3CR3C

Structure of a transient complex between dha-kinase subunits dham and dhal from lactococcus lactis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
121
structure length
121
Chain Sequence
YGIVIVSHSPEIASGLKKLIREVAKNISLTAIGGLENGEIGTSFDRVMNAIEENEADNLLTFFDLGSARMNLDLVSEMTDKELTIFNVPLIEGAYTASALLEAGATFEAIKEQLEKMLIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Structures of the Three Lactococcus lactis Dihydroxyacetone Kinase Subunits and of a Transient Intersubunit Complex.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Transferase
molecule keywords PTS-dependent dihydroxyacetone kinase, ADP-binding subunit d
total genus 41
structure length 121
sequence length 121
chains with identical sequence D
ec nomenclature ec 2.7.1.121: Phosphoenolpyruvate--glycerone phosphotransferase.
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03610 EIIA-man PTS system fructose IIA component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.510 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphotransferase system, mannose-type IIA component 3cr3C00
5IM4F 1VSQA 3BEDA 2JZOA 3IPRA 3CT6A 3CR3C 1VRCA 3GDWA 3MTQA 3GX1A 4TKZA 3LFHA 1PDOA 2JZNA 5T3UA 3B48A
chains in the Genus database with same CATH superfamily
2QRJA 3BSWA 1WP9A 5EE3A 4AG5A 3OCYA 3I73A 1V41E 1TQ8A 1I4TD 3CEAA 3E9YA 3S0JA 3T9FA 4DHWA 4EHKA 3KXIA 4G5QA 4TLEA 2VXBA 2JIOA 4GXNA 1UODA 1F9EA 3ZV5A 1CG6A 4C0QC 1AKUA 4D9KA 1YKSA 2I33A 1E3QA 1KK3A 4FFNA 4OLJA 2YOGA 5AHKA 3OZCA 3S8EA 3S29A 4AB1A 5F5XA 3HNRA 3T94A 4U3JB 3P9XA 1KYQA 1Z3CA 1T0PA 4XVUA 3GNSA 2CVZA 1RPNA 3E2PA 1HZZA 3NRCA 1T1SA 4ZQFA 3ZY3A 2AEEA 4G67A 4XPZA 3FTEA 4AAYA 4BQNA 1F4VA 2UVPA 1V7CA 2VLBA 3IUPA 4L4RA 3T1OA 3DVQX 4X92A 3IJPA 4EPTA 4LZLA 1P1BA 1T2VA 2O8FB 4BFTA 3P9QA 1THGA 2X1HA 5LZ7A 3H3JA 4EY8A 4R16A 4URUR 4XYEA 2XQJA 4LCBA 5T6BA 1CY4A 2XZDA 2QRLA 4DUYB 4OBEA 1XX6A 1EUZA 4CTNA 7REQB 4M9ZA 1UBEA 4BWVA 2G04A 2Y1WA 1B6RA 5B6IA 1T1GA 2XWSA 3T4PA 4E1BA 2VATA 3IXMA 3UV7A 4GM4A 1UOOA 3HBFA 1PFGA 2R6DA 1XNHA 1F0NA 4RXTA 4UDXX 5HJ7A 1JG2A 1HDGO 3HBAA 3QITA 1M1YB 1E3EA 1VJ5A 2I7VA 4RV4A 4YP5A 2XZOA 1VZ3A 2ZB8A 3F6CA 3GZNA 2NM0A 2PBLA 3R3HA 1JEQB 3HYTA 4B8YA 2OK7A 4I9UA 2J5RA 3CLSD 2WM3A 2XA2A 1HL3A 1WZCA 5M04A 4H59A 3HM2A 3CNNA 5J9FA 2VIIA 1EDZA 1KMHA 2GF0A 4MA0A 4D9BA 1X7DA 5CXSA 3SZGA 4B7ZA 4RORA 1LXCA 2C5HA 4F3KA 1IN1A 4G63A 1X19A 2W6JA 1YMUA 4ZK2A 1NULA 1NXWA 5LMNB 1NMEA 1O5IA 2IRWA 3PDHA 4A36A 3H65A 5JHHB 1RJ9B 3LM8A 1TZBA 2AN4A 2FWPA 5DLPA 3LWZA 4NEQA 2BUCA 3OBBA 1XUOA 2E37A 2AQKA 1EIZA 1RHJA 2J9FA 4O4JA 1IUNA 2G6BA 3RFTA 2A2ZA 2XYVA 3SSAA 3IEIA 1DQPA 2EHJA 2NU9A 2BRUC 2CDCA 2IYAA 1EHIA 1SC1A 2DPHA 2H48A 1PP4A 2CFSA 4Z54A 4ZOLA 3D1LA 3D8BA 2L17A 1DRUA 2OD2A 1O96B 5FWXB 4FR0A 2FP4A 2B0JA 1T4CB 1XZ8A 4ARAA 4UNQA 1G64A 2P35A 3LIPA 4HDCA 5SZKB 4CHTA 1P3DA 3C4VA 2YWCA 1IPFA 3QVVA 3S7TA 4F2HA 3NHZA 4HG2A 2XYPA 3HA3A 1JHDA 1SHLA 5AHWA 2BKVA 3AJEA 2BM9A 3KEMA 5FBQB 4F71A 5EZSA 3TQRA 2RCYA 3E3MA 3SX0A 2JIMA 1UM9A 4Z6KA 3HXKA 2EEZA 3UC5A 1UP6A 2WJHA 4ZO6A 4F4IA 5A2QA 2RGNC 3DOOA 1G7SA 1B6TA 1G3RA 2YWHA 3MC1A 4BZQA 3WMRA 1K8XB 3UK7A 2CXTA 4E6PA 5LZ2A 4H3KB 4C5AA 3FNBA 3H17A 4TVKA 5C4MA 4NBWA 2PS3A 3R76A 5KOJB 2PX0A 5JDIC 3OCJA 2O8VA 4NARA 2RHWA 5M5BA 1UOEA 1DC8A 1O95C 2G40A 3GAAA 3JARB 4XWYA 3TQSA 2IU4A 2Y05A 4Q1CA 5CTJA 3ERCA 1MA0A 3N0TA 2HBRA 2ZLBA 3I32A 3OPNA 5HE9A 2UDPA 1R7RA 4CTOA 4D26A 1AGNA 3QY0A 3H11A 3J7TA 4ETIA 5BYBA 5LA6F 1PGPA 1YFKA 1TZMA 2RCNA 4BNIA 3OQ1A 1P18A 1D2EA 1FVHA 3G49A 5CXUA 1BN7A 3ZW8A 1PDOA 1WXGA 3H87A 4MW6A 3L77A 1OIVA 3PQEA 5TPZD 3RDPA 3ZUGA 4D3ZA 1JHUA 1SXGA 1KS9A 1P0MA 3DVLA 1OV4A 1ZGGA 3NYRA 5M2QA 1NX6A 3BIJA 1P5RA 3O7MA 3F1LA 4TYQA 1JZTA 4R8MA 2IT1A 3IAS1 4BC0A 1WMEA 3FPLA 4AULA 4DIEA 2ZBFA 1TA4A 4AJLA 4WLUA 4L72A 4DEVA 2YS6A 2X1MA 4NXNB 2RHHA 1JHZA 3A6FA 1S9DA 2E4WA 3W4KA 4Z4QA 1DAPA 1CFZA 1PSWA 2VK1A 3JYQA 1QQTA 1YZHA 1BU5A 1XTBA 4YGXB 2GKOA 4FBLA 4HEHA 4JZYA 3RSFA 3B3JA 3ZQKA 1RYHA 2R62A 3MJCA 3SXUA 2QRUA 2Y0PA 3THXA 4ZTZB 1AB5A 1YU6A 4B3CA 1PQYA 2B25A 1W75A 4CQMD 4EQZA 3ABIA 3CXUA 3VXKA 1XZKA 2IUSA 4M22A 3BMOA 4RIFA 5F4BA 2A14A 2CNLA 3K96A 4NCBA 1XAJA 3I76A 2I7XA 2QQEA 3BZUA 1SURA 4C21A 3QLEA 1V43A 3L8GA 3I05A 1W85A 1B16A 3P5BA 7GPBA 2O8EA 3GIDA 1TXGA 3IV7A 4KG7A 4N54A 4NZPA 1YFZA 4G0QA 3EIQA 4GDMA 4XWOA 1RWMA 2C04A 3WAJA 1I4EB 1REQA 2HIGA 2B2CA 3IBTA 3NANA 5BWNA 1N2HA 1PK7A 5HOEA 3PX7A 4LF6B 2EX4A 4RM3A 3T06B 4ODIA 1MABA 4AJ4A 2NGRA 1T15A 1XFAA 2Y1CA 4G37A 2ZB2A 4RA9B 4WK4B 3L7BA 3UT5A 3NIBA 3LFHA 4J1TC 4ZAGA 1I30A 1NUAA 4G84A 4YLYA 5JNLA 4ZA2A 4KITB 1ZVMA 2OL4A 3I4LA 3CO5A 2ZIWB 3TOVA 1F1BA 1B23P 4A10A 1QDEA 1RQ2A 4GQAA 4QUKA 4X00A 3STHA 2PZLA 4YMSA 1WSBA 2XCOA 1O9BA 4QOHA 3NG1A 1NAHA 1Y37A 1ENPA 3K9WA 4BN4A 3AR8A 4AO7A 1X86B 2B5WA 3A6JA 4CIWA 3L7NA 4A6EA 5I01A 3B1WA 1OBFO 2XUZA 1P2TA 3FVQA 3QZUA 4ZO4A 4AX4A 4JC5A 4UQPA 4AY2A 1QO9A 2HA5A 3L5KA 4KFTA 4RHXA 3RC3A 3D31A 1CE8A 4YJ2F 4JLSA 4LY3A 4GOJA 1E1DA 1LGYA 4KW7A 5FL7A 4IJMA 1XMJA 4O6VA 3U7EB 3ZJVA 3PC8C 1Z4MA 5AJWA 4PWZA 2B61A 4IXMA 4A6XA 1L5YA 2WV7A 2CVQA 3ZTTA 3T7RA 3UCFA 1IIRA 1OTHA 1XEXB 