3JQAA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-1,9-dihydro-6h-purine-6-thione (dx4)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
249
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
molecule tags Oxidoreductase
source organism Trypanosoma brucei
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
total genus 95
structure length 249
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqaA00
3KSZO 2J5RA 1XWFA 4BNUA 4W6ZA 4P8RA 3R3SA 1YJ8A 4WCDA 1LNQA 2OZPA 4FR5A 3ADOA 3F9IA 2VZ9A 1OC2A 1VJ1A 4GVLA 2DT5A 3RI3A 4WJZA 1AN9A 4YQYA 3LQFA 3OECA 1ZFNA 3WGYA 1B8UA 1ZNQO 3EDMA 3GH3A 4YT8A 2B4RO 4YJHA 2IODA 2UV8A 4CV3A 1B2LA 4E3ZA 3IAHA 1E6EA 5DP2A 5ER6A 3ICPA 4BO2A 5AOVA 4D46A 5JFOA 1ENOA 1T4BA 4GGPA 3S2GA 1PWZA 3DZHA 4CUZA 1O6ZA 2FN7A 1EFLA 1T4DA 4CMCA 1ULSA 3K96A 2QRLA 1UDCA 4PRLA 3KBOA 5ER9A 5I7FA 1EEHA 2IRWA 3NEPX 4E5KA 1Z82A 4OSPA 2PTGA 4IGEA 1NWHA 4E33A 4BS9A 2X7HA 1R0LA 1SAYA 3M1LA 4R4JA 1RM0A 3GPIA 4RZHA 7MDHA 4ND2A 4DL9A 4J0EA 3L4SO 4RVHA 1K2WA 4U6QA 4CQMD 1U9JA 3OIFA 4EJMA 3HNPA 4EW6A 2VCYA 5KVVA 4QTZA 4GX2A 1DBVO 2I99A 1X1TA 1BHSA 2AW5A 2Y1EA 3WGOA 3OJLA 1T1SA 1N1EA 3KYCB 3D1LA 1HDXA 1CETA 1V0JA 1H2HA 2NQ8A 1F14A 2HQ1A 3DL2A 3NX4A 4ALKA 4D3DA 3HUDA 5CEFA 1Y8QA 4NMHA 3HSKA 3ZV3A 4YJGB 5CG2A 5U4QA 3RC1A 3I3OA 3D3EA 2FZWA 3KO8A 3BAZA 4UUMA 4HKTA 2PH5A 2V6FA 1YRLA 1C0IA 3EW7A 4KWHA 3RUHA 3OP4A 5EQDA 2BFOA 4XX0A 2EIHA 3DONA 1DO8A 3K5PA 2B4QA 3W6ZA 3GHHA 1O89A 3PIIA 4GSLA 3ANLA 4CODB 3ZWPA 1SZJG 3C8MA 3RKRA 1JW9B 3H2ZA 1YQXA 1YKFA 3W8DA 5AXBA 5GZ6A 2WSBA 2NVWA 1HKUA 4O0LA 1DC4A 4OOFA 2AG5A 5F1KA 2VHYA 2NWQA 3DBHA 3OJOA 4ND4A 1JDJA 1UH5A 4OIMA 3ZI0A 5JSFA 4ALNA 3JTMA 2B35A 2YV2A 3QWBA 3MCVA 1H6CA 1SNYA 3WSVA 2P91A 4A5OA 3JQ7B 3BIOA 4ILKA 4ALIA 4A2CA 1EVJA 2FSVA 4XQ9A 1E1MA 4Q3AA 4R69A 2V6GA 5ILGA 4IJUA 2WDZA 5GMOA 4OQZA 4OJNA 1DIBA 2RCYA 3AI1A 3GA0A 4O6VA 2VWHA 4GX0A 4JLWA 3BMQB 4TZTA 3AW9A 4FFRA 2Y67A 3DMTC 3V5NA 3C7AA 3UHAA 5IDXA 3GRKA 1Q7CA 1J49A 4RL6A 3PIDA 3WICA 3WNVA 1DLJA 3QVWA 1NX6A 1EK5A 1GQQA 1ZK0A 4K26A 4IY1A 4WASA 3PGJA 2JHGA 4G81A 3NGXA 4RF4A 4MO2A 3NV9A 1GUYA 3FR8A 4GVXA 3DBLA 5C7OO 2RBEA 4GAEA 3C3XA 3INGA 3VZPA 3JD4A 1XELA 3DBRB 3GG2A 1FJHA 2GPTA 4GWGA 1UJMA 3BTUA 3JD1A 3UN1A 1RM4A 1GYRA 4PVDA 3E1KA 3MOGA 4XZ3A 3EZYA 1I36A 1O9BA 5EIOA 1UUFA 3OSUA 3UUWA 1LLCA 3FTNA 4QO7A 5JYEA 1GZ6A 1JVSA 1KC1A 4ZA2A 4ZD6A 2GZ3A 4CLOB 1GCUA 2PD3A 4CM4B 1UR5A 4E2YA 3TZKA 2CDBA 1Q0HA 1NR1A 5KJ1A 1TEHA 4PLPA 4XIYA 2GLXA 4BVAA 4OKNA 1QYWA 4H3VA 2C29D 4J0FA 4PIVA 3BMCB 4AJEA 4J43A 1BXGB 3IMFA 1E7RA 1EUDA 5CEJA 1HE2A 1KYQA 3HFSA 1QYXA 4DIFA 2EWMA 2LDBA 2NU9A 2HK8A 3G79A 2AEJA 1ML3A 1ZK2A 3T7EA 3NRCA 3LU1A 3AM5A 5TT1A 4LMRA 4JJIA 5KJFA 4CM4A 4CLOA 2P4HX 1M6HA 3AM4A 4RPHA 4IDCA 1O94A 4L4SA 3B1JA 3A28A 1JQBA 3N74A 5COQA 1LX6A 3WMWA 2YW9A 5JDIA 4OH1A 4L8VA 4CM3A 3KTDA 1MC4A 3OBBA 5BNIA 4KP7A 1O8CA 5JCJA 2ZKLA 1C1DB 3Q0EA 2JAPA 4B4UA 2G1UA 1I3MA 3JD0A 3KLPX 1WDLA 4R1TA 2VWPA 1VI2A 3NT5A 1MC5A 4EITA 2IYOA 1JLLA 3ZU2A 3U4CA 4BNMA 2GO1A 4CLRA 3GUCA 2FHSA 4PCVA 4EUFA 2DBVO 3KV3O 3ZU3A 5CP8A 4BO5A 4UVEA 3UVEA 4Q3CA 3GN2A 2VNAA 2CDCA 3E82A 1RWBA 3RCBA 5DCWA 1NQAO 4NK5A 1RYDA 3MZ0A 4ID9A 5BSEA 1IB6A 4MJLA 5BSFA 2WE7A 1ADBA 3GZ4A 3JQAA 3QVOA 4ZRNA 2C5AA 2ZB8A 2GN8A 1PR9A 1E7MA 4Y98A 1HYEA 3FR7A 3DZGA 1E3WA 1BDBA 1R66A 3I9NA 4Q39A 4WNCA 2Y05A 4XB2A 1O95A 2EJWA 4OSOA 3RAJA 1CYDA 1ZSNA 4CV2A 4RF2A 1B15A 1D1SA 4YJDA 4MVJI 1NQTA 2YFHA 3GGOA 2TMDA 5KVQA 1A7AA 1PQUA 4WLEA 2DPHA 2ZTVA 4CMEA 3V1TC 3BTSA 5AXCA 1NFQA 2H5LA 1ISJA 4GKBA 4F6LA 3TZHA 3E5RA 1ISFA 1J0XO 1OBFO 4AG3A 4XYMA 1NPDA 1L7DA 5JMWA 1LQTA 3ONFA 3SEFA 1HDCA 5A9SA 4BKQA 1ZH8A 4CUJA 1N8KA 3DWFA 4JK3A 5HBRA 3W4IA 3W1VA 4BL5A 1F8FA 1R12A 3DR3A 4NK4A 1YL7A 2HMSA 4N5LA 4L4RA 2GYYA 4GLLA 1IZ9A 3ZHXA 1LRJA 2C54A 3GF4A 2IYPA 1PU2A 4YYZA 5TS3A 2JFFA 2PY6A 5FF9A 4E6PA 4Q9NA 1N7GA 4XIJA 3MJEA 3O4RA 1ZZEA 4HY3A 3RUEA 1I2CA 3PHHA 3I6IA 4H16A 2BFMA 4BNJA 2I76A 3GFBA 4MP8A 3JQ8B 4XYGA 3D3WB 5JAMA 1H6BA 3ROPA 4P38A 4GI2A 4IQGA 2O23A 4FN4A 1P9LA 2A92A 4NR0A 4FCCA 4Z0TA 3COSA 1AXGA 1HSZA 3RBVA 3WGHA 2OFPA 3E03A 1DAOA 3UOGA 3NAQA 5F3RA 5DP1A 2Q2WA 4DBZA 4IBOA 3EHEA 1H2BA 4DRYA 4GKVA 1PTJA 5DZSA 4D41A 4WLVA 2NACA 2CF5A 4P4NA 2ZTUA 2W4QA 3DBLB 4YA6A 2FPIA 4XD2A 1DJNA 1R15A 2OBNA 3DZJA 5HS4A 4R68A 1QXSA 1NNUA 3GZNB 3G49A 2EERA 1BVRA 4FS3A 2BD0A 3DTYA 3DHNA 1NXQA 4KUHA 4L74A 4TZKA 4W9NC 4WLUA 4CL8A 3GQVA 4CQMA 4PG4A 5JY6A 5L7YA 4II2A 3TPCA 1V6AA 5IXSA 3W4JA 5H83A 3PDJA 2E4AA 1E7WA 1SBYA 3ROQA 3QWHA 1YB1A 3H65A 3Q2IA 1ZW1A 1X0VA 5FI3A 1HDOA 1JKIA 2AHRA 3FN4A 5TSDA 4DC0A 1Q1NA 2ZJ0A 2NLOA 1MXFA 1OMOA 2Q3EA 4URFA 1M76A 4YJFA 1DRUA 5K6AA 1ZVMA 1YXMA 3D5QA 4TQGA 4NH4A 3ZDFA 4R5HA 1LC3A 4DIBA 5G2OA 4B79A 1ISGA 1U7HA 3JQGB 4FOSA 4HFNA 3HDYA 3CINA 3LF1A 6LDHA 2PFGA 3VH1A 1JU9A 2CDAA 1IUKA 1P33A 2EG9A 3NTRA 4YEDA 1PWXA 4BNZA 5I9NA 3DBHB 1NPTO 3GAZA 5J23A 4J1SA 2RHCA 5F1OA 1GQ2A 1YBMA 4LVCA 1EQ2A 4J4BA 3QY9A 4Z0HO 4O5OA 2DKNA 5A5EA 2R00A 3WWYA 1HRDA 1EDOA 2P9GA 5HA5A 2B69A 2W8ZA 5ICMA 3GY0A 