3JQAA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-1,9-dihydro-6h-purine-6-thione (dx4)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 95
structure length 249
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqaA00
2HCTA 1HEUA 4PVDA 1MX3A 4QSMA 3G0OA 1ZSYA 2GN8A 1U1IA 1P1KA 3EY4A 1AGNA 1EUZA 1HE5A 3ZU3A 4AFNA 3AI1A 1KBZA 1WW8A 1Y8QB 3JTMA 1UZNA 5ER9A 1QSGA 1P45A 4XR4A 3GNSA 3JQ8A 4YVFA 2HO5A 3QIVA 5A02A 4OH1A 1PU2A 1HSZA 1N1GA 3UCEA 2PK3A 2NTVA 4YRAA 3WR5A 2FOIA 3VZQA 3DC2A 1WWKA 3PLRA 3WJAA 1ISMA 2WE7A 4JX8A 5EN4A 4L4XA 4AICA 4ONEA 4A5OA 4XQGA 5LC1A 3ZNPA 1NBOA 3P19A 1O9BA 1R4MA 4KTTE 1O95A 3HHPA 3ENNA 1NPTO 1YB5A 4IXTA 4IJUA 4XJSA 3M2TA 4DGSA 4LRTB 1KOLA 3VPFA 1IL0A 1SPXA 2Q1UA 1LDEA 1NWHA 1PJ4A 1R0KA 3JQ8B 5EQFA 3U62A 1AXGA 4CLHA 1IHYA 1V8BA 5H83A 4ZICA 4XIJA 4CQMD 2PZMA 4BHTA 5JBIA 1EVJA 4EJMA 1SOVA 4GWKA 3I52A 2CMDA 4J2OA 4O63O 4Q39A 2R00A 3TL2A 4ALKA 4J91A 2EGGA 3GAZA 3OIFA 1QYCA 5KJCA 4NMHA 5L53A 4J1TA 3W6ZA 1R4MB 1Z7BA 3EMKA 5DOVA 3ANNA 3H9GA 4BO0A 1GAEO 3MEQA 3NX4A 4MIOA 3OFSA 4Y6RA 5LDHA 1HYHA 5U4QA 2B37A 4J1NA 1WZIA 3JQBC 1ZXLA 2WYWA 2ZB8A 3OECA 3WBFA 3TZQA 1M6HA 2VWPA 4JBHA 4D41A 3T7EA 3GAFA 3D4NA 2ZCUA 3WGZA 3PQDA 4M1QA 1HDGO 2BGKA 5TC4A 1YBAA 3JCZA 1EBFA 3GNQA 1SB8A 3DZFA 1T24A 2DPGA 2Q50A 4WLFA 1O5IA 4PG4A 3WOHA 3KYDB 4WJZA 2Y68A 4WASA 3WGIA 2GN4A 4UVDA 4QEDA 3AWDA 2VZ0A 1WDKA 4N7RA 1JDJA 2B4QA 4YAGA 2NQTA 4ZHSA 4BGIA 4LN1A 4J90A 3FTPA 3H6KA 3R0IA 4L0QA 4O59O 4PLHA 2P4QA 2O3JA 1GV1A 4BMVA 3WG9A 1B26A 3SX2A 5JDCC 3HQ4O 4JP2A 3TDKA 2IZ1A 4DC1A 5CG1A 4GLOA 1VI2A 4Z0PA 1UP7A 3VVBA 2FP4A 2Q2QA 4XJTA 4AG3A 3EDMA 3QVWA 1A5ZA 3S55A 2EG9A 2Q4EA 4L4RA 2WWRA 3WQQA 3I9NA 5G4KB 2QYTA 3M6IA 1QRRA 3QVTA 4FFNA 3WWZA 3FRJA 2VHXA 1P33A 4CM8A 3BTVA 1SB9A 4J9VA 4YJFB 4D0RA 5CDSA 4GX0A 2FSVA 2VHYA 3D3WA 4HBGA 3Q6IA 1F8FA 2PH3A 4HY3A 5JE8A 2D59A 4BNHA 1LI4A 4CLOA 1KVSA 1SOWA 5FI5A 2IXAA 1ISHA 1D8AA 3MWEB 1XU7A 3GK3A 1TEHA 2OFPA 3BAZA 1HZJA 1SMKA 2C7GA 3KSDO 2CDCA 4XRGA 1PZGA 2V6FA 1A27A 1E3WA 3I6IA 4L9RA 4R41A 4MIYA 4XGKA 1MC5A 2DBRA 2J5QA 4KDEA 3H5AA 4U8GA 4OYRA 3H4VA 2ZB4A 3OJEA 3AY7A 1BTOA 3O8QA 5T67A 3KYCA 3PIIA 3MJCA 4CM8B 2DC1A 1ADFA 3GDFA 4GL4A 2EEZA 3UHAA 1IOLA 3IMFA 4PZCA 5LCXA 3WJ7A 1X7DA 1PJCA 1PJSA 3GT0A 5DCYA 5CDGA 1CERA 2DBZA 1B3RA 3NV9A 3EYWA 3D3WB 7MDHA 2NLOA 5KJEA 1H6DA 1LEHA 4UEOA 1YE3A 3IL2A 3RFTA 1DC6A 1VL6A 1FDUA 3Q2IA 5L7YA 5I7VA 9LDBA 2Y99A 5C7LO 2UUOA 3DEYX 1YH3A 3GVHA 1HSOA 4NJOA 4R5MA 2PA3A 3KOUA 4W7HA 1U9JA 4BNIA 2CF6A 2Q4BA 3C1TA 1BVUA 3FWNA 3DZJA 4IBOA 2OL4A 1XEAA 2PD4A 4ALLA 5JNLA 4W9NA 4D43A 2IZZA 4TRMA 4DIFA 3ABIA 1T25A 4R1TA 5CAEA 1Q7BA 2WSBA 1JVBA 4E12A 2ZK7A 1I3NA 1YDWA 2ZCVA 1NR7A 1B14A 4OO3A 1DSSG 1E6UA 3EZYA 3JD4A 4XA8A 5G0UA 3PFWO 1NM5A 5G0WA 4KOAA 2J5KA 1UUFA 4YXFA 5CDTA 4ID9A 4PG8A 2G76A 2HMVA 5ITWA 2J3KA 3JQAD 1LDMA 1UDBA 4FOSA 1I8TA 3PHGA 2ET6A 1GR0A 4DQVA 2W2LD 3FBTA 4J7UA 2JD0A 1EMDA 1DC4A 3TFOA 2E37A 1C0KA 1X1EA 2AQKA 2UYYA 1E7RA 4G2NA 1DIRA 2D5CA 5A9RA 1U28A 3H9UA 3HDHA 1YS4A 3ETDA 3DAGA 2ZTVA 3SC6A 3O38A 2BH9A 3WGOA 4XZ3A 1NWCA 5TJ9A 4BNNA 1GV0A 3ZN2A 3WIDA 1R12A 2PTGA 2Q1TA 3PYLA 1JAXA 4A7PA 1EVZA 2B36A 5CDUA 2OBNA 1E7SA 4IJWA 5BR7A 4YJGA 2AG8A 5KJ6A 2P91A 2Y67A 3JYQA 2CY0A 2AE2A 2YHUA 3UF0A 4OQZA 1N7GA 2Q46A 3GVXA 3V2HA 3GQVA 5A9SA 3O26A 4P4LA 4PLVA 2Y66A 3CSDA 2RHRA 1IZ9A 2JAPA 4CM7A 1T2EA 3PK0A 1GYQA 5JYEA 2Q99A 3LF1A 1KC3A 3WMXA 2GYYA 4Q3AA 4CV3A 3BMOA 1HDXA 3FSRA 3OJOA 3GEDA 3D5TA 1XLTA 5TJHA 5A9TA 3GHYA 2E48A 5F3RA 4MOWA 1W6UA 1XU9A 1YB1A 4BO3A 1GL3A 2OGUA 4GAEA 3SLKA 2O4CA 2B5WA 3DZGA 2X9GA 1TT5B 4PN3A 1U8FO 2Q3EA 4RPGA 4YJGB 3ROPA 4MJLA 3OQ1A 1U4OA 5CEFA 6LDHA 4CM9A 2X23A 1GQQA 3LQFA 1HL3A 2VHWA 4YCAA 2WE8A 4GSKA 1LA2A 3E9NA 5G4LA 1NFRA 2ZB3A 4Y6PA 2NVWA 5A9SB 1NAIA 1TXGA 4IQ8A 3RQSA 2VYNA 2B69A 2I76A 1ID1A 1E5LA 1G6KA 3ZNQA 3GDGA 2PZKA 3UICA 3BMOB 4FSHA 4BV9A 3BHIA 3JQGA 4BKUA 5CP8A 2EW8A 3F4LA 1JWBB 4DYVA 3DOJA 4MVJP 1LUAA 1UXJA 1WZEA 1BSVA 2BKAA 2I65A 4IDCA 4NFSA 5BT9A 9LDTA 2DVMA 2PWZA 3I83A 4CR7A 1I36A 3D4OA 1VL0A 1J6UA 1XHLA 1WNTA 2JHFA 3FCOA 3FPCA 4Q3NA 4Z3DA 4KWIA 2O2SA 1H5QA 2C5AA 3BHMA 4TVBA 5EQDA 3I23A 2HJRA 3ZWPA 5C3MA 2IEDA 3HNPA 2AW5A 3OJLA 2NU6A 2E82A 2YV3A 5HM8A 1P74A 1SC6A 3EVTA 2PR2A 3JQGB 4DWVA 1PQUA 3CH6A 3I9LA 4QO7A 3E82A 3WNVA 1K0UA 5BSFA 4IS3A 1FK8A 1NPDA 4M55A 1DIBA 2VHZA 3WFIA 4N54A 1DPGA 3PI7A 1BVRA 1Y1PA 2X5JO 4M87A 4RVUA 3TPCA 2Y1CA 5DF1A 1GPDG 2P5YA 3BTUA 4Z3KA 1E1MA 3L77A 2A94A 4XDZA 5BNFA 1QYDA 4KQXA 5JCJA 3RASA 3RWBA 1ISJA 4OKNA 4YDRA 3TFQA 3LT1A 2H9IA 4AJNA 3ZGYA 3KSZO 1HDRA 1GADO 1WMBA 3AU8A 4FBGA 3N7UA 3GVIA 3U4CA 1LLCA 2C2XA 1L7EA 4ALMA 4E2XA 2HKIA 4UUNA 3GEMA 5A3JA 1LRKA 4MVJD 5AVOA 4UVGA 1IHXA 3OIGA 4I1IA 4IUYA 3KHUA 1WMAA 4QQRA 1D1TA 4FFPA 1GCUA 4BO4A 4EEZA 1K5HA 1U4SA 2RAFA 5BNIA 4I08A 1JA9A 4RLHA 4RJTA 4DPMA 2VN8A 1K6XA 1QXSA 5F5NA 4YEDA 3GGOA 2B0JA 4DXHA 5JSFA 3BMNB 2Q2WA 3LF2A 1R66A 3RD5A 4JJIA 3VPHA 1DLIA 4FCCA 2R00C 5DDIP 1LXCA 1YBMA 1PGPA 2J6IA 3CPSA 4U0JA 1DEHA 1KYQA 5JYDA 3GFGA 