3JQAA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-1,9-dihydro-6h-purine-6-thione (dx4)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
total genus 95
structure length 249
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqaA00
3S2GA 3BTSA 2VOJA 4O0LA 1F8GA 2JHGA 2C59A 4R16A 4I5FA 4ZJUA 4A10A 2Y0CA 4HX5A 4M8SA 1JAYA 4CLHA 5JS6A 1NFFA 2YJZA 3S8MA 1PL8A 1XSEA 4MO2A 4TZTA 1WLYA 2DUWA 3B1JA 3VPFA 1EUDA 3WDSA 4DC0A 5LDGA 3GMDA 3L4SO 3C8MA 1ENPA 4WNIA 5GZ6A 1P1FA 3QVWA 5JE8A 3KEOA 3DZIA 2QIOA 4NHEA 5KIAA 1IB6A 5I9LA 1IYZA 2P4HX 3PHJA 3E03A 1PWXA 2DFDA 1VJ0A 4BNWA 4GI2A 1J6UA 4DC1A 2Y66A 4WNCA 4PLWA 1B26A 1E7SA 1GZ6A 3IC5A 2PD6A 3PEFA 2FMUA 1NX6A 4RDIA 2VRCD 4B4WA 4CLOB 5B12A 4B7XA 2HCTA 2P68A 3OF2A 1Y9EA 4CV2A 3X2FA 5DBIA 3ASUA 4R1NA 4NJMA 1OFGA 4JP2A 4Y6SA 4D3SA 4S3MA 3I6IA 3RFTA 4DBVO 2PY6A 1EUCA 1QKIA 2ZTMA 4K6CA 1XA0A 2VYNA 2VZ0A 3JQ7B 4DMMA 2NTNA 4OSPA 4CLDA 3CINA 5IG2A 1F17A 3TZCA 3EHEA 3N7UA 2YY7A 1WDKA 3HFSA 1LRLA 3PDUA 1LI4A 4BO8A 3KYDB 1VL6A 1YQGA 1CEQA 2DBVO 3QWFA 4J4HA 3V2HA 5C7IO 2JKVA 4RVHA 4GL4A 1NPDA 4E2XA 2IYOA 4BHTA 1ZUD1 5I7EA 5L4NA 1K2WA 1NHGA 1HDZA 1DDOA 4H7PA 3F4BA 3SJUA 2AA3A 4LSWA 2QHXA 4YA6A 3FNHA 3JV7A 3C3XA 2IEBA 4FCCA 2AG5A 2IZ1A 1B2LA 3I6QA 4FJ1A 1A7KA 2OORA 5T8KA 3ICPA 4JXKA 3KETA 1OAAA 3Q9NA 3GG2A 2FR0A 2FPGA 3ST7A 3PP8A 1XQ1A 1YQXA 4NMHA 1C14A 2UUOA 4CR6A 2R2GA 5JSFA 1WPQA 2A94A 1J0XO 1E7WA 4MKRA 1IPEA 3OA0A 4F3YA 3L77A 3I83A 3E9QA 2E6UX 4Q3EA 4CQMD 3T7CA 1LC0A 3ZWBA 2WD7A 3VPSA 5DZSA 4QSMA 1UAYA 1HKUA 4QECA 3F5SA 4PGFA 4BV8A 4BQPA 3D4OA 1W0CA 3JSAA 2J3IA 1E1MA 2EKQA 4CR8A 3IIEA 4BNUA 3KLMX 2ZQZA 1Z82A 3HJAA 2WYWA 4M87A 5JAMA 5KTKA 2QW8A 3JD2A 2OO5A 2WEKA 3QRWA 4KMSA 4XJTA 2G1UA 1LRJA 4D45A 5EQDA 4TKMA 1OBFO 1D3AA 1XU9A 1MC4A 4CLRA 2QZZA 1EQ2A 1PGPA 3QSGA 4EI2A 1JAXA 1I8TA 2I3AA 1EVZA 2HQ1A 2X6TA 3H2ZA 5G4KA 2I6TA 1NFRA 4MP3A 4B4UA 3EGOA 1BXKA 4XGIA 3GGGA 3IS3A 5KVSA 2BFOA 2VYVD 4K6FA 3QQPA 1ZIDA 2CFCA 5DOVA 3WMWA 4YQYA 1H2HA 1R4NA 1B15A 3KV3O 5KJEA 2HO5A 3GHHA 1BXZA 1JQBA 1WNTA 1LDGA 5A5EA 4L74A 3G0OA 4DQVA 1O94A 5JDCC 1YRLA 3EK2A 4W7IA 1PEDA 3ZN2A 4N5NA 3I5MA 3JQGB 2RIRA 2DAPA 2VHXA 2AQIA 5COQA 3OJLA 2P9GA 2EGHA 3LVFO 2IZ0A 3PHGA 5T5QA 5TJ9A 2SCUA 4MVJA 4D7AA 3GZ4A 4XYGA 4YRAA 2X0RA 3FPCA 1KC3A 4BB5A 1ZK1A 3QY9A 4NPCA 3SEFA 4UVIA 1J49A 5JCJD 4EGFA 4CMIA 5ADHA 4W9NA 1SOVA 4CMGA 3AJRA 4DL9A 1GR0A 4DPLA 4FR5A 4AJNA 3G17A 4I5DA 2GGSA 1P1HA 5TJHA 3DMTA 3M1LA 1GQ2A 4BNFA 4W7HA 5B37A 2D5CA 4IDEA 4BNYA 1V9LA 1G1AA 2EIHA 1GUFA 2GR9A 1R6DA 1UZLA 2PZKA 1LQUA 2X7HA 3IOYA 3LF1A 1ULUA 4UUPA 4BO4A 2NQ8A 3MJCA 3H4VA 4MKZA 1U8FO 4ID9A 4XYEA 6ADHA 1T4DA 1D4FA 4N7RA 3T4XA 5THKA 2JHFA 2I99A 3ADOA 4UULA 3HDJA 1CWUA 3PPIA 4BNVA 5HRUA 1T2CA 2O3SA 4I5EA 4FFNA 5TNXA 5JYDA 1AN9A 2C2YA 2X5OA 2EF1A 1X13A 3NJ8A 5TGDA 4B79A 4CJXA 2O7SA 1X14A 3H9GA 4CUKA 3JYPA 1P44A 3CKYA 2WD8A 4J0FA 4ZN6A 1ISFA 4MVJM 2J3HA 2O3UA 3CMCO 3DBRA 2E37A 3HN2A 2D1YA 1ENOA 4GVXA 3ZI0A 4Y98A 4IMPA 3H65A 3PK0A 1DAOA 1V35A 1IOLA 1E92A 3ULKA 2Y0EA 1GYQA 3WGYA 1HYEA 4XIYA 4UVDA 3A28A 4PFJA 4RPLA 3D5QA 4UAGA 4NJMB 3RBZA 1NVMB 4ALIA 3U4IA 3I9JA 4MVJF 2WTBA 4Q3CA 1Z74A 2WJPA 2D5AA 3P2OA 4R01A 2XOXA 4ALKA 3FNGA 1WVGA 3ONDA 3DFZA 4FJ0A 3DBLA 4MIOA 5COBA 4BUCA 1YOVB 4XQGA 3DHEA 4NBTA 5EERA 1I33A 3DOJA 2X9NA 1SMKA 3LSYA 3UGKA 4E12A 2P5UA 4MP6A 4L76A 1CQJA 4J3FA 4EDFA 3OETA 4N5LA 4XCVA 2EW2A 2NVBA 1AE1A 1Y5MA 4KZPA 3ROKA 5A5FA 2D4AA 1LTHR 1PWZA 1O9BA 4R9RA 4RO0A 1C0LA 5A9TA 4NBRA 3HSKA 2ZATA 4CLXA 3PJDA 5BSHA 1HLDA 3OJ0A 3GDFA 4RF2A 3SX2A 2OZPA 5FWNA 2O2SA 2QYSA 3DZFA 3F1LA 4CMBA 4U0KA 4EBFA 1ADBA 5IDXA 5JC1A 2GO1A 3NT5A 3DONA 4J7XA 1O95A 2W2KA 5KNLA 1KVQA 2Q1UA 1B0AA 3E9NA 3D3WA 3KRTA 3WNVA 1KVSA 4GAEA 4XRGA 2AEJA 1PS0A 3JTMA 2Q3EA 1A4UA 1CDOA 2B5VA 4Q3NA 1HF3A 2NVUA 5FYDA 1DC3A 4RCVA 2PK3A 4BNNA 3K2EA 2X4GA 1A4IA 3SC4A 2CVZA 1VLLA 5AXBA 4O63O 1BRMA 3MZ0A 4MOWA 2YUTA 1TB4A 1JKJA 4DIBA 1PJ3A 4NG5A 1IULA 1MLDA 3VTZA 4FGSA 4BNXA 3A14A 2HRZA 1ZNQO 2Q1WA 4BMSA 3PWZA 1C3VA 2ZTLA 2VRBA 3LT2A 4PLTA 3O8QB 4OHUA 4PZDA 4LISA 4CMIB 2YHUA 2RHRA 2AQ8A 1Z45A 3KTDA 3U4CA 5G4KB 2RCYA 3OP4A 5F21A 3U4HA 1U5CA 3GFBA 1LC3A 2I9PA 3BMQB 4OKNA 3QIVA 3GNSA 5BNTA 4NIMA 1KOLA 4HKTA 5EN4A 4WGGA 1YJQA 3JD4A 3QWBA 2YV3A 1ZK3A 5CPBA 3ZNPA 2V65A 3F9IA 1UDAA 4M54A 1HZJA 4HADA 2O3QA 3HDHA 3JQ8B 3KUXA 5K0ZA 1PX0A 4JK3A 4HFMA 2VUTA 3BMNB 1WZIA 4Z3KA 1C1DA 4IDFA 5IDQA 3R3JA 1Q7CA 4BO0A 4OL9A 3QLJA 5BSGA 3RUAA 3SVTA 2BGMA 1E3WA 3GZNB 4XA8A 3Q9UA 3BTUA 5KKAA 4E30A 1HDOA 4FGWA 3AWDA 1PQWA 2DPGA 2UV8A 3GA0A 1U4SA 1UR5A 4R68A 4RF4A 3T7EA 1BWSA 5JDIA 3IKVA 2GERA 4IXTA 1B8VA 1IZ9A 5G2OA 8LDHA 1PZFA 3MTGA 2EGGA 2ET6A 3C85A 4I9UA 3I9KA 1BXGA 5IN5A 3OIGA 3W4JA 4D46A 3BA1A 4BNIA 3IP1A 3VVBA 1PSDA 1I10A 1SO8A 1KC1A 3LU1A 4FD3A 2XXBA 3H9JA 3RQSA 3UF0A 5IAAA 2DUUA 3EY4A 4BO5A 2VNSA 3AUUA 3V5NA 5DP2A 2IEDA 1W8DA 2JL1A 1XKQA 2VWQA 2CD9A 1EVJA 3GN2A 4Z0TA 3Q3CA 1VE9A 1EVYA 3INTA 4WPGA 2PGJA 5AYVA 1NASA 2JD0A 1TVEA 1W73A 5CEJA 3C1AA 3OA2A 4OOEA 3WX0A 5LC1A 3BMOA 4LMRA 