3QV1A 3ZGYA 3WGTA 5JDIC 2TMGA 4YCAA 4N7RA 2RH4A 2D4AA 3ZU5A 1R0KA 1VSUA 3V1YA 4CJXA 1EZ4A 1FDVA 3RFVA 5IF3A 3WFJA 5DF1A 5HWSA 1I2ZA 5JE8A 3TRIA 1TT7A 2I5PO 4PG6A 4CMGA 2CD9A 3ZW8A 2IZZA 3BTOA 1UAGA 1LLQA 3ABIA 5AXDA 3WWZA 2BKAA 3E9NA 1XU9A 2DLDA 3Q3CA 4IQ0A 3CMCO 4MKRA 4D3FA 1MGOA 3D7LA 1HDYA 3IKTA 2HLPA 1HL3A 2W2KA 2C82A 2R00C 3W8EA 1PZEA 1DDOA 2V6BA 1YO6A 2X58A 5JAIA 3KM0A 4TROA 4EBFA 2HMTA 3Q9UA 1OC4A 1E77A 1QV6A 3EYWA 4NNJA 3T7CA 2GN6A 3RBXA 1PZHA 2PNFA 1KY4A 2H63A 3VKVA 2YHUA 4Z9YA 3LZ6A 1VPDA 3I9LA 4WNIA 2C7GA 2RH8A 1U3TA 4KZPA 3BHIA 3VPHA 2HRBA 4LRSB 4BGEA 5L7TA 4IDGA 4XQEA 3EUWA 2PGJA 4HXYA 1MXHA 3QA9A 2OGUA 1E3WB 3V2GA 4JBHA 5KJCA 1IL0A 4IZIA 1XHLA 2V6MA 3KETA 1ZMTA 1P31A 3C24A 3GGPA 2Z95A 1A9ZA 1J6UA 1XIVA 3JQAB 3UGKA 1V3VA 2C0CA 2WWRA 3I6QA 3JD2A 3WG9A 3WTCA 3FBGA 4PG5A 2DFDA 3WIDA 1F8GA 4L0QA 4MVJD 1P74A 4C4OA 3DZIA 3JYNA 4NU5A 3WGIA 4LCJA 1UXKA 9LDTA 2BELA 2NTJA 3GEGA 4FQ8A 3JQBC 2HMVA 9LDBA 2GD1O 3TZ6A 1U3WA 2QX7A 2RHRA 3VDQA 2X4GA 4F3YA 1PJ4A 3ORFA 4XQCA 4PLCA 1NVTA 4WGGA 1E6UA 1MA0A 3RUIA 5COAA 3KYDA 2VWQA 2P9EA 4WLOA 4IDDA 1VE9A 2D59A 3GHYA 3K6JA 2JD0A 3QLJA 3DFZA 3BMNB 3JQBA 4KDEA 3I9OA 1LEHA 4IMPA 5G0SA 3DZBA 3W8FA 2EGGA 1GFSA 4CMIB 1VL0A 5L9AA 4H15A 4G2NA 3NJ4A 1M66A 1K3TA 4IZHA 4AJIA 3GVHA 4UAGA 3PGXA 2SCUA 3TDKA 2PZKA 3LC7O 5A4DA 1E6WA 1NHGA 5CDTA 1NVMB 5TC4A 5B4VA 4OM8A 5G0WA 5C5IA 1MUUA 5C37A 2VN8A 1L1FA 4D79A 1PJLA 3VTZA 5CDYA 5KVSA 4EJ0A 1PJ2A 5FI5A 2AE1A 1XR3A 4U5QA 4PZCA 1FDUA 5BR7A 4A10A 1KC3A 3ON5A 3GNTA 3OEWA 2O3SA 3G3EA 3F5SA 2VTEA 4FFMA 5ILOA 3V1UA 4NBTA 3TSCA 1YWGO 1MX3A 1R16A 3H3FA 4KWIA 1HLDA 3K73O 5COBA 1P1KA 1RKXA 3DQPA 3QVSA 3A9WA 1I30A 1TA4A 1ZXLA 3S2FA 2BFPA 4WECA 1V8BA 1GV1A 5A9TA 5A06A 1ADFA 2HO5A 3HDHA 4OOEA 4DYDA 5DBIA 3AFMA 2POQX 4DGSA 4RDHA 3B20A 3ZHZA 3FSRA 2Y0DA 4R9RA 4B4OA 5TRTA 5JBIA 1BWSA 5C7IO 2V7PA 4I9UA 1B14A 3M2TA 5KIAA 4BNXA 2EP7A 4CLDA 1YBVA 4FSHA 4MIEA 4HX5A 5A1TA 5HM8A 1Q0QA 3VPSA 4DA9A 2H9IA 2CVQA 1MFPA 1WLYA 1DC5A 4MOWA 4DMMA 4BO9A 4M86A 3JQ9A 5F5LA 4M8SA 3SC6A 5BSHA 1CEQA 3ZWYA 1X13A 4WOKA 2NVBA 4NHEA 3H6KA 4J1QA 2VNSA 3H7AA 1R4MA 2CVZA 2C7VA 4ZJUA 1I32A 5L3ZA 3UFXA 4J9UE 3OICA 1YH3A 1Y81A 2GN4A 2Y1GA 3B1FA 4DLAA 2VRCD 3PYLA 4QUKA 3STHA 3WS7A 2ZYDA 2C5EA 2EP5A 4CLHA 4JCOA 1UP7A 3DAPA 3L6OO 4GBJA 3ZV4A 4G5HA 4G65A 4AJNA 3EGOA 1T24A 2VOJA 4PLVA 3EZLA 1SOWA 5MDHA 4N18A 3FNGA 3HN7A 2AQKA 4JGBA 4YXFA 2ZJ1A 4HNGA 3H5AA 2PKRA 4HUJA 2BI7A 1KBZA 4HWKA 1HEUA 2Y68A 3PTZA 4TVBA 3ZNPA 1HF3A 4PG8A 3PFFA 1DXYA 1I2BA 2Z1NA 4QFCA 3RC2A 4TRMA 4CM7A 3EMKA 1A72A 3BA1A 3JQEA 5A9RA 1D4FA 4Q3DA 4CMBA 3PWKA 1HDRA 2W98A 1JWAB 1FDSA 4DPMA 4Z9XA 1BDMA 3KHUA 1MB4A 4KTVE 5FFFA 3L6DA 4OGWA 1HLPA 1P0CA 3R0IA 1WMBA 1PGOA 1YB4A 3GVXA 2Q4EA 3M2PA 2O3RA 2Y1OA 2YV1A 4XGNA 3U4DA 2BRUA 1ZKMA 1ISMA 2HMWA 1K6JA 2HDHA 3OQBA 3F6YA 2O3QA 2B4TO 3FPCA 3JCZA 1E7QA 1Y1PA 4ZHSA 3ANMA 5IDQA 2J3JA 1ZEMA 2X9VA 4FJ0A 3CPSA 1WMAA 4XYEA 3ZNNA 1WVGA 4TSKA 4OHUA 1BG6A 1IOLA 4CM8A 3FNHA 2EKQA 3EK2A 1WPQA 4FFLA 4RQUA 4I08A 5JC8A 3RUFA 1NFFA 2O3JA 3S2EA 1E3SA 1MV8A 3OA2A 2GR9A 4FIZA 3ZN2A 4FFPA 1M67A 2JCYA 3ZWOA 3KXDA 2EHDA 5DOZA 2X0JA 1GR0A 4JP3A 1HE5A 1LSUA 1BMDA 5EMHA 2NTNA 3CXRA 4I9HA 2I9PA 3F4BA 4P22A 4AFNA 3TFOA 1U8FO 4NBWA 1E7SA 5JCJD 3AU9A 4CQMB 5B12A 5TJ9A 4BNIA 1GDHA 4L75A 1U5CA 3JQ7A 1ID1A 2BHLA 3LVFO 4L9RA 3WNQA 4J91A 5LCXA 2PZMA 2Y66A 4WCFB 5ES3A 4TKLA 4TWRA 1QG6A 3UF0A 2YUTA 4MP3A 1DRVA 4CV1A 2NVUA 1GUFA 1EBUA 2ZTMA 3F46A 5KKCA 1GZ4A 4NFHA 4INAA 2J5KA 3QQPA 3DB2A 5G4KB 2OXIA 1NHWA 1ONPA 2WD7A 1X14A 1EE9A 3G1UA 3IP1A 2XXJA 1N92A 2DUWA 1KETA 2ZCUA 2R6JA 3GFGA 1OZAA 1H94A 5CEEA 1CQJA 1T2EA 4B7XA 4DBVO 5I7VA 2HU2A 4YAGA 2UYYA 4WK6A 2I67A 4WE3A 1A5ZA 4IMRA 3BTVA 3IL2A 4AJLA 4BO0A 4YB8A 3I1JA 3H5RA 3O26A 5LC1A 5TNXA 3RQSA 5JY1A 1GAEO 4YDRA 1J4AA 1EDZA 2AMFA 1YS4A 2D8AA 3BMCA 4QT0A 3SXPA 2PH3A 1VSVA 4FGSA 4TMFA 2VHWA 4MVJM 1DIRA 2JFHA 5T8KC 1XEAA 2CF6A 3RU7A 1Y9EA 3D4PA 1MP0A 4PLTA 5DN9A 4CMKA 3LSYA 2BLLA 4UUPA 1XGKA 3WQSB 4KTTE 2GN9A 2P5YA 2D0IA 2GZ2A 1OOEA 1PGPA 4OQYA 4PLYA 4EZBA 3X2EA 3AU8A 4NPCA 3OIGA 2DTDA 2Y93A 3SC4A 1DIAA 2I6TA 4HFMA 4BO8A 4E0BA 1YBAA 1Z7EA 5G4KA 4CL3A 2QYTA 4KDFA 3W6UA 4NFYA 1PGNA 1UXHA 3L07A 4RLSA 3DOCA 5ITWA 4M49A 4BNKA 2X9NA 2PLAA 4JJFA 2JHFA 4OO3A 3N7UA 3DEYX 2H6EA 6ADHA 4B4VA 3HDJA 4GPD1 4WCFA 4YAJA 2QG4A 1C1XB 4PZEA 4QX6A 3VPXA 1PIWA 2UUOA 3AUTA 1BVUA 4E12A 1U3UA 3JQCA 4DTIA 1R4MB 4DPLA 5KJEA 5IDWA 3LC2O 1KERA 2DVMA 2ET6A 3Q11A 1I33A 1VRWA 4YJFB 5FYDA 2O3TA 4RV9A 1CJCA 3RUAA 4CR7A 1H6DA 1PJSA 1I3NA 3BMQA 4IS2A 2PR2A 1JVBA 3I83A 3PJEA 1GYPA 3KRTA 1Z45A 3AK4A 3Q6IA 2UAGA 1ZK1A 3GDOA 4RPLA 3S1LA 3TOZA 5BNTA 2X86A 1TLTA 1Z7BA 1B0AA 2IZ1A 3DTTA 1EVZA 2NU7A 4WLNA 1A4IA 3GZNA 3UW3A 2PK3A 4RCVA 4M54A 1F17A 1PS8A 4FC6A 1KIFA 1CRWG 1X7DA 4PG7A 3U9LA 5FEUA 3LF2A 3F3SA 1E5LA 3JD3A 4WEQA 3MOIA 3PLRA 4E30A 4WCFC 4FDAA 1QV7A 2E37A 3VOSA 2WD8A 2OOSA 2Q1SA 4E2ZA 3GR6A 3NT2A 2VHZA 4J2OA 1LC0A 1PQWA 3V2HA 1NBOA 4A0SA 2W2LA 1U8XX 3KLMX 1R37A 4BKUA 4J1NA 1KEUA 1HDGO 4PVCA 4R9SA 4E13A 3FWZA 4AJ4A 