA 2W58A 5EE0A 2OFOA 3K9GA 1M6NA 1G291 2JDIA 2WVJA 2N1BA 3AB3A 4ESVA 5L3SB 1NBMD 1OW3B 1G16A 1Z6YA 2ZU0C 4BLPA 5BN5A 2H7VA 5FPSA 4C0SA 1W36D 4Y0AA 2VL7A 5CIQA 1UKZA 5AUNB 2FOLA 2PH1A 4LJ6A 1W4CA 3MWLA 3U3MA 3W8NA 2HLDA 2ATVA 3EZ6A 1M2OB 1F2TA 3HDTA 3WYAA 3R9IA 4MKHA 2IS4A 3ASZA 1EXMA 5J4KA 2FSHA 1GG2A 4G5OA 5KSYA 2YJTD 2C96A 1E1QD 3ZYCA 2FZ4A 2ZRPA 1NBME 2ZI4A 3SZRA 4HUQA 4DZZA 2Z4RA 4P4TA 4PC6A 2RGBA 1P72A 3OHMA 3EPHA 3CX6A 4C7OA 3H84A 1OE0A 2ANCA 1E2HA 1II8A 2ZR9A 3CRMA 3GLIA 3AVXA 5C1BA 3RS0A 621PA 4TLCA 4ZKEA 1UBEA 1XD2A 4KHZA 4RFVA 1XEWY 1KI9A 5CIWA 4YDSA 4MYTA 5H70A 1UDWA 3T5DA 1TUEA 2FFBA 3I3SR 4I81A 3TSZA 1OH8A 3VKHA 2ZI7A 1N5JA 2KE5A 3CPEA 1P2TA 3QUSA 2O8FA 4LJAA 1UF9A 4Q9JA 3NKVA 5CB6A 4Q9IA 4HAZA 4JBWA 4IVPA 4M0LA 3PR1A 4OYHA 3RSOA 5FBVB 2KBEA 4GOJA 4OI1A 2O8BA 1JBKA 2RGNA 4FCVA 3NBYC 1O87A 4KBGA 2FFAA 4P32A 3TSWA 3U60B 1ZM3A 4FINA 4PAQA 3P27A 1Z0AA 1RPZA 2O52A 2WMOB 1Z07A 4TMKA 5JRJA 1OHHA 1ZM4A 4PPFA 3B85A 4HDQB 5C46F 3MWJA 3MSXA 4D80A 3Q5DA 2V8OA 3AF1A 1U0LA 4XOIA 4PZYA 1BIFA 4WZAE 1N6NA 2ZU6A 4Q4JA 3UANA 3WMGA 1Q12A 3C15C 4MUAA 3EPKA 4LJ7A 4BFSA 2HCJB 1UPTA 2O8DB 5K8IA 1P5ZB 4C30A 1G6HA 2DBYA 2OFWA 2A5DA 1FUKA 2BEKA 4YMTA 1JQJC 1L4YA 4QXAA 3KJHA 4ZO4A 1COWD 2AN9A 2OO7A 2VH5R 1LFDB 1XTJA 3RVBA 4IEIA 3RS5A 1N0WA 4FI3C 5G3YA 1T4GA 1XMJA 4Q1AA 3GJ6A 4Q48A 3ICQB 5EE3A 4Q7KA 3KKMA 1NIJA 3QBTA 2IS1A 3QNUA 2IYSA 3RS7A 1R0WA 4HZUA 4LYHA 2VYFA 5FTLA 3KQKA 3CRRA 1E9CA 2D7DA 1NMZA 3GJ3A 2R6AA 1MR3F 1RE0A 4OHZA 1AKYA 3U44B 4RJLA 3RLFA 1J8MF 3GLHE 3L82B 4M1WA 2HDNB 2FMXA 2BBSA 1G4UR 3VX4A 3FHOA 2R44A 4PAOA 3X1YA 3SYNA 1ESNA 2V9PA 2A9KA 1RJ9A 3LW7A 4L15A 1FP7A 2Q3HA 5G3ZA 3TW4A 5BN3A 2XXAB 4GMXA 2CLSA 4BLOA 3L2OB 4ZDJA 1HEIA 1QHIA 4CVNA 3TAUA 4AKEA 4UNSA 2FWRA 3PG5A 3KFXA 2Z5FA 1U8YA 4EQ6A 3N2EA 4JLOA 1EX6A 5FFMA 4JIMA 4HB3A 2BMEA 3ADDA 1D8TA 3OZXA 4DBLC 4OQMA 4WZBE 2BMDA 5DN6A 3FGNA 2IYTA 1M7HA 2QY9A 1SKQA 2REBA 2EYQA 5L3SA 1QHNA 2GZAA 1N0VC 1ZNWA 3A4NA 3ZD6A 5G40A 1TQ6A 1TU3A 1UKVY 4DVGA 1T3SA 4TSFA 2PJZA 3A1TA 3PUZA 4DUGD 1MV5A 2X19A 1E1RD 3OE7D 1NRJB 4LBYA 4NKRA 4ILEA 3TUIC 4A92A 3B9PA 2B8WA 3IO5A 4HLDA 1T3LA 4TLAA 2QTFA 3NBFA 4DIEA 5JMTA 2ZS8A 3K70D 1D9ZA 2WSSD 4LK2A 5HKKD 2WOOA 4I1VA 2DB3A 5LDDC 3EASA 1K5DA 2WJJA 1KSFX 1M74A 2VO1A 3GJ7A 4V03A 3QXSA 3T61A 2OUKA 1N6HA 3AP1A 2JDID 4M9SA 4A15A 5ANRB 1TQ4A 2ZYUX 4US0R 2BHRA 1W1WA 2G0TA 3BH7A 3CB4A 1E96A 1QG4A 2AR7A 1NY5A 3OF5A 4D4MA 3R8FA 2BJVA 1NLFA 1XP8A 1TQ2A 2C5LA 1NMXA 3SEAA 4V0ME 3BH6A 3IQXA 2CDNA 1OFHA 1XEWX 5FUXA 4A8JB 1WB9A 2GEVA 1KGDA 2JJ2D 2P6NA 3C5HA 3RC3A 2AK2A 4DCNA 1AA9A 3MGCA 3QPVA 4DLUA 3SU8A 4OHXA 1IJEA 1X86B 3UG6A 3QIAA 2QA5A 4LV5B 5IK2A 3DMNA 4A2QA 1NN1A 3MJRA 1E4VA 4QJ4A 3SBEA 1U99A 5HE8A 2F6RA 2QE7A 1E0KA 4URVR 1A4RA 4NYIQ 2WJYA 5G53C 4H1UA 4P3YA 3L8ZA 3QVVA 1CTQA 4DDVA 1KY3A 1RRPA 4FD2A 3ZQ6A 5JSZB 1DPFA 1M1YE 3BERA 4Q47A 4U5XA 4KJZA 2YC4C 5B58C 1HT2E 2J9RA 2O8DA 1IM2A 4QNMA 4E07A 3PEVA 5JJIA 1KOFA 1XEXB 4LYFA 2W0MA 5JI3E 2X2FA 5J4LA 3GJ8A 1G7TA 2UZ3A 2EFEB 2KI5A 2P6RA 1PVOA 1Z8FA 3FKQA 2RGNC 1KZ7B 3T1OA 1CJVC 2ZUDA 4NH0A 3PEWA 2BKUA 4DCTA 3GLIE 4EPVA 5CM8B 4CRWB 3RNLA 2FU5C 4JLDA 1XU4A 5IF9A 1OHHD 5EQTA 3HU2A 3CRVA 2CLDX 3LO5A 2GWHA 2D2FA 1RVDA 1YZGA 3B7GA 4QHYA 3FFBA 3E2IA 3AM1A 3IILA 1E2QA 4Q00A 1XB2A 3U4QB 1AJEA 3Q7PA 4L16A 1N0UA 1UDXA 4LHWA 4PC2A 1VG0B 3U44A 2QSYA 3E5HA 4H9GA 4BECA 4X8MA 2P0EA 2R6GA 4OI4A 2GRJA 3ZZTA 2OEPA 5LD2B 2XXAA 5EE5B 1YHNA 3B2EA 3K0CA 2J46A 2ZRBA 4TYQA 3X2SA 2YWGA 2W83A 2DR3A 3LX8A 3THYB 2Z0MA 4JLMA 2BCGY 2OCAA 4OJKA 4DDUA 2J0VA 4OI0A 3KZ1E 3GQBA 4JBYA 4AG6A 2JLUA 1W4RA 4DLSA 2NIPA 4LV6A 3T34A 4PO8A 2CK3D 4PXAA 2Q9CA 3M1IA 3X1WA 2XGJA 4ZPXA 1ZD9A 2EWVA 4PR0A 1WA5A 4KFSA 2BOVA 1OPXA 1A2KC 3KKNA 1CP2A 3RS4A 2ZRHA 4RD2A 1O3YA 3QBVA 1ZINA 4PPNA 5FUWA 2ZJ5A 5FUVA 2D7CA 4DLXA 1UAAA 3IIKA 5AWFC 1TTTA 1UJ2A 4LYJA 4JT4A 4A0HA 4B48A 3ZD7A 1CEEA 3CF0A 5CK5A 1ZUIA 3UMRA 2ZI3A 3ZVLA 1J70A 4G5GA 2QBYB 1D2EA 1PLKA 3CNOA 3TIFA 1KAOA 2CCKA 2HYDA 1RZ3A 2ZJZA 3D8BA 1F60A 1G8FA 2CHGA 3CH4B 2NPFA 3QXXA 2W00A 5DN6D 2P65A 4QM6A 3ZH9B 3TUJC 3SYKA 1XTQA 3LD9A 4TQ9A 2IT1A 1JECA 3VMFA 1JR3A 4BFXA 1ZC3A 2G1JA 2PL3A 1DADA 3U7HB 4JLNA 3KX2A 5M04A 1ZU4A 2ZRLA 3VU9B 3VNVA 1GL6A 5IRCD 1YKSA 4BLTA 1AK2A 3QEOA 3V4RA 2V4ZA 4RKFA 3RABA 2NO9A 3IGFA 4JVMA 3AVTA 3CRW1 3B1ZA 2PMDA 4A8JA 3VTKA 2QMUA 3NHBA 2XTZA 1J99A 