1MB4A 3DWFA 3GAFA 4KUGA 2YDXA 4O6VA 4FSHA 3RWBA 4HNGA 3GH3A 1PQPA 4OQZA 1LSJA 3WGQA 3OFSA 1GYRA 4UREA 2HU2A 4LW8A 3JQ9C 1GTMA 3LLSA 4FFRA 4AJ2A 3K2BA 2C2XA 3BTOA 1W4ZA 3KB6A 4FIZA 2AEMA 2VWGA 2XXJA 3ASVA 4HBGA 3GVXA 5GMOA 4RF5A 3NTRA 4GX5A 1HYGA 3KSDO 1G0OA 3UVEA 1ENZA 1IHXA 1HWYA 1OC4A 2PD4A 1ISHA 3DBLB 3VOSA 3OJOA 2VZ8A 4DA9A 4TRJA 2JCXA 4PRKA 2DQ4A 5HTOA 1DLJA 2OL4A 2PD3A 1SEPA 5DP1A 1OOEA 3DFUA 3K92A 4EZBA 4L8VA 1GY8A 2ZB4A 4TRMA 2HMSA 1TEHA 2FP4A 4YXFA 1GD1O 4JLWA 4AJ1A 1MFZA 4RVUA 1HDRA 2CUKA 4OSOA 4CM5A 5JCXA 3KEQA 2QG4A 3PFFA 5T57A 2AW5A 4CMEA 3D64A 1WMBA 2ZCUA 3WWZA 3I4FA 3JQAD 5GZ3A 2ZB8A 4IQ8A 3KO8A 3JQGA 5KWEA 3GQVA 3HQ4O 4NJOA 2B0JA 5IDYA 1BDBA 3O38A 4B3JA 2IDZA 2X58A 3L6OO 4ZVVA 1ZJZA 4B8ZA 4PLPA 5J23A 5KJ6A 4YDRA 3FPLA 1P3DA 3JQAB 3TOZA 5KVCA 3G49A 1T2FA 1Z6ZA 4FFLA 4K9DA 9LDBA 3ZWYA 3TN7A 4ALNA 2ZK7A 4BQRA 3ONEA 1QYVA 1Y81A 1D8AA 1DAPA 1QYCA 1I36A 3VH3A 4E2YA 3H9UA 3DHYA 1QYXA 2DBZA 1JKIA 2JFFA 2LDBA 3EUWA 3F4LA 4RVDA 4F6LA 3M1AA 4ZU3A 1P31A 3O03A 1Y9AA 4YJHB 4HWKA 4FFPA 4BL5A 4BNZA 2BMAA 1JA9A 1EQUA 2VRCA 1LDYA 3PRJA 4F46A 1LRKA 3NDIA 4E4YA 1YKFA 5ILGA 5TLSA 4ND4A 5LCXA 6LDHA 1NQAO 1EK6A 1MA0A 2YYYA 4QT0A 1X7DA 4XYLA 4PG7A 1KVTA 4LVCA 3JQDA 2EKLA 2VYND 3NX4A 3U62A 3CE6A 5K6AC 1Z7BA 1HDYA 1ZZEA 4A5OA 5A03A 3VPHA 1NQTA 3NT4A 1PL6A 2NU6A 1EDZA 2QRLA 1UUFA 3E5RA 3OM9A 1NNUA 2FN7A 2WSBA 4KQWA 4NK4A 3UH1A 2G17A 3HDQA 3S1LA 2CVQA 3GEGA 4WCFC 3U3XA 2YFHA 1QORA 3UFXA 1WMAA 3H3JA 4P4GA 4FPXA 4MVJD 1GUYA 3C1OA 3PGXA 4FS3A 2FRDA 1H9AA 2NTVA 3JQ9A 4JBGA 1D1TA 4BNKA 3QE3A 2PZJA 2AQHA 4MKXA 5IXYA 3I9NA 5L4SA 1PR9A 1YDWA 5JYEA 4Y6PA 2PH5A 3CZMA 4ZRMA 1X0XA 2OBNA 2VUUA 3HWRA 1I2ZA 4QX6A 3ENKA 3GNTA 3MCVA 1I3LA 5CEFA 4IZHA 4YYZA 2OP1A 4OXNA 2HMTA 2JAHA 3ETGA 3VPXA 2O2YA 1MP0A 1JU9A 4IGFA 5G0UA 2C07A 2HUNA 5L7TA 4OH1A 5ENDA 4ZD6A 1ID1A 1XCBA 4GPD1 2UVDA 4NI5A 1PJTA 1OZAA 2AQKA 4YEDA 4MVJG 3UCEA 4E6PA 1KEWA 1DHTA 4CM1A 4CM4A 2YFQA 2A92A 4XQ9A 1ZKMA 4XGKA 2CDCA 3NEPX 4XQEA 5ICMA 1NFQA 4YJGA 4RPJA 3LT0A 3SXPA 3WSVA 3KZVA 4P4NA 2WMDA 4YJDA 3WS7A 1MXHA 4NH4A 3ZHZA 3PJEA 4PG4A 1H6BA 1WDLA 3BMOB 4DMLA 3PJFA 4QO7A 2NU9A 4XDZA 4M86A 1I30A 4Q3BA 2YV2A 3VDRA 1Z75A 3A4VA 4U0JA 3RBXA 2AG8A 2I67A 3AFNA 3CH6A 3OJEA 4MDHA 2E4AA 2GSDA 4DREA 3DAFA 4DVJA 3FTNA 3CTMA 3UHAA 3VH1A 3U9LA 5KJ1A 2O7QA 4E31A 1M66A 2D2IA 4YT2A 4KP7A 3DOCA 4GWGA 2ZTUA 3OIDA 5DCUA 4QFDA 3PHHA 1FDTA 2I66A 1XWFA 4BV9A 4DYVA 3BYZA 3RUHA 4P38A 1LX6A 1D1SA 3RUFA 4BIIA 1YH3A 1N7HA 2UDPA 4TKLA 4UUNA 2VQ3A 4CL8A 1ZSVA 3OJFA 3ORFA 4YJFB 1C0KA 2QQ5A 4TVBA 4ZRNA 1LSOA 3PYMA 2A4KA 1GZ3A 2B37A 2GDZA 2CVOA 3FWZA 2AE1A 3JQCA 3I9MA 3BHJA 4PLYA 1B14A 2HJSA 3AI2A 2RAFA 2HAEA 4XX0A 4EYEA 1XYGA 1BMDA 4QFCA 2EJVA 1KEUA 4FJ2A 5FFFA 4R9SA 5B4VA 4AJJA 4E33A 3D5TA 2CNBA 4RZHA 3CPSA 3NAQA 2J3JA 3GDOA 3ZHXA 3I4CA 2DT5A 4MVJH 2C7GA 2YZ7A 4YAGA 4FOOA 1LNQA 2TMGA 1UZNA 3JQBC 3V1UA 3BHMA 3ZV5A 4GGPA 4OOFA 3CMMA 1HTBA 5A3JA 3JQFC 2X1HA 3DMTC 1P77A 5TRTA 1T1SA 4IBOA 5EIOA 5L4LA 2CDAA 4YTEA 2EW8A 1HSZA 3N58A 4I5GA 3LC2O 3GLQA 3K30A 2GN8A 1JTVA 4XJSA 3ABIA 4XQCA 5F1OA 5AXAA 4BO6A 4DIOA 2IXAA 1S6YA 3HB4X 3MJTA 4XDYA 4BGEA 3GRPA 3NJ4A 3DBHA 3UICA 2PA3A 1E3SA 2VHWA 4WOKA 5H82A 4YAEA 2W8ZA 2BI7A 5AQ1A 4YT5A 1QXSA 1HE3A 3GVPA 2V7PA 4TSKA 3D3WB 2O23A 3IDSA 3KVOA 4YPOA 3W8FA 4R5MA 5C7LO 1VJ1A 4YQZA 3HE3A 5TT0A 4IIUA 4R3NA 4XZ3A 1L1FA 4LMPA 2HMUA 4WUVA 5DT9A 2PR2A 2BFMA 4WLUA 1W6UA 1DRWA 4JBIA 4PVCA 5HBRA 3HFGA 3LZ6A 1E7RA 1NPTO 2POQX 3ITDA 1L7DA 4J1SA 1NXQA 4LSMA 3ZWVA 1A5ZA 3SLKA 1RPNA 4DQUA 1HE4A 3IUSA 3MEQA 1ADFA 4WECA 1KY5A 3UCFA 4ZQFA 1FDSA 3QVTA 4WKGA 1DFGA 1PS9A 1DSSG 4PZEA 1UXGA 2PH3A 3F47A 4B7CA 4MJLA 1IL0A 5JAQA 4WLFA 1BW9B 4E32A 2VN8A 4TMFA 2JFHA 1H6DA 2DKNA 2G76A 3KXDA 3LK7A 1ZVMA 3COSA 1XDWA 4XYMA 3DO5A 2DTEA 4ZQHA 3TZQA 1ZEJA 3LC7O 4J2HA 4WCDA 3PIIA 2Y67A 1U7TA 4TVOA 4CUZA 2YQ4A 3OEWA 5TT1A 4IDCA 2W2LD 5A3VA 3WQQA 2NNLD 1T24A 2CSUA 2YHIB 4CQMB 4IS3A 3MJSA 2ZQYA 3ANMA 3TSCA 3WICA 4AJIA 1LU9A 3VPGA 1HYHA 1YQDA 1BHSA 1PJ2A 1VRWA 3AM3A 3UCXA 5B1YA 1Y8RB 3C7AA 4UVEA 1HLPA 1E6WA 1YVEI 4XGNA 4W82A 3S2FA 3NRCA 4PN3A 1B16A 1NP3A 1SB9A 5HS4A 4Q3DA 4XWYA 4JCOA 1IZ0A 2B83A 3VKUA 3E1KA 4CQLA 2B69A 1B7GO 3WGOA 1CQIA 1V3TA 3DTTA 5CDUA 2Z5LA 5JDCA 4N54A 2B5WA 1AHHA 1RM5A 2JD1A 3GY0A 4RQUA 1MXFA 4J7CA 4Y67A 4Z9YA 2JJYA 1Z7EA 4AFNA 1U2DA 3WSWA 3QJ5A 1KBZA 3JYLA 2VT3A 2PZMA 3VZRA 3GNQA 1ARZA 4BNMA 1XLTA 1GQYA 1R66A 3CXRA 5AVOA 5MDHA 1DB3A 3VZPA 3G3EA 1P0FA 1HXHA 1UDCA 5DBFA 1MFPA 3PFWO 3JQAA 3NTOA 3PYLA 3QV1A 1N8KA 4CV0A 5A9RA 1ORRA 2C82A 3H3FA 5EESA 4A73A 1P9LA 3QVSA 1ZXLA 4BO7A 1ZXBA 2G82A 4YT8A 1ZO8A 1NAIA 5I7VA 3BTVA 3DBHB 3I1JA 4GBJA 4JQCA 3GEDA 4KDEA 2HK7A 3VHRA 4D43A 5LDHA 1ISIA 1DOHA 3RASA 3TL2A 3PJGA 2WE8A 2Q46A 1FK8A 2Q1SA 1QV6A 2J5QA 1YL7A 1GV0A 3B70A 4ZA2A 5EINA 4M55A 4XEHA 3WYEA 4DUPA 5THQA 3OHSX 4TROA 2A35A 3RC2A 3U4DA 3WBFA 3E9MA 4BKRA 4R3WA 2Q2QA 4HFJA 5U4QA 1DIAA 3HUDA 2J8ZA 4ZQGA 1TA4A 3L9WA 4Q3AA 2XF8A 4MP8A 1U8XX 1E1NA 3E18A 2OBYA 4GSLA 5I7FA 1LBEA 2VT2A 1TLTA 1G6KA 