3DOJA 4E2XA 4D7AA 4ZVVA 1LLDA 4L73A 1Y9AA 2O2SA 3LDHA 3OF2A 1HXHA 3IDSA 4EI2A 3HE3A 3F1KA 4MVJF 2YFQA 5THKA 1XCBA 4YJGA 1BXGA 3PDUA 1LSOA 2B37A 2WYUA 3W4KA 1ARZA 3DZKA 4GX1A 4XR9A 3ZWMA 1F06A 1GEEA 4XB1A 5G0TA 1P3DA 4K1LA 1UDBA 3AM3A 2Q49A 3TWOA 1H9AA 3QWAA 4TKMA 3FNFA 4CMEC 3ONEA 2IDZA 2XPCA 4XYBA 4BKRA 1JWBB 1SO8A 5JYDA 4RVGA 1AGNA 2DBRA 3BMNA 1QLJA 2A35A 2OO5A 3H3JA 4RJTA 1SPXA 3IS3A 2Y1CA 4DYVA 5IZCC 3ZWCA 3C85A 3EVTA 3TNLA 5LDHA 4IDBA 3RC9A 4Z6KA 2HSDA 3ZWXA 4YBZA 2PGDA 4IIVA 4NQZA 4GL4A 2WJPA 7ADHA 1NFRA 1GCOA 3NJ8A 1QORA 3LLSA 3KZVA 2UUPA 2IZ0A 4IIUA 1LUAA 2J5QA 1GYQA 2Y0CA 1T2FA 1VJ0A 4QSMA 3GMDA 2NU8A 1PS0A 3WLEA 4B3IA 3RROA 1E5QA 4YACA 1P0FA 4DLBA 5JNLA 3U0BA 3SVTA 3H9EO 1YDWA 3OH8A 2X5JO 3K2EA 1GQYA 4M1QA 5KOIA 3U5TA 1DLIA 1I24A 2A9FA 2GGSA 4NJMB 4R1SA 1PSDA 3OJEA 4R16A 4Q3BA 3LT1A 2XOXA 5JMPA 1U5AA 2JD1A 1I10A 2VT2A 4CQLB 2D5AA 3VC7A 2X0IA 4HP8A 4DMLA 1J5PA 1LXCA 3JYPA 1U7TA 2X9GA 1ULUA 4YRBA 3WTBA 4P4LA 5CAEA 3O03A 1E1NA 3FHLA 2JL1A 1UZMA 1XU7A 1AHHA 2YJZA 4UULA 4WKGA 4II3A 8ADHA 4FD3A 1DFHA 4P4GA 4NFSA 3A14A 3X2FA 5K9ZA 4UEKA 4PN3A 5B4TA 1H6AA 3RFXA 2J3KA 3GK3A 3IQDB 3LT4A 4E5NA 2VZ8A 4Q3EA 3K30A 3ZHBA 1RM5A 3AWDA 3HDQA 2EW8A 1ZK3A 1XKQA 3OQ6A 5A04A 3ANNA 3NT4A 3OETA 4IXTA 4EDFA 3I9MA 1PR3A 3P2YA 3Q9NA 3U09A 4AJKA 4AVYA 3SLGA 2QIOA 1GY8A 2X23A 1TVEA 4Q3NA 3GAFA 5L4LA 2X6TA 5IJZA 1UP6A 1ZCJA 4TRRA 2C2YA 2OUIA 1TT5B 4IJVA 5JCXA 4YT5A 5JXWA 3AY6A 3ASVA 4Y67A 1VL8A 3E18A 3ZH2A 4EEXA 3RBZA 2AQIA 1ZSVA 3JQFA 1YE3A 2HRZA 2FWMX 1QMGA 2LDXA 3VZSA 3KEOA 4B4WA 4ZQFA 3ZV5A 3KSDO 3PI7A 1UXGA 3AOEA 3IOYA 4GX5A 4IPTA 3JQFC 4DLLA 2AG8A 1H0KA 1HE4A 2EF1A 1G1AA 2VTDA 1DFIA 4L76A 4XEHA 3WGZA 1LU9A 2QZ9A 5EL0A 4CQLA 5CG1A 1EBFA 2JJYA 4MVJA 1GPDG 1YONA 1IPEA 3MTJA 4NJMA 1QKIA 5ICSA 2YDXA 3GGGA 3I4CA 1Z75A 4XGKA 3SX2A 3DAGA 3RJ5A 3S55A 3A06A 3DHEA 4DPKA 1W0CA 3A4VA 8LDHA 3OQ1A 1NQOA 1R0SA 1E3LA 3H2SA 4Y6RA 3ZWVA 5LDGA 2VYNA 1IHYA 1JKFA 1VKNA 4CLRB 4CV0A 5ITVA 4WLFA 2C2XA 3INRA 4O1MA 3VH4A 4BMVA 2ZTLA 4KMSA 1PEDA 5EN4A 2J3HA 5JPIA 1W4ZA 5DT9A 1HZZA 3F1LA 3GNQA 3M6IA 5A3VA 1C1XA 3TJRA 3WMXA 4R41A 5TGDA 4W7IA 4LSMA 1QLHA 4RORA 5ENDA 2DAPA 3PEFA 4D43A 1K89A 1EVYA 3CH6A 4BO3A 2O50A 2NU6A 4I1IA 1LDGA 1LJ8A 2AQ8A 4WOJA 3G0OA 1P44A 3NDIA 3IUSA 1PGQA 2Q45A 5GY7A 1LDEA 3WBBA 4KQWA 3SLKA 4LK3A 5EERA 3ONDA 5TJHA 3T4EA 1IE3A 5DBGA 1W73A 3UCEA 3RASA 4YQZA 1RJWA 4MKZA 4OAQA 3FPLA 4Y6PA 1ZJZA 3I9JA 2FP4A 2ZB7A 4NBRA 4FW8A 4CMHA 5KJ6A 3PZBA 1T2CA 3HADA 2E82A 3ENKA 4DQUA 2PKQP 5TX7A 4RZIA 3DXFA 3NGLA 4HFRA 3VZQA 3LC1O 4J9VA 3GC6A 1H93A 2CY0A 1ENPA 1MFZA 1LDYA 3SJUA 3TN7A 5I8ZA 4GLOA 2EKLA 4RGBA 4FB5A 4D45A 2RAFA 3B6ZA 1U3VA 4Z0PA 5IXYA 4OMUA 4RLHA 1XLTA 1X7HA 4ALMA 4E21A 2R2GA 3A1NA 1YL6A 3KYCA 1AUPA 1XG5A 4QO8A 2WM3A 1NQ5A 5DOVA 5A9SB 4XYLA 3ROKA 4ZQBA 1CF2O 3WGGA 1ORRA 2X0NA 5ADHA 5AQ1A 2C59A 3GLQA 3VKUA 5I8WA 2ZYAA 3AY7A 1ENYA 1WZEA 2WD7B 3D4OA 5TF4A 1JAXA 3PYXA 4FFOA 1ZJYA 2FPPA 1U28A 2HUNA 3NUGA 4QEDA 4B8ZA 5AYVA 4U0JA 2HJRA 1RPNA 2JCVA 3I52A 3HJAA 1I3LA 3N58A 1FK8A 2DFVA 2P68A 3R1IA 4IJWA 4E32A 1ADCA 1YVEI 2Q50A 4K6CA 1WDMA 4IDAA 4R5MA 1EK6A 3V2UA 2P5UA 1B8VA 1W6UA 1XQ6A 4BNWA 4OL9A 1F0YA 4YAKA 4IINA 3NTOA 4WEOA 4IDEA 1YB5A 3VVCA 4YJHB 3RC7A 3GDFA 5IFLA 2P9CA 3OHSX 1S7CA 3UAGA 1R4NB 4HBGA 2CNBA 3PK0A 1B16A 1R6DA 1IY8A 1HYGA 2A94A 2AE2A 4CM9A 4HV4A 3PFWO 4IGFA 1U2DA 2JKVA 1R4NA 1CDOA 3GRPA 4TVOA 1KVSA 4JX8A 3PHJA 2VQ3A 3KSUA 5F1PA 3ICCA 4J7XA 2GDZA 1E3IA 2CFCA 2IE0A 1ZBQA 4JBGA 1EQUA 1E3JA 3QSGA 3BMOA 3AUUA 3DAFA 4CMAA 3PXXA 2B36A 4JJGA 1I3KA 4DC1A 1ZIDA 3PJGA 2XF8A 3B70A 1LSJA 2G17A 4UUOA 5BT9A 3PHLA 2I3GA 2DU8A 5KNLA 3FBTA 1U4SA 3DBVO 5JW6A 3S8MA 1T25A 2IXAA 3I23A 2PZLA 4LSWA 2IEDA 1BSVA 4R51A 3AI3A 4GMFA 1M6WA 5U9CA 2BI8A 2BH9A 4W4TA 3AJRA 3JYLA 4R54A 3DOOA 3JQ9C 4QQRA 2W2KB 5EJ2A 5FWNA 4DQXA 2PD6A 2EKPA 5K0ZA 2FOIA 3MJCA 3EAGA 2G5CA 4JNKA 1G6KA 3CSDA 3JQ8A 4MKXA 4PFJA 1QYCA 3AUSA 3GMSA 1OAAA 4XA8A 4ND3A 2XXBA 1GZ3A 2O4UX 2DC1A 3CMMA 1YDEA 3L4BC 1UP4A 3PHGA 4GSKA 4J6FA 3TZQA 4B7CA 3CZMA 2YHIB 3K31A 1KVTA 4ITUA 3WIEA 4D0RA 4EUEA 3WGQA 3GDGA 3UXYA 4W9NA 2YHIA 4Z3DA 2B5VA 2HJSA 4DREA 3WDSA 5IAAA 1WZIA 3CEAA 4BO4A 3NDJA 4D0SA 4CPDA 5CDGA 4XDYA 3E8XA 5THQA 4A03A 5BNFA 3HB5X 4PLZA 3IJRA 2ZATA 2WYWA 5CDUA 4OXYA 5HRUA 2HAEA 4FBGA 3JQDA 3TOXA 3WQQA 2EXXA 5A05A 2WE8A 5G4LA 1M2WA 4RPJA 4XWYA 4BB5A 2X0RA 5JO0A 2JFGA 3PP8A 4CR6A 1S6YA 4XR4A 4BO7A 3VDRA 3LK7A 1C3VA 1TB4A 1EMDA 3K2BA 3OJ0A 1CQIA 5K6AC 4NBUA 1HETA 3WJAA 3AY3A 1Z74A 2QW8A 3U3XA 2ZK7A 2OP0A 1DC6A 1EUCA 1GEGA 3TL3A 1HZJA 1KEWA 2ZB4A 3EC7A 2DBZA 2ZB3A 1A4UA 1PL6A 4YRDA 3E6AA 5CDSA 2AA3A 1DEHA 1NASA 3UICA 1N2SA 4XRRA 1L7EA 4JN6B 4R3WA 3QVXA 4MVJE 3UH1A 4E31A 2HK9A 1ISIA 4FOOA 1VM6A 4E4YA 2GNAA 5L4SA 4EEZA 3QHAA 4ND1A 3PWZA 3BZUA 2DBQA 2J8ZA 3P5SA 4HFJA 1DB3A 2JD2A 4J90A 1A7KA 3ZHYA 1D7OA 3DO5A 4U7WA 2JAHA 3JYOA 3VZRA 1KVUA 2PGLA 2VYVA 1LRKA 3RKUA 1PL8A 4D44A 4NIMA 1HTBA 5JAZA 4JP2A 3WXBA 4NBVA 4N5NA 2AEMA 1SB9A 1V9LA 1P1RA 1PL7A 1YJQA 3BYZA 3GNSA 1KEPA 4RVFA 3RUCA 2YYYA 4YPOA 2P4QA 