5BQOA

Hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus with sulfate bound in the 5-phosphoribosyl binding site.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
176
structure length
169
Chain Sequence
b'EYHIPSWDEIEDAVFSIGEALVKSNYIPDVLIAVLTGGIIPAKLLSDLLDLKVIRYIDIKFYSKPVIRSVYTDSLEGKKVLVVDDVADTGETLEAVSNVITMFNPAKVMTAALYLKPWSKRIPDFYYKQIDKWIIFPWDKWDVVRENSNVPVDKKERFLNLYNQLLKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine phosphoribosyltransferase (GpT-2)
molecule tags Transferase
source organism Sulfolobus solfataricus (strain atcc 35092 / dsm 1617 / jcm 11322 / p2)
publication title Sulfolobus solfataricus P2
rcsb
total genus 47
structure length 169
sequence length 176
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bqoA00
1PZMA 4IJQA 1ZN8A 2H08A 1U9YA 3EFHA 1O5OA 4M0UA 4TWBA 1XTTA 1TC1A 4PAWA 1TC2A 1QCCA 4ZFNA 1G2QA 1W30A 1YFZA 1QK3A 1WD5A 4FYMA 4JITA 4M0KA 4P82A 1JLRA 4P80A 4F8EA 3ACBA 1ECGA 2FXVA 1I13A 5BQPA 1HGXA 3ACCA 4X44A 1A96A 3H83A 1J7JA 2E55A 1UPUA 2WNSA 4QYIA 4MB6A 3GEPA 5KAMA 3GGJA 1HMPA 1VSTA 4P83A 4RADA 5KAPA 1JLSA 3O7MA 4QYIB 1DQNA 4M0PA 4RHUA 1AO0A 1VDMA 1MZVA 3MJDA 1ECCA 4RABA 3ACDA 3LRTA 1VCHA 2JI4A 1XZNA 2DY0A 2P1ZA 2PRYA 1P17A 2XBUA 1ECBA 2H06A 1QK5A 4LYGA 1BD3A 3DAHA 2H07A 1G9TA 2PRZA 5BQOA 4RQBA 1ECJA 1OREA 1OROA 2PS1A 3DEZA 1XTVA 4RV4A 1DKRA 1ZN7A 4RHYA 4RHTA 4P84A 1UFRA 4KN6A 1A3CA 4RANA 1CJBA 1QB8A 3KB8A 2VFAA 4PFQA 1P18A 4P3KA 1QCDA 3MBIA 4WN3A 1NONA 1A97A 3OHPA 4RAOA 3OZFA 3DMPA 4LZNA 1A95A 3G6WA 4S2UA 5JSQA 1P19A 1XZ8A 1BZYA 1NULA 4OHCA 5IAOA 4P86A 1GPH1 5K51A 2IGBA 1G2PA 2JKZA 1L1RA 1DKUA 1G9SA 1FSGA 1R3UA 1L1QA 3NAGA 2YZKA 4X45A 1GRVA 1Y0BA 2JBHA 1QB7A 4QRIA 5ESXA 1ECFA 3N2LA 5BRNA 4JLSA 1LH0A 3OZGA 1ZN9A 1XTUA 5HKLA 1OPRA 1O57A 1QK4A 2C4KA 2GEBA 3HVUA 2JKYA 1V9SA 1A4XA 3M3HA 4RHXA 4LYYA 3GGCA 1STOA 1A98A 1DBRA 3S5JA 5ESWA 5IPFA 3QW4B 4P81A 1P4AA 5JV5A 4WMLA 2HCRA 1IBSA 4Z1OA 1Z7GA 1I5EA 5EUCA 4LZAA 4RACA 1D6NA 4LZOA 4RAQA 5BSKA 5HIAA 1DQPA 3LPNA 4RQAA 2EHJA 5E38A 1I14A 1I0LA 1I0IA 1UPFA 1BD4A 2AEEA 1U9ZA
chains in the Genus database with same CATH superfamily
2ZRHA 3BK1A 1P4HA 1DWOA 4LWZA 3JASA 3QXHA 3U6BA 3KVYA 3L6CA 5ALEA 3VQTA 2R9VA 1Y1RA 1F14A 4PG4A 4BBZA 5I7RA 1C8KA 1KAHA 1NW6A 3AEUB 3PPIA 3FIJA 2QZ9A 5A5FA 1RWVA 2P78A 4ZI3A 2LNDA 3N7TA 3TLZA 5CVVA 3TBFA 4CM3A 2V54A 3S81A 4LHEA 2GZDA 4DHWA 1Y5IA 4E4TA 3JYPA 2D74A 1JXMA 1COWA 1L7BA 3C14C 3NHSA 3BSYA 2FEAA 2WJVA 3OIWA 4FYWA 1NXSA 4GLJA 1DC6A 1DMRA 4BMCA 4E7OA 4ZZIA 5FL7A 1SZPA 1DG9A 1WDWB 4AZ3A 2C31A 1J1UA 1V9LA 3OEHA 4AJHA 2H2IA 3I09A 4HC4A 3FTNA 3RADC 4KDEA 1G98A 2POQX 3TTXA 2AMYA 1LJ8A 2XEXA 1TGYA 5INTA 3F2VA 1SXIA 3HB9A 1N3LA 2VTEA 3FGOA 3RG8A 1Z6AA 4Q93A 4LBZA 3ETDA 5DJ5A 1D4FA 5F3WB 1AQLA 2YXBA 3LTNC 2O2HA 2GCOB 1MOSA 5AHRA 5B5SA 3E8XA 1FFCA 2BKAA 2AT1A 1OYOA 1BCRB 1HT0A 3OOYA 5MN6A 1CFJA 3BXOA 3UG6A 4ZQFA 3HB1A 1M54A 1TVMA 1YBVA 2MSLA 4LN1A 2DH6A 3Q5GA 3U3KA 3VR3A 5KUTA 5DX0A 3KG2A 4ARCA 4BRSA 4DGSA 3CT4A 2VQ3A 3OF2A 2CFIA 1RAHA 1Y9AA 3C3CA 3D0QA 5AKHA 3HTXA 3KDPA 4JLNA 5EMMA 5TQ0A 4G1VA 2PSDA 3NPMA 3CH7A 2OFPA 3WNZA 4P4TA 4WASA 2FPXA 2CC2A 5AVUA 3AIMA 1WQ4A 2GJKA 1BHO1 2FW8A 2FFJA 4MUGA 4X8LA 3ZJ5A 1EK1A 2X19A 5DP1A 3KTOA 4TXNA 2FDCA 3C6ZA 1ISMA 1GADO 1OFUA 1R5OA 2BPOA 3NQ41 1NBHA 1Z8NA 2WWIA 4JOBA 2OOSA 2P5UA 3FDXA 2PUDA 1F1JA 4NCJA 4WZAB 2R5WA 3ZZTA 2BVNA 2DR0A 3IMEA 5HOEA 2JZCA 5JS7A 2OGTA 2ZULA 1TYDE 4IWNA 1HOXA 2BELA 1YIDA 1XZFA 4M1WA 4YGYA 3K0AA 4RK7A 2WOJA 3S40A 4TTJA 4URYR 4RFSA 2D4HA 2CDAA 1JZTA 1U0OC 1YKSA 4IIYA 2QLMA 1UZLA 2C96A 3UMVA 2FWJA 4G81A 1LW7A 4MQUA 4ZYUA 4DIOA 3LS2A 2RJNA 2GN4A 5I7WA 1WXHA 3P9ZA 3OJ0A 4JODA 4BNGA 1CS4C 1FZQA 1PNTA 2V9ZA 4IDQA 4RW0A 1XAIA 1AZTA 4Z9YA 3NASA 3HA7A 4HAWA 4QQRA 3DFFA 3TW4A 3ZHQA 3WMGA 3EOZA 4Q02A 5FPTA 3K0FB 4Q4HA 1O0CA 2VJYA 5F9FA 3AP2A 4TT3D 1RKQA 4JYAB 4H6PA 1EUQA 3TXAA 4FT2A 1RYYA 2VQSA 1RRFA 2OGWA 2R7NA 4JKIA 5IH3A 4BO9A 5K9ZA 2YCBA 4U0KA 2FSFA 4EPTA 5JPDA 2WMNB 1XP5A 4DANA 3A3OA 1V3TA 5HEKA 1DBQA 1CKEA 1GNRA 1R66A 1OTYA 5B3LA 5F2OA 5LD2B 1PR6A 2MYPA 3SBXA 3C8MA 3STUA 2OHVA 4ZPXA 4ZIRB 2OCKA 1KY2A 1K5DA 1XV5A 4HRAA 1QVWA 3AHJA 3IUJA 3G82C 4ZYYA 4Q4LA 4LF5B 6Q21A 3ND7A 1ECGA 5FTWA 1W29A 1AQIA 1ZK2A 2BFCA 2GD0A 4UUBA 1JIQA 1T4CB 2GT1A 4P8RA 2XJ9A 5DX8A 5AQ1A 1RC8A 4AP6A 1EUDB 4HQKA 3KK0A 3WKCA 2LDXA 3CUTA 2QTMA 1L7MA 3GJ0A 1I9CA 3U3ZA 1SUPA 4UNIA 2O8DB 3EHEA 2IXTA 4C29A 1A5TA 1YO6A 2O2IA 2VUSA 3KE9A 1YAJA 4KXUA 4UE3S 2BR5A 2NPFA 4A0GA 1AO0A 2PD4A 1E9AA 4LE2A 2W2LD 3GW8A 1G8AA 1G7RA 4HEJA 4OB7A 4Y0NA 1NJSA 1JVSA 3EMKA 3HJBA 3ZWVA 2FWPA 4RD6A 2EZTA 4YRZA 1LLDA 1O9HA 4J2OA 4NQZA 3SS9X 3NAZA 2JFOA 2WTMA 5JOQA 2XCRB 2ET6A 3M5DA 4E03A 3OZCA 1UC4B 3G49A 4IIBA 3NHKA 3EUEA 1WQ3A 2ORVA 3W5BA 3LUJA 4ND3A 2IHNA 3ABIA 1YVUA 3EZFA 1AU9A 3ELDA 4QLOA 1NXPA 1UEJA 3ZHOA 3P8ZA 2QJRA 4HH4A 5HCIA 3T9EA 2JI8A 2EIXA 4XPIA 2OYRA 3VSEA 2A9OA 1GKUB 4DC1A 1JRLA 1DBWA 2YV2A 3PENA 3AM5A 4GZMA 1E2MA 1E9BA 3WGOA 1FE8A 2WHPB 3OFSA 3SZMA 2G5TA 3HBAA 4XI9A 3VR0A 4D9GA 3IOMA 5EHGA 4PPNA 3HY6A 1AS0A 3NYIA 3QLTA 4R1SA 5UKDA 4BNZA 2BHLA 4B79A 2GM9A 1OYWA 3H87A 4L15A 4MGZR 1AT1A 1XCPA 1U7ZA 2I29A 5TVGA 4F93B 2L18A 3H8WA 1GRCA 4GBJA 4ZDWA 3V9AA 3CA8A 2FW1A 3KJEA 4YN3A 1C7FA 3MSXA 4RSMA 5KTOA 2WOOA 2KMLA 3II6X 3PX3A 2VKQA 1TUGA 3GFTA 2Q6VA 3LQKA 2WJYA 3CB2A 4MJ7A 4MRAA 4MCJA 4DLSA 5T5QA 4DCUA 2J9XB 2HCTA 4ALKA 1CX9B 3VNRA 3ROGA 2VZ0A 4BVEA 3TNYA 4I1UA 1BFDA 4LNAA 4MNTA 3R3UA 1RPTA 4PC1A 5FULA 4NCHA 4S1WA 3VZCA 2FN3A 2GUGA 4WKCA 5CNJA 3KKQA 1RLTA 2B7LA 2VHCA 1Y8ZA 5AW7A 2INGX 1YS7A 1DQRA 2COKA 2DQYA 4KW7A 3V1KA 1GGFA 2DUJA 2I3GA 3KHKA 3F49S 1JX6A 4HHEA 1E2PA 2Q0XA 4HDKA 3WLQA 3ZDBA 4KXWA 2RKWA 3MM4A 1WM1A 3OU6A 4N7RA 5A7HA 1EWVA 3VBCA 2B78A 3PQEA 4PSDA 2B4AA 3RASA 3LU1A 4OFXA 1VI2A 3H99A 3ST7A 2X8AA 4BGUA 3ZE0B 2ODPA 2P6PA 2WM2A 3TF5A 3QSYA 3FWNA 2Q0HA 2XOKD 4PQGA 4WBNF 1BE8A 1OXXK 4X0EA 5BSEA 2JFBA 3ED5A 3VTFA 1XFDA 3ZI0A 2QTVA 1BO6A 1PS8A 1TYAE 4FI3C 3WIVA 4BE9A 4WFKA 2QTLA 1E4VA 1I0IA 2J9GA 1XRPA 4LOKA 2A7XA 1BVUA 2RGRA 4EGQA 2RGAA 4AMYA 1I4WA 2EWWA 4Q34A 3HH8A 2WF7A 4FGSA 4CWAA 3OIYA 3ZJ4A 3LBYA 2GPTA 2ZJZA 4XIJA 4IXDA 5K0GA 4JL8A 2QNRA 4B0PA 2X5NA 2DQSA 2BSXA 5J2UF 1Z6QA 2M6RA 2F43A 4FBGA 4R7ZA 3HR7A 4Z0HO 2JJ2A 1FMTA 1Z2AA 2KJQA 4FX2A 1F7VA 2O4CA 1QYDA 1MDBA 1W5FA 3P45A 2DPHA 4ZPJA 4D26A 4J0CA 3DWFA 3Q7PA 4I81A 1OAKA 3HY4A 4MV5A 1T2FA 3WLIA 3QM1A 3OLZA 5BMVA 1L4MA 1MA3A 1Z3CA 2BCGY 4TLBA 3TZCA 4B3HA 4S04A 4DUYB 5I7VA 1JLLA 3F3YA 2QQFA 2EW1A 2H1CA 4B4KA 2RE8A 2ZXUA 1SCUB 1VMIA 2FRXA 1ESMA 1ZOIA 1ZJ4A 1LVHA 3HYCA 3IUYA 4KQEA 2HB6A 5FL7D 3RFTA 3BZUA 1U7HA 3CVYA 2Q46A 1UP4A 4GBGA 1ORHA 1Y1PA 4JUFA 4LTMA 3JQCA 3IPCA 1M6EX 4UFOA 4UDXX 4AJOA 1JE0A 3VYRB 2CNDA 2JVIA 2PS1A 3KV1A 4LDRA 3RIHA 3H1BA 2PKYX 4YJDA 1U31A 5B36A 3KT8A 1IB0A 2JGLA 9ABPA 1DCTA 1T5DX 4HQOA 2IYVA 4JUIA 3FNIA 3G0CA 5JMTA 2YYSA 2ZB3A 4KRYA 3P9CA 2EFCB 1KDYA 4HGRA 1A1SA 1OWPA 2B4RO 3ESYA 3I28A 4G07A 4IXWA 1IWPB 4JN6B 3WZMA 4EDHA 2V7PA 1JA9A 1L7PA 2H17A 3HKDB 4KWIA 4TGLA 3VPXA 2X2OA 5CGQB 3VC1A 5EJ5A 2AFHA 3WDKA 5CHEA 4QVKA 1LQUA 3ZEIA 1IWBB 1IY2A 1E4YA 3RRYA 4FOLA 4XQ0A 4DV6B 5LFAA 4Z5XA 4URXR 3A3PA 3HBNA 1H4SA 4W8HA 2FY8A 2GBIA 3LG2A 4JBGA 1M3SA 1N2OA 2CDNA 1GAJA 1S5PA 3M4XA 5CX1B 5CD9A 1JAHA 2IGTA 3CZMA 4E2YA 1FS5A 2EVWX 2IPMA 3DHWC 2BTOA 3H19A 1E5DA 1CR0A 1I9GA 4DIKA 2UUAB 2JPDA 1J8YF 4YQFA 3COVA 4H3VA 3P20A 1QAOA 4HYEA 4EY4A 1Y9ZA 2IRWA 4BFZA 1KZ9A 2IYUA 3D6VA 3DKKA 4WCVA 1XLTA 1SIWA 2NO4A 3R4VA 1HKUA 3KBOA 2PS0A 4G24A 5T4EA 4JJ6A 4DTIA 4E11A 4YT2A 6NULA 5SZHB 3VZDA 1MB9A 1YASA 1BE0A 9LDBA 1VE1A 3M3PA 4J1SA 1T4MA 2PO7A 2ZJ7A 2G9NA 3RUDA 2R25B 2YJ3A 3B82A 1W581 3I5UA 3FX2A 1R5JA 3ANXA 1J23A 4GNKA 4MUIA 5AO9A 2BP7A 5HQ3A 4BNXA 3PRKE 5L7WA 1GTJ1 5FIUA 1WXXA 4I1SA 2Q62A 3AZQA 4OHZA 3O8DA 4DRXB 1CVIA 1N3YA 5JI2E 4AKGA 2VYFA 4X97A 5CCBA 1D4AA 1S02A 2IYPA 3SEZA 3C4JA 1J5XA 4QNRA 2BRUA 4C0BA 4AKEA 4AO7A 4BMXA 1KSHA 3MWKA 1L5ZA 1VLVA 2XNSA 3FYHA 2QQ0A 4MP3A 4WPGA 5C8XA 1C1DB 2E85A 4V0KA 2J48A 2QVGA 1T43A 4LPSA 3TL6A 4C7XA 3IAHA 1VGQA 1TVCA 1UBOS 3DE5X 5EVJA 1LBEA 1R3DA 3SC6A 2IEIA 4DV4B 1UUFA 4ARIA 3K0HA 2P4SA 1Q7TA 1IN5A 4U2KA 3D3JA 3F5SA 2CLHB 1SCKA 1E2EA 3BCUA 3Q8XB 3B6ZA 1NQ5A 1T1GA 3PDUA 2G1JA 1KAEA 2AJTA 3S2SA 3COPA 3H2GA 2W2NA 1GWNA 3OX2A 5FT9A 3OCWA 2OG2A 2H4WA 1PK7A 1JEAA 2J4DA 1OQAA 3HB5X 3SNKA 4QUKA 3CUUA 1P31A 5KX5F 5LZ4A 3EDQA 1KI9A 2W7TA 4N1AA 3KFLA 1X8LA 2UV8A 4FJ1A 4PNEA 2YS6A 4XDGA 4KV7A 4YRGA 4RTSA 3VX4A 2ZUFA 1YZ3A 1VG9B 3U7FB 3KWMA 2RI0A 1T2NA 2YN0A 4BC1A 1YHYA 2IVFA 3TGLA 1GL9B 2JLZA 4OOEA 4E5NA 1Q50A 4L5AA 3W9BA 3WMXA 4MEAA 5B1HA 2I1QA 5F5NA 4QTZA 4LC0A 1OXSC 1MX3A 1WHSA 1Z2PX 2EFYA 4HH3C 5KYKA 3R6DA 5E6SB 1QYCA 3KLBA 3T3IA 2CL0X 2XA9A 1RXWA 2W6NA 2Z5LA 4OBWA 1W52X 1Q0RA 3OZVA 4ENVA 1QQTA 4A73A 2CMHA 2CKMA 2NYAA 3ZZ1A 2CLOB 3SDZA 1VE6A 8AT1A 2DTXA 5H5JA 5BW5A 1NNLA 4E1VA 3GFSA 1J24A 3LPMA 4TMYA 3T9FA 4S05A 2J3IA 4O1HA 5KX5B 2KB0A 2R1TA 1KYIA 3H8SA 5IU6A 2RGUA 3PITA 3UHPA 3RTAA 2GJ9A 3N87A 4G1UC 1KY5A 2UUOA 4MQBA 4RHYA 4K6KA 4Y67A 3HRKA 3GCWA 3R0ZA 3K9FC 3O2SB 4KU4A 4BNVA 1E0SA 3HY3A 1VLMA 3TTSA 3ZNOA 5B7PA 5IWCA 1I7NA 1NONA 1ZJ6A 4ZAYA 3RS8A 3UT6A 1JQBA 2GXSA 3O94A 4B5KA 5F2NA 5K5EA 1M6WA 5EHNA 1LPNA 3G68A 2IDZA 2JI7A 4MCAA 3EDMA 2EJBA 5JO9A 3HJAA 4MW7A 3CG0A 1DT3A 1KWKA 4R54A 3PTAA 3C6QA 4HL6A 4QTXA 3OEED 4TX1A 3D43A 1LLUA 2G0NA 4XGQA 4EY3A 1RQNA 3MBOA 4CBVA 4G1FA 2VRCA 1G4AE 4EW1A 1BAPA 3KUKA 5SZJA 2GRAA 4U2BA 3LH5A 1NBMD 2FW7A 5BYAA 2B8JA 3O9MA 4O2AA 3CCFA 4LVCA 2A9PA 2QKYA 3WHKA 1CZLA 3GMTA 2GEVA 1QKIA 2V8BA 5ADHA 4EF6A 2A33A 2QN2A 3HN7A 4JL5A 2QSYA 3GJ7A 4I4LA 1H6BA 2VQ6A 4M7OA 1A69A 1N8KA 2IELA 2Y4OA 3TOXA 2CYCA 4EDFA 3LHSA 4EHDA 1ORTA 4RXMA 4PHHA 4E07A 4C6RA 1UK6A 3HBLA 5FV7A 1MABA 5CEFA 1FTWA 1OBOA 1T6BY 4GI2A 2W2LA 2X9LA 4Y6GB 4QEDA 3WZLA 2O07A 4O1IA 3Q8KA 3QMMA 2GNPA 4B40A 1DZ3A 1GZ6A 1KERA 1U8CB 4CM8A 1VKNA 1T9AA 3AHGA 3EXHA 4RPKA 2HT1A 1FXUA 1T8PA 1XE3A 2HBYA 2XIQA 2Z8XA 4NRDA 1K66A 4OK6A 4V2IA 3K73O 4BO1A 2J59A 4NC9A 2ZSUA 1P9WA 3D7MA 4HVTA 4NSNA 5CH3A 1QYIA 1HLFA 4XJTA 3V4FA 3Q6MA 3SYLA 1SHKA 5C53B 5FWYA 4C7OA 5JJIA 2IYWA 3BMCA 3GU3A 2JL1A 4MMXB 1NFRA 3I42A 1ZJ5A 5C4GB 2VH2A 5B58C 1UCFA 4F3NA 4X85A 5F51A 1E2DA 2JB9A 3DSRA 2GFIA 1HV8A 1TIBA 4QASA 4KN8A 3C5WP 3RIGA 4QZVA 3S68A 2J46A 3I62A 1DE0A 4Z4QA 1XTTA 1TU0A 2A92A 2DOKA 4B2LA 5FOXA 4BYGA 3K70D 4CQLB 5DW0A 1WHTB 4LDNA 1P75A 4RK1A 3FCSB 4GWLA 1ZRSA 4MVJA 4A91A 2FMTA 3QHPA 1SOVA 3UGTA 4OHWA 2AEJA 3ZX4A 1PR3A 2B8EA 1I7DA 1S3GA 3FRJA 4NOMA 2P35A 3T8YA 4F86A 2O59A 3ILSA 1OFTA 1ZH2A 2AI2A 2ODBA 3WWCA 3V2UA 3PFBA 3RK0A 5C46F 3C3XA 2F64A 2ZUSA 1FUYB 1OR8A 4ZT2A 3EXHC 1BOFA 2H5IA 5T4HA 2QJFA 2ONCA 3TJMA 1U2TA 2YW9A 5I9NA 5D00A 3PE4A 3EXEB 3DCJA 2BP7B 2JNWA 3UKDA 5HQ3B 2P4QA 4QFBA 4BWFB 1DWUA 3RU2A 3R3XA 3TGWA 3TVYA 3BWBA 4QC2A 5C0OE 4CKBA 3AUXA 1XI2A 2PV0A 1P1FA 4FFOA 4Z4IA 3D4PA 3TMKA 3W3AA 5K3CA 1OZFA 2JEOA 2XMBA 3IX7A 4FDAA 5P21A 221PA 2BFFB 2P3OA 1I2MA 2C0PA 4IMJB 3FFAA 1C5KA 4FFVA 4U7DA 4NCBA 2CHVA 4I5GA 3PCTA 3D2LA 3IOBA 1H0SA 1DDIA 1M7HA 3I73A 3J7TA 3HGTA 4MW5A 2AJ8A 3K32A 5TARA 2ZUEA 3QBDA 4GRDA 3S1AA 3C48A 3O4RA 1W5SA 2IVZA 4AUNA 2XYHA 2ZJ5A 5HR5A 1AKUA 3N7UA 3HWWA 4DCCA 3BIXA 5KPJA 1MJ5A 1UJNA 3E9YA 3H9UA 3K92A 3KTAA 3L1JA 1VKRA 4LCJA 5KYYB 4HQ0A 2MYNA 2YDYA 4KIUA 2WE8A 1QAQA 4W99A 3C3PA 3GBPA 5GONA 3H9CA 3O73A 1JDNA 2ANCA 5FO1A 1CHDA 2R1VA 4E6PA 3DZDA 4ND8B 1U1DA 4RVFA 5EQFA 1LBQA 1YQTA 1W1WA 3H7AA 5LKAA 3HCOA 3NHMA 4JOSA 4KXMA 3DZHA 2C83A 1YBAA 3OX3A 2ZYDA 1QIMA 3ENKA 3K0EA 5K4HA 5ESXA 3OIDA 1NNSA 2G72A 4HAXA 4HEA1 4LK2A 4F5YA 4NZOA 3GLGE 1JI3A 1GN9A 2C3MA 5D85A 1U3FA 1QFXA 2P62A 2X0DA 4ZD6A 3PGJA 2HA2A 2P2DA 4FEAA 4EB6B 4TV9A 3DYIA 2VT3A 7ABPA 1MV5A 1A9PA 5L3SA 1GCAA 2QLBA 5DISB 2P11A 3PNVA 4BWYA 3LKZA 5BR4A 5CFLA 1WXEA 1I30A 2PUHA 1ADBA 3KT0A 2A1TR 2JLYA 2GF0A 3NHRA 2GQ0A 3PUWA 1L5HA 5TX7A 3WK9A 1JEQA 3ANSA 2IYLD 4MYCA 1P4AA 2V6GA 2JGAA 2XCLA 4B3GA 4LDQA 4CLDA 4UNPA 1RCUA 1SPBS 1TQ8A 1Z8FA 4OQFA 2AZMA 5BSKA 1JWAB 3Q88A 2H1HA 2W4MA 3D6TB 2WIGA 3EJ6A 3EWSA 3KPWA 1AUOA 3W05A 2Y66A 3I37X 3OOHA 4Q9NA 2V3CC 2FPRA 3CSUA 1V3UA 1CUIA 4KFTA 2Q5QA 3DGEC 1I14A 3GJ8A 2PX6A 4K0RA 4QFMA 3VAAA 3PEUA 4MQ5A 4TKVA 1ZWLA 1FYFA 3WLRA 4FC6A 2V7BA 1PO7A 1L9KA 2ZYAA 3D6JA 2O4UX 1M73E 3H5IA 3IXMA 3QJYA 1PEDA 3W7BA 3U7QB 2YJ4A 4R3UC 1NM5A 1JQ3A 1DDGA 4WD3A 1E9VA 3W1EA 3WKAA 4QWWA 2GH1A 4BUJA 4R9SA 1GAXA 5FI5A 4X00A 5FTNA 1Q0SA 4RK5A 3KQQA 2EFEB 4Q9AA 2B21A 1XJ0A 3JZDA 3U13A 1EX1A 4RVGA 2W70A 5C7IO 2HHAA 1DAPA 2WTUA 5EJ6A 1KOGA 3JD4A 1YBMA 2CB9A 3D8RA 3GLSA 4C7BA 1L5OA 3NBZC 4ARZB 3IRUA 2YN2A 4CG2A 1U8XX 3RSHA 3BCRA 5KTPA 4XWAA 4N9WA 3DCYA 1AV6A 4PGGA 5B3AA 1OBHA 1TAHA 3SYRA 3CWZA 3R6LA 4XWGA 4A1OA 5AIBA 2FE1A 2B0CA 1UJCA 5FBWB 3NBUA 3L9XA 1VG1A 2JGDB 1BWRA 3ESRA 4A2WA 3MRSA 2G1KA 2V7GA 3ANNA 1O95D 1EFPB 4GGPA 1HDXA 1G0OA 3R9IA 2PVSA 5U4QA 4A16A 3WL3A 5I9TA 4D80A 2C9DA 1CUVA 1IONA 4ZAZA 1L7DA 4DOMA 3X1MA 1AMOA 5FHRA 3IE0A 4YWJA 1Q3TA 2QRMA 4IGIA 3JQPA 4NABA 4WN3A 3MBIA 4HADA 1VIVA 1XEXB 2HSDA 4M21A 2AFVA 3CJQA 1WLYA 1W2HA 2JGIA 3L06A 3LBFA 2ID7A 4N0PA 3FHCB 3EZGA 2ZT5A 2BM8A 3TTVA 5AVVA 4MS1B 1N2BA 4BZQA 1GP2A 4HNTA 2QRQA 5EEGA 2VDNB 1U2PA 2XTZA 2O8BA 1JLMA 1RHJA 1XLVA 1Y37A 4P98A 2JKZA 2E48A 4I4TB 3RT9A 3QRWA 3PNSA 3LYLA 3RBAA 4CV1A 1SKAA 1A7UA 4KNVA 3GFOA 3ML1A 2UZ3A 5ICEA 2DXIA 3LUPA 3ETGA 4OF4A 2R6R1 4YCLA 3CWCA 5EIBC 1T2EA 4IFIA 3TLGA 4QRDA 3EHDA 2YWGA 1XJ5A 3UJDA 4EH1A 1ZNQO 4X94A 2QE7A 4L5CA 3G13A 2G28A 4DDVA 5KQSA 3IUPA 1LZKA 5L3QB 4O4IB 2BV3A 3UJPA 4K9OA 3QUTA 4IGEA 4KQIA 5BQFA 1KYWA 2NTEA 3DEAA 2OL4A 2ST1A 3D1LA 4EUEA 2HRZA 1SCNE 1EZZA 4PX5A 2ZT6A 3UJ7A 5LC1A 3HA2A 4FU0A 5LQJA 3UHOA 3MQFA 4OH7A 3GNQA 1JTVA 1OLSB 3F2IA 3C74A 3TOCA 4UEJA 3PUYA 3SQLA 3VC2A 4HFMA 1YR3A 4FHFA 4YTEA 5FBQB 1H69A 5FNVF 1MN6A 3TCXB 1XZMA 1G64A 4C06A 4DARA 1DDOA 4G63A 1QLHA 1S3FA 2Q3EA 2WY2D 3RF6A 4AT1A 1QPBA 4R8VA 1X8JA 4CMGA 4X6XA 2EDCA 2CJPA 3NBQA 1I7PA 3KR0A 4WZBE 1A9XA 2HJGA 4NFLA 1XQ1A 4TWBA 5K3EA 4W7HA 3BBLA 4OHVA 4DZRA 3H17A 1R8QA 2SCUA 3T5BA 2QENA 3NC0C 1QUEA 1EINA 1JQ5A 3LBIA 1NJFA 5FWAA 3SEQA 1NOKA 4IUYA 5HK9A 1U1IA 3K35A 1P4SA 4FDLA 2B99A 2Z98A 3V4VB 5J1TB 2Q5OA 5JC8A 4EPRA 1P7YA 1YDWA 1J7JA 3TLJA 4HUQB 1YVRA 3ZJYA 4XQGA 3AHCA 4IL5A 4YJKA 5DBOA 5JMPA 3UCEA 2LCQA 4RSGA 1EEHA 5KWVA 3IB6A 5MDHA 1X7ZB 3OHMA 5ISMA 1GPMA 3HXKA 1W19A 2LP4Y 3PC2A 2XX3A 1HE3A 4TL7A 4O3MA 3IDZA 1WSAA 1A88A 3K9NA 3GEBA 4HLCA 4Y8VA 1ZX1A 3MGGA 5KTKA 4K1LA 1BYUA 2AYZA 4V0QA 4W9RA 1ODIA 1WKBA 2VS1A 4PSCA 3KYDA 4MV3A 4ROTA 1SIBE 3A6DA 5IVIA 3BQ9A 2XKAA 1FMFA 2G4LA 1VPEA 3QNMA 3KPJA 1EFVB 5ESRA 1JPNA 4RCVA 2YNMC 1F51E 3DZCA 1S2GA 2OK8A 3EXHB 4IIXA 4PR0A 1ICIA 3IAS6 3RJMA 3CPJB 3WISA 4MRRA 3VGJA 3D8TA 2A5LA 3O2QB 4GW3A 1R12A 2A7QA 4RIHA 4UXHA 4TZ0A 3Q0TA 3VSDA 4ESOA 1CUWA 4KJZA 5BMOA 2YC2C 1TMKA 1YOVB 4RJKA 1RTTA 1U04A 3NC1C 1NBIA 3G89A 3WTCA 4E2XA 4BQRA 2IPLA 4HS9A 4GZ5A 1AO3A 1L5YA 4BO8A 1HEIA 1CJMA 4MUNA 3WNBA 4PTLA 1ZK0A 1SVKA 4HZGA 4HRXA 5G40A 4FFBB 3VKVA 5KB3A 3RC8A 1CQXA 1E4EA 2CK3A 1MFZA 3N8DA 3RWBA 4DMRA 1FDSA 2NQ8A 1B93A 3HN6A 2HOQA 5LZ2A 4UTPA 3GAMA 3CUKA 4HGOA 4Q16A 1EE9A 1EG2A 4MDFA 1ZEJA 1FBNA 3VJRA 2A30A 4P22A 5CVJA 2Q7OE 5ABPA 3P4XA 3L0ZA 3KJZA 4A10A 3DBLA 1I8TA 1M0TA 3ORFA 5J58A 1WS6A 3KSMA 4NE2A 4NZZA 1ZGBA 2WVGA 4YP0A 3UMRA 2XMGA 2VIIA 3PNKA 1TVKB 2VA9A 3ME5A 3LVRE 1QK4A 4FFNA 4RU1A 3SJ7A 4B6RA 1BJKA 4DSUA 1KJJA 1N6PA 1UPCA 1ZJYA 3CNLA 3ETJA 4MQEA 4ZVKA 3UBTA 1KK0A 4FNGA 2H1LA 3I92A 3VZPA 3EG5A 1JR4A 3K9BA 4KQ1A 4YCJA 2JIQA 3EVEA 2HK7A 1Z2OX 4WEOA 4YAFA 5FI3A 5LQDA 2QX4A 1KI2A 4K46A 2X7JA 4TQAA 5JV5A 1QF6A 1YJQA 2QVBA 2WDZA 4ZOBA 5IVHA 5TMDA 4OU4A 1MJGM 2QRZA 1GG8A 5JFTA 4I50A 3VPHA 4ASUA 1DXYA 2QRVB 4N03A 2I67A 2VDWB 4EW6A 4KFUA 2EFGA 3DWIA 1TD9A 3I9V6 3TSWA 5EHZA 1GM5A 4J0HA 4FGWA 3NANA 4WBSA 4Y7DA 3D0RA 3QYJA 1RXCA 1O54A 1WX1A 3I6BA 4BZXA 1LTHR 1G2OA 2O19A 4P6VF 4RZUA 3D6NB 2EKPA 1J0EA 1SC4A 3BH0A 4KK3A 4YMVA 4HLUA 4RMJA 3OZWA 4O1MA 1B0UA 2XV1A 2ZVJA 4KDFA 3I9NA 3H5AA 2A0YA 3IUQA 5JAZA 3DJFA 3OC0A 4PPQA 5CLLA 1HDCA 3RSFA 4REOA 2X2FA 2C7RA 3P9SA 4DLBA 5LIRA 1A9TA 2V6IA 1QS0A 1NNEA 5JDIA 4S24A 4LHZA 3KHTA 1T8TA 4L6AA 4TV8A 1AKTA 1JS1X 1FTNA 1WW8A 3N0WA 2D1SA 2DVMA 4R8SA 4TN1A 2HPZA 3RAGA 1M2VB 3ROTA 4RLHA 2O14A 1RZRA 3CM0A 3IOCA 3ESCA 2GVDC 3LUDA 3OEWA 3R5TA 4Y6SA 3V6LA 2I22A 4PPYA 2XRFA 3D7LA 2FGJA 1P3DA 1SUEA 2IH5A 5IC5A 3F90A 1QKJA 4PYMA 4A8JC 1GFIA 1X1BA 3FUUA 3MCZA 1KO1A 1MRZA 3UJBA 4BFWA 4RIFA 2XCSB 2ADFA 3CZ5A 3DV0B 2A4KA 4GM0A 1SM4A 1KOLA 4B48A 5F21A 5HJ7A 1ZOLA 3QEBZ 3K2EA 2C94A 3BRSA 2GCOA 1W0KA 3H6HA 5COBA 3AVPA 2WKRA 1A2OA 1CEXA 5AP9A 2BM1A 3OQ6A 1U8ZA 3H05A 3PFKA 5IJWA 1Y3BE 2H51A 2I87A 5I9LA 2Q1UA 2KE5A 1XZAA 2PMKA 3HUUA 4IV8A 2RHGB 4IKEA 4AS2A 2OHHA 2OHJA 2LUOA 3I34X 4DJ5X 5D7NA 5A3RA 3VPSA 4NXMB 4BNKA 1U2GA 3AU8A 5DM70 2CHGA 3NBAA 1FYVA 2OT3B 4J1QA 3RIMA 3ZV4A 1U0NA 3UJ8A 4H6XA 5DNWA 3R74A 3F6RA 1YNOA 5ETJA 3BWVA 4CT0A 4DKXA 3STYA 4DWJA 1GZUA 1JSLA 4G0QA 3I3OA 3GAAA 4C04A 5DBGA 1RPZA 1N9GA 1PVDA 4F38A 4MA4A 4CYMA 4BQIA 3L0IB 4ND8A 2PGAA 3FNGA 5A4JA 3L41A 4BO2A 2MSDB 4ZYWA 5C7LO 4I2NA 4PG8A 1HKHA 1PFKA 3W4KA 2HDHA 4PC3A 3EEBA 1D2CA 1LZLA 4IHKA 3CW8X 3OCYA 1CUCA 1R6BX 2X5OA 1KO4A 3ZCPA 4CQLA 4D6PA 1FFWA 4BLVA 1X80B 4QU5A 5TDHA 3D4NA 2D5LA 2H3HA 4R8MA 1GVHA 4GQBA 3RTGA 4UM7A 2C58A 2FMFA 4CIYA 3FMFA 4KYVA 4HJRA 3JQEA 3LDFA 5C7YA 1W9HA 3E7XA 1WCIA 2C9YA 1PV2A 1UXKA 3HYNA 3I6IA 5EE0A 3T9DA 1PR0A 2GESA 1G38A 2D8AA 5ITVA 2XQVA 2DJ5A 4DJDC 2AMFA 4K2HA 4NU0A 4XB6B 4ZQHA 5DPMA 2LE0A 1VFPA 2NZYA 3EUFA 1QGUB 2H54A 3FWYA 3FR7A 5FFFA 2OFOA 1RXEA 5E7MA 4JI7B 2QZSA 2WKWA 4QOFA 1JIJA 2PUGA 3P9PA 5C5DA 1N0IA 3UT5A 5EJ7A 4DG9A 1Z4KA 2ZAMA 4PNZA 5CA1F 4OHYA 1Z13A 4Y1EA 4RTOA 4A23A 2QXUA 2CXOA 2WILA 2E49A 1J2YA 1JKFA 2AD5A 1CJVC 3LDAA 4MVJD 4NU5A 4WWHA 1UAAA 3QOYA 1U9YA 2WD8A 2NU6A 5IULC 1E1YA 4TS3A 4KUGA 5JADA 1SXGA 4JQZA 4KODA 4JLUA 2FG7C 2HPVA 3WV4A 1CPYA 4MR7B 5EXXA 4IZIA 1E69A 2WJIA 5IP5A 1AM4D 2DMRA 3KSAC 4UREA 5EGSA 3E3MA 2YDXA 4NJEB 3KWFA 1KC1A 2FXVA 3GROA 1LNZA 1GD1O 2IOHA 2W6MA 4R8RA 2GCGA 5J4VA 3GYGA 1SEVA 2XI4A 3L8DA 4OQQA 1UXJA 2C9BA 2PL5A 4GSKA 3FAZA 1TQ6A 1HT2E 2I99A 2O0JA 3GMIA 3IGFA 5T6BA 3TE6A 4B6EA 5BSTA 5BN4A 3NBMA 2FPPA 2VBGA 4HTAA 1SOAA 4V1CB 5KTYA 4YJFB 4YP6A 5HDQA 3ZXXA 3LI2A 2G70A 4G5GA 3V8BA 3H5WA 4UPEA 3A1NA 3H3JA 1CLEA 4QDTA 3L93A 1T0JB 1SOMA 4UDOA 1WW2A 2ZS7A 1QU2A 3K6RA 4R69A 2C3OA 3RV3A 4GI3A 3ZNPA 4FMPA 5H70A 5PNTA 1F8YA 3AF0A 3WY9A 1GUFA 1ADJA 3DXFA 3UOAB 4F3CA 4CEIB 3PJGA 3OE5A 5FBHA 1ZN7A 4WCFB 4KE7A 2PO5A 4H1WA 1WDKA 2BI8A 3PGLA 4HYTA 1KNQA 3DYVA 3KOYA 3OIUA 4YCSA 2BGMA 1AV7A 3F0TA 5A1JA 1PHPA 3M81A 4X8MA 1RCFA 3MUNA 3OVMA 4TZKA 1DHTA 1JIXA 3DE1X 4DQXA 2B4YA 4F7WA 4RTLA 3FA2A 3KPVA 3KYDB 5MHTA 5EJ2A 1CDZA 1OX6A 1YUBA 3QPUA 3WIBA 2RONA 1UWVA 4LDJA 4NCAA 3DOHA 1XXHE 3F4KA 4HXEB 4BVFA 4HZIA 2NV6A 2BEKA 1VLHA 2NACA 2PNJA 1UMCB 5CFPA 1QVRA 5IBCA 1U3WA 1FSFA 1RLMA 1Z74A 2A58A 1TQHA 3D0KA 1KXJA 4PS1A 2E4ZA 4O2BF 1XKTA 4OKIA 4AJ4A 4GC9A 2R97A 1SKBA 2AI1A 2X1MA 4OHUA 4YRRA 3DE7X 4ZU3A 2D2EA 1KFCB 5IYZF 3ZVRA 3MD9A 3THWB 2RB5A 2H9IA 2M1ZA 2RG7A 3R5SA 4NFSA 1GFWA 4ZI7B 3AF5A 1FW6A 3SQMA 3B1KA 4XWYA 5DGXA 4C7MA 4W5NA 1O4VA 3M6XA 3Q3HA 3GWGA 5BWLA 1RHKA 4M98A 4TTSA 5L3QA 3T7SA 1IXRC 1NPDA 1QIKA 3MINB 1DJMA 3S5JA 2OYSA 4OH1A 4JNKA 4Z1OA 4B3BA 1KJZA 3L7DA 1M2NA 2W8BA 4N3GA 3M70A 2H63A 2CFCA 3G2OA 1KVRA 4BNLA 4YAGA 1J1IA 3D6MA 3FFXA 4TYWA 1TZBA 1P9OA 1XZCA 1R0YA 3H6KA 2WUWE 3PCXA 3RNLA 3CNBA 2AMVA 6GPBA 2WJAA 2Z3WA 3IOYA 3NWPA 5F52A 2EZUA 2DRIA 2ZB2A 3BE4A 4M38A 1OI7A 4OXNA 1SWVA 2Y1FA 1ZL2A 1GL3A 4NYIQ 3B7GA 4PF1A 4EA9A 2UU9B 1DUVG 3QVWA 1PNOA 1Q0HA 3BORA 1X38A 1Y81A 3JQAD 4DIMA 1S0UA 1VL6A 4F5EA 4HNHA 4KE6A 5EKSA 4M7WA 3TSOA 1J2JA 1Z16A 1GKIA 1W30A 2VNHA 1SU8A 4KUHA 3C7TA 2XTMA 3N2GA 3ZWAA 4C0AC 3AFOA 2DULA 2EP8A 4LRUA 2JHGA 1JTFA 1FYWA 1S2NA 3NCHA 1W6RA 2RSLA 3N6RA 4PU0A 5H81A 2QMHA 3KU4A 2P91A 4CETA 1LBSA 2AVNA 1N2CE 2NSJA 3D64A 3QI2A 2XT6A 4ME6A 5A9RA 5IASA 4QKQA 1F60A 3JWHA 2ZANA 2G9VA 4JGBA 3CZPA 1U5AA 1NBWB 3KT6A 3QEMB 4AX8A 4BNJA 2WJZB 1N77A 3GVXA 4HUQA 2XAAA 4YYZA 3MG9A 2IFTA 1H93A 3P2YA 4ZQBA 3RVMA 4BAGA 4DY6A 3GN2A 3R3YA 2NU7B 1VCHA 4GIBA 1JJ7A 2ZYHA 3ZXYA 3U7GA 1NHWA 3CXUA 4Y2SA 4YECA 1DBIA 3FNHA 3JD0A 4G9GA 4MS4A 2RK6A 1IG3A 2HD4A 1NMXA 4DV3B 1OTHA 3OURA 1UBUS 3UGJA 5G0SA 3L7BA 2CB0A 1K86A 1GSOA 3LXRA 4YMUA 3OFND 4ABYA 4EHJA 5DN6A 2IP4A 4L5JA 5KVVA 5I3CA 2BC9A 1NZJA 3Q0IA 4AMZA 2NIPA 3DOOA 4QEKA 3QKTA 4U0JA 4R1LA 1UK8A 1XNGA 5LMUB 3OFVA 1CZNA 1JH8A 3FPBA 3P9NA 1GV0A 1XTKA 1IHDA 2QRVA 4DDUA 4RPHA 1OIWA 4EYGA 2C9CA 3GO4A 3LOUA 3U4CA 1UMBA 2I55A 2VK1A 2IHJA 3ZY2A 1CU1A 1R0CA 5NULA 5DTJA 5ALRA 3W8RA 1NVXQ 4OO3A 4I36A 4ZJPA 2E18A 3FCUB 2G8LA 5THXA 4ZAFA 2OZVA 3EC7A 2FI1A 3G0IA 1I1NA 1R0XA 3FOEC 2QMZA 1C9MA 5HJ5A 4L75A 1C1DA 1CY1A 3IEXA 5IVDA 1ABEA 4JC0A 4F6LA 1K5HA 1L8LA 2CVOA 1V35A 2CF5A 3CJRA 4FYIA 1FVOA 4HZUB 5JAOA 2QXYA 3BK7A 4KQJA 1VHQA 5IDVA 3EE6A 8OHMA 2GOYA 1M7GA 3QU9A 3D6AA 4RPGA 4DA0A 4R2IA 1FXWF 3AEQA 4P7JA 4RJ2A 2YWXA 2X41A 1O9GA 3EZXA 3OJCA 4G86A 4OEHA 1DHRA 4DIFA 1OBCA 2FKNA 5JYDA 1PR9A 4UUAA 4S1TA 4U2EA 3HCCA 4E31A 5CB4F 2FKAA 5KNBA 3T5AA 1NMQA 4BVBA 2XGGA 3BXPA 2WG1A 3DP7A 3PHGA 2VWQA 1JIUA 2O1SA 2E9SA 4LDZA 1YQUA 2O3SA 3MUOA 5ENZA 2DTEA 3WL4A 2VHQA 4H1UA 3HZZA 3JATB 2C61A 4TRJA 2V3VA 3JASB 3KXKA 1Z28A 1AG9A 3PE6A 2VBIA 4INZA 4K9SA 5A62A 2HLPA 2PUBA 5KREA 3IA2A 4L22A 2V9PA 1F9AA 3I01M 1G291 1F8GA 1I4DD 1J8DA 1FNCA 1Q1BA 1XYGA 3BA6A 3H9JA 3P19A 5DYIA 5AVOA 2FPMA 1SCUA 5CT9A 4JI4B 4PBTA 2NV0A 2P1DA 1BHQ1 2PD3A 1K4MA 3BXHA 4IJWA 2Q1TA 1QYVA 3ZE9A 2XVYA 2XDWA 5C31A 2HUPA 2I7XA 2NGRA 2WYHA 1RYZA 1ULBA 4GC5A 3MJHA 4LZZA 3ZDXB 4JVSB 2NZVG 4EGCB 1QJ4A 2N3ZA 2YH2A 1JLRA 2NXNA 3ZVNA 3OA0A 1ZI8A 4CIBA 2VDOB 2R8OA 3UV6A 5DIZA 2CXHA 3MUEA 3SC2B 1N9GB 3FH0A 5B7QA 3BMXA 4HVAA 4Q24A 4CKCB 3MC1A 3TN7A 1IBRA 1DKQA 4OGFA 4MPRA 1B6SA 2UUBB 3AETB 1VSTA 3A70A 4H6VA 3R5FA 4L0DA 4PGAA 4Q00A 4CKCA 5KNCD 4DBZA 1GARA 1M83A 2Y05A 3B3JA 3EPKA 4CHGA 1D0VA 3UJHA 2ZP1A 2VHXA 1NA5A 5DCWA 2XBUA 4X62B 3DFMA 2H06A 3AF2A 1RWWA 4URWR 1YR7A 3VNBA 2OORA 4EFLA 3RVJA 2H0RA 2BFOA 4AJ1A 2H9AA 2DWUA 4D6YA 4X7BA 4QXMA 4BN4A 3OKPA 4CU2A 4ENUA 5A1TA 5IEBA 2NZJA 3OFJA 5LKRA 4PYKA 3WGIA 2D7CA 2PWAA 1EK2A 1CS0A 2CUKA 3KVRA 1GUYA 2FYTA 1EP9A 3B9BA 4BJ3A 1ZVJA 1GPJA 2P6RA 2RHRA 4PVCA 2WA1A 3CVOA 5C7OO 1YVPA 4DDHA 5JJKA 4WLFA 3WKBA 1Z7WA 1TK2A 2KI5A 1NXQA 1WNTA 2REQA 3C8UA 4D3ZA 3PDIA 2R6HA 1DVRA 1LSUA 1DPFA 3L4KA 3LYAA 4C7OB 3HJFA 3E7DA 2C3UA 5B4TA 4LF4B 2QDKA 1NI5A 3GD5A 2ALJA 1RAGA 1IZ0A 1JEOA 1EG7A 4MVJE 3OTQA 2ZFUA 4ZOAA 4M53A 4PAGA 4ZC1A 5HJEA 3WLFA 3EMBA 2FUNB 5BQ3A 3HVIA 3OE1A 1MAAA 4RD3A 4XCQA 1XDWA 1D2AA 4FCTA 5DGIA 4EGJA 4MVJM 1XTQA 1EXMA 3COWA 4IOLA 3SFTA 1Z0KA 1Z47A 1SKYE 3AR7A 4O4HA 2ZYTX 5HZGA 1H0HA 1PFWA 4UJ3A 3VPDA 2AB0A 1PTJA 3LIPA 3OLQA 3V5NA 4D9BA 5TE9A 1QX3A 1RYFA 3UUWA 1Z7BA 3UHFA 3WVNA 4IHJF 1N2CA 1RAEA 4Q01A 1V2HE 1SHLA 2JJ1A 3L04A 1CEEA 3EPRA 2C3PA 2VK2A 4N5IX 3A1FA 4Q37A 4Z9FA 4PGMA 2HT6A 2JC3A 4IILA 1GY8A 2DECA 5HK8A 4TV8B 5I9MA 5ARDA 2B30A 1BIFA 3JQGA 4RZ3A 4BWVA 3H18A 3PHLA 4BCBA 5JD4A 2XAUA 5BUSA 1UBGA 1P7VA 2W2VA 1XLWA 4OM7A 1TW2A 2WU0A 5L7YA 1T34A 5I8WA 1HTTA 1PSDA 4V24A 5J63A 4YUVA 2ONKA 4XQEA 4MUFA 5C3MA 4FJ0A 2CUZA 4I3HA 3HKEA 4XQCA 1EK0A 1V5IA 3CISA 5IT9A 2J31A 1RJWA 2YCLA 3WGNA 2Q9CA 2W98A 3L8ZA 4MVWA 1V48A 4NK5A 4QELA 3RVLA 3IMGA 3OZXA 1PNRA 3M5PA 3SBEA 4BBPA 4RY2A 4P82A 1Z5GA 5KNBH 1OUMA 3UAVA 1N75A 3VKGA 3R5KA 3T52A 1O94C 1WMAA 5IBPA 2I7VA 4G4IA 1MEOA 3O6VA 2VZLA 4N3CA 1O3YA 2RGNA 3EK2A 1P8AA 5FOSA 2E55A 5KOYA 4DADA 3FSGD 3L46A 1QDLB 5D8DA 2V98A 4P4UA 2DCMA 3MTAA 1UDBA 3AFMA 3K6JA 2PS9A 4ZO4A 1GTMA 2ZWPA 1GZSA 4M1SA 4G8BA 5JRZA 3T3HA 4F9FA 3DT8A 2GCNA 3F9RA 3BXEA 4BP1A 1VLZA 4U6SA 3ON5A 4LJ5A 3LLCA 1XFAA 3AHDA 5AOBA 2K87A 1YZQA 4BTVA 2XYPA 2YUIA 3BAFA 4L78A 3G1TA 3B85A 5AUNB 1H2WA 4ENRA 3O3NB 1WAMA 2XUJA 3UAXA 3TD2A 3INTA 4YR9A 2RD2A 3SX0A 1NDQA 3CNEA 2MSNA 3LQ2A 1OAOC 3RBXA 2AYYA 5LU8A 2XUKA 3JALA 4JJ8A 3I5XA 6ABPA 3COJA 1Z18A 2RAUA 3M9XA 1OLXA 3AK4A 1T5SA 1MJHA 1A9ZA 3OMLA 1KI6B 2AEFA 3BICA 3G0OA 1SCDA 1ZRHA 2FSVC 2GS9A 5AJHA 4D99A 5HZHA 3EFBA 2B7BA 3PUJA 1AURA 5BMVB 1Z2DA 4YRAA 4IH1A 6LDHA 2ZIGA 3QKWA 2X6QA 2P8SA 3QEKA 4DE5A 5AVTA 3CX3A 4F9EA 3JRWA 4UXIA 3IKTA 3PWSA 2ODQA 3AP3A 1FUEA 5LJIA 1EA7A 2BM9A 1Q14A 2O0HA 4MWTA 2XTNA 3I8SA 1Y4UA 5DXAA 5LA6A 4BATA 4K05A 2VTKA 4TV9F 2CHQA 3TUIC 3N07A 4EKDA 2WNHA 1FFXA 4TWZA 1FNNA 3CF2A 1UBCA 2I7TA 1QRDA 3CO0S 2IZ6A 5AUPB 3E5HA 4PAOA 3ZH2A 1MDFA 1V5FA 4HPXB 4BNMA 4G0ZA 5I45A 2QUBA 3WQRA 5AM3A 3PFFA 2JIOA 5E6UA 3O93A 1SXQA 1DO2A 1WOYA 2WHQA 1HQCA 2FW9A 4PC2A 4MHSA 4CCAA 4Z8YA 1HNZB 2ZJAA 4KR2A 3RBZA 2PYZA 4TN5A 3ZCUA 3FOAA 3DOIA 1PVOA 4UHHA 1IEVA 2I4MA 2IJGX 2X5JO 1GIAA 3IT2A 5A5EA 2LVBA 1QORA 5JCPA 2GLTA 2WB4A 2YMMA 4QARA 1W94A 4N5DA 4BNYA 2YV3A 2NLOA 1UC9A 2ZWMA 1JHQA 2XUZA 1DI0A 5ED4A 2GK7A 1TJPB 1CW2B 4QGFA 1D9ZA 1UDCA 1JW9B 3E9QA 3EXG2 3C45A 2BFBB 5DEOA 5ALNA 2J9ZB 3WQHA 4WBNB 4KMMA 3DEJA 4DA8A 2YYAA 4YMHA 3W9UA 1C7IA 3PRYA 4Q7QA 3A11A 2XHZA 1RD4A 5KVAA 1ACLA 1LW6E 1PK8A 3LBAA 5EZYF 1XG5A 3EFHA 1YJXA 2PQ0A 5IAGA 4D9HA 3ZY4A 1QDUA 2BMAA 3C1UA 2Z09A 1YZTA 1YZVA 4AICA 1L8QA 3HFRA 3TRJA 5DW3A 2UVPA 4RGVA 3G79A 3NHZA 4NBVA 1OV6A 4TMFA 2GMWA 3H0EA 1I3CA 1EIZA 1YS2X 3OOSA 4J0JA 2V4UA 4X92A 3TQFA 4URVR 4NFHA 2CFTA 3PGXA 1IPFA 1VLJA 2ROQA 2H4XA 1FP6A 1H8EA 3DMTA 4RNCA 2MWMA 1BMFA 2YIDA 4NZNA 4BDTA 2I6UA 1YCFA 1G3UA 3LO8A 3ZDZB 4IJVA 4QTTB 4YMLA 1Y89A 5HBRA 2KLBA 3K15A 2TS1A 3I39X 1CWUA 2DKFA 3L84A 2CXNA 4P3NA 2AMLA 3ABQB 1H23A 3F96A 3J81A 1Z88A 2ZJBA 3R5JA 2PX8A 1ECCA 4BZZA 1UMCA 3ZJUA 3QG1A 3OZ7A 2WHPA 4OQYA 4PRKA 2Q3DA 3QF7A 1FVFA 2GD6A 2NSDA 4W1QA 4E5YA 2OLKA 3P26A 5TMEA 4JJKA 1MX9A 3HE3A 6AT1A 1ORRA 2KYRA 4OYYA 3L02A 3BB3A 2Z9DA 1E2KA 4QUHA 3GLIE 4DIUA 3ASYA 1ZC3A 1C7JA 4Z0NA 1H5QA 3WWDA 1J33A 3R4CA 3EH1A 3DZFA 3WBKA 3PWTA 1X1DA 3OIVA 1YRQA 4XZ3A 2D62A 3NVMB 5KYVA 3W2GA 3WJ7A 1Y4AE 5C2JB 1I80A 4MUXA 1R0RE 1DO0A 1XWFA 4FGJA 5BN5B 5CDUA 1BN6A 4EMBA 4I19A 3PPWA 3DHEA 1PL6A 1WKVA 4RMNA 5IH7A 4F4DA 1EBUA 5IDQA 1UJMA 1Y9DA 3CLSD 4AMUA 1FFEA 2GO1A 1RZRD 2FZEA 2NUAA 5K1ZA 3TNLA 1G2PA 2KW5A 2NTJA 2VI5A 5TXGA 2FEXA 4D3YA 4H27A 2A4MA 2QLTA 3ZC3A 4MAMA 2RH9B 1HYEA 1O58A 1JEJA 2YXDA 2X2EA 4LBVA 3VH2A 2ONJA 4AC9A 1UKAA 4EWLA 1P0QA 1B0AA 2ISCA 3HJNA 3UMGA 1I24A 3TDNA 4EB3A 1G6OA 5HFNA 2CV1A 2Q5IA 3GOQA 3DP9A 3T7JA 1YI1A 5L95A 2G4CA 1IOLA 4O2AF 2OGZA 4QJIA 5JT1A 4MOWA 2QAGA 1AGRA 1HC7A 1OXTA 3HQ4O 4I3FA 4C43A 1KRXA 1I5OA 1P9RA 3HKCB 4J3NA 3KFXA 4JT4A 2P6OA 4EGSA 4HAIA 5JECA 3K3PA 4O4LF 2XR1A 4HK4A 3GXOA 4HBZA 4RC9A 5IRCD 1NVVR 3VHQA 3ZXSA 3F5MA 2QVXX 3MJVA 3OF5A 5LUBA 1EGVB 1X77A 3GLGB 4UZSA 2R84A 1GGNA 4KGDA 1F0PA 3E61A 3NTXA 3SXJA 2O2DA 1U02A 5H0IA 1JG6A 2PT5A 3QX9A 1XPUA 1DUSA 3BMCB 1FDWA 1G6HA 3BRQA 4LZAA 3NIDB 4K8OA 1XD2B 4LFAB 3WQQA 5HHTA 3CEPB 3AB3A 2HNAA 3D4LA 4F8YA 3NPAA 1R8XA 3LC0A 3SZUA 5JXWA 4FIZA 2QRHA 2BFDB 4MTLA 3HEMA 3STTA 4HT3B 5BPHA 1CIPA 3W5IA 1AKQA 1RHQA 4I1PA 3IVCA 4S0XA 4XGKA 1FDIA 4PLFA 5BO5A 3ELUA 3SR3A 4ER5A 4CM8B 2XDYA 2V7TA 2OHGA 5F1OA 5JR3A 3H4MA 4CKEA 2A78A 2O2SA 2IQ5A 1N3IA 4MLPA 4WOJA 5K3AA 4UVGA 3RFFA 1Z4OA 3RDPA 4F4CA 1RC0A 4G26A 3FYDA 3N9IA 2J7PA 2FPGB 3IAXA 4EB0A 4JGGA 1BKYA 4C5BA 3RC1A 1KPGA 1USVA 3JQBA 3JXEA 1SJ9A 2HF9A 3I3SR 2ODNA 4DCVA 2IF2A 4AKIA 3RYIB 4KEAA 2NT3A 4MKZA 3QX8A 4EI7A 4REMA 4X7MA 1N1DA 2Q5CA 3HDQA 2ZJYA 3GRUA 3K8YA 1BEEA 1WP9A 2CL5A 4MB6A 1C7RA 4JBWA 4BU0A 1YC5A 3KOWA 2VP3A 3GFPA 5TJ9A 1SKYB 1T8WA 2QLLA 2GHRA 2ECPA 3FSGA 1B73A 1GUBA 2J6BA 1JTEA 1JB1A 4MWGA 1UEXC 4UM8B 2ECOA 1LKZA 3IDQA 4OQLA 2MOKA 1XJQA 1W25A 5SICE 1RE0A 2JHCA 3RAEC 1E0JA 3IQHX 3MJSA 2WQ6A 1VHTA 1TK9A 4Q4DA 2PGLA 8MHTA 4BN0A 1EB8A 3I6ZA 1BYIA 3PIRA 3DBRB 3FMOB 1FOEB 3IOEA 1JH9A 4IICA 4KYTA 4XH9B 3QMPA 1HM5A 1VKZA 4U9IS 5DZSA 1BGWA 3SE7A 4IEEA 4NMMA 2OWEA 4DLXA 1VHJA 3DO8A 1YACA 4BY9E 1MRNA 1F2VA 1HDGO 3ORQA 4ZAXA 2OCAA 1ZHOA 2X22A 4F4JA 2ECFA 4W1PA 2C2MA 4EHHA 1SZJG 1NN3A 5CUQA 1YZYA 3PDCA 1WZUA 3DV0A 3FPFA 1UT6A 3FMPB 4U7TB 4ZARA 1LPOA 1KU0A 3KR9A 3I0MA 1EVZA 1XXHB 2NU6B 3I9KA 3NHFA 4IVRA 1OYYA 5HG0A 2R1UA 3TQOA 5ADUS 3CX8A 3X1KA 3EPJA 1WUYA 5LZ7A 2GCEA 2VT2A 2YWDA 4Y9DA 4B3JA 3BKWA 1IZYA 2JIMA 1QB7A 1RZUA 1Y7LA 3GPBA 1ST2A 3EOAI 3RT1A 3ESQA 4FR2A 4M1KA 3SEFA 1WPXA 2ID9A 4FUTA 5A06A 1L7EA 3KLMX 2GKSA 1ZN9A 2FZVA 5HKLA 2QZZA 1F2TA 3GPDG 1XPOA 1ODTC 2A3NA 2XNDA 4TM8A 1J5PA 3GCZA 5EG5A 1YQQA 1WY5A 1RLUA 1UQTA 1G42A 3GEDA 5SY4A 4DR7B 1TF5A 4IIUA 1G8SA 4DT1B 4E21A 1P2TA 2JFVA 1FFXB 1NJ5A 3K5HA 3RS5A 3KHUA 1DG3A 2RHLA 5I5GA 1PGOA 4HDSA 1NR7A 1RYNA 3SM9A 3EVNA 4R5MA 1B2LA 2PBRA 1GQFA 1T5BA 2YVQA 3K4QA 4JKYA 5T8KC 5JJBA 3GC6A 2J85A 2IYYA 5IKEA 2NSHA 5J23A 4A2PA 4O2BA 4O4JB 1VP9A 2BLNA 2KBEA 2JLCA 2GNAA 3AUSA 3AU9A 3GT3A 3KSRA 3L8EA 2AJLI 4G67A 2DF8A 4QJBA 1A8PA 4YONB 3QE9Y 3BEOA 1GCGA 3WYNA 3OUUA 2P6UA 1MNQA 3CLSC 2XQKA 2PV7A 2TMGA 4ZGBA 4JR2A 1NSTA 1I94B 3H86A 2OEPA 5DTEA 3GJ4A 5DM0A 5KS2A 1RQGA 4ZZ3A 2HMVA 5K0CA 4DR5B 4LI3X 5J2TA 1YFZA 1TMYA 1KVTA 1KSGA 1J0DA 2AXNA 4B7CA 3WV5A 2XZTA 3E9DA 3LK6A 1CQJB 1RRVA 3F7NA 4B3DA 4FN5A 5B2EA 4JI1B 5HYVA 3ROPA 1DNPA 4QDKA 3JR3A 2G04A 3IBSA 1OLSA 2E2WA 3HKCA 4YEDA 4E32A 3UZUA 4EQZA 1E79A 4YHHB 1IBKB 1ETHA 2EFHB 1FNSA 2I7DA 3MXTA 2GN2A 2RGDA 3MTBA 2QU7A 2WF5A 3MWEA 3WP1B 4C01A 4XA8A 1C4WA 1L4GA 4L72A 2MCFA 4EYKA 2R68A 2H5EA 2CYAA 1SHZA 3KZKA 4OKSA 5KCMA 3NHWA 4MEJA 3JPYA 2VNIA 2GTIA 4NDAA 4MRSA 2Q2NA 3OLCX 1C3OA 3C3WA 5DIFA 5F73A 1HWYA 4FYVA 1BFUA 3EIUA 4M9CA 2CJFA 4PGHA 2ISSD 1TZ2A 1I6MA 1ZAKA 4P4LA 1XTSA 2J3QA 2VG8A 5E7JA 1FTSA 5FPYA 1P5HA 1FLVA 2GVZC 1O03A 4RLFA 1FFYA 1EX7A 2GPBA 3G9QA 3PF9A 2EJUA 4TLDA 3RRFA 3I5YA 3SKXA 2PBZA 1W1UA 1TCAA 3OZRA 3EY9A 1L4YA 1FVHA 4HQNA 1E6CA 3BS4A 4ADSG 3RUAA 2YMPA 4CQNA 4UTNA 4LX0A 4MGYR 3RHTA 2HLHA 2WV9A 3HPQA 4X6YA 1A9SA 5C18A 4FEEA 1N5RA 1QG6A 4Y7CA 2YFQA 1F0NA 1XWIA 4ZAVA 1L1FA 2HIGA 2W83A 4I0WB 4NS4A 1YE3A 2XECA 3W1WA 5IJ0A 2C99A 1I7SB 4AY4A 5U9CA 2JBWA 1QVVA 4Z86A 3F73A 4W63A 2HDOA 2ZYUX 3AKDA 3B6IA 3HCPA 3TNJA 2A94A 3EGVA 4UBLA 1TJNA 4EG4A 2IIQA 1OBVA 2VDRB 3DBHB 2CZCA 3GL9A 4AJNA 5GV7A 3RQIA 4Y6RA 5CVDA 5J5VA 1LRKA 1MXHA 4TL8A 3VI4B 3UC9A 3V4OA 4JXXA 4XSVA 3QGMA 4DSNA 3CRZA 2QAJA 1MQSA 1DIAA 1U2EA 1X1RA 1M2JA 2DU8A 2VCYA 3ETEA 3IVRA 3T41A 3CGWA 2VCHA 3EIXA 3KZVA 2VHEA 1MJNA 3L8HA 1CY8A 2ZRFA 4RKFA 4E51A 3D7RA 1VCNA 2WG0A 3TLKA 4EHKA 1GYQA 1FUKA 2RC6A 4FFWA 2ORED 3ZHCA 5E8RA 5IWAB 3A7DA 1AGXA 1AK9A 2D7DA 3SFZA 2QTVB 3ZDAA 1TAGA 5FBLB 1NSFA 1R9NA 1Q19A 2REXB 1UIMA 4UE2A 4C2BA 3PLAE 1Z29A 4GVLA 3R3ZA 2ZYVX 5EUQB 1TZKA 4DWVA 3G7UA 