3COJA 4MHSA 4ZOLF 3FTDA 1LUAA 3L9XA 3IQDB 2YIVX 1E1CB 3CINA 2VHTA 3FZNA 2RGWA 4XSVA 4KO2S 4OFXA 1KVQA 1XZFA 4TKMA 1RQNA 3BMCB 4FUTA 2QRVB 5FUMA 3TW8A 1CEQA 2H4ZA 2BGTA 2I5PO 3OE1A 4TQ9A 3SLKA 3ZXSA 3QJYA 4EGFA 4XUEA 3EMKA 5FYQA 2JI6A 2C3YA 2BFFA 1MQSA 5H3CA 3P27A 5B1YA 3BGSA 5CURA 5H83A 1J90A 5BN4B 4E5PA 1O1YA 1O2DA 1S8NA 1FYXA 4EGSA 2GBCA 2R7NA 4ZGGA 5IF3A 1JIIA 2NO7A 2XDAA 1YB5A 3VPXA 1VMEA 1T9AA 4E08A 1XVUA 5AIAA 2F1HA 2QAJA 1YDWA 1XTJA 1Z35A 2CLMB 1H65A 3CC8A 2HEGA 3H42B 1JS1X 3I9NA 3PRJA 4U5XA 5KNCD 3ER8A 5G0UA 5F64A 3GLHB 2QSUA 2JKZA 1KAOA 1EP2B 1EVIA 3OX4A 1D1PA 1T4CA 3PHBE 4Q4CA 4QQRA 5JH7F 2P78A 1VYHA 4Q21A 2P4EA 6NULA 1JALA 5KSZA 1W49A 2D4HA 1CDOA 1OZFA 4YRDA 2FSVC 5ADVA 4MINA 2PUFA 3EULA 4MQFA 3VDXA 5EQTA 4LXQA 5SV2A 4H7JA 4CPDA 4Y1RA 5BSWA 5HKAA 2WOOA 2XNHA 1L3CA 1ZUD1 1OX5A 2YDYA 3G7NA 3LX8A 3N2NA 4FDUA 3NEJA 3ZNPA 4HSGA 2V3CC 4Z5XA 2YWBA 3JYOA 2ZJYA 4FU0A 4WDRA 1W73A 3L8YA 1LW6E 3TQCA 4CT4B 5MFZA 4N76A 3A6HA 3ANMA 2JEZA 4K88A 4LF5B 4J76A 2D1FA 2HV9A 4M0UA 3EQ9A 4FMCB 2RAPA 4OQZA 2ZUCA 4D4MA 1S96A 2JJ1D 1Z2DA 2BISA 3VZSA 3HU3A 1TD1A 4F56A 3DUFB 4LDAA 3BD8A 3NBXX 4JVNA 3A70A 3NDIA 3SQOA 3O94A 4QUBA 5CYFA 2R751 2DY0A 3T9EA 4MEJA 5IF9A 2Z6UA 2QE7A 4DWJA 3UC9A 2C5FA 1D2CA 2GRJA 1XCPA 2ODNA 1CUDA 2ZJ7A 2QJFA 4YRFA 3CUEF 2XJ4A 2ZI3A 4HDSB 2QVBA 1SVSA 4OQMA 4ZEXA 4RY8A 4Q4JA 3WMGA 2I03A 1EI9A 2L42A 4P81A 1XPRA 3WV4A 5F9FA 1F38A 3JQ6A 5G4LA 2XCTB 2RGDA 1QOPB 3OT5A 4BRSA 3RBVA 4GX5A 1U2DA 1EVYA 2QDXA 4IQGA 1LK7A 4DXHA 2XYHA 3LXRA 4JBXA 3PTZA 4KRYA 1BHO1 5BW6B 3W8EA 4IICA 2PUJA 3ZQ4A 3L05A 3F74A 4KUHA 2ATVA 3JVUA 3T9DA 1DL5A 5HIIA 1PJCA 2M6SA 2EFYA 2B2NA 4NCAA 1HNXB 3G9QA 4QVIA 1O77A 2CHFA 4Y1RB 4Q1BA 3R6GA 5KBYA 1FJ2A 2FRDC 2PDAA 4BECA 3G2PA 3OQNA 1A2QA 3JPWA 5H9VA 3ZGVA 4LXTA 2C7VA 2D7CA 4YDRA 1HYQA 3OM0A 1KOJA 5CYPA 1KBZA 4NEHB 2Y9PB 1BVRA 1W93A 2PKWA 3HGTA 1QFMA 4NDAA 2J46A 2O1XA 4D9NA 4A1FA 2QTVA 3CVVA 3ECAA 2DH6A 4D3DA 5MHTA 2R2AA 1UBFA 2XBUA 4GC5A 4L27A 2D0PB 2IW1A 2QMUA 2GM4A 4DMUB 2O0MA 1IJEA 3CWCA 4KB5A 3R6TA 2JCVA 1RHMA 2PVCA 3QVGA 5KSYA 5IM4A 1N2OA 5K9ZA 4K05A 4UAVA 1P0FA 4TS9A 3GRZA 2W43A 4X62B 2BFDB 5LOVF 1CS4C 2OECA 1RBYA 4AK9A 4D9EA 4DT1B 2O8FA 5I7SA 1JKMA 1SG9A 3L40A 1Z22A 2VRCA 4F85A 2D1SA 3GWGA 2XSZA 3ME5A 4JL8A 2F8LA 2LDBA 4YJGA 5D5QA 1U3FA 2G1UA 4YUYA 4Y30A 2ZRCA 2V96A 3NASA 2JNWA 3FI0A 2IXGA 2P90A 2Y8EA 2ZYGA 3LECA 4NQRA 4RH3A 5CK4A 1TZ2A 5IFKA 1OCEA 4J0GA 4NX2A 3A0UA 3DLIA 1PR1A 4XWGA 3WLJA 1RRGA 1AHNA 1FK8A 2P2NA 3CE6A 1ND5A 3RIXA 3WLPA 1SK9A 3HFSA 2QV0A 1BDMA 2X9QA 3QVXA 4HDNA 4XB2A 4JR0A 1C8KA 1TC2A 1KAEA 1KOGA 4PTYA 1H22A 2QG9A 5DN6A 2E48A 4NMLA 1SUAA 2F3PA 2XTAA 1WF6A 2BMDA 1SBNE 3WGZA 1FY2A 1Z5ZA 2D5AA 1BZYA 1OHHA 3BL5A 4WKGA 4HZUB 4RUKA 3U3OA 3HMQA 4PZDA 1I5OA 2CHEA 1K8YB 2POQX 1CRLA 2MSLA 2RH4A 5JQWA 1COWA 3D2AA 2HSEA 2WY2D 1OBHA 2B7LA 2ARKA 1X8KA 1RWXA 2W6JD 1EZ4A 1CUZA 2VNJA 2WD7B 4IVQA 1G2IA 1V47A 2FKAA 5EIBD 3ZTYA 3QWAA 4L5CA 3FDXA 3OT4A 3WISA 4Y6PA 2O52A 4EYQA 1FZTA 3C3XA 4INOA 1PQUA 3ZU5A 3BOSA 2A6PA 3Q5EA 4P7FA 7YASA 1TUIA 3R5SA 4TX1A 1B2RA 4KPUB 4PRKA 1VKZA 5HWSA 5I4BA 1DRWA 1M2VB 2V74B 3KXKA 5DBFA 4U9HS 3W79A 4KQ1A 1MJFA 4H7KA 1Q92A 4EZIA 3WGVA 3OCCA 3P0FA 2ZB7A 4E30A 1KI6A 1NBOA 3TR5A 4H18A 1SUWA 2VZEA 4UATA 2MT9A 2VTDA 4BQEA 2V6BA 5JXJA 1UPXA 1GYPA 2P4HX 4F5ZA 5K4HA 1Q57A 1AHPA 4XDHA 4P3PA 1G7RA 2DSTA 1JQKA 1RXVA 1EQAA 1KDPA 2JGMA 3G7UA 2IDJA 3A6LA 3NAZA 4R84A 3UWDA 5KU1A 2Y1LA 3BGDA 3HPQA 4ER7A 2JLUA 1KKLA 4K2AA 4TSFD 3N28A 3V55A 3THRA 2QM8A 4DA6A 2ETVA 3G0IA 4FYJA 3CH7A 4JOBA 4FYPA 4Y18A 4ZYYA 1KZGB 4OH7A 3S1SA 1HUQA 3G79A 4QDUA 4ZI7A 2VP0A 3KRTA 3DEJA 5TARA 4E46A 3L07A 4P8RA 3OCXA 4PZPA 4ZCMA 4AUKA 5JR3A 2BUBA 1C3OB 3X44A 4AMUA 4ZCSA 1ZZGA 3OZEA 4J2HA 4CN9A 1RJ9A 4C6TA 4CFYA 1UPFA 3IP3A 1C9NA 1KMQA 1T3GA 1R0RE 1CZUA 1DWQA 1YVEI 2QNBA 4QO8A 2B4KA 1X2EA 1T43A 2EFEB 2RHOA 1JQJC 1E5QA 1Z7EA 2XPCA 3GDOA 3C70A 3K9NA 4NCJA 5LDGA 4G1CA 4GSKA 4OCZA 1ZM9A 2CXNA 2ZJFA 4LNUB 4OFZA 3LS2A 2PL1A 2QAIA 3CIOA 4JJKA 3A4LA 4AMBA 1UJ2A 5DM60 3NYIA 3F6BX 1AKYA 1MC5A 1F06A 2VBGA 2WE7A 3AF3A 2VO1A 3FVRA 3IESA 1GKYA 2XUQA 5EWJB 1X1EA 3E70C 3KAPA 4RKRA 3CLUD 5AVSA 2NUPA 3GLVA 4LDZA 4LRXA 2M2IA 3DNMA 4Q1DA 4YUAA 3EAGA 4LSMA 5L9AA 2O6LA 1T5DX 1N2EA 2HWKA 2QN2A 2Z09A 2JS7A 3EIOA 1NYLA 4JJ4A 4RH0A 2WBLC 4F38A 3U4DA 5C7OO 3KSRA 2F8SA 3LRXA 2O6HA 5J23A 4M38A 4UAUA 2XWJI 3PVCA 2PG3A 2Q1TA 3U7FB 2GBFA 4RELA 2G1PA 3EEOA 1E1LA 4KN6A 3NWJA 1R9NA 3EDRA 1BHSA 3NTVA 2BR3A 3PYXA 1ELOA 2QVCA 4ALKA 2IYSA 4D0RA 2OOKA 3LT5A 2ZYAA 5G41A 2AI1A 3F5QA 5EFOA 4ERNA 3LXMA 5COAA 2XUHA 2W42A 4YRRA 3I34X 5THXA 3KETA 5LMZA 4URYR 3IT0A 1H2AS 2KBEA 1W0CA 4MMXB 5IM4F 3DBLA 1E61A 3HC7A 1ZXLA 3IVXA 4HSEA 4KYIB 4TV9A 4ZVUA 4BFSA 5HG0A 4OHVA 3K70C 1H4QA 2OGZA 3WBKA 3UHJA 3HA5A 4HYEA 3HVKA 1NOJA 4OHWA 2GEFA 2WNHA 3ER9A 3R8FA 3QY9A 2XGJA 3COYA 3DLAA 3QVUA 1K1EA 2VN8A 4E09A 5IC6A 3W6UA 3T1NA 5DRYA 3RNLA 1B6GA 2G17A 3HLTA 5FRDA 5TX7A 3LPCA 3VZRA 4M6WB 3FUTA 5DTJA 4ZYWA 2WYVA 4WKOA 4A91A 4L3VA 4C78A 1MDBA 2FG5A 2N1BA 1BDHA 3MXOA 2R84A 3L0PA 3FHLA 1KZ9A 3LE8A 1QS0B 3PR2B 1V16A 2GK7A 1W76A 3T7SA 2P3OA 4BO5A 2QMEA 