4LGVA 5JAIA 5JLAA 3DZBA 2IRWA 4R4JA 4URFA 3PLRA 5BSEA 1LLUA 1VC2A 4QXMA 5IDWA 5JXWA 4L4SA 4YB8A 1IPFA 1U9JA 1I3NA 2C7VA 4RPHA 1DHRA 1HT0A 2HSDA 4PG6A 1WXDA 2EHDA 3RI3A 1SBYA 5IXSA 1R4MB 3GPDG 4PIVA 3L6EA 4ONEA 1P1IA 1MC5A 3HADA 4YVFA 4GMGA 2JFGA 4TZKA 1XG5A 1VL0A 4WCFB 4P4LA 4LVUA 4G65A 3GG9A 5L7YA 1K6IA 4MIEA 2CF5A 3FBGA 4KWHA 4G81A 1E3LA 1E7YA 2OFPA 3A1NA 1OMOA 1QLHA 5HA5A 3A9WA 1PJQA 4L75A 1MX3A 2GZ2A 1HEUA 3L07A 2P5YA 5ICSA 1Z73A 4RF3A 4Y9DA 2BI8A 4CM4B 1M67A 1PTJA 3DAGA 3WTCA 1NWCA 1GAEO 1PL7A 1YB5A 4EEXA 1LDBA 2FHSA 5C37A 3GK3A 3PZBA 1E1LA 3SBOA 1R12A 3VH2A 5CDTA 1QG6A 3WLEA 4CM3A 3NV9A 3P7MA 4RPKA 3GAZA 5TSDA 3QHAA 4L4XA 3D1LA 4AJEA 1E1KA 4FC7A 4PLCA 1KYQA 3JD3A 3GF4A 3JYNA 4XB2A 2X9GA 2VUSA 3DR3A 3LQFA 1DPGA 4KTTE 1RM0A 4ILKA 2GNAA 3KBOA 4OXKA 4E5NA 4M49A 1GQQA 1YBVA 1YJ8A 2R00A 2Y1EA 3W6UA 1NM5A 1I3MA 3MJVA 1ADCA 4Z9FA 1M2WA 5DCWA 4GLLA 2NLOA 2BELA 3S2IA 1UP4A 1YXMA 1E77A 4R54A 1ZMOA 3MJ4A 4UVGA 4I9NA 4E5PA 5JAZA 2HLPA 4BKUA 2GPTA 5F3RA 3TZ6A 4K28A 3H6KA 1JKFA 3U5TA 1LDMA 4QUKA 1E3WB 1V8BA 2P91A 5HS6A 2GN4A 4NU6A 4D42A 1NTOA 4DXHA 1EBFA 1PZGA 3DC2A 2GLXA 4J4BA 2B36A 4BNLA 3VKVA 4WEQA 4QTZA 2DPHA 1H9BA 1AHIA 3VVCA 4YBZA 5EL0A 3WFIA 5KJFA 1X0VA 2ZJ0A 1YE3A 4XIJA 4FW8A 1HDXA 2YQ5A 1Q2XA 2PGLA 2VZ9A 3ZNQA 1QSGA 5CPFA 3ZZNA 5T64A 5DULA 5A9SB 2GRAA 3WOHA 4AVYA 2HDHA 3JQ8A 2O50A 1V6AA 1P45A 4IDDA 3CEAA 1Y8RA 4OKIA 3WYBA 1U3WA 3IL2A 2ZIZA 1I2BA 1C1DB 3NDJA 3OMLA 3W6ZA 3BMCB 1P0CA 4CLEA 4JGBA 1UP6A 3PYXA 1R37A 2VOEA 3QWAA 4RL6A 1LDNA 2OMEA 2PFGA 4LN1A 1CIVA 3DHNA 2HKIA 3BXXA 3BMQA 4WLOA 4B4OA 3DEYX 1SOWA 4E3ZA 3FRJA 1U3UA 2O3RA 3R0IA 3OECA 3TDKA 2EJWA 4ALLA 1VL8A 1E3IA 1M6HA 2H5LA 4U7WA 1A7AA 3UOGA 4OMUA 4MINA 1A71A 2AEFA 3CZRA 1T4BA 4R1UA 1EVIA 3AY7A 1E3JA 2GASA 3ZWXA 2BGKA 1R15A 1BG6A 2R00C 4FFMA 5CG2A 1QYDA 1ZSYA 1HE5A 4GQAA 2QRKA 4CMCA 1FXSA 1ZH8A 2W2KB 4WLEA 4YT4A 1I24A 5G0WA 5I9MA 3EYWA 4A7PA 3NUGA 2C0CA 4ALJA 3E6AA 2H1SA 3ENNA 3TZHA 2C29D 1H6AA 3NGLA 3ZU3A 1H5QA 5K6AA 1LLQA 3U0BA 3P19A 5B4TA 2NVUB 3RFVA 1UJMA 3O4RA 2EKPA 2ZB3A 2E82A 3P2YA 3GZNA 3W8EA 4RV9A 1GZ4A 3IUPA 4KOAA 3OEYA 4Q9NA 5U1PA 2FSVA 2RHCA 2XPCA 3DB2A 1KY4A 4GSKA 4F6CA 4BO3A 3KYBA 3QA9A 3MJEA 3HN7A 4H16A 5TS3A 3UKOA 4IXWA 4NDNE 1T2DA 2B4RO 3PQEA 3T4EA 4J2OA 4BB6A 3OQBA 4E21A 3JYQA 2Y1FA 3EDMA 3K96A 4E0BA 5IFLA 3WYCA 4D79A 2GF2A 4KWIA 3OSUA 4A27A 4C7JA 2Y1CA 4OM8A 5EQFA 1SNYA 5G0TA 2QZ9A 4YRDA 3X2EA 1GFSA 4NBWA 3AUAA 4RDHA 1LA2A 3PQDA 4A0SA 5JW6A 1PS8A 3FWNA 3D7LA 1AUPA 1ZK0A 3I9LA 3SC6A 1SB8A 2RH8A 3ZV6A 1X15A 4DLAA 2UYYA 2FWMX 4BKQA 5ES3A 5CDGA 2FZWA 5L53A 5AOVA 2GZ1A 1ZFNA 3PWSA 2Q2VA 1YBAA 3L0DA 3JQ7A 3QVOA 3OICA 3RUCA 4MVJI 4D0RA 3AUSA 1F0YA 1GU7A 4GMFA 3IAHA 1WWKA 2DBRA 3PZRA 1LLCA 3DZGA 2Y99A 5DBGA 5T67A 3DDNA 3VAZA 1ML3A 1PJCA 4CV1A 4YCAA 3WGIA 5L95A 1YOVA 2J5KA 2NM0A 1IUKA 4WCFA 3V8BA 1EBUA 3IJPA 1VM6A 2X23A 1DC4A 4B7UA 2BFAA 4J90A 1BVUA 1TT7A 3LYLA 2TMDA 3RVDA 5C5IA 1NR7A 3AY3A 4FDAA 5TX7A 4EITA 2BLLA 4J4TA 1TT5A 1PJ4A 2DTDA 4RGBA 3AW9A 1GEEA 1GEGA 3ZWMA 5C3MA 3GC6A 4RZIA 4YWJA 3BHIA 4XR4A 3IMFA 1Q0HA 3V1TC 4GX1A 3QWIA 4S1VA 4UUOA 1CERA 1YBMA 2WD7B 4M1QA 1QRRA 3ROMA 3EMKA 1NHWA 3L4BC 3Q11A 4IDBA 1PGJA 4FB5A 4CLOA 2AHRA 1ZSNA 2OP0A 4HV4A 5KCZA 1DO8A 1L7EA 5GY7A 4LRSB 1A9ZA 1AXGA 1F14A 3ANLA 4OAQA 4RVGA 1I01A 1QR6A 1E3EA 3ROPA 4BMNA 3RC9A 2GN6A 1I3KA 3AK4A 2VWHA 1HDCA 4IJVA 4OJNA 4WASA 1U3TA 3GVCA 1UH5A 3I23A 1U4OA 3CUKA 4WOJA 1N1GA 3RIHA 2VNAA 4N5MA 5I7SA 5IZ4A 2BGLA 4G5HA 4JP3A 4Z3DA 2NSDA 3HG7A 4CM6A 1N9GA 9LDTA 3FR8A 5JC8A 5L7WA 1UAGA 3RSHA 2DC1A 2V6BA 3VDQA 1CRWG 4NBVA 1O0SA 2Q2WA 1E6EA 3NYWA 3EW7A 4NBUA 3OH8A 2BRUA 1DC5A 3AM5A 1XHLA 2VTDA 4WLNA 1M75A 3ANNA 3MWEB 5EJ2A 4BKOA 3VZSA 2B4TO 4FC6A 3H9QA 1DIRA 4DLBA 1ONNA 3GRKA 3RD5A 3HDYA 1M6WA 3DZJA 4IZIA 4ESOA 4TWRA 4GKVA 3GHYA 3LT4A 1RM4A 4BNHA 4GH5A 5BSFA 2CZCA 4X54A 1DJQA 1CJCA 2Y1GA 5A9SA 2IYPA 5TF4A 2EV9A 2UUPA 4CMAA 2Q49A 1N92A 1UXIA 1XQ6A 2P2SA 3QWHA 1EE9A 5KOIA 2Q45A 4IJWA 5L40A 3TFQA 2HK8A 3NDRA 1NAHA 3BIOA 1ZEMA 1GCOA 4ND3A 4AJOA 3HB5X 4WK6A 3RAJA 4OXYA 3K6JA 1PU2A 2NUAA 4RVFA 4OYRA 3ZWOA 1ZBQA 2I3GA 3KSZO 4N18A 2Z95A 4J1QA 1G0NA 3H9EO 2GCGA 3D4PA 4J49A 2QYTA 1KEVA 3FNFA 1I0ZA 2C5EA 1X7GA 3DTYA 5JMWA 1RWBA 4J6FA 1GCUA 1SC6A 3SJ7A 2ZB7A 4RLSA 4NQZA 1B3BA 4IY1A 3W8DA 5IF3A 2W90A 5HM8A 4P22A 1YL6A 1XELA 1T26A 2ILTA 2PWZA 2HJRA 1WZEA 1UXHA 3WXBA 3ROQA 1KVUA 7MDHA 2OHXA 2NTJA 5CHEA 3F3SA 3ZHBA 5MGBA 4K26A 1SCUA 1LUAA 5COAA 4FFOA 4CM9D 1AGNA 1WP4A 2IE0A 4AL4A 2PLAA 1QYWA 2Q4BA 4XYBA 4BMVA 5A4DA 2YV1A 3PWKA 3WMXA 5AXCA 3WTBA 2V6MA 1KS9A 2VHZA 1Y5RA 1UXJA 5DNAA 3WGGA 3ZWNA 4HP8A 5BNFA 4U8GA 4YJGB 3ZWWA 4L9RA 4NK5A 3VC7A 5ITVA 3KSUA 4CMEC 4AJLA 3KHUA 2HMVA 5F1KA 3STHA 4W99A 5F1PA 4C4OA 1NVTA 1PQUA 1T1RA 2WYVA 3K31A 3HHPA 2EXXA 3W4KA 3TFOA 3N74A 1IE3A 1UP7A 4KTVE 4NNJA 3NKLA 1ISJA 4ZICA 5JFOA 2NQTA 3GR6A 1A27A 3AOGA 4CV3A 2NWQA 3B20A 3ICCA 2DU8A 1K5HA 2BD0A 3DBVO 1KIFA 4DPMA 3JQFA 3JQEA 1H2BA 2GD1O 1U1IA 2WDZA 1DIGA 4O5OA 1JVSA 5DDIP 4IMRA 3WJAA 4PLZA 4FQ8A 4E5MA 3L6DA 1PJLA 1ZK4A 1DRVA 1PJSA 1LEHA 1MV8A 5ITWA 3Q0EA 1DFHA 5IJZA 2R6JA 1E5LA 4LCJA 3AOEA 2D0IA 2X0NA 1LQTA 4PVDA 4CLRB 3NTQA 4J9VA 4CM9A 5L45A 3ZW8A 4MVJP 2F00A 4Z6KA 4TRRA 4KUHA 4CMHA 5JDIC 4UEOA 4G2NA 3S2EA 3G1TA 2NU8A 3IKTA 3FD8A 3LC1O 1N1EA 3WLFA 2VHYA 1C0PA 1J5PA 3D4NA 1XGKA 3OIFA 1O5IA 4IQ0A 4DGSA 1PGQA 4IPTA 1ONOA 3RBVA 3PTZA 4GVLA 4PG5A 3K8ZA 1A72A 2JCYA 1N7GA 2Z1MA 4R5HA 5GZ1A 3FHLA 4E13A 2AE2A 2Q4EA 4YJHA 3TWOA 1N2SA 3MWDB 4L0QA 4W6ZA 3ZW9A 4R41A 1DIBA 4PLHA 3GVHA 3WIEA 4CMKA 1U2GA 4QO8A 2Q50A 3WQSB 5L3ZA 1DLIA 4HY3A 3FR7A 3C1TA 4UVHA 3HNPA 4YJFA 4UUMA 3UW3A 5JPIA 4MPDA 1PZHA 5JO0A 2P9CA 1MUUA 1R4NB 4CM8A 1VKOA 1YONA 5L9AA 4ZQEA 2GN9A 4LK3A 3V2GA 1E7QA 4PLVA 4JROA 3ON5A 1FMCA 1NQOA 1VJTA 1Y8QB 4BO1A 1O8CA 1EFLA 1JDJA 1F8FA 1H94A 3GVIA 3PXXA 1PGNA 4IJUA 4GWKA 4WEOA 3WFJA 3LT1A 4C7KA 3PIDA 3WGHA 4JBHA 1VI2A 5ER6A 2HK9A 2VCYA 3RC1A 2PKRA 4ND2A 3AOEC 3EVTA 3EZLA 4II2A 4ROSA 3Q2KA 5AXDA 2WE7A 2IZZA 4II3A 1LLDA 5CG1A 2BH9A 1ONPA 4HFNA 1KERA 4B3IA 3C24A 3RKRA 3AY6A 4U6SA 5BQFA 5JY1A 1K6JA 4JJFA 4YAKA 2G0TA 5TQVA 4GLOA 4KDFA 5JO9A 4NR0A 1SPXA 4WE3A 1F12A 3ZDFA 4E2ZA 4WJZA 1B8PA 4JX8A 4U6QA 1GPDG 4W4TA 1C1XA 1U5AA 3C7CB 4KQXA 2AMFA 4DPKA 3INGA 4F45A 2D59A 2DM6A 3K9QO 4QQRA 4QEDA 3O9ZA 4EUEA 5K9ZA 4CODB 5B4UA 4GKBA 3NT2A 2V6FA 2ZYGA 3KYCB 1K6XA 2V6GA 4R69A 4IDAA 1O89A 3MOIA 3AI3A 5BNIA 2X5JO 4J7UA 1Q7BA 4J91A 1X7HA 3UN1A 4B4VA 4B8WA 2FSSA 2FR8A 2IODA 1H93A 3FNEA 4EUHA 2Y1OA 1A9YA 1ENYA 1NPYA 3C7DB 2NV6A 4GGOA 1MGOA 5FI3A 3BMNA 8ADHA 2Z1NA 3DL2A 4IQGA 4MIYA 1BVRA 1ZW1A 2EWMA 4FBGA 5CEEA 1RYDA 3D0OA 1CETA 4DIFA 2FOIA 4ND5A 3VH4A 1GUZA 3WJ7A 1HE2A 2W2LA 3GDGA 4BOYA 4HXYA 4NFYA 3TNLA 3TJRA 2LDXA 4ND1A 4CQLB 5F5NA 1JLLA 3EAGA 5G0VA 4L73A 1KEPA 2FR1A 4CUJA 1PZEA 1N5DA 1U7HA 3CIFA 4MVJE 4A03A 1E6UA 4BS9A 1BW9A 4J9UE 1FJHA 2X86A 5EPOA 1XIVA 1KVRA 4ZGWA 1HDGO 1VSUA 3PI7A 3O8QA 4PLGA 4XKJA 2Q99A 4IGEA 5JNLA 5ENVA 2E48A 1HL3A 3KM0A 2C20A 1RJWA 2O3JA 4D3FA 3RJ5A 4CL3A 1EE2A 3IJRA 4BGVA 5A02A 2W4QA 2ZTVA 2JD2A 4BO2A 2C5AA 1SAYA 3INRA 2I65A 1T2AA 4EW6A 3JD1A 5A04A 4YAJA 3ZNNA 4TRNA 4XD2A 1RYEA 3IP3A 1M76A 4JJGA 1IHYA 2PKQO 1LJ8A 2O4UX 3LLVA 1JVBA 4O59O 1RM3A 2GUGA 4ALMA 3AUTA 1K0UA 1V3UA 3EVNA 2CY0A 1P74A 4Z0PA 1E5QA 4J16A 3PGJA 4JNKA 1BTOA 1E0DA 4WLVA 3B6ZA 2Y93A 4RQTA 3BAZA 4RJTA 1B8UA 1JW9B 4OIMA 1NYTA 3E82A 3K5PA 5I9NA 3TF5A 4HNHA 4NFSA 4J1NA 4AICA 1YB1A 4R51A 4J0EA 1EFKA 3PVZA 4AJHA 5CDYA 3AI1A 4BGIA 1JWBB 2WYUA 1LSUA 1R0KA 2AXQA 2B4QA 3EZYA 3MOGA 5G4LA 5A1TA 2OUIA 2BHLA 3IQDB 1PR3A 4I08A 3ITKA 5C7OO 2PV7A 1I32A 1PIWA 3HZZA 3FBTA 1R4MA 3DXFA 3GGOA 4FOSA 4BKPA 4LRTB 3ZWPA 3BZUA 3D3EA 1C0IA 5DF1A 1R0LA 1SZJG 3KLPX 2NACA 3B1KA 3Q2IA 4CM7A 3GUYA 4RVSA 1VKNA 2UAGA 2YW9A 3DQPA 2YHIA 3LDHA 3TRIA 4CQMA 3F1KA 3QP9A 3I3OA 1QV7A 4OQYA 1YO6A 1FDWA 2DFVA 3DAPA 4NZ9A 3TQHA 1P33A 4PZCA 3VTFA 4B3HA 4CMJA 1P1JA 1MG5A 3F5QA 4OO3A 5JMPA 4A2CA 3UXYA 1NQ5A 3RKUA 4JN6B 1CF2O 1YB4A 3G79A 3ZHYA 3RROA 4BNGA 4EEZA 3PHLA 1XEAA 2EERA 4A26A 1GYPA 1WW8A 5DN9A 3V2UA 3QW2A 1K89A 2PNFA 4JIGA 4U5QA 2H9IA 1Y7TA 4IS2A 1ISMA 4NU5A 4IM7A 1DIHA 2B35A 1D7OA 3H2SA 3ONFA 3ZV4A 2EP5A 4IDGA 4Q39A 1VPDA 1S7CA 4AG3A 4E5YA 3ZGYA 4EJMA 5JY6A 1BXGB 3PLNA 4DBZA 2D8AA 1WDMA 4TQGA 5TC4A 3FN4A 2BKAA 1GDHA 2CF6A 5F5LA 1JWAB 1I2CA 3M2TA 1ZK2A 4CM8B 2RBEA 4KUEA 4P8RA 3L9XA 3GEMA 2J6IA 5IZCA 2X0IA 2P4QA 1DXYA 3GUCA 5I8ZA 1K3TA 4DYDA 4D0SA 2DTXA 5ER9A 4AJKA 2NU7A 1QLJA 3F6YA 3Q1LA 3ZV3A 2OGUA 3H7AA 4YACA 4EJ0A 1CYDA 2JAPA 3H5NA 5T8KC 3FCOA 1Y8QA 3OQ1A 3O26A 2CMDA 4DTIA 1O6ZA 4D44A 1J4AA 1R16A 2Y1DA 1BSVA 3CSDA 4R1SA 5JCJA 3JQ6A 4YRBA 1V3VA 5KVVA 4CPDA 2QX7A 1DJNA 3DMYA 3PDJA 3GT0A 4IJKA 1X1TA 4BNJA 4EUFA 1XU7A 3WG9A 4ITUA 2X0JA 5CP8A 3R6DA 3DZHA 2VHVA 5CAEA 2XAAA 3UUWA 4RORA 4HFRA 3TZKA 3AFMA 1R0SA 1V0JA 1C1XB 2VYVA 2WM3A 5ILOA 1DEHA 1F06A 3H8VA 1FDVA 1DBVO 4FN4A 4I1IA 4XRRA 1H6CA 1ZCJA 1Q1NA 2I76A 3B1FA 3QVXA 1ULSA 1HSOA 4AJ4A 5TIIA 1I5RA 1X1EA 3U49A 2E49A 3WQRA 5IN4A 3RC7A 3RUDA 1QP8A 1DC6A 2X22A 2Y68A 2ZYAA 3NGXA 4E5KA 2G5CA 3KYCA 2J5RA 1XR3A 4XR9A 4DWVA 3H5AA 1LXCA 1TI7A 3AM4A 4PLFA 2PZLA 3GFGA 4ZHSA 5KKCA 4DRYA 3E8XA 3JCZA 3OBBA 3WIDA 2PGDA 3WBBA 3RU9A 4CR7A 3I52A 4PG8A 5HWSA 1AXEA 4NFHA 1U3VA 2ZYDA 4M89A 3ZNOA 3ADPA 2CDBA 5FF9A 1VSVA 2VTEA 3P5SA 5FEUA 2J3KA 2EEZA 1GV1A 1Y6JA 2FY8A 3MTJA 4K1LA 4IIVA 4PRLA 3WWYA 1UXKA 3ZWCA 2Q1TA 5BR7A 3ZU5A 3SLGA 3WNQA 4RLHA 4GX2A 4D41A 2VWPA 4J43A 3TPCA 3M6IA 4ZQBA 3LF2A 2YDYA 4LCEA 3TOXA 2O4CA 3L4BA 3TL3A 3DOOA 2H63A 1EDOA 2H6EA 2Y05A 4L4RA 2O3TA 5KVQA 1P1RA 1UDBA 3R3SA 4XB1A 4GX0A 2QRJA 3GPIA 1FDUA 1U28A 1DRUA 2WWRA 3JD0A 3K73O 4BVAA 1ZMTA 2P9EA 3JQBA 4H15A 4UEKA 4IINA 4DLLA 3VZQA 5JBIA 3W1VA 2D3TA 3WGZA 1EK5A 1WAMA 2GYYA 1SEVA 2X8LA 4IUYA 4EJ6A 5BT9A 3DBRB 1HETA 3FSRA 2GZ3A 1Y1PA 3ETDA 1H0KA 1T2EA 1PGOA 3FTPA 3E48A 5CDSA 1YL5A 1EEHA 1GADO 1NR1A 2Y0DA 2A9FA 4Y8VA 3RU7A 4AJPA 3A06A 1Q7GA 2W98A 3R1IA 3KYDA 3GOHA 2HRBA 4I9HA 2HMWA 4PCVA 1LDEA 4W9NC 1YGYA 3H5RA 4Y6RA 1NVGA 2EP7A 5H83A 2OXIA 1E7MA 4INAA 5I8WA 2FPPA 1B3RA 2F1KA 2NVWA 3M2PA 4BNTA 5L51A 5G0SA 5U9CA 3KOUA 3GMSA 1TT5B 2DBQA 3JYOA 2FZEA 3ZU4A 3S55A 1RKXA 2PKQP 5A05A 1OC2A 4JJIA 1EUZA 1Q0LA 1ZJYA 2RH4A 5CFZA 3OQ6A 4O1MA 5IZCC 4D3DA 3EC7A 2ZKLA 3AU8A 1UZMA 4RPGA 2IXBA 3I9OA 4R1TA 3FI9A 4DQXA 4YR9A 2X9VA 3GN1A 3V1YA 1YWGO 5KJCA 3WR5A 4UEJA 1HZZA 5T6BA 5A06A 4YAIA 2ZCVA 3Q6IA 1TXGA 2O48X 1FF9A 1GL3A 3UAGA 3RCBA 3ZCXA 1BDMA 3PHIA 2JCVA 1NBOA 2DLDA 3W4IA 2OOSA 4HUJA 3BMCA 5FI5A 2C54A 3GGPA 3WB9A 4H3VA 3RUEA 2ZJ1A 3RFXA 4Z9XA 1OI7A 1T25A 5DOZA 2X5KO 3RJ9A 3FF4A 1KETA 2BF7A 1PJBA 3F46A 3E5MA 2FPIA 3DZKA 1P1KA 2DVMA 1IY8A 4BGUA 1YDEA 1ADGA 5EMHA 3RUIA 1EMDA 2I5PO 1LSSA 1MG0A 3WGTA 1BGVA 1GPJA 4OGWA 3ZWAA 2NADA 4I8XA 2EG9A 1QMGA 1DFIA 1Q0QA 2PTGA 7ADHA 3PQFA 1YS4A 3ZU2A 4J1TA 3G1UA 2BFPA 4BO9A 3ZH2A 4Z0HO 3U09A 3ETEA 5H81A 1N9GB 1JN0A 1ISGA 3AU9A 4E2WA 1NWHA 1EZ4A 5DCYA 1HRDA
chains in the Genus database with same CATH superfamily
2ZAMA 4C4ZA 2J5BA 1YNSA 2ZRAA 3SR4A 4N01A 4BNDB 1VXRA 2C59A 4DCGA 4HVAA 1V25A 3R77A 3VKHA 2QTHA 1Y3BE 2RGGA 1CP3A 1Q91A 1Y8CA 1YKGA 2Y0CA 4M8SA 4TN5A 3VSEA 4E1VA 1LPNA 1KK1A 4ZCQA 4HDAA 4O4IF 5B1IA 3S8MA 2ORIA 4JLNA 2JFXA 4Y0AA 3W2TA 3A0UA 4DC0A 1GL6A 1XDUA 2H7XA 3AI7A 4MV5A 3C8MA 5JLJA 1NI4B 2LD4A 1S02A 4XVRA 1ELOA 4GI5A 2Z2IA 4XD7D 3QVWA 2Z8ZA 2LWIA 3BJEA 3WNBA 1NBIA 1DT5A 1JI0A 2MSWA 2XVYA 1KGDA 4BB0A 3NIWA 5FR2A 1J42A 1HEYA 2ZPAA 5FWYA 2P4HX 3PHJA 4QU0A 1QO0A 1Q84A 1DUIA 2UYQA 1L1EA 4QXQA 5LM3A 4FYVA 1E9FA 4B8ZA 3WA7A 3O1IC 4JJKA 2YJTD 1FSPA 1BNCA 4BQSA 4WNCA 5GP1A 4BLVA 3BJIC 1E98A 3NBZC 1GGNA 5FT9A 2HCRA 5F3DA 1E7SA 2PBZA 2O5CA 4LE0A 1Q1AA 3LG2A 3AF0A 1K7XB 2GAOA 2ZI9A 5JRJA 1MAWA 2RB4A 1I0IA 4RY0A 1RKBA 1GG9A 1BQEA 1ZH2A 5DHSA 1WA5A 2P68A 2HA3A 2J3LA 2RK3A 4C0LA 3ASUA 4R1NA 5IF9A 2WR8A 1M5UA 1MJNA 1DXOA 1EP9A 2PY6A 3TIFA 1QKIA 3CX6A 1UJBA 3OM8A 1SHZA 4NBKA 4WXEA 2F3QA 4W6QA 4IP0A 5LD2B 4CLDA 1TF7A 4FDLA 1ZVVA 4RKEA 3MS4A 2R8EA 4Q4JA 1WDKA 2OVFA 3GLVA 1TEVA 5AESA 1LRLA 2ZYVX 1I9CA 1QTIA 3PDUA 2MR5A 2Q5QA 4JBXA 3TW8B 1KWKA 1YVDA 1CEQA 2DBVO 1GIAA 4NY1A 4ZQHA 4ZREA 2IHUA 2CJWB 4RVHA 5JARA 1IBRA 4BMDA 1SD5A 2D4HA 2IYOA 4BHTA 1TMYA 3SNKA 5I7EA 2WNIA 3RFFA 1HDZA 3EXHC 4NVRA 1MC1A 2AVNA 2HHCA 3F4BA 3H2KA 1RZ3A 4DABA 2EKDA 1ITZA 2B20A 1Z2EA 2G28A 4N1AA 4YA6A 1IAQA 3C3XA 4FHEA 2AG5A 4YROA 1B1CA 1V6CA 3O75A 4M8LA 4LJ5A 4D1YA 5T8KA 4P86A 3WHKA 4F9EA 1NMYA 4JXKA 1W5EA 4EJFA 2EL7A 4AYXA 3QEOA 4G0OA 4NZYA 4TUYF 5EP1A 5JYBA 4U9IS 1EX9A 5JAPA 3PP8A 4RNDB 1SY7A 1YQXA 5I51A 3CA8A 4NMHA 2UUOA 4CR6A 1WPQA 2A84A 1YZTA 1J0XO 2A94A 4UBNA 3LDUA 2G4LA 2CE7A 3L77A 3GEHA 2BZGA 1M8PA 3NIGB 3R7DA 3RJZA 4U4AA 2H29A 4QDKA 1UAYA 1HKUA 2JVKA 4YRRA 5D8DA 1D1PA 4EMBA 2PJZA 4EKGA 4YMIA 4CFYA 3JSAA 1I4DD 2J3IA 1T2VA 3T95A 3IIEA 1IXZA 3KLMX 4KIWA 2CHGA 4OY3A 4RM3A 4I1UA 3PEWA 1DKOA 3DW1X 2B0CA 4B4DA 1EGMB 3PI6A 2OO5A 2G1UA 4D45A 1KR5A 2DR3A 3K0HA 2B98A 4OXQA 5CURA 3J81A 1Z8DA 1RQNA 4YGYA 1K6EA 3WWEA 3AEUA 3UPTA 2DFLA 4CTJA 1JAXA 1E2LA 2ETXA 4WXMA 1EI9A 3MGBA 4UAJA 4ZVNA 4TM7A 2JASA 3WWDA 4HWSA 4ER0A 3AO0B 4CXMA 1M1YE 2WG0A 1BXKA 1OR8A 1XLTC 2JGIA 3GGGA 3JPYA 1YMVA 4FFDA 3NORA 4B34A 3UQZA 2BFOA 4RD2A 5KVSA 3Q6NA 4CEHA 1SKBA 4TS3A 3LZDA 3MG9A 1WETA 4YQYA 2EX0A 4R8KA 1B15A 4TL6A 2HO5A 3GHHA 3EBLA 4NCHA 2H1LA 4P53A 4TXLA 4OA5A 5A5EA 3T34A 1GPLA 5L6LB 2AFHA 1RZUA 1JXOA 1USVA 1O5OA 1IHPA 2ANBA 2ZRFA 3I5MA 2RIRA 3L7JA 4XE5A 1KYZA 3OJLA 2IV2X 2WTUA 2P9GA 4XFJA 3EQ2A 4FLFA 1UZAA 1F51E 3UJ7A 2IZ0A 3EULA 5T5QA 4ZC1A 2V7WA 4C4SA 2HA0A 1KY2A 5BVGA 2Q5JA 1R8SA 4O2BA 3WLRA 2X0RA 4C5BA 3MTDA 1WUJS 4PXAA 5A7FA 1FFAA 2VDNB 1KC3A 2FPLA 4J07A 5HCIA 4EVSA 5JIBA 2YWFA 3QY9A 3RSCA 3U2QA 5BOVA 3BGDA 4RTKA 3RU2A 4EGFA 1BCRA 4Z8XA 4FU0A 1YQEA 5AMXA 5ADHA 2OV1A 4YV7A 1SOVA 5EXSA 4DCVA 3BZBA 4AZ3B 4ADSG 1DAKA 3EPLA 1KSGA 3SLRA 5F3WB 3AYXB 4PZZA 1QFMA 3ILSA 5BOSB 1GITA 3Q6MA 3W2EA 4MX8A 5GONA 5LMCA 4TMWA 1NVBA 4BNFA 4URHA 4W7HA 1TK3A 1UK8A 1TCCA 5B37A 3HXOA 3E9ZA 1JKJB 1V9LA 2LUOA 1PZMA 2EIHA 2JI9A 1RWWA 4YJ3B 2VF7A 3CF6R 5J4HA 1GNSA 4YQEA 2CCKA 4MKZA 1U8FO 5I9SA 1FZQA 1I0LA 1ZU4A 1ZG3A 1VIDA 1D4FA 2GRJA 2HA6A 5EJ8A 1LTQA 1PR0A 3ADOA 1SH7A 1D07A 1CWUA 2CYBA 1BYUA 2OBFA 4OBEA 3LWZA 2I2BA 3T3PB 5T3YA 3AUXA 2WVAA 4IXNA 4NDAA 4PRZA 1X13A 2ZE5A 3EX7C 3PX7A 1GAXA 4LK2A 3H9GA 3NTLA 2I3ZA 2WLTA 1XAGA 2ZVQX 3FFWA 3SE7A 3RYCA 1M8FA 5EXEA 1RVV1 2BW0A 3A70A 1AA6A 3GCGA 4ARCA 4X3PA 1BX3A 3R3HA 2PLRA 4LV6A 1K9VF 3KSMA 1JSCA 3ULKA 1QIGA 1WLSA 3LFUA 5C8DA 5C9ZA 5LQCA 1G59A 1NGSA 4UVDA 4IJMA 4A23A 1K97A 2EZ8A 3CGGA 3IQHX 3ZIUA 2ST1A 4P4TA 2H2IA 2FP3A 3I5YA 1KU6A 3DGFC 4Z4FA 2R8RA 3W05A 5BVGB 1W29A 3UV7A 4Q3CA 2ZRLA 3P2OA 2DY1A 2XOXA 4ALKA 3FNGA 4JI3B 2HNKA 3VHXA 4DJJA 3DBLA 1AY0A 3D6JA 4NBTA 4OH7A 2DFNA 3LSYA 3LA6A 5FOQA 4NNPA 2HTFA 3UV3A 4Q1EA 3VO1A 1GKIA 1R6AA 1NW6A 2H2HA 2C0PA 1JI3A 1R8YA 4U8HA 1U2QA 2EW2A 2QVCA 2NVBA 3OQPA 5A5FA 3BBLA 1XXHA 2D4AA 3FPGA 5JYCA 4MROA 2FSGA 1PWZA 1DC7A 2FPIB 4MAFA 2Q1YA 3LY8A 1C0LA 4LJKA 1TKCA 2IZOA 2DLNA 1P91A 5F64A 5AW0A 3PJDA 4CGZA 1H65A 1XZKA 4GOKA 2ZVDA 3SX2A 2O2SA 