4K9DA 3HN2A 4FJ1A 4AJPA 3ZNOA 1O5IA 1V3UA 3IIEA 1N5DA 3D0OA 2O7QA 1D3AA 3ZNQA 1YQGA 1C14A 3VPGA 4MVJH 5T64A 1JKJA 2J6IA 4U6SA 4U8GA 4B8WA 4BKOA 4EGFA 5TLSA 4B7UA 4Z9FA 1IHXA 4AJ1A 2I3AA 4MINA 2Q2VA 2DQ4A 4LGVA 1U4OA 2O2YA 3PJFA 1O0SA 2NADA 4CM6A 3WSWA 1QRRA 1E1KA 1QYDA 2BF7A 3PQFA 4I5EA 3RU9A 4UVDA 5C7LO 3E5MA 1Y8QB 2GERA 3DC2A 3FTPA 2OL4A 2OP1A 4EJ6A 2C07A 3HFGA 4KOAA 1WAMA 3ETDA 2GSDA 2PA3A 5I9MA 1KVRA 3F47A 4I5GA 3PQEA 4ZU3A 4W7HA 3ZV6A 2J3IA 3DMTA 2Y1FA 4IDFA 3U49A 4R3NA 4E5MA 1Q7BA 3GVIA 4CMIA 1SCUA 1UZNA 2DTXA 2EW2A 3ASUA 3VH3A 2B0JA 1VKOA 4M89A 3VHRA 4Y6SA 5B4UA 2EGHA 4NDNE 3TZCA 3GG9A 4J4HA 4BO6A 4DXHA 3PRJA 3INTA 3ETGA 3FCOA 3ETEA 3L0DA 4J4TA 3ULKA 1D1TA 2VHVA 4BGUA 1BGVA 1FF9A 1U2GA 2O4CA 2P2SA 1PJTA 3K9QO 4X54A 1C0PA 4ND5A 1NYTA 4NU6A 3PQDA 3G1TA 2X1HA 3ADPA 1DJQA 2CZCA 2PWZA 4QFDA 5I7SA 4XJTA 4LW8A 5JS6A 2D3TA 4BV8A 4LN1A 1QYVA 4WUVA 1JN0A 1OI7A 4UREA 3DHYA 1NVGA 2W2LD 2EEZA 2VUUA 3ZWBA 4F45A 4BNLA 4RVDA 4BKPA 5AXAA 2VUTA 3HQ4O 2X5OA 2Y1DA 1LRLA 3K8ZA 4BQPA 4RVSA 1EVIA 2YZ7A 3TQHA 4KUEA 1JAYA 3WYCA 3O9ZA 2VOEA 3TF5A 1UAYA 3RSHA 4LMPA 1LLUA 1YGYA 2Q2QA 3C7DB 4AL4A 5G0UA 3WYEA 4BMSA 4PLFA 1EUZA 4CUKA 3WBFA 2PD4A 3DFUA 1TI7A 1DIGA 3K92A 5DNAA 1ISHA 3NTQA 4I8XA 2AQHA 1B7GO 2FR1A 4J7CA 2B83A 3QJ5A 4GMGA 3ITKA 4BNYA 4EYEA 1A71A 1V3TA 1RYEA 5L51A 3ENNA 1U1IA 4MDHA 4S3MA 3AUAA 2YY7A 1T1RA 1N1GA 4YT4A 3RD5A 2D1YA 4DIOA 4GQAA 3FF4A 2QHXA 3ZW9A 2QRKA 5EPOA 5L40A 1DPGA 1DSSG 1PJ3A 4J2HA 2AXQA 5I7EA 5IN4A 3WJ7A 1ZSYA 3QWFA 4GGOA 2E48A 1B26A 1X0XA 4BV9A 4PLHA 1ADGA 3AOGA 3OA0A 2UDPA 3R6DA 3HWRA 1SEPA 1P1HA 3H4VA 1I8TA 1C0KA 4OKIA 3C1OA 1PX0A 2PKQO 3MWDB 4FFNA 4H7PA 1T2AA 3B1KA 3WR5A 1EFKA 1OFGA 4LISA 4OYRA 3D64A 3D4NA 3ZWWA 4AJHA 1GD1O 3HHPA 3NKLA 1KOLA 2ZCVA 4D42A 1JA9A 3NYWA 4JROA 4CM9D 3HG7A 1I01A 1LI4A 1VLLA 3RIHA 4O59O 4KUGA 1NAHA 3KB6A 3FI9A 3ZU4A 5KVCA 1YQDA 4UUNA 2UVDA 5KTKA 2ILTA 2XAAA 4B3HA 3VTFA 1Y8RB 4XJSA 2Q46A 3JYQA 4BUCA 4RF5A 4JXKA 4R01A 3WX0A 3FD8A 3DBRA 1XDWA 1VC2A 3RWBA 4IXWA 1ZMOA 4FGWA 1TXGA 3MJVA 1H5QA 1H9BA 1EE2A 1LA2A 4BB6A 4ONEA 3L9XA 3QVTA 5DDIP 3NDRA 1C0LA 4EUHA 1T26A 1ZXBA 5TIIA 1MG5A 3PPIA 1Q0LA 3BXXA 4FPXA 3LYLA 4UVGA 4A73A 4OXNA 3OFSA 2ZQYA 3EVNA 1N9GA 1Z73A 4OXKA 1XQ1A 5KWEA 1KEVA 1LTHR 4HADA 1G0NA 5B1YA 1JTVA 1YOVB 1HSOA 3KEQA 3P7MA 4A26A 3WOHA 2F1KA 4BNVA 3F4LA 5JDCC 4ZQEA 1PJCA 2DPGA 5EINA 1UXJA 5AVOA 1YOVA 4ZN6A 5KCZA 2VYVD 3PHIA 2FRDA 2BGKA 4YVFA 2Y99A 1N9GB 2FR8A 3AFNA 3VPFA 3QWIA 2GUGA 5DCYA 3VH2A 3IKVA 1AHIA 4MIYA 2RIRA 1N7HA 4AJJA 5G0VA 3IC5A 3CIFA 3PJDA 4W82A 3V8BA 3EY4A 4J7UA 1SB8A 2VUSA 2GF2A 3QIVA 3KVOA 3WLFA 2CSUA 3CUKA 2O48X 1X7GA 1WW8A 1AXEA 1Y8RA 3KUXA 1NM5A 4IM7A 4J49A 4WPGA 2QYSA 5H81A 1I5RA 3C1AA 3D5TA 4QECA 3WB9A 4AICA 1E3EA 2YQ5A 4Y9DA 3FNEA 3OEYA 4LVUA 5CPFA 5L7WA 5T6BA 3D3WA 3SBOA 5A02A 5T5QA 3JV7A 3HZZA 4M87A 3RFTA 4ZQGA 5CPBA 4ROSA 1P1JA 3H9UA 4UVIA 4Y8VA 4BNFA 1X15A 1B3BA 2NSDA 3FRJA 4U0KA 4DQVA 1NTOA 5GZ3A 2I65A 3H5NA 1XA0A 5L95A 1LDMA 2OMEA 5U1PA 2CUKA 4E2WA 5IZ4A 4BGVA 4D3SA 1BW9A 2AEFA 1B3RA 5DCUA 3T4XA 5JDCA 1ZUD1 3CE6A 3H8VA 3DZFA 2HCTA 3GVCA 4HNHA 2VYND 2YV3A 3S2IA 4NJOA 4DVJA 5JAQA 1P45A 4KQXA 4BNNA 3P2OA 1X1EA 3H9JA 1P1FA 2I66A 5F5NA 1GL3A 1ONNA 2EJVA 2WEKA 5A5FA 4BOYA 2ZIZA 4F6CA 2B5WA 2ZQZA 1M75A 1HWYA 1NPYA 1SMKA 2FZEA 2HK7A 1Q7GA 3BHJA 3GPDG 4RVUA 3KYDB 4CR8A 1UDAA 2PZJA 2NVUB 1PGJA 3PYMA 3MTGA 1K5HA 4IJKA 4FC7A 2BFAA 5C3MA 3HB4X 4MIOA 4XDZA 2OHXA 5I9LA 1DOHA 3ROMA 4ALJA 3BHMA 4B3JA 3JQAD 4YAEA 4E5PA 4XCVA 4ZQHA 1SOVA 3GOHA 1PJQA 2WMDA 3BMOB 4BMNA 1FXSA 1ZO8A 3E9MA 3PLNA 3QRWA 1FDWA 1DHRA 3L6EA 4I5FA 5EESA 2BMAA 4QXMA 3PZRA 4S1VA 1PQPA 1D8AA 5L45A 1DAPA 4XGIA 3P19A 4BQRA 3OMLA 3MWEB 4IQ8A 1Q2XA 3I5MA 1Y7TA 1BXKA 4RO0A 3L9WA 4F46A 4BNTA 1XSEA 1GTMA 2VRCA 2FR0A 2X22A 1DIHA 2IEBA 1E7YA 3I9KA 2A4KA 5JLAA 1HDZA 4A7PA 1DC3A 1DRWA 2EV9A 4YT2A 1C1DA 1WNTA 5IN5A 5BQFA 4YR9A 1IPFA 3CZRA 1IYZA 4GWKA 5A3JA 1FMCA 1GPJA 3DDNA 4LRTB 3GT0A 1LDNA 1ZEJA 1RM3A 2QZZA 5A03A 3H9QA 3Q2KA 4TRNA 2CMDA 1BRMA 2E6UX 1HT0A 4FJ2A 2JCXA 4PZDA 1P77A 3WQRA 3DMYA 1NR7A 1NWCA 1B8PA 3KYBA 4XKJA 4ALLA 3TFQA 2E49A 1TT5A 3I4FA 3L77A 3Q1LA 3IUPA 1BXZA 3M1AA 1K6IA 1BTOA 2VHXA 5EQFA 1E92A 3E9QA 5GZ1A 1P1IA 3H9GA 4PGFA 3MEQA 5T8KA 2QQ5A 1LQUA 3U4IA 4YAIA 4CLXA 4RF3A 3C1TA 3AI2A 3U4HA 5DULA 3KOUA 3QW2A 3PWSA 3ZZNA 2DM6A 1QP8A 2ZYGA 1GV0A 1KVQA 3L4BA 3LT0A 4BGIA 3IP3A 1QSGA 2GCGA 4MPDA 4PLGA 1CIVA 5T57A 3O38A 5L53A 3LT2A 2BGMA 2Q1WA 5B37A 4DUPA 2G76A 5CHEA 1WXDA 5HTOA 1NP3A 1VJTA 2QRJA 3O8QB 1PJBA 4N5MA 3TL2A 1Y5MA 4CMJA 4ZGWA 3MJTA 4L4XA 4J1TA 2NV6A 1ONOA 1G0OA 3FWNA 1WP4A 4R1NA 3R3JA 3OJFA 3E48A 3C7CB 4LCEA 4JBIA 1FDTA 1GADO 1Y5RA 4M55A 4C7KA 2V65A 2Q4BA 1HE3A 4PRKA 2G0TA 2Z5LA 1WWKA 4DWVA 1UXIA 1LBEA 3ITDA 5CFZA 1SC6A 2F00A 5BSGA 1KS9A 3ZWNA 3UCXA 3GUYA 4ESOA 3JQGA 1HYHA 4MP6A 4C7JA 1IZ0A 2CVOA 4YWJA 1GUZA 4E5YA 1DHTA 3QE3A 1LDBA 2FPGA 1MG0A 1NAIA 2C20A 2HMUA 4UEOA 3RUDA 4AJOA 1F12A 4O63O 4ZRMA 1UZLA 4JIGA 4Z3KA 2YDYA 4UEJA 1V35A 1Z6ZA 3QP9A 1XYGA 3MJSA 4IUYA 4MVJG 3LLVA 1ZK4A 3ZWAA 1DFGA 