1VB5A 1F0KA 1U94A 1NZDA 1YZ3A 3VKFA 5D3KA 1LPAB 4IHQA 5FFFA 4DGQA 2FW1A 3LUCA 3AJDA 4Y2RA 2ZRPA 2QM3A 3LT4A 3UAYA 4FEGA 4KQMA 5BQ3A 4BLSA 4MCHA 2H2DA 1OVMA 3HYLA 1MENA 1H1DA 2PRYA 1UH5A 3ROFA 1PJTA 3OF5A 3VSEA 3QEOA 3ER6A 4DXAA 3PUKA 1XGKA 2EP7A 2K7ZA 3KBBA 2JJ2D 4J2TA 4P33A 4I55A 3PWSA 3IQIX 1BGWA 4HATA 3EQ7A 5ER9A 1WETA 2PBZA 1E0SA 4UC0A 4TMYA 4UTVA 4Y9TA 4XLZA 4B4DA 3GU3A 3IOYA 3ZNNA 1SBTA 4W6ZA 2Q6LA 3IL2A 1OT5A 1DDGA 3OPYB 1NW8A 4UVDA 4UCFA 3NONA 4X3PA 3NVDA 3DFZA 4N7MA 1EK2A 1ZJ4A 3RODA 5EJFA 4BP3A 3QV1A 5CHEA 8GPBA 1A7JA 3DDOA 4LMRA 4NJMA 4DZZA 4F3RA 4ZVVA 1N4AA 1FTQA 4JB8A 1BD4A 1W581 1ADBA 1H0KA 1UZLA 1HSZA 3JD2A 4ENTA 4HZUA 3ZWWA 2QUHA 3TQHA 3HWX1 3QYAA 2PTHA 1U8YA 1XVIA 1YS6A 2REOA 3JWEA 4GOLD 4CNBA 5ILGA 2ASEA 3L7IA 3F5SA 3IRUA 2OUKA 3RCBA 2A0FA 3W2IA 4ASUD 5TF0A 1SC3A 5EGSA 4G1EB 1P9OA 3E7PA 4XUDA 1D2NA 1RTTA 1FFCA 3TX6A 3VM6A 1TYAE 3R3YA 2X5NA 3SJ7A 5EIEA 4JEMA 5TPZA 1YIOA 1ZO8A 4UCWA 1V1MA 3ICOA 4OH1A 1PTJA 1CF2O 1Z0UA 1VKJA 1VL2A 2K5UA 2QW1A 3ADKA 3CF2A 5DNDA 2Q07A 2FU5C 4D9CA 2C95A 3L6EA 3MTEA 1E6MA 2C2GA 1H42A 1BU8A 2FW8A 3AFHA 5KTYA 4IMRA 5ERYA 5I5GA 2CB0A 3I2IA 1TW3A 2B78A 1WXDA 4Q9AA 1U3TA 4NJEB 4JQYA 3K0FB 1Z8FA 1TVMA 1W1IA 3FNQA 1E6EA 2Q2OA 3KDPA 1BEEA 1UAGA 3C3WA 3LL7A 1WW3A 2QL5A 1YS9A 4YJFA 1YR3A 3ABRB 3R7FA 3SFZA 4BB0A 5JAMA 2FEMA 4XGKA 5A7FA 3CH5A 3OCWA 2CL0X 2FZ5A 3IMGA 2IIPA 3RH0A 4IJ5A 3HR8A 5K6RA 3KB6A 3KR2A 3Q9NA 4QGGA 1M33A 4CL0A 4E5SA 4JBYA 4YCSA 1LH0A 1YR2A 1XBTA 1XALA 1Y1KE 2BW0A 4K0RA 1HKHA 4G5YA 5TQ0A 2WG0A 3SZLA 3VVBA 4UBOA 1CUHA 1G5FA 2RHMA 1FPMA 3PC7A 3ZDBA 1QV9A 3BA6A 4OXNA 1IZ7A 2C4KA 2HEIA 2W4QA 3PCRB 4KZKA 4ZO8A 1POWA 1UXOA 3MWJA 4GZ3A 5SZHB 2XB9A 2V6FA 4RZHA 1EINA 3UJ3X 1NPDA 1EBFA 3BD9A 2WJVA 5KYNA 3HVIA 2VDMB 4BFVA 2Z2IA 4URFA 2J3LA 2WIDA 3A6ZA 4CGYA 4E4TA 5F77A 2Q2VA 1SVMA 1TVEA 4G8DA 5A6SB 1F5SA 4ZCTA 3C1AA 4NY1A 1OYYA 2ERXA 1BFUA 2PRJA 2G8LA 3LX5A 4B43A 5HCUA 4RD1A 4ZWNA 1J8DA 3V7WA 1NP6A 4EKEA 2XOKA 1P0CA 1A8QA 1QQ7A 3AY6A 4ZHQB 4HTFA 5IKOA 2YQZA 1M2KA 2RH9B 4U9IS 1M34E 2GESA 5B1DA 4F8YA 1ZK3A 1NONA 1SPXA 3VPFA 2Q3CA 3RRJA 1DXQA 2CC2A 1V8OA 2PX8A 2RH5A 4Z4HA 5HHTA 2EGUA 3L1JA 4MKXA 1UM8A 4N5IX 3A9UA 3GJ4A 4Y1GA 2ZPTX 4GZLA 1QE5A 2O48X 1WUKS 3QYJA 4EUEA 4MKHA 4RMGA 3PJFA 1VBNA 2RGRA 3BTVA 3C3AA 3PQ4A 2FX5A 4URVR 1UMKA 3RTAA 2P9TA 5JAHA 2Y2VA 1SMKA 4MLDA 1RRPA 4BNGA 2RHGB 4IX9A 3RTEA 3PHJA 4DWOA 4EL5A 3BT7A 2OHGA 4MS4B 4MMYB 3DWEX 3NT5A 1ODKA 3OZ7A 3ON5A 1GQQA 2X9VA 1IDN1 3OPMA 1SXHA 3QFHA 4B6QA 3R24A 4Z9XA 3LUHA 3F5MA 1XU4A 3QVSA 3FHTA 1NRJB 3R3XA 1PEKE 3ETEA 5KVSA 4N39A 4YR9A 1EGMB 3ZWAA 1EB8A 4DAEA 4PXAA 3BRWA 4EKIA 4R71A 2FPIA 2QX4A 2W4MA 2C54A 3G2JA 4IHAA 4LZZA 3PLRA 1NR1A 4UVHA 1IL0A 4PZUA 3AKDA 4X95A 1XPOA 1FX0A 3AHCA 1SVKA 4P31A 2QV7A 3WNDA 3EGXA 2A9JA 3G2OA 1J42A 1J9EA 4XVCA 1E1NA 4G81A 4LJ9A 2HLDD 4WKBA 2LKDA 3NTXA 4QXOA 5HJ5A 1L4YA 1WD7A 4YAUA 3H05A 4R01A 3I9FA 1Y4AE 3KJXA 4LSGA 1YUMA 2E0IA 3KOWA 4UZFA 3RUAA 3SEZA 4R05A 2H16A 3ND9A 5DP2A 1IK4A 3RYTC 4ARVA 1ZXBA 1J23A 4KGXA 1NOKA 4PS1A 5IZ4A 1KMHB 3BFKA 1I7DA 1BKYA 2X3FA 1JFRA 1WPXA 4RHYA 2YCLA 1COZA 3K70D 1GR0A 4N3AA 2DLCX 4CIAA 5PNTA 4Z49A 4BB6A 4KLCA 5DSZA 2AZDA 3I9KA 4S2EA 3UPDA 1PS8A 4GPZA 2VK8A 3EUFA 5T4HA 4NOKA 3PKZA 2JA2A 1L5FA 2E4ZA 3Q2IA 4P93A 1N8TA 3LHDA 1VE3A 2C1EA 2J9FB 3TECE 3V4RA 2JIZD 1JYFA 1N2BA 1SD1A 4JOSA 3WGLA 2R5WA 4OJYA 3HS3A 4QBTA 1G1AA 5BMVB 1C7FA 4TUYB 4ZV9A 4PM4A 4DR7B 2XHZA 2WAYA 1T4BA 3BWEA 1T1EA 1Z7BA 2FDXA 5JDCC 4YRCA 5KQSA 3DMGA 3E9RA 4OQ4A 1P1IA 2IODA 4KDCA 4NWIA 4EJ0A 1LB1B 2CV2A 3ZKAA 3GJRA 3N8DA 4TLDA 3G13A 4D9JA 3K71B 2WSSA 1I1QB 2CD7A 3ONFA 3QPBA 4HDRB 1XCGB 3AZPA 4BVLA 1QV7A 1OX4A 2P9YA 1MRSA 1DOAA 1N5KA 1FW6A 2V4ZA 3CKMA 2P7IA 3DXXA 4G1BA 4ZVRA 1HF3A 1LDBA 1SA0A 5FEUA 2KLBA 1NHGA 3B8EA 4DSAA 3P52A 5BRAA 4L76A 1R9GA 1V26A 5A3VA 4WIAA 4LJ7A 3ZHTA 2Q1UA 1CZRA 3OTQA 1ZN2A 4RZSA 3IVAA 4S1WA 1CC1S 3W8DA 4JX9A 5GZ6A 4B09A 3GZJA 3E81A 3OKAA 3UJ7A 1Y6GA 2N0SA 5IH3A 3OZWA 5EMKA 4UM9B 3BF8A 4AJHA 4CZ2A 2BM0A 4L5AA 3JWJA 3LFTA 3N9IA 4X45A 4IDPA 4E5YA 1E2UA 2P6RA 1LK0A 1VLJA 5T8KC 1GG9A 3I83A 2O7NA 2C2XA 1Q77A 2NADA 1TFUA 3JQ9C 5LLTA 5AW8A 1DPGA 3EXFA 3CE9A 4D8XA 5AJXA 3K70B 2YBDA 3T6KA 1T5OA 5PGMA 3CJQA 1KAMA 2O3QA 3LC7O 4K9LA 2WWRA 1VRVA 1F8GA 1NL3A 3K94A 1Q44A 1L1FA 4N0PA 3WLMA 1Z8HA 2HHAA 3IELA 5DKFA 3S5UA 4DNFA 2C7QA 4ZT2A 2EKPA 3K9GA 4BMZA 2Q6VA 2WPNA 2O5RA 1ISRA 2E21A 2UUOA 4GUDA 4IDEA 3G6WA 4PHGA 3WYCA 4BFCA 1NMXA 4KFUA 4OEHA 3RB8A 4DLSA 1FDVA 1B73A 4HLUC 1ZGBA 4C2BA 4UTNA 3UYLA 1SRRA 3G7SA 3UAWA 1SQFA 2FETA 3C5CA 4MK4A 2QTZA 2ZUVA 3FM9A 3SN6A 3UTCA 4Q6WA 3CISA 4GWKA 4INPA 1E2FA 1IXYA 3WLLA 1NW3A 1N0VC 1KJQA 3H6HA 1DB3A 1UC8A 2O2JA 1E94E 3D8TA 1F3LA 4N0DA 3EEYA 4NICA 3T0IA 4AZSA 3EZXA 1J8YF 2JGKA 1AKQA 3AEKB 1Z68A 5KHLB 1YDMA 1JLMA 1T1JA 2F43A 4B7CA 3MA0A 3EIHA 1YVRA 4HDMA 4L02A 4AO8A 1PNRA 1ESEA 1E3JA 4QVGA 1HLFA 1W0KD 1DG1G 1D4ZA 4FNMA 4FMCF 1OBCA 1DIBA 3ETDA 1T8WA 2D3TA 3RU9A 1SVLA 4M9SA 3O8QA 5BQOA 4BNYA 4UTXA 4FNOA 3H9QA 3W6NA 4F96A 3SBEA 5FPYA 5L3QA 5AW4A 1YL5A 1XRLA 2IXDA 2W00A 1X7ZB 2ZJ4A 3FKQA 2HRZA 1Z7YA 2I54A 4ENVA 3RYCA 4F1WA 3WFIA 