3F1LA 2B82A 4C78A 5IKEA 2EFEB 2QD4A 5INTA 2NIPA 4UCWA 4KW7A 4Q1CA 5IDXA 2GO1A 2OXFA 4AROA 3NC4A 1O95A 2E0IA 3LY7A 4LJ4A 3B6KA 5D5QA 4X44A 4JWKA 1KS2A 2BMEA 4G25A 2DBYA 3U13A 4KR7A 2Q1UA 1FU7A 2D00A 3WNVA 3KRTA 1EWTA 1E1CB 3NH6A 3IOMA 4QRIA 2Q3EA 3ED1A 2J07A 3JALA 1A4UA 1Z6XA 3QXCA 2Q6KA 4OTZA 1WD7A 1UFKA 3CQ9A 1XVLA 1LX7A 1A4IA 3R5FA 3WK5A 3WK9A 2CVZA 5JSZB 2F1OA 3FJYA 1W2HA 3LOUA 3LL4A 5E3IA 1M34A 2XT9A 1BRMA 3GP8A 3LVBA 2C8JA 3ESAA 3IAFA 3M6UA 2H2WA 5EXDA 2XB9A 5TQ2A 1BX0A 3QJGA 1E8MA 4ENQA 2IPXA 1MLDA 2RK6A 4MUKA 3A14A 5FL3A 2YYZA 1I5OA 2DHQA 3AJDA 3ZQ6A 3MXOA 1BFDA 3OKCA 1V9CA 1OAOA 2QLBA 3DKRA 1YHZA 4Y30A 3EVZA 3OE4A 3BQMB 3LNTA 2FQYA 3U6BA 4OHUA 4HNAB 4CMIB 4Z4GA 1XAJA 3DMPA 1SHLA 4MR8A 3W7VA 5G4KB 1CVLA 1BHQ1 3UC9A 1A69A 5JS1A 1IQPA 4EG1A 4PTLA 3QIVA 4JJZA 2R8ZA 3KZOA 5F7OA 4RKRA 1MOPA 2GK6A 3DAOA 3TMAA 3IPYA 4K05A 1RRCA 1QF6A 4G0YA 2YV3A 3EGVA 1ZK3A 2VUIB 4CTNA 1KMCA 4GXNA 4MQEB 1P9OA 1IATA 3C97A 4XIGS 4EJSC 4HBZA 3JQ8B 3R6GA 2Y92A 3I45A 1T8YA 4R05A 1VKHA 5FRDA 4ZHQA 2R68A 2PFSA 2JW5A 2WWGA 1AUVA 1Z0UA 4IV0A 4Z3KA 4IDFA 4V3CA 1L4MA 3OEEA 4X93A 1JFTA 5H68A 3IE0A 3JALB 5FOTA 1T8UA 3MUFA 3TLYA 1QH8A 1XMVA 3O3OB 3H17A 4EUSA 3JQRA 1FFGA 1QIFA 2WYHA 3G68A 4B74A 5E7MA 3I1IA 2VF2A 4BFTA 5G1PA 3B3GA 3ZR4B 3Q5DA 1PQWA 1FFWA 4JITA 5HNKA 1I6MA 2C8KA 4GHWA 1BWSA 5J2TA 3GLGE 3PL1A 1P2TA 4FYIA 2DR2A 2FEOA 3QNWA 1KH3A 2HF8A 4Y0NA 4YP9A 5J9FA 4PQFA 4C21A 4ZYUA 1DCMA 5G2OA 1Z7WA 1PZFA 1CLEA 2G83A 5BXQC 1N34B 2PMDA 3C4QA 5UKDA 4ZODA 2J08A 2WTMA 1OB5A 1U63A 1JAHA 3IP1A 4L8WB 3DR5A 1PSDA 1I10A 3QMPA 3H9JA 1D2GA 5LQUA 3P9SA 4F3KA 1X7WB 3EY4A 5FV7A 4QLBA 3JAWA 4CKEA 2I4OA 1JILA 1W8DA 2JL1A 3HVUA 2H18A 1TUGA 1HQCA 1E2BA 1OYYA 4Z0TA 1NNLA 3G2NA 4QVIA 1MZPA 1QTQA 4JH0A 3WC4A 3HL4A 1NASA 3R40A 4F8EA 3KT6A 4OYHA 1TVEA 4QJ3A 4OEHA 4E1AA 1ZGGA 3C1AA 4ZK6A 3GCZA 3P0HA 1CR0A 3L6RA 5LC1A 1UJ4A 3BMOA 3HBLA 1GZUA 5BUSA 1G8PA 4FI3F 3RSLA 3AMVA 5B3AA 5AK0A 3GAFA 3N28A 4O6VA 4HYYA 4EP1A 2LW7A 1KP2A 3DVSX 4NE9A 5EJ4A 1ZX1A 3TNDA 4KEAA 1GYRA 4UREA 4GLFA 4BLRA 5ITZA 3LLSA 4FFRA 2Q5HA 3JARA 3C6ZA 4LDNA 2BR5A 1LW7A 3K2BA 4MLCA 3UXHA 4AULA 3A9CA 4O4JB 5AIBA 1R88A 3I61A 3KB6A 1SG0A 1EUDB 2VWGA 4PO1A 2GEJA 2XUJA 5DMHA 2V1UA 2FZGA 4EY7A 3RHTA 2JIDA 1ZOOA 1NIJA 1JQJC 3EXAA 1U65A 1YJXA 2QWXA 3B2NA 1OC4A 3VOSA 2H1OA 1ISHA 4YXWD 1JB9A 3OJOA 4AF6A 4J0GA 4PRKA 4QNMA 5K1ZA 3ZWKA 2EJBA 3I32A 2VA9A 4RQBA 5DP1A 3DFUA 3KJNA 4EHJA 3ET4A 1E2HA 1XMXA 3LKBA 2O2EA 1WXGA 5EKXA 4IKPA 3DLIA 4RVUA 3HYRA 2CUKA 4OSOA 5FLEX 4X64B 4EH1A 2Q9BA 3H4TA 3PFFA 4JI0B 2XLBA 2AW5A 5I4CA 3D64A 2ZCUA 3WWZA 4E08A 5SY9A 2CN1A 3OD5A 1XVIA 2ZB8A 3RUAA 2P35A 2GPYA 3C7TA 3JAKB 3RVBA 3TLCA 3CVVA 2KJQA 3HQ4O 1DX4A 4NJOA 2B0JA 5FHQA 4D82A 4FDVA 3CLUC 2OCXA 1RBQA 4LBZA 2PZAA 4U7JA 5EIBC 5IDYA 2X58A 3DFFA 1KTVA 4ZVVA 4BRWA 3PUKA 2IUTA 1JL3A 5KUTA 2X15A 4EPRA 4QXAA 5K99A 5J23A 5DV9A 3UAYA 4CNQA 2QUJA 3FPLA 1P3DA 3JQAB 3LGAA 1DAEA 4ND8A 4FOLA 4IICA 4X24A 1DIOB 4QC2A 3ZWYA 1H2AS 3TN7A 3WLJA 1GAWA 4DXHA 2NUAB 2ZK7A 2W2PA 2ORVA 4QBIA 1Y81A 3WLHA 1RJEA 1QYCA 1XMIA 1L1QA 4PR3A 1I36A 4E2YA 1QO0D 3KDAA 4ENTA 3DCNA 1D09A 1U2PA 4LXYA 4YCNA 4MDEA 1UMBB 4ZTBA 3T7KA 3ABSB 4L78A 2MYPA 1JKIA 2VNIA 3EUWA 4KE9A 4RVDA 4D9HA 5LPNA 2WVJA 4I14A 1E3MA 3DEKA 2B61A 3L0IB 1P31A 3M1AA 3O03A 4ZU3A 1RYYA 3L2OB 3QNUA 4HWKA 2XE7A 1CQIB 3I3SR 2FSUA 3IAAA 4BN5A 4O3FA 2WVHA 4BNZA 4Y1RA 1YS6A 2X1MA 3AVTA 1R9NA 4KR2A 1EQUA 4X7PA 1LDYA 4AIIA 4DCOA 2R1VB 4WSOA 4F1JA 1YKFA 3OTIA 3KKMA 5IEBA 1N9ZA 4QAQA 5LCXA 5TLSA 4NATA 3JVIA 5EMLA 5T4BA 3W1WA 2RKWA 3DE2X 1NDHA 3PXDA 4WFJA 5L9AA 1OFHA 5MN5A 1JFSA 2O5VA 1B4DA 1QKKA 3U1TA 1KBQA 5EIFA 3U62A 3CE6A 4KWEA 5HCUA 1T4CA 1JS1X 3DWEX 3TRJA 1TUIA 1RLMA 4TT3D 3TCXB 5A03A 3T5MA 1NMEA 2EG5A 2ZOSA 1BIFA 4YMVA 3GFSA 4E5DA 1FQKA 4I55A 1RJDA 4H4CA 1NNUA 1MIOB 4KQWA 3UQYS 2C8LA 3HDQA 2RB5A 3AR2A 1FVHA 3GEGA 4WCFC 3U3XA 3IQZA 2QMZA 3UFXA 4ERXA 3PQ2A 1M2HA 3PGXA 3D81A 4TPKA 1XN4A 4QD3A 3JQ9A 3AZPA 1W96A 3JASB 3OFVA 4BNKA 4Z99A 2AQHA 1N2IA 4NS4A 2JIMA 1DQNA 1NKTA 2RHWA 2D1TA 3RSOA 4LF8B 3IKMB 2A3NA 2KSQA 5JAIA 5JYEA 3S28A 2FW8A 2MU1A 2VH1A 1QWOA 3CZMA 4NYMQ 4H4DA 2OBNA 5HK9A 4TL7A 4TMZA 4EPTA 1T9AA 3P32A 5LYJA 4DC9A 5DTEA 2CKMA 1YK1A 5CEFA 1I3LA 3P20A 3PTAA 2ISQA 1DARA 4IZHA 2OP1A 1NKSA 4QHYA 5CCDA 2JAHA 3H11A 2O2YA 3S1AA 3TDMA 4LOJA 3TINA 5IWCA 2BM0A 3ABZA 3S3TA 5ALEA 3U16A 4MRMB 2HUNA 2QTBA 1EYZA 4HAIA 3DNMA 2O7NA 4D96A 5L7TA 1H3NA 2IKQA 5CH5A 1OA1A 5ENDA 1ID1A 2QX4A 1XCBA 2ACEA 4D81A 3ESZA 4CEIB 1IQUA 1OZAA 4IDOA 3WIVA 1EIZA 3FFBA 3LPMA 5JS7A 3UCEA 2O0KA 1KEWA 3B9BA 2ZR0A 4OI2A 4RK5A 3FLMA 4LUCA 3PXAA 1NVEA 5ICMA 2UXDB 2WQZA 4RPJA 4FZ5A 3OWHA 5JV5A 1NOKA 4P4NA 5ALNA 5KYNA 2GETA 4DA0A 1X70A 3HU2A 3Q10A 4PG4A 5DYYA 4CF3A 4DMLA 3EARA 4INZA 4XOUA 1KIMA 4XDZA 4M86A 4F4IA 3RU3A 1MABB 4DF3A 3VDRA 2PT6A 1T6ZA 4CE6A 2VHJA 3A4VA 2R6FA 4HAOA 4QWMA 1JLKA 1U9YA 4U0JA 4WCVA 3RT9A 3SI7A 4BWVA 4JJ4A 1CRZA 1Y3IA 2IUFA 3MWJA 1XRPA 2VJKA 4JLPA 3AT1A 3GZTB 5EJ6A 2VSXA 3DAFA 3UHAA 5KX5F 5KJ1A 2NXWA 