3K1JA 1GKYA 4NPHA 4XVQA 1KAGA 4AKIA 4KXFB 5KSOA 4ACAA 4LGMA 1II9A 4GT1A 5P21A 4HB0A 2OG2A 5KHOC 4RD0A 2JLVA 1ZBDA 2ZEJA 1XXHB 4Q9KA 1KSJA 4C0QC 3TUZC 2OXRA 5GJCA 4Q21A 1Z6GA 4QC2A 5AR1A 2ZSBA 4BFWA 4B2PA 2QZ4A 4GP7A 5JHHB 1IONA 4MGIR 1LS6A 4O0MA 3CF2A 4Z1MD 2QORA 1OSNA 4Q4HB 4EDHA 3B1VA 2RGXA 2HEIA 2NZJA 1LVGA 1BMFA 4ZCLA 3KQUA 3CH5A 4QFMA 5DHFA 3VR1A 1W44A 1VG8A 2QQ0A 4MYUA 2VSOA 2VSFA 4KAXA 3ZQJA 1XEXA 4DCUA 5JWOA 1TL7C 3EZ2A 1TF5A 5EXSA 1KNQA 3D6TB 2GZHA 3KTAB 3PUXA 4PHFA 1AQUA 4DRZA 1FNMA 5IK2D 8OHMA 2PX0A 3WBJA 1KI1A 2XJ9A 1LNZA 2OV2A 3ZGXA 4QBHA 4EFLA 1T0JB 1P3JA 2N42A 4KVGA 1RYFA 1T9HA 4P4SB 3VHLB 3VR3A 4PHTA 3ZZUA 4DKXA 4B3FX 5KYKA 4XWOA 4KODA 1G6OA 2F7SA 3MG9A 1S8FA 2GJ9A 2AKAB 1G3QA 1JI0A 4NTZA 3KQLA 3U4QA 3JZAA 2JLSA 3KKQA 1WDTA 2J7PA 4UNPA 4PZZA 4UNRA 3P4XA 1QG2A 4URUR 2B6HA 4X8OA 5BN4A 5B64A 4JSYA 1ZVQA 1ONBA 4K8OA 1OXSC 2QI9C 1I4LD 1PUJA 1VTKA 4V0LA 4CDGA 3T15A 1E79A 4EKDA 3THYA 3A37A 3TJZA 1P61B 3AKCA 1EFRA 1N6KA 3D7MA 5JI2E 4BPBA 2DHRA 3I32A 4FCWA 5EXPA 1OF1A 2AXNA 4B35A 4WW0A 1KTVA 5EP1A 1E9BA 3WP0A 2ZJYA 2ZSAA 3KL4A 4BFTA 3BC1A 2ZQ5A 4LHZA 4IDPA 4JLVA 1N6IA 3BAFA 4LC1A 4KCGA 3AEZA 4A0GA 2ZVPX 1PLJA 4Q7JB 1Z2AA 3KXLA 2DYKA 1FTSA 1YE8A 2OM2A 1IN7A 4TMWA 2QP3A 1Q3TA 1DTSA 3K0CC 3O8DA 4YMWA 2CVFA 1TEVA 4G0NA 3TR5A 4Z51A 3FTQA 3W5JA 3E1SA 2IW3A 3HJNA 3EZFA 2DPXA 2GK6A 3UWKA 3WY9A 2QBYA 2HCBA 5FOUA 2OLJA 4MGZR 4DSOA 2VIIA 4KVAA 4EJSC 2JLXA 4C0KA 1T91A 4YQFA 4TMXA 3KXIA 4QHSA 1NG1A 2EFCB 1NI3A 1IY1A 1OH5A 4I1OA 3B8HA 4NCNA 1WBDA 3RRNA 4OHVA 5KSZA 4JYCA 1CLUA 1ZD1A 4IDNA 4RSGA 4GNKA 1NNEA 2Z4SA 3DKVA 3TBKA 4U7DA 4HUTA 4NYJQ 1N5IA 1KK0A 1X1SA 4DLTA 2EYUA 1U0HC 1F5NA 1G1MA 5E95A 1SGWA 1SKYE 1US8B 4AYXA 5AJVB 1ODFA 3K53A 5KNBA 1SXJB 1E9DA 1KO5A 4JLPA 5SZIA 2J41A 1KJYA 5DNYB 2BMJA 4PPGA 2R6FA 2ZSDA 1FTNA 2R8RA 3HPQA 1W4BA 1TUIA 1TAGA 1UKYA 2Q21A 4Z8YA 1DO2A 3QI2A 2CBZA 3BXZA 4PFSA 4CEIA 4Q4AB 2GJAA 2V7QA 3EWSA 4C0BA 4LJ9A 5EJEA 4JBXA 3UPUA 3NH6A 4IXNA 4ZV4A 4UJ5A 1GIAA 4UXHA 4RD4A 4TN1A 1JR3D 4EPYA 4W7SA 1UBGA 4WIAA 3GLFE 2XNDA 1TX4B 4EPRA 3MAAC 4Q4HA 4OJQA 2IUUA 3B1WA 4BQSA 3WXMA 2PBRA 3SJBA 3DM5A 3IPXA 1Z6TA 1GNQA 4A8JC 1RC8A 4BWYA 4LHYA 1E2JA 3B9QA 4PQYA 1YRAA 1ZAKA 2R2AA 3KTAA 5JS8A 4DCSA 4L4UA 1NL3A 1X8LA 4MRVA 3BFXA 5F98A 1OJLA 2CVHA 3R20A 4GOKA 1GL7A 2RGCA 3OEEA 4JLAA 1VG9B 2IYRA 4XVRA 3CWZA 3EW9A 3L0PA 1RKBA 3A1SA 4MH0R 4OQFA 4P4SA 1G3IA 4W5WA 5C4MA 3GFPA 1F3OA 3X1ZA 1S4QA 1JXMA 2GA8A 3QKRB 4OK6A 3SHFA 3W6NA 4JL8A 5DLQC 4F4IA 2BKEA 3P1JA 2CCGA 2QEQA 2P6UA 4RZXA 5JHGB 3HR8A 3BBPA 2W2XA 1JQLB 2D74A 2GCOB 1BMFD 3AF2A 4PO1A 2G88A 4TYYA 1AGRA 4Q1EA 3RAPR 2ZE8A 5JFGA 2NQ2C 4IHQA 1G5RA 1KI8A 3NVAA 5JCZA 3KJEA 1ZRHA 4N3NA 421PA 2FFQA 2NZ8A 2BJWA 3AVWA 2RGDA 3K0AB 2ZIAA 1R5NA 3OFNA 4DEXA 3ZVMA 3GLGE 1WXQA 2FN4A 2GZDA 5L8VA 3NBZC 4MKFA 1R0XA 1E6CA 1S0UA 2ZYWX 3JZMA 4HAYA 4RKEA 4I1UA 4M1OA 5H8WA 3A58B 3VKWA 2G3YA 1KI4A 2IUTA 1YZNA 3LVRE 1IY0A 4NCJA 2YWHA 4NZYA 1OYWA 1WMSA 2VTKA 1KIMA 2QM8A 3FHCB 1DOAA 3O47A 5E7IA 3QPUA 3N2IA 1VCMA 4TQUS 1XWIA 2LKCA 2ZI5A 3IBYA 4OBEA 3VFDA 4JVNA 1YR6A 5FBWB 1W36C 4ERNA 1Z06A 2J7PD 3CNLA 1R2QA 1YR9A 1JXOA 4ASUA 2PZEA 2ZYVX 4LHVA 5DYGA 1VKJA 2ZE5A 2GXSA 2FGJA 3RRYA 4KU4A 5LD2C 1OB2A 2REOA 1DAHA 1FNNA 1Z3IX 4PSKA 3CIOA 4O2RA 4PZLA 1QRAA 4R98A 2AFHE 1Z6AA 1E79D 1RRCA 1U98A 3WBKA 3W6PA 2NTYC 4LUCA 4US2R 2W2VA 3PEUA 1EFRD 3WYGA 2YOFA 2FZLA 4HDOB 3QG5A 1R5OA 2QROA 4PX9A 3GJ0A 1HY3A 4BZPA 1X8JA 3SFVA 4URYR 1VIAA 2O0HA 1OKKA 2A5FA 2JIZD 3U61B 4PTLA 3EWAA 1SVLA 2QTVB 4WBSA 3B1XA 3LLUA 1NF3A 2HJGA 3AGQA 3PV0A 4IKEA 3RC8A 4HLQB 2B21A 1DG3A 3FPAA 1MRNA 1HA3A 2GXQA 1Z0IA 2QN6A 4CYMA 2F3RA 1AIPA 5CLQA 2Z83A 3AF3A 3AVQA 4BUJA 3QE0A 1NIPA 1RRGA 2BM1A 2VEDA 4ON9A 4EQ6B 3NTUA 4GDFA 1KDPA 5L3QB 1JALA 2H1LA 1SXJA 3C4JA 2W6IA 1GWNA 3ADBA 1DARA 2QGNA 1S9DA 1XTRA 2UKDA 4V0OA 5KO2A 4J0QA 4M4SA 2JAQA 1CKEA 1G8HA 2HJVA 2WWXA 3CF6R 4QJ3A 1ZNYA 5LBIA 4XWAA 2WM9B 1KI6B 1W2GA 1ZM7A 4M8NE 4Q4AA 2IS6A 4QGAA 1QZXA 2WTUA 3Q9LA 2VHTA 1XCPA 2ZRJA 5BQ5A 2VHUA 4NL4H 3QKTA 2EFGA 4IDOA 3AVYA 1NY6A 1ZNZA 3AV0B 2GDJA 2YV5A 3DHWC 4FMBB 1KO8A 2REXB 2ZRKA 2FEMA 1W4AA 2F3TA 2RCNA 1KI7A 4Q9LA 4HYYA 3KJGA 2FFHA 1W7AA 3SDZA 5CYPA 1U9IC 3LXXA 3I8SA 3WMEA 2KBFA 1AZSC 1Q1BA 1DAMA 2FPKA 5JZVA 1ZP6A 5FTKA 5J5CA 1QHHB 2YINC 3AVVA 2VP6A 1D2NA 2F9LA 4Q5IA 2YZ2A 1X6VA 2P5TB 2HT1A 2A5JA 4B3GA 2V7QD 