4S1PA 3EISA 3PGJA 4QRDA 4RGQA 4UKDA 4WCFC 2QP4A 1ACJA 1L4BA 4ML3A 5FQNA 4HXEB 1H3EA 3F9RA 3VVLA 1HDXA 3PIIA 3GLIE 1RR6A 4FMDF 1WPQA 4Y0NA 4B32A 4BZZA 2QX9A 4I1VA 4OHRA 1QKJA 2OBXA 4Y6RA 3Q0EA 2JLQA 2NUTB 2WB4A 5DLQC 2NU8B 3ZGLA 3GMIA 2VH1A 5JH7B 3CNOA 1WABA 1KSHA 1QVAA 4CLOA 1U98A 2VDOB 1ZYUA 2C4HA 2E18A 4II7A 5AVJA 5JWHA 4RBNA 1C4WA 3AVPA 1LNSA 2FR8A 2JAPA 5H0IA 1T5SA 2VG8A 4Z9YA 1E5XA 3CX3A 2Z2KA 4OYRA 5JLJA 1PUXA 3EWSA 4RJTA 2QRGA 4D5GA 3J80A 3DV2A 2M98A 2GK4A 2F67A 3E27A 2A9PA 4V1CB 2J5BA 1ZZEA 2FX3A 5EIXA 4C9BA 3O3NB 4CXMA 2HJHA 3DSRA 1WV1A 5ITVA 4WCDA 5HQ3B 2O7RA 1N32B 5DJ5A 2A1UA 1C0EA 1M1ZA 1VBMA 4O4LF 5BO5A 5KI6A 2XXBA 5P8WA 1W34A 1ADCA 1XE3A 3TXXA 4EHHA 5K8LA 2Q3BA 2J9GA 3QEJA 5LLDA 1H6AA 4GLJA 1UBMS 2XTMA 3CGWA 2BBOA 2XIQA 3DOUA 2IYWA 4LHEA 4OXIA 3FUUA 1AQ6A 2C2BA 4PYRA 3H7IA 1IUPA 4MICA 3KR0A 1OSNA 4G2TA 2OV1A 4RV5A 2X9GA 4PZ9A 3KUXA 2INGX 4PG8A 2PUCA 3H6GA 2XNDA 4XQ9A 3AETB 4AKTA 2ORIA 1TM3E 4G85A 3REFA 2H1CA 1AA9A 1YRWA 4FLEA 3H5WA 4DOMA 2ADMA 2JZNA 1EFPA 1PLLA 2W8BB 3ZIDA 5JCJD 1SBYA 2UU9B 2TS1A 2G09A 4J1TA 3VO2A 5HJEA 3ZHCA 1QJCA 2ZIUB 5G0WA 3UB2A 4C2TA 1RRVA 4GEGA 4ND1A 3ETHA 5IC5A 2JFBA 3QIAA 3V2UA 3WK9A 4PX2A 2PX2A 3OH8A 3OOHA 1EP9A 1FSSA 2HA7A 4MS1A 1J39A 5EPOA 1P33A 4CEJA 4IKOA 5HS4A 4OX9Y 1Y3CE 2UXDB 3TJRA 2I4MA 3O3MB 1NVGA 3HCWA 4J1QA 1R66A 5DTMA 3WGHA 4LVOA 4CLXA 4DR6B 2ORWA 3AF0A 4FEYA 2NX2A 2HUPA 1IJBA 2ACKA 3QQPA 1NQAO 1QTIA 3T52A 3W04A 1C7IA 1QYXA 4B82A 4WXPA 2JLSA 1HE3A 1U1EA 3FVVA 3HY6A 1XTVA 2HPVA 5LBUA 2RC5A 2O8CB 4QPDA 4TMVA 5KVQA 4URHA 3KKMA 4FGKA 1E18A 5THKA 5GV7A 2O2IA 1PZGA 1VFPA 4G26A 4WZAE 4EOGA 2G9QA 4YROA 1ODFA 2FB9A 3AGQA 3SIXA 4IEFB 4A27A 3UHOA 5LU8A 1WP4A 3D6VA 5BNZA 2JJQA 2J6IA 4MIOA 2HIMA 2XBLA 2B4RO 3FYSA 3PVZA 5G1PA 1KR2A 4IMPA 2W2LD 4CCYA 4DKJA 4JASB 3N2KB 5I7FA 2Z98A 1L5OA 5IMBA 2XV1A 3J7AC 4FR2A 3K20A 2OCGA 4BNZA 4Z2AA 3PEUA 2NAFA 2QSYA 5AI8A 4A73A 3LWDA 1X1AA 5K3BA 1SCAA 1W44A 3C8MA 1ORIA 4CQLB 5HOQA 2GGSA 4B46A 1UKYA 4QOEA 4E1VA 1VIDA 2FDCA 4NLLA 2JKYA 4EPRA 2JPDA 4GD3Q 5MGNA 2ZSJA 4M87A 3RBAA 3ENKA 3GR6A 1J5PA 5BUQA 1USVA 1JU3A 1MT0A 1RAEA 1Z15A 2H52A 2H3EA 1WZEA 2I3BA 3GLTA 3IIIA 3ITEA 3L0ZA 2L69A 2HDOA 3N59A 2ZJOA 3F7OA 4K6OA 3DEZA 1FRQA 2W70A 5ICSA 3LBIA 2ZUUA 1V5EA 2NO0A 3I4FA 4WSOA 2E49A 3F9IA 1O8BA 4K8RB 1V5FA 4JI8B 4H0CA 2I76A 2OHVA 2Q6OA 4EVQA 1SCDA 5IX8A 2OHHA 3GEIA 2XEDA 4FCTA 4ZAYA 4CU2A 4B35A 3RS4A 1I51A 4IDQA 2WFMA 3GRAA 4WAUA 1C50A 2W2QA 3FMIA 1AURA 3B9BA 3MCUA 3AKZA 1D09A 1QRAA 4UNSA 4F91B 2GZ3A 4JKOA 4HYTA 3W4IA 4QUEA 3IODA 3F3MA 1ZOPA 4D4KA 5IBPA 2AOWA 3WKEA 2Z30A 2VJNA 4HGQA 3TQTA 3FHOA 4EENA 3PPXA 1A9ZA 2JGRA 3LI2A 1PFUA 2FTKE 1F2TA 3K5PA 3SQNA 3PNQA 3IQGX 4LKOA 2OAEA 1U28A 2GYUA 4AS1A 1VIYA 2ZT6A 4JHLA 3E22B 1P5JA 3SSOA 2AXNA 3BYZA 4B79A 2ODEA 3F8TA 5GJVC 4L6AA 2ZDQA 4DLXA 1M9NA 2P6OA 5ESRA 4RPIA 1FP7A 2H17A 3OPYI 2XZLA 1QV6A 3C8ZA 3DD5A 5FPQA 1RHUA 3M8KA 1NA5A 3K6SB 2E4AA 3TNYA 4DQXA 5KVCA 4WASA 5D7NA 1L5MA 1EX7A 1G2PA 3HACA 1JNYA 1H4SA 2BCEA 4FLMA 2E9SA 4N7BA 1WSDA 1E2EA 3QXHA 2J3MA 3KPUA 2IOFA 1XG5A 4LJAA 1RRKA 5DNUA 1DJLA 2JF0A 1IUOA 1MW9X 3AYXB 3W90A 1TEZA 1R3UA 3RUCA 4FFWA 1RD4A 1U80A 4X64B 4GZ6A 1ZU5A 2R79A 3HYCA 4ITUA 1R5NA 4ERXA 1QRTA 4KR7A 2Y27A 3D43A 3K3PA 4O2BA 1RTKA 1OF1A 4FDAA 4UNNA 1H2BA 5U1PA 3SC2A 1FCJA 2ACEA 4LDRA 1BYIA 4J7XA 5KTNA 4CYMA 3BD7A 4UHKA 2F8TA 4KE7A 5ER6A 1DAHA 4EVRA 4M0FA 1BKDR 1BOOA 1SBIA 3NFRA 1THMA 4MUIA 4RVFA 3WXMA 5ABPA 1P5FA 1HORA 3AF6A 3C6YA 2Q4TA 1P9RA 5FKJA 3V8NA 4H3HB 3H1PA 1LQUA 4US0R 4QRIA 5HFJA 3DDCA 4RD2A 4RAOA 4XD2A 1NVBA 1SHKA 2J3EA 2CF6A 1QVWA 5B3JC 3RQIA 5CVCA 3MILA 3OJXA 2PMDA 2IUFA 1S3FA 1DWOA 1JTVA 1Y9AA 1FP6A 2C8JA 2F00A 3B6ZA 3M3PA 3M6LA 4L8GA 3PUIA 5AM4A 5CB4A 4PV7A 5BN5B 3MYRA 3LDHA 3CSDA 2P0EA 3EB9A 3LKVA 4D0SA 5F35A 1EJ2A 1ZESA 5CCBA 1FRZA 4UEKA 3AUAA 1RJEA 3B20A 4LMBA 2Z8YM 3AVVA 4HQLA 4FDLA 1JPVA 3I3OA 4AT1A 3AOEC 5JSQA 3DXZA 1RYYA 4MP3A 3TD6A 1NUTA 1RM3A 2AI2A 1JAXA 1HY3A 1WDWB 2XA1A 4FI3F 4RYLA 5C80A 2FYTA 3ZW9A 4OL9A 4BBAA 1KGSA 4IWXA 4RK6A 2J85A 4MQ6A 2AJTA 4GOKA 3OQVA 4ZIRB 3KT0A 3FMOB 4FKZA 3DVRX 4LPSA 4Z51A 5JALA 1RXYA 1QVRA 1UOPA 2ATXA 3OT1A 3WBJA 4PPQA 4ZGBA 2PIAA 2PBRA 1ZVQA 5JXIA 3ST7A 3P0IA 1L4UA 2RGAA 5KDDA 3DB1A 1XCOA 3WSWA 1YQWA 1N6OA 3OURA 4ZT3A 1ZS9A 5BNIA 5SZJA 2XMGA 3ND5A 5AUNB 3LGXA 1VRWA 3MB5A 1N57A 1P74A 2R47A 2VHZA 3F8WA 3L0CA 2ZBQA 1LDYA 2VSYA 1AM4D 4WJZA 1M5UA 2A9VA 1N2CA 3MMXA 4ZVSA 5HDQA 4ZYTA 1KC3A 5I8ZA 1XEAA 1UK8A 3B12A 4XYGA 1DT3A 4EYGA 2UV8A 3I01A 3UW1A 3B78A 1RCUA 2RHTA 3DDZX 1FLVA 3L7CA 1TCBA 3GFFA 4C4ZA 4XOUA 3IEVA 3H5OA 2XI4A 4RY2A 1S01A 2GASA 5IDYA 3TGPA 2H9AA 3OEYA 1D1QA 1CZHA 4QT0A 2ECQA 2RGCA 4UBLA 5IBRA 1G8SA 2D0IA 4MGKR 4Z0PA 1D2RA 5T64A 5DN6D 1DEAA 4HNVA 3C7DB 3PFGA 1LVGA 1IJKA 1J6UA 3MIZA 1BE6A 2GCPA 4HQOA 3BEDA 2ZJAA 2AK2A 2P9HA 4HQNA 2QL9A 1R6DA 2DP4E 2VQ3A 4E2ZA 2J0VA 5KNLA 1YI8A 3INYA 3N07A 3LMKA 4RK5A 4W4TA 1MIHA 3KT3A 1TU0A 2HA4A 2IPMA 5DH9A 3UEOA 5AVQA 2VPQA 4UE3S 2J3QA 3LUFA 3GD7A 1FBNA 4NAUA 4W8GA 3UT6A 1U0OC 4J9UE 4YAKA 1J09A 4RMNA 2UKDA 1U6IA 2OO3A 1E66A 3ZWKA 5LVAA 3HJHA 2GM5A 4KAXA 4PYNA 1AE1A 2P2GA 5LQUA 