1GA4A

Crystal structure analysis of pscp (pseudomonas serine-carboxyl proteinase) complexed with inhibitor pseudoiodotyrostatin (this enzyme renamed "sedolisin" in 2003)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
369
structure length
369
Chain Sequence
b'AGTAKGHNPTEFPTIYDASSAPTAANTTVGIITIGGVSQTLQDLQQFTSANGLASVNTQTIQTGSSNGDYSDDQQGQGEWDLDSQSIVGSAGGAVQQLLFYMADQSASGNTGLTQAFNQAVSDNVAKVINVSLGWCEADANADGTLQAEDRIFATAAAQGQTFSVSSGDEGVYECNNRGYPDGSTYSVSWPASSPNVIAVGGTTLYTTSAGAYSNETVWNEGLDSNGKLWATGGGYSVYESKPSWQSVVSGTPGRRLLPDISFDAAQGTGALIYNYGQLQQIGGTSLASPIFVGLWARLQSANSNSLGFPAASFