3CR3C

Structure of a transient complex between dha-kinase subunits dham and dhal from lactococcus lactis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
121
structure length
121
Chain Sequence
b'YGIVIVSHSPEIASGLKKLIREVAKNISLTAIGGLENGEIGTSFDRVMNAIEENEADNLLTFFDLGSARMNLDLVSEMTDKELTIFNVPLIEGAYTASALLEAGATFEAIKEQLEKMLIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTS-dependent dihydroxyacetone kinase, ADP-binding subunit d
publication title X-ray Structures of the Three Lactococcus lactis Dihydroxyacetone Kinase Subunits and of a Transient Intersubunit Complex.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Transferase
total genus 41
structure length 121
sequence length 121
chains with identical sequence D
ec nomenclature ec 2.7.1.121: Phosphoenolpyruvate--glycerone phosphotransferase.
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03610 EIIA-man PTS system fructose IIA component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.510 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphotransferase system, mannose-type IIA component 3cr3C00
1VSQA 3CT6A 3B48A 3MTQA 3LFHA 2JZNA 3BEDA 3CR3C 2JZOA 1VRCA 5T3UA 3GX1A 4TKZA 1PDOA 5IM4F 3GDWA 3IPRA
chains in the Genus database with same CATH superfamily
3OM1A 3LPAA 4X93A 3M3DA 3ZCQA 4LE0A 2FP3A 1LH0A 4HTFA 4Q1BA 1FU8A 3GUHA 4GM0A 5JVDA 5EMNA 2C4UA 3T1QA 2IXFA 4HNVA 4MP6A 3OMLA 1IXRC 3PTZA 2R60A 4R9RA 4QWMA 2ADOA 3ESQA 1WCV1 3C3XA 3MB5A 1X8XA 4UPDA 2VNJA 4Y8VA 5TC4A 3PDUA 1H2HA 3N6RA 4HAVA 4ITUA 1GTJ1 1NP3A 5JCJA 5DDIP 2NSDA 1CZLA 4FYKA 5L7WA 4KNYA 1FX1A 3I5MA 1I3KA 5ELLA 1T6NA 3AFGA 5TQ2A 2NUPB 3A9VA 1MIHA 2FZ5A 4TQGA 4WY5A 3S8MA 4YRZA 1PWEA 4AKIA 2J4DA 1QHXA 3RVDA 5IBQA 3PGA1 3MGGA 4RK6A 3NIGB 4YP1A 5EJEA 4AUEA 3RUAA 1EZ4A 4BNDB 4N5MA 1ZRSA 5T5QA 3DLBA 3WKAA 4B2LA 3UW1A 2HU5A 4QM6A 4MLDA 4J6FA 4QARA 1MNAA 4DBLC 4OF4A 2B1JA 1TQ8A 2GT1A 3L5KA 3CS3A 3DB2A 4R8RA 3NASA 3B53X 5IAEA 4ZD6A 2XI4A 4HS4A 2A5GA 1NP7A 1ATZA 2N3ZA 4YAUA 1SUBA 3LTNC 1GPNA 4EHAA 5KX5A 1Z6AA 5HFJA 5L3RA 1U81A 3HNPA 1JHQA 2KB0A 4LJ9A 5EIEA 4ZDJA 2AFHE 1V8OA 4FFPA 3OVMA 3RFUA 3ZHVA 1D6SA 1WXGA 1C1DB 3IQEA 3H0EA 3OFNA 4H31A 3AJ8A 3D7LA 5HUJA 3LUGA 3AOGA 3ZWOA 3LW8A 4QXMA 5IKMA 5AXBA 4MR7B 3U37A 3KEGA 1QG4A 5FTMA 2PNJA 4A16A 1Q0QA 4NPAA 2ADFA 5HFAA 4P82A 2C92A 4Y0NA 1CNEA 3FCSB 1LQ2A 3K1YA 3UFXA 1KJ9A 2HWXA 1F4LA 1ULSA 4FC6A 3O8QA 1USVA 3TH5A 5H59A 3LXXA 5T4FA 1T0UA 3W5BA 1PK7A 1A50B 1JZQA 3IAS6 2FFAA 2VPYA 3EXEB 5JSFA 1SNYA 1ZESA 1IZZA 2PVCA 1SK9A 2QP9X 3BB4A 2HR1A 5JQGF 4GRIA 1ZHOA 1V16B 4U7JA 1JG7A 5TMPA 4HI0E 1W96A 3GZTB 3H8SA 1CRZA 3MWDB 2VQDA 4M0FA 3ZCSA 3KJNA 4U2BA 1R7RA 3DTNA 5CX1A 3VI3B 1GSHA 1WAMA 1VPWA 1OXMA 1UPCA 2PXHA 4BLRA 4L07A 1SVUA 4GX1A 3SZRA 1GN8A 4ZO9A 1NJ5A 3ZC3A 1QK4A 1VI6A 2GZ1A 2WOJA 3K5WA 2ANCA 2CXRA 2H48A 1CEXA 3Q6MA 1EK0A 3CEJA 2EKQA 2XUJA 3EGCA 2CZQA 2NTVA 1I2ZA 2FR8C 4C05A 2HXYA 2ZUDA 3OWXA 3VTZA 2XDYA 5C4MA 2VZ0A 6Q21A 2OL4A 2J9XB 3E3LA 2WKPA 4KXUA 3KJXA 3B82A 2O2ZA 4MIKA 4RY8A 5JH7F 2ZREA 1U80A 1H85A 3VO9A 4D0SA 3LPCA 1M8KA 4KXXA 3HCFA 3L79A 3JVUA 1R4AA 2D1SA 1C9DB 2YZ2A 3EZ7A 3V4VB 1MXHA 2Z30A 1GIAA 1M2EA 2OBBA 4EPTA 1Y6ZA 4X3OA 4D4LA 3DVAA 1A2BA 3WRYC 1GG2A 3DMGA 3ZZTA 1EXWA 1GVNB 4UPVA 1OKKA 2APJA 1VHLA 1JMKC 1RCFA 3QIVA 1CLEA 1KYWA 3BMOA 4IXDA 5FA8A 3TEMA 2Z08A 4JOBA 4YA6A 1BYIA 4QQFA 1FRQA 1JAHA 2VJNA 4BWYA 1GG5A 2DR3A 4QJ3A 2KMLA 5A2GA 1J56A 2MDTA 1XLWA 1C1DA 1GQSA 2IE8A 3GMIA 3M6AA 2C1EA 4L28A 4WZBA 3ZDQA 2QZZA 5BWBA 1SXJB 5AW3A 5I7SA 5I7UA 4KR7A 2UUCB 1Y9AA 1C29B 4U2GA 3EK2A 2OG2A 2J48A 1QOZA 4MR7A 3RSGA 3EXFA 5JNTA 4D8YA 1JIUA 2I03A 4C7OB 2BSXA 4N3GA 1U3TA 3U3OA 3NHJA 5PNTA 1NXWA 2E4ZA 5AVUA 5A5VA 2ZQZA 2Y0CA 4JLAA 1IOLA 2ZRGA 2BR3A 5AI8A 1XTZA 3R7DA 4XUCA 2X5KO 1USWA 5T57A 3AIOA 1RRMA 3M6FA 3RRFA 3EXEA 2VDOB 5CYPA 1GPBA 2WSSA 1Z8HA 1GUZA 1YNOA 5GZ6A 5HK8A 1V16A 4IBOA 3HLTA 4ZO7A 3MWDA 4W6QA 5HMMA 3QTTA 3WX0A 4ASUD 2QGZA 4KLRA 3UJ7A 3PQ2A 1A5BB 3RS3A 4P34A 4QE3A 1Q12A 4JI6B 4K86A 3RI3A 1GFSA 1XQ6A 2D1TA 3VR4D 3W78A 1KMQA 4DXAA 4JOQA 2P67A 5CPBA 5DE3A 2PZFA 2FJUA 2WVJA 1M2OB 4IDDA 4QXOA 2WYUA 2NU8B 1N4DA 2NXCA 1U5CA 1JEQB 1B76A 2P6UA 2WUGA 4IOJA 2BEWB 1AHPA 1B2RA 5FEUA 2VWHA 3OQNA 1N57A 1SO8A 3ETCA 3I5XA 2I67A 1LTQA 3B3FA 3FHTA 4HXFB 5HS4A 3EVCA 1MW8X 2QMEA 3TOXA 3EFEA 3FPJA 4BN5A 2CDNA 2P3OA 1NW9B 3CEAA 2FPSA 3FSEA 4RD1A 5TMBA 5KYTA 4IPTA 2WJZB 2AW3A 2O2XA 4LOKA 3DO5A 5EIBD 5KWJA 5IDYA 3DMFA 5FPKA 4I1IA 2DKFA 4IKEA 4WZ6A 3OOSA 1QP4A 2BEVB 1U9CA 1UJMA 1QK5A 3IAM6 1Z06A 1L8QA 4G5RA 4PQRA 1NI3A 2I34A 1JSRA 3KJEA 3R3YA 5DT2A 4ZQGA 4B0PA 1MVLA 1N0UA 1YZHA 2WJWA 3CW9A 4J4HA 1UPBA 1FP6A 1Z0UA 3A58B 4KE9A 1FY2A 5ENDA 1G63A 1FE8A 3QMVA 1JXQA 5DMHA 5J2UA 1SXJA 1ZLXA 3HCRA 2R5FA 4DADA 4A23A 2VWQA 4QREA 1U9IC 3NOVA 4B32A 2KLHA 2XY4A 3QK7A 4A6XA 4C7OA 1B41A 3QEOA 1TXGA 3WGUA 2UZ1B 2I6TA 4C0BA 2COKA 4I9NA 1LBSA 1TQHA 3L6UA 3MTBA 2G1JA 3VHXB 4Z99A 3CV3A 5B37A 3FSRA 3ZZNA 3K4HA 1KTIA 1YBHA 2GUWA 2FRVA 2PNFA 3DGEC 3E4DA 4YO7A 1QU2A 4FT2A 4OOFA 2BGRA 4ZYTA 3MGCA 1BC5A 1DOAA 3CZCA 4F5ZA 1J2YA 1U0EA 3U7GA 4CZ2A 4PRYA 4JBYA 4PR0A 4M53A 1BKSB 2IU0A 