3SG0A 4G84A 5EHGA 4PBTA 1M66A 4YT2A 4OATA 3IIKA 1BH6A 1SK9A 1QO9A 4G8JA 4JLDA 4GWGA 4KP7A 3EIUA 5FORA 4FK8A 1C7FA 4NFLA 1Q0TA 2ZUEA 2XA9A 1TK9A 3A6EA 5TEVA 4ENUA 1LX6A 1HT2E 3ZIAA 1XCMA 4Q3LA 2W71A 1JAIA 1N7HA 2Q5IA 3OLQA 1OI3A 1WE2A 2UDPA 4H6PA 4Q00A 4TLBA 3NPMA 4GW3A 4UUNA 2ZIGA 1I4TD 4NCBA 3K9BA 2IPAB 2G9QA 1ZSVA 3ROEA 3W78A 1HGXA 4Q9IA 5JD3A 2OCDA 1RP1A 1K66A 5ILQA 2QQ5A 1I1OA 4LEIA 3GQBB 4C7BA 3N05A 3D7SA 3PYMA 4EG8A 4Z49A 5BT8A 3K94A 3MWEA 2WQ7A 1LW6E 1QZZA 1P61B 3FZGA 4LDPA 2AYXA 2P78A 4R8RA 3WWCA 3IIJA 3NU1A 1M1XB 1ZWKA 3I9MA 4PLYA 1G60A 1B14A 2GSWA 1DRKA 2OOKA 3FUCA 1RXCA 4XX0A 3U61B 3ZLBA 1XYGA 3RG2A 1YI1A 5D3QA 4QOEA 4TX1A 1AF4A 4FJ2A 4R9SA 4JU9A 4TWBA 4FNOA 5KTSA 1NI3A 2WUDA 2BGNA 2CNBA 4PS0A 3N2LA 1V2GA 4RZHA 3VR6H 3CUYA 4RIIA 3FOEC 2XQKA 2X8BA 3ZHXA 2XSZD 1K0FA 2C7GA 4QPPA 1LNQA 3RSFA 3JQBC 5CT4A 1UF9A 1T3HA 3CM0A 5KTPA 2D5LA 2C9CA 1NJ6A 4GI1A 4NBSA 3BHMA 4QLOA 4C30A 2PWYA 3CMMA 1HTBA 5A3JA 3G13A 1E4EA 1Q3HA 2OSVA 4G85A 5E6RA 1JIQA 1G2OA 5FUXA 1P77A 4Y1RB 5TRTA 1Z17A 3VR6D 1F1JA 5EIOA 1KH1A 1QX4A 5L4LA 2CDAA 4YTEA 4NZPA 3G8DA 2EW8A 2C2GA 3DKPA 1NVVR 1BN7A 2QW1A 1EP2B 1YZ3A 2GN8A 3GLQA 3K30A 3RFUA 2H07A 4ZPJA 1GRVA 5AXAA 1NQVA 1H2ZA 2IXAA 1S6YA 2BGIA 2QL7A 1GNVA 1S96A 1W4RA 5C1PA 4LHYA 2E1RA 3DBHA 3SIWA 4D8YA 1JPJA 2PA3A 3BIXA 1E3SA 4CTMA 1N0IA 5A2GA 2VHWA 2NZ2A 4RXUA 4WOKA 5ELLA 5IC5A 2DHEA 3KP1A 4YAEA 3KPWA 2ZT7A 4LY3A 1Y6FA 1ZVKA 4WWHA 2IITA 5KQMA 2GLTA 3QUCA 1DX9A 3ITNA 3D3WB 5DSZA 4YPOA 2H48A 2NO4A 3LLCA 3C3WA 3DAHA 4P7JA 1BWQA 1C1YA 2QD5A 5C7LO 1I9GA 1IDOA 1EVEA 4X1OA 3TX6A 2NGRA 1WVIA 5CMLA 2RGRA 1H0RA 3D3JA 1M10A 1L1FA 2HF7A 4X9XA 4W63A 4WUVA 3B82A 1MVLA 1PWHA 2BFMA 3TW0A 3LOQA 3MM4A 4EZIA 4LZAA 4NMLA 4JBIA 1RI4A 1TD1A 3DCYA 3Q7RA 1E7RA 3OZSA 4M0MA 3ITDA 2O8DB 1GU0A 4J1SA 1CY1A 2NO7A 2V97A 1R50A 3I42A 4IOMA 1RPNA 3IVCA 1S5PA 3E9YA 3BG5A 4KL8S 1ADFA 3RV4A 1MMFB 5BV1A 2Q5LA 1KY5A 3CU5A 3HL0A 1NRIA 3MYYA 3QVTA 1HNNA 1BMQA 3IAS6 1QIJA 4JJEA 3NLLA 2J9GA 4WKGA 1DFGA 5EJIA 1DSSG 3OIUA 2I2AA 4PZEA 1UXGA 3BT7A 4NH0A 3F47A 1Y1QA 2C2OA 3PIRA 3JAMA 3IP6A 1ZNZA 1UK6A 4E32A 3OP1A 1XD8A 2VN8A 2OKGA 4GD3Q 5E0OA 2FSVC 1QGUA 1PYGA 2G76A 2J30A 1HE8B 3OI7A 3QA3E 4CMKA 3COSA 4HNVA 2UZIR 1ND5A 4RH0A 5HJ7A 3T7SA 3B8EA 1WEHA 3KR9A 1J07A 3E7XA 4QUGA 3N8GA 3LC7O 5TQ0B 2RI1A 3F74A 5IK2A 4JENA 2KYRA 5LR6A 2W6MA 3WIOA 4CUZA 3LKDA 4DJ5X 1OYWA 9ATCA 2ATVA 4LQCA 3NXKA 1BGWA 4IDCA 3NHKA 4PPFA 4C0BA 2Q4RA 3A3KA 3WQQA 1NSYA 4AN0A 1T24A 1B93A 1T5HX 2CSUA 4GMHA 4X20A 4CQMB 2FQ1A 4JFRA 2BGTA 1HYHA 3DV0B 3GRAA 4GECA 1BE1A 1O6BA 1VRWA 3K9LA 3AGPA 4UE6A 2YZMA 4HN9A 2C42A 2HQBA 4HNQA 5B1YA 1WBBA 1AK2A 3C7AA 3GRYA 1QOZA 1E6WA 2OBMA 2P9HA 1L7XA 3I30X 2FPOA 3W3AA 3S2FA 1GZSA 2HD4A 4ACAA 2VTKA 2WMYA 3OT5A 2GA8A 2VQSA 2A88A 3MTEA 1JHQA 4YJ2F 1D7AA 2J0UA 3UMSA 1B16A 4BXOB 4G24A 1NP3A 5HS4A 2JKYA 2XF2A 2MINB 3UENA 2YY5A 1AMUA 2B83A 3MRTA 3VKUA 3U19A 5AVSA 1B7GO 2GK7A 4JUDX 5CYGA 1Z0JA 5EKTA 1GGVA 3EPKA 1FMJA 5ARDA 4H7DA 3SS8A 2WHXA 2XXAA 4KNYA 4HUQB 3PBKA 3O3NB 4ZP1A 3DJYA 2Q6TA 3QFFA 3FSEA 3QJ5A 4JVMA 1XJQA 3GWZA 5L6MB 5EIHA 4DIUA 3E7PA 3VZRA 1NJ8A 1ARZA 5FLYA 1GQYA 3AHFA 4LG1A 4WKOA 3VYTB 3PC4A 1YZYA 1P0FA 3OZIA 4D9NA 4LGCA 1PEAA 2AZ4A 2YNMA 3DEJA 4YUZA 2PYIA 1IMOA 1WXFA 2GTHA 1XTKA 4YRIA 2IXTA 1M7GA 4N6OA 2O8FB 4M36A 4EQ6B 3IHWA 5EESA 3QVVA 4UW9A 1YJBA 1PJZA 1VG8A 5JXIA 2G82A 3CVWA 2JLAA 4C5CA 1ZL2A 2AXEA 2ZJBA 4WK4B 3HCRA 4ER5A 2ADOA 3ZE1B 3N76A 2CJYA 1R8JA 4PO8A 3BTVA 5AM3A 3VYUB 3IUJA 1U2ZA 5D3KA 2R3SA 4PZ9A 3VHRA 1W4BA 3RTBA 3UYKA 1ISIA 3IELA 1DOHA 4IIXA 1RRMA 1LJLA 2VPTA 2WE8A 3O21A 3PJGA 4OLJA 4R83A 1JQ3A 4BZZA 5KYXA 1GV0A 3B70A 4MMYB 4BQQA 1EFTA 4XEHA 4DUPA 5H7XA 1QHEA 4EATA 4TYNA 2C2BA 1XAIA 1WUYA 1S3FA 4B6FA 4EVQA 2BBWA 3E9MA 4BKRA 1ZGZA 2GILA 4DR7B 4TZ6A 3L84A 2Q2QA 2O19A 1Q3TA 5BSVA 4HFJA 1DIAA 4JELA 1UC4B 3QELA 2Q7XA 5E1BA 2YN0A 3TH5A 2ZREA 3ABQB 4PSAA 1R0XA 1ZJ4A 4DG9A 4WBNA 4ZI7A 4KRFA 3L9WA 4D9BA 3GGCA 4MP8A 3L7IA 1E1NA 3KZMA 4UCFA 5DNEA 3QITA 3P2EA 5CYOA 3L05A 5ALSA 2C4MA 5FYQA 5I7FA 1Z6TA 4RMNA 3K8QA 1CPYA 2XB8A 2VT2A 1SBZA 2V7VA 1GNQA 4L72A 3PXGA 4DA7A 4D4IA 2PSFA 2HJVA 3B7GA 2EBUA 1UOPA 1IQ0A 3H5WA 2FEXA 5JLAA 4KQEA 1ZR2A 2PEYA 4LPSA 2A3RA 1KO8A 3WAJA 1PX2A 1E2DA 4IRXA 4JUFA 1UPFA 2VO1A 2O8BA 1VPWA 4DZRA 1IPFA 1U2EA 1U9JA 3K09C 1LBHA 1UWLA 1OGIA 4P4SA 4DDKA 5BRJA 1BS1A 5LB4A 5F7XA 2PYZA 2Y9MB 3WMFA 1HT0A 3UMJA 4BMCA 1THZA 2VJBA 3FMVA 4CN8A 2YZKA 3G23A 3LHKA 1YVUA 3H5OA 4FINA 1FFHA 3QNMA 1TJ3A 1P1IA 1BE0A 3BL6A 4TZKA 1XG5A 3GJZA 2VHTA 4UD2A 3DEZA 1VL0A 3COVA 1GVNB 3K9CA 3GAMA 2QTVB 4G65A 3D6TB 3KHSA 5IUNC 4QQKA 4PBSA 3PE6A 4G81A 1KYVA 1F20A 3A9WA 1PJQA 4PR0A 1QHXA 1TD9A 3LBAA 1F9AA 1R10A 2JA2A 3FMFA 3P27A 3LUPA 1M83A 3GBVA 4KPEC 1GQFA 2F9FA 1NY5A 2GS9A 3ECSA 3FMOB 4QOFA 4RF3A 4HAUA 4Y9DA 5ICSA 1TOAA 3DF7A 3SZ3A 4ZJZA 1M67A 1PTJA 1UWVA 2E5WA 1NATA 3WTCA 5EGSA 4EG5A 3HABA 3KV1A 1PL7A 1KXJA 2QX9A 3LUCA 4X61A 3QYJA 1PT6A 1R12A 3I8XA 5BW5A 1QG6A 4HAXA 3PRYA 4IJ6A 1QGAA 1N6IA 1JH9A 3GUZA 1JDBB 4H18A 4JSYA 