4DLYA 4I1SA 1KI3A 4ZDWA 4JMPA 1J7KA 5SZJA 4X8LA 4A4DA 1LW7A 4EFMA 2XTMA 2AK3A 1G8PA 4XSGA 1E2MA 3I5XA 4KLNA 1NJGA 4LWZA 3QKRA 2XNDD 1G20E 3EC1A 4QBFA 2XB4A 3CKLA 4TZ0A 1G7CA 1FQKA 1R6BX 2GESA 2RB4A 2GCOA 1N3BA 2ZUCA 3IIMA 3KJIA 3PIRA 4GP6A 3DOEA 2B7CA 3B60A 4Q4LA 3QKUA 2GCNA 3E70C 2ERXA 4AURA 1CJUC 3IBGA 2IYLD 1DAIA 2V1XA 3NXSA 2ZJ8A 1GILA 1HV8A 2GNOA 1YVDA 2VP5A 3DOFA 1OIVA 4B33A 3UMSA 2V1UA 3T35A 2F43B 3K0AA 1UKEA 2QL6A 5EP3A 3O8BA 4XSHA 1EK0A 4PC7A 4TTRA 2VBCA 3VX3A 1Q1EA 3GCGA 4A6PA 1KZGB 2RMKA 3KDSE 4M1MA 5FR1A 1GVNB 3K09A 2ZREA 1OXTA 3A36A 4C0HA 3W9YA 5FPYA 4GSYA 2ZR7A 4LBVA 3EA0A 3BWDD 4JKIA 4NCKA 2AL7A 4NYJR 4UNNA 1KO4A 2L0XA 4B3DA 1NLYA 4Z8XA 2YWFA 4IOMA 2BMFA 1T5IA 5KOYA 1TF7A 4DSTA 3U7GA 4QGFA 1E2PA 4EAQA 4AWXA 2ZJAA 1ZUNB 3G5UA 2QAGB 5E7MA 2I4IA 3N70A 4OHYA 2GAOA 5GADl 3BIFA 4JT2A 4Q1FA 3IEUA 1H8HA 2WWHA 3QF4B 4ZCMA 3K70C 3QQ5A 2J87A 1YU9A 5L3RA 2FPMA 3RANA 3AKDA 1DVRA 1F48A 2OCYC 4MRPA 2AD5A 1Z0FA 2GAAA 4JVLA 2JGNA 3TGPA 1E0SA 1F2UB 2JLRA 2O0JA 2RH5A 5JJKA 1JR6A 2BBWA 721PA 1IN5A 2PT5A 3DZ8A 1KJWA 1XFAA 1WBBA 1E9FA 3K9NA 4NU0A 2H92A 4JLJA 4A2WA 3BOSA 4FMCF 1G3RA 1VHLA 4A82A 4ASUD 2ORIA 3BE4A 4IEEA 2HLDD 3IHWA 1PZNA 3ASYA 3W34A 3T1TA 4WAUA 1HQYE 4BLSA 3R8CA 1FMJA 1RFLA 2XZOA 1LB1B 5L3QA 5B57C 4NE2A 4XTCS 3L0IB 1ZW6A 5HE9A 5LB4A 3H0KA 1FFHA 2B8TA 4WA7A 3NHAA 3OAAA 3OIWA 2KSQA 3U3JA 2ZJ2A 3CZPA 4V02A 2IYZA 4S35A 5EXXA 5C4GB 1ZCBA 4HLUA 3L43A 1KI6A 3RWMB 2QUZA 1JNYA 3PUVA 2PZFA 5EUQB 2ZRNA 4GMDA 1OKKD 2ZSFA 1A2BA 1RW4A 5B2ZA 1EFTA 3P32A 5BW8A 4DSNA 4F92B 1GTVA 2CMKA 1CXZA 1XNJA 5GVRA 1FMLA 3BB3A 4FMCB 4JL5A 4DWJA 2ERYA 4LJYA 2QPOA 2Z6VA 5AJZA 1GUAA 1U8AA 3GJ5A 5HPYB 3X1XA 4CZ2A 4IOKA 3BH0A 1Q1ZA 2VHQA 5H1YA 1GOTA 3BS4A 1SXJC 3IO3A 5DISB 1SXJD 5FTMA 2W6ID 2OHFA 1QHHA 4RFSB 3K0SA 1PJRA 2WPDA 5AJYA 1GKUB 4ACBA 3PUWA 1GFIA 1BKDR 4MRRA 1Z6XA 2ZYTX 3NC1C 4TLBA 4R2IA 3VNUA 4IDHA 1QDEA 4DCVA 2WIAA 3ND9A 1N5LA 3MLEA 4YC7A 3P26A 1ZC4A 4TWZA 5D3MB 5SZHB 1BS1A 2R9VA 5FBRB 1P60A 2OE2A 3LAWA 1MOZA 4MRSA 5FPKA 1SXJE 3A8TA 3B82A 4OHWA 4TQAA 3WP1B 1P2SA 1M7GA 2D62A 2OFXA 3SJCA 4ITRC 2E1RA 5KPJA 2O0KA 4DJTA 4CEJB 3LQQA 3MCAA 2FDCA 3AVOA 1HE1C 1I4TD 1ZMXA 1CU1A 1D9XA 5BXQC 4DSUA 2KB0A 1QVRA 2IF2A 3AUYA 3TVDA 5HCNA 5CJPA 2D3WA 2VQSA 5EP2A 121PA 2QU8A 1OFIA 4Q03A 4XD7A 1HH4A 5F9FA 1J90A 1H65A 2AFIE 3SE0A 3KFVA 1NVUQ 5K8UA 3EARA 4D81A 1YZKA 1KY2A 3MJHA 1T5LA 3HU1A 2WMNB 5EUMA 2JLWA 1C4OA 4UKDA 5BWMA 1G9XA 1CULC 2YNMA 1D6JA 2WAYA 3SN6A 1E2LA 2NO0A 2JEOA 2VLIA 3KKOA 4L9SA 1SVIA 1Z29A 2EU8A 2IK8A 2GCPA 1BH2A 2OILA 3CZQA 1R0YA 1ZYUA 2JATA 2WKRA 5D3QA 1OH6A 4C3ZA 2EVWX 4D4KA 1YR8A 3A4MA 2ZITA 4B34A 2C77A 3EZ9A 2ODWA 1NVXQ 3CX8A 1OXUA 2QAGA 1QHSA 1P2UA 3EIQA 3ZS9A 5AUPB 3QF4A 4PSVA 2X1VA 2MMGA 2BIFA 2MSDB 5IDVA 3K09C 2WHXA 2X2EA 3LLMA 2XX3A 2Z43A 5DSZA 3UKDA 2F1RA 3ONWA 5A5GA 4L9WA 2IXGA 2QQEA 1TU4A 5TMPA 4I4LA 3KUCA 4YXWA 2ZPTX 4C2TA 2N46A 1ZNXA 2NG1A 4BE7B 1E2FA 1TQDA 2LWIA 2ZRGA 2QENA 4LJ4A 1W5SA 4TSFD 3ZVNA 3VAAA 2XOKA 2OAP1 2K5UA 2YYZA 3FMOB 3NIBA 4AKGA 1EGAA 1KDTA 5FI1B 1H8HD 1OYYA 1NLZA 3DMDA 3JVUA 1NVVQ 3TMKA 2NO7A 2CE2X 2QM7A 2JJ1A 2ZAOA 1X8KA 4QGHA 5CYOA 2Q9BA 3RDPA 4NHOA 2QSZA 3TQFA 4ZKDA 1X1RA 4URXR 5F3WB 1OXXK 1DAEA 4MDFA 2F1JA 3V9PA 1NSFA 1W0KA 5KSPA 2FH5B 3IDQA 5DYIA 4F93B 3ADCA 4HDCA 4YMVA 3HU3A 4KI0A 3QVUA 3IHLA 4TL9A 2DY1A 3MWKA 3Q72A 3G82C 3D3QA 3B1YA 5TB5A 4XJXA 3GP8A 4Q9HA 1NKSA 2BV3A 5E3HA 1GSIA 4UQOA 4F4CA 3KQHA 3GLHB 1EWQA 4BRUA 5JSZA 4DC9A 3W5IA 1JJ7A 3DL0A 1VHTA 5EZ5A 1KNXA 1OV4A 2OBMA 2IYQA 1VYVA 5CM9C 2P3SA 4TMVA 2PCLA 4RFSA 4DB2A 1QF9A 1CJKC 3OAAD 4HI0E 1J8YF 1GRQA 1KDRA 1DAKA 2ZRFA 4AD8A 2EWWA 4GFDA 3KQNA 2W0SA 1Z2CA 2A78A 2ODBA 2B7BA 3PQCA 4BEJA 1W46A 2GEUA 1SVSA 1GL9B 1IBRA 4LHXA 2Q9AA 4TT3A 1CR2A 2RHMA 1IXSB 2CL6X 2ZJOA 3UIEA 3V00A 3AVUA 4OQXA 2O8CB 4Q1BA 1MT0A 2QE7D 3WHLA 5D3MA 4NP6A 2IWHA 3TVTA 2QRNA 3BB1A 3CWQA 2ZE6A 3O8RA 3CLVA 3OEHA 2J1LA 4FIDA 2E87A 3EPLA 2OESA 4QL3A 4RD6A 1ZJ6A 2C78A 1MH1A 1HYQA 4H1VA 5TARA 5DHAA 1GP2A 2WPDD 2ECKA 3RRMA 2DFTA 5BYKA 3H2YA 4K81B 4LI0A 2GXUA 4MKIA 1G7SA 3F0TA 2C2HA 2MSCB 3NBXX 1U0JA 4GRAA 1BOFA 4KFTA 1ZM9A 2DCUA 2VHCA 4OQNA 3ECCA 4LBWA 1FQJA 1NBMA 4AYTA 1Z0KA 5B30A 1N2CE 4GPTA 2F1HA 3HYTA 3M4YA 1E32A 3FMIA 2IA5A 4RD3A 4Q7LA 4U00A 1IXZA 2IYUA 4A1FA 3PENA 4NBSA 3A1WA 4JSTA 5FI0B 4B71A 1G4AE 4TTPA 3SOPA 3PITA 1JEEA 1R4AA 3SQXA 1ZIOA 