2H1SA 4RPKA 4NG5A 1KY5A 4RQTA 5IG2A 4GH5A 3GEDA 4XQGA 5IZCA 1ENZA 2Q99A 3G17A 2FY8A 2Z1MA 2VWGA 1CERA 4I5DA 4CM8B 3VVBA 2NUAA 2BGLA 3PVZA 4IS3A 2O7SA 2W90A 4PLWA 2D2IA 4NZ9A 2Q1UA 3CKYA 2X5KO 3JSAA 4J16A 4JQCA 5TQVA 5ENVA 3SJ7A 5MGBA 3OIDA 2YQ4A 3CTMA 4TRJA 4K6FA 3GN1A 2FSSA 4MVJP 3O8QA 1PS9A 2WTBA 4BIIA 3ZCXA 4CLEA 1K6XA 1Y6JA 2D5CA 4UVHA 5JC1A 5KKAA 4I9NA 4W99A 1PZFA 5L4NA 1A27A 5T67A 1A9YA 1T2DA 4NI5A 5H82A 3MJ4A 1CWUA 2HKIA 2O3UA 1BW9B 3RJ9A 2G82A 1AE1A 1QR6A 1SEVA 4BHTA 4A27A 1LSSA 3OM9A 4BO1A 3IJPA 1GU7A 4N54A 4K28A 3GVPA 1VL6A 4BNHA 3UKOA 2DTEA 2VT3A 4BNGA 3AOEC 2PV7A 4YTEA 1IULA 5JO9A 3GEMA 2GRAA 4CM5A 2OBYA 4R1UA 4CM1A 2Y0EA 3ST7A 5F21A 2IXBA 5HS6A 4RDIA 3JQ6A 5IDYA 2DUUA 4XRGA 4J3FA 2Q1TA 2NM0A 2VZ0A 2NNLD 3VAZA 1I0ZA 1PZGA 3F5QA 4YRAA 3WYBA 3UCFA 1WDKA 1E0DA 2X8LA 4ZICA 1MLDA 1W8DA 2FMUA 3WFIA 2GASA 1K0UA 1YL5A 2OORA 5DBFA 5TT0A 4AJ2A 4RPGA 1E1LA 2WYVA 2VRBA 2GZ1A 2NTVA 3U62A 2NQTA 3RVDA
chains in the Genus database with same CATH superfamily
3AG5A 2O59A 1SCKA 1XWFA 2RE8A 1IEQA 2NT4A 3JX9A 1T6XA 5FOVA 4JC4A 5AHOA 3TD6A 4BNUA 4CDMA 4L2IA 2AGVA 3WRWA 4E7PA 4WCDA 1Z25A 1LNQA 2H8KA 1DBIA 2CFOA 4Y2JA 4A3SA 5IXJA 3F9IA 1B1CA 2VZ9A 5HE9A 1FLAA 1EXDA 2F1OA 1W52X 3MJHA 4IFEA 3N8DA 1OR8A 2MINB 2C96A 3HLKA 4OU4A 4KYTA 1L4YA 1ZFNA 2HLDA 3SE7A 3WGYA 2H52A 3D2LA 3EDMA 3GH3A 1YHYA 4YT8A 1VHWA 2FE4A 2IODA 3D6UA 4YNBA 4IIGA 3VAAA 3OIUA 4C0BA 3H2KA 4W8OA 1NYLA 3RT7A 2OWEA 3FOWA 2DR0A 4LWPA 5ER6A 5JJBA 4Q16A 2HFKA 4G5RA 5J2UF 4ZOLB 4EW3A 4NONA 1CQZA 2XMGA 2IYZA 4GGPA 3QVLA 4CUZA 3D1JA 1O6ZA 1C3EA 1CP3A 2NTYC 2FOXA 4DCJA 5BV2P 4QASA 4PSKA 1PT5A 2QRLA 4KVZA 3ONVA 4GVPA 4US0R 1SD1A 4BPRA 3BA6A 2PBRA 3KBOA 5DMXA 3PEEA 4F2WA 4HNTA 2B9VA 2BY4A 1EEHA 2H4XA 3WYAA 4E5KA 1M8GA 2QNBA 2WSIA 5J2UA 2BTQB 3G9QA 1CQPA 1RJGA 3C4QA 1TCAA 4OSPA 1OZHA 3AW8A 3GEPA 3RJMA 1N25A 3RYFB 1L7OA 2AUNA 4JKYA 3GPIA 1IN7A 4J0EA 2O8BB 1IQUA 3CPJB 5AJYA 5DW3A 2VDKB 4GLJA 2QXTA 2ZRPA 4CQMD 3VJKA 1U9JA 5AKYA 1X92A 3CO5A 4NESA 3LE8A 4EW6A 4D4GA 5KVVA 2JKYA 2QPOA 2FAXA 1X1TA 2QLBA 2YHSA 4J03A 3U4GA 2K7ZA 3G88A 2H4HA 5HCNA 1S3FA 2C9OA 3FTQA 4ER0A 1UPAA 1V8DA 2YXNA 2ZJ8A 3QTTA 4C3VA 3NC0C 3N28A 1FPQA 3QX7A 4A0FA 4NYIQ 1H2WA 3LQYA 1JB9A 5D85A 2J45A 3C16C 1G7SA 1SBIA 3BB1A 2PZEA 4W5OA 3H2HA 2W2QA 4D4HA 2VBFA 3X44A 1QIMA 4BCDA 2PH5A 1VRCA 2BSAA 2J41A 3DFFA 1CLEA 3EW7A 3I45A 1VE1A 1GCIA 1GA1A 3R3VA 5DBOA 5EE1A 3V4FA 2BFOA 1OAOA 2EIHA 2XVMA 2P3OA 2B4QA 4XM1A 2O8CA 2CLHB 3DCJA 1I51A 1SZJG 2UVQA 1CUDA 3RKRA 2V4UA 1EXNA 4ZTZB 2JJQA 1P7YA 4HQ6A 4KSYA 4JXXA 2HH9A 2CWWA 2BEUA 3QENA 2YMPA 5DHQA 1XMVA 5LBUA 4L4YA 2RGCA 5I9IA 3LCMA 5JXWA 1W0KD 3Q8WA 4KGDA 1HKUA 4O4IA 2DHQA 1BKSB 1CEYA 4XLTA 2Q5QA 4MUHA 4LGCA 2AG5A 3ESRA 3DBHA 3N9IA 4RMJA 2GK4A 1E66A 4ND4A 3I5AA 2NUAB 4N01A 3DAYA 4TTQA 2XQGA 2B35A 2YV2A 3QWBA 3MCVA 5JATA 2VLIA 2H1RA 4A5OA 3R2JA 5FB3A 1RYMA 4ARAA 2GILA 1YA4A 5L8VA 2HTFA 4G0PA 1U4NA 4RSHA 2G06A 2FSVA 5FO1A 3SZGA 5CFNA 4AKGA 1O6GA 1W30A 2PN1A 1MQ9A 4IJUA 1WMEA 5ILGA 3MJRA 1L5SA 2RCYA 1KS2A 5ECWA 4JYAB 1QWSA 3BG5A 3LLUA 1KDPA 4P31A 1DEXA 4CVNA 4WK0B 1IHUA 1L5VA 4FFRA 2R1VB 3F8TA 1ZJ6A 3V5NA 3C7AA 5DPMA 3I2IA 3TFWA 1TEVA 3I2JA 2OLJA 3GRKA 1WVIA 4IXNA 4HDNB 4O4LA 3E8MA 2E4UA 3HJUA 1K4YA 3DEJA 1X2BA 2PA0A 3PIDA 3RT9A 4BFYA 4D4IA 2GTIA 1NX6A 1EK5A 1RJFA 4X1KA 2WHPB 1XJ5A 4AN4A 4WASA 2IV3A 1DXQA 1R3DA 1VCIA 2ZUCA 4YBRA 1KXJA 2YICA 5J59A 4G81A 4MDEA 1RYYA 2WA2A 1OT5A 1J1IA 4GVXA 3DBLA 1E1QA 5JXJA 3REOA 3WE7A 1BH6A 1W5BA 1IMOA 4FYJA 4ENVA 2PO5A 5K4GA 4BWYA 1V1RA 3JD1A 4OAPA 1OVGA 3HABA 5FX2A 3QPVA 5HF9A 1RM4A 3BFPA 2IHJA 1VKJA 4UUQA 1KMQA 4V3CA 2NPFA 4CBVA 5FV4A 3AJDA 4E5VA 3EZYA 4UNNA 1PSWA 5EXEA 2FEWB 2Q6OA 1LLCA 3WGHA 1VI6A 2WJVA 1H4QA 2EFCB 5JYEA 5EJIA 1GTZA 1P7ZA 3ESDA 4OFXA 4MKFA 4YMVA 4DUGD 4JL5A 2H7VA 3AETA 1AVTA 4ZD6A 3U80A 4CLOB 1Z0FA 2PD3A 3PUHA 1UR5A 4E2YA 3BFXA 3OOYA 1FPMA 2ZI9A 4JB2A 1C2TA 1NR1A 5D5HA 1IUPA 4ZZ3A 3RSGA 3C3PA 4XIYA 5CNKA 5FUYA 1QYWA 4H3VA 2C29D 4J0FA 3TZLA 5EJMA 2DERA 1LBSA 2C57A 1PW5A 3IMFA 3JQQA 4RGVA 2EBHX 3TRDA 1QMPA 2QQGA 1VE5A 1QYXA 2JKZA 3RTEA 3I8SA 2EWMA 2LDBA 2V8BA 1LPAB 2VA8A 3IPAA 4ESEA 4FCWA 3ZKWA 1ML3A 4YHHB 4XUGB 2ZZNA 1GKIA 3KQYA 9ABPA 5LU9A 2QSUA 4JJIA 3ZLJA 3STVA 3FDZB 3AM4A 3BWVA 1O94A 3FUCA 3OTOB 5LP6F 3LW7A 1A8IA 3T34A 1RI1A 1M1YE 3MT8A 4N39A 3SJZA 3F6RA 2X9LA 2BKVA 3WGMA 4AG6A 3B1JA 2ZB2A 4R0MA 2HQOA 4KE9A 2C2HA 1G8MA 5COQA 1NOIA 3BVPA 2ZI5A 3H99A 4OKSA 4F5WA 1YR9A 2YW9A 3WO0A 2GAOA 1TQ4A 4L8VA 4EPXA 1HNXB 1NVDA 4IUDS 5KTSA 3JAMA 2J3LA 1V8FA 1CR2A 2FZLA 4XJXA 3KTDA 5J2UB 1TAQA 1Z5OA 3F7OA 4WKOA 5LIPA 1PX2A 5JCJA 2LCIA 1Y3AA 1Z4PX 3OZVA 1E5XA 4TZ0A 4BLQA 4X00A 4B4UA 1SC9A 2G1UA 1I3MA 2GPYA 5AM4A 3TEJA 1DKNA 1J42A 3O4IA 5LUAA 1F2UB 2GEDA 4FYVA 1NLZA 1HKHA 2IYOA 3IGFA 4HWGA 2YWEA 4FFBB 4PBSA 3ZU2A 4LHXA 1TK2A 3TQTA 4G56A 2QWXA 5EUCA 4CLRA 3IT0A 1XQ9A 3LXUX 4EUFA 1NNLA 2PPVA 3T4PA 3CRMA 3CUEF 1RQNA 1Z6PA 2QORA 2ZXFA 2RGAA 1THTA 2OHHA 3PNMA 3DZCA 2NAFA 2NO0A 4CFSA 4ME6A 2O2ZA 4C2BA 4EVSA 2QDXA 3RS9A 1RYDA 1VZ2A 4ID9A 4OXIA 