1V8DA 3TNJA 3U2QA 1CFJA 3EBLA 3OY7A 2J0SA 1Q7GA 4JSRA 4LY0A 2FMXA 1IYZA 4FB4A 3SJUA 3IJ5A 1KOLA 4AZWA 1V35A 3MCWA 2GAJA 3AIOA 4ENSA 4M1YA 5E2IA 3RPEA 2BFCA 3ZYZA 3ES9A 1NJGA 3PXAA 3JQAA 2CNWA 1Q16A 1TYZA 2FEOA 2IYLD 2NXCA 2ZTHA 4K8OA 2GXQA 1GZ7A 3LKDA 4JWTA 4R3NA 1AUXA 1QUEA 1S8AA 1AXGA 5ES3A 1HO3A 2HIHA 4KUEA 5EHIA 5IH7A 1KYWA 4M53A 4HNHA 4LZWA 3COVA 4M21A 4N01A 3LA8A 4KWTA 1ZNQO 4LJ8A 4PLPA 5EMJA 4EB8A 1QFSA 2OB2A 5ILOA 5EE5B 4Q3OA 3GCGA 1T3LA 3EJWA 4HLUA 2GTPA 2WTUA 1PE0A 1GVNB 2AR9A 1EA7A 2I8AA 5T3YA 4OHZA 2BFBB 2I3GA 4EPVA 4MUKA 2F1IA 2ZAOA 4HCJA 4NMWA 4OMFG 4B45A 5DHSA 3I9JA 2CKMA 3VVMA 3EY9A 4OHBA 3GP8A 2I55A 4QUHA 1BRMA 4HTAA 4TWBA 3VV2A 3EH1A 2FWMX 2A5GA 2X22A 2REQA 1RAHA 5MN5A 3RSHA 2VF2A 4NU0A 3EYAA 5C0OE 5FULA 5LB2A 3V9AA 4UCXA 3BGVA 4JI0B 5ICFA 3HY3A 1Y63A 1WG8A 1UWCA 3CF0A 3OD1A 3K35A 5DEOA 4B2LA 4TN1A 3MELA 3RC8A 2BFOA 1NLZA 2AJ8A 4OU5A 3M49A 3LQ2A 2ID8A 2QQFA 5FUYA 4O0LA 3T95A 2J7KA 2IXAA 3K53A 4JVLA 1BCSA 4XGQA 2J30A 1Y9ZA 1PD1A 2XH8A 1UXKA 3UJ8A 5KX5A 3T1YB 3BAZA 1PVVA 2QY6A 3JQRA 1JQ5A 1HKUA 3CX4A 4P08A 1E2PA 2JFZA 1T2CA 1PV2A 4D9IA 4IXTA 4G5FA 2E82A 3RARA 4QOGA 5INTA 5CCEA 5IT5A 2Y0BA 1E9VA 2PKQO 3P0RA 3DVAB 1JLRA 4RTPA 4RTOA 3DJYA 4F45A 1P7CA 3PHLA 1AKTA 5EZYA 1U9ZA 1UANA 3BE6A 2O3SA 1USIA 1W0JD 1U0EA 4GP6A 1VXOA 2Y1GA 2NSYA 2IEBA 1R8XA 4M1SA 3L8FA 4QTUB 13PKA 3FJYA 3WNZA 2LUOA 2R1UA 1YTUA 2H1FA 3CX7A 4J0QA 4AG6A 2WK1A 4EAQA 1O94D 1NJ8A 2BJHA 2BMEA 3MWKA 5F7ZA 3RHFA 5EJ6A 1JLKA 3GRKA 2X4GA 1UPTA 3PJRA 1Y3FE 2RBKA 3ZGXA 4M3NA 4F3CA 3R9XA 1Y3DE 3DTVD 3Q7PA 4WA7A 4ZMBA 4X41A 2UUPA 4Y6GB 1E32A 2CJWB 4NNPA 2QYSA 3I23A 2XTZA 1NUPA 3GH3A 3KVRA 5FFMA 4CKZA 1AKNA 1HOXA 3WK5A 1CUWA 1PRYA 3KM0A 1KP9A 3WZ2A 4MR9B 4Y2PA 3RBZA 1C9KA 5I9TA 4Q05A 3VO9A 1EAMA 3DTVA 4K1XA 5JBQA 2R8ZA 4Q7KA 1K06A 4TTVA 2OWEA 4YLGA 1MPXA 3OKPA 3A06A 3PNMA 2DGDA 2QG4A 2VDRB 1HA3A 3E5MA 5CPBA 5BSTA 3RABA 4L07A 3FGNA 5KYUA 5AJVB 3H19A 4MGZR 3EOZA 3JATA 3TTXA 4QUGA 3SQXA 1OFTA 2XQKA 2UXCB 1C1HA 3NTQA 2MYNA 1H9CA 5EIFA 2OLKA 3E4CA 4FP9A 2VL7A 1RWOA 1SZDA 4QFMA 3G8YA 5FP0A 1CHDA 3LHSA 4KX5A 4QRHA 1Y8QB 3AIMA 2F3TA 4W5JA 4ARZB 3ZW7A 5JOQA 3LDFA 1DCTA 4ARCA 1RAGA 5FOWA 1P1RA 721PA 4O2RA 3EVEA 1JVNA 4N7RA 4X63A 3QBVA 3VTZA 1B8NA 3G1UA 2I87A 2VH2A 4UZEA 4Q9LA 5DNWA 3QE9Y 1MXHA 1V8FA 5ADHA 3TNFA 3LSTA 2X13A 3MIIA 1RRCA 4BVEA 2OFFA 2R68A 1CWUA 4PRZA 2JBWA 3T7KA 3IO3A 2CWDA 4EJFA 2P7HA 2QT0A 2WNIA 2B37A 3HXLA 2AF4C 3I58A 5EP4A 3WR5A 4D5EA 2NT3A 1MH1A 2BCJQ 4RE6A 2LIPA 1H6CA 2RKOA 3OQBA 1D5CA 1NVVR 1VJCA 3MZ0A 5EKDA 3I37X 3ANXA 2QPTA 4A3SA 3CUTA 4I5IA 5KVAA 3BB1A 1VQ1A 1PJQA 3BMXA 4HGZA 1U4SA 3B6EA 5A0FA 4RIEA 2A7QA 3L8DA 3QKUA 4HN2A 4MITA 1MEJA 1WVIA 2IYRA 1FVXA 1V7ZA 2OCXA 2RGUA 2ZVDA 3ROGA 4ARSA 1J8VA 4HL6A 1TZKA 1E98A 2Y77A 2AWOA 3TX2A 1DAOA 3HBNA 4JD5A 1C80A 1KL7A 4M76B 1KTIA 4M7RA 2O8CA 4X44A 1QDUA 5IAOA 2X0JA 2ZJ6A 3VKWA 2CBGA 4KREA 1TJYA 3ZHRA 3ZDYB 4C01A 4MUNA 1XQ9A 3CNLA 3H3XA 1F2UB 1CIPA 3I5XA 1R4NB 2IDZA 1V45E 4OQXA 2I6SA 3D3WB 1QKIA 1M6YA 4AY6A 3D5QA 4RVNA 4C4YA 2XMSA 4MAMA 4P98A 1LRLA 2YWJA 3EW7A 3UWPA 1NBME 1JE1A 3DE0X 4MUXA 5C8DA 3F7NA 3T15A 2PRKA 4Z0NA 2UUBB 2X41A 2OAQ1 2QT9A 4ENWA 2CLEB 4Y2VA 2ZZKA 3OY2A 3DUFA 5EGNA 3C2QA 1XVLA 5U4QA 4F2WA 2DF8A 1UT5A 5FIUA 3L6DA 5E6UA 2AYYA 5JC1A 3V4PB 5LD2B 2VDNB 2WFLB 3PRKE 1PZHA 1E9DA 1DV2A 3DYIA 2QJOA 4IY1A 1E7MA 1B3RA 2IBMA 2QVGA 3PNKA 3DBIA 1PJ3A 1U7UA 4HH0A 1FNSA 1UZUA 1EX9A 3L01A 2A9KA 3M6UA 2GFQA 3DWGA 3QLVA 3SIWA 4ENPA 2HHHB 1VBKA 4C7OA 4DNPA 3R1IA 4RD4A 1SWWA 1R27A 4RTMA 1UT6A 2F90A 1CV2A 3WK8A 1DBQA 3ZWMA 1H5UA 1LCIA 3RGGA 4NH0A 4X93A 4DVJA 1ZUIA 2LD4A 3GIWA 3GUCA 5G53C 1KFJB 1RJDA 1DBPA 2WJ6A 2WSYB 3PNOA 3S5JA 5FJIA 1S7CA 2Q45A 4NVRA 4OJMX 2F4VB 1HZJA 2DPGA 2YOHA 5JVDF 1NR7A 2ZIFA 1S4QA 5AW9A 3O4JA 1SU7A 3UKDA 4D8VA 2GCOB 1JLLA 4L4SA 3U37A 4H7IA 4XJXA 1L5LA 1RAAA 2ODBA 1VLQA 3OIUA 4MWTA 3HRIA 2OCDA 2FSSA 1FFXB 1QCDA 5KAMA 3SDZA 3BDVA 4ED9A 5GOTA 1E79A 1GGFA 2UUAB 2BFEB 1XTZA 4FTWA 2NW6A 4PONA 1EZ1A 5FBLB 3VC1A 2DLNA 3ASUA 2QGNA 2HF2A 4EGJA 1L8QA 2J9XB 3WRWA 4C2AA 5BN1A 5SYMA 2IYUA 2QBYB 5AXAA 1P2BA 1TYCA 1A88A 3K9QO 3LC1O 1F6BA 1LFAA 2Y68A 1UOQA 3D2BA 3H8WA 3JRXA 3T0GA 5A03A 4DFDA 1GQ2A 5I9IA 3PNVA 3JAMA 4QLOA 5K8JB 3NB0A 1Y4UA 1EB9A 2A30A 2MINA 2H4WA 3EN0A 3STYA 3VI3B 4C22A 1OFIA 3QK7A 2IITA 4PVCA 1SULA 4PFQA 1KAGA 4OQDA 2WB2A 3Q0TA 3JQPA 1U0RA 4DRXA 1E0DA 1K6IA 2QYHA 3THXB 1QBKC 3I5UA 3M9LA 3D0OA 1RWPA 4Y9UA 4LC0A 5BT8A 2VPWA 3K4HA 1FU8A 3SY8A 1RKBA 5I7HA 2JIBA 4TTRA 4NZMA 4CEHA 3KPVA 4JB3A 3UVEA 4LQDA 1CDZA 1DKNA 1W5AA 2Z2XA 2GKGA 2CLKB 3PFIA 4FWIB 4R51A 1YRHA 4YAJA 1SC6A 1UDRA 3NEAA 4B34A 1QHGA 4PY2A 3M6AA 1FL9A 4CCAA 4OGLA 3A4VA 4DDHA 4AKSA 2H9YA 1RBZA 1SBHA 2HT1A 4AZVA 2JLVA 3UMJA 5HZGA 2GTIA 4RZIA 1QG4A 1L7QA 3B36A 2V6MA 4LYEA 3FYHA 4OX9B 3I04A 4NU8X 1CVLA 2WKPA 3BJIC 1JHQA 1GFSA 1KMIY 3I6BA 3RJMA 4CM9A 3KYDB 3WQHA 1OAOC 3VR5A 3MMPA 1CVIA 2HQOA 3EIWA 4GHWA 3ZX4A 3PJEA 4RMHA 1MAHA 1ZQ9A 2XF8A 2GS9A 3AIIA 1CS0A 1R0WA 1ZWLA 3OI7A 4C6SA 2OV2A 1M1UA 2BR4A 1INLA 1P39A 2QSJA 3HNPA 3MT0A 4FGSA 5HCIA 4BJ6A 4V0ME 1ESCA 4TMTA 4WGFA 4X90A 1SKMA 3ZI4A 5FOSA 1JIKA 