4HDRB 2ZVPX 1RKQA 3QVUA 3W2IA 1P4GA 1M2OA 1BAPA 3GLHE 2Z1NA 2X3UA 4B40A 1Y8ZA 3C7AA 3MRSA 1MO3A 1IN1A 2G6TA 1QCDA 3W5HA 4CLRA 3O2SB 4CKBB 3AKDA 1H6CA 4C7JA 1ESZA 3VSDA 1ZVKA 1Z7BA 3HZHA 3S0JA 4Y9DA 3S7ZA 1RQNA 3TCKA 3TRKA 3O95A 1QZXA 2A5YB 2AQ8A 4KPYA 1Q57A 1XAHA 3AERB 4ZKEA 4DHWA 1E1YA 1QIKA 2WJPA 2BY4A 1AV6A 1UZUA 3N8HA 1M76A 2CLLB 1MT3A 3HUUA 3TRJA 4JIMA 1RIIA 3TPCA 3QVVA 2J4FA 5JNLA 3BL6A 4RSRA 1IXYA 3W8RA 4RLFA 2EG9A 4DSUA 1MMFB 1BMTA 1JHDA 1WDMA 1IQUA 3BHMA 3KYJB 1DB3A 3L7LA 3P0JA 4ZGWA 2IC5A 1LBHA 3IEPA 2XCQA 2OGTA 1KPIA 4G1VA 4BVKA 1I32A 1JSCA 3BMCB 4TS3A 3HY6A 5E9AA 4JSRA 3F6CA 3SXJA 3ONFA 3ZEIA 3BK7A 2R6ZA 2XVXA 3OZDA 4XPZA 5FOUA 3WE7A 1YR2A 5BWLA 3GT3A 1PU2A 2IEBA 3RSCA 2VNHA 1SU6A 2Q46A 4ZKDA 4TZ0A 4KKXB 3HKCB 3CSUA 4L5IA 4P3YA 5EIWA 4EEZA 4ZALA 2FRDA 2W58A 4BFWA 1I7PA 3H2ZA 1KI3A 2A5LA 3VC7A 1PJCA 4BU0A 3FRHA 3UJHA 5L3VA 2C04A 1Y6GA 1ZN7A 3ROPA 4QYIB 1NC1A 1NVUQ 4BY9E 2CYBA 4AUMA 5IJXA 4DLSA 1A9TA 3NHWA 3V8BA 5DTRA 2O59A 3NYIA 5L3QB 4RMIA 2H1SA 2A86A 3DMHA 5U4XA 3PCTA 1ZM2A 2EOAA 2X4GA 5EERA 5BVGB 2O7NA 2VH1A 1PIWA 1UOEA 1CY8A 1YI1A 3DEZA 3WGJA 4W8OA 3ET5A 4CG1A 4MRRA 1QIJA 4DNXA 4L9SA 2A88A 3W9SA 4QXPA 2XOXA 3WIDA 3MN1A 4E21A 1BDBA 2PHZA 5JAOA 1DTWA 1VIVA 4HDRA 5FEMA 4EGAA 3FUVA 4NOJA 4ZVSA 5B7GA 4O4IF 3VUFA 3PC8A 4KFUA 5JBIA 5MN5A 5SICE 4X65B 1FMJA 2BI8A 3L7MA 4G0NA 5AD1A 3I45A 3SLGA 3EPRA 2P9YA 5L4NA 2F62A 4NAUA 2DPGA 2H29A 4RX1A 1CY4A 5IRCD 1X7HA 1YBAA 3TXAA 3VC2A 3AERA 4V2IA 1ML3A 3OKAA 1USUA 4D3FA 3B2QA 1O4WA 3COYA 4KWIA 2P6RA 1DCKA 1SPBS 1UK7A 2RGGA 3NJ4A 5B30A 1B8VA 1YCGA 2WU4A 4JYBA 4Q3EA 2QD3A 2ONJA 4NZPA 1RM3A 2FZVA 2WJYA 2WHXA 2DHDA 2CHFA 2GCIA 4DG9A 5KDDA 4YDHB 1X2BA 1FFWA 4HMQA 1OF1A 1UBGA 2WTEA 3R2JA 4RPJA 5H3HA 1OBCA 3ZDEA 3WNDA 3FMIA 3QF4B 3RWBA 4EUHA 3MQ2A 4XKJA 5C34B 3BMCA 2X0EA 3AILA 2QT9A 1QHHB 5B7NA 3K09C 5KREA 1WXFA 3A1SA 3A9SA 3MD9A 1U0OC 3WK9A 2WMNB 5KVCA 1KVRA 5CLJA 4Q3OA 2FK8A 1CVIA 4EFLA 2NUAB 2JFXA 4QDUA 3ADPA 4GM1A 4QOSA 1WJGA 2W0SA 1VKNA 1WHSB 4LJYA 1NMYA 4DDHA 2BGNA 4K9LA 4ZRDA 1U7WA 3EZ9A 4JUDX 5ERGB 4L2IB 4WCVA 1M7GA 3JYPA 3UMJA 1V1JA 2OECA 2XE7A 3WGTA 4RH1A 2Z2YA 2HLNA 1LVGA 3HU2A 4QYIA 4YMVA 3HMQA 3LCUA 3IT1A 4DJEC 2YFYA 3M1YA 4II3A 4I9HA 1TJ5A 3RG2A 4MWGA 5C5CA 2ZIXB 3KTDA 1CS0A 1HYGA 3DONA 3QEAZ 3A1CA 4HMPA 5BVGA 3HEBA 10MHA 4Z4IA 1GLNA 1XELA 4JYMA 1SBHA 4KR3A 2WM3A 2VYVA 4L0MA 4TV9A 2Q1UA 1G291 5F51A 4IWXA 4L5YA 4PFQA 4MJLA 4FFBA 3RH0A 2V03A 3OG9A 5AKEA 2PUTA 1TPYA 3PGLA 1OB5A 1IZ0A 3BWDD 4OHFA 4O4LF 4F2HA 3NBQA 3QEMB 1ZUD1 3LT5A 1CBUA 3LPMA 4XGKA 4G1BA 3MZ0A 4HB0A 5AJTA 1QUFA 3AVPA 1E3IA 1UBOS 3FBTA 2PT6A 5FPPA 4OHZA 4EA6A 3WJ7A 2P9BA 4M1MA 2JZCA 1H6DA 1G4AE 2RH5A 1FMCA 2F4NA 1EAYA 2QVZX 3ROEA 2QXYA 1EFCA 2ZBFA 3GYBA 2ZXFA 4NK5A 4EVQA 3AB8A 2QVYX 2EJBA 3I6ZA 1V3VA 3M4XA 4LEIA 2ZYRA 2EW2A 3LBFA 5KNDH 1E5DA 1YDMA 1BKYA 3LDHA 1JHVA 3ELBA 2ZB4A 3FFWA 2CYCA 1Q0RA 3FJ1A 4X8LA 4DWJA 4UUBA 3TF5A 4UTRA 1N6RA 3RG8A 2HJVA 4XWGA 3LC1O 4FB5A 3BK1A 3SBEA 4BGUA 4FE4A 3SF8B 3N2LA 3QF4A 1CR2A 1GVHA 1SRQA 4NFHA 2F67A 1QHHA 2J30A 2H08A 2XF8A 2ZR8A 4PANA 1EUYA 2R86A 2WG1A 3DEAA 4H7PA 4BYMA 1WVMA 4CKCB 1UEXC 3NIBA 4Q05A 3U7FB 3DZBA 4BLSA 1EWTA 4DLRA 1Z0SA 2CCGA 1E9DA 2C4VA 4UAGA 3R7SA 5CB4F 5JYCA 1WHSA 3GJSA 4DCNA 3HVHA 4DB4A 3V8PA 1X1TA 1D8TA 1XTJA 4DR2B 5ARCA 4K1LA 2IGTA 1E3QA 2D0PB 2GNOA 1YZUA 4MVJH 3HGTA 5KVVA 3G8AA 2P11A 3EXG1 4GRDA 4P3OA 1KXZA 3Q7EA 4M2LA 2EW8A 3H86A 3IAAA 4GDMA 1Y8CA 2IHYA 2NIPA 2XMQA 3G8YA 3T6KA 4EPYA 1JBQA 3Q9SA 2FDRA 4XYBA 2IZOA 3STUA 2ZIXA 3NHZA 3O74A 3ZGXA 1ORIA 4MKFA 4BE4A 1QGDA 2GA8A 1V3QE 4RGBA 1E9CA 4NCHA 1FFHA 4P7GA 1YB5A 3DE4X 3W2EA 1HNZB 1MNQA 2QLJA 4NWIA 4CR8A 2BSAA 3NBKA 2HU8A 4YAEA 5D6NA 1JDVA 1TMGE 4MNTA 5IKOA 4E32A 1WD5A 5C4GB 4EQZA 1DLJA 4OQLA 3OQBA 1GA6A 2EL7A 4RM2A 1LK0A 3UT0A 4BVJA 4TS4A 3UK2A 1OFUA 4EO7A 1KEZA 4E5NA 3I73A 5EWMA 3V6LA 1V47A 3B1XA 3M1IA 1I30A 1B3BA 3VYVA 2HK8A 2BTOA 4FMPA 3AZQA 2ORWA 4V38A 4BTVA 1ATIA 5TQJA 2PTGA 2C94A 3OC6A 3GJ8A 3ODPA 4JUBA 4XM1A 5GMOA 3U7RA 1VLHA 1Z2DA 3AHFA 1WKBA 2OM6A 2WJIA 1CUXA 2FF5A 3K0AB 4C6HA 4CGYA 3DV2A 1TUEA 4LC0A 4NDNE 5ITZB 2C3OA 5HDBB 4CEIB 5IKEA 1FFEA 4G8BA 1K6XA 3QWFA 1XU7A 4OBXA 5E2IA 3RKSA 2ZAOA 5JT1A 3H9QA 1O89A 1JLHA 3OF5A 1NSTA 2QMHA 3U7IA 4C1BA 3IT2A 4WCFB 3U62A 2MOKA 2G4LA 1UMDB 4D4MA 4RTLA 3DW3X 1RKXA 1W0KD 2H0QA 5LVAA 4M98A 1P9WA 3SF8A 5BORA 5KWIA 1DKLA 1EP9A 3KU1A 4IG4A 4ZYWA 3AL0C 3E9CA 2IDMA 3K94A 5JFOA 1LBIA 4EHHA 3OX1A 1U8FO 3C5VA 5T4EA 2R6GA 1UBHS 3QMMA 3IPRA 4FS3A 1YA8A 2R96A 1HEIA 1BE6A 2A30A 1MH1A 3LHDA 1GRCA 2JI9A 3HCWA 4MS3A 4ND8B 5IXSA 2EJUA 4KYUA 5JS7A 2HHCA 5IMSA 3NLLA 2WVHA 1GCAA 2O6HA 4EW1A 3ECAA 1HEYA 1DCMA 4UQOA 4LHYA 4X3CA 3RIXA 3PIRA 5FI0B 2CFTA 3PHLA 4G1MB 2JEOA 4OLHA 2CFRA 5EKDA 3DD1A 4Z1MA 2VJDA 3PWZA 3QA9A 3SC4A 1NVGA 2EIXA 4AYXA 3FGNA 2CBGA 2AOUB 3G88A 5L8VA 2V7QA 2ZAGA 1B26A 2ZSFA 2GUGA 1SC9A 3I52A 3PRYA 2FEXA 4JVNA 1JE1A 2VQ6A 4LW8A 2A4MA 1RE1A 2GETA 3RK4A 3IE2A 4C3VA 2O5VA 2POQX 2P9HA 1IYZA 1B73A 4EH1A 3I39X 3EF3A 3QXXA 4NYJQ 4TTPA 4YI5A 3OX2A 4EMBA 3HABA 3UGTA 3H11B 4TTVA 2CLEB 3AZOA 2YQZA 4Q0MA 4Q15A 1P0QA 1IVSA 4PRKA 3VPDA 3SMQA 