4MJLA 5BSFA 1PBNA 2VYFA 4WOCA 3UMJA 3ZLVA 3JQAA 4ZRNA 1RXVA 3H17A 3LHFA 5ESDA 2ZB8A 2GN8A 4M83A 1KAHA 3BDVA 4Y98A 3ZHTA 4OUDA 2PBZA 4UU1A 4ZDWA 1E3WA 3ZTYA 1S2OA 2TYSB 2HPAA 4Q39A 1JAHA 2XTMA 3IXLA 1O95A 5FBWB 5IBCA 1C7QA 4OSOA 1M6EX 1ZSNA 3JALB 4QVGA 2A0KA 4N8SA 4CV2A 2ZZMA 1B15A 3T3OA 1D1SA 4UCXA 2EQBA 3B9RA 5H5JA 4ZI7B 3HVRA 3SQWA 3NDBB 2YFHA 2F62A 2XD4A 2C88A 4MARA 4K9QA 4O4IB 4A2PA 3SJAA 1XTSA 3UV6A 5EWMB 5JSQA 5AW0A 1N6PA 4WLEA 1E3TA 1ZYUA 1Q6ZA 4WESB 3V48A 2RHHA 1RMYA 5AXCA 3I8OA 4V0OA 4BN5A 2H5LA 3GRUA 3FYUA 4BCBA 3ZGOA 2RHTA 3AZOA 3D4BA 1RBMA 4FDMA 2PM8A 3QU9A 1QLWA 1OV6A 1OBFO 1O0CA 4AG3A 2VATA 4MGYR 1ND6A 5DYGA 1RXIA 4WBNF 4BKQA 2P0EA 1UBLS 2BKLA 3L7OA 1N8KA 3WFZA 1YDMA 2VQDA 4CUJA 4OHYA 1YS2X 2IKSA 3L7LA 2OBXA 5TMEA 4BL5A 2OV8A 1PD0A 3MJDA 1JEQA 4NK4A 3G7SA 1V2GA 2HMSA 3DULA 4P0PB 3FHOA 5IJAA 5IJWA 4MWDA 3DEKA 1IZ9A 3CIOA 3GF4A 1GAQA 1TKBA 2IYPA 4I4TF 5BSUA 4HJXA 4HRAA 1E0JA 3PA6A 1XEFA 1T0PA 4Q9NA 5H4HA 4CT5A 2IQ5A 1HK7A 5IARA 4HY3A 1UDWA 3RSLA 4G2TA 2CMHA 4MP8A 2EP8A 3JQ8B 1USGA 3OESA 3VJMA 4UPEA 1JEYA 3FHCB 1SM4A 4LXYA 5DBEX 5E1OA 4Q05A 4GM0A 1EHIA 5JAMA 4KXNA 1H6BA 4IOKA 4GI2A 4IQGA 5G1OA 2O23A 1TFUA 4HXFB 1TF5A 3B9BA 2J3QA 3COSA 1VYHA 3HB9A 2PKCA 1X7WA 1DAOA 3EXFA 4I81A 4IGKA 3A04A 2J9RA 4I46A 5C51B 2CMKA 1FP7A 1ZJJA 2NU6B 2R8RA 4IDOA 4OTZA 1Q7EA 3B85A 4NDAA 4UD6A 4RK7A 3IODA 3ELYA 2L0XA 4P83A 4WMLA 4DRYA 2XTJA 4EGJA 1RXEA 5CA1B 2X2EA 1NBHA 4WLVA 3TCKA 4P4NA 2P1ZA 4KI0A 4LZPA 2QTLA 4QUEA 3ABRB 3AZPA 5ECYA 4YDQA 3VNVA 2NZVG 3F6EX 1DJNA 2R6R1 3LVRE 3DV9A 1R15A 3IT2A 1XRQA 4Q6WA 4UDOA 5JZMA 5HS4A 3WLFA 2ATEA 1WD5A 3MVEA 1TIKA 2AFHA 3FZNA 4ZXPA 3U3DA 3UW1A 3G49A 4DWWA 4EUKA 2E1PA 4KUHA 3ZVKA 1FRFS 1XA3A 1U0JA 1Z0UA 3GRYA 4HH4A 4V02A 2ODWA 2DHRA 3FVQA 3WDMA 5L7YA 4CL8A 5HZMA 5JY6A 5FBRB 4MVCA 3KFVA 2O07A 4DCSA 1P0MA 2W2NA 4ZPXA 3UQZA 1YZQA 3PDJA 1E7WA 2JS7A 3QWHA 2VRWA 2XJ9A 5A4IS 3HB0A 5TSDA 2HDOA 1FY2A 5FI3A 3FN4A 4M0DA 1V7QA 1GUAA 2GJAA 3SXUB 1X1QA 4PE5B 3N6RA 3WIBA 2IT1A 1A5TA 5AVUA 2QTNA 1E98A 1OMOA 4URFA 3W9SA 3ZZ0A 2H31A 3IMGA 5TQJA 3H5TA 1ZVMA 3HGMA 2OSVA 4F56A 4ML3A 3LYUA 4NH4A 3G1WA 2CFSA 3ZDFA 4CN8A 3OF3A 4L6CA 3VYUB 4KITB 1AF4A 4DIBA 5G2OA 5D1HA 1L3BA 2OBFA 4BX9A 1RXUA 2EZUA 3LF1A 4X71A 2JFVA 2AJBA 1P33A 2HJVA 4M0FA 4YEDA 2CW5A 2FLVA 1ST3A 1H2YA 1MB0A 2AXNA 2HCBA 2WIDA 5ALDA 4J1SA 4B3SB 1GQ2A 2PZ8A 4BZPA 3QY9A 2IBSA 3PDIB 2NUPA 2C4VA 3EG5A 2R00A 2AOUA 3ZUGA 4ZYZA 2AG6A 5IKEA 4Q9HA 5K8UA 1TM7E 1FSSA 1YU6A 2V7WA 2HWWA 5K8TA 3WGTA 1PO7A 1RFLA 2TMGA 2WR8A 4BNDA 1RJ9A 8AT1A 3EQ7A 4JLDA 4IIBA 4OJKA 4TMTA 2RH4A 2NYAA 4WKCA 5HW0A 5LJLA 1IBMB 4KXUA 1VSUA 5HKLA 4QFBA 3W2IA 1DUSA 3V1YA 1XLTC 1A3CA 5FFMA 3O8OB 1ML4A 3VSAA 2NU9B 1RPTA 1SVSA 2W00A 4KSCA 2BTEA 3HI6A 1FRNA 1Z7GA 1ZM3A 1NZJA 4M0KA 1OI2A 1THMA 1HOXA 3DBIA 1SK9A 2EFJA 3DVAB 4YR7A 3K2QA 4P5DA 3P9KA 4QQ8A 1KI4A 2RG1A 3ABIA 5AXDA 4L08A 3SFZA 2W2XA 4L5IA 3Q3VA 3VPDA 4BLRA 1QAQA 4DABA 5JD6A 1HDIA 3D8SA 3LVBA 5JYCA 1WQ1R 1G5TA 3F98A 4JBYA 4UAVA 3WGKA 1JILA 2VA9A 4D3FA 1IWBB 4DA4A 4NZPA 3H16A 3D7LA 2AN3A 5REQB 2W2KA 1XZMA 2C82A 2W9XA 5EE0A 2COUA 3WLMA 5JH7B 5LZ4A 3Q12A 3RNLA 4DV3B 4EA7A 4IH4A 5SYNA 2EYQA 4XFJA 2AYYA 1H5NA 4CI0B 5CHYA 3ZIUA 3A7EA 2F4VB 3KVYA 1IBRA 5JAIA 2DKOA 1HBJA 4TROA 1H0RA 2HMTA 4F7DA 3TD9A 4P7FA 1QV6A 4NNJA 3T7CA 3F67A 2CLFB 3RBXA 4IHAA 2H63A 1NIPA 3VKVA 2GH1A 4N5DA 3E1GA 4HZGA 1FDIA 1U3TA 4NEHB 2DX7A 3BGIA 4F1WA 4BGEA 3IX7A 4PTZA 1E4YA 1H1TA 3NWPA 5LZ2A 2OHJA 4XOUA 5KJCA 1QIDA 5CVTA 2CYAA 2V6MA 1R8XA 3C5WP 3FKQA 1P31A 2MMCA 1P2DA 3PC7A 4AZVA 3MG9A 2Q29A 1O3YA 3GGPA 3UGKA 1XIVA 5K8VA 2WWRA 1BHQ1 1TQ8A 3FBGA 4I36A 2ZBPA 5EMJA 1V6SA 1E94E 1F8GA 4L0QA 5JTUA 2O14A 4ND8B 4MRMA 1P74A 2XYVA 4ZRDA 2V7VA 3AJAA 4QKQA 2F8SA 1MAUA 4IHJB 1HRKA 4JFAA 2OB2A 4C2TA 1U0EA 4KX3A 2XAUA 1GQRA 4HEQA 5LA6A 1MQSA 3AXTA 1PEAA 3P26A 4NX2A 3ZY6A 2GM3A 1XZBA 4PXAA 3A4IA 1OB5A 2P9TA 3GEGA 4FQ8A 3UA3A 5INTA 3JQBC 4GBED 1EUCB 1UKBA 3C6ZA 2LGJA 5AVJA 1EGQA 5HUQA 3IE1A 1VIDA 1X7XA 3EGCA 1LGYA 4PEVA 2J7PD 3O6VA 2IYRA 1NBME 1LBHA 2XMSA 3AF2A 4LJYA 3WGJA 3WL7A 3QIAA 1A69A 3LX8A 4X3PA 1P2UA 3OOSA 1UZUA 2E87A 3QVVA 5JSKA 4GT1A 3U3KA 1AY0A 2WSMA 4IOLA 3CRRA 1NVTA 4UASA 1JSLA 4HWSA 3V32A 1CUSA 2RHJA 4G84A 2VBCA 3DC7A 3KYDA 3OZWA 5CB0A 5J4VA 4IDDA 2Y0BA 3H11B 2JD0A 4JVNA 4M1EA 4BECA 4HNRA 1LEHA 5CB8A 4IMPA 1BD3A 4ZV7A 2GPJA 2QW0X 3ESYA 4H0NA 4BQIA 4D8VA 1S3GA 4Q34A 4JLBA 1JR3D 2IH2A 1K8YB 4H15A 3ZOKA 1N2XA 2HUPA 4AU1A 3GVHA 4DMFA 4PQGA 2W11A 2ZU0C 2SCUA 1T3ZA 5CGQB 2V0NA 4OQMA 4XUCA 4IIYA 4DJ5X 4O25A 4ACAA 5CDTA 1EFTA 2D4HA 2OFOA 4M60A 3O8DA 2L19A 3H1BA 2OHGA 4C7XA 4DJDC 1V96A 2VN8A 3LPCA 4RNCA 4QHSA 1K3UB 1PJLA 4IMJB 1XDDA 4EW2A 1AO0A 3L8DA 1T5LA 5FI5A 4QJ5A 1XR3A 5B58C 4U5QA 1SC3A 1FDUA 5BR7A 3FLAA 4EFDA 2AFIB 5JNWA 1KC3A 1JB1A 2GO7A 2Q5EA 3F96A 5F2OA 4KR9A 1C81A 3GNTA 2QR3A 4DCNA 1NZDA 2WOJA 1S2MA 1U6KA 5F9MA 3V1UA 2R1TA 3JRXA 1YWGO 4MB0A 2Q6LA 4F4FA 3IOCA 4X1YA 4YQEA 1CCWA 1G3MA 2F1HA 1NW7A 3C3JA 1CUYA 1N57A 3BFJA 5LOVB 3ZI7A 1N34B 1QFJA 1X42A 4KQ1A 4KR3A 2F3PA 