3PVSA 2P2LA 1NG9A 4PHGA 3FOZA 2FNAA 2Q3MA 1GAJA 4LV8B 3A1UA 4XD7D 1GZSA 1X3SA 3UG7A 3PFIA 4O25A 2ZUBA 4UJ3A 2CXXA 1CIPA 1DS6A 1E69A 3FKSA 5TDHA 3GFTA 2A2ZA 1VYTA 2IXEA 1OFUX 2CLCX 2MSEB 3QKSB 5FL3A 1NN5A 2J5XA 4N1AA 3SJAA 1LV7A 1CRQA 2J0UB 2R6DA 1E3MA 5LB2A 1VMAA 3DPUA 3C41J 3WNCA 2NO6A 1L2TA 1W48A 1Y3AA 2ZETA 3JVVA 4QM7A 1AS0A 4XH9B 1Z83A 3GPLA 2DFNA 1QHXA 1VG1A 1OIXA 3SBDA 2O8EB 4EPTA 2WOJA 3VU9A 2VF7A 3VKGA 4B75A 5JECA 4EIWA 1XPRA 3OESA 5FL7A 4BZXA 1FOEB 3Q8XB 3NC0C 2GHIA 2YVUA 4L8GA 1XX6A 2HUPA 3LX5A 1S1CA 3QPWA 3NEJA 1S9HA 5HR5A 3U6BA 5TXGA 3GEEA 4URZR 1KMHB 1Q1QA 4JKYA 1XD8A 4POAA 3GEHA 4R71A 3HWSA 1HUQA 1XD2B 4YXWD 1I2DA 1Z0JA 3ND8A 1KO7A 1XXHA 4TMTA 1KSHA 2QT1A 4F7WA 4N0EA 2GVZC 3P20A 4LCBA 2CJWB 4G01B 3QENA 1YR7A 3FDIA 2WJVA 4TLEA 2ZE7A 5FOWA 3NEYA 1CR0A 2XOKD 3LDAA 3MFYA 3HP1A 4MUBA 3W90A 1CJMA 2GJSA 4BASA 1Z08A 1KKMA 4GBMA 1N6PA 3K9HA 2LKDA 5CJ2A 1N6OA 2HV8A 2QP9X 3CW2A 2XNSA 4C0JA 2JJ1D 1EFUA 3BB4A 4LYAA 4JZKA 1KI2A 1P73A 1XPUA 2CNWA 1JR3E 2J0SA 3A1VA 3BFKA 3QXCA 3ZLJA 1HE8B 3TR0A 3U5ZB 2AX4A 3LFUA 2IC5A 5K8TA 1W0KD 4IVQA 4OK3A 5A0FA 2HXYA 1ZU5A 2V6JA 4MA4A 2O8CA 2QAJA 2CEAA 2CL0X 1YZTA 2QGZA 1ESMA 2WZQA 3K0FB 1W0JA 1RYHA 1G5TA 1G8YA 2WKPA 2CHVA 2I1QA 4ZI2A 4TYWA 2NOAA 2YHSA 3FHTA 1P9RA 2IYXA 4HAWA 5TY0A 1P2VA 2KJQA 4B43A 1S2MA 3CUEF 4R7ZA 5UKDA 5KUTA 1W2HA 4DEYA 4Q19A 2IWRA 1R5BA 5KTYA 3IEVA 1XMSA 4TTQA 3VR4A 3DM9B 5CDFA 5FUYA 2ANBA 4IDQA 1FZQA 4L5BA 2O5VA 1VIYA 2RHDA 3ZDQA 4ZDKA 2PLRA 2OCBA 2OT3B 3LH5A 4CT5A 1SHZA 4TT3D 3PJRA 2VPPA 2G0NA 1FW6A 3FFAA 4LPKA 3RRZA 4OKSA 4P33A 3EXAA 4W5HA 4CT4B 4DUGA 1WP9A 2P67A 1Q22A 4MYCA 1IJFA 2AXPA 1G8GA 1E1RA 3OEHD 2DFLA 5BYJA 3ZS8A 1P7CA 4R2HA 2ODNA 2WWYA 2Y8EA 1K6MA 3B78A 2WSSA 3TQCA 4G1UC 4B2LA 1DAGA 1NVVR 2DWQA 2A7QA 5KNCA 1VYUA 2ZI9A 4AKHA 4IOLA 4BRWA 1T8UA 1T0HB 3U3KA 1IHUA 4WOPA 1CR1A 2DWOA 4NYMR 5J47A 1TMKA 4AI6A 1E0JA 2CL7X 4G5RA 3IPYA 3IUYA 5TVKA 2BC9A 5SZKB 1KHTA 2FGKA 2GEDA 4UXJA 1E9RA 4PHHA 4V0KA 3SQWA 3QKSA 2VP0A 4IJMA 1ANKA 1ZUHA 3OIYA 1JJVA 2J0UA 1FPMA 3I62A 4DLWA 3CO5A 1G41A 5E4FA 2V6IA 1DG1G 3QY0A 2ZRAA 2JJ2A 2PLFA 1BYIA 1L8QA 4B2IA 4FCTA 4Q1DA 3FVQA 4GI7A 2O8EA 3SFZA 2JJ8A 3DZDA 4ESHA 2J59A 1A1VA 1US8A 2VP9A 1U2RA 1XDBA 4LY6A 4WZ6A 4QHTA 1WCV1 1M34E 1UEJA 4M22A 1JEDA 4Q18A 5FPHA 1GKIA 2WJHA 3FKSD 5KU1A 1P75A 3MRSA 1KMHA 2C8VA 4JJKA 3EX7C 1PV4A 4BLQA 3R9XA 2ZTSA 1JPNA 3AF4A 3AKYA 3H4MA 4TLDA 1HT1E 1XTKA 3SI7A 5JJLA 4HATA 3SJZA 4DLZA 1FUUA 2FG5A 1G5PA 1HTWA 2GJKA 3I1FA 4TYNA 2FX3A 2WWIA 4R9UC 1IN4A 4D4LA 5CITA 4KFUA 2CJWA 4LC0A 4CW7A 1JPJA 3FWYA 3Q85A 2WIBA 1MABB 1E2GA 1L4UA 2PMKA 1NJFA 1Z0DA 5DO9A 5FL7D 4D2IA 3NDBB 2QPTA 2EFDB 4XWKA 1UFQA 2ZSEA 3I73A 3B13B 1BYUA 1XBTA 3QG1A 2IL1A 2A5YB 1C1YA 1F6BA 1TEXA 4LDJA 1II0A 1U8ZA 3KXKA 2C9CA 1KDOA 4A2PA 1CF4A 2QRZA 3ZIAA 2GKSA 2BEJA 1MO5A 2QP4A 1P62B 5C18A 1XTIA 2DWPA 3THWB 4B3XA 3GFOA 4PSAA 1D2MA 3I5YA 4IOJA 2GK7A 3I92A 5H68A 2QMOA 1DELA 3KB2A 3K0FA 4YONB 1U90A 2RGAA 1WF3A 5IHPA 2NMVA 2JLQA 4F38A 1E0AA 1Z22A 3WNBA 4JLKA 2VRWA 1SVOA 1EFHA 3VQTA 4OK5A 1P6XA 1A5TA 1IOZA 2G77B 3QEJA 4IFEA 4KBFA 4MQBA 3TE6A 4WVFA 2J7KA 1XXHE 1PUIA 4P31A 3ETLA 4KYIB 3IIJA 4IXMA 1VCIA 5ELXA 1FX0B 2CNWD 1B0UA 4B32A 1ZIPA 1GM5A 2ONKA 3MD0A 4KITB 4GZLA 2CK3A 5HZHA 2WWWA 2AWOA 1AKEA 3EG5A 3TH5A 3REFA 4B74A 1HQCA 3OEED 3SYLA 4XVUA 3DVLA 1E2NA 3GD7A 4YMUA 5C2JB 3PEYA 1AS2A 3U3RA 4A0RA 3C7KA 1S1MA 1W0JD 4LJ5A 1OXVA 1Z47A 4YLGA 2D2EA 4IRUB 1N6RA 2WJGA 3LV8A 4EUNA 3WNDA 1Q44A 1E9AA 1SVMA 4QBGB 1AQYA 1OLOA 2YWEA 4HB2A 1CR4A 3L0SA 1JAIA 1XCMA 2IX3A 1AGPA 3DKPA 2ATXA 5DGXA 1LF5A 2OAQ1 3AGPA 1SKYB 3OFND 3TLXA 4EJSB 3I8XA 4M9ZA 2BVNA 5LPNA 2XSZA 3U3OA 3ICEA 1E2EA 3TRFA 4F4JA 3CBQA 2SHKA 3EZ7A 5DE3A 4DT1B 2J0QA 2OBNA 5HZKA 3Q7QA 1VCOA 1G64A 3D31A 1ZD8A 4D0NA 2BBTA 3Q5EA 4A36A 1N6LA 4FXPA 2LCFA 1DBSA 2V54A 1L7VC 1Q20A 2OXCA 3LQRA 2RAPA 3EC2A 1XEFA 2QTHA 3LBNA 3W3AA 1JAHA 3LNCA 3GJXC 4M53A 2FSIA 4MKGA 2P5SA 3GMTA 2UVQA 3GLFB 5CDFE 1NMYA 2IXFA 4BFVA 4O2LA 5TV2A 5FH9A 1LS1A 5DIFA 2OBLA 3DDCA 3KUDA 5AK0A 2GF9A 3TSOA 2I3BA 1K8RA 4CF7A 1FP6A 4MGYR 4JVSB
chains in the Genus database with same CATH superfamily