1K9VF 3ICWA 5HF5A 3TVYA 2DWCA 2CLKB 4LYFA 3BSYA 1VPDA 3SICE 3I32A 1YDWA 5L51A 5E0OA 3WK6A 1SIBE 1GFWA 3DE5X 4UDYX 4ENUA 1DFIA 3LQ1A 2HCTA 5D86A 4CL2A 4U2DA 1PNQA 3CLTD 3HSKA 3T7RA 5D7BA 4XVRA 4HNQA 3M34A 4MPTA 2RG1A 1UBTS 1UC9A 2CHUA 1OWOA 4TWBA 5B7PA 1UBJS 3A3YA 4ADSG 1MHPA 1XRSB 2E7ZA 4UHDA 1MHTA 4CEIA 1WB5A 1CXZA 1PWYE 1U8UA 4H77A 4CDMA 3DBIA 3FYCA 2Y1CA 3M5WA 3R3WA 1JX6A 1T91A 1UMDA 1A5SB 1WXIA 1SKYE 2BAGA 5T8KA 5A3QA 4FMDB 4MV4A 3IVMA 3LCMA 1KFJB 3JD0A 3OAAD 1MP0A 1R12A 5CAEB 4EPXA 2VWPA 2ZI6A 3IAUA 2L69A 4PS1A 3UJ6A 1E2FA 2GCGA 2R87A 3D5EA 1HNWB 4KN5A 1F2UA 2J87A 2N1BA 1F06A 4ISBA 4AKGA 4ND8A 3BH7A 4KGZA 1PFWA 1WPXA 3I8OA 4LJSA 4R0VA 2EQBA 4XUEA 3X1DA 3FIUA 3IQZA 1CJSA 2TMYA 3PICA 3U3JA 2B8WA 5DOVA 4FYMA 1L4MA 4G2TA 3N8IA 4LVCA 1HRDA 2QU7A 4CF4A 1FTSA 2H00A 4Z4QA 1W8IA 2O7QA 2PX2A 3H4VA 1ZJ6A 1SUSA 1FDRA 2AOUA 4QPZA 1SCDA 2NLOA 4JN6B 2YV5A 3BCUA 1IIRA 2HMWA 3SYKA 3GUYA 1TJPB 2QMOA 2RHGB 1AXEA 3RC1A 1AVTA 1CNFA 1SXJC 1VBKA 2ZE5A 4R2KA 2FG5A 4RKWA 1Z0KA 3RO7A 3HHPA 1DX6A 5E8RA 4ND2A 3RS9A 4NBLA 3H11A 5H82A 5F21A 4D9BA 2QBYB 4R5HA 5AUNB 5KYWB 2WV7A 4HUTA 3AUXA 2RCNA 1E61A 3CUKA 5DNCA 2HC9A 1A8HA 3RKRA 3EPLA 3ZEAA 2ERYA 2Z56A 2O2YA 1BQEA 1GTMA 4DCVA 3QEJA 3D8RA 1SHZA 2C5FA 3NU1A 4PCLA 1HKHA 3F6SA 2NP6A 2AG1A 2P2NA 2ZSJA 4JJ6A 3F6YA 2GA9A 3HNOA 3TR6A 2C82A 4A6PA 5AJUA 1BS2A 2V97A 3FWHA 4O2RA 2LGJA 1F8FA 3KR9A 4O2LA 4DG8A 3NC1C 4UAJA 3FE2A 3JQBA 3OQ1A 3VTFA 2IHJA 1VB5A 1W25A 1KVTA 1GRQA 3BXPA 1N92A 4I1RA 4O8CA 1WG8A 1ZY2A 4M0MA 5KHOC 3BGIA 1JBKA 2OK7A 2JGIA 3LGAA 4NMXB 5HOEA 1SGWA 1TEHA 3A0UA 1WF3A 1MJFA 3KQWA 5I3ZA 2FUG1 5LU8A 3RGGA 4F60A 3KK0A 2IW3A 4HQRA 4HNAB 4PG5A 3TRDA 1HA3A 2SECE 3D6HA 3M4YA 3PVCA 1XP5A 2IXGA 4FHEA 8LDHA 1Z4MA 1VMDA 4G65A 3GLIE 1HM5A 4PAMA 4DQUA 5MGNA 2FUKA 1VLZA 4Q1FA 1NT2A 3WGNA 5D3KA 2EFYA 3GVPA 1F2DA 4QAQA 4QELA 3U4CA 4WOPA 1FU7A 4XWTA 3UCEA 4DBLE 3IHKA 4NOMA 1H6BA 4LJ6A 4P84A 1Z38A 4G26A 3HCOA 4N01A 3C41J 4U5QA 2P2GA 5DTMA 3WLRA 3RYCA 1OC4A 2AOWA 5JWHA 5AVRA 2HL6A 3CNHA 2I8AA 1IG3A 2EX0A 4DJJA 2NYVA 1VFNA 5F7OA 2P4QA 3NDPA 1MGPA 2OFPA 4FEGA 1J1ZA 3HTXA 4HH0A 4MW5A 4FKZA 3IESA 1QAOA 3HN7A 2IY8A 3PC2A 2IV2X 1ZAKA 2EKBA 3JWGA 3K15A 3WGYA 5JTUA 3HJCA 4E22A 3V00A 5F3WB 2QTVB 1G2PA 4NY1A 3DF9A 3NWPA 5T67A 1P74A 4JVOA 3T06B 2IIBA 5L4LA 4BMXA 3WBFA 2VHVA 3NHMA 4YCBA 4LY0A 1E3JA 2FRDC 2FSSA 3PU6A 2EATA 3DDUA 3GPDG 1O0SA 2PJUA 2PL3A 2V98A 2W90A 1C9KA 5FI1B 2CDRA 4PYMA 1I13A 3KUXA 3JASB 4DHEA 3JWIA 1CUBA 2H1IA 2NPOA 3PQFA 2PUJA 4U0JA 3ZY6A 1TVCA 4RPCA 3ZV7A 5JRZA 4ZODA 4PLGA 4IMPA 1PGNA 1ZONA 2QX9A 3ND8A 1EIZA 4RVOA 2F8MA 1QHGA 4BPBA 3U3ZA 4YWHA 5DGHA 2VEOA 5BV0A 3WADA 2EX1A 4ZVPA 2IEYA 1H6AA 1WDKA 5CD9A 4QIHA 5CG1A 4FCVA 1CK4A 4KOAA 4JJGA 4NG5A 4TMYA 5A4DA 2FQQA 4DMHA 5ICCA 4LXTA 2HD4A 2QRHA 5EWJA 2ACKA 3C3PA 3PC8C 4R1TA 1RDFA 4Z1OA 5CNIA 2AA3A 3WWOA 1IPHA 2GZ2A 4EK9A 2A2ZA 3CPHA 1DADA 2V45A 4D4IA 5LP1A 1WOYA 2C1XA 1VXRA 2RGCA 3QV2A 4X92A 2RD2A 1S6YA 1LXCA 5ERYA 1N4AA 3VR6A 3CN9A 1NP6A 1XNRB 2YXBA 2IYOA 1UFOA 2R79A 4EYEA 2OZEA 3TRHA 4LDJA 1FW8A 1FX0B 2R8YA 3TBHA 5IAOA 4WOCA 3OZFA 2OQ2A 3CLUD 3EXAA 4ETNA 1FNNA 3DLTA 4HWSA 1DKMA 4RSHA 4JI7B 3KO8A 1EBBA 1U2PA 3D4PA 5I7AA 2R65A 4ML3A 4XR9A 2Y68A 4FE3A 2C8KA 4QPJC 4QUJA 3VKVA 5ED4A 2A0UA 2HJ9A 2VNIA 3KQOA 3ASVA 5DULA 5HJEA 4X0EA 3ZTYA 1USGA 4XQEA 4P0QB 1C3JA 3OZVA 2FMFA 2QLBA 1Z6TA 4HC4A 4K6HA 3CNNA 1NJGA 4IVRA 4NV0A 1FTWA 2XWBF 3F3YA 4GO1A 2IWRA 3F6EX 3R5KA 3T5DA 2ZB2A 1I24A 1MQ9A 1QFSA 7YASA 1PL6A 1YFZA 5AW9A 5IHPA 2QTVA 1GEGA 5FA6A 1X1QA 4P22A 2OOSA 1TJNA 3TIIA 2IYLD 3BDIA 4FM9A 4X84A 1RM5A 4X45A 1S4QA 2FMXA 3PUHA 4BGEA 4U7FA 3HACA 3IQGX 3JASA 2QVXX 4FR2A 2DSNA 5ARDA 1OXKB 1QOQB 2FYTA 3BMXA 2PEYA 3I5UA 1NA5A 3Q6IA 3UK7A 3L6OO 3UT6A 3DULA 3E7PA 4REQB 4ZT2A 1YS9A 2ZBDA 1WSAA 3CC8A 2JZNA 3BD8A 2IJGX 4M9CA 3V2UA 2XB6A 3L6EA 4Q4HB 1GKLA 1EZ1A 2FOLA 3H1AA 4ND4A 4BL5A 5KZMB 3H2SA 2JBAB 1SU8A 2Y66A 5CNJA 1AK9A 1DKPA 2C2GA 3SVTA 3G5MA 4OXRA 4F7WA 4QT4A 1NF9A 2AI2A 2VJMB 3QKRB 5B1EA 3GJ7A 3IBYA 2OYCA 2C7BA 3ZWKA 4CUKA 4P08A 4EG8A 4BXOB 1VBFA 2ZBQA 3JY6A 1Z6XA 2D59A 2FXVA 2NM0A 3OP4A 1XSEA 4LZWA 1XZLA 2C4MA 2M1XA 4B82A 2V4UA 1MBZA 3AJAA 3ENQA 3MWGA 3KXLA 3TNDA 1XYVA 5KAMA 1VPVA 3B6MA 3NGLA 5LB2A 1B16A 1RLIA 1DJOA 1G3QA 2YUIA 2C9BA 3PPIA 3GEIA 4L74A 3WRWA 4EG4A 2HW8A 5CA0F 1TZCA 5M04A 1FFSA 1OVGA 3K5IA 3TVTA 3PZRA 3V46A 3ESZA 4RZIA 5SZJA 1N3YA 2AHRA 4H7HA 1LSOA 3AI1A 4HAIA 2O3RA 2WF5A 5COQA 1JA0A 2VAPA 2H52A 1NN0A 2DTEA 4YIKA 5FPQA 5F7XA 4G25A 4WXHA 2ZB7A 1JLKA 4MK4A 3KJGA 3TKAA 2CMGA 3BT7A 2GERA 1NMEA 2P40A 3IUEA 5GOTA 2JIZA 4Q1AA 3FDIA 4R2WA 4TMFA 1K8ZB 4C5CA 5D3QA 3BMNA 4M6WB 2G83A 3TLEA 2ZSAA 1IHPA 3M2PA 1GLGA 1ZH8A 3PE3A 4YJGA 5F5LA 4BLUA 4JLKA 4UULA 1UIRA 1LV8A 3CUWA 5EG5A 4TLDA 4ZJUA 1GZVA 1V1MA 1WLSA 4R69A 4TX1A 1NASA 4RTQA 2AI1A 3SYNA 4AZWA 3IV6A 1GZ3A 2X13A 5CH5A 3RLIA 3B9RA 3C7CB 3A36A 2B94A 4QSHA 1PGOA 1WZCA 5IVPA 1U94A 4GWLA 3CF4G 3ILHA 2XSZD 4UZSA 5C8YF 2I3DA 4I5FA 1YSCA 3RC8A 5A0VA 2NZYA 5ILQA 3IULA 1ZN9A 3JTEA 3L8MA 3GH1A 3ASZA 4IILA 3CJQA 1QVWA 4DAOA 4DRXB 2ISSD 4LY9A 5KTRA 4HSGA 3H65A 3DZCA 3VR3A 2FCRA 3L8HA 4N76A 2ATEA 3HH8A 1M5UA 1J7JA 1ULZA 3LFUA 4GBMA 4MW0A 4EX6A 2PEZA 2YXEA 3TMYA 3V8RA 1K08A 1L4UA 5TPWB 3ZD6A 3F6BX 2EVWX 4ENVA 5HBRA 4MDEA 4Q4HA 4Q9IA 1OC2A 3CLHA 3Q7PA 3C4JA 2JHGA 1YFJA 4UTNA 4ANFA 1UKZA 5G41A 2H11A 5CTAA 4F12A 4RD2A 2X77A 3CIFA 2Z5VA 4ZVRA 2Y76A 1RKBA 3FUUA 2XUIA 2ZM5A 4EPRA 5AYVA 4TWJA 1TYCA 4W82A 4DV4B 2ZXEA 5JU6A 2OILA 1BCRB 4BXOA 1KO5A 4I1YA 1J25A 1QNFA 2ZWPA 3I0NA 2AX4A 5C9ZA 5KYKA 4INOA 2DLCX 1H94A 1NVWQ 1YIAA 4FHCA 4MV1A 4QLBA 4NI5A 1V8BA 3KG2A 2D8MA 2G9ZA 4NHOA 4R4JA 1ZNYA 4IW3B 3N8DA 4YXFA 4I4TB 1MB3A 3PFCA 2Y1WA 4PIMA 1LTHR 1GCIA 3FHOA 2B2CA 2DGDA 3PC6A 2CZGA 4WLOA 3RRXA 4AJKA 1HE5A 1L7QA 2NAFA 3H9BA 1HK7A 3IBGA 1NY5A 5AJWA 1GKKA 3G68A 1DIGA 3L46A 4O0LA 3AIIA 5SY9A 4BOYA 2XDAA 4FVTA 3BJIC 2PWYA 2DQSA 1ZHFA 3QKWA 2QRPA 5A5GA 1GPAA 1REQA 1QONA 1Y4SA 4JLDA 1N1DA 5IANA 2HK7A 1RD4A 2H1HA 4AY4A 4B3RB 2OZKA 2W6QA 5EKTA 5CLLA 5I47A 3M89A 2WSLA 1QHSA 5JARA 2UZAA 3GCDA 4TL6A 3V8EA 2AC4A 4J1QA 2PD3A 1WV1A 5AXCA 4AKHA 3T3IA 2DF8A 4B35A 4BC0A 3K9WA 2D1FA 3AGQA 4L5CA 4M6WA 2C0CA 4QWWA 3WKEA 1Y3FE 2AZ4A 3AY0A 3VSEA 3EGIA 4AD8A 4QDTA 2CLCX 5C7OO 3COPA 3U3KA 1X7ZB 3AG5A 5SV2A 2YICA 4JI5B 1MW9X 1K5HA 5ICFA 1EMDA 2DPMA 3DKVA 2XXBA 3A06A 1DC3A 2FFRA 3A70A 4ZDIA 3J7TA 3N0XA 4YLEA 1I7NA 2HPZA 4RDCA 4C7KA 3VAYA 1SMKA 2YWCA 3OJ0A 3ANSA 1XZKA 3TM5A 4A7PA 4IIGA 3LD9A 3L8DA 2CNWA 2XNCA 3PXAA 4D25A 2X19A 4V3CA 4DRXA 4DDUA 4KC0A 3TLYA 1MRZA 3A7DA 4Y2GA 1B00A 1V8ZA 1KIFA 3TB4A 2HN9A 1RYBA 2WJHA 2FDCA 1RWQA 4E3WA 2NO4A 5TPWA 4QICA 4UC0A 4S3MA 3GP5A 3KE9A 3SEZA 5J2TB 1MVNA 4CM7A 2GZAA 2ZT7A 1Y6QA 5IMBA 1JHAA 2PDAA 2NO1A 2GKGA 3KKMA 3M4JA 4CQMD 2PUGA 5A05A 2R7AA 1N75A 1MQSA 3EDYA 2QHXA 2Z57A 3I6MA 4EW3A 1EDDA 4WZAB 4CLXA 1ORTA 4HJRA 4MW4A 3DE0X 4YMUA 4RTSA 4FOOA 4Q4LA 1X2EA 1ZWLA 2J3JA 2PO7A 2PQ0A 4U6SA 1CQPA 1SURA 5SZIA 1J2EA 2FWJA 2HIAA 2JIQA 3DE2X 3F97A 3JD4A 5FO0A 4BCCA 2JIMA 2PXXA 3QXHA 5FWNA 3EVGA 4OA5A 4G4SO 4K7JA 4P3NA 1BROA 2YZ7A 3F0TA 4CI0B 3D3JA 4TTQA 1I6KA 3RAFC 2GPJA 2GX6A 2IUTA 3WAKA 4P83A 2NMVA 4BB6A 2H1FA 4PRLA 5AK3A 4JB8A 3RD5A 5DWVA 5DNUA 1LFDB 3ZU4A 2QRQA 1OT5A 2ZWMA 4YDSA 3KELA 1CHNA 5KTPA 3OIGA 2PXCA 2QM0A 2XQJA 1UZNA 1FL9A 1HEUA 1NT4A 1SG0A 2LD4A 2IYTA 1U2QA 3S28A 4E2YA 2BMVA 1SPXA 1TYDE 3I8SA 1W8DA 4N65A 4X20B 5T8KC 1Z63A 2JPDA 3SEFA 4NIMA 3AXTA 5JDCA 5L3SB 3AUTA 3G2OA 2XEXA 5EHQA 5IEJA 1YRLA 4M87A 4BTLA 2AUTA 2IPAB 2CLFB 2O8DB 3JQDA 2FVYA 1TM7E 2VF4X 5TS3A 5I9LA 5JR3A 2JKVA 1C1XA 3B6KA 4XA8A 3OHSX 4Q3NA 5BRJA 1X7ZA 5CW1A 5IASA 4H0CA 2H7VA 3OLQA 1LY1A 1U65A 1Z47A 3Q2OA 3L7JA 3GZ4A 2ATIA 1T8PA 3VJRA 1P4HA 3ABQB 4Z9YA 1DCFA 3V7YA 3T34A 2OBMA 2X7XA 1S1MA 2W6NA 1Z36A 5YASA 4BZWA 2XE4A 1D4ZA 4WXMA 3KQQA 5JD6A 2PVSA 1GN9A 2CL7X 3AONB 4BZPA 4RZXA 3WBKA 4OJNA 4KXNA 4O2BB 1JGTA 3KSZO 3AC0A 1GPDG 4KJZA 4JJKA 1K75A 1RMYA 3SZGA 3LTEA 5J2TA 1S1CA 1V6AA 2C7RA 2WJVA 1USKA 1N2CA 3OPNA 4FFVA 3FYDA 1S8AA 4JQSA 3VU1A 1IK6A 1W48A 1H22A 421PA 4OQYA 2XOKD 3U3RA 1G66A 2YXLA 1W59A 3RUCA 4WZAA 2TYSB 4EA9A 4H3HB 4RPGA 5DNAA 1NXSA 1U3VA 2WDZA 3GDHA 4BJ1A 5GZ3A 4GKVA 2MR5A 4CHTA 4IH4A 1DKNA 1KJ8A 1P5FA 4YRPA 1VGRA 4I55F 5K2OA 1B14A 4JUCA 1YFKA 4EITA 3R0JA 1UPFA 4LNAA 4BZQA 5BN1A 2O8EB 5A6VA 1M1NA 4WINA 3ZHXA 2EC5A 2QIOA 5BQXA 1LQTA 2QM3A 5DM1A 4NYJR 3HWSA 3PNVA 2FWMX 3BGVA 1LPOA 1IVNA 3EZLA 4EMSA 1ZIOA 3JQBC 4CDNA 5FTNA 1J70A 1KI1A 5AVKA 5IP5A 4BHTA 4XVCA 4MRAA 4HVLA 2FN8A 5AK0A 1OPXA 2Q3DA 2BP7B 3HDVA 2VDVE 2Q8QA 1NJ1A 5AIAA 4C6SA 3USCS 1M33A 3FAKA 2VCYA 3PHCA 3KAPA 3SN6A 4ID9A 1D0IA 4WVFA 4DC1A 4AWXA 5L3SA 5C5EA 3F4BA 2WV9A 1UFRA 4HEQA 4ZP1A 5A62A 3JSAA 2C5BA 2G1UA 4Q19A 5ICGA 1JYEA 1U8CB 1E20A 1MGOA 4G81A 5CVUA 3K9BA 3BX1A 5AVZA 2WJ3A 1KRHA 4F46A 3CVOA 2W43A 3QUBA 1PT7A 4ZC1A 3EEIA 1XDUA 1N3LA 2UYGA 1ZSVA 3L0YA 2Q50A 1JHXA 3DTVD 4FOPA 2Q45A 4TMWA 3KOWA 4A03A 1PAUA 1RCUA 3RIHA 3GPIA 5K20A 1NJ2A 4IXMA 3WL4A 3R76A 3WIUA 1Y42X 1QOPB 4ZV4A 2Q4EA 1NW6A 4F4DA 1YIDA 3RTBA 1VSQA 2X14A 1RAAA 4KHPB 1DJNA 5C53B 1N2BA 1E2NA 3IXLA 2VTKA 4O2BA 1PZEA 3PDWA 4QBGB 4PZUA 1TRHA 3SM3A 4A0QA 3O8RA 2X6TA 1OIVA 4P4NA 3EFBA 2Q3JA 2QMYA 3T5PA 4TL7A 3RUIA 1COWD 3IXMA 1N2EA 3UMSA 2ZUBA 4ABYA 5L4SA 4RVSA 3O2JA 3OU2A 2G36A 4BMNA 3OF3A 1EM8A 3QOYA 1E92A 5CIQA 3VOSA 3HGQA 2P4UA 1DBVO 3NTOA 2W70A 2JFVA 4MW6A 3CLSD 5EIOA 3E9EA 2HRBA 2IPLA 4Q3BA 1H8HA 1P7ZA 4DLUA 5BR4A 3TL6A 1SU4A 4KCGA 3RT9A 2YZMA 2J09A 3F6PA 3INTA 2AOXA 3D3WB 5D00A 3GJ3A 3L0OA 4MUXA 5J63A 3RHSA 3I9MA 3C3YA 3PGJA 3QBVA 5HKAA 4B73A 1QGED 1L1QA 1PE0A 3FHCB 5AK6A 3OM9A 4BZXA 4YJ3A 4MITA 5JRJA 2DHQA 2I3BA 2UYOA 2VTBA 2BP7A 1EX9A 3B70A 4JLUA 3IR5A 1AZLA 1NW7A 3PYLA 3RM3A 3KYDB 1OIWA 3NDIA 4BJ3A 1OZHA 2X1MA 3N1UA 4MVJI 4I5GA 5IC4A 5IWCA 3OZTA 1H05A 2XZDA 3CZAA 5CM2Z 2AG0A 1K1EA 3BXHA 3HI4A 4GGPA 1DT5A 2RBEA 4PCVA 5KVSA 3BM5A 2HWWA 2RHWA 4ZYLA 3X1WA 3NC4A 4N5HX 1XJCA 5ESXA 3CURA 2WWHA 5DYYA 1FW6A 2GWRA 2QOEA 2WUEA 5G3ZA 4E2ZA 1C4WA 4KQJA 4LCEA 4RIEA 3IEVA 4LXQA 3VVLA 1ILWA 1E0AA 1QTQA 4J0QA 2RG7A 2P5TB 4LGCA 4Q9HA 5ES3A 4F84A 2JATA 3HLYA 3TECE 3E5HA 4ZXPA 3RVKA 2JGJA 3HWX1 5DBGA 2PWAA 4JWTA 3K0CA 1CHDA 3HJAA 2CNNA 2JCBA 4UMEA 1V3UA 1WUIS 3CVUA 2B82A 3BL5A 3NANA 1ETHA 1YBMA 2ZWAA 