1GV0A 1SOAA 1G0NA 1NF3A 1OUMA 3U7JA 1CZLA 3RD5A 3ZG6A 4FYXA 4CL8A 4LFAB 3KU1A 1A96A 2QNIA 4NS1A 2E55A 5CBPA 5IAKA 1U3VA 1Z73A 3E5NA 1V71A 3OX3A 4WVLA 4IZOA 1IH8A 2ZI7A 3JZFA 2P67A 1GUYA 1RBMA 1SXJC 2XE6A 1P17A 4HNUA 3KNZA 2YFKA 1APBA 2OXCA 4B0OA 1T3TA 4I0WB 3PD7A 4PGGA 1OLSA 3MHPA 4MWSA 1NUHA 3ICVA 4FGUA 4XDZA 2HZBA 3AXTA 2Y93A 2BEUB 3FUXA 4N8SA 4WNAB 2GEKA 4LOHA 4YDHB 5CFPA 5GTDA 1F7UA 4G09A 2VP2A 1RRMA 3HYNA 5E4JA 5JAZA 3LAWA 3UBTA 3NBZC 2ILTA 5JCOA 2GPSA 4EZEA 4A5SA 1Q74A 1EK5A 2RHJA 1DTWB 1GQFA 4V0OA 2XNCA 4KBYA 1DBRA 3UT0A 4BQQA 1ZQ1A 4C4AA 1W19A 3L6CA 1LKZA 4ER5A 4N0EA 3QVMA 3SJZA 4X1IA 4DV6B 2DKFA 2QW8A 3UJDA 2C98A 2EJBA 1U04A 2PKQP 2XMDA 4U2BA 4BMPB 3WWZA 2B6NA 4WINA 1Z0IA 1NQUA 2JEOA 4DM3A 1VL1A 3E8MA 4LRYA 2E85A 3K0CC 1WXQA 3C3KA 3CZQA 3BHIA 1NX9A 8MHTA 1L4LA 3BWMA 3FA2A 3WK6A 3GPDG 5AKXA 5CW1A 1YJQA 2ZRBA 4EPXA 1IG0A 3HU5A 1N6KA 1X0VA 4AIIA 2VFAA 1UZMA 1LDMA 1TEVA 1Z0AA 1U9JA 3ZV6A 2PUDA 4Z99A 4UREA 3ILXA 5FLYA 1RPAA 3GDFA 3QVKA 2IJGX 2ZQYA 1SUSA 2QR5A 2WJAA 1ZJZA 3JCZA 2AG8A 4EFLA 4HAWA 4RO0A 4HMOA 4R1NA 3KWLA 5JAUA 1CUEA 1E3IA 1GKUB 1TCCA 5CHYA 5BNFA 2BTQB 2ZRAA 4R83A 5CU7A 3HU2A 2B0CA 1UAAA 2NIPA 4DKXA 4P82A 1LC0A 2RGYA 2WVJA 3H9CA 3GJZA 4XIYA 3GA5A 2NVBA 2I2FA 3AIKA 5BSKA 4UD6A 1YE8A 5B57C 4OBWA 2J8ZA 4KXMA 1XDUA 1OH6A 3R0IA 3FWYA 4KGZA 3G5MA 3HXOA 2O4UX 2RHRA 4R7ZA 3PQ5A 2WIKA 4P80A 3UFXB 3OFNA 4RQUA 5DB4A 4EY6A 4JJZA 5EP3A 1JLHA 1ZD5A 1DBWA 1U6KA 1UJNA 2WA1A 4PX5A 5KTOA 3GVIA 2JFXA 4KODA 1WEHA 5E1DA 4H6PA 4IUYA 1CQZA 2VK4A 1YGPA 3G59A 4TN5A 3T3IA 5FPKA 3I2KA 4YN3A 1VYTA 1M2JA 3QYPA 3OOEA 1E2KA 4OKSA 1JH8A 2R6R1 3S40A 1E9CA 2GVDC 2JIDA 3SJCA 3P97A 1PJAA 3P4UA 1HDCA 1NKSA 2GPTA 3AC0A 4Y7DA 4E7OA 4CIBA 2UZ4A 2I6GA 2YYAA 3O1JC 1DAMA 1I5EA 1AXRA 2ORVA 3EY4A 4LF4B 5BSHA 5BURA 1V9SA 3NHLA 4DMHA 3ANYB 4DIMA 1IONA 4R69A 1G59A 3PD0A 2Z1NA 3AVXA 1SN7A 2CVHA 1J0BA 2WSIA 3DMTA 3LQKA 3PC3A 1Z0KA 1KPIA 5HR5A 3AUKA 1NJ6A 1G3UA 1QLJA 5KWIA 2C29D 4C4PA 5CJ2A 1HDEA 2CFRA 1NKVA 2BLNA 2J32A 3PRYA 3IURA 1G9XA 3TH5A 2QXYA 1JECA 3QUQA 4YEDA 4YRKA 5FWNA 1MMFB 5KB3A 1S7GA 5J1SB 3FLEA 1CETA 2XUDA 1SCIA 2MSCB 1BEZA 1PR9A 3N6VA 3RVRA 2W37A 4KKVA 4ZC1A 1BCRA 3GYBA 3SBXA 1ORDA 1YULA 2I4RA 4EW2A 3VZQA 1ECGA 2ZYRA 3FMVA 3FYDA 4QSMA 1KU6A 3JQBC 2OM6A 1RE0A 2WHEA 3BQMB 3IT1A 5B7QA 3RR2A 1W4BA 3OM9A 2B8WA 1R5OA 4CIXA 4N5DA 3D7RA 1CS0B 2IU0A 1T9CA 2LW7A 3DM9B 5EPEA 4P4GA 2I29A 2G80A 3OO0A 3NETA 2NWQA 3M70A 5J58A 1Z29A 4EMBA 3AF2A 2HM7A 1S02A 4J2OA 1CPYA 4S04A 1NP7A 3ECCA 4NECA 4FIDA 1EFRD 1OAAA 3KLPX 2R6AA 4NABA 2GUGA 2YWDA 1IPEA 1P0QA 3SOZA 3P32A 2JGDA 4D3FA 2DMRA 4OJNA 2XBMA 1Q7BA 2ZUEA 1D0IA 4GMDA 3PZRA 5CT9A 4YQZA 1PLJA 2J4FA 5A3SA 3DZBA 4I5DA 3HABA 4WOCA 1HQKA 3B3QA 4UU8A 3ZYCA 1Z56C 2VK2A 3CT6A 3A27A 4CJXA 1U2QA 4ZCIA 3GLFE 3P0EA 3V42A 2BBSA 2B9VA 4FONA 3FLAA 5K0EA 1ZRMA 4MR8A 4JJ7A 1ISFA 1US8B 4F46A 3GAFA 4UFOA 1Q0UA 2FGKA 1IBKB 4F3YA 3SFTA 1KEVA 4Q93A 3ZPXA 2Q5QA 4Q9NA 4RJIA 4I6EA 3T7AA 1X7GA 1WWKA 1WB5A 1ZOLA 1YZQA 2IYQA 5HIMA 4EO7A 4ZI7F 1BMTA 1K66A 2WIAA 3BORA 2WYIA 2CNBA 3W2TA 3WLNA 5KINB 2IH5A 4DC0A 1FB5A 1DWUA 4ETNA 5CLFA 4BIMA 2V0GA 5UKDA 2QLJA 1BJTA 1L4HA 2VSQA 4N9WA 4DJ5X 2B99A 4B33A 5F98A 5KYYB 1QF6A 2VQ6A 1L9XA 1G2QA 2NTVA 3RLIA 4PPGA 3U7RA 4FYVA 4TXLA 2I2XB 4FZRA 3SGLA 4DLZA 1DOZA 1USWA 4UE2A 1IHXA 5H70A 2O14A 4B0PA 2OVBA 3FNGA 5LNK1 1ANKA 2NUAA 4J94A 2FRXA 4Z0HO 2DJ5A 4I7EA 4I3GA 2B1IA 2BL4A 4BBJA 1WD5A 1MDFA 4NH4A 3KU4A 4YALA 3MWLA 1C3XA 4U7JA 1A9OA 1XEXA 1SU4A 4CBVA 1EFVB 1A8SA 1IE3A 1N7IA 3OVMA 2H00A 4IP0A 5J4HA 3GXBA 1RYNA 5GVRA 4YCJA 3T7JA 2PNJA 1JR3D 3EPPA 4S1OA 4B83A 5B55A 4JYZA 1CCWA 3OLCX 2QMZA 1V9LA 4LC9A 4HWOA 4OAOA 4ACBA 2W6PA 5KOJA 2BGGA 3FYCA 2BE7A 2FSHA 2JAXA 3HKBB 3DBRB 4WQMA 5CJJA 3J81k 1MAWA 2CLOB 1BQEA 4HRXA 4MQUA 1XTKA 4U00A 1IY2A 2JA1A 1A9XA 4CV1A 1AVTA 2H1LA 5FI5A 5JDIA 2H31A 1QIMA 1ADJA 3IHLA 4TV9F 2AJDA 2WWIA 1ZHHA 2BONA 4FBMA 4JR1A 4XTCS 2FCRA 2I78A 1M54A 4EGQA 4C6TB 1E7SA 3G2KA 2QQ0A 2EV9A 5B6PA 3OAAD 3T5TA 1Z13A 1PFYA 4G5XA 1S0UA 2PGXA 3R3SA 4KWEA 4EHJA 4ZGWA 5A02A 3FCSB 5JI3E 4JYCA 2VSOA 4PX9A 5LU9A 3H86A 1KKMA 1Z82A 3KKPA 1XKQA 1W5FA 4LVCA 2XVMA 3TE7A 1K4MA 3U80A 2VJCA 4C4TA 5KQGA 2ZWMA 1GGVA 4IH1A 1Q3KA 2H8GA 1OZHA 1PQ4A 5FTMA 1W6UA 4LJ6A 3COPA 1CJBA 2D2FA 3MSCA 4LHZA 3HTXA 4DA4A 1I3LA 3TOSA 1P9WA 1TTPB 5J63A 5FBVB 4YCNA 3EPHA 3SQLA 1BS2A 4DJAA 5EZ6B 4LXUA 5BV1A 3UKOA 2OCLA 1IN6A 1BMQA 4MPJA 4IIVA 2Y1OA 1ISMA 2WDPA 5A3RA 3NH9A 3ZGYA 5IG2A 3BN3A 3T3OA 3GGGA 1ZJ6A 1M2HA 2IV2X 2NNLD 2ZIXA 4XX1A 5I45A 4UMDA 3C4QA 4NL4H 4OJTA 2O1WA 4JYPA 1ZINA 4GMXA 1QGYA 2MDTA 4KP7A 4OO3A 1IXSB 1ODJA 3AF1A 2R85A 3FIUA 2WKWA 2Q0HA 4I55F 1CR4A 2I2DA 1D0SA 1XF9A 1DO2A 2ZS7A 3Q98A 3TKLA 4BLQA 1Y7PA 5P21A 1M0TA 5KNBD 3I9V1 3DOCA 1JT9A 2HTFA 4YUZA 2PV7A 4TTSA 5BNTA 3MF4A 1SOMA 4LXIA 1OA1A 2A4KA 5D8DA 3TMYA 1D5WA 5FO1A 2YXEA 4UDNA 3H2JA 3L46A 1G55A 3C8HA 4KQFA 4RA9A 1CD5A 4EUNA 2AMFA 3NC0C 4UM8B 1DKRA 1FYVA 1QX3A 1UQTA 4IV0A 4MGYR 4BVJA 3R6DA 2BHNA 5ENZA 3K72B 4I9HA 4BLTA 2PK3A 4ECEA 1DRVA 4D4LA 1TB4A 4P34A 4H3SA 3K9CA 3SYKA 4IJQA 2GB4A 3ELUA 4OB6A 2OB1A 3RRBA 3UJ9A 1W9HA 4EG1A 5ISMA 