3G2KA 1P1KA 3DQPA 5SY4A 4ETNA 3VBEA 3I1IA 2Q3FA 1I4OA 2IVZA 3A9WA 4P2GA 3RODA 2FMFA 3HXLA 4ERNA 2IYUA 4LPKA 2H54A 3FE2A 1XTIA 3SQLA 4TMXA 4NS1A 5DX0A 5B7QA 2G72A 1ADFA 3MUOA 4EO9A 1KZGB 2ECFA 4OYYA 3VDXA 5DBIA 1YKSA 4NAHA 4TV8B 5CRIA 4REOA 4DGSA 5K0BA 3FCYA 5AK3A 3H42B 1NVXQ 4W8GA 2HL6A 5TRTA 5ERGB 3UHFA 3OZXA 5EJEA 5JXIA 1AB5A 1B14A 1INLA 3M2TA 1FYEA 4OI2A 5KIAA 3A25A 1VHDA 1YBVA 2P6RA 4MIEA 2Q07A 4DA9A 1N2EA 2GD6A 3OU6A 1NW4A 1QYRA 3N2EA 3ODPA 3JTEA 4QBGB 4UNSA 1MFPA 1O87A 3FPJA 3JQ9A 5F5LA 3UKJA 3OQJA 5DLDA 1ECCA 1GZ7A 2V98A 2XA9A 2JGFA 1BMQA 3E2IA 5J2TF 1KSGA 2PGXA 4GUAA 1X13A 2H4YA 2C3YA 2R2AA 3EOBI 4N0QA 5ALHA 3ZWYA 4ES6A 3OO0A 3UKDA 2VYQA 1ZG3A 1PAUA 5CT9A 5FA6A 1W2GA 1EHYA 1KH3A 2VNSA 3H6KA 4RY8A 3GFRA 3DDWA 4TQAA 3KEMA 2CBXA 1GU0A 1RZVA 1VBKA 2CLSA 4KEAA 4K86A 1I32A 2MR5A 3RTBA 4LBWA 3OICA 2ZAYA 3TQFA 1D9XA 3CEHA 4D3YA 4KE8A 4YJ2B 3HVUA 4DLAA 2FEXA 4QUKA 3STHA 4FYWA 3WS7A 2XNSA 4P81A 4QRDA 1YJAA 2FA9A 3C2QA 4CFYA 4CLHA 3ADCA 2BBWA 3DAPA 3IEKA 2CLEB 1UK9A 3J81A 3J81k 2FN9A 4G65A 1F0PA 3ABSB 3W05A 1T24A 2WHYA 4PLVA 3ZGXA 1SOWA 5T6MA 2AK2A 4F04A 4MWZA 3EXFB 1PFVA 2EW1A 5CR9A 1UQRA 3BWEA 5CXSA 5BN5B 2W43A 2BBOA 3H5AA 1GA4A 5I9TA 1KOJA 1CR0A 1KBZA 3QG1A 2YYSA 3V9AA 2Y68A 4PXYA 4EYSA 1HF3A 3CZPA 1QFZA 4AF7A 3E58A 4GI5A 2YV4A 4XW2A 4CM7A 1A72A 4OF4A 3L41A 2G6TA 1YUNA 3K8QA 2C1EA 3FRHA 4JYCA 2QRMA 4CRWB 3PWKA 4G63A 4IO0A 2GVZC 3L7DA 2W7TA 2BP7B 1PR0A 1JWAB 2W98A 2VSYA 2XUQA 3DDUA 2F17A 3H4TA 4I6GA 5HK9A 5JD3A 2X7XA 1T4CB 3PPYA 4A8JC 4C3ZA 4IVNA 4GMXA 5DM4A 1JH9A 4D8YA 4XWKA 1P0CA 3QTBA 3FI0A 3DE7X 1KWGA 3OKFA 4XM0A 3GVXA 1VXRA 3FB1A 4R84A 2Q4EA 3M2PA 2XECA 4GKJB 1SHUX 3BAFA 2O0LA 2YV1A 3NTUA 3A9VA 3EASA 5CURA 1ZKMA 3WYNA 2C61A 4G5GA 3VR5A 5J4YA 4BTEA 1C3LA 3LUHA 2O3QA 4NOJA 4BMCA 4ZHSA 1G2PA 4K87A 2J3JA 3QHPA 1Q17A 4MGKR 4M7WA 1ID8A 3AJEA 2WU3A 3P4XA 2Q7XA 2WZCA 2WTNA 2BM8A 3ZNNA 2ZJAA 4G0MA 1WVGA 3H8JA 2H4FA 4Y2TA 5DGDA 2QVZX 1UKYA 4LS3A 1IOLA 2D7DA 1EAYA 2J6HA 4P4SB 4ETIA 3D0KA 3PQCA 4BMOB 2C3MA 2GK3A 1M9NA 2DXIA 1WPQA 3BKWA 5GJVC 1DAGA 3O8LA 1H2FA 3FDIA 3OMWA 4MYRA 3ZXIA 2WFMA 2O3JA 1OXBB 4IYJA 1E3SA 3AB8A 4I66A 2GR9A 3OUTA 4QBTA 3ZN2A 3ZK9A 3WLQA 4JQYA 3T5PA 1GPH1 3LGXA 2C8KA 1WF6A 1ZAYA 1YCFA 1GPNA 1NDQA 4OXRA 3VMMA 4YP6A 1HE5A 2X0FA 2BUAA 2VK4A 3E9YA 1B4DA 3QV2A 2N42A 3A8TA 3CXRA 5MF6A 3MD9A 4JKIA 3I0MA 3TQRA 4BFUA 4P22A 3JRWA 4AFNA 2HJ9A 2R5WA 5E1MA 3K9FC 1YS6A 4Z1OA 5KINB 2B2CA 4UHHA 2X77A 4AXBA 3AU9A 4YV7A 4BZWA 1VHTA 5GONB 4MEAA 1Z2OX 4DLTA 3AR9A 4BNIA 1RRPA 2NO1A 2F3SA 3R9WA 3ZXSA 3TIXB 4L15A 2REQA 2XF2A 4WCFB 2FZ5A 3X1MA 3UF0A 4KNVA 4PU0A 1BX0A 2YOGA 3STYA 3K0BA 5C34B 1E2UA 4RY0A 3EQ8A 2PUEA 1GSIA 3CW8X 1D1QA 1E2IA 1OGJA 2A78A 4HLNA 2D3WA 2YIJA 4INAA 4JOCA 1II8B 3G8BA 3MELA 4J0QA 1XTRA 4LA4A 5FPQA 3BXPA 4H6XA 1TKAA 4TXJA 4C7OB 1R0CA 2JHAA 2XXJA 1JNYA 2CB9A 1HNNA 2JIZD 2QJFA 1I2MA 1NGSA 2YXDA 1FW6A 1UFRA 3CX7A 1OZAA 3FPHA 4GI1A 4FHCA 5IAOA 1JLKA 1V41E 1WZUA 4F3TA 3JWGA 4M0EA 1ZD2P 5I7VA 4IGAA 2HU2A 2XMPA 1T9KA 2FTKE 3LOQA 5SZHB 1R5NA 2X5XA 5B1IA 4LF9B 1Q3TA 2PJUA 3NI2A 4WE3A 4OREX 2VNKA 1JA0A 1N77A 4W1RA 4YB8A 4F84A 1DCMA 2ZFUA 3O26A 4UU0A 3M6WA 5DEIA 3CE9A 1GAEO 3DR5A 3DTVB 4YDRA 1J4AA 1TIBA 3RQSA 3S44A 1FUYB 3I2KA 2HN9A 2QBYB 1YS4A 3ECSA 1VSVA 3KOXA 2CDRA 4P5EA 4UHBA 5C8XA 1XMXA 3Q5DA 3MTBA 4M6WA 5T8KC 2CF6A 2QU8A 1FP6A 2V0CA 3JWHA 3P4UA 3RFUA 3RU7A 5TEVA 1E9EA 1K8QA 5DN9A 4NCBA 2JEOA 2BLLA 2HLDD 2FMXA 3OUUA 4UUPA 3VU9A 3OPNA 3OOEA 4KTTE 4ZDKA 5KTRA 4JELA 4CFZA 2LCFA 2X1LA 4PXSA 2X40A 4GZ5A 1OOEA 3USES 1XRNA 4MUEA 2AVDA 4PLYA 1D6NA 1NP7A 3QGMA 3ZIAD 3Q72A 2DTDA 2PIDA 4B46A 3ID6C 1CV2A 2I6TA 2B9EA 4CG1A 1YBAA 4ZARA 5G4KA 4CL3A 2QUJA 1FC0A 1PGNA 3V7YA 5B6IA 1UXHA 4B3DA 1ZGJA 2WWIA 3H1EA 3IIIA 3T7RA 3QKSB 4BNKA 1CS0B 2X9NA 2R5NA 5C8YB 2FZ4A 1FTSA 2D2VA 2JHFA 3WLJA 2R11A 2VDPB 2GXSA 4ANFA 3GLFE 2Q8PA 2RHGB 3D6FA 2ICAA 3ZG6A 2EKZA 3CTPA 3DLPX 3L82B 3OOJA 4GPD1 2NXCA 2IXDA 2AI3A 4YAJA 3ZKAA 4QX6A 5KQGA 3FKJA 2UUOA 4GPEA 4JBLA 3N5KA 4M0PA 4C06A 1N6OA 3JQCA 1RWOA 2JK1A 3V4OA 1N6RA 2ZWMA 4GQIA 4DPLA 5IDWA 3LC2O 5CYGA 2ABWA 2CHVA 2ET6A 4KQIA 1YA8A 4YJFB 5AW5A 1QK3A 2G07A 3W5HA 2I9KA 1VLMA 1XHEA 1CJCA 3EBPA 4IGIA 1PJSA 1YVUA 3OWXA 3S3TA 2FE1A 1M2OA 3WQHA 3FUWA 3F0TA 5FXMA 2PR2A 3AIMA 3V4SA 3I83A 3B13B 3Q6IA 1Z45A 1HMPA 4J6EA 5BYAA 1PNQA 1VQ1A 4ZU1X 4REQA 4I55A 3NGMA 1UOEA 2QX9A 2NU7A 4L5AA 5I45A 2ZI4A 3UW3A 3SZOA 3CZ5A 5ELMA 1PS8A 1CRWG 4DWJA 4HGPA 5FEUA 2FWPA 1E5LA 1Z0KA 3HC7A 1FNBA 3CBGA 3O4JA 3MOIA 4RHYA 3KVRA 4RY9A 4UZEA 1JBQA 1H2AS 3C8DA 4E30A 2ODBA 3H4MA 2PO7A 2E37A 4MR9A 4BVKA 3GR6A 3L0OA 3HA5A 1LC0A 3C87A 1NBOA 1P4RA 3IPCA 2B4AA 3O2NA 3A9TA 3T1VA 3VPBA 1NBIA 4PCLA 2ZM6B 1YDGA 2K4MA 4J1NA 4BKUA 1T4GA 4K3UA 2ZJZA 4XLZA 4KK3A 4TTIA 3VRHA 3UFBA 4AJ4A 2KWIA 1DX4A 2EWWA 4D2IA 4DUYB 4E5DA 3KLOA 5EP2A 2GFQA 3IDSA 1E8DA 4DWOA 1SULA 5BMVF 4DUZB 4JEHA 2C8VA 1KXZA 3VI3B 3FMGA 1XCBA 1H4VB 4D8TA 4YRQA 3CLHA 1N2OA 3I01A 3PUVA 4QPNA 5H02A 2WYUA 1XRPA 3C8UA 1ARZA 4DLUA 3N05A 1WXIA 3X1ZA 4EYQA 3LHIA 4PF1A 1SUEA 4XB1A 