4KR0A 2RBGA 2Q99A 4WZBE 2FUCA 3U61B 3IC5A 4MVYA 4R7ZA 5LZ9A 1E2JA 5C1DA 1D6JA 4YN3A 2OPHA 4TSKA 5HJ5A 5D1NA 4RF3A 4H0NA 1DWPA 1G0NA 2VP3A 4W99A 4BFZA 4ZZIA 3TN7A 1ZD1A 2LDBA 5HNKA 2WU8A 3DLPX 4L6IA 3HCAA 4PHGA 1QRAA 2XNSA 4MVWA 2KSQA 3WBBA 3N8KA 1WQ1R 3S1LA 4DJAA 2A9RA 1CIJA 1B0PA 3IAEA 5BSVA 2B4RO 5JAHA 5DCUA 2FK7A 3GROA 2GAAA 3PS9A 1YMUA 4ZVQA 4UHKA 4BVAA 2RAFA 4FBMA 3VKHA 3TNJA 2WPDA 2PFSA 3T7EA 3RV3A 2AE1A 3A9CA 1JE0A 3OIUA 1CT9A 4DJ5X 2AMYA 2NPIA 2HJWA 5D1HA 2PT7A 4WERA 1T26A 5LMCA 4M1QA 1O8CA 1XXLA 3EDRA 5I9BA 2JLYA 5K3BA 2OZVA 2NW6A 4PQEA 4FDAA 3L1IA 4HX9A 4LOLA 1P33A 3KYDA 2J8ZA 3KLPX 1WR8A 4NAVA 3STTA 3BWMA 4WHMA 4WN3A 3T4EA 2V74B 4ARIA 2M6RA 4ZEWA 1NBHA 4ZTUB 3GW8A 4GL2A 1H8EA 4OFWA 3DTTA 5F3DA 4HTAA 3VPHA 1VBMA 4R16A 1LBQA 3R3VA 4AG6A 5I7EA 3RU3A 2DQ4A 4QECA 1CV2A 1XDGA 4MV3A 1U8ZA 2Q5JA 3PTAA 2IS2A 4GSYA 4EI9A 1E5LA 5CGQB 4NABA 1GV1A 5KSZA 1BXGB 4FZRA 1RHMA 2BH9A 5B36A 3DZHA 2VQFB 4WUVA 3CUVA 1T6YA 5DM70 1QS0A 2Z5GA 4WPGA 2Q2NA 5IF9A 3OEHA 3BE5A 4M0DA 3TJZA 4BC1A 4RHCA 1UJCA 4YP6A 2MYUA 1DRWA 3KL2A 5CK4A 2GXQA 1HURA 3PFIA 3ZYCA 5BSHA 4X64B 1VP3A 4BFYA 2SCUA 5T4BA 4HGPA 2DAPA 4QDKA 1U0BB 2QD2A 5E1DA 4LK3A 3HLKA 3DHEA 1J1UA 1XB2A 5KYNA 2JLVA 2YZKA 4NZOA 2OGSA 3FRIA 3QVOA 2HA2A 2Z2JA 2MMCA 3E84A 3F3MA 4LOIA 3TW0A 3N9IA 1FSPA 5IHXA 3UQZA 4A0GA 4H1WA 4PYOA 4PS0A 4EPWA 3R7WB 1GP2A 1KJJA 1ECCA 2NZVG 4OATA 4RK0A 4CNBA 1DCTA 1CF2O 2KWIA 2O5CA 4MX8A 3VNRA 4E3ZA 3RC2A 3P9SA 3URMA 1UBCA 4RNDB 3H6HA 3NWEA 1DJPA 2NO5A 5H9VA 5K0JA 2IOHA 2L0XA 4HZGA 1NBMA 4MI3A 3TI7A 3TJRA 3L01A 4JJIA 1E9RA 2JC3A 1IUKA 3OFSA 4Q24A 5EQJB 2O5RA 3KXPA 1L7MA 2GYWA 3R6GA 4WZZA 3TLKA 4WADA 3FWNA 4FFOA 4V1CA 5KAPA 3ZHTA 5BOVA 3VUEA 1DKQA 1KGDA 5CUQA 5K09A 3NWJA 1H3NA 2QZJA 2WZBA 2E85A 4F8JA 2XBMA 1Q0UA 3QE2A 2A94A 2OCYC 2BKVA 4P33A 5CXXA 4V0RA 4NBSA 3X44A 1M75A 2WU3A 3REQB 2RH9B 5HQJA 3PDCA 4QBHA 2JFNA 2E48A 2G72A 4A73A 2PWPA 3ZOZA 5DGCA 4BNTA 4QTYA 1YH3A 4RORA 4U9HS 4J49A 2DBQA 1ZQ1A 3QVWA 3BYZA 3RT7A 3GEPA 4LXGA 2RHTA 2I54A 2V7TA 4YCAA 3UWMA 3FMGA 3LV8A 3HXOA 4X71A 1FRZA 1WCYA 2WQ7A 3QU5A 4IIJB 4AKEA 2B2XA 3B5JA 1JG4A 3PUXA 3ST7A 2IS1A 3VYSB 3EA5A 3WBJA 5GV8A 3S8YA 2J7PD 3KHSA 5ICMA 3BGSA 2VT2A 1RQLA 2VHJA 4C43A 4CKZA 2CXNA 4AJLA 3ETDA 1R0YA 2ZUTA 3AKCA 2O3SA 4EATA 1JDSA 4KACA 2FLWA 2VOEA 3T61A 1U2EA 3A3KA 4A26A 1UXOA 1JHPA 3DO6A 4RXMA 3WICA 1J39A 4ZOEA 1XMSA 1N5MA 3SJZA 1Q92A 4W7SA 4FYXA 2ANBA 2XRZA 5THQA 2Y6VA 4YC7A 1EFKA 1NPYA 3HB7A 3NPMA 4DA9A 5LIRA 3CKYA 3BKXA 3E27A 1YKGA 2XAUA 2IYAA 2PL1A 3LJKA 1JDBB 1Z56C 4D4JA 5AUOB 4H60A 4ALJA 3R7WA 1QH9A 3RADC 1QQTA 1N5LA 3QFRA 1W88B 2GFHA 2A9QA 2YDXA 4M3NA 1Z35A 3CU5A 3EWIA 4DIOA 1Y6FA 4H4EA 1SXIA 3PYMA 3SXPA 4ZQHA 5BXYA 1YVRA 1RCTE 1U7ZA 2BKAA 2HFKA 4JSYA 3AXSA 3Q1LA 4D56A 3VHQA 4J7AA 1JTVA 4KFRA 3LVRE 2WPNA 4WKCA 4IQGA 1M2GA 1CQXA 4X41A 2OCDA 4UREA 4MHTA 2BHTA 3QHQA 1Q15A 1SULA 2Q4TA 5AP9A 4G84A 4CKWA 1GSOA 3KPYA 2PMBA 3QNWA 4XJXA 3CX8A 1PS9A 1K06A 2RGBA 4YHBA 1A76A 1PFVA 3BFXA 3KKZA 1RQ7A 3TIVA 1SWWA 1W0JA 2HDWA 4IDFA 4OBEA 4RANA 1M6EX 1JG6A 4IY1A 1MOQA 1Q0LA 4ZPXA 3AF3A 5I45A 1MDBA 1HDOA 3Q3GE 1EVEA 3IUPA 4M9SA 3A10A 1FXWA 3QSGA 1I2AA 4ROTA 1FYWA 1RXYA 1YNSA 4TLAA 2P4SA 4MROA 1EFDN 1U6IA 1GV0A 2OCBA 2EFGA 5A9RA 2QLTA 2DHRA 3QWBA 1E6UA 4N03A 3WO1A 3AF4A 2YWDA 3HUEA 5AJYA 4V2UA 2BCJQ 3K5HA 3ITKA 1GSIA 4LPKA 4NZNA 2CHQA 1WBJB 1K7YA 1QZ3A 2BVNA 1C2TA 3WVNA 5ENVA 4R1SA 4AURA 3GLGA 3N76A 3GJ5A 5E0KB 1KE2A 4OY3A 2R68A 3IUJA 1E6CA 4OXQA 3M33A 3ABZA 4R84A 2CUKA 1I4EB 4LX0A 5DB4A 1F14A 4RK1A 5JDCC 1BQ3A 1WXDA 2IZ6A 4YUZA 1UK6A 2I55A 3B89A 4J4BA 2MYPA 4R81A 5ALKA 2XMBA 4QUEA 4ENSA 4KPEC 2BONA 1KRWA 2NU7B 1AN9A 1Q44A 1DO2A 1KL7A 2PSDA 2A1IA 4L9AA 1PJLA 4MQ6A 5I4IA 3LA6A 4W5RA 4B0OA 2WUWE 2O9JA 4IGIA 2DBVO 4DM7A 1JPNA 5IK2D 5JQGB 2YZGA 3ADBA 1PRYA 2CV2A 2FN4A 3KVRA 4DSTA 2JGMA 2ZKIA 1DMSA 1GUYA 2XJ4A 1M74A 2CB0A 3H5LA 3G2JA 3HJBA 1SVIA 3N39C 2ZRBA 4DIKA 4E15A 1PT6A 1NBWB 4U6NA 1DQPA 1RRCA 3AR5A 4JCCA 2W48A 1W88A 1BE1A 1SC4A 1CQJA 2XIJA 3KDPA 5JCXA 2VK8A 4XSVA 4I36A 4PNPA 2JGLA 5K8LA 3LBYA 1JAXA 4BNUA 1ZS9A 1QE5A 2ZU6A 3GZJA 4TN1A 3MAGA 3WB9A 3V2IA 1OI4A 5AOVA 5JH7B 3U6BA 1ENPA 3LH5A 4KP7A 1PG2A 2N1MA 2Y05A 2TRSB 5IWAB 1XGKA 5LLDA 1A82A 1ZEJA 5DK4A 4RELA 2WSYB 2B83A 1FEZA 3B9QA 1LLFA 4KMSA 4J16A 4LBVA 4QGSA 1NG9A 2EFCB 3PGVA 1CRPA 1CD5A 2AMFA 2QRKA 3VPGA 4QOHA 2VP6A 4ALNA 3HWWA 1X3SA 2JGDB 1HSOA 3K32A 2C96A 4L5AA 4I1SA 3KBBA 4DGQA 4H7JA 4W5JA 1LNQA 2J6BA 2OBLA 3CNBA 4BDSA 2DOKA 1KMMA 3TEFA 3BVPA 1N5KA 2WWYA 3PITA 4Q7QA 3OE4A 1G5HA 1WV0A 2QN2A 1JDPA 2YZNA 2VJCA 2FZLA 3RS0A 4XFDA 1VJ5A 3GVXA 1E3SA 1E2QA 1TAHA 3QQPA 5LIPA 3AMVA 3CT4A 2Y1EA 3S99A 5J23A 1U3FA 2P5SA 1JR3A 1FFXA 4EAAA 1TRKA 3NVDA 1LTKA 3QLUA 2I33A 4D57A 2AUMA 4MYDA 1HI9A 4PEVA 5KJ1A 5KOIA 2O48X 1GM5A 2I80A 5EINA 2BUAA 2OFOA 3PXEA 4RJ2A 5KINB 1A7AA 2GN8A 1FP7A 5K2MA 4CGZA 4MLPA 5B6JA 1B1AA 3G9ZA 1KQ3A 4NVRA 1ORWA 2QT0A 3WYEA 1H2AS 2FZKA 1A0OA 2EDAA 4LVNA 5LQNA 4IQ4A 1LBTA 1EVYA 4F7DA 3ZD7A 1YD7A 3I53A 4D3DA 4YAKA 1YB7A 1MLDA 1OSNA 3NS7A 3OUUA 4ASUA 1NJ6A 5TE9A 4IAOA 5JWRA 5G40A 3ZHUA 4W1SA 3PP8A 4HLCA 5M34A 3C7TA 3VR4A 1PYDA 4HYYA 4XOUA 1H4SA 5TY0A 2FPIB 5FL7D 1E60A 2HKIA 1QR6A 5LZ2A 4JGBA 1EXDA 5FQNA 1UT6A 3L49A 4UNQA 3CG0A 3U49A 3UK6A 1PBTA 1QWSA 1IONA 1U7UA 4ITVA 1L8AA 1OFUX 1UMBB 2XDQB 4IYRA 4X5OA 5HDQA 3B3JA 1J5PA 2G9VA 3G9QA 4LI3X 3B1JA 3ABSB 2ZM6B 3DDZX 1MQ8B 2W00A 5CK5A 1T2NA 1E5VA 3PGMA 3V97A 3QLEA 4Z0PA 5B1HA 4GPAA 4W5QA 3W1EA 3FCYA 4PPYA 4ARVA 1XMJA 4QSMA 1GGJA 1HYQA 4JB2A 4BVFA 5D5PA 3FXAA 4IHJA 4S0XA 3V48A 2LRHA 3L6DA 1Z6YA 5EXSA 3BB1A 3IBSA 1P7VA 2P1DA 4YFYA 4ZEVA 4H1VA 5A1JA 4FFNA 3GDOA 3JAKB 4OYRA 1JHRA 1U6JA 1V11A 4WECA 1XT6A 1O6FA 4ZU1X 4KXQA 3OTGA 4OB7A 1D1QA 1QH1B 1A4RA 4MVXA 1ZM3A 4S2EA 3HK2A 2G82A 1CUAA 3PQ5A 3AO0B 4G8DA 4XM2A 5JJBA 4YAFA 1JXOA 3WWYA 2EF0A 3K9LA 1XNJA 5FFNA 4MKGA 1O94D 1E7RA 2Y99A 4UNPA 2A6PA 2OV4A 5F7JA 3EIEA 4B81A 2ZIZA 1IWOA 1RPZA 2VF7A 4RHYA 2JG3A 5KNBD 5JI3E 3G2KA 2ZU0C 3L7DA 4QUIA 5JXWA 1NUPA 1IWPB 2WTUA 5ALFA 5FAKA 4R1UA 4RV5A 1VG9B 1XO1A 3MELA 2VRNA 3H5WA 5LJIA 4HJXA 3VR5D 1ODLA 2QTMA 2RGDA 3RSQA 4B3JA 3U0VA 2CF6A 3CKKA 2HY7A 3KXDA 3LA8A 3H6KA 4LJ7A 2HSWA 4N3NA 4Z4GA 1D5CA 2C58A 4IRMA 4R2HA 4XRGA 2H4FA 1SBTA 1MKYA 1KRXA 4MPPA 5EE5B 4MPJA 5HIAA 2VSQA 1IUOA 3FNQA 2D2XA 3AUKA 5EYPB 2WJ4A 2BFOA 5G02A 5KCMA 1K6MA 1IEXA 5HS6A 1GAWA 3WOHA 4IJUA 3WLAA 3H2YA 1F5NA 5EMMA 3K92A 3K0CC 3CQ9A 4NPHA 2QP3A 2XMRA 3R5FA 3T38A 5G1PA 1XXHE 2AWOA 2XDQA 3HUTA 1LJUA 1TIKA 2OCKA 1A4IA 3CJTA 2FJ0A 2ZWOA 3T9BA 5ALMA 3HZOA 2VJYA 1QQ5A 2YCBA 1UQUA 3D6FA 4C4SA 5EPEA 1B43A 2A9JA 3EMBA 1X87A 3V32A 4Y0AA 1A5ZA 3L18A 1G8YA 2A92A 4HGQA 3TE7A 2JK0A 3DUWA 4K87A 1IM2A 3V1TC 2VF8A 1PTJA 4RBNA 4F6RB 1PLLA 4R41A 2X7HA 1H2XA 5EKXA 3JAKA 5JNRA 1YR3A 4MAAA 1TM5E 3DBRA 3S68A 2ZCVA 4B6GA 3KU4A 2H57A 3ROKA 3K8OE 3FRJA 1CY7A 1E1LA 3IOEA 3A4VA 2E89A 1VKJA 1YDHA 3ZQJA 4KQ2A 3WLJA 2J7KA 2SNIE 3HWRA 4G56A 5JVDF 5K8JB 1QLJA 1T5LA 2GEDA 2Q8PA 1NXTA 1JDTA 3K0BA 2X9QA 2HT1A 1TNDA 1MAHA 2HQ1A 3K16A 4TKMA 4D9KA 2ZUCA 2H16A 4E31A 3IMFA 2OCIA 1D7OA 3MTQA 4RVGA 3USES 3V1UA 4LDPA 3AUJB 2DFNA 3ER6A 1C5KA 2A0WA 3OPYA 4UDNA 2JIDA 3GWZA 3QP9A 5CFPA 4K2AA 3BMQB 3OH8A 1DAPA 4RM3A 4XI9A 1CR4A 3RE1A 3CLRC 2QPLA 4BASA 4GPBA 3TD6A 2OGZA 1SVOA 2C7VA 2YBEA 3CWQA 3VH3A 3ETLA 3QFSA 2MR6A 5HIKA 3MGKA 1NE7A 1T9AA 1NQWA 4GOKA 3ASYA 4UKDA 3U4IA 1PDOA 1KYIA 1XYGA 3H17A 3KT0A 3ZY4A 2HZBA 2GK3A 2P90A 3NXSA 2VDKB 4FONA 2XF2A 4MQEB 1QP8A 5DN6A 3TE6A 2PQMA 1P2DA 1BRTA 2RHBA 3PUJA 3MJ4A 5IYZF 5C35A 4KHZA 3GQBA 3GT7A 4ACAA 2ZUUA 3CPSA 2C4NA 2WM9B 3FSJX 1GG9A 3GIWA 3LK6A 1W1UA 4HSEA 4I5DA 5KX5F 1FFYA 3TMKA 2RI6A 1ZIYA 2F3TA 4GBED 3WO0A 2FZGA 4GQAA 1X1AA 1I1QB 1FRVA 1Z68A 3V9AA 2QTGA 3P2OA 2OB2A 2QNRA 3E2IA 4I0WB 4Q03A 4B4DA 3O75A 3R1IA 2QDKA 4D02A 3OIYA 1POWA 5LKRA 2JHCA 4GI1A 4O4IB 3LY9A 3HADA 1M73E 1M66A 5KPDA 2XKJE 2N0SA 3X2EA 4PG7A 5AMXA 4EJFA 4M9ZA 2IQ5A 2XPCA 3N6VA 1E0SA 5EMJA 1ENOA 2Q4BA 3JU3A 4Q4JB 2Q6VA 4JI8B 1VCHA 4H6WA 4U2KA 4BKQA 2XXAB 3QOWA 4YGXB 4Y2VA 3KKLA 4W9NC 2FNAA 4LOJA 5ED0A 1U8EA 3IDSA 1DAEA 1T4GA 5KC8A 1Z4PX 3PJGA 4F6RA 4KN6A 1YJXA 2ODWA 1CW2B 1ES9A 4BE7B 4M36A 3GPBA 1VCOA 4LK2A 2CF5A 3NHKA 5I9IA 1ISIA 3IPCA 4FGJA 4YAGA 4URYR 4DKJA 3I01M 2VIIA 4FGLA 4AZTA 3GLQA 4S0ZA 1QZUA 1FQKA 2QTNA 1JQLB 1ZPDA 3MW8A 3R5JA 4WIAA 4WNCA 1X92A 3OEYA 3ENNA 4MYHA 4X00A 3TKLA 1CUYA 3ED5A 4EM6A 4AIRA 3WDSA 5BYJA 4G85A 5HR5A 2GDJA 3AFOA 3L8CA 4PHTA 1C0EA 1ONBA 2PZ8A 3BMQA 2QQEA 4JDPA 4C4RA 5I9NA 2VLBA 4AP6A 3NBAA 4QEKA 1VHWA 2WA2A 4MQUA 1M2VB 2GFIA 2HWKA 1AZWA 3D8NA 4BMCA 4X8OA 5JWOA 2BWJA 3QGMA 1UZAA 4HQ6A 1B23P 4ZAXA 2D06A 2P69A 3OZ7A 4DT1B 4AK9A 2I2AA 3GYGA 3NATA 2CDAA 4B8YA 3V4PB 5ETJA 3ORYA 4EFNA 2RGRA 1Z2PX 3U48A 5AT1A 4D9NA 1IBCA 4PQFA 3EF0A 3RBXA 3OMXA 5EUBA 1UDRA 3PL1A 2QUBA 3EGWA 3W04A 1VMAA 1XWIA 5LMZA 2CLHB 2QJWA 3CH5A 2YWJA 3IMCA 3ADKA 3L7IA 2RHHA 3L7YA 1USIA 3M3PA 3OEED 4LYAA 4RJJA 4Z7QB 5K4GA 3ZOKA 3ZTTA 2CMFA 5DWDA 1H5NA 2HNAA 2I65A 4I7EA 1Q22A 4X44A 4YFVA 3QWIA 1W85B 3GRZA 3KD2A 1B0ZA 2TMKA 2H54A 4MXDA 2VSXA 1MRSA 1XTSA 2VCEA 4MRSA 4O4LB 4CCYB 1QXSA 2DWPA 1FU4A 4O4IA 3U81A 2XW6A 3U80A 3CO0S 3UAYA 2ZSEA 3MMNA 4B45A 1NKTA 1PV2A 2AEJA 2ES4A 2PKRA 4PFSA 4D0GA 1WB9A 3INRA 3INNA 2UKDA 4Q4JA 4A27A 3QKIA 1TEVA 4O8ZA 2XXAA 8GPBA 2P7HA 1VI2A 4QHTA 1E2KA 2CV0A 1AGPA 1Q17A 4ZI5A 3ZDRA 3V4SA 1FUKA 3CVYA 5IEBA 4LJ8A 1T3ZA 3NHAA 3QNUA 3KSUA 3ZGNA 4F3CA 5LCXA 3FFXA 2F1HA 5LQDA 5JYDA 3N2YA 4A4DA 4FGUA 2IGBA 4EUSA 2Q0HA 1DC8A 2IHTA 4Y2QA 3OJCA 3MMSA 2IBMA 4BFUA 3JQ6A 2DT8A 2XNDA 3E9NA 4JQZA 1VKOA 3MSCA 3CW2A 5DTEA 5LP6A 2HHJA 5DM60 2GF9A 5DU2A 4GD3Q 5F2OA 4D8WA 1J33A 4IEIA 3VNUA 5ADUS 4C04A 3GPCA 2VTEA 2FP4A 4COKA 4RTNA 1OH8A 2PUHA 3L77A 4OHKA 4D9EA 3PVZA 4N18A 5KIAA 1RJWA 4RLQA 1YHYA 5CB4B 4OCZA 3ZNNA 4OHCA 4KAAA 2H1RA 3MS2A 3AM3A 4C29A 4PYIA 5D51S 2Z8ZA 1QLHA 5ILOA 2CB9A 3WZ2A 2C2ZA 3KWMA 2IOFA 3VDNB 2HQOA 4L4YA 2OORA 3AP3A 3TQOA 4NCNA 4BIMA 4QD3A 4DT1A 3U26A 1L4HA 2D54A 3ORSA 2GNAA 2X4LA 1N6LA 1QDUA 2CFOA 1EGMB 2OV1A 3MWEB 4FGKA 4HN4B 2NADA 2ZZKA 4Y2UA 1OXXK 3GGSA 4HWRA 1T8WA 3GHYA 3X2FA 3O26A 3AK4A 2VSFA 2OCGA 1NKVA 5G4LA 5TMEA 3VDXA 3PJDA 1D04A 5KSOA 4EZIA 4LVOA 2PWZA 1ZAYA 3L40A 1KDTA 2QU8A 4MV9A 2E4AA 5H5JA 3TZBA 2FQXA 3BJRA 4IIHA 1CDOA 1ODCA 2E6KA 