4PVCA 2CFCA 4DC0A 4EJ6A 1E3SA 4AJPA 5ITVA 3ENKA 1HLDA 1TI7A 3JQ9A 4L74A 4DMMA 1P0CA 4MO2A 1LQTA 4NNJA 3V2GA 3MWDB 3IJPA 3S2EA 4AJ4A 2HJSA 5L95A 5L7TA 3WIEA 2DFVA 1X1TA 3HN2A 4A03A 4Z9FA 4BGVA 5JY6A 3ZHBA 1KEPA 1PGNA 3VPXA 1UR5A 4ZD6A 4E5NA 1ZIDA 1GD1O 1UXIA 1YL6A 1DJQA 4MP6A 4YAEA 1IPEA 4DQUA 1PSDA 2QZZA 3OEYA 4HADA 3IP3A 4P4GA 1MXHA 4MVJI 4B4VA 2X9NA 1ADGA 1ADCA 4UUPA 3E18A 2JFFA 1YOVB 3AJRA 3I6QA 2LDBA 3JQFA 4BOYA 1QMGA 4MVJM 2X0IA 1Z45A 3DHYA 4E33A 2QRKA 1CRWG 5DP2A 1LNQA 4JCOA 1M6WA 3K5PA 1ONPA 1X13A 4QX6A 4A10A 4E30A 2A4KA 1P3DA 1YQXA 1C1XA 2GGSA 2GZ1A 3H3FA 4URFA 2B4TO 1U7TA 3DBRA 4U5QA 3ZDFA 2DTXA 3KEOA 2NU8A 3CZRA 3CTMA 4ZJUA 1EFKA 3PP8A 4ZRNA 3AM4A 5HA5A 4D0SA 1IPFA 4KQWA 2CDAA 4ND4A 1B3BA 3WGTA 4F45A 4ROSA 3PJDA 3PHHA 1BG6A 5KJFA 3OA0A 4CMGA 2H5LA 2XF8A 1Z6ZA 4UUMA 3OQ6A 3HFGA 2D3TA 4IQ0A 3FI9A 3PJEA 5I7SA 2NADA 4XYBA 4CV1A 3IIEA 1NX6A 4DBZA 5F1KA 4B3HA 4F6LA 4E13A 2ZATA 3C3XA 3ZV4A 2E49A 4DIBA 2AEMA 3F47A 2VQ3A 1Q7GA 4OXYA 1A7AA 2C59A 3DBRB 3NRCA 4IIVA 3CIFA 4BKQA 3QHAA 3NUGA 4NBRA 3PHLA 3TZHA 2ZTUA 1XQ1A 1T26A 2BLLA 4TRJA 5BSEA 4XIYA 1GQ2A 2BD0A 2ZQZA 1D3AA 5EINA 3AUUA 4Z0HO 4CL8A 1YL5A 1DIGA 4IINA 5A03A 2DTDA 2WD8A 4ND2A 5GZ6A 2FHSA 3MJSA 4CPDA 5F1PA 4TVOA 1OFGA 3MJVA 2XAAA 2IZ0A 2PH5A 1KEWA 2Y1OA 3WTBA 5JS6A 1L1FA 1FDWA 1ENYA 3NJ8A 1XR3A 5K0ZA 1YBVA 3ZW9A 1V3UA 3F5QA 1J0XO 1TLTA 3HB5X 3RROA 3H9EO 1U5AA 1P1FA 3WB9A 4OMUA 3GOHA 4EEXA 2ZJ0A 1T1SA 3FNHA 3ASUA 3B6ZA 5AXCA 1GU7A 3KO8A 5A06A 3RC7A 4BO8A 1T2DA 5L45A 3JYOA 1RM3A 4KMSA 4RQUA 4CL3A 3DOOA 1A7KA 1J4AA 2VUTA 5KVQA 4W9NC 3B70A 4LISA 4ND3A 3HN7A 1A72A 3ONEA 5KNLA 3SXPA 1H6BA 4J7CA 1RKXA 4YR9A 2CNBA 1DBVO 3GMSA 1ZEJA 5IN4A 3H8VA 1DC5A 3MTGA 3G17A 3V1YA 4HV4A 3LT0A 2UDPA 5FI3A 4W82A 1PJBA 4Q3DA 3Q3CA 4RDIA 4UVIA 2GR9A 4UAGA 1VJ0A 4N5NA 2HMTA 2GN6A 3OJFA 2G17A 4BNVA 1PZEA 1ADBA 4YAJA 1GZ3A 1GEGA 3COSA 1D7OA 1W8DA 4RF4A 4A2CA 4EBFA 3LC1O 3QWIA 2VHVA 4MVJG 2WYUA 4XWYA 1Y9EA 3AY3A 3RJ5A 2FZWA 3K6JA 5JO9A 4OM8A 4QO8A 2EXXA 5I9MA 4D3FA 3DDNA 4B8ZA 1MV8A 3NYWA 4IS2A 1P0FA 2BGLA 2GF2A 3F5SA 1E3JA 5DCWA 4CUKA 4JROA 1F14A 3AUAA 4CMCA 3NAQA 1PGJA 1C1DA 4NI5A 2DLDA 4UREA 5TS3A 4BB6A 5DNAA 1ZFNA 3OIDA 2P5UA 4RVSA 4R3WA 5I7FA 3GZNA 2ZQYA 1F8GA 1F12A 3FF4A 4XR9A 1ARZA 3AI3A 4HWKA 5AXDA 4RZIA 3VC7A 2VRCD 1JKFA 2OZPA 2EW2A 3ZNNA 1QKIA 3JD0A 2Y0EA 3RVDA 3C7CB 4ND1A 4QUKA 4XQCA 2HDHA 3ZWAA 4J6FA 3PHJA 1GCOA 2OO5A 5B37A 2ZB7A 3RC1A 3GMDA 3PDUA 3GG2A 1PTJA 2QZ9A 4KUGA 1X14A 3OEWA 2D4AA 3P7MA 1CEQA 4KTVE 5TSDA 1NAHA 4HX5A 2PKQO 4LCJA 4U6QA 3EHEA 6ADHA 1P1RA 5AOVA 5C7OO 3PXXA 2CUKA 2PFGA 1ENOA 4E5KA 5L51A 1FXSA 1SAYA 1DFHA 2X5KO 1X7GA 2YDYA 3H5NA 4IZHA 2BELA 3GZNB 1GTMA 2JD1A 3SJUA 1G0NA 4F3YA 3ZU4A 1I3MA 4NBVA 3UGKA 4IDDA 2JCXA 3WSVA 3D5QA 2ZYGA 1HDZA 4DPLA 1KVRA 3HJAA 3TSCA 2VOJA 3QWAA 1E3LA 2O3SA 4WLOA 4W6ZA 4K28A 4N5MA 4FJ0A 3SLGA 1HTBA 4NK5A 4BO9A 4M49A 1E92A 4JGBA 1R6DA 4HUJA 4EDFA 1E77A 4A73A 1ZEMA 1I2BA 3RIHA 4HKTA 2NU7A 4PLZA 3S1LA 4BL5A 1R16A 2NWQA 4XEHA 5EMHA 3ITKA 3F46A 3DFUA 1P31A 3C1AA 5KVSA 3WWYA 3TZCA 1YKFA 1I10A 1I2ZA 1LRJA 5FWNA 3FHLA 2QW8A 4RF3A 5ENDA 1XKQA 5U9CA 2NQ8A 1RYDA 4CR6A 3LZ6A 1KY4A 5TQVA 1BW9A 1MA0A 4TZTA 4IMRA 1BMDA 2PY6A 1H9BA 4WE3A 4CJXA 3WBBA 4FDAA 3UFXA 1B8UA 3RKRA 1WDLA 4HFRA 2D5AA 3QVXA 3I5MA 1IYZA 3RCBA 1XIVA 4UVHA 1H2HA 1NFFA 4W4TA 1S6YA 2O23A 1NXQA 1Y8RA 5JDIA 3ZWYA 2G82A 4G65A 3DFZA 1X7HA 2QQ5A 4O6VA 7ADHA 4BO5A 4D3DA 2POQX 2I66A 3MJEA 3CE6A 1EVIA 1YRLA 4L4SA 5I7EA 1BXZA 4CLXA 3KEQA 1RM4A 1D4FA 5IN5A 5F21A 3WLEA 3M2PA 4P8RA 3HADA 1DRVA 4RF5A 1N1EA 4A0SA 4OSPA 4YJHA 2P4HX 5G0VA 5JMWA 4E21A 3ZWWA 3IKTA 4S3MA 3UXYA 3I4FA 4LGVA 3E03A 3RUCA 5TT1A 3BYZA 2OUIA 2Z1MA 1PS0A 1BXGA 1V0JA 1BDMA 3E48A 4TZKA 1HRDA 3HE3A 1NHGA 3GR6A 3NKLA 1B8VA 4CLOB 5EESA 5TX7A 2D2IA 3IDSA 3LSYA 5KWEA 3JQ7A 1U7HA 2FSSA 3QE3A 2Y1GA 5KCZA 1K6IA 1CQJA 3OETA 4QT0A 1UP6A 4J4HA 2PD3A 5GZ3A 3AK4A 5JAMA 1E3WB 3W8FA 3VH3A 4JIGA 1ZCJA 4TKMA 3DBLA 2GN9A 4ILKA 1F06A 3JQ9C 2AHRA 1YQDA 4OHUA 4YJHB 4DBVO 1I0ZA 1ISFA 3O8QB 3KYCB 1IB6A 4D44A 3F6YA 4WK6A 3STHA 1FDVA 4N5LA 1CDOA 2I9PA 1ZSVA 3AFMA 2JHGA 3LLVA 3OQBA 2JFHA 3VH2A 1K3TA 1BXGB 3JQDA 5IXSA 3WSWA 3BTOA 3ZZNA 2P9EA 2DKNA 1QP8A 4CQMA 4I9HA 2X86A 2O50A 4PG7A 3MOGA 1OAAA 3AY6A 4J43A 4KP7A 5L4SA 4JQCA 4YB8A 4PZDA 1YONA 5IFLA 2W4QA 1EDOA 3ZU2A 2NU9A 2FMUA 3B1FA 2FRDA 3PWKA 3H3JA 3GC6A 2NVBA 5MGBA 4JNKA 4OQYA 3K31A 2GPTA 4NU5A 1KEUA 1ML3A 3A06A 3L9XA 1VE9A 4RPLA 5KVCA 3G3EA 2ZYAA 1E3IA 1AXEA 3JQFC 3OA2A 3DBLB 4MVJF 4PLCA 1TA4A 1WP4A 3ANLA 3F1KA 1DAOA 4MVJH 4U6SA 4WEOA 4FD3A 4WLNA 3VOSA 3WGGA 3FTNA 4KUHA 4R4JA 1SO8A 3NEPX 4TQGA 3RC2A 2QG4A 2C07A 2VWHA 5T5QA 3JV7A 1YJQA 4R9RA 1H0KA 3C85A 1VKNA 2C0CA 2X22A 3WS7A 1Z74A 3LT2A 4CUJA 2DFDA 5COAA 4B4UA 1B16A 4ZA2A 5JC1A 4PZEA 3E8XA 2I5PO 4BV8A 1XA0A 1HE3A 2JKVA 1HZZA 3LLSA 2NTNA 3IUPA 4B7CA 1JVSA 1HT0A 4HNGA 3W8EA 4MINA 2X0RA 4QFDA 5ICMA 3E6AA 1E3EA 4RF2A 4TSKA 5TT0A 3ICCA 1LU9A 4YWJA 4Q3EA 4AVYA 5DCUA 4WOJA 4CM1A 4BO7A 5HWSA 3H9JA 3G49A 1F17A 1UDCA 1IZ0A 1O0SA 2EF1A 2B5VA 4GKVA 2ZTLA 4E2YA 4EJ0A 5GY7A 4WNCA 1O8CA 4GKBA 1PL6A 4Y98A 3U9LA 2ZTMA 4A27A 4K1LA 1LLDA 4G5HA 2YY7A 3RFVA 1HKUA 1CETA 4R9SA 1CIVA 1JAYA 1JWAB 2G5CA 1H6CA 2EKLA 5B1YA 3RC9A 2BF7A 2H63A 3KBOA 3PFFA 4FOOA 3X2FA 4AJ2A 3JYPA 5KTKA 1DFGA 3PZRA 5JAZA 3EAGA 1AN9A 4Y9DA 4BKRA 2VTDA 3LT4A 5ADHA 2RBEA 1OC4A 4FJ1A 3FD8A 1CWUA 5C7IO 3TZ6A 1UH5A 2VT3A 4R16A 4B7XA 1UXHA 1DLJA 4NFYA 4YRDA 3V2UA 2YDXA 3L07A 2PGLA 2IYOA 3ZWCA 4FB5A 4L76A 5T57A 4BMNA 3P2YA 3VH4A 2BI7A 1H6AA 3JSAA 3TNLA 4BKOA 3QSGA 2Q49A 5CFZA 4EYEA 3W4IA 1LTHR 5JLAA 1NFQA 1Z82A 2BRUA 2VUUA 4NBUA 1ZO8A 1W0CA 2WJPA 1DJNA 3VZRA 3MTJA 4BO1A 3ZV5A 2B35A 4R54A 3IKVA 2E4AA 1Z75A 3QWFA 1VRWA 3CUKA 3I9JA 3E9QA 5DULA 1ZK4A 2O3RA 1DRUA 5IJZA 1UJMA 2DUWA 2PZLA 2W98A 4MKZA 2DQ4A 4P4NA 1HYEA 5DBFA 1P9LA 4EZBA 1E6WA 2AA3A 2EKPA 1I01A 2D0IA 2Z5LA 3A28A 3PGXA 3IAHA 4R3NA 1JN0A 4AJLA 5G2OA 3GUCA 5BNTA 3TOXA 1QYXA 1JU9A 4ALIA 2QIOA 5J23A 4IMPA 2C54A 3VTZA 5A1TA 3IC5A 3I3OA 4FC7A 3RU9A 1WPQA 4CLEA 4PLPA 1T2FA 4DQXA 1OBFO 2BHLA 3ANMA 4GLLA 1Y7TA 3BXXA 4AJEA 2EWMA 2V7PA 4J7XA 4BNJA 3PIDA 1GZ4A 1DHTA 3B20A 1XG5A 3DZKA 1H93A 3EVNA 3AW9A 2RIRA 3UAGA 3JQEA 1ZMOA 4R69A 4FJ2A 1MG5A 4WKGA 4CMJA 2GLXA 3KUXA 3NDRA 1GQYA 1ZK1A 1RWBA 3TRIA 3C24A 1R15A 1ZBQA 3JQAA 3VKVA 1AHIA 3JYNA 1X15A 4RGBA 4YBZA 5CEJA 4FFLA 4I5EA 4BUCA 2W2LA 2JCVA 2I99A 4YTEA 3UH1A 2X6TA 5JAQA 1EK6A 3HSKA 1WLYA 1EDZA 3DOCA 3X2EA 2GNAA 3DHNA 3LYLA 1RYEA 2NUAA 1Q1NA 4IDGA 4B79A 2DBVO 3JQCA 3O9ZA 4AJ1A 4BNTA 5I8WA 1C14A 1A4UA 3QWBA 3QLJA 3OBBA 3K30A 3U4DA 2VT2A 1A4IA 5TNXA 4AJHA 1J49A 5COBA 1U2GA 2GDZA 1B0AA 5AQ1A 4K6CA 4TKLA 2IE0A 2X9VA 1PWXA 2DT5A 4FFOA 5ER6A 5JC8A 2O2YA 3S2FA 1PWZA 1PS9A 2AQIA 2VYVD 4HFJA 4U0KA 1YXMA 4HP8A 4J1SA 4GMFA 3IUSA 3R3JA 1KVUA 4LRSB 1XYGA 1B2LA 3V5NA 2VWQA 3VVCA 5L3ZA 4BNWA 4JJFA 3H7AA 4MPDA 5I9LA 2IODA 3D7LA 3UKOA 1BXKA 3AOEC 4NHEA 4PLYA 5ES3A 1SCUA 1HYGA 4LMPA 2EJWA 3UN1A 5B4UA 1SBYA 3L6DA 3Q9NA 4RVGA 4L75A 2BGMA 2OBYA 3VKUA 3KZVA 1NQAO 1PJ3A 3I9KA 2V6GA 1VL8A 4B3JA 4DA9A 3E9MA 3DZBA 3DAPA 4I5GA 1DXYA 1ZKMA 5IDQA 1YVEI 5IZCC 1HWYA 5EPOA 4J0EA 4YACA 2VTEA 1YB4A 3M1LA 4GQAA 3C8MA 5IZ4A 5L9AA 2EP7A 1NASA 4C7JA 1MLDA 2WMDA 3NGLA 2AEFA 3PVZA 4FN4A 4XKJA 1SEVA 5U1PA 3TWOA 1ISGA 4R68A 1M67A 2FZEA 1BRMA 1PJTA 1PR3A 3FNEA 3VDQA 4BNXA 4RPHA 3DAFA 4XGIA 3KVOA 3ST7A 3RBVA 1M2WA 1ZUD1 5EIOA 5TGDA 2YFQA 4I5FA 4YYZA 5A3VA 1GFSA 2CD9A 4XYLA 1I5RA 3GY0A 4DTIA 5KKAA 1GUZA 1OMOA 3FWZA 4CQLA 2XXBA 3RUEA 4IIUA 1OOEA 2YV2A 2FPIA 4J2HA 1EQUA 1LSSA 1SNYA 1I30A 1K2WA 4ZQGA 4BQPA 1E7YA 4J49A 2ILTA 1ISIA 3F9IA 3ZWXA 4WECA 3PZBA 3DHEA 5FYDA 4BIIA 1LC3A 1DIHA 4GGPA 4CLRA 2P68A 5JDIC 2X7HA 4P38A 5COQA 1P1IA 1KEVA 1U3VA 2F00A 3ZNOA 1MFZA 1M75A 2Q1SA 1ZK3A 4BB5A 2YW9A 2NVUA 1PEDA 4GSLA 1GDHA 3MJ4A 4NU6A 2Z95A 1C1XB 3INRA 3ETGA 1E6EA 1H94A 3I1JA 1UXKA 4IDBA 2C2YA 4DLAA 1I32A 4UULA 1UDAA 3HG7A 2H6EA 4KZPA 3DB2A 5TIIA 3TZKA 4BGEA 1KY5A 1CYDA 4CMBA 4CM3A 3D4PA 2BFPA 1YO6A 3EGOA 4WCFC 1LDNA 1NQOA 1DOHA 1N9GA 1YDEA 4IDFA 2YUTA 3DBHA 2C29D 4HFMA 1MP0A 3RBXA 5CDYA 2X0NA 4DMLA 3JD3A 3WQRA 1K89A 3GH3A 5L4LA 3ADPA 1NYTA 2O3TA 4NJMA 4TWRA 3GRKA 3BMCA 3V8BA 3D1LA 3BA1A 1RM0A 3DZIA 2NVUB 4ZGWA 3PDJA 1CF2O 1UP4A 4NDNE 2GZ2A 4TROA 5B4VA 4MVJA 2GUGA 3OP4A 3IJRA 3BIOA 5T6BA 1D1SA 2GASA 3KM0A 3QQPA 4B4OA 4DLBA 1W73A 1U3WA 2Y1FA 1SEPA 1LDGA 3OF2A 1KIFA 4IJKA 3RUAA 1BHSA 2EP5A 4I9NA 4JBGA 4NK4A 1E7MA 4Y8VA 1TB4A 2P9GA 4OXKA 3QP9A 2BFAA 2JJYA 3GVPA 4K9DA 1EFLA 3JYLA 4FR5A 1VLLA 5HRUA 5CPBA 3TF5A 5JCXA 3IS3A 1MB4A 4EUFA 3DL2A 5G0SA 3U4HA 3R6DA 4PG6A 1GY8A 1ZXBA 3KRTA 2FPPA 2HMSA 2AQ8A 4OOFA 4LW8A 2RCYA 1X0XA 3AU9A 4E6PA 2YQ4A 3H2ZA 4GVXA 1PJQA 1XDWA 1PQPA 4Y67A 4BNZA 3GN2A 5L7WA 2JD2A 3U4IA 2D8AA 4MP8A 2FR0A 1C0IA 3UCFA 4CMHA 8LDHA 4CM6A 4RVHA 2HK9A 3NTOA 2DAPA 2AMFA 2OP1A 4BNKA 1G0OA 2FR8A 4XYEA 1VPDA 2YQ5A 1NVMB 3L0DA 3WNQA 4L73A 2NSDA 2PV7A 4LVCA 1ULUA 1PL7A 4RPJA 5C5IA 3D3EA 3UUWA 2OXIA 3VTFA 2ZYDA 3JD2A 2YHIA 1H9AA 3NJ4A 1PR9A 4E2WA 4PLWA 3GFBA 4XDYA 3RI3A 1LDBA 3GPIA 3SBOA 1Q0HA 2BI8A 4Y6SA 3IQDB 1KERA 4N18A 2X1HA 1MGOA 5AYVA 4ESOA 1NQTA 3GHHA 3PLNA 3ZWNA 4CMIA 1U3UA 3WYEA 2HRBA 2NTJA 5JW6A 2Q45A 3DTTA 3H5RA 4LVUA 1N2SA 5THKA 4NZ9A 3HZZA 3RBZA 3ZWOA 3FR7A 3WXBA 3Q1LA 2VUSA 1HXHA 5DT9A 1N5DA 1N8KA 1ZJZA 2EV9A 5K6AC 3IP1A 2VZ9A 4YQZA 2HAEA 1MXFA 3BZUA 2YHIB 3KLPX 4RVFA 3DMTA 4GX1A 2G1UA 2VZ8A 3ZHYA 5JAIA 3GA0A 2CF5A 3HDJA 2CVZA 2A92A 3L6OO 4YAIA 4AJJA 1DAPA 2AG5A 1C1DB 1JQBA 2QRLA 4FW8A 4NH4A 1EQ2A 5DBIA 3U3XA 1TVEA 2DM6A 4CMEA 4II3A 4OXNA 3KV3O 3QRWA 1LLUA 4CMIB 5A04A 2WEKA 2QRJA 3AOEA 1PX0A 2I3GA 3ADOA 3UVEA 4NPCA 2Y05A 1YJ8A 4W99A 2HMWA 1HF3A 3RFXA 3QJ5A 1VKOA 3RU7A 3H2SA 3KYDA 1WDMA 2VCYA 3S2IA 3UCXA 2VRBA 3G1TA 4BO2A 4EUHA 1C0LA 3K73O 5C37A 3A9WA 3ITDA 1UAYA 5IZCA 4JXKA 4OAQA 4RVDA 1EE9A 4ZQBA 5H82A 5L4NA 4PRKA 2FY8A 3GZ4A 3PQFA 1BWSA 3KXDA 5IDWA 5EERA 3OJ0A 4W7IA 3PGJA 4JBIA 1ZSNA 5AXAA 4DPKA 1R37A 2R2GA 2VOEA 1G1AA 2X4GA 5CPFA 5B12A 3MOIA 1ZMTA 4B3IA 4QFCA 4BO6A 1NPYA 4E0BA 5TLSA 1V9LA 1YQGA 2F1KA 2WM3A 3B1JA 3PPIA 4H3VA 4HFNA 4EUEA 4YAKA 3DBVO 1A9ZA 4R1NA 3K9QO 2HRZA 2A35A 1R4NA 1MC4A 3ICPA 1PQWA 5G4KA 3VDRA 5BQFA 1XQ6A 2CDBA 5F5LA 2IXBA 1IE3A 2HMUA 1XCBA 2OMEA 3NTQA 5FFFA 2Y93A 1H2BA 3GUYA 3GF4A 1ENZA 5I9NA 4DLLA 4FS3A 4YJFA 3WX0A 3GRPA 2PLAA 5THQA 4KUEA 5G0TA 1T2AA 2EKQA 1T1RA 1I24A 4Q9NA 5I8ZA 3W4KA 5A05A 3ON5A 4FGSA 1EE2A 1T2CA 1ZH8A 4D45A 5FEUA 4PLTA 4HXYA 3K8ZA 4X54A 1BGVA 4QXMA 4UEKA 4ZVVA 5JPIA 2C5EA 1AUPA 5EL0A 4MKXA 4JP3A 4RO0A 2WDZA 4MIEA 4BNFA 3CINA 2O3QA 2V6MA 2QHXA 2UV8A 1R4NB 4R01A 4JK3A 3GGGA 1VSVA 4Z9YA 3WLFA 4PG5A 3R1IA 2EIHA 2ZIZA 4RQTA 1MG0A 4G81A 3PYMA 2C7VA 1Y81A 4CM9D 1S7CA 2D1YA 1BW9B 2EERA 4RCVA 3D0OA 4XB1A 3KB6A 4CM5A 4EI2A 2AQHA 4WCFA 2X8LA 1EUCA 2VWGA 1E0DA 5DBGA 5IDYA 1E1KA 2VYND 3PTZA 2B4RO 4CLDA 2Y1DA 3ASVA 3MCVA 1PS8A 3ZCXA 5T8KA 1VSUA 5ENVA 1O89A 1Y8RB 1PZHA 1ORRA 2QX7A 3CMCO 4IGFA 1OC2A 3AUTA 2HUNA 2FWMX 3ROKA 4O0LA 1Q7CA 3PWSA 2VNSA 2DTEA 4WPGA 1WAMA 5KKCA 1Y6JA 2GZ3A 4JJGA 3JD1A 4YA6A 4ALNA 1Y5MA 4BVAA 3TJRA 3FR8A 4Z6KA 2A9FA 2FPGA 1B7GO 3O4RA 4JLWA 1FJHA 5TRTA 3TN7A 1GYRA 1UXGA 3C1OA 1GYPA 4WCFB 2P9CA 1LRLA 1O6ZA 1SZJG 3L4BA 2WTBA 1DDOA 2VRCA 4M8SA 2IYPA 4CM4A 5BSHA 4K6FA 3GLQA 4XQEA 1EVYA 4FC6A 3OICA 2IEBA 4R51A 1DO8A 5JO0A 4BNUA 4DRYA 2EGHA 2YYYA 3EZLA 4DVJA 4YT5A 1KS9A 2PGDA 3HDYA 3JQ7B 1JTVA 1NR1A 3QVOA 5B4TA 2O7SA 2Z1NA 1JKIA 1YL7A 4IDEA 3VAZA 2I3AA 3CXRA 4J16A 4NR0A 2C82A 4Q3CA 4TMFA 2BFOA 4BGUA 1NTOA 4NFHA 1YGYA 2UUPA 2WYVA 4H15A 1Z7EA 1WXDA 4IQGA 4YRBA 2Q1WA 5CHEA 5JCJD 4IZIA 5HBRA 1DHRA 3KETA 2OP0A 3ZW8A 3DMYA 3WQSB 4CM4B 1I3LA 3I9OA 3WMWA 1E1NA 1LC0A 1RPNA 4MP3A 3GGPA 1GUFA 3PJGA 4FGWA 3KYBA 4CQMB 1DFIA 1U5CA 1ZJYA 2HSDA 3AUSA 3I9MA 4PIVA 4GH5A 2UVDA 3LK7A 3F3SA 3TQHA 2DPHA 3NDIA 3QA9A 3ZHXA 2SCUA 2XOXA 1ZK2A 3A14A 3FBGA 1LQUA 3E1KA 3PWZA 4IXWA 2BMAA 2NACA 1VC2A 4OKIA 1DIAA 2W2KA 3N58A 3OSUA 3BTSA 2RHCA 4FPXA 1QYWA 4ZN6A 3L9WA 3TL3A 3Q9UA 1RM5A 2AXQA 1P1JA 1B15A 5LDGA 3G79A 3PQEA 4GPD1 3WGQA 4PGFA 3AM5A 1P77A 4AJKA 3RUIA 4O5OA 1LSJA 3DR3A 3FNGA 3GEGA 1A9YA 3DO5A 3PJFA 3INTA 4GMGA 4J4BA 1ZVMA 1LBEA 1QORA 4FFRA 4OGWA 3WYBA 5K6AA 1CJCA 3LU1A 1TT5A 2OORA 2J8ZA 3HFSA 3NT4A 4WLVA 4DUPA 2FN7A 2NM0A 1EUDA 3UOGA 3DQPA 3T4EA 4JN6B 2J3JA 4BNYA 4M89A 3CZMA 4AJIA 3ZWVA 4LCEA 4F6CA 1HDOA 4Q3BA 3DTYA 4R1SA 3ORFA 4OOEA 1Q0QA 1HE2A 3FPLA 2GERA 4IJVA 4RLSA 2W2KB 1U3TA 1P44A 3F4BA 4DYDA 2J5RA 5JY1A 3P2OA 5TF4A 4CR8A 3IOYA 4H16A 1B8PA 4GVLA 4PLFA 3EK2A 2O4UX 2OHXA 1QLJA 4CMAA 1O94A 2NV6A 4I9UA 3CKYA 2PKRA 4J4TA 2VNAA 2Y1EA 4Z0TA 3LDHA 2XPCA 1KVQA 3VZSA 3N74A 4FQ8A 3ZV3A 3RUHA 2EJVA 2I67A 4P22A 5JFOA 2PGJA 3JQBA 4I8XA 3DXFA 3U49A 3NGXA 4RL6A 2PKQP 1KC1A 2C20A 3QW2A 4A26A 1OZAA 3D64A 5JMPA 4AJOA 8ADHA 3A1NA 1J5PA 1VJTA 1YWGO 2IRWA 2ZJ1A 3ULKA 3RUFA 4GBJA 3L6EA 3TOZA 2HK7A 3RKUA 3U09A 4D46A 1N92A 4MKRA 1F0YA 4II2A 1Y9AA 4B8WA 4E4YA 4E3ZA 1JKJA 3PRJA 4YT2A 5A5EA 2GRAA 2RH4A 4MVJE 1HLPA 3VPGA 3WFJA 4PRLA 1V3VA 1A71A 2EHDA 2J3IA 3HDQA 1ZK0A 1V3TA 1DC3A 3GDOA 4BNLA 5DZSA 2W90A 1PJLA 5HS4A 4D42A 4XRRA 3AM3A 4AL4A 1V35A 3NDJA 1HE4A 5JDCA 4RDHA 4R5HA 1WVGA 5K9ZA 2HQ1A 4E5YA 3K92A 1NHWA 1HDYA 1UZLA 1XGKA 2YZ7A 1LLQA 1XWFA 1T4DA 3ROMA 3VH1A 4WCDA 2FR1A 4IPTA 3A4VA 1V6AA 3W6UA 3UW3A 1Z73A 4GWGA 3GVCA 4ND5A 2B83A 3FN4A 2GSDA 4WGGA 1PGOA 5EJ2A 4LSMA 4DIOA 1X0VA 2GD1O 2I6TA 1GPJA 3W4JA 5F1OA 4S1VA 1IY8A 2G0TA 4C4OA 3FNFA 4XGNA 3WYCA 4PFJA 2R6JA 4B7UA 4D3SA 1KVTA 5IDXA 3ONFA 2V65A 1QR6A 4WUVA 1E1LA 1CQIA 1LX6A 2W8ZA 3M1AA 2X58A 3BMNA 1HETA 2UAGA 4M86A 4C7KA 1AE1A 2HK8A 1ULSA 4O1MA 5GMOA 1JLLA 1L7DA 1PL8A 1DB3A 2BFMA 4NBWA 1I3KA 5IAAA 3U5TA 2YJZA 3MZ0A 1QYVA 1LDYA 1Q2XA 3EC7A 2IDZA 3GNTA 3DMTC 3QWHA 1QG6A 3E5MA 3JQAB 3ZV6A 3K2BA 4XYMA 1HDCA 3KLMX 4PCVA 1P1HA 1ZW1A 3DONA 4I5DA 4ZQFA 5IG2A 3ZH2A 4EITA 4YPOA 4CMEC 3ETEA 3GPDG 1I2CA 1TT7A 2WD7A 3OM9A 1ONNA 2TMGA 3V1UA 3W8DA 4D7AA 2J3HA 1GEEA 2JCYA 2LDXA 5BSGA 3ZWBA 3AI2A 1PZFA 4GX2A 3EUWA 4YT4A 1ZNQO 4ZU3A 4R1UA 3AFNA 4NBTA 5A5FA 2GCGA 3K96A 1GZ6A 3LC2O 4WLUA 4ZQEA 1EEHA 5DP1A 4EW6A 3QY9A 3SEFA 4RPKA 5IF3A 2O48X 1BDBA 4LSWA 1YOVA 1U2DA 1EK5A 2DUUA 4OJNA 4GI2A 3OMLA 1QV6A 3G1UA 4WEQA 2X0JA 1ZZEA 3PYXA 5ICSA 5KVVA 2NNLD 2O7QA 1I33A 1NNUA 3T4XA 4E2ZA 3LVFO 1PGQA 1N7HA 4YQYA 4BQRA 2WD7B 3HUDA 3EW7A 3WGHA 3NT5A 3OHSX 1FDSA 3PEFA 4FFMA 2X5OA 3ONDA 2JL1A 3B1KA 4KDFA 4L8VA 4XB2A 5AXBA 4BNGA 1FMCA 5GZ1A 1GUYA 4NQZA 4OL9A 4ZQHA 4QTZA 5JXWA 2AE1A 3CMMA 4CODB 3S2GA 4DREA 3RUDA 2PNFA 1T4BA 1VJ1A 1E7WA 2CVOA 4RORA 4ALJA 3Q2KA 4BNMA 4CV2A 2Y0DA 3Q11A 3JQ6A 4WOKA 5MDHA 3AOGA 4ZRMA 4FIZA 5KIAA 2Y0CA 1NP3A 4XCVA 4GGOA 4NIMA 4CV0A 3ZWMA 4CMKA 4DL9A 5HTOA 2P2SA 1KETA 2CZCA 3PHIA 3VHRA 3WGYA 5L40A 1U8XX 1PIWA 3W1VA 3KTDA 4EGFA 1ONOA 2O3UA 3H65A 1QLHA 1R0SA 2JFGA 4RV9A 5H81A 3K2EA 3GN1A 5T64A 1M76A 4J9UE 4QECA 2YFHA 3DZHA 2ZKLA 3CEAA 4UUOA 5DN9A 1LSUA 3NT2A 4J1QA 2H1SA 2YV1A 3KSUA 4CQLB 2GO1A 1Y5RA 1QV7A 3DWFA 4H7PA 1LJ8A 4U7WA 3F1LA 3BHJA 4BS9A 3OH8A 4BMSA 3C7DB 4XQ9A 1OI7A 1NQ5A 2CVQA 3HWRA 5HS6A 4LK3A 3WICA 2RH8A 4E5PA 1PJ2A 2HLPA 2PZJA 1W4ZA 4B4WA 5ILGA 4M54A 2DU8A 4NG5A 3RAJA 4KWHA 5KJ1A 1C0PA 4GX5A 4XD2A 4Z9XA 5T8KC 4CLRB 4E31A 4E5MA 4CUZA 1VM6A 3C7AA 1Q0LA 4YT8A 3BMQA 3MJTA 5IXYA 4MDHA 2HU2A 3ZU5A 4E32A 1E7QA 3QV1A 1NVGA 4TRNA 5CG2A 3Q0EA 1ENPA 3QVSA 4IDAA 4D79A 2OOSA 3RSHA 1M66A 2JAHA 3NTRA 1RJWA 3ZI0A 4IY1A 5KOIA 3LC7O 1NVTA 4ITUA 3GG9A 1UAGA 3E5RA 3HB4X 1N9GB 3U0BA 3VPSA 3DBHB 3L4BC 4J0FA 4RZHA 1R0LA 3P5SA 3SC4A 1XELA 4WNIA 1FDTA 2TMDA 3SJ7A 4INAA 1K6JA 1MFPA 3ZHZA 2V6BA 1DRWA 4YJDA 1XSEA 5ILOA 5FF9A 3BMQB 3O03A 4NJMB 3WDSA 1UZMA 3BMCB 2QYSA 4PLGA 1IULA 4XYGA 3R3SA 4OIMA 3INGA 3H9QA 2XXJA 1E5QA 2VYVA 1IUKA 2PD6A 4XX0A 1Y8QA 5DOZA 3ROQA 4UVEA 1JW9B 1LSOA 5A4DA 2Q2VA 3RJ9A 4BKPA 3V1TC 3S8MA 3T7CA 3L4SO 2DBQA 3SVTA 4IGEA 4WLEA 1AHHA 4HNHA 1FF9A 1EBUA 3WTCA 2CSUA 4TRRA 4J3FA 1EZ4A 4UEJA 4K26A 3I4CA 2AEJA 4LMRA 5CEEA 1MUUA 2E6UX 4OSOA 4F46A 1C3VA 3VZPA 4IM7A
chains in the Genus database with same CATH superfamily
2XODA 3G0OA 3H7IA 3VR4A 4BZWA 2XHEA 3EY4A 1EUZA 2E6KA 2VC2B 1AHNA 4AFNA 3ZV7A 1W46A 3KJGA 5C81A 1WW8A 1W85A 2QUAA 2ZSUA 3JTMA 1U28C 2ZUFA 1P45A 3G59A 4QLBA 5IW8A 5K5EA 5FFNA 4DSNA 4YVFA 3HRKA 3TBFA 2ZU0C 3IFSA 3RK0A 1RPAA 3A25A 4NCNA 2B9VA 3IR7A 4M7PA 1WV1A 2I7XA 3TTSA 2OXRA 3IUQA 2PK3A 3OCJA 4MJ3A 4GKKB 1YA4A 3WR5A 2JARA 3CW2A 3DC2A 3DT6A 4LYHA 1OVMA 5EMKA 3RJZA 3MJDA 4EF4A 3PLRA 2XNCA 1MO6A 4JX8A 1KMHB 2HCJB 3H9CA 3NLLA 5ALDA 2AGVA 3BA6A 3F9RA 2AN9A 3PGVA 5JQWA 1C8BA 1O9BA 4QU8A 2H2WA 4KTTE 3HHPA 3NVAA 3ENNA 3KKQA 3VR2A 4A1FA 1NPTO 2JS7A 2IE8A 3D59A 4TX1A 1WW3A 3M89A 3ZCQA 1VPTA 1ZC4A 4GNKA 3SNHA 3GLGA 5JFTA 4G1EB 4QUGA 4HTAA 4MR9A 2WTEA 3WL6A 5J47A 2HBRA 4DGSA 4GXQA 1OXTA 4A8PA 1PJ4A 1E2QA 1VE6A 2X19A 3JQ8B 3U62A 1AXGA 3O92A 3WK4A 4B71A 3B5EA 3WGUA 4CLHA 2YRFA 3A2NA 1YACA 2B25A 5LLTA 1V8BA 5FWDA 5F64A 4YRIA 5DI9A 3B3FA 3IAAA 4ZQIA 1N4AA 4NC9A 3SGLA 2PSDA 4R0NA 4U7TB 1L4KA 2ZUUA 4QAQA 5G53C 2ECKA 3RRYA 1R9NA 4EJMA 2D6FA 2P69A 4MV7A 3I52A 4JEHA 4ALKA 4B6PA 4NBLA 1Y6ZA 1O94C 5KJCA 1UJCA 4AZTA 1QYCA 2Q5CA 1ZJ5A 2WG1A 3EFHA 2GXQA 3UMSA 2BH2A 4P3YA 1R4MB 3SYNA 2R6DA 1D2EA 1DDGA 1Z7BA 3B7GA 1E5TA 3GRZA 3HP1A 3DBOB 3HP7A 5DFAA 1RZUA 5EKUA 4OHYA 4UU1A 1GAEO 2XQGA 1SUBA 3MEQA 2V6JA 3CGWA 3NX4A 3NBFA 3OFSA 1KZ1A 4PZUA 3BE5A 3W6OA 4DNOA 5A4AA 2FSGA 1MB9A 3VKWA 2ZB8A 3HZHA 4YMUA 2Q07A 2PL1A 3TCXB 5JQGA 1KK1A 3K8QA 5E3HA 4D41A 4Q66C 2VBGA 3A2KA 4OCZA 3BXGA 3GAFA 4QJIA 3WGZA 4JBLA 3CW9A 3RRBA 4YIHA 2BGIA 4Z7QB 2R5NA 3FKQA 5J59A 2M6RA 2ZREA 2H92A 3UAYA 4ZGGA 3COJA 3DE4X 1YBAA 1SB8A 2QUJA 3DZFA 4RCYA 1T24A 5EJ4A 2QR3A 5ALHA 1EFRD 1SIOA 2Q50A 4WLFA 2WM8A 2W0MA 2CB0A 4DFDA 5KX5F 2WYIA 4HN2A 3H86A 3PQ6A 1V5WA 1EWYA 3E8MA 2Y0BA 1WDKA 1CUCA 1JDJA 3IP7A 4ZHSA 3DYIA 3BM5A 3Q98A 4ER0A 3CLRC 4J90A 3LHDA 3OCZA 4IL5A 1IN8A 2X3FA 4O1HA 4X7BA 3JATB 1DV1A 4KQFA 1W7AA 2P4QA 1RZRD 2ZIXA 3PKIA 1KSJA 4GZLA 5JCOC 5LIPA 4ZVRA 1K7SN 5JDCC 3WNCA 3VYSB 2IZ1A 3MWEA 5CVDA 4BVEA 2BBOA 3A9CA 1MKYA 5IPFA 3DZCA 3TQFA 1JAHA 3VVBA 3WK8A 4XJTA 4X71A 3RVOA 3OD1A 4YIKA 3UWOA 3FZGA 1A5ZA 4GEGA 3PR2B 4L4RA 5SYNA 3WQQA 2QL5A 5CB6A 2I6UA 2JIBA 1I4EB 2C61A 3NGMA 2DECA 4FFNA 5BW6B 3WWZA 4DY4A 4MO9A 4ZZ0A 2ZRDA 1BDIA 4AYXA 4KYIB 1D2MA 3HO6A 5TR9A 2A5FA 3T7TA 1IZYA 1CUGA 3C5VA 3P0EA 4HRXA 4K46A 4D0RA 5CDSA 4YDQA 1Q0TA 4CTMA 3L4EA 3OX1A 3RFUA 1Q44A 4V0SA 1BYIA 4F5EA 3UXEA 3H42B 2XDYA 2IEGA 1JDUA 2FEWB 3D3WA 4BNHA 1AUQA 1F8FA 1Z6GA 2PH3A 2Q1YA 2D59A 3Q15C 3Q6IA 4K9MA 1SOWA 1FY2A 5LLSA 3VDNB 2PMCA 1FZQA 2C04A 1GP2A 2DCUA 1WPXA 2PKCA 1USKA 3I12A 1SVSA 1J2EA 3GK3A 4JVSB 3HGTA 3I04M 5DGDA 3ZHCA 2AS0A 3G0GA 4RA6B 3N8NA 3U7FB 4JT8A 5FTMA 1L7AA 1HZJA 4BCDA 4WKBA 5HOQA 2GN0A 3U7QB 4XRGA 3N05A 5AIAA 4E5SA 4EPVA 1PZGA 1M6NA 2HRRA 3I6IA 1XMQB 4R83A 5HZKA 5FLKA 1L4EA 2DBRA 2J5QA 3NALA 2YY6A 2LBPA 3H4VA 2ZB4A 2J5BA 5F76A 1YJXA 3LA8A 1P61B 4CM8B 5JZBA 3D81A 1G8MA 3KCQA 1P9OA 1SH7A 5HKAA 2PUEA 3PJRA 3IP8A 3IMFA 1AGPA 1YR9A 2BUCA 3DO6A 4PZCA 3HCNA 5LCXA 4F86A 1PJCA 5DCYA 5CDGA 2CDNA 3SP1A 1B3RA 2JGIA 3VO8A 1T1IA 2NLOA 2WHPA 3MXTA 3RSCA 1U02A 4H6VA 5KJEA 5DT2A 4L8GA 1EUCB 4UEOA 2VBIA 2WUFA 2X2OA 3F7OA 4Q5IA 5KDLA 5LB4A 3RFTA 1DC6A 3T5TA 3H4IA 3Q2IA 2OTCA 2I80A 2P78A 2Y99A 1UQTA 3MWJA 4LX8A 1NUTA 3KJXA 3MTQA 4WVFA 5P21A 3REFA 3ROFA 1YH3A 2BDTA 1TCUA 1HSOA 2Y6VA 4A6XA 4YRMA 1W36C 2HA7A 3ORHA 3KOUA 4KR0A 4BUZA 3HA2A 2CF6A 5FQNA 3C1TA 1HT2E 4FZRA 1BVUA 3D6FA 3W2TA 3SKYA 4K9NA 4IRXA 2VSNA 2YHSA 5EYPB 2QN8A 1XJ5A 2ZTHA 4B6OA 1U0HC 2ZG6A 3FPHA 3LXUX 1FFSA 3TSAA 4W9NA 3I72A 1IIRA 3ABIA 4CT0A 1V25A 3G9XA 2I6QA 4R1TA 5AJUA 2IH4A 2ZDQA 2C9OA 2REBA 4TS1A 3TD6A 4FR2A 2ZCVA 4JI2B 3BC1A 3QPUA 4MWGA 1DSSG 1U0SY 3EZYA 3JD4A 1ZONA 2OBMA 4PRZA 1F4LA 5G0UA 3R8CA 2RK3A 2VJDA 1NM5A 5T3YA 3TTWA 3PS9A 4NS1A 5CB0A 3Q8KA 2I22A 1ZUNA 2QR5A 1MRZA 4PYLA 3JQAD 4DZZA 2GF0A 3MRXA 1OB2A 2DFLA 1UDBA 2NZUG 3QE4A 4C2UA 2WFMA 5HKBA 1YF3A 5LQAA 4DQVA 2X77A 4I55F 5EFZA 2XT6A 5DWVA 3DLCA 1J70A 3IAM1 2XECA 3T1HB 2RBKA 1MAWA 2MINA 3CJRA 1HEIA 2G0AA 3W7BA 2B7CA 3RGGA 2UYGA 3OLQA 5H3CA 3OESA 2D5CA 4FTWA 3V33A 4G0VA 5ALQA 1AIPA 3H9UA 3ZXIA 1YS4A 4M1KA 4HJXA 3ETDA 4NYMR 2A33A 3UT6A 4NMMA 1TW2A 2QD1A 3JRWA 4CTNA 1QHGA 1S2GA 5HDQA 3NOXA 2GK6A 1NUPA 1GTRA 1CT9A 3O38A 5AK4A 4A4DA 2QP4A 2YMQA 4A8JC 1G3UA 5JYBA 4PYOA 4PQFA 5KO2A 4HB4A 5EA2A 2ZUTA 4BNNA 4ZREA 5D3ZA 4C0LA 3MC1A 3MA0A 2OQRA 2R8EA 1JAXA 2ZRNA 2XW6A 5CYOA 3HFRA 4OPMA 5CDUA 2AUNA 2OBNA 5JFGA 2XCQA 4GKJB 2WMOB 1Y3BE 4JENA 2AG8A 3EMVA 1Z29A 3FLMA 3JYQA 5KTMA 1UWVA 3NYQA 2YHUA 4Y6OA 5J4HA 1ESZA 1KZ6A 1OR8A 3I05A 3BHNA 5J1SB 4ZIRA 1Z3IX 4Z4GA 5A9SA 1JSLA 4P08A 4Q4AA 2A88A 2QJRA 2RHRA 4RFSA 4AMBA 4JLNA 5AHKA 4NZYA 1KC3A 3FSRA 1WX1A 3D5TA 1XLTA 2WNIA 3OT4A 4U2CA 2XTMA 3RG8A 4EHJA 5A9TA 3THYA 1BH6A 2Z43A 4MR8A 4XVRA 3BGVA 3BXFA 4YN3A 1D6NA 2JPDA 1OAOA 5K0FA 2WVGA 1NUHA 1W6UA 1XU9A 3LAWA 4F3NA 1YVPA 3HBNA 3HXPA 3SLKA 1TT5B 2K6GA 3E3MA 2Q3EA 4YJGB 3ROPA 1EUDB 1GPUA 2F59A 2I71A 2IEZA 4CF4A 3VU1A 5J5AA 2B92A 4YCAA 4RCZA 5F12A 1L5VA 5LZ8A 4UQLA 4DCPA 3ASYA 1X7XA 4U6NA 1W0KA 3OOYA 4TYQA 1NFRA 2XTJA 4RL4A 2NVWA 3L8HA 4RH3A 5IT5A 2ZS8A 1TXGA 5KCMA 2FWIA 3O5AA 3RQSA 2Q9BA 2OOKA 3KUDA 2FN4A 2QL9A 3IXLA 5LQDA 3ZNQA 3AH8A 3UC9A 3VR3D 5EKSA 3ZK7A 5JNWA 2I33A 4BV9A 4OXXA 5GIPE 2EW8A 1JWBB 3KOOA 5DX1A 3BFKA 4YRQA 1JECA 1KBQA 1VE5A 1ZVJA 2TRSB 2Q41A 1GQRA 1WZEA 3EPPA 3GRVA 4NFSA 9LDTA 3AFOA 1AXRA 2DVMA 4FFVA 3UHFA 4CR7A 1L8XA 1I36A 3EUFA 4ER5A 3DKIA 3P71T 3P52A 3CNHA 5B53A 4IIBA 3ZVRA 2PUAA 1XHLA 1V7PC 2V74B 2F4VB 1J0AA 1E79A 5T4FA 2CK3D 1XC7A 2XTNA 3D6NB 4Q3NA 3ZIDA 3RYIA 2C7OA 3PX2A 2W2MA 1H5QA 3ZWPA 3I23A 4QRHA 1T9GR 3GJ0A 5C3MA 1ZQ1A 4ZOBA 3CUTA 3KUCA 2AW5A 4LZLA 4FQ7A 3S2UA 1XDGA 1ZNYA 1IY2A 4LRQA 4YP9A 3SS9X 4X1OA 3PNSA 5E6RB 3O73A 2A0XA 2G4LA 2QVGA 2V0NA 4JUAA 4NYIR 3WLJA 4CKZA 4X5OA 5HM8A 3BGWA 2ACWA 5B3JA 3ZD9A 3BIFA 3JQGB 1NBEA 1KEEA 2D13A 1QHYA 3I9LA 2PBRA 4QO7A 3AJAA 3S68A 1RHKA 4JOSA 4K87A 2R84A 4URZR 4CTJA 4IS3A 1ZIYA 3NIWA 2G9UA 3P4YA 3HO1A 1W59A 4A8HA 2XCLA 1U9IC 3SQNA 2QUBA 1YCHA 1HPLA 2X5JO 2BSXA 3DEKA 3WRYA 4C20A 2ZAIA 3BTUA 3CF0A 3CCBA 4XDZA 5BNFA 5JALA 4KQXA 5JCJA 2ZJBA 1UKBA 2I7CA 1FBTA 4GNRA 1N34B 4Q03A 1RMQA 2H9IA 3ZGYA 3KSZO 1GNRA 4U2KA 4FBGA 2C2XA 3STVA 3S7TA 1BCSA 1DU4A 5MHTA 1BOOA 4EATA 2W6JD 3M1YA 4QE3A 5BP7A 5A3JA 2WWTA 1WCIA 1LRKA 5AVOA 1YJ5A 2O8FA 2PZEA 1SRQA 2VP9A 1OLXA 2NYVA 2WVAA 4HZIA 4I1IA 3WRVA 2GO7A 1QIGA 4QVKA 3RO7A 3WLOA 4BO4A 2OHIA 4EEZA 1PDWA 3GV0A 1R6BX 5ALWA 5IU6A 3BFPA 3U9SA 1K5HA 2N0SA 5AVKA 4ZMRA 2QW1A 3MXOA 1U9YA 2I8AA 2PUFA 1N32B 4I08A 2JIRA 3E1GA 1GILA 1XWIA 2IXEA 3GZJA 3ZI7A 2G6TA 2EX4A 1E99A 5EKDA 5E1DA 4OIFA 3AFGA 1VRCA 2GEJA 3FCEA 2PWAA 3L0PA 3IX7A 4EJSA 1UFOA 2PMWB 3GGOA 4B74A 2C2OA 4PQRA 4I0WB 3BMNB 5JSFA 4TOIA 2BP7B 1YNSA 2DWCA 1GPBA 1NW9B 2Z2XA 1SJ9A 1Q3HA 3LF2A 4GRIA 1XVAA 4NCIA 4W5WA 5EQTA 5ERYA 3VPHA 1XDDA 1CNFA 1JLLB 2BM1A 2J0QA 4Q9JA 3OCXA 3BD7A 4ZXFA 1P0PA 1VYHA 4NATA 5JYDA 2AG6A 1CY2A 1T2VA 2A1UA 2OD9A 3KQVA 5E6UA 5EZ6B 2FTKE 4D9HA 5A5VA 3FGNA 4LWZA 4O3FA 5K6RA 1BDHA 3NOQA 3TLYA 4LRYA 2UZAA 3ZBTA 1O9GA 4W5TA 2YWBA 3JQ9A 3L7KA 3QZUA 4FINA 3FFTA 1G4AE 2ZB2A 4Q05A 2EL9A 3IJPA 4TL8A 2COEA 3O4JA 4BUJA 4FU0A 5L95A 4KMRA 4OYHA 1K8RA 1MIHA 2BSAA 1KEPA 4X6LA 5B2ZA 1J1ZA 1JG2A 1T15A 4DHWA 1GD1O 1VHQA 1YL6A 4MP6A 4DQUA 3T3MB 1V1RB 1X8LA 4RY2A 3ICVA 2ACEA 2N1BA 4V0QA 5FORA 3RQIA 3GLHA 3UB3A 1JWLA 1EFVA 1MXHA 1RQGA 3E7PA 1SUFA 1WHTB 3ZHUA 1SVUA 2GJSA 3WXMA 1M1UA 4ZCQA 4UUPA 3E18A 4INOA 2R5WA 1JAZA 5IKEA 1KPIA 1JIUA 4E1BA 3LQ1A 3F9CA 3HEMA 1AG9A 4BOYA 5JRJA 3SVLA 4F3RA 1Z45A 2OKGA 4UDXX 3DHYA 4ES6A 2HWXA 4LE2A 1RJGA 2QRKA 2QRHA 4JLVA 3HZOA 2RK4A 3FPSA 4Y0NA 1LNQA 4JCOA 3QBTA 3F49S 4WJLA 2IYUA 5KREA 5GADl 3TR5A 1X13A 4A10A 2AFHE 2HBZA 4GUAA 3SYLA 1OYOA 5P8WA 1ODJA 5EMLA 1YULA 1FSFA 2AXPA 4MS4B 1H2EA 4AP6A 3R77A 5JOQA 1GJRA 4DA7A 2YZ2A 3BB4A 1GRVA 2QI9F 2WSLA 3ADCA 4MDFA 3UG7A 4PM4A 4A8TA 2ZWVA 4ETWA 1RWVA 4OFXA 1DQYA 2F67A 5FA6A 3CTMA 5CH3A 3UAZA 4ZJUA 4L6IA 3MCUA 4I8DA 4HWTA 4FYVA 4N40A 2O8EB 4ZWNA 4D0SA 2HJVA 4J94A 2CDAA 4HNAA 2ZYHA 1RJFA 3MG9A 2EFYA 2OAGA 1Z2NX 3OKPA 4XWAA 4C0BA 4D9MA 2QE7D 2HZBA 3WLIA 2HIHA 2XNHA 5KJFA 1PYDA 4HLCA 1QRAA 3OQVA 4FX2A 4L3WA 1H2XA 1NVVR 2H1VA 2OWDA 3KL2A 2XF8A 4RHCA 5BVGA 1CR4A 1Z6ZA 2JGMA 1II8A 3HFGA 2D3TA 4IQ0A 3EOAI 1MT0A 4RM3A 4HS9A 5AW0A 2XWPA 3GDHA 5CM8B 2NADA 3EF1A 5I7SA 1EM6A 2C5BA 5AVVA 2VDWB 5F1KA 3NHWA 4E13A 1LPSA 4U3JA 5BN1A 4KI7A 5HQ3B 4X62B 2CZQA 3AL3A 2E49A 3RFFA 3PXAA 1PG5A 4I4TA 3ZV4A 5LWHA 1SXIA 1VMKA 4OXYA 1Q7GA 2W43A 2XUJA 1VBKA 3CH5A 5I3CA 2CUTA 4LQ4A 5JBNA 4FGZA 3NUGA 1QIJA 3QVMA 2CJWB 2OV3A 2ZI6A 4HDSB 4LAFA 4B9EA 1XQ1A 3DCIA 4BFYA 3TE6A 1P2FA 1E2DA 1NG9A 1M7GA 2WAYA 1TVMA 4LSGA 4Z0HO 5DB4A 4MGHA 4JUDX 3T3NA 1CZOA 2PXAA 4ND2A 4UBMA 4B4DA 3MJSA 2PZGA 3MUOA 4TVOA 4BE9A 1WXGA 1T2NA 5GTDA 1PNQA 2IZ0A 1FMTA 3WTBA 2I7TA 1MTOA 2O0KA 3DAYA 4I1PA 2A67A 4HH4A 3UT0A 3NJ8A 1A5TA 3EEOA 1XR3A 3MINA 1YBVA 3AI7A 5K0ZA 4Z4IA 1V3UA 2W2NA 4HYQA 1J0XO 4JP1A 1Y9JA 1IFXA 4FYIA 5FULA 4CBVA 5JS7A 1CHDA 1DTSA 2LP4Y 3H9EO 1KSHA 1U5AA 5B55A 3ZE7A 4EEXA 2ZJ0A 3DFKA 1R4ZA 5AXCA 1GU7A 3K32A 4DCJA 3Q5DA 1Q11A 1T8YA 2WUEA 2HU7A 2ZPAA 3GU3A 2V45A 4BO8A 1YFKA 1RM3A 3EOZA 4HRYA 2VUTA 1V26A 3D8HA 3GFVA 3Q8MA 2WIDA 3B70A 4LISA 4JLSA 3ONEA 3HH8A 1AS0A 3LE8A 5FUQA 2VO1A 4FHGA 3BWCA 3DV0A 1OA1A 5KEIA 2UVQA 1DC5A 1QDEA 3H8VA 5TPWA 5K4GA 1CE8A 2AR7A 3MTGA 3Q3IA 4HDKB 1GVNB 2UDPA 1WEKA 2CLIB 1WR8A 2C4TA 1JALA 2R97A 1PJBA 3N39C 5LP6C 2K5UA 4Q3DA 3Q3CA 3T1VA 4X64B 4BFXA 3MHTA 5GGYA 3DD1A 1N5IA 1DCMA 4N5NA 1M0WA 2HMTA 5H59A 3O1LA 4DZRA 3ZJVA 1P7VA 3FX2A 3NI2A 1T0PA 2J9YB 2XRYA 3NTUA 4M0LA 1T1JA 2D2FA 3OJFA 3OAAD 3CNLA 4BNVA 4AI6A 5CB4F 2R2AA 1QH8B 1K27A 1M2OA 1VKJA 1A7JA 4W5OA 2VPYA 2IHNA 4RF4A 1WXIA 4IHKA 3QWIA 3W2HA 1SVNA 2FZCA 4MVJG 3EXEA 2XZTA 3P9RA 4MXDA 1Y9EA 1NF9A 1PWYE 4PXSA 3UATA 2UXDB 4O3MA 3I42A 4GPAA 1K06A 3K6JA 4UTVA 1HNWB 3QV2A 4ISCA 4OM8A 2H17A 1LD3A 1JLRA 1LPMA 1ZMBA 2IP4A 1EZZA 2EATA 2GTHA 2I4IA 1F5SA 2LIPA 4IS2A 1JSXA 1Z07A 2ECFA 3GI1A 3F5SA 3KZKA 1CZLA 1VIYA 1Z8HA 3BREA 3KDAA 1JHMA 1SKYE 1MJGA 5DCWA 2Q4OA 3Q9LA 3T3PB 2CMHA 4CUKA 4YH1A 3KG2A 4JROA 3AJDA 4TV8F 1F14A 3WBJA 5KC9A 2HJ9A 1PFKA 1N9ZA 4IILA 1PGJA 1F8UA 4KK3A 4HAYA 1XVTA 3QXCA 5E7MA 2CMFA 2WTXA 5ESXA 5BO5A 5TS3A 1GPMA 2IHKA 1ZFNA 4HTFB 4V1CB 1JUDA 3DF7A 4DNQA 1EGQA 1M8PA 2SNIE 3PNPA 4R3WA 1Z9BA 2GF9A 4RABA 4LC1A 5MN5A 3KKKA 1TGYA 3B60A 5F35A 4RANA 1W85B 2VJPA 3CZ5A 3AI3A 2R8YA 4HWKA 3U3DA 2I9KA 3LFTA 1JKFA 3RS7A 1L5WA 2EW2A 3LFUA 1XZCA 4N47A 2OBLA 4F96A 5KZMB 1Y6GA 4XQCA 1NN0A 1EINA 4IKEA 4P3PA 1I7DA 4P4SA 1CUJA 3RVSA 4BGDA 2LD4A 2P40A 3TK1A 1C7EA 1QC5A 2ZB7A 2PM8A 5F7ZA 1W5EA 1Y8AA 3UM9A 4TTVA 4V0MA 3GROA 3UMBA 1R5JA 4NJEA 4U6QA 4F5WA 2Q0HA 4YASA 4L4UA 1IXSB 3O91A 2CUKA 1F9AA 3PXXA 1HEYA 4E5KA 1WOYA 2AG0A 1DFHA 2OO3A 1G6Q1 1UK9A 1X7GA 5E2IA 4DDWA 2WNSA 1D0IA 2WYOA 1LFDB 3AEZA 1XMJA 2FA9A 3GZNB 4GGMX 3KVVA 4Z9BA 3L6UA 3SJUA 4B80A 4C4ZA 5K0BA 2BZSA 1ADYA 1U0EA 1XWWA 2ONZA 3N75A 3UV3A 1Z2DA 4OI4A 1IQPA 3D6HA 2AFHA 3I30X 4HOYA 1C7JA 4TT3A 4M60A 3D5QA 2ZYGA 3HDVA 1P7WA 1C2YA 2G5TA 1DC8A 2XQKA 3HJAA 4JLMA 4TMXA 2J3QA 4UAUA 2VOJA 1E3LA 1M0TA 4NE2A 4W6ZA 4FJ0A 2VRWA 1HTBA 4MH0R 4J75A 4MYDA 4BNDB 4FOLA 5K09A 4M49A 3NNNA 4YXWA 4JGBA 4WN9A 4EX6A 4MV1A 4CCYB 1K1EA 2JGNA 3QMVA 4ZOCA 3DT8A 3TJMA 4ACAA 4P92A 5LL6P 1PZMA 1H05A 2PLRA 3E7FA 2AB0A 1ZD2P 2VJNA 3QYPA 4BXOA 2Q62A 4BL5A 3RTDA 4ZYLA 2ZVDA 2MWMA 4GYJA 2QTLA 5LXTA 4QU0A 1WXXA 5JQGB 2E5FA 3AERA 3F46A 3DFUA 3ND7A 2I29A 1QKKA 1TM1E 2C3YA 2CCJA 2JGDB 1UOQA 5KVSA 1RAFA 3ADBA 7MHTA 3BH6A 2ORED 1RHJA 2RJ3A 5JD6A 2GPSA 4XDHA 2PUJA 3UQYS 1IATA 2ZZMA 3FHLA 1I2AA 2QL7A 3P0JA 5H68A 1KMMA 3TLGA 4B0PA 5U9CA 2NQ8A 3ZDDA 1YKGA 1NY5A 3OWXA 3DM9B 1LQ2A 2BFCA 2FSIA 4M3NA 1KY4A 4J03A 4R9UC 1CUFA 4IMRA 3L2OB 4OHVA 3EGWA 5IM5A 3P45A 2DUNA 3RDPA 3DDHA 4FDAA 1RRVA 2H4WA 4GYWA 2ORYA 4HLNA 4IQFA 5J9FA 5CCDA 3W9SA 3G5MA 1XQ9A 3IAXA 3QPCA 1K63A 1I0IA 1PZXA 1XIVA 2ZIXB 3I01M 2AK3A 4DLPA 2YCBA 4JHXA 3VUFA 1RJ9A 3ZWYA 3U3JA 2RHWA 2QQ5A 3L1VA 2RCNA 3LSTA 5DX8A 2POQX 3H9BA 3MJEA 2ZBDA 3CE6A 2B82A 4JVMA 1YRLA 2B4YA 4L4SA 2AVDA 2YFYA 2PJZA 1Z36A 4BVBA 1BXZA 3AXTA 5C46F 3NIGB 1RM4A 1D4FA 4EO4A 4TLCA 1CY1A 5F21A 3UMFA 2P1RA 3M2PA 4IVPA 3HADA 3MPOA 3DHVA 2OPBA 5IKXA 2CWDA 1N5JA 4IYJA 4PXAA 1E2IA 3MWYW 4OSPA 5KAPA 4YJHA 1V9CA 4UU0A 4ZCTA 5BV1A 3ZWWA 5AWFC 5JNSA 3UXYA 4F2HA 4A2QA 4H1WA 2C57A 5EE0A 3T3IA 4H7DA 1GKYA 2CLEB 4KH1A 2BE7A 2OUIA 3A26A 3LY8A 5FAXA 1YA6A 1BDMA 3DEZA 1E4YA 1XJWA 3I1YA 1NHGA 3GR6A 3NKLA 3C45A 4PEVA 2HFKA 5CX4A 5TX7A 1VA5A 3EUAA 1XMSA 1SFRA 3VGJA 2DQZA 3QA3E 3IDSA 1RYZA 1U2ZA 3GLFE 3TVTA 1NGSA 4KE8A 2WFZA 3JQ7A 4QUBA 4UMVA 4DSAA 1S1MA 3QE3A 4PGGA 5KCZA 4UTXA 1I4OA 1QX4A 3M0EA 1K6IA 1CQJA 2ZEJA 1L8AA 2BFFB 3O4IA 3RHTA 5GZ3A 4U2GA 3ELDA 4S1OA 1ILEA 3KJFA 3VH3A 1YDHA 1INLA 2FCRA 1QU3A 4JIGA 4TMKA 5EE9A 3DBLA 3I2GA 5EHGA 5FUBA 1ZQ9A 2PX5A 2DWPA 2J6BA 2WHYA 1WUHS 2VPPA 3SN6A 3F6YA 1AKVA 2XWJI 4WK6A 3VR1A 1LGYA 2EOAA 4CFYA 1FDVA 3RSZA 2WJ6A 1F9EA 1QX3A 4D57A 3LH5A 3AFMA 3LLVA 5AVXA 3OQBA 4X63A 1BQ4A 2QG9A 2HHLA 1W4LA 3VO1A 2WLSA 3OTOB 1RPTA 4HLQB 2WHPB 2P9EA 4TV9A 1ZH4A 4TTQA 2Q3JA 2X86A 5AK0A 1U8CB 4KP7A 5L4SA 1VECA 1Y4DE 1CUIA 1MRNA 3O6VA 3G2OA 5I4BA 5ITZA 3P2KA 4FHDA 5FOUA 2O54A 1T9BA 4ZP1A 1NXOA 3TI7A 3B1FA 2FRDA 3P0HA 1DO2A 3I37X 3I2FA 3R09A 5MGBA 2I3DA 4EK9A 5MN6A 3L9XA 5DI3A 1Z88A 2ZYAA 4R1QA 3JQFC 5CXXA 1V9SA 4U8HA 4XUCA 4AO6A 1TA4A 4DMUB 5FCDA 3FVVA 4AIRA 4U6SA 1VP3A 2VJKA 4NNOA 4UHJA 1H66A 2QG4A 4HPXB 1N8SA 4MYTA 4OMDA 5T5QA 4CTOA 1YJQA 5C1OA 3YASA 1H0KA 1IRIA 1WP9A 3C85A 2C0CA 2ONYA 5EGSA 5FL7D 5DISB 1RACA 4CUJA 1OI2A 4UUAA 2PJDA 1EFRA 4ZA2A 5JC1A 1QRDA 2XA9A 1UCFA 2WK1A 2I5PO 3SFZA 1QH9A 1SD5A 3R0JA 1F8YA 1HE3A 2JKVA 1ZUNB 2XDQB 4MW2A 4YHBA 5SZJA 4B7CA 3TOSA 2JAOA 1Z0JA 2B34A 4WY8A 1FQOA 1M1NA 4JXXA 1TE2A 4RTRA 2QU7A 3MS4A 3SVZA 4QFDA 1VKHA 4EGAA 1ZINA 1WUKS 4JYCA 2GWRA 1SC3A 4RF2A 5EIFA 1V7ZA 4ZT2A 4G0MA 3GLIB 2QA5A 1LU9A 3GGCA 3ICCA 4WKOA 3GX1A 3ER8A 5DCUA 2J9GA 4BO7A 1C3LA 5SYAA 1RZRA 1F17A 3TM4A 4ZK2A 2EF1A 2R3SA 4ND7A 3WI7A 4E2YA 2IW1A 4L50A 2IXGA 1DJLA 4QDJA 3RB8A 4IIGA 4W9MC 3WIVA 2NTYC 2PRYA 4Y7DA 4KHPB 1QVZA 