3ND5A 1XZFA 2L17A 3NBXX 3NV9A 4RSHA 4CM3A 5GADl 1Z6GA 3P7MA 2F17A 1VIVA 2QOEA 4LE2A 3VU1A 1P3Y1 1U28C 3QHAA 2P6PA 2HCBA 3N5CA 1E1KA 2YCBA 3T9EA 5JCPA 2C4UA 5ALIA 1ZM7A 1K68A 2WPDD 3S5JA 1M1ZA 1KYQA 4EWLA 4EYOA 3JYNA 5HUHA 1TC2A 4X8OA 3EPJA 5BXYA 5FV4A 1EUQA 1JR3E 1NLUA 2FW6A 3PDWA 4IW3B 4IUBS 2FUNB 3OJXA 2FX3A 4YY3B 5K4HA 4ILKA 4NZMA 3KBOA 5A4MS 4M49A 4MR9A 1YJ8A 1GA1A 5F77A 1NT4A 1I3MA 4P3YA 4KGDA 4XSGA 3GFFA 4K7JA 3A2KA 2COKA 2ROQA 1RACA 1M2WA 1A7JA 2QPOA 4IF6A 3PQ6A 2QZPA 4A92A 3R6WA 3KOWA 4JD5A 1E77A 4EOGA 1U0GA 1W75A 2FF7A 3NHBA 2ZBUA 4UVGA 4X7RA 3KE9A 1ECPA 1A9XB 3SFZA 3GRUA 2X3FA 2A67A 4ZVOA 3N3BC 3NBAA 3U4GA 2GPTA 4ZT2A 3PPVA 1EDDA 5JAHA 2NN3C 3CLTD 4K28A 1KOGA 2CB9A 4ZYLA 4D02A 3NWOA 5ALKA 4QUKA 4X62B 2IPOA 4EKEA 1V8BA 3NHWA 2YXNA 4NU6A 4U2KA 4D42A 1NTOA 4EX6A 1QCDA 1PZGA 4J4BA 3UB4A 2B36A 1M2OB 3ZX5A 4BN4A 3ZQUA 4EM6A 4LXIA 2B6HA 1XC7A 3NQ41 4L9WA 4RDCA 4V0ME 5GM1A 3VKVA 4DCMA 3KKPA 3P9XA 1AHIA 3H04A 1YRBA 2C2WA 3D5EA 1IAVA 2ZJ0A 5KJFA 1Q11A 1XDDA 1YE3A 4Q37A 5GONF 3W5IA 1UKYA 2HCJB 4UU0A 1Z7GA 3LRPA 4NJEB 4EHHA 1Q2XA 5T7BA 5K0BA 4LMBA 3ZQ4A 3N2KB 2VZ9A 5WRFA 1KQNA 4NICA 1B00A 5K8CA 4PPYA 3QVGB 1QIIA 1P7WA 1X87A 2WWYA 2VHEA 1UPBA 3S5UA 5AHWA 3SF0A 2O2DA 1LPMA 2XBLA 4LKOA 2HDHA 3T0FA 1HFEL 1KTIA 3E9EA 5KOJA 3JQ8A 4K6HA 4CYMA 5HQJA 4GKKB 1R4AA 4R8VA 3FFAA 1Y8RA 4QATA 2R96A 1L4GA 5DXJA 2I80A 2V96A 4OQMA 3RHFA 1C1DB 2I78A 3SOZA 1FJXA 1V3QE 2ALJA 1Z6QA 3B51X 1OVMA 1P0CA 3I6ZA 1JQDA 4I2VA 3PYXA 1XMQB 1GKYA 2WJAA 1S1CA 5AJYA 4TYMA 3QWAA 5LP6B 4HTFB 1QYIA 3UAWA 3IFSA 5IMSA 2HU7A 1V11B 1XT6A 3U4AA 4AZWA 3OECA 2D7JA 3WKAA 1FZTA 1M6HA 5DBOA 1TM5E 4REQA 1UANA 2CMFA 3FVTA 2JLVA 2CWWA 1F2UB 3LAWA 3RYFA 1SQFA 4HB0A 1A7AA 4COOA 5I7OA 3JATA 4KN6A 1NBWB 4MINA 4G5QA 2ZRMA 1T4BA 1EVIA 2PQ2A 3ZWXA 2KPOA 4P2GA 4FE7A 3VYWA 4B3XA 1OJ7A 1JZTA 1QHSA 3T12A 4IWYA 2UYOA 4D9FA 1WX1A 1W2GA 2F3UA 2WJVA 1ZSYA 4JQZA 4YHBA 1JEOA 5FJJA 1AURA 2VP6A 1YRQA 3LY5A 4X1IB 2R6CA 1FXSA 4YV0A 4HDMA 4YT4A 1I7DA 1EJ0A 1CY0A 3G2OA 5I9MA 4U02A 1ACMA 2C0CA 2FWBA 1TFUA 4G97A 1E1QD 1Z39A 2HU5A 3RF7A 2W6NA 4MUYA 3TZHA 4PZLA 1OHHD 3IQFA 3D31A 4JXJA 3ZVRA 3TOCA 1CSEE 3BXPA 5JADA 2ZRIA 4KIJA 1NJGA 3O4RA 3R7BA 5K09A 1HDEA 3D2CA 1YFKA 1MD9A 2FKNA 1IU9A 1GZ4A 3BF8A 4L0DA 3NHMA 1MOQA 1XNJA 3IUPA 4GUDA 4Q9NA 2O5RA 3V33A 2BMJA 3SOPA 1QX3A 1SQ0A 2HRRA 5F33A 3I5AA 3QA9A 1Z63A 2XCTB 1ZI6A 1N1MA 3ML1A 4IXWA 4NDNE 1IWBB 3RE1A 4B6SA 4DL9A 3KQHA 5F7JA 3GUVA 4Z7OB 3PQEA 1X7ZA 2L2QA 3NM4A 5BMOA 5AKKA 3T9FA 3TTVA 5CLFA 6AT1A 5LP6A 3RQIA 3JAWB 3GCXA 3P94A 3K96A 1VJGA 2GF2A 4KWIA 3EXFA 3V1LA 1SHUX 3OSUA 4A27A 4UPDA 4KQ9A 2Q3JA 3U1VA 4CIYA 5EQFA 1EA7A 2UUBB 2MR6A 1UEXC 2AR9A 2B2CA 5G0TA 1XVTA 4MRAA 2RG7A 1RQPA 4YRDA 3X2EA 5JH7F 3H99A 4NBWA 4DV6B 2GKOA 1R5OA 1ZCAA 3OTWA 4RDHA 1ZNYA 4GBED 4ITVA 3RB8A 4BVEA 1CW2B 1OD6A 4BN0A 5KYUB 1FQJA 3KT0A 3RVKA 2JLYA 4PX2A 3A3NA 5JMTA 1R5BA 1C5KA 3FNIA 1I7PA 2IW1A 5DLEA 4DJTA 3ICOA 2R8YA 1GTVA 1VE1A 3QF4A 4HDQB 3AFOA 3QX9A 2RH8A 3D2LA 5ALPA 4ID3A 1U7XA 2AS0A 1R0ZA 4CDRA 2W6JD 3IYLW 1A76A 3K6SB 2UYYA 5LIRA 5ES3A 1SBCA 2QL6A 5AOVA 2BE7A 1TVMA 1TZJA 1ZFNA 3M5DA 1YBAA 3QVOA 1KAOA 4FUTA 5H70A 4D0RA 4TXHA 1F0YA 1DZ3A 4GMFA 2Q3HA 3EF0A 2CLIB 5FUBA 3ZVLA 1L5RA 3C3YA 3FYCA 5FO0A 2PKWA 2BBSA 3DDNA 1ML3A 1PJCA 4HMQA 3T61A 4CV1A 3SNHA 3TLMA 3VPCA 3V8BA 2J5KA 2NM0A 2AXNA 1I7LA 4EHKA 2VBGA 1DC4A 3TAXA 4YV1A 7MHTA 4B7UA 121PA 2BFAA 2OQIA 3JWJA 3A4MA 3R41A 2N47A 4J90A 3FX2A 4PHFA 3LYLA 4YP7A 1WCIA 4L02A 1FUIA 3BREA 2HX1A 5EOVA 4CU5A 5I7HA 1LK0A 2VEOA 4CT0A 1NR7A 3OMXA 3O8NA 5BV7A 4ILEA 1ZVJA 4EITA 2QMQA 2BLLA 4B1FA 1Z4KA 2QTWB 2VYQA 1YJAA 3PRHA 1PJ4A 3ZTYA 1Q14A 2DTDA 1JJ7A 1R0CA 1W5AA 2CNWD 1ZM2A 3MJDA 3TAUA 2BUBA 4ZCLA 1E58A 1HYBA 4C89A 1P8JA 3GC6A 4RZIA 4XR4A 1SUPA 1A5TA 4FT2A 1EB9A 4M0UA 1OU0A 2FZVA 4GX1A 3RGWS 3QWIA 1T2UA 1RS0A 2XADA 3E4DA 4JA2A 1J0CA 3UWDA 5DEIA 4RK1A 3ROMA 3EMKA 3KJEA 4RYLA 2RAPA 1FVXA 1UPCA 2OO7A 1V95A 2PXHA 3KWJA 5L3SB 2OP0A 4HV4A 3IB6A 1L7EA 4AG6A 3TG2A 2K7FA 1W44A 4EHFA 1OHHA 1PK8A 2WIAA 3HVRA 1AXGA 3TKLA 4R2WA 1HK7A 2C9BA 3QBTA 5B1SA 3SF8A 1E3EA 3ROPA 3CRNA 3COJA 3REOA 2H4WA 3AUKA 5AD1A 1TGYA 2X8JA 1HDCA 2ATCA 4U3JB 3VNAA 2JG3A 1UL1X 3GLTA 1UH5A 2G7MC 3ME5A 2W7TA 1BXRA 5FI0B 1QF7A 3IBGA 2VNAA 3PDCA 3RIHA 3C43A 4G5HA 2F7SA 1F4VA 4Z3DA 5I7SA 5J1SB 1N2GA 2BGUA 3GLGA 2Q3BA 1L4UA 4W8GA 4R1MA 2HQOA 2LE0A 2V6BA 1LD3A 1QBGA 2XOKD 3H9BA 3HCWA 4R7GA 4DTCA 3IMCA 5J3JA 3ELUA 3MWDA 3BRWA 1Z25A 2FZ5A 1DC5A 4RBNA 5GJWC 4F9TA 1JZSA 4Z5XA 5EJ2A 1T9HA 4TVKA 1ZWLA 3UJ8A 5KB3A 3LX5A 3KEMA 3VZSA 5AJHA 5HF8A 4FC6A 4DDVA 2RCNA 4K9OA 1DIRA 2QX8A 3B38A 3PXBA 4DLBA 1RZRA 1ONNA 1PD0A 3GRKA 4I1OA 4MTCA 4AP9A 3DZJA 3IAUA 3GUHA 3OU6A 4D99A 1CS0A 3BDAA 1Q5PA 2CXQA 3GHYA 2GZRA 4GKVA 1RM4A 4B2YA 3GW8A 2X0EA 1BU5A 4KPYA 4X54A 2HY7A 4RENA 4G0VA 3FUVA 2Y1GA 3EVFA 2XOEA 2P0YA 1Q95A 1NE2A 1TIPA 3RRNA 2EV9A 4CMAA 4M76B 2Q49A 1UXIA 2C3YA 1PR2A 4JLSA 1L9XA 3Q3IA 5HQ3B 1P0IA 1RWVA 2ZR8A 3S7ZA 2CLMB 4TWZA 3THYA 3PD7A 1N8TA 2HK8A 2UUCB 2ZS7A 1NAHA 1SC9A