3PZBA 2JFZA 1W85A 5COAA 3SNKA 2CVHA 4XSGA 5J2UF 3CSDA 2BDEA 4O4LA 3E15A 2BM0A 4HEA6 4BN0A 1GAEO 2FKAA 3P9QA 2YFQA 5E1MA 1LC3A 1FQJA 4BLOA 4G0PA 4IMJB 2AK2A 5KNBA 1KO4A 5IVDA 3IDQA 1KEEA 1XQXA 3T4PA 4J07A 1EM6A 3UXEA 4M37A 4CETA 3TR5A 3DE6X 1M1ZA 3HR8A 4EI7A 1JB9A 2C5AA 4OXKA 4XE5A 2FW1A 3RGWS 4DF3A 3QVTA 1TVEA 4XVHA 2IPOA 1JDBC 1K5DA 3C15C 4KREA 3WIVA 3AV0B 4YQFA 1O77A 5TF0A 4CIDA 3TSCA 1OY1A 1RMTA 1W0KA 2BGMA 3KB1A 4MVCA 5CJPA 5FQOA 4GECA 1N0WA 3C24A 1XMVA 2Q5HA 4BKOA 3F6RA 1SUWA 1GGMA 2J3LA 2GN0A 2O54A 3C3AA 2GNPA 4QKQA 1PN3A 3QXCA 3QYJA 4IS3A 3I01A 3KKPA 2WWFA 2BL4A 5E4TA 5C7YA 1G5TA 3G8BA 5KYUB 2BFEB 5AVXA 4E30A 3GC6A 4JDUA 4EX7A 1Y6JA 1QE0A 3TUJC 2QD4A 2CWDA 2I4RA 1AX9A 3R7BA 4J16C 4KRXA 1HH4A 2OC4A 3VQTA 1M9NA 1JILA 1GXSB 1P80A 2HMAA 2O57A 4PZAA 2J08A 1EA7A 1NIJA 2KE5A 2XH8A 3OZCA 4K9SA 3UWKA 2PUCA 2FSGA 4OLFA 5CX4A 3T4XA 1B4DA 4EHBA 3KKEA 3LUJA 1SUFA 4FLEA 4KQ6A 2F8TA 5LZ7A 1CUFA 4GYWA 3KOOA 3ZLTA 3TCNA 2X1LA 2JAQA 4AUNA 1QCZA 1VIYA 4ALIA 2IITA 4PSCA 2Y6UA 5LLSA 3CWCA 2D6FA 2PH3A 4KIFA 2WTAA 2BZGA 3LL4A 1E1MA 4HS9A 5IBRA 1M8JA 1JLRA 3QQ5A 1K6EA 1JUDA 1YR1A 4NKRA 1CJVC 1U7HA 2RKWA 5MFPA 1ORVA 1M72A 1W4CA 4D9MA 3OE1A 2PUWA 4CG3A 2YC2C 5TMDA 5BUZA 1JKFA 3C1AA 4DA6A 3WK8A 3K72B 1N34B 1FSSA 4CXMA 3QLUC 1N2JA 4UJ3A 5TGDA 4U2CA 4XCQA 3OT4A 2HNKA 1JWBB 3W4JA 5KTYA 3KDAA 2BMJA 1G55A 1KJIA 1L7PA 2Q8NA 2X76A 3KC2A 4HOYA 5AW2A 3RV4A 1R74A 1YQ9A 4Q02A 4URHA 4J3NA 4GKJB 5H0IA 4CF6A 2Z2KA 3TGPA 1VL2A 2NT3A 1XD2B 3DSRA 4TMXA 5B58T 4E4RA 4YONB 3FYHA 5AVTA 5F1YA 2LWIA 3NHSA 1KH1A 2X4IA 4P3XA 4YRAA 3EEOA 5FNVF 2YJ4A 3KV3O 4U7TB 2C2OA 3O38A 4IJQA 1M10A 4QQNA 4XGQA 2IPXA 5AI0A 5EZYA 4JEUA 4OFZA 5DHRA 4C2UA 1XTUA 3KVOA 3SQNA 4ECEA 1G4UR 4FYHA 4AWAA 1VHDA 4GVPA 1MABB 3QHAA 4RKFA 3JS5A 1NVFA 4RQUA 4YBRA 5FLEX 2GN4A 4XJSA 4M0PA 4CF7A 3A32A 3OAAA 2OXEA 1NBIA 1NFFA 1T9BA 1PV1A 4MUFA 4OI4A 1E6KA 5JE8A 3VZPA 1XRLA 4I66A 4TKLA 4UTXA 5JAUA 2CXXA 2ZE7A 3BA1A 4C76A 1TMOA 3LK7A 3IUYA 4PLFA 4WAUA 2WLTA 3RNLA 1C80A 2YN2A 3B1YA 1VYTA 1G7CA 3I23A 1H9AA 3CSSA 3OHMA 2QAGB 2W2XA 4GZ3A 5KYUA 3UHOA 5BNFA 3LLMA 3ZU6A 2XNJA 2CXPA 3WQHA 1YK1A 1GXSA 4IUBS 5CEJA 4ZVOA 4NBNA 1VI5A 4OL9A 3UAWA 4YT8A 2C84A 2Z0MA 3RRBA 3QTBA 2NACA 4M1YA 4RF4A 1WULS 4ZMSA 3IUBA 5ITWA 4NXMB 2D2VA 2B5OA 3ROFA 5EE0A 2AFHB 3WWCA 1JJBA 4MUBA 3KIPA 3RU7A 4DPMA 2HDHA 2WWWA 3ND5A 1IBRA 4EABA 2LZ0A 2VDLB 1T5TA 5H83A 3FMOB 1D6MA 1DG1G 3B2NA 1WXQA 2H2FA 2QYSA 2QR2A 1FJ2A 1HE4A 4M0CA 3IPXA 4Y1FA 2H3HA 3LFTA 2ATVA 1ABEA 1L3CA 1O3YA 3B3QA 3DJYA 3R3SA 3UMFA 2B0JA 2B4TO 1BS9A 4GIBA 1SBQA 3LWZA 5DCLA 3HXQA 1YGPA 3FNRA 2P1ZA 1TCBA 1V3TA 2ZQYA 4MQFB 1B93A 4D4GA 5TIIA 1ACMA 5BN3B 4WOKA 1KMIY 1YB4A 1CUSA 2G6BA 1YS6A 3SY8A 2A0FA 3VM6A 3OPQA 1FXUA 4H15A 4R71A 2DYKA 1RWVA 2H1WA 2IELA 2JJMA 3JQAB 3ZV5A 5FTLA 1RZRD 2GXAA 4MIYA 1Q1BA 1M54A 2H63A 3DYBA 2FPXA 4BNIA 4DR5B 2QTTA 1YRWA 4DIEA 5JQWA 1TF7A 1MOPA 4LMPA 4XQ0A 3TUZC 1SD2A 3HXPA 3KKOA 1SAYA 2GPYA 2ZJOA 1LPAB 4AO6A 4PAWA 5F9FA 4CM4B 1XQWA 1ZN2A 2OENG 2OHVA 3S40A 4WBXC 4C4ZA 1AOXA 1KDRA 1ZLYA 2I4OA 3OM0A 1HV8A 2QTZA 2XYHA 4TV9F 1HE1C 5A6SB 4D9IA 4COOA 5DVZA 2BTEA 1TFRA 2JI4A 3KEMA 4LXXA 4B7ZA 4Q16A 3W8FA 3U6KA 1PP4A 1SCNE 2AYYA 1I33A 3M6XA 2QJOA 4ZCTA 1CUJA 4PQYA 1EXVA 4EW2A 2PSSA 4X61A 1RYYA 5KJFA 1BGXT 4UHJA 4EFDA 1PTJC 5AI5A 3W5DA 3C3KA 5HF6A 4TSFD 1YWGO 3ULKA 1MEOA 2CVFA 1XHLA 2JHPA 2Q6OA 3IV7A 1W4RA 4RFSA 1YVPA 2PZLA 1SVMA 1KZGB 4JA0A 5FX2A 5I7OA 4PIPA 3F1KA 4FZ5A 4IF4A 2AFHA 4JB3A 4E46A 3COJA 4QFDA 1WE2A 1H1LB 3FNFA 1H4TA 4Y7CA 1HYBA 4NR0A 5BW6B 5BVHB 1E4OA 2HRRA 3BJMA 4DGSA 3NGMA 3DXZA 3QW4B 3RIGA 2OV8A 3GQVA 2XCSB 1FMFA 2WIAA 2C99A 3QKSB 5HWSA 5BUSA 3HBNA 3C4VA 2R6DA 2L17A 1UC5B 1MF7A 1K7EB 1ZZEA 1B15A 3K5PA 1VMIA 3TO5A 1SG9A 2YCLA 4GT1A 3EGOA 1KSJA 2AMJA 2CK3D 4XQ9A 1U0RA 1CX9B 2UYCA 4KR6A 3EQ2A 3DAGA 3DOOA 1UAGA 3TDKA 1XVLA 2FKNA 2HO5A 4JVSB 3LXRA 1T2AA 2B1RA 2IZZA 2GPBA 1UC4B 5P8WA 1Z3CA 2Z09A 3FFAA 4X8HA 5BN3A 4QVIA 1C3OB 3PHJA 3R5HA 1FZTA 1QG0A 1X7GA 1CYDA 3QVXA 3LKBA 4NL4H 3HJNA 1A7UA 3WSVA 1P77A 5FUQA 3R3ZA 2NXNA 1JKXA 1XU4A 1N1GA 1Y80A 1VYHA 5JYEA 1Y81A 1PK9A 3KR0A 4AI6A 4WGFA 3EOZA 4UXIA 4F1JA 1IEWA 1JA1A 2Z83A 2D4HA 3BKWA 4NSNA 5E6RA 5HK9A 3SQXA 1JHOA 1MIOB 4CM4A 4GQIA 4UVIA 1XQ9A 1MPXA 3VHRA 4C0QC 1NLFA 5JCPA 1NG1A 1TF5A 1RJ9A 3TZHA 3H18A 1DWQA 2AFIE 5LQMA 5A6SA 1V2GA 3BHNA 1M7BA 1U04A 2X22A 3NTXA 4NRDA 4H7KA 1NVEA 4PYQA 3FCUB 2HNBA 4ARAA 5DBHX 1GGFA 1N2CE 5DNVA 4DPLA 2ENWA 3P7MA 5F4BA 2D2IA 2J46A 4MJXA 4MS1B 3W5VA 1UT5A 2QW0X 3KZCA 4MWOA 1YASA 3PQ8A 4O2AA 5KQRA 3KEFA 1KI7A 3PPWA 4OOEA 4EYKA 3I2HA 2VA8A 2UUOA 2DB3A 3LAWA 5C7IO 4MRMB 1K6IA 1BEEA 1EBFA 3U09A 4Z86A 5EIXA 2OZLB 1Y5NA 4EA7A 1QCCA 4WASA 1QSGA 4MP3A 1O03A 2I91A 1YCDA 1NX6A 1M1YE 2ATXA 1RWWA 2Z43A 3C1UA 2O05A 3TLAA 4CHGA 2PR2A 2O7RA 3TIXB 3KR2A 2L18A 2IYSA 4P38A 3J81k 1PV4A 2M9MA 4KAJA 4LJRA 4GX5A 3UA4A 3EGEA 3LKZA 4KE7A 3ROXA 4HPJB 4C0KA 1VPEA 3OJOA 2P9EA 5BVHA 4RTMA 3GAFA 3LX5A 4OHXA 2BEUA 2TMDA 4JBXA 1AK2A 5E3JA 4JKOA 5B57C 2JVIA 3QKSA 4IDHA 5FL3A 2CW5A 1E2EA 3AUSA 1F1JA 2C3PA 1C9EA 1KAEA 4G5SA 4I1PA 2O2EA 1D6NA 2BMFA 5JD4A 2JLZA 4M8KA 2HLDA 2HA6A 