1CDOA 1P31A 3KG2A 3U9SA 3MCUA 4JJZA 4DM7A 1MO6A 1QZUA 2Q3JA 3BORA 3MJTA 2OKCA 1WJGA 4BZQA 1R8SA 2QUIA 4YJGA 1NURA 2XBMA 2Y0CA 4B31A 2OV4A 2VTVA 5H3HA 1JFSA 1SPBS 1GNPA 1SUIA 2QVGA 4Z1MA 2UZ0A 3LMKA 3VZQA 1JDBC 1GQRA 2CVPA 1QH0A 4B09A 5JS7A 5FTNA 3RS3A 3IQDB 5FBQB 4OGLA 1ZH6A 2VJYA 1RS0A 4YCAA 5DI9A 5C34B 5GP1A 1BN6A 5HTKA 3A9TA 2QUAA 1AQNA 1DCFA 3VC3A 1UANA 4BC1A 5GONB 4Y6LA 2BEUB 4BBAA 5JLJA 2AOWA 5LDGA 2VUUA 1SXIA 1G2PA 3T5GA 1FY2A 3EVNA 3H5VA 3UUGA 1CY1A 2DQSA 2YV1A 2EP5A 4FGUA 1KO1A 2D1FA 1MP0A 1K1EA 1V47A 3B20A 3K9CA 3KKLA 1FSSA 3QUBA 4J1SA 4PBSA 2ORED 3CT4A 5ERXA 1RAGA 5IDWA 5H4GA 2A30A 4PFJA 3NPMA 1OQAA 3IRVA 1YB1A 1SC6A 4ZHQB 3DLBA 4OXYA 4TZ6A 1UZAA 2Z3ZA 2VDNB 2IZ1A 5E6UB 2QG6A 5JIBA 2VZ0A 2OL4A 1QIHA 4C2UA 1QP0A 1GNRA 4N3BA 5AW7A 4I46A 3AZQA 2P1DA 3PNQA 3F71A 4K9OA 3S1AB 1EP2B 3OQ1A 4O4LB 4WWHA 2VAWA 4DLRA 1S96A 1XDDA 4FPXA 5F7XA 3I61A 4FHGA 4PQEA 3DKIA 4PAMA 3HWX1 4NCHA 4B44A 2I6SA 3CTMA 1M10A 3HKDA 3MCZA 2FQ1A 2NTNA 4G8JA 4MIEA 2FEPA 3BXHA 3BKWA 1CYDA 4ZI5A 4BQOA 1LLDA 1Y9JA 1T8TA 3BL8A 3FDXA 5T41A 1KFBB 3BFVA 1N2SA 3KVNA 4MYSA 3SXPA 3WV5A 1E1LA 4UHBA 2BM0A 1C4WA 4BB6A 2YUIA 4BFLA 3GAFA 1T2FA 3M6UA 5H82A 1SULA 2MJLA 1E9EA 2P5YA 3F5QA 4KDEA 5AKHA 3X1DA 3CIFA 1FX0A 2P9BA 1OH7A 2J6BA 1W9HA 1R8YA 1R8JA 1TM1E 4M8IA 3L02A 2XOXA 4CIWA 2LIVA 1KETA 4E0BA 2I3AA 3AETA 3AEYA 4K9NA 3U81A 1OGYA 4BMNA 4MITA 1EZ4A 5HK8A 4D8TA 1O9GA 2Q0XA 3B5IA 3IMFA 3K0HA 4YAUA 1N34B 1CEYA 3U31A 3DTNA 4ARZB 1QGOA 1U3TA 3WGHA 2WK1A 3M6AA 4OMUA 4RZUA 2XOEA 4O2AF 3AP3A 2PQMA 3B3FA 1V8FA 5H3CA 4Z4CA 3URMA 3PUHA 1H0HA 3T7SA 4ZYXA 2W6QA 2JB9A 4KR2A 3A4VA 3BHIA 3C6QA 3SR3A 3V42A 1JHYA 1XF9A 3WRYC 2FPLA 1OCEA 4NV3A 1REQB 1EIZA 5K0FA 4PNPA 5FA6A 5H5JA 5SY9A 4ZZ3A 3RWOA 5DI3B 1NM5A 5KHAA 5LP6B 1O6FA 3RVQA 3I4FA 4DQVA 2NGRA 4F3CA 4GL2A 3WRXA 4F06A 3BE5A 2H1SA 3TD9A 3A6DA 2CXNA 2EF0A 1XL1A 3IT0A 1NKTA 2PT7A 2C99A 2FN9A 2J3LA 3F7NA 1JIKA 3JQ8B 4L72A 3WNQA 4C0AC 4P0TA 5IJ9B 1RKUA 2FW8A 2Q3FA 5F2EA 5HCIA 4AVYA 4AYWA 2C7RA 1Y63A 2DR2A 4FZ3A 3USCS 5K8LA 1QUEA 1T5SA 4I3GA 1EFCA 1BWPA 1T4CB 5AM0A 3R41A 1P4SA 2GJ8A 2ZROA 3JR7A 2GD6A 3DVAB 3PE6A 5DN9A 3X43A 2HIHA 3D4BA 3CX7A 4H15A 4G5XA 5J9FA 2PUCA 4CM7A 1RHKA 4GL4A 4RY2A 5LQRA 4QJIA 4WDRA 1HNZB 3ESQA 3C3AA 1LNQA 2HHAA 2OCPA 5LLSA 4CKCA 2VRBA 1EXDA 2HT6A 1G7RA 1H8EA 4N6OA 3MWYW 3IQEA 3DFIA 3DV9A 3HEBA 5BSVA 5FBLB 2Q5EA 4UTVA 3CNNA 1I7SB 1AS3A 2B4AA 4N8SA 4OL0A 5D5PA 3FHJA 1L5GB 2IOFK 3DO5A 2FLKA 1IN6A 5JH7F 2WM2A 3MMPA 4X45A 3G0IA 4HVAA 3VH3A 4V39A 3DBOB 3LCJA 2DSNA 3C8UA 5AT1A 4EYEA 1J8DA 4B0PA 3N9IA 3X1JA 1T6ZA 2H08A 2X5OA 4G37A 3MM4A 3G2JA 1XJWA 2BRUC 3KHTA 4R2XA 2BM9A 3T1QA 1TNDA 2LGJA 4BFUA 3PL1A 2C5SA 5AVTA 3D3EA 2YJ6A 3OFVA 1DL5A 2XITA 3G7NA 2XKAA 1KYWA 4MQ5A 1KSGA 1DX9A 1UJ4A 2GPYA 2HW8A 1OWPA 1C0EA 5EKDA 5GONA 2BEUA 3PLAE 5AHOA 2QRKA 7ABPA 3ASUA 4G8CA 4MWBA 1Q7GA 2ATEA 3C3YA 3TQIA 4D0RA 1T34A 2F8MA 1ZK2A 3I6BA 4WN3A 4ZWNA 3SQOA 3UVEA 1AGYA 3UJPA 5KDDA 1YRLA 2B69A 2JW5A 4R8MA 2J9YB 3E9ZA 1O7JA 2GM9A 1DAFA 4H6PA 1LPNA 2H57A 2XE6A 4ZHQA 4KKVA 2F55A 3TM5A 1C9KA 5E6UA 1PR3A 3ZDDA 2R5FA 4I1RA 1YF3A 2C7VA 1KPGA 3JQQA 4YRCA 4ZOBA 4LX0A 3G8AA 1DX6A 5K09A 4YREA 4D0LB 5C80A 4Y2SA 3S1AA 4MDEA 1CDZA 4O4LA 4YN3A 4MA5A 1MKYA 2GPTA 2QUKA 5A04A 3CQ9A 3RSLA 2AKYA 1GT91 1AQJA 3V48A 3UATA 4RD1A 4X65B 1W36B 3ENZA 1H2ZA 5AVOA 1J22A 2R6CA 3VR2D 5IMSA 4HB4A 3ZVRA 2EIHA 4RJTA 2W4IA 3IUJA 1G17A 4NAUA 3ETJA 3P2YA 5GJBA 5E38A 2XDWA 2C5AA 4PYLA 1J0XO 4ZDIA 3D6AA 2FMKA 5J59A 4D46A 2ZI6A 4RPIA 1E1NA 2B37A 5MDHA 2AG1A 4JLUA 2EJBA 2NXNA 4RMIA 3HSSA 2RC5A 5JAPA 2VHEA 3EZYA 1IBCA 1RD4A 4MDHA 5L7YA 2WD7A 3IODA 4LF8B 2B1IA 4KWCA 1X70A 3GCWA 2YOGA 2DLCX 4YUAA 1ZVVA 4Y98A 1B8PA 4BO0A 5BNZA 2F8SA 4A27A 1EVIA 4IIBA 1NFQA 3I9FA 5DTIA 1ZO8A 4PQFA 5GVSA 3RJZA 4ARZA 5F9HA 1Y33E 3RUDA 1DEAA 1EWRA 1VXOA 2JFWA 2FPIB 3TNFA 3VU3A 2P68A 2XTJA 2I1VB 1R0BA 2JHPA 2J31A 2QT0A 2ZDGA 3P4YA 4IIJF 4K9RA 3K70B 5EEGA 2ZS7A 3FGZA 3STTA 3VZSA 1REQA 5LXTF 2EBWA 8GPBA 4FE3A 5DI3A 2JASA 4TL8A 5LP6A 2GXAA 1VKHA 4QO7A 4NCAA 3HA7A 4OXRA 1OB5A 1CD5A 2HQ1A 2NU9B 1FFCA 3LC0A 1OVMA 2HQSA 4NDNE 3GX1A 3JQ8A 4N39A 1JQ5A 3PA6A 4NK4A 4YROA 2YRWA 4K87A 5DXFA 5HRAA 2WF7A 3C3KA 5IJ9A 4WLEA 3RHFA 3SEZA 4EB6B 5BN5B 4IMIB 1CZHA 2H7CA 4BC0A 1JQKA 4LW8A 5IYZA 2PWBA 4UHEA 3I0NA 5EGNA 1BVYF 4CUJA 1T4CA 4Q3DA 3KPWA 1JU4A 4YPOA 3P9ZA 3DVAA 4FLFA 1B1AA 4MB6A 3L0DA 2O2EA 3H1GA 4HAUA 2RBGA 1HZZC 5LQDA 7MDHA 1U28C 2WHEA 3N0XA 3WWEA 2HH9A 2VDJA 4BQNA 2RDMA 3UFBA 5BSRA 2BM8A 1WKCA 1LI4A 3HKCB 3SS8A 1TZJA 4WZAA 4RQUA 3ROTA 4K0KB 4F21A 2WINI 3HCWA 3LU1A 4I8DA 