5CD1A 2XVYA 1VE5A 2D7JA 2VNAA 4JT4A 2D0OB 4XSHA 3VZPA 4AD8A 2J0EA 4TXJA 4G9BA 3VGPA 1CY8A 4F11A 1SIOA 2IEYA 4FLFA 4KN5A 5HEKA 4EDFA 3K0HA 2B7BA 4JCOA 3BERA 5AI5A 3HCOA 2ZSAA 4JXKA 1YBVA 1UXJA 1QLWA 3ELWA 3IKVA 1JDTA 4IIJA 1GPJA 3CXRA 3JVVA 4S3MA 3NUGA 5EQFA 3VA7A 1U3GA 3CZMA 5IJ9A 1FJHA 3QF7A 3ZU3A 4H9GA 4D44A 8ATCA 2BI8A 5I7WA 1BX3A 2G8NA 5CDHA 1DELA 1OROA 1GL7A 1G8PA 2VKQA 3KSMA 4J4TA 4ZODA 5K8CA 4UEQA 1QIKA 3IBYA 3CEPB 4N82A 2QTMA 4OGGA 3NZEA 5LN1A 1YS1X 4TYMA 1NFFA 2V8BA 1VA4A 1QZXA 2BMAA 1BJRE 1P19A 1JTEA 1Q5PA 1SKBA 2AOUB 2AW3A 2YIDA 3LPDA 3SR4A 3AEUB 2I3DA 4JVOA 2G25A 2KX7A 1OFUA 2ZJ3A 2DHRA 3LT0A 2Z5VA 3JD1A 4BRUA 3PHCA 1G7TA 1WXWA 3ADCA 2DE0X 4MWBA 1GNRA 2QRVA 2Y67A 1B0AA 3JWHA 4AVYA 2HCRA 1DX9A 2J9YB 4ZZ0A 1IZYA 1L5NA 1EE2A 4PGMA 3LT1A 3QE0A 4Y3UA 4DYVA 3BK2A 1RP7A 4FS3A 1QZTA 2BFAA 1X8JA 4K46A 4GVXA 3EXEA 6REQB 1JDNA 1ZCAA 4I36A 5B1SA 5MF6A 2ODPA 3LTNC 3U4QA 2OG2A 1E6CA 2UVPB 3PGKA 2ZOSA 4MO2A 3PT9A 4OQQA 2R6HA 1MNQA 1O0CA 4Y1EA 4ZCRA 2ACWA 2QY9A 3TTUA 2CDRA 2CVPA 3K0EA 4F3NA 4MS3B 3EARA 4RDCA 4BO6A 1RCTE 1X87A 9ATCA 3Q7RA 1QVZA 1UFOA 3JQCA 3WI7A 1E2MA 1PNVA 2C4VA 3H2BA 3SZRA 1AKWA 4Q15A 4ZZ3A 1MPTA 1PT6A 2B92A 3V48A 4AECA 2PS9A 3PPIA 4JNKA 4OLAA 1SHJA 4LK3A 3RHSA 3KEFA 1PKEA 1XZDA 4Q4AA 4FBGA 4O2AA 4A15A 1AIPA 2GN2A 2HTEA 3BE5A 1U1CA 3CSSA 1HYGA 1VP9A 2YYZA 2JDIA 2GH1A 3IUEA 4XDYA 5K0JA 4XD7D 2MSKA 2EAUA 4L85A 5L53A 3OU6A 1VIAA 1VE7A 2QLMA 3B89A 3FPAA 3WIBA 5AM3A 2ZZMA 3X1MA 1Z2EA 1YT5A 4CT0A 1N2XA 1Q0SA 1D1SA 2OT3B 2YHSA 4JCCA 3KFXA 4M8KA 1KRXA 2O0JA 5HQJA 2AZTA 2AG5A 3IMCA 4JIMA 1XNJA 1OI3A 1R15A 1UDCA 1F6WA 3WLEA 2IIBA 2FRVA 2JFPA 4XKJA 4GMGA 3LNCA 4EHLA 2TMGA 4J3JA 2E2WA 2QROA 1K3TA 1CNEA 4ESOA 4L0CA 2DLDA 3G3EA 5EIBC 1JJIA 5DNAA 1O08A 1VSTA 1U3DA 4ILKA 3QLUC 5F7XA 3MB8A 4BO2A 2A7XA 1ECJA 4ZOBA 1TUBA 2WMNB 1C9YA 1OXUA 2NZUG 2WC1A 3RBXA 2V7EA 2YHUA 4UU7A 4O4LB 1TK9A 1XKTA 2P91A 5C2JB 4JI7B 2WHPB 3CTPA 1PJ4A 5L3QB 3IKMB 4BUZA 1E2IA 3H5RA 2IQ5A 3AP3A 4X91A 3FB1A 5CP8A 4ZU3A 2JGAA 4ZAFA 1CEYA 4BS9A 3HNOA 3L7AA 4BEVA 2WWYA 2OXEA 2OP1A 2IXBA 3GBSA 4LYYA 1JQBA 1QCYA 2COUA 3FUVA 4PZ0A 5KTKA 4TKVB 2ZCJA 1T9GS 2HK9A 2LV8A 4FN5A 1XMPA 3IV9A 1A8HA 2G1AA 3QKIA 5TNXA 2HNBA 5K45A 1SM4A 2LCIA 4ADSG 4FOLA 3OX2A 4HFNA 3AVUA 3AFGA 4JLAA 3ZC3A 2VNKA 2ZR7A 1DQYA 2X2OA 2P8JA 4XIGS 4A6DA 5FL3A 1Y7LA 1NURA 2R2GA 1A1VA 1YONA 2HO4A 2NVOA 3PHHA 3T9BA 3HDGA 3O2QB 3GJXC 4O8CA 1GIAA 2EXXA 2BLLA 3C3JA 3L41A 2O57A 1GTJ1 4NOLA 3SF8A 5GZ1A 3GDGA 2C20A 1ZC3A 3ORFA 1QAMA 5HM8A 2DBVO 2FF7A 4UBJA 3EFHA 3IBCA 4YCCA 3COWA 2OBYA 4ER6A 4GL2A 3W2FA 1QC5B 1AV7A 4WKPA 3VX3A 4WV3A 4CEIA 3E6AA 3GAZA 5ESXA 2ZFUA 1ETUA 4OHCA 5HK8A 5EP2A 3H11B 4IINA 3RC1A 3UIEA 4BAZA 3KJGA 1Y42X 1OB2A 5M3BA 1KYXA 3OIFA 5F7OA 1NOIA 2SKDA 4HUQB 4Q7LA 1O9GA 2WQ7A 3NHRA 1DAGA 4N18A 1XQ1A 3ESAA 4ARZA 3ZK7A 4LE2A 4FW9A 4XQEA 4Y2XA 1ZD2P 2DFDA 4JBHA 4XFKA 1ZFNA 4A4DA 1Q95A 1NU6A 1P1CA 1SFRA 1A4UA 3WKBA 5F1YA 1PWEA 1HZZC 3BIOA 3DPUA 4KIWA 2BF4A 5F7JA 1NQWA 1VGVA 4GGMX 3KKLA 4I1YA 4QTXA 5K51A 1C4KA 2C5LA 3TLEA 2FVYA 5FUXA 1JBEA 2N3ZA 2XYRA 3ADOA 3LVBA 1VHQA 3NTRA 4D9HA 1E1RD 2Q8NA 2PJUA 2W93A 4HRAA 4PQEA 1XZLA 3OQIA 2C2MA 1IFXA 3SR3A 3TNLA 3MCZA 2C00A 2XCRB 4JMLA 3VO1A 3LTEA 1ZMOA 2Y99A 2ANCA 2M9MA 5BQ5A 3LLSA 3N7UA 1C8VB 3EWAA 3O31A 3V1LA 4BGVA 1C30B 5BYAA 4ALLA 1S3IA 2W90A 4B4VA 1IIBA 4HD8A 3D3EA 4MVJP 4H7EA 1B00A 3EVAA 3UAVA 3P9KA 3G02A 1DEKA 4QREA 3TLGA 2HFKA 3DNFA 3GLGB 3PA8A 5ALYA 1GNVA 2EYQA 1G8JA 3EG9A 5IYZB 4F5DA 2PLWA 4F84A 4KX3A 4OQEA 4CKBB 3DOHA 3FNIA 2G5PA 2PNFA 4EJ2A 2BDEA 4MWEA 2WUGA 4YONB 5T41A 4DQDA 1GT91 3LC0A 4NYMR 3QX9A 4X84A 3HKEA 2RIRA 1U1IA 2Q5HA 5C53B 1W48A 3C7TA 4CQMA 1PNTA 1GL6A 1PG5A 3IGFA 5AJYA 3WGOA 1T2AA 1AKEA 1J2RA 4G97A 1WHTA 1CR1A 4HH4A 2A58A 4G0MA 4KO4S 5IK2D 2NU7B 3DMYA 3N3BC 3W6PA 5J3JA 1EK0A 4XWAA 3AX6A 5K2MA 5BXYA 5HKKD 4IOMA 1A97A 1O4VA 2J5XA 2YZKA 2N9UA 4FWBA 3NBUA 4YCDA 4X94A 5I4CA 1JWAB 3HSKA 3CEHA 1EFHA 4O2AF 5GVSA 4N40A 4HNTA 3TZLA 5LL6P 1UZNA 3HCCA 3PQ3A 4YJHA 1R6TA 1BXGB 1G98A 2QJTA 4TVOA 3ZCXA 1L8AA 1QGDA 3D1VA 1EEXB 3HLKA 2BEKA 3OQIB 3QW2A 1MC4A 1V4VA 3V4LA 1BWPA 2OGWA 3E3AA 3RSLA 4AS2A 5L7WA 5JC8A 1RXSA 3ZOKA 1KBOA 3GAMA 3R5TA 4G1FA 4JFAA 3D0QA 2QF7A 3ENWA 4DRYA 2ZE5A 3QSYA 2BBTA 4PAWA 4FVTA 4QBGB 1YCFA 4N7JA 3V33A 1XF1A 4DIKA 4BNHA 1JWLA 3TQOA 4DSZA 5K0SA 1ZW6A 3Q40A 4JC8A 2D6FA 1VOTA 1UADA 3DO6A 1TD9A 4GKKB 1DOHA 2IYTA 1Z5UA 3R5JA 2X0KA 3DL0A 3V2HA 1F8YA 4MKRA 5E0KB 1OYWA 2AQIA 4TSFA 4GS5A 1HE4A 2IX9A 3E5RA 1X1QA 3ENZA 2BTEA 2GA8A 1N1EA 2Q9CA 1U7XA 2GD6A 4C0WA 1A5ZA 2VCHA 1L1EA 1NW6A 2Z3WA 3DMHA 5BSEA 1JDBB 4I14A 2UZ0A 1HXHA 1D3AA 2YN2A 4GBMA 4WOKA 2QGZA 2ZBGA 1KDTA 1E3WB 1GRRA 5DTEA 4CM8B 4F4DA 5JNTA 4ATNA 3C41J 5ALXA 4JENA 4QO7A 2XMRA 1T6ZA 3RVKA 1KQ3A 3QNMA 1I2CA 2ZKIA 4HKTA 2O8BB 1EU1A 1U1FA 2HJVA 4KRGA 3WKCA 4FMPA 3AM4A 3IPRA 4R2JA 3Q12A 3QPCA 5FOUA 1XMOB 5BN4A 2QTGA 4EYOA 4YAEA 1R16A 1WMSA 2Y9MB 1P4AA 4JI1B 5AQ1A 2EFDB 1J00A 2X8WA 3A4MA 1Z63A 5A0TA 1TW2A 1S2NA 3PR1A 3AUJB 3QU7A 1E0AA 3OQHA 4J6EA 2Q3FA 3EDYA 1LK5A 3P2EA 3CRVA 4O4LA 5LXTB 3AM1A 1FDWA 5AVKA 3QPWA 3VHXB 3LDUA 4RXUA 1NKTA 4NV0A 1VCHA 