5FAXA 2RFLA 2Q2QA 3CGWA 4MCHA 4YAWA 1I9GA 3MT8A 3E1SA 2UYHA 1NI4B 3N05A 3DS8A 4R2LA 1SHTX 1KS9A 1XK6A 3HRKA 5EJ6A 4WKPA 1NVAA 1G5PA 1U3UA 1ZO8A 1T5DX 1W34A 2H4WA 2OK8A 1C3OA 2V4ZA 3HC7A 3MJHA 3QUAA 3MTJA 4RS3A 3V4ZA 4L7VA 4JYAB 1BN6A 3SFVA 4QG3A 1WB6A 221PA 2DG2A 3CRVA 4YJHB 5IKPA 1Q91A 1CR1A 4S05A 4OH1A 1G6OA 4RKQA 2OAGA 4JLSA 3GLHB 3TQFA 2K2QB 4KXMA 4RFLA 4X7PA 4W8GA 3AVTA 3NT5A 3PWTA 2PCLA 3DNPA 3E8SA 5EFZA 2EZ4A 1VTKA 1IJKA 1UPTA 3QFHA 1MIOA 4Q00A 4PG4A 2VSNA 1EP3B 3D6JA 5I7HA 5JOQA 5IJZA 1Y0BA 2QRVB 1MJ5A 3KWFA 1Q6ZA 4ROSA 1RXEA 3N2NA 3Q9NA 2RE8A 3L1KA 4KVGA 3P2JA 1A8IA 3ZIAD 2ZUWA 1NUAA 3IQXA 4IDOA 1VG8A 4HAOA 3IQHX 4LBWA 5DHSA 4ZEMA 2Q9UA 2GTPA 4DV0B 3VKWA 1V4VA 4YP5A 1LA2A 3WL7A 2ZJ2A 3OIWA 4QLOA 2SKCA 2F6RA 3TQIA 1WA5A 3O9ZA 5CA0B 3D6MA 2DFTA 3T3EA 5JLAA 4B2PA 4YUXA 5A5EA 2HCBA 2Q07A 4MRMA 4V03A 4HCJA 1I1HA 1P4RA 4ZQFA 2CNBA 3M6UA 3QBTA 3PPXA 3SS9X 3PF8A 4DUGA 3SJCA 1CUUA 3THYA 3H83A 1IXZA 3RQIA 1IJBA 2BR5A 2H7XA 1JEDA 5CDUA 4IMIB 2FFJA 4OQMA 2W2QA 3WLSA 3IHTA 4FSDA 5LP6C 3IVXA 4RIIA 4O63O 2OE2A 2QN9A 1MDFA 2QKYA 1RWPA 2WOOA 3FPHA 3GD7A 4QU5A 3VAAA 3R8FA 1N7JA 3MWKA 2X23A 1ISGA 4IFIA 1PFKA 2JRLA 3LNTA 1B1CA 2WVAA 2OAEA 1XAIA 5EJFA 5LYYA 3L6BA 4G9EA 3L93A 5JZVA 2XSZA 1M67A 4YHHB 3QXSA 4PFKA 4AFNA 1OHHA 3GIDA 4AP9A 1XALA 4CLOB 3NONA 1EWKA 3ZXUB 5HIMA 3SR0A 1SOAA 4Q9NA 3EIOA 5C8YB 5DW3A 1G5FA 2OORC 3KOZA 1N5RA 1NPTO 1X7YB 1Q5PA 2WSIA 1LF0A 3GOQA 4D45A 4LF5B 4DJTA 3P9PA 4PCUA 1W6UA 2IF0A 2PMFA 2O6LA 3BJZA 3FMPB 2A5JA 3LUHA 1MAUA 1TA9A 3T41A 4D92A 1E3TA 1AB5A 4Q01A 1L7XA 2MU1A 1Y5MA 4K9OA 1JSXA 1NM5A 3HY3A 4FX5A 5JMTA 2Z4SA 4KODA 3C98A 2YBDA 3QY9A 4FYWA 4YJKA 2ECFA 2XE8A 3LHFA 4QDOA 1YR8A 5IZCA 2PIDA 2W2MA 2W7TA 4I5EA 5HZHA 2DLNA 2QL6A 3PE6A 3U44B 1MOSA 2ZJYA 3EPHA 5KTMA 4OYYA 3Q2IA 3H8VA 3A31A 3R0ZA 4RABA 2RARA 4FB4A 3FTEA 2JHAA 2HBZA 2BOVA 3KE8A 4QUDA 2I7CA 2Q7DA 1BH2A 2QRVA 5IABA 1EP2B 4OM7A 1SIUA 1JPJA 2FXIA 2WW8A 4FSXA 4P1ZA 5TQ0B 1ZN8A 4CV2A 2EWMA 1IQPA 2BBOA 1R0BA 3FI9A 3O1HB 5AHRA 5CXUA 3ISTA 1TGVA 1ESEA 2ZYHA 4W5WA 4UCFA 3X1XA 4KWEA 3DZJA 3NKLA 521PA 2WYHA 4I3GA 4FN4A 3K7EA 3E53A 4JA2A 5A0FA 1JJVA 1J8QA 1UZLA 4YRFA 5AXAA 4UVHA 3FI0A 1DRKA 5CA0A 3ROMA 2P3QA 5AUPB 1FF9A 2ZIAA 1Z83A 3IBTA 2GN9A 3LZCA 4LWQA 3BXFA 4MDYA 2PG3A 3QFCA 3AYXB 4N1AA 3RK0A 3EIHA 4O1HA 5JJCA 5K8UA 2Q1WA 3BD7A 4EKYA 3WL8A 3QLTA 1QLWA 4IUDS 2RB4A 1Y37A 2AF4C 2JAUA 3C6ZA 4K9KA 1GQYA 3P27A 1ZVMA 2FJPA 2GLXA 3M5CA 2ZJ7A 3S2UA 3DM5A 2JGEA 3A6LA 4YASA 3HJGA 1Y8QA 1PFUA 2Q3LA 4QOFA 2J3QA 1LW7A 2XYPA 4BUCA 5FH9A 2E9SA 2J1LA 2PRSA 1H0HA 1MU0A 2YS7A 3IOMA 1Y98A 5M2QA 3W6ZA 4MPRA 3ZLJA 4DR6B 1G21A 4NATA 5A9SB 2VF2A 4D0NA 4TMVA 4OUKX 2ZDHA 4AW9A 2ZT6A 5C8YA 1GGVA 3RC7A 1X7YA 4Y2XA 1LZLA 4QYXA 2COEA 3DEKA 4ETMA 4CFSA 4YJ2A 4CEJB 1L2TA 2N9UA 1NN3A 4H16A 4H1TA 2DPXA 1T10A 4XGNA 4EPVA 2GVDC 3F90A 3IJRA 3NNDA 1L3IA 4QULA 4MLCA 4MGIR 1LRJA 5F5XA 3VR5H 5IFLA 1L5FA 1WTAA 4CQMA 4XYGA 2HREA 1QZZA 2MSDB 4GS5A 3QRWA 4BNWA 4NJMA 3PHBE 4GXTA 5JG7A 2QPAA 2BBSA 5DHAA 3QOFA 3HPQA 3UQYS 3T3HA 3WRXA 3UGJA 4YNBA 2R9VA 2PX5A 2ZTVA 2Q3HA 3BXXA 3WDMA 3IDAA 1KHHA 1RMQA 1T9GR 2IHVA 3FTQA 5L3ZA 4AYTA 2FGKA 4LZJA 2W37A 3UUGA 3MS7A 5FBVB 4UQLA 1SCKA 1V4NA 3LT4A 3OQVA 1NNSA 4OSPA 5EPUA 2ZSKA 1A9PA 1P1BA 2G17A 1Q1GA 4JODA 2WNSA 2O3UA 3IHWA 3JQ9A 3N0VA 4FGWA 5ALDA 4F2DA 1SBCA 5H68A 3VV2A 3VNVA 4V0NA 4B83A 4ZIRA 2DHEA 3H0CA 2IXAA 5KI6A 4IYJA 4Y7DA 4D4KA 4G0VA 2CDCA 1H2BA 3NDRA 2BLLA 1LS1A 1MZVA 2ECKA 3MRVA 3W2GA 4URXR 3LGXA 3SYTA 3L06A 2XA9A 5DM4A 3ZIUA 4TWRA 3QOXA 1DVRA 4GLBA 1OFVA 2QK4A 1ONPA 1Z7EA 4Q47A 4UHCA 5E4YA 3K6SB 3H2IA 3ELYA 3QU4A 5B5SA 3KRTA 1LX7A 4FILA 5EHXA 3GFSA 1PCXA 1WMDA 5FUBA 2IYYA 4KQFA 1ZGAA 5IJAA 4XCVA 2YHIB 1DPFA 2VRBA 4KGDA 4NFSA 1NL3A 4C2BA 4C3ZA 1I7QB 1LC0A 1P2UA 1HY3A 2FY8A 3CF6R 2HBYA 2IV7A 3KUUA 2X5XA 4ED9A 1FK8A 1GCGA 4AECA 2R8OA 1CG6A 1YZ3A 4D8VA 3R74A 2QL7A 1E94E 4C2AA 1EI9A 3R23A 1FVHA 3A26A 4JEHA 2CL6X 2WZCA 1HO3A 3CG4A 1R6DA 3FIJA 1XP8A 1BX3A 3FGOA 3R8XA 4F4FA 1GTRA 4CEJA 1YE3A 4NCJA 5EY5B 3GUVA 1MV8A 1QYWA 2ZS8A 3T1VA 1KYXA 2UVQA 3QG5A 3TW8B 2W6JD 3P0RA 2IX3A 3CA8A 1JEOA 3I4LA 1THZA 3IXQA 2WHEA 5TEWA 2Z5LA 2GBCA 2XOKA 3T3OA 3IVRA 2NWQA 3MLEA 3PL5A 3S4YA 3ZHQA 5ARBA 1U8TA 1ZGGA 2BGLA 2EG5A 2J5QA 2R7KA 5HXAA 3N6XA 2GEKA 2GAOA 3OTIA 1G18A 4JP1A 1LK7A 3L0IB 1HPLA 4PHHA 1P5HA 4HFNA 1DLIA 5ALYA 3AKYA 3II6X 3JWEA 4GICA 4JBLA 5DV9A 1J0DA 1AXRA 3P2EA 1J07A 3SAJA 2O8VA 4XZ3A 3T7AA 2FPPB 5IUJC 4L1KA 1WBDA 3GBSA 4AF6A 3UCXA 1NDHA 3GUUA 2FW6A 5BXQC 4YRDA 2ZBGA 4I55B 1ZW6A 4KRGA 5I7FA 3EAFA 2QTWB 3B5EA 1YB2A 1GQQA 4Q1CA 3NEAA 3UT5A 5B4TA 2ORYA 5GJCA 1TQ6A 5LWQA 4GVLA 1AKUA 4IDQA 1Y3DE 3WLFA 2PXAA 3G5UA 2XT9A 4UVDA 4Q48A 3WFZA 4EJ6A 4GNKA 1X8LA 3UAXA 1ZGJA 2GI4A 4ZI7F 1AQIA 1L6IA 4GPZA 1E1DA 1QHYA 1SKUA 3NFRA 1O87A 1V45E 1T25A 1AKVA 4W9RA 3T12A 3OA0A 1QFZA 4CUJA 4EF5A 5JNUA 3DFKA 4H7DA 3H2KA 3R3XA 2CVZA 1JR6A 4N0QA 2VF5X 1U2DA 4NK4A 4DEXA 3G82C 4MUJA 1RAEA 2QAGC 5BV2P 5GJWC 1LS6A 4RYLA 1D9ZA 1NTOA 1VKZA 2YHIA 2YOFA 3I12A 2BE9A 3O83A 5JATA 3VR1A 1IQRA 1RYNA 3DTVA 3FMFA 3H5RA 3ZK8A 4BO5A 5L6LB 4QRIA 3WLPA 1P1KA 3I1FA 2G8LA 2YOHA 3U4A<