1FPMA 1H1LA 3R3HA 3W5JA 2GBFA 1JJVA 1CD5A 4P80A 1QIHA 1XZKA 5K20A 4B43A 3A7EA 1DDIA 3ANYB 2YY7A 3ZD6A 4DRXA 3GPLA 1HKUA 1DG9A 3KHKA 2AUMA 2Q5QA 4LYFA 4HQ0A 3ZI4A 4HAUA 1J24A 2H63A 4FOOA 4J2TA 2R4UA 3W2FA 4AJ2A 4WOPA 1OWNA 4UNSA 3HYCA 1AN9A 5ALLA 4IMJB 3SZOA 3R6LA 3KVYA 3TPZA 3GFQA 1BFKA 1WKBA 4FJ1A 2EKZA 5ADHA 5M2QA 2OM6A 1E2GA 2ATEA 1UH5A 2NGRA 3A04A 3D2BA 4Y1EA 1HI9A 2JJQA 4YJ2F 4Q01A 5IAEA 3NASA 1UF9A 4PN7A 3NUQA 3DVSX 2VA9A 1KRWA 2W2XA 2YDXA 4KBFA 2IYOA 1TFUA 2A30A 3NIFB 4IVNA 4ZIRB 1QYIA 4Q4AB 3V7WA 1BJRE 2BI7A 2FPMA 4KW7A 4B3TB 1T5IA 3EQ8A 1QLWA 2VT7A 4BFLA 4DHEA 3SDZA 2VK4A 1CYEA 2CFIA 3UW1A 4WA8A 2H4YA 1G5QA 1NL3A 4NF2A 1Z82A 4N9WA 4NBUA 5EZ5A 3WWDA 1N2EA 1ZO8A 3VZRA 1DJNA 4H7KA 2IIQA 1Q1GA 3MTJA 4MR8B 4BO1A 4K8OA 4JFAA 4F4DA 1P5RA 4GUDA 1A7UA 2WUVA 4C7VA 4D8WA 5E0OA 3KIPA 1NQUA 4EH1A 4YUVA 3QWFA 3GT3A 3O8BA 3TQSA 4YCMA 3RWOA 4RGVA 3E9QA 4O2AF 4UTOA 2O3RA 3VU0A 1DRUA 3IV7A 3PL5A 4QYSA 2QOEA 1WBBA 2DUWA 2W98A 2G5GX 1NBWB 1SOUA 1X7XB 1IN1A 2O2CA 1ESEA 4HPWA 1ZAKA 3SK0A 4ZRDA 1SZCA 1YQQA 4DLWA 2BTEA 5EWLA 2EYUA 3PEEA 4P4NA 3A4YA 3L7DA 2NX2A 3HWX1 2P27A 4EZBA 4I50F 1JA0A 3Q3EA 1I01A 3A28A 2HMYB 1ZKDA 3IAHA 4H0FA 2CLLB 2GETA 2ZSJA 5G2OA 3KAJA 2VTBA 2IZ6A 4DADA 2KHZA 2R1VB 1MQ9A 1P4SA 4QBFA 3TOXA 1CEYA 1JU9A 3LUPA 1PFUA 1V5EA 2C2GA 4DCSA 4DSZA 1G5PA 1ZN9A 2Z8ZA 4FUTA 4IMPA 4C1BA 2C54A 3TNFA 1LTKA 5A1TA 2Y77A 3T0GA 4FC7A 1NNLA 4NBKA 1BA3A 5IH3A 3WMFA 3MD0A 1OBFO 2FW8A 4OHXA 2GCOA 4D9EA 2C3UA 3CF2A 3I9FA 3OM0A 4ZZIA 4BNJA 3CTPA 1VKRA 2VYFA 1DHTA 4PO9A 3FF1A 4UD6A 4C07A 3EVNA 2RB4A 4R2IA 4IUBS 4LYYA 4B75A 4M98A 1KNQA 5FHRA 1T6BY 4MA5A 3AKYA 4ECEA 3B9QA 2JHCA 4TV8B 1FXUA 3P20A 3PXCX 4QASA 1GQYA 2Z83A 1YZ3A 1ZK1A 1RWBA 2ZUWA 3ISJA 4BMCA 3U19A 2QMZA 5KSWB 1D6JA 4FSDA 4GQBA 3TRIA 1ZBQA 3JQAA 1X15A 2ZTSA 5CIYA 2AMVA 4Q1BA 1YR8A 5EE1A 4ZANA 1YDFA 1KEEB 2GAAA 2WU1A 1Q57A 1RIIA 1ZN8A 4EFDA 3K0AA 4B1FA 3HSKA 4HS4A 1WLYA 4P9NA 4XH9B 4ZVTA 3UB4A 5JV5A 1A88A 3DHNA 4L6CA 2WAAA 1Q1NA 4AQDA 4JLAA 3H4MA 4NYJQ 4B4KA 3L8GA 2LTAA 4IO0A 1VJDA 2WJ4A 4P4UA 2WZDA 3QWBA 3LVBA 4OB7A 4ZOAA 1TO1E 2PX4A 4OA8A 1LB1B 1RAAA 3MWKA 4JSYA 5TNXA 4ZHQF 3ZY4A 1U2GA 1UKVY 4NCAA 4RKQA 1B0AA 2Z08A 3FDZA 5AQ1A 4EENA 4TKLA 1SPBS 4BQOA 5C7YA 1OW3B 4OMCA 2X9VA 1WQ3A 1BCSB 2Q5LA 4KYTA 1ZESA 2Q9UA 1MA3A 1S8FA 3BEDA 4FFOA 1HTTA 1T91A 2O2YA 2PUVA 4H59A 4JLUA 4B6FA 4ZYVA 2AV6A 1TQ4A 4HFJA 2XUZA 2HGZA 3TD2A 5KQSA 1QB7A 1RYBA 3IUSA 4LRSB 1KVUA 5IAGA 2F3PA 4BP1A 2O8FB 3LUFA 1B2LA 2XUDA 4UNRA 2EZ8A 2VWQA 5LU8A 4JJZA 5KMGB 3EN0A 3H7AA 3V1LA 1GTG1 5I9LA 1BYUA 2XT0A 3DUWA 1B4DA 1FVFA 3K7EA 4QULA 2A59A 2FK7A 5AJHA 5ES3A 1PN3A 3RTGA 3VU9A 1OIXA 2JLSA 4ZAYA 3SF0A 4RVGA 4L75A 1Z0AA 1E5VA 3KD2A 5KHOC 4P5EA 1G8KA 1ZM4A 2NW6A 4QD3A 2P8JA 3I9KA 2V6GA 3JWPA 4F4IA 4I5GA 3DZBA 2EBFX 3DAPA 4CEIB 3V8EA 4PBTA 4RGYA 4EJSB 1Z08A 1ZKMA 3KR0A 3ICQB 1HWYA 1EHIA 3ZW7A 3ETHA 4YACA 2VTEA 3HY4A 2YYSA 3K0CA 2A9OA 3C3CA 4GQAA 4NHOA 4Z2YA 3VSAA 5BUQA 5FTLA 3DUFA 1XUOA 3MYYA 4C7JA 1MLDA 1GQOA 2LR0A 4B5KA 4IH9A 2AEFA 4FN4A 3ZJYA 1Z25A 1SEVA 2FWPA 5THXA 2LUOA 1DTEA 2A1UB 3E05A 1FNNA 1M83A 4ZAFA 2IBSA 4MTCA 2FZEA 3AF5A 2FU5C 1PJTA 4H7HA 4RPHA 2PH7A 5IKOA 1MIOB 1ESDA 4GOKA 1K5PA 1PJZA 1M2WA 1ZUD1 4JL5A 4DB4A 4YYZA 3WE7A 4BRZA 1S4QA 1TYZA 2VF4X 4UBNA 4XYLA 1DBWA 4PO3X 2IYZA 1ODTC 3R9WA 4C88A 1KL7A 1S1CA 1XCPA 2QXUA 4G5XA 1GUZA 3AEYA 3ZGLA 4X66B 1WOMA 1N2CE 2G5PA 3IODA 3OJCA 4JVLA 4RVOA 5CB8A 1AA6A 4H0CA 2ZE7A 4ETIA 4BQPA 1GGEA 1HFJA 4J49A 1ISIA 1T5LA 2AR0A 3F9IA 2GBCA 4INJA 4EVRA 5BUZA 2VUHB 3PIRA 3VXKA 1OD6A 5F98A 1J22A 3UUFA 3PZBA 2CK3A 1SXHA 3JZIA 1M5UA 3OQJA 3IP9A 1ZUWA 4CLRA 2NXWA 3X2SA 5JDIC 1EWVA 3N2IA 4X1IA 5FPHA 2Q21A 1P1IA 1KEVA 1L7RA 4H4DA 2Z8YM 2NOAA 5AUQA 1ZK3A 1N6NA 1CF4A 1ZVKA 2VK8A 3PPYA 1JEYB 3QSYA 3EGVA 3BIWA 3K9FC 2C92A 3NM5A 1A1SA 4Q47A 1ZJWA 3NQ41 1PVVA 1UPCA 2OCXA 4NU6A 2Z95A 3BOSA 4AS2A 1XZJA 2GYWA 1G7RA 2A1IA 3WWOA 3WWEA 1MGPA 2QLMA 1UXKA 4KACA 3T9BA 1X39A 2C2YA 5FBLB 3W5BA 1BMTA 3M3HA 4KE7A 1UDAA 1SY7A 3BIXA 3K0BA 3PEUA 3TZKA 1CYDA 1CKEA 1E64A 1NXSA 2BFDA 2WWFA 2ZWPA 3WGMA 2BFPA 1YO6A 4CM3A 4L78A 4UPEA 3VNUA 1NQOA 2C8JA 4IIEA 4D0LB 2UXBB 1QIEA 4HNAB 2DQSA 4WKNA 5C2JB 3RBXA 2Q7OE 3ORYA 1FRQA 3LRTA 2IBMA 3JD3A 4LDQA 3EXHA 4BFSA 1BKSB 1KZ4A 2IQ5A 1MX1A 4RMHA 4DIUA 5GJBA 4W8GA 2D74A 1QS0B 1GQFA 4HAOA 1II8B 1NYTA 2O3TA 2YIVX 3K20A 1NI3A 3KKNA 4NJMA 5EIWA 5EJFA 3RLIA 3WYFA 1C50A 4GRDA 2ORVA 1HURA 1I3OA 1C29B 1WQ1R 2W6JA 2M32A 1UP4A 2WD9A 1EX1A 3HDTA 3I64A 4NDNE 3RFCA 4U3JB 5CA0A 4KIWA 3REQB 3UGTA 4FGLA 1U1CA 4I4IA 1YJAA 4I4TB 5I7HA 2RGUA 1LCIA 4Q3KA 4B9AA 4Y1FA 1FXWF 3I5AA 4GZ6A 4IJQA 3ETJA 5IEJA 5KNDD 1Y3DE 2W6MA 3LECA 3KM0A 4F9TA 5IVKA 3PICA 1YZFA 1W73A 1WSBA 1AQUA 1U3WA 4JXZA 4TL7A 5FNVF 2YOFA 1Z0KA 4IJKA 3RUAA 5JQGF 4L02A 4DMKA 1BHSA 1MORA 2EP5A 3EVCA 3IA7A 3LHSA 2QNRA 3QBVA 3QP9A 1E20A 1EIZA 5JNRA 4GW3A 2YWFA 4K9DA 3HLYA 1W93A 5LNK6 2GNPA 4G5FA 5DTIA 1VLLA 2NIPA 1GGNA 5CPBA 1WZNA 1PNTA 2VXYA 3TF5A 5JCXA 3IS3A 3H2GA 4ZAZA 2QW0X 3I6BA 3RJTA 1YU6A 4FE3A 4M0FA