1YIOA 1I1NA 2QAGC 3I42A 1RRMA 4HHEA 4HZIA 4X8HA 1XFDA 3DW3X 3BMNB 2WHYA 4HUQB 3TDKA 3WK4A 1W29A 2QN2A 3I4LA 1USKA 1LUAA 4JLBA 3UV3A 2DUMA 4JR1A 3LYUA 2QM3A 4HDMB 4R7GA 4FWTA 1ZXBA 5I51A 1BQ4A 2H1CA 3GLIA 1RWKA 4L8WB 5B12A 4DW8A 5JNRA 4O3MA 4QXQA 3L79A 1XKLA 3QM1A 2K2QB 1JR4A 1D09A 1B14A 4BLVA 1LY1A 1QIJA 2E9SA 2J5KA 3KKPA 3TM4A 1BAPA 3NMUF 2X8AA 3C3XA 1NSTA 2QPAA 2X6TA 3DQZA 4P9NA 2O0LA 4QGSA 1GDHA 1YKFA 1OAOC 2B92A 1W49A 2R48A 4K86A 1AHIA 1KEPA 4XSVA 4AJNA 4DABA 2O8FB 1AGXA 2VUHB 2DBQA 3BZWA 2XYGA 1UBCA 3CZCA 3DH0A 1DMSA 3QV1A 1A8HA 5LU8A 4CG2A 4Y9RA 3MWEB 2RHGB 2XWSA 2Y0EA 1H66A 1F9AA 1QAOA 1VDZA 4ERXA 1XZPA 1JZQA 3TBFA 4Y2YA 3L1HA 1FRFS 1TMGE 3GJQA 3HPRA 1WVIA 2FW0A 4W9NA 5IFKA 3G85A 1OT3A 3AFGA 5EIWA 3ZV4A 3DUFB 1KFKB 1O0SA 1HURA 4F93B 3T1YB 4FYXA 2O4CA 1ECBA 2C88A 4NQRA 1P5JA 3WFJA 5H7XA 4F9FA 4YMVA 3DS8A 5C1DA 1P0QA 4RYDA 1DKPA 3UXYA 5FOVA 1KR5A 3AEXA 1R37A 1EDBA 3DXFA 3FMVA 1E9SA 4MWSA 4Q4JB 5EY5B 5JCPA 3OQNA 4E33A 4FILA 2OCXA 2V55B 4EL0A 1NGSA 1WL8A 2BGUA 4GE3A 1SXPA 2V3CC 3QSGA 4JODA 5K0TA 1A5BB 3HZOA 5COQA 1JFRA 2Y05A 4BCDA 3AWDA 3IQWA 4KREA 4QG7A 4QDXA 2BBOA 3T4UA 3LXRA 1OWNA 1N2JA 3WLIA 1UADA 5E1BA 3WMFA 3R0XA 3L0OA 2GSDA 1XQWA 5CLGA 1NN3A 1X7GA 1KXZA 1ZK0A 2JIOA 1G3UA 3DV2A 4WY8A 4ARCA 1SZPA 4NJMB 3OA0A 3D3KA 1EDOA 3HJRA 3DBRB 3SC3A 4IGKA 2O20A 2EEZA 5JO9A 2IYWA 4BLRA 1EG7A 2LIPA 4J1TC 4W63A 3UNXA 3CONA 1HT0A 1UBSB 2MSNA 4CM6A 3EPJA 3TN7A 1FYWA 4KRFA 3Q3CA 5DB4A 2QX4A 5EP4A 2FF7A 3E5RA 1DQYA 1TCBA 1GU0A 3DYVA 2XWPA 4X0EA 1T3GA 1ESCA 4UBOA 3Q3VA 4OFWA 1A7UA 1DC6A 4HZUB 2J08A 2Y76A 3C8HA 3NIWA 4Q02A 4C9BA 1YJQA 4R3WA 4LXUA 3GROA 2NP7A 4UUAA 1FDUA 1A1SA 1Q0SA 1E92A 1T1GA 2B36A 3FB4A 5CDTA 4A10A 5I5EA 4LF9B 2C7PA 5KJ1A 5KPDA 3AG5A 5GJVC 1ZZEA 2JLCA 5T8KA 1HBJA 4M1YA 4YNBA 1HR0B 2EFJA 3DC2A 4W7IA 1WQ1R 5FOXA 3RRFA 1F0PA 1ZCZA 2LVBA 4F9TA 4W5JA 3SS7X 2RGUA 5BPFA 1UWLA 3VISA 5KX5A 3A6PC 4PCVA 1LX7A 5FV4A 4EB3A 2O5CA 4CJXA 9MHTA 2RGGA 2PGJA 5BWLA 4NE9A 4BNFA 1E4YA 2XNJA 3K0EA 1N5KA 2Q5CA 4E2YA 1P5HA 2GBLC 3NKFA 3KJNA 4V0MA 1QHYA 3VR6D 3MJ4A 3TB6A 4RBNA 4ND4A 4Z9BA 4D4JA 3N74A 3RFUA 3WIBA 2V9CA 1ZDMA 3JX9A 2D06A 4TTSA 5ALOA 1YQTA 2XTNA 4XPIB 2O2XA 3QTTA 1UDCA 3E8SA 2NU9A 3QKWA 3ISVA 3EEFA 3FPEA 4LJSA 2XLCA 2O3SA 4GE0A 3AB3A 3D8RA 3V8PA 5L3SB 1RPNA 3DFMA 2VUIB 1OW3B 4EGAA 1G16A 1EM6A 2ZJ3A 2X8WA 2ZU0C 1BD4A 4EB6A 5BN5A 4TTTS 4Y0AA 2VL7A 1KQ3A 2V5VA 1N7JA 2YN2A 1C4KA 5TGTA 4LJ6A 1EPUA 2FZ5A 2ATVA 2HLDA 1B8UA 2AMVA 1M2OB 1F06A 2ONZA 3RSQA 3C87A 3S5JA 3VSBA 4OLAA 4UM9B 5K3CA 1AF7A 1P6QA 2OQ2A 3R3XA 4NE7A 1QE0A 1STOA 3ASZA 1TA9A 3HKCA 1Z5NA 3P5SA 1GG2A 4G5OA 2GOYA 5KSYA 2WNIA 1FW8A 5DHSA 4LRYA 1PZHA 4BVHA 3JQRA 4C07A 4D6XA 1E60A 3T41A 2ZI4A 1JDSA 1GZUA 3QY9A 4YASA 2G5CA 2PD3A 3BMNA 1RM3A 4HUQA 1PJZA 2Z4RA 1ZD4A 4E5NA 2FSPA 4RQAA 4PLGA 2M6LA 4WBXC 4CV2A 4HDMA 4KXMA 3DULA 3ROZA 3EVBA 3UAZA 3H84A 1UBNA 4HXYA 4LVCA 3BBLA 3LVBA 3WHIA 1TUBB 2X2OA 1U8EA 3C43A 5DJ5A 4RFVA 4CPDA 1R6VA 1XEWY 1JXAA 2HRCA 1VLZA 3EUFA 5CIWA 3DYBA 4MYTA 4YDSA 3KSBC 1OH8A 1YVPA 3LL7A 1KJQA 3QE9Y 1DKUA 2ZI7A 3DE0X 3P9IA 1PD1A 3K73O 2KE5A 3CPEA 1Q74A 4TMFA 4B9AA 1IQRA 4LJAA 4IX9A 4N5NA 5AI0A 3T5TA 5CLJA 3FHTA 2E4XA 5FNVB 3D6VA 3QLUC 3OJOA 4JBWA 2Q1YA 4PTYA 5EESA 1JZTA 3RSOA 4DEVA 1W94A 3MWEA 2O2JA 1EVJA 3FDZB 3TWOA 2UYOA 5FBVB 1XA3A 3AHCA 1JEAA 1JQBA 3QITA 4J3FA 1JBKA 2RGNA 4OI1A 5BQFA 1J39A 1O87A 3U60B 5FLKA 3RKUA 5EHXA 3ITNA 1TJ4A 1PJCA 2DPHA 3P27A 1Z0AA 1I1QB 1VL1A 2Q0QA 2Z95A 3DUFA 5HX7A 3C1OA 4KIFA 1RPZA 3C1TA 4Z4IA 2PO5A 3DTVD 5JRJA 4X7PA 3ZJ5A 2OVFA 2ZBVA 5C46F 3R1IA 3MWJA 3MSXA 1CUZA 2I0FA 3V8BA 1JMYA 1DG9A 2Z1MA 3Q5DA 1N3LA 1U2PA 1QC5B 3AF1A 3H9GA 3FOCA 1NVKA 3BHNA 1L4GA 2O7NA 4Q4JA 4QTXA 1SPXA 3SHOA 1Q12A 3SZGA 3WMGA 4EK9A 4LJ7A 1Z2DA 2XZTA 3EQZA 5EJ6A 1UPTA 2W9XA 5BW6B 4YEDA 1P5ZB 4BX2A 3KETA 2DBYA 2OFWA 1PNVA 2A5DA 2O1XA 2HB6A 1OWLA 1L4YA 2RARA 4QXAA 3SJUA 3D3JA 4TVKA 1T0UA 2QL7A 2AN9A 2VH5R 1GARA 2P9FA 4ZCSA 4NJMA 3DBRA 1A4UA 1XIVA 5LQKA 4BZZA 4Q1AA 4E5VA 3IC5A 4ETWA 2V97A 4EA8A 4PYRA 2G71A 3CHYA 3GRPA 4MMYB 5AMXA 4Q7KA 5EE3A 3R4VA 4U6QA 5I7AA 5ALJA 5IJ0A 3IBTA 1J8QA 3M33A 3PXUA 4QLOA 3WIVA 2IYSA 1ULAA 2PIAA 4HZUA 4F96A 2R1ZA 2VYFA 2WE7A 5FTLA 5I48A 3KQKA 1RQXA 3CRRA 3UAOA 4ETMA 3GJ3A 5BW5A 1MR3F 5LDHA 1AKYA 4Q93A 1S4MA 2JHGA 1U1IA 2D5AA 1YJAA 1J8MF 1QJCA 2FR8A 3GLHE 3PDWA 2HDNB 3RLFA 4ENVA 4HGYA 