1CDEA 5IFLA 1G9TA 2ZXFA 4IHKA 2VYQA 2ZW9A 2G6TA 3DF7A 1R4MB 4QYMA 5A1JA 5LQCA 2ZI4A 1SC9A 3TPCA 4QG3A 2GNOA 5J4VA 2ZTSA 1GUAA 2CFTA 3JQ8A 5IT0A 1HX7A 1GITA 3GP5A 2D54A 2EZ9A 4CMJA 3GLIA 4JLWA 3LA6A 5TV2A 2QVZX 1S2OA 4MYCA 3A8TA 4A0GA 5FAKA 2WNSA 3EVZA 1E2LA 1WV0A 1JB1A 1G6KA 4EI7A 4AYXA 2QW0X 4R1MA 2FSFA 5DI9A 3K0BA 3N8IA 4HQKA 1D4OA 1P2GA 1Z6XA 2ASVA 2ISSD 4JP5A 5GPBA 3C7AA 1FXSA 3TS1A 1C1DB 3MJSA 5EMHA 5EXTA 3ZD7A 5L4NA 2BFEA 3HL0A 2ZB3A 3M1AA 3VOTA 3NBAA 4GNRA 3GRRA 5JY6A 2CUKA 3H1TA 4I5EA 4HEA1 2H1OA 1WCIB 3SF8B 4C89A 1SQGA 1DJNA 2O7SA 1MTOA 1YD7A 1E79D 2FJPA 2V9CA 2ZRHA 3EQ6A 3SEQA 3E9CA 3E1GA 4E2WA 5K8VA 4IDAA 5HQ3A 2PJZA 2VJBA 4ALJA 2C9OA 3F7TA 2PU7A 4CVNA 4B17A 5HE8A 1M2FA 1A77A 5H5JA 2ZXEA 3GXOA 4GO1A 1PEAA 2HSWA 4EMSA 3RFCA 4CKYA 5K0BA 4JOCA 4P3XA 4V1CA 1V9CA 3DR3A 4L7VA 4UAJA 4JDPA 2Y3IA 2EU8A 3QXSA 3TIXB 3S81A 2PXHA 2CYAA 1N3LA 3AV0B 2ZZNA 3CGGA 4G01B 2FR1A 2QMOA 4PCAA 3KOMA 5TE9A 4IX1A 4KNYA 1K4YA 3OIGA 1TMYA 3C3YA 1L8LA 2EWWA 1U0NA 3WNVA 4C05A 3PQDA 1DAEA 1TCVA 2O2HA 1BX1A 1QGED 3NX4A 1N7JA 1U9CA 3DKVA 1I14A 1P72A 1DKUA 4FXPA 1EFPB 2HLPA 2W8BA 2ZRIA 4K9QA 4C7JA 1JP7A 3O91A 4K0KB 5JXHA 1VLLA 2B7CA 3OICA 3QPDA 1N4DA 4HB2A 4LOKA 4NZYA 4OOFA 4P4TA 3KWFA 5AMXA 1FNMA 1IB6A 2BELA 3N7AA 4MV0A 2M6KA 1VHDA 3HM9A 2GNAA 1TTTA 4G5OA 1FRNA 5JZMA 4YRSA 4HEQA 1H1LB 5LR6A 1QHNA 4FFRA 4UBMA 2Q29A 5TGDA 4R3UC 3ZGOA 1X8XA 4YY3B 4Y98A 4FJ1A 3UCXA 3U16A 7MHTA 3PWTA 1NVDA 2J3DA 5E38A 5K0ZA 3TW4A 1NFRA 2HQBA 1K92A 4PCVA 1E9EA 4EFMA 3A1EA 1NQTA 3ZXYA 2V7GA 1RU3A 3OFSA 3V1TC 5GY7A 2HDNB 1J8QA 3IDQA 5L3SA 4NFHA 3F3KA 2OMEA 3REQB 4PHTA 3I42A 3EXHA 3F8SA 1A7UA 5AW7A 5H4GA 1E92A 3B7GA 4YFYA 4YUVA 1YFLA 3L7JA 4D80A 4IRUB 5JPCA 4RD6A 4LHSA 2XCUA 1R6VA 3C5HA 4JROA 4Y0VA 4BO8A 2CDNA 1HDYA 2OSVA 2PU5A 1KDZA 2ZWAA 4CQMB 4YCLA 1PKXA 4LHVA 2IEIA 1DJPA 2OUIA 3G0DA 3N2ZB 1HT0A 3GOHA 1ESMA 2CCGA 5IJ9B 4GXQA 3M4NA 2O19A 4UU1A 1K6EA 5TQVA 3LDGA 3PC6A 3AILA 1KEEB 1I9CA 5HF9A 5JRJA 4MR7B 4NTZA 3T1QA 1AMOA 1M8GA 3SHQA 2OMKA 1H8EA 2CV1A 1QG6A 2VYND 4RPJA 1XMVA 3OZIA 2UYCA 2LWIA 2GZMA 3A9RA 2XVZA 4BEBA 5I9NA 5JQGA 4CL2A 1YWGO 2K7FA 5KKAA 4YR7A 1YR7A 5KX5F 4R1TA 4DA7A 4ZZIA 2W48A 2NVUB 5AKZA 1UMCB 2H08A 2H3HA 3QMMA 4N5LA 2EKLA 2O07A 3DB2A 1BH2A 1N7GA 2EQAA 3G5TA 2IOQA 2OXRA 4OG2A 4BZPA 2PMBA 2ZP1A 1SZCA 4YI5A 2BKAA 4YMVA 1G4HA 3AESA 2H4JA 1ENYA 2CT8A 5IYZF 4YWJA 2IHTA 5TEVA 1ENZA 2IPOA 1G8YA 3HO6A 3AI7A 1U6JA 5DM70 2OPHA 1J8MF 3MVEA 5CG1A 3EXEB 2RGEA 4D9GA 2FF5A 1ADGA 5HUJA 3T4EA 2WU8A 1GQRA 3U48A 4Q7EA 1RI1A 2QGFA 4KWIA 3L04A 4QECA 2P2SA 4H77A 3Q10A 2IHKA 3PYMA 2X4DA 2V0NA 3UHAA 3I2JA 4Z4IA 2WWTA 2QTLA 4BVGA 3SJAA 3NJ8A 2K2WA 4DB2A 2QEQA 4XUGB 1MJNA 4CI9A 5K3OA 4QWWA 5L40A 3RTGA 2G4VA 4Q3NA 5CDFA 2JJ8A 1TYDE 2ZE8A 4JJAA 1Y82A 5JROA 1D07A 2C2KA 1DE0A 3BAFA 1MNAA 5CDSA 5EMMA 2FSUA 2BDUA 2PH3A 2R8RA 1WCXA 4JC4A 4I8IA 3UN1A 2O5EA 4G3XA 3QOXA 1BC5A 3FVTA 4MUMA 4WD3A 1F14A 4R98A 1Q22A 1SBQA 1O0SA 4NEGA 3Q3IA 2PH5A 4JI2B 1OWLA 1IHDA 1LPBB 3V5NA 2D00A 1K7FB 2YVKA 1SELA 1FC0A 4TTJA 3A2NA 2GZSA 3WIDA 3KKQA 2OA0A 1ONSA 3C1TA 2MSWA 2YFQA 1E1CA 3RAJA 3DAPA 3EYWA 5BT9A 3A14A 2OFWA 1VKNA 5CB4F 3DGFC 3AUSA 4F2GA 5T57A 1GSIA 5D3MA 1U5BA 4ZCLA 4G4JA 3R0JA 1AQYA 3LGSA 2FN4A 2J67A 3I64A 2VHXA 2FX2A 4NATA 4P4UA 3FTCA 3CLVA 3HZOA 4NU6A 1LTKA 3OD5A 4NCHA 5JVDB 3B7PA 1UAYA 1YJ8A 3AR6A 4AWXA 1ZY2A 1VHJA 1NIJA 3PENA 4UTOA 4P0TA 3KR9A 3W5SA 2MTBA 3EQ2A 4J1NA 3UOAB 4HNAB 1HYHA 3GGJA 4W1SA 3KZMA 3SCZA 5B3JA 1JTFA 5C46F 1SVUA 4F06A 3Q1KA 5C8XA 3U7GA 4RLSA 2IY7A 2R00A 5FLXA 1QQBA 3RYCB 1FXWA 1LLDA 4IDNA 5CK5A 1MO4A 2PT6A 5E9QA 1X7WB 3BFJA 3NHBA 1NN5A 1O94A 1VPEA 5THQA 1GJRA 2NZ8A 1G60A 1TM1E 3I1YA 5EWLB 2MOKA 1UFVA 2WPDA 4YS6A 1XZQA 3IB6A 1JDVA 5FFNA 4X61A 3ZNOA 1GZ4A 1YBMA 4KTVE 5NULA 4CF7A 3DWIA 2ZBRA 1IMOA 4UUBA 4LE1A 2HJWA 2BKEA 2GZHA 3KXLA 2DPXA 2MMGA 4PIVA 3GOQA 1TK2A 5F2OA 1OB5A 1GSOA 1KIAA 1JIQA 2BM8A 4FYKA 4Y2SA 2B20A 4U7WA 1J56A 3A9SA 4FN4A 3JPYA 5ALWA 3RM3A 3JZAA 1PR4A 3OU7A 4BVBA 1DBIA 1P81A 5HYVA 1X9IA 2DRIA 3Q7SA 4U8GA 4J8PA 2W98A 4K3UA 3EMDA 3BFXA 1NI5A 1D9ZA 1WPGA 1PG0A 3DEAA 4Q7JB 2YV1A 4FX5A 3N3AC 5G4KA 1NU8A 3OWHA 3EGIA 4KJXA 4Q7MB 4D79A 3BXZA 1J7KA 3BMNA 3G0GA 5EN4A 2XXAB 1QIIA 1V5IA 2P2DA 1T4MA 3R4VA 1ZNZA 4P22A 3DFUA 5G0TA 3W3AH 4AWBA 2EARA 1UKVY 3SQMA 1NMYA 4ZYLA 4ZO9A 1U2ZA 1IZ8A 1WIWA 4A16A 2Q4EA 4M1KA 2HHJA 3FCUB 1EG2A 4BVHA 2PKRA 2GAFA 4GMFA 2PANA 1KYZA 1NXOA 2VPTA 1I8TA 2WABA 3KUUA 3M4ZA 2R8YA 1V95A 2ZYDA 1RAIA 6GPBA 2R4UA 4L2IA 4YRGA 4LF7B 1U8XX 2QYOA 5K3SA 3FETA 4IXNA 1VGQA 3KELA 2JRCA 4BKPA 3D59A 3F3YA 2HRCA 2Q1YA 3FB4A 4D7AA 3T5AA 4ZO7A 1QQ5A 2C97A 4UUMA 2P5UA 3T5BA 1XKLA 1OAKA 1YIAA 2BT4A 1H9AA 2BMVA 1LDNA 5CFRA 3GNQA 3O8CA 1BEUB 2P1ZA 2Q9BA 3TDKA 3VJKA 4HADA 2E1PA 3WLHA 2IA5A 1M8PA 3VR4A 3GRPA 3O2JA 2R97A 3RT1A 4BJ1A 2QRMA 4NMXB 4DCUA 5JCXA 5IEBA 1VHWA 3T7DA 4TLCA 2P68A 3AK4A 3IIJA 1A8IA 3L6BA 2CB9A 2Q62A 1K63A 1CQXA 1G6Q1 4HOYA 1IG3A 3DBHA 1MB9A 1E20A 2FPRA 2JK0A 2PH7A 3IMEA 1GQOA 1RFGE 4L51A 1KI8A 2A8YA 3EG9B 2CHQA 3OPQA 5BSGA 5IYZA 4GRAA 5TPWA 3WLOA 3BMNB 2OYCA 1M6EX 3HZHA 2Q99A 4Y2UA 3ZU6A 4JY7A 5E4FA 5KYXA 2VZ9A 2A9QA