2PRKA 3AQ4A 5HKKD 4GDFA 5K8LA 2IS4A 3B9PA 4II3A 2FWIA 2FXIA 2P4HX 3LFTA 2W90A 1XJWA 3BREA 3ILVA 5ICCA 5JFOA 5EJEA 1ULHA 1M0WA 4LJ8A 4N3NA 4MV9A 3STHA 5KIAA 1H4TA 2F9LA 1DAGA 2H3EA 2Y1EA 3GLGA 1H6DA 2P0AA 2GJAA 2P9GA 2PSSA 4QX6A 5ALTA 3QWAA 1SU6A 2WT4A 1YB5A 3SKVA 3AFGA 3ANTA 4PLHA 4QFDA 1SIOA 5DULA 1FX0A 3WNQA 3EQ6A 1HRDA 2I5PO 3FTPA 3ABRB 1XXHA 2JGDA 2NX2A 4FDUA 4I99A 4D45A 5K8UA 3IDFA 5K3FB 4YI3A 2GBGA 5DK4A 5CLFA 2XMPA 4A0SA 5HP4A 3EQ2A 2HIHA 3HB0A 4MJXA 5KMGB 2UKDA 4L76A 1GU7A 3BULA 4ZRDA 1ZCAA 3FWPA 1UQRA 3UHJA 1TTTA 2X4IA 5ALUA 1GNSA 1RE1A 3O03A 3PTLA 2VQDA 3W0LB 4LJ6A 3K16A 4EYOA 4ZOQI 3NVDA 5KC9A 3AM4A 1QQ6A 5ESDA 1XVLA 2PMBA 3VZQA 4M3NA 1UOOA 3EZ6A 1LVUA 3OT5A 4PG5A 4FGKA 2HK9A 3T54A 2E89A 4MEBA 2AZDA 3SHWA 5DNYB 2HK8A 3B78A 1W75A 3L01A 3TXYA 4JVMA 4UAVA 2A1UB 1RHUA 4EG8A 5GWXA 4OOFA 3FRIA 3QUCA 5FBZA 4FXOA 3CRMA 2PHZA 3DEFA 3DL2A 2BJHA 3KQLA 5TQ2A 3EB9A 2WM9B 1YZNA 4UU1A 5NLLA 3LIIA 3VBEA 3LQFA 1AK1A 3ZBQA 4FNOA 2P69A 5EFZA 16PKA 2Q07A 5KTMA 4PXYA 1L5RA 3JALB 1XWWA 2R4UA 4D8WA 5TLSA 3FOZA 4BVJA 1YD7A 3PWKA 5K0LA 3ZGOA 4JLJA 2ZITA 3ZR4B 1SVSA 1YDEA 4J6EA 4TYMA 4D7AA 4S35A 2FN9A 3WNCA 1EWTA 1ND6A 1KZ7B 3PQCA 4TUYA 5LA6F 5I7OA 2XEDA 2B6HA 4YJHA 1O2DA 4WK4B 4TYPA 5JD3A 1TA9A 4ZYVA 3CMMA 3EIQA 3V2GA 3QVSA 4WERA 3GZNB 2FEOA 3E23A 5FFMA 1N78A 4JLOA 5G2OA 5CLJA 2A1TS 3FJOA 1JUDA 4RD2A 3BTOA 4LQLA 4M0DA 3LLSA 3KXIA 2VQFB 2WI8A 1KPIA 1UKYA 3AKEA 3OZBA 5JY6A 2HQRA 2QUJA 4X54A 5FFNA 4DR4B 4D4GA 3DBVO 4PGFA 2QBYA 1NBMA 4LRSB 1I4LD 2BZ1A 4F6CA 2ZLBA 3RYHA 4DPLA 3THXB 3IP5A 1Z06A 1SBZA 4POOA 3W5DA 3L18A 4P0PB 1OVGA 3KD2A 3QJ5A 1CVLA 3KEGA 2HMUA 1UODA 5DM2A 3SI7A 3QUBA 2VL7A 3PFGA 2Q1WA 3SX2A 3TPFA 1KVUA 2CJWB 3PNYA 4J29A 3T4UA 5JS8A 5DTIA 1DBRA 4TTVA 1RYMA 4TLCA 2DT8A 5C35A 5EXDA 3CLUC 1MKYA 2DPYA 5AM2A 3S2ZA 4GR9A 1T3ZA 3DF9A 4QHYA 3A37A 4WGGA 5H16A 5CDFA 2HU8A 1K1EA 3DOCA 4C08A 4RENA 3I4FA 2I91A 5B3JA 3SHTA 2L69A 3G9TA 4ZOLB 3QX3A 2HV8A 4Z2YA 2PUCA 2B1IA 3EIWA 4KXXA 4UBMA 3VA7A 2BE7A 4MVXA 2VBFA 2GYWA 5FA8A 1Y3DE 2J07A 4MYUA 5GZ6A 2Z4TA 2BWJA 3GHYA 5JUWA 2QG6A 1UJ4A 2XT9A 1PZEA 1CCWA 2E21A 2W6CX 3CZ9A 3JQGB 2E4UA 4KH1A 2C2OA 2MTBA 2YJTD 3QF4A 4L74A 2IYXA 1T2UA 3AJ8A 4GP9A 4GDMA 4B2IA 4F5DA 2AXPA 3O8OB 4DV7B 3HMKA 4P80A 2AOUA 1JF8A 3OE4A 4MUYA 3ZY6A 3EW7A 2LD4A 3BCHA 4M0CA 3CX7A 4CKYA 4MS4B 1BXGB 4N7BA 1KEEB 2HJHA 5LZ8A 1C0KA 1MW8X 2CDRA 2QQGA 3TOZA 3TL2A 1JE1A 2X13A 5FR1A 5AR1A 1YNSA 1HMPA 4I50B 2FX2A 4XOIA 5C8ZA 1D7OA 1V11A 1WETA 2QN9A 4JP2A 5EPOA 4G1MB 2ZJ4A 4B6FA 2PIAA 4PZAA 2JGEA 2VN8A 3IA7A 3V2IA 3I4LA 5KTSA 2PZMA 2PL1A 4CEJB 2RHJA 3UMBA 4CGZA 2JIDA 3HI6A 4FE7A 3VNVA 1H9BA 2VRBA 1C0EA 2WTBA 1N2CB 4XX0B 1KK2A 3JAKA 4EJSA 3C6KA 3HCAA 3QOFA 4KQGA 2AG1A 2FQWA 4A0HA 4IHJA 4E3WA 1DEKA 4CE6A 5BQ5A 2WMYA 3KV3O 2OAP1 2P5YA 1IZ8A 4FR0A 4MMYB 4AY5A 3BQMB 4K1XA 1BRTA 3T5CA 3WWYA 1GQRA 1NX9A 1BCRA 4GPEA 1R37A 1P1HA 1IY0A 1Z2NX 2BI7A 2VYQA 3BHIA 1E1NA 2GARA 4IY1A 2LIVA 4LZPA 1NUPA 4WKBA 3X44A 4DEXA 1E60A 2FSIA 3PD1A 3NDJA 5J4KA 1VL0A 1DS6A 5G1OA 2O2ZA 4X3CA 1JT9A 3TR6A 2VT6A 1X1SA 2XSZA 3DXXA 1P8JA 1Q16A 1W85A 1R4NB 3KNZA 1XJCA 1ZOPA 1P0IA 1F1BA 4LF8B 3DMHA 4FDTA 4LSGA 3A1VA 1GV1A 3SFVA 4ATNA 1QTQA 1RKXA 2XYQA 4AVYA 5M5BA 2E4YA 3O8CA 1AZLA 4X91A 1CB0A 3HRIA 2DHRA 2VNKA 4R16A 3UUEA 4ZTZB 1P7WA 4O8ZA 3EVGA 3F5DA 4IPTA 3ANMA 5DE3A 4DSTA 5LDHA 3JZFA 4GOJA 5IT0A 4MJ3A 3TX6A 1JMVA 2EOAA 4II2A 5FP0A 5IABA 1B74A 4NU6A 1G3RA 4OQNA 2EZ9A 4GOMD 1K75A 1QGAA 4TLEA 1RU3A 3UBMA 5E95A 3A28A 2EZ4A 1Z36A 3KDAA 2HBRA 3IT1A 4KN9S 1D0SA 1Q7CA 1G21E 2XLBA 4ACAA 2ZZKA 3BIFA 2WWTA 1QO0A 3P2KA 2PR2A 3UQYS 4CL8A 3H04A 1ODLA 3L4BA 3WOVA 3UWSA 1KMNA 4C05A 2IX9A 2W9XA 3D6UA 2OCDA 3IKMB 4AJPA 1HY3A 3MCWA 3NX4A 3BFVA 1NYTA 1IM5A 1PEYA 2EJTA 2UAGA 3SD7A 1PGNA 3JQ9A 2XUAA 3O4JA 3CF4G 3P2EA 3DDHA 1EVKA 4PYNA 1QGOA 3AR3A 1ZD4A 2MINB 4IVQA 2C5EA 4YA6A 3J81k 2JJ2D 4FLFA 3RB8A 5JARA 1ZD8A 4Q1CA 4F8JA 3KQUA 3OTHA 2QMUA 3VX3A 3W79A 1BW9A 4JJGA 1E66A 1QE5A 4U5XA 3WFZA 4LRQA 4AD8A 1GUDA 1REQA 2Y71A 4ETNA 3KVOA 4AWAA 2VJNA 4AJ2A 3CLRC 4B32A 2V7UA 2O57A 3A6KA 3V32A 2QHXA 4WTOA 4D92A 1ORVA 2P9TA 2VH5R 2ASEA 3FZQA 2RC5A 2FPGA 3IAM6 3BBPA 3OF3A 3M0EA 3QUAA 4HEA6 5F5XA 1WXFA 5JDCC 2IZ1A 4WOBA 2F1JA 3IULA 1KQFA 5JSKA 1UEIA 1BMTA 3BRCA 2VATA 4JXJA 3S7ZA 2Z5FA 1YZLA 2G9UA 3DPIA 3SHOA 1I7LA 3IFSA 3T3PB 3EQZA 3DLIA 5B1IA 3NIFB 2Y67A 4M46A 3T1NA 2QY9A 2IUFA 1OLUB 3I58A 4GZ6A 4JEIA 4PNHA 5FOVA 3RS3A 5F7OA 1FP4B 4LXYA 1ZK1A 3ORYA 4EGFA 4K88A 2QNBA 3LCVB 2GEJA 2H4ZA 3F78A 3LO5A 4R8LA 1IBMB 4HS4A 4WCFA 2ABWA 1K9VF 2F48A 3HV0A 2CVQA 2VSNA 2OXIA 4F06A 1UPAA 4IIDA 4BIIA 1M6VA 4FCWA 4DN6A 3JARB 1ZZGA 4GUDA 2J30A 1C9YA 4RV5A 2CXTA 1QGYA 4QGGA 1AA6A 4ZJYA 3VXKA 4C4PA 5CDTA 3AKYA 1A95A 4BXOB 3WGLA 1IDN1 4L07A 4PM4A 4ARZA 4F2DA 4BUZA 1U3TA 4ZVVA 2BFEB 3OP1A 1LU9A 5HUQA 2OBNA 3QFSA 3QITA 5FD8A 2J4FA 1RXUA 4C21A 4FZ5A 1DADA 2J6HA 2IY7A 3MT7A 4LYDA 4I4TF 1X13A 3WQSB 2ZAYA 1G7CA 4ZEVA 4DEVA 3DLCA 2P2LA 3A32A 4EKYA 1XMOB 3HEAA 1H2AS 2V7XA 3KSUA 4BKRA 4YAKA 1WCIB 2QRLA 2FFAA 2UXCB 4ER0A 4IIFA 2NV2B 2CLDX 1V6CA 5JVDF 1AUQA 1IYZA 3K31A 