2XB2A 1G4UR 1RLMA 3NB0A 3NO4A 4V0SA 2VDQB 2R85A 3VX4A 1GL3A 3X1YA 1FP2A 2GERA 1I3OA 1WVMA 3KYCB 3LW7A 3BDIA 4HG2A 1L0BA 1FP7A 4NK5A 5G3ZA 3TW4A 1OI2A 3H19A 4GZ3A 1MTZA 1KP9A 1R3DA 3QA9A 4AY3A 5ARBA 1GQYA 4D0NA 1HEIA 2EKDA 3II6X 1LBTA 1ZWKA 2CF5A 1RABA 2Z5FA 2Q46A 3OQJA 4HLNA 4DA6A 2VSYA 3HJFA 2C07A 2NADA 4JLOA 3O4VA 4BQFA 3GQBB 1UK9A 2BMEA 2G0AA 4I6JA 1JAYA 4MYDA 3NALA 3V34A 5CFZA 1CUWA 1QWSA 3JZDA 2CFIA 4WZBE 4XPIA 5DN6A 1JIJA 3N6XA 4DLPA 3GUYA 4CMAA 5HRCA 2IYTA 4BIIA 1JKXA 2REBA 2R8BA 2WSBA 5L3SA 1QHNA 4JB2A 3BRSA 3TIGA 2AG5A 3ZD6A 2VT6A 5IM4A 1UBRS 3A32A 1UKVY 4CL8A 3LI2A 3AR9A 2CMHA 4K9QA 5L51A 4TSFA 1SEPA 3A1TA 3G6KA 4DUGD 2VTEA 3N8GA 4KN8A 1UFVA 4CKYA 5JQGB 3CLSC 2X19A 1ZEJA 4RF3A 4ZEMA 4RY8A 3FFWA 1QTRA 1LDYA 1NRJB 3BIOA 4NKRA 4ILEA 3ZGNA 4A92A 4DIUA 5JMTA 1T3LA 3DLCA 5JY1A 2EC5A 2ZS8A 2AGVA 2P9TA 2QLMA 3PQDA 4LY9A 1D9ZA 2F48A 4O2BF 1DQRA 2WSSD 1ZGGA 4IJKA 2WOOA 3QVWA 5B2EA 1P6UA 2IRWA 5IX8A 5SV2A 1Z4NA 1C9YA 2EFYA 1YQ9A 3L5KA 4HOYA 1TCCA 3OP4A 4XFKA 2WSLA 2I62A 3TQRA 2DBZA 1W52X 5B1YA 1AHHA 1N6HA 2OUKA 2R25B 3QYJA 1ZL0A 1C1DA 5B4UA 1LVUA 1V1RB 1L7EA 2AR7A 4RXUA 4REMA 3WYDA 1TUBA 5JNVA 2XUJA 1NLFA 1RR6A 2HA2A 2VDPB 4JQCA 1O1YA 1UC8A 2E4YA 1VL0A 2JL1A 3H99A 3LDHA 3ZNQA 1ZQ9A 1Z4MA 3SKXA 1L1RA 3BH6A 3DL4A 4ZT6A 5JJCA 3BYZA 2I6TA 3I6YA 1C30B 5M34A 3AKZA 1RAAA 2H07A 2ZUTA 5FUXA 1JLSA 5BT8A 1PO7A 1N32B 4Q3AA 3S2ZA 5KQMA 2JJ2D 4ZZ2A 4TS1A 5FNVA 3PQ4A 1EP3B 3EFBA 3RC3A 2XRMA 1DRVA 5KQSA 5DSXA 3Q7TA 3BKXA 4Z4GA 1NP3A 4BVAA 1CERA 3HM2A 1J8VA 4DLUA 3SU8A 3W06A 2C54A 4BJHB 4LIPD 4S2UA 1PBNA 3QIAA 2QA5A 3FSRA 2JAOA 3H13A 4PZEA 1RQPA 4YP0A 5IK2A 5CB4B 1SC3A 1WXHA 3QLEA 3DMNA 4R8SA 2PRYA 1GPAA 2YWDA 1U0FA 4BJ1A 2OGWA 4O8ZA 3QVSA 3ABIA 3GU3A 4A8PA 1U99A 1T9CA 5HE8A 4EECA 2IYAA 1F6WA 1WXDA 1SCIA 2F2TA 1A27A 2D54A 2QE7A 3H83A 4J7UA 4PLTA 4F72A 3GW8A 4YV7A 4ZJUA 5KVVA 4MPTA 1MVNA 1CUJA 1QC5A 1RRPA 2E4ZA 2NXJA 3H42B 2CBXA 1TFRA 2INGX 3B53X 3EWNA 3LGXA 4HGRA 4EA9A 2DHCA 5CH8A 4U5XA 1YR3A 1PI3A 2B0CA 2HCFA 3BICA 2J9RA 3HRIA 1D0IA 4QNMA 1AOXA 3PEVA 5JJIA 2YJ4A 5JI3E 2QVYX 2DU8A 3A4TA 3FHLA 3UJ6A 2X2FA 3I1YA 2AYZA 1G7TA 1Z6ZA 3I04A 5AI6A 1MOSA 1PVOA 4LK3A 4TKLA 4IS3A 5CFMA 3RC7A 1P0MA 3T1OA 3VYTB 4NH0A 1FVFA 2Q6LA 1NQOA 1V95A 1Y9EA 2FU5C 1KYXA 4HDSB 4PLCA 4MW6A 5FWYB 1XU4A 4AS3A 5IF9A 5L7TA 1OHHD 2H54A 4BTEA 1MHTA 2LPMA 5GTDA 4LE1A 1J8FA 2YDXA 3CZ4A 5D6NA 1E3IA 5BOVA 3IE1A 3D6FA 1RZRD 2OKGA 3CS3A 3L0CA 3DOUA 4OGGA 2R1TA 5B53A 4MINA 2DSTA 2G25A 3WAJA 3WOHA 3R3SA 1VOTA 3Q7PA 1C3JA 4L16A 4HBGA 1N0UA 1KERA 1SBNE 2I7TA 1L9XA 2Q50A 4LHWA 4PC2A 1Y8ZA 4JOSA 1U0TA 1N4AA 5CT4A 3GR6A 3KYCA 3DUWA 1J23A 1DT5A 4CN9A 4IL5A 1K3FA 3OZBA 4G9EA 3K0CA 1GN9A 4TYQA 4TYNA 3V2UA 2W83A 2DR3A 3NHFA 1BEEA 1H2EA 3AZPA 4RIIA 2EZUA 4RHEA 5ICSA 1Y8RB 3QVTA 2OCAA 4OJKA 4X3CA 2PM8A 1MPTA 3V6MA 5MFZA 4OXQA 3WYEA 4KWHA 1TKCA 3F96A 2DCMA 1CDEA 3GQBA 4EHAA 4RK4A 3A2KA 5A6VA 1YJXA 4RV4A 2EZ4A 1V4NA 3QEBZ 3M1IA 4AJKA 2B2XA 4PR0A 2N75A 4RVGA 1XRLA 2EATA 4Z0PA 4WXEA 1QCZA 3D81A 2FW1A 2BOVA 2PS3A 3JARB 5CT9A 1ZZGA 3N28A 4K9KA 1JFTA 3EODA 1OBOA 3SX4A 3PX7A 1VLVA 3CPSA 1ULSA 2XNHA 2A1TS 1RYBA 4DLXA 5A62A 5KYUB 3IIKA 5JQGA 3A9SA 3PRJA 1P1RA 1U2ZA 1UJ2A 3L6EA 4JT4A 3EEOA 3MXTA 3CF0A 3ZD7A 1ZMTA 1DJQA 1IXKA 1PT9A 3GN2A 1RYZA 1ZUIA 2OQRA 3AY6A 4UHKA 1XVLA 3QU2A 5E4JA 2JJYA 2C61A 2HPHA 2Q5QA 1ZK4A 4E6EA 3T7DA 4NH4A 1DIHA 2AZDA 1XQ1A 1D2EA 3KQSA 3MB5A 4GSLA 3RRBA 1PLKA 4X7RA 3SMQA 3TIFA 2CCKA 2HYDA 5C51B 1B8NA 3Q98A 1F60A 4KRYA 2CHGA 4JQYA 5KKAA 2NPFA 3WK8A 4Y2UA 4R1MA 1V96A 3VBEA 2DLNA 2Q49A 2QUJA 4DMLA 3A3PA 4X93A 4WTOA 1XE3A 3DDUA 1XTQA 3LD9A 4ZVNA 4TKVA 2GFIA 4H6VA 3T7AA 3RUFA 4ZZ1A 5F7OA 1V1RA 5MGBA 4BFXA 2VQFB 1ZC3A 4PN7A 2BEWB 2CMFA 4E6PA 3DONA 3U7HB 1KMMA 3MJFA 2ZRLA 1POWA 1EHIA 3IOEA 4UFOA 4AJ2A 1FDSA 3VNVA 1FP4B 1MC4A 2YXPX 4YQZA 4BLTA 1AK2A 1QLJA 4N18A 1D3AA 3V4RA 3GRVA 2NO9A 4CE6A 4H6XA 7GPBA 1C30A 1VI5A 3CRW1 3VDNB 4BKOA 4DMCA 5KKNB 1W4LA 1ZH2A 2ALJA 2NT4A 3HU5A 2QMUA 4TV8A 5IUJC 3D7RA 5EIHA 3K1JA 4XWWA 1LRLA 4QULA 1GKYA 4XI9A 1VJDA 3FPJA 2Q4OA 3PYMA 2O8NA 4KXNA 3LUDA 1Q14A 4ACAA 4LGMA 4N8EA 2PVPA 1E5LA 3EIOA 4B80A 4DR5B 2W7TA 3HCOA 5CB4A 1NXXA 3IQGX 1KJ9A 1UPCA 2JLVA 1TJ5A 1X1DA 4GX1A 4TM8A 3UM9A 1XXLA 3UC9A 4ISCA 1KSJA 5I9LA 4ME6A 4AS1A 4EM6A 4QQFA 4AZTA 3MINB 2HPVA 4ZVRA 1UT6A 1UIRA 3LRTA 2CSUA 3A1DA 4KMRA 5AHKA 4ZODA 2WZBA 1WQ3A 