2XI4A 5HKAA 4PNHA 3I8XA 2P2ZA 2BFWA 2ZROA 4NBLA 5IHPA 2BEKA 2PQ0A 5KWSA 3TWOA 3UC9A 2CHUA 4DM3A 2YVQA 3MT0A 2X3UA 4TKMA 4CMEC 4LF8B 2VDUE 1G9XA 5K8JB 1JIKA 4L22A 1SD2A 4M8LA 3L5OA 1L5FA 1USIA 2OYRA 1SO8A 1UBFA 3GJ0A 4MZXA 1OB2A 1CG6A 1DWOA 1QLJA 3BMNA 2IX9A 3DWEX 1JR6A 5G1PA 2QXUA 4L78A 3IS3A 5FPSA 1P18A 1W36C 5K0SA 1BS9A 1Z0DA 5JOQA 1Y3CE 4M8KA 1EA5A 2X5NA 4Q7LA 5EJFA 1VE7A 3C85A 3EVTA 3ZWCA 3NONA 2FP3A 2VDJA 4OX9B 5LDHA 4IDBA 3RC9A 3RYTC 1CR1A 2PGDA 2EX4A 3TTYA 2P6OA 2B1GA 1SC1A 4C4TA 4D9EA 3W5CA 3PXDA 1R9JA 3NJ8A 4EUSA 3KZVA 4HEHA 1N6KA 1GYQA 4TTAA 2Y0CA 1LB1B 1G6Q1 2WB4A 4L85A 4HHEA 4WN3A 3RROA 3THXA 3AHEA 1ADYA 5AUPB 2BN4A 2OHVA 1KZ4A 3DF9A 3OH8A 4MS3B 2PCJA 1GQYA 3UENA 1DLIA 4AUNA 1A4RA 2WA1A 2ZBFA 1SWWA 3K9CA 3OJEA 3OCVA 3PEUA 3Q7EA 4Q3BA 3LT1A 1JLLB 2WKQA 3AR7A 4TVKA 4N49A 2O1EA 4B6FA 2CKDA 1U5AA 4FOTA 4EG4A 3WL3A 2C77A 5M29A 4X90A 2X0IA 3G5MA 3GIDA 3BFVA 1QIHA 1RLTA 3EGEA 5KNDD 2I8CA 5FNVA 1FFSA 3KQHA 2JJMA 2YWRA 1GL6A 3E5HA 3NHLA 4XVUA 1P9RA 2X9GA 1EFHA 1BC5A 1Q0SA 3OPYA 1T9GS 3P2IA 4TM7A 2WQ6A 3TB6A 1EWYA 1DBRA 1UZMA 4ERXA 5JZ9A 4FYKA 3V7NA 4DR3B 4R2JA 1QZXA 2A9QA 5SYAA 5FOXA 4A8TA 3LCUA 4WKGA 3NOVA 3VR1A 3HZRA 1F9AA 3HO8A 4FD3A 4B5LA 1CUIA 2Y1KA 2ZYSA 3VR4H 4QTYA 2IGTA 2WFZA 4QWWA 1MO3A 3KOYA 4QPPA 1MOPA 2J3KA 1WZ2A 3EPHA 1MENA 3TLEA 4C4XA 4K9RA 2VZ8A 4ZO7A 4Q3EA 4OXXA 3ZHBA 4RYLA 2HSJA 3AWDA 1F3LA 5THXA 1RRMA 2C5SA 5JNSA 1RLOA 4GYJA 3PCXA 2GKOA 3OG9A 4IUBS 2DPXA 3WBJA 4QZVA 3P97A 5DK6A 4E22A 3ANNA 1XQVA 4LHYA 1LNSA 1U02A 3WLPA 4EB8A 3Q9NA 3EZXA 2XA2A 3U09A 2PPLA 4MCHA 1UBJS 2QD2A 3FMFA 1GY8A 4LBVA 3DVLA 3UXEA 2X23A 1AV7A 3FYCA 1TVEA 3E1SA 4IHQA 1RWPA 2QYHA 3GAFA 5B3JA 5HM6A 1RHMA 2ONJA 3U31A 4BFSA 5IJZA 3THWB 1ZCJA 1C3JA 4GGMX 4TRRA 5FNZA 4M9CA 3A2KA 4Z3OA 2PRSA 4QUAA 2OUIA 4IJVA 4NU8X 1NX9A 3RYHA 1TYEB 3E9RA 3NHKA 3ZCRA 4EI9A 3AY6A 2ZIVB 1VL8A 3OT1B 3GX1A 2VP6A 1CIJA 2JFBA 1S3IA 4FFVA 2Z1DA 2D62A 1P19A 5IWCA 2ZR0A 2YVKA 3LCJA 1BE8A 2HRZA 3D02A 4H0FA 4O2RA 1IG0A 2RJOA 5EOVA 2LDXA 5C3UA 3WIDA 2FU5C 4ZQFA 2G1AA 5DTMA 2ZIXA 2R25B 3DKVA 5LYYA 3PI7A 5BOSB 4KR6A 2J4DA 2AN5A 4HJRA 5CVJA 3CX3A 3STUA 5JLJA 3RAFC 2GBCA 3GGDA 2OZKA 1KAEA 3H86A 4MJXA 2BR3A 2XCTB 5CIWA 3NV7A 5D5QA 3V97A 4AZTA 2Q3HA 4DLLA 3CH5A 2QF7A 1SRQA 2QLTA 5CCXA 1TAGA 2BTOA 3GLUA 3IAS6 5H3LA 4F12A 2ZIGA 3K94A 2QZ9A 4FWBA 3OX3A 4CQLA 2B3DA 5CG1A 2JJYA 2QVYX 3LBFA 1TJ5A 3IP9A 3P4YA 4QPDA 1YONA 2GA9A 3LRPA 2QTZA 2V3WA 5FO0A 1IPEA 3SZMA 5KNCH 5AVSA 1RYHA 2ZRIA 2HF8A 1QKIA 1T13A 1GNPA 5LYJA 2JARA 4DLNA 4L4ZA 4ZCRA 2JZCA 1D0VA 5FUBA 2KMLA 5A1JA 3SX2A 3RJ5A 4PS1A 1JQ3A 3CCCA 4QLBA 1MB3A 3G9UA 3R09A 3OQ1A 4FGJA 4BE9A 5JVDA 3KE9A 1R0SA 1E3LA 3BQMB 4Y6RA 3RYCA 4M9SA 1M2HA 1VKNA 5ITVA 4CV0A 4CLRB 2ZBRA 2C2XA 4WIAA 1O2DA 2ZTLA 5EN4A 3SD7A 5LMZA 4MQEA 4YUZA 5CH8A 3MPOA 3SDSA 4BX0A 2PRJA 1D09A 4AURA 2IX3A 5ISMA 2D1TA 1YK1A 5A3VA 1TM4E 1XXHA 5TVKA 3LWZA 4W7IA 3IAM1 3V1NA 1WY7A 4XVQA 5FD8A 1UIMA 1L4GA 2VPIA 1OBHA 4LDPA 1K89A 1C1HA 2JJ2D 4RM2A 5D86A 4D43A 3PDCA 3AIKA 4ZZ1A 3WNDA 3CH6A 3FMVA 2H9YA 2PMKA 1OREA 2AI1A 1LJ8A 1XRLA 3G0OA 3NDIA 2D5IA 5GY7A 4CCSA 1Q3HA 2V58A 4HCJA 2CL6X 4X6YA 3SLKA 4MV8A 1YQQA 1W73A 1BX3A 2FUCA 2NSHA 2HCJB 2HA6A 4G4SP 4HLQB 4LY9A 3RASA 4HEJA 3GT7A 5FWAA 1RJWA 1VFPA 4MKZA 4OAQA 4DLPA 2QTAA 1ZJZA 1XKLA 3L1KA 3QLVC 3IAEA 4FW8A 3VI4B 3PNKA 5KJ6A 1T2CA 2Q8QA 5FTMA 3ENKA 2A58A 4YH1A 3SK0A 5HJ2A 1PHPA 4G5QA 2VAVA 1A0OA 1I80A 2JIMA 2YN2A 3DXFA 3HEMA 3MWDA 5GZ3A 2CY0A 1TNDA 3LWDA 1MFZA 1QCYA 3FLEA 3O3CA 4KLRA 1PZNA 5AFSA 2EKLA 1EFVA 4O33A 3K0HA 3ONNA 4NAUA 3NPMA 1M10A 2RAFA 5LSAA 1U3VA 4LE2A 1AUVA 1M0WA 2QMZA 3EGWA 1GPAA 1L8LA 1LW6E 1X7HA 2J3DA 2W6JD 1NW9B 1J8DA 4JFRA 2AN4A 4G23A 2C1ZA 2PFSA 2QZPA 1Z18A 2FCRA 4KGVA 3VR2A 3SHTA 2Q2OA 4IG9A 5DOVA 1EFPB 1N4DA 3AHIA 3RSFA 3HJFA 3AF1A 3KIPA 3IALA 4IO1A 4ZAFA 3RH0A 4LYYA 1T9HA 5ADHA 4KR0A 4X44A 5E9AA 2WFLB 3A70A 4HPWA 4RSGA 4ZWNA 1DG1G 4CQJA 5IM4F 2UZ1A 2YRWA 3AY7A 4BMXA 4U7HA 1WZEA 2NIPA 2WD7B 3D4OA 2CD7A 3R75A 3CNNA 1VYVA 2G9UA 3EGDB 2ZUTA 5EKSA 3L8EA 3IIKA 4U0JA 2Q6IA 3OZDA 2QP9X 1PT8A 2YMLA 3AQIA 1HDEA 1RPNA 3CO0S 3ORHA 5BYJA 1IRXA 2P6MA 4CETA 5K03A 4W5JA 1T5OA 4P3PA 2IW3A 2DFVA 1FK8A 1GT91 2P68A 3KZCA 3R1IA 4NAVA 1GTVA 2WUDA 4Z9BA 2QL5A 2HNBA 4IDAA 4PIPA 1B8VA 5IANA 4Z4QA 3UH0A 3IA2A 1JEJA 3P0EA 3JVDA 1F0YA 3G9TA 1WLSA 3NTOA 4O4JF 3FJOA 1DP4A 2I6UA 2UUAB 3A1FA 3ED5A 4X65B 3PC2A 4YJHB 4C30A 2CXSA 4EGAA 5IFLA 5C4MA 4JU8A 2SHKA 3L6RA 1KMCA 1I6MA 3RYCB 3K6KA 2P30A 4HWTA 4P3XA 4NHOA 5K4HA 5U4XA 4MB2A 4BFTA 4RC9A 4P53A 3G0GA 1H0HA 1MC8A 1ZWLA 3ZK8A 5IABA 2AE2A 5FI1B 4HV4A 4ENPA 2B82A 4IHJA 4LYHA 5BWLA 2TRSB 1K7XB 4Z99A 4JB3A 3QPAA 4TVOA 1EX6A 2VQ3A 5KVAA 1ZOLA 3EY9A 1FS4A 3P27A 3IP8A 2GDZA 4KQFA 1RU3A 1GLNA 3BMOA 3AUUA 2XQKA 4E03A 1J20A 4RQAA 1UBTS 1USVA 1Y6FA 2BVNA 2L17A 3IP5A 4QGFA 4QPCA 5HIKA 1ZQ9A 1AZTA 1ZQ1A 1MW9X 5IMSA 4RXUA 1TO2E 2QAJA 3CA8A 2YJNA 1Y9ZA 2IHBA 2Q9BA 2YJ5A 1FSZA 3EG9A 3OKCA 5F2EA 3WNZA 2WILA 4UUOA 4MV5A 3D8RA 5DXAA 1XKXA 2DU8A 4Z7QB 3V4LA 1A88A 2VS1A 1H4TA 2LKDA 2V97A 1XZDA 5JW6A