2PY6A 3AVOA 2PSEA 3CY6A 3E3OA 3QQPA 4GOLD 4MPDA 1TCCA 1K7SN 3FBWA 2HSZA 4MQFA 4UUMA 4MKFA 2UYCA 3HVUA 1Q1EA 1IZ7A 2JGRA 4J90A 3QYPA 2D2VA 4G0NA 5AVRA 1KK3A 1ESDA 5D3MB 1ZUWA 2A1IA 1KEWA 2J0VA 3BWXA 3QXJA 4YXWA 1QRAA 1J70A 1IZ9A 2V45A 4E5DA 4RA9A 1UZAA 1TQDA 1DAFA 2TYSB 4UU7A 1ZSNA 5J5CA 5KNDA 3FPCA 4UMVA 1M0SA 3DMFA 1KZYC 3DUFB 2IUYA 1SXJD 5JTTA 3WDMA 1KTIA 1EP2B 1G59A 3EXG1 2TRSB 5ITWA 2QM0A 4YRDA 3V8MA 2BSQA 1I6KA 4RY9A 2V5AA 5BXYA 4KAFA 3F74A 4I46A 4UNQA 1HDEA 3TKLA 4AKTA 1WV0A 1EGAA 1T0BA 3BFXA 5AI6A 1W4ZA 4Z9AA 2ES4A 3BGDA 3FZEA 4ZYXA 2IYSA 5ARBA 5DNAA 4EYQA 1XK7A 2CZGA 2B98A 2ZBPA 2FPWA 3ZH9B 3ZTTA 5BN4B 5CEEA 2CCGA 1VSUA 1NXOA 3K1TA 4KMRA 4P4SB 1DWQA 8GPBA 1QZTA 2V65A 3N2GB 2BHTA 3HDHA 1B23P 4OHFA 2CD9A 3HDVA 3I01A 3ZDDA 1FXWA 1LPSA 2AJBA 2VCEA 5AKJA 4A4DA 5HSGA 4NATA 5HIKA 4X20B 1W36C 1VBKA 2FSSA 3ENQA 3NM5A 3W7VA 4QNMA 1RRGA 1HFEL 4CLHA 4G41A 2GBFA 1HGXA 2I54A 4UNSA 2IYOA 3ZYZA 2OOKA 4LXUA 5LPNA 2KLHA 3NALA 4QYIA 3W6PA 4DY4A 3F6BX 1IUKA 4LXXA 4RA6B 5CA1A 1IVSA 1H9AA 2H92A 2P6MA 3G17A 4NV3A 3NIWA 1QE3A 5DM1A 1R0BA 4OQXA 1IHUA 4MMZB 1GDTA 1KJ8A 4QBGB 4NBLA 3CINA 2ODEA 1NVAA 2P7IA 3I1JA 2BI4A 3IJEB 3LC1O 4ZEWA 1J2UA 2IYQA 3NXSA 3SSOA 2RGGA 3MOIA 1I2BA 4DDWA 3QXSA 4RKEA 4NLLA 3P9RA 1P61B 3B9RA 1ANKA 4YUWA 1F2UB 3IV6A 1KE2A 2WT8A 3FCAA 1U8YA 3JQ7A 2AKAB 3EEIA 4S12A 1LC3A 3EEYA 2QTRA 3KUDA 2P2NA 3MCAA 2IHZA 4QWMA 1Y48E 3USZA 2RI1A 3RIYA 2FTKE 2J7PD 2R60A 3ZXIA 3CVXA 5HIJA 4W9NC 1Y8AA 3OA2A 1N7JA 1PJ4A 2EQAA 1PR2A 2K5UA 2QTGA 4JLWA 4Y3UA 1ZH0A 3M6MD 1W49A 1C50A 1KMHB 4NX2A 1S2IA 2HJVA 2VYCA 3OM1A 3V7WA 3DD5A 1XZEA 3JQQA 3EBLA 5IBRA 5JNSA 1KMHA 1ESEA 3K2BA 2PYDA 4PC7A 5HTKA 4YXFA 2QEQA 3IEUA 5H3LA 4GXRA 4ZALA 2WMDA 4RCYA 1NF8A 3VO8A 1JBKA 3RKSA 5EJAA 3K6SB 5LP6C 3R9XA 1CBUA 1HYQA 3SLKA 1E89A 1C9NA 3N70A 4M4SA 1P80A 2Q3BA 1TKRA 2XF2A 4IJUA 4QT0A 1XQYA 2DM6A 1R2QA 5EIBD 5LMNB 1VCMA 1B15A 3MWDA 3UFXB 1EXWA 4FN4A 3KXPA 2XUQA 5JH7A 5K8IA 3N2LA 3I04A 4EPXA 3SC3A 3SR4A 1U63A 1Q1QA 3EPLA 1IJKA 1HNWB 1VIYA 5JBNA 4N0DA 1KZ1A 1UL1X 5CIWA 5FTMA 1ENYA 2EQBA 2IHKA 1V8ZA 2BGIA 1O08A 2JZNA 2DB3A 3WLMA 3R1IA 1EDEA 3GAFA 3EG9B 5CRIA 5B1DA 5BNTA 2XQIA 3ODPA 4L50A 4QECA 1LV7A 1RYEA 4IX9A 1EKXA 4AB1A 3OM8A 4OYRA 4X5OA 1BQEA 3H9EO 4JROA 2XCTB 4BJ6A 2AHRA 4IDFA 1HDYA 3ADKA 3R0VA 4Q7KA 1UC5B 1FX1A 1WG8A 4JB8A 4XYGA 4ZZ0A 4Q03A 4K87A 5BWOA 2I34A 1SURA 1D4ZA 1DQSA 2UVPB 4TRMA 1A8IA 4Q6BA 3ICWA 4GS5A 4TLMB 3MILA 1NNUA 1TUBB 2FFRA 5TRTA 2DCUA 4OV6B 2OA0A 5K2OA 2WUVA 4W5TA 1RZ3A 1V8PA 1PZGA 1XDSA 2NSLA 2HXSA 1CY7A 1HBJA 2ONZA 4IDPA 1OW3B 4ONEA 4XM0A 1ZN8A 4Q1FA 1QIDA 1I3NA 1G3IA 4UM9D 5FOUA 1KI8A 2GA9A 1RIIA 4UW9A 5EA2A 1I32A 3SOPA 2YBDA 5GZ3A 5ALJA 3CUYA 2BEJA 3NHAA 4A92A 4CLRA 4NMWA 5KJ1A 1V8FA 2FVXA 4RXUA 2XLCA 3L05A 3UH1A 4JLDA 2X15A 5T4BA 4EUNA 2LCIA 4AX4A 3DZBA 4NNPA 1MIOB 3GH3A 3H7IA 3N0VA 1UQUA 1Q0UA 2CY0A 2PU5A 1OH7A 1BJTA 4BV9A 4YRBA 7GPBA 1RI3A 1HDRA 2AR9A 3C7KA 3A4MA 1OAAA 1IH8A 1KI6A 2VXOA 1M2VA 3HABA 3KJNA 4WDRA 1JHMA 5G4KA 4HH0A 4IIGA 2PKQP 4I9HA 5AVKA 3L1KA 5AK4A 2YWCA 4FFMA 2D0OB 1CUJA 4W6ZA 2AMJA 3KTDA 3CKLA 5CLGA 1ZK4A 3N6VA 2QUKA 1XTPA 4IGFA 4BMVA 1VFNA 1WXQA 2HNBA 3ET4A 2DKNA 1KZHA 2OE2A 5J2TB 3DLHA 2ZJ3A 3QYAA 1N6OA 2YQZA 2PRYA 2HHLA 4Q7EA 2HQOA 4AXBA 5EP2A 1MOPA 1IN8A 3OFNA 3PQ7A 2PGJA 2R1TB 5L6MB 2CL7X 1H4QA 3WO0A 3DAHA 3LFUA 3VR1A 3FWKA 3USES 2FQQA 1PG0A 4CNBA 2J09A 3NETA 3BDVA 2OENG 2GPWA 3FYSA 3F7TA 1WXIA 1E9FA 1NY6A 1DKRA 1ZC4A 3DO5A 3U4QB 2SKDA 1JG7A 2PKQO 2XDAA 4CI0B 3J80A 3D2AA 5ALDA 4FMCB 3A06A 5M3BA 3ZU5A 4DMUB 4HP8A 3VZBA 1N36B 2PT7A 1TO6A 3DMPA 1R4MB 3RLFA 3WJ1A 1USUA 2NO6A 4UTZA 4D82A 2FMIA 4FB5A 3O5AA 4IKPA 3P9QA 5KJFA 1QIGA 3IHKA 4WZBB 3RWMB 4DS3A 2X9QA 1NIJA 1EWRA 2EERA 1EFDN 1GNVA 3ABZA 2I1WA 1VSQA 3DL0A 4D9MA 4TXJA 5CFZA 3H11B 5DYTA 4E08A 1MAWA 1N6HA 3VKUA 3WXMA 1Z4PX 3EQ7A 1VCOA 2ZIUB 5G3ZA 2HFJA 1U28C 5F1PA 4S1OA 5TNXA 5K0TA 3NUGA 3VDNB 4GX0A 2PGIA 3EGDB 4TWIA 5F3RA 4ARSA 1HT1E 1RMQA 1U98A 3MMXA 4OLJA 4ZHQF 4DVGA 3Q2IA 3DPSA 3DDSA 4KMSA 3N3BC 4C9BA 3X2EA 3GZNA 3QVGA 3U19A 2XB6A 2PUEA 2AG5A 2WFMA 3W8DA 2YOFA 2PFGA 1WZ2A 3ZKAA 4PPFA 4JLVA 3DLBA 5JNLA 4RVOA 3H84A 2IPNA 2HTEA 4Z49A 3VJMA 3LT4A 2BHRA 2IV7A 4CKZA 3EVAA 4GP6A 4MR8B 2G88A 1O5TA 3DTYA 3I2KA 2BN4A 3OJXA 2J5RA 3G1WA 1J22A 4FKZA 2QRKA 3BMNB 3PUHA 2R1ZA 3RO7A 1DX6A 4ZK2A 1K6MA 1CZUA 5EZ6B 1GG5A 1ZUNB 1USKA 2RI6A 4V0ME 4CMKA 1P1CA 3ZW7A 5I8PA 2WHRA 1A8SA 4CR6A 1IEWA 1JR3E 1U4NA 1Z38A 3UUFA 2FJPA 2HBQA 3ETNA 5JQGB 5DXJA 2QLFA 3X2SA 5I7EA 3NO4A 4UHBA 4QE3A 1DQPA 5TQVA 3SIWA 4C5CA 3H8VA 5IAEA 3O4GA 1SVOA 3WRXA 3IL2A 3LT5A 1NM5C 2D2FA 1JPVA 2C78A 3KQNA 1HTWA 4PV7A 2UUCB 3WB0A 3MB8A 3D5EA 4CUZA 5JISA 1B6GA 1Q83A 2P9ZA 1GCOA 3KYJB 1IM8A 2ZRNA 3ZCVA 5E3IA 3DAYA 2X5KO 4F0JA 3RSCA 3F97A 4RYDA 2PS3A 4XEHA 3UICA 1PRYA 1WB4A 4RMIA 1BQ3A 1UBRS 1ZIOA 2GHQA 1TFRA 3VR5D 1GQSA 2EKDA 2P65A 2O5CA 1XDZA 4UCQA 1I51A 2ZUBA 1VJTA 4JBYA 2ADMA 4QYXA 4D8XA 5JQGF 1BE6A 5DHQA 2BBWA 4NH4A 4YAOA 1G7SA 821PA 2I1VB 1RRCA 3AVVA 3GPIA 3BGIA 4WFQA 1UJBA 1BS9A 1YVEI 2Y6VA 3P9KA 1EFRA 1ZY2A 4QXRA 2PKXA 3UFXA 4GXNA 3V80A 1E3WA