3AL2A 4UC0A 1K7FB 3OLXA 3PPIA 1ZLYA 1GSHA 1B4DA 2C42A 2HWYA 4Q4HB 2V8BA 3B1VA 1WO8A 1LVGA 2G8NA 2HEIA 2WRZA 2V6MA 2QNBA 3HGTA 4MO9A 4QFMA 3GEGA 1V4VA 4LZOA 5ELMA 4ZCLA 2HCTA 3SDSA 4FHEA 3GPBA 3HO8A 3PLRA 3WSWA 1E5QA 2QQ0A 1T2UA 3ZQJA 1VFNA 2FPGB 5JWOA 4NBWA 1TL7C 4HRXA 4KPYA 3EZ2A 4XASA 2GD0A 3PFHA 1KNQA 2F8LA 4KLRA 3PUXA 4Z9AA 3W5VA 1AMUA 4DMRA 1Y1QA 1LPBB 4DRZA 1FLNA 3ZTWA 1UZLA 1ZJJA 3O82A 1Z33A 4YUVA 4EW6A 2PX0A 4HPWA 4TXMA 2BZ1A 4L28A 3QE4A 2C5FA 1UUFA 1QGUA 4HDSA 3ZGXA 5FWYA 2A1IA 3KV1A 5ADWA 3VR4H 4KVGA 4G67A 1T8RA 3MC1A 3RSFA 2E0IA 3GFSA 2CD9A 4F8JA 5JMWA 4FE7A 3ZZUA 1GZ3A 4DKXA 3GC6A 1QTIA 4GI1A 4FDVA 5D00A 5KYKA 1G6OA 2AKAB 1G3QA 2WD9A 5KWIA 4CMIB 2ISCA 4JEUA 2ZM6B 5LQJA 3EVAA 4RPGA 3KKQA 1WDTA 2LCIA 4RVUA 3JQEA 4HNGA 3WLKX 3LHKA 3P4XA 1QG2A 1FDIA 2B4QA 4URUR 4X8OA 5A9RA 1VDMA 3V7FA 4IX1A 1CUYA 1ZVQA 2YIDA 4GM1A 1PT6A 2OG1A 2QI9C 3IP7A 2FPWA 4B17A 1VTKA 4HYQA 3RHSA 3HJGA 4CDGA 3PWZA 1E0DA 4UDXX 2C97A 3T15A 1WXFA 1YVRA 3EXEB 5LZ2A 10MHA 4NAHA 3TJZA 3RVJA 2XMQA 3UHPA 4I3HA 3WLMA 4AN4A 2YFQA 5ILOA 1P61B 2GR9A 3AKCA 1EFRA 4EEXA 1CFJA 1L4MA 4YJFB 4W8GA 3H17A 4HKTA 3TPZA 3OZFA 4RWZA 2WFMA 4RLSA 1A0OA 1KTVA 5EP1A 4FQ7A 4CTOA 1PW7A 4BFTA 3PRHA 2Q27A 4LHZA 4N0QA 3UUFA 4IDPA 1N2OA 3BAFA 1CUAA 4KCGA 4OXXA 3AEZA 4A0GA 5LIPA 3JARA 1Z2AA 3KXLA 4DR4B 3FG9A 4KO2S 3PNOA 4K6OA 2E21A 3NXKA 3F8SA 2WP8J 1QQTA 1CUDA 4R8VA 3BSWA 2CVFA 3CU5A 3R3YA 5I7FA 2JFBA 2QN1A 3FTQA 3V1KA 2IW3A 3N39C 3OZIA 4ZGBA 4KIGA 2GK6A 5BY2A 4MPPA 3UWKA 3L9XA 4JSRA 4XIJA 1S02A 2HCBA 5ULLA 4DSAA 4MGZR 4CMBA 4EGQA 5CB0A 4FYJA 4C0KA 1A9QA 3IS3A 5E4YA 4KR7A 3KXIA 5KJFA 4NZ9A 1D2CA 1YT5A 1PS9A 3WDLA 3WR5A 1N1EA 3MAJA 5BUQA 4BBZA 4U7HA 3RRNA 2X58A 4KQMA 3SVLA 2XAAA 3CISA 2MR5A 1J33A 1TXGA 1MHPA 2BTOA 2H06A 2BEWA 4GNKA 4HPXB 4MNTA 4ZQIA 2E37A 2O3JA 3SFTA 2OGTA 3GGJA 3TBKA 4HUTA 4U7DA 2XUDA 4EFKA 3B9BA 2XE7A 4W5QA 1R4NB 4DLTA 3WSTA 2EOAA 1FP4A 1C29B 1H9BA 1G1MA 4FJ0A 4YHHB 3K53A 5KNBA 1L5YA 4W1RA 1IVSA 2PUDA 3N0RA 3FROA 2W6NA 4V24A 4E70A 1GA6A 2BMJA 2HDHA 1E2BA 2HJWA 2RHCA 3HPQA 2O2ZA 5ALGA 1W4BA 4DA9A 1ZHFA 4UNIA 1AX9A 1QCDA 1SD5A 2Q21A 3QI2A 4CEIA 3BXZA 4ZJYA 2DC1A 2RGWA 3GL9A 4LJ9A 1YS1X 1KDYA 3RV3A 2ARKA 1RWPA 3KQPA 1LDEA 2PZ8A 3NH6A 1BE8A 2X7XA 5CPBA 4UXHA 5TF0A 2QMZA 2RH4A 3MINA 1NYLA 4UD2A 4W7SA 2KS6A 4DWVA 4FFLA 3IAM1 5EJ2A 5ER9A 5IAGA 4DLNA 1XZNA 1LBQA 3IQHX 4TMYA 1JHPA 1LI5A 1T5HX 4DLLA 4Q4HA 2NPOA 4RDXA 5LQUA 1DSSG 3RFCA 2PH7A 5AM4A 3DM5A 3SF8B 1TLTA 4YRIA 3QX3A 4G9GA 4UE2A 1ORHA 1GNQA 4JVOA 1XR3A 4MWCA 4LHYA 1FQOA 3IVXA 2W90A 2OAGA 4NMWA 5E1OA 4OA5A 4H77A 3EEBA 2AC7A 2FPGA 3ZWDA 4X62B 3VNAA 1RZVA 3MCWA 4LZPA 2B4KA 2GRAA 2ZT8A 1ZAKA 2R2AA 1RLTA 4TWRA 3AB7A 4MRVA 1OJLA 1QLWA 3ABQB 3V8VA 3R20A 4GOKA 4NC9A 4EAAA 3OEEA 3PPWA 4JA2A 3KAJA 4BUZA 3EZXA 3HJAA 1W73A 3E84A 3A1SA 5F2OA 4NNJA 4AUMA 3MS7A 3KJQA 3GFPA 3X1ZA 4EG4A 2I4RA 3OJLA 3QKRB 3SHFA 1VSBA 1YR2A 3W6NA 4D4IA 3B3QA 2CCGA 3BG5A 4RZXA 5DNEA 3WI7A 5F77A 1ZQ1A 3WFZA 3BBPA 2GCOB 3CXRA 4HMQA 4CMIA 3OT1B 2G88A 4KQEA 3GF4A 4G1MB 4Q1EA 3RAPR 2ZE8A 4DCPA 3WSVA 5C8YF 1G5RA 1P1CA 3TLAA 5FJJA 3UK2A 5CA1B 4WNIA 5JCZA 1NOJA 3KJEA 1ZRHA 3L1JA 421PA 1BX1A 3GDWA 4Y1GA 4G1FA 4ZO9A 1YTUA 4GX2A 5LWQA 3K0AB 3OFNA 1I2AA 3L7AA 1WXQA 2FN4A 5L8VA 1YD7A 4MKFA 3A3KA 3HTXA 4LXYA 2WU8A 1ZEMA 2MYUA 4HAYA 4MW4A 4QASA 4UHHA 1FYFA 2QGFA 3ENWA 5JY6A 3A58B 3EXEA 2Q5LA 1UEXC 4CHGA 4LWQA 5FKJA 3PHCA 3KWLA 1I30A 2VYVD 1E64A 2PWAA 4ZVOA 3ZZMA 1AV6A 5FDFA 4IDGA 3VR3D 2QM8A 2CFTA 4YJFA 1JVNA 1KQGA 2GN6A 3O47A 5E7IA 2YR0A 1XKQA 5COBA 4NBUA 1CNMA 3UHOA 2ADFA 1Y1SA 3VFDA 1F38A 1K4KA 1PSDA 3I09A 3URKA 1THMA 3CNLA 1YR9A 2O0MA 1EI9A 3IUMA 1FLVA 3OZ7A 2VATA 3EVFA 3MGAA 4GC5A 4GOOD 4GYJA 4WFIA 5BW4A 2Q07A 5IJAA 1XVUA 3HB1A 4X66B 4KU4A 1ZMRA 1ULBA 2RHJA 1TYDE 5LD2C 1RBQA 1OB2A 1XCBA 2D7JA 3DF9A 4ZT2A 1NULA 1YQUA 4PZLA 1AO0A 5AXCA 3KHKA 1CRWG 2BW0A 2IIQA 3ANYB 1FBTA 3P9CA 4XWTA 4YAEA 3RG8A 1I2BA 1GG9A 5IT9A 4LXXA 3MTAA 4KK3A 4B3SB 3CLTD 2YOFA 2O2GA 3K1AB 4ND7A 2QYOA 3GJ0A 2BP7A 4HEA1 4PX9A 4URYR 2MSKA 2VDRB 1JIQA 2CYCA 2VK2A 1ZJ5A 2ZQZA 3QIVA 3ZWVA 2XIJA 4QU8A 4F7DA 2ZVDA 3NHRA 4RTKA 1SVLA 1WEKA 3IAUA 4XDHA 3Q8MA 3AGQA 4OM7A 3BREA 3RC8A 2EDAA 2B21A 1DG3A 3D4OA 2PJDA 3FPAA 3JWPA 1MRNA 3SSMA 3VVMA 4ARBA 4DMUB 4BNLA 4O1IA 5LZ9A 4DR3B 2F3RA 2HPZA 5LYJB 2J5BA 3GN1A 3OTWA 1R4NA 2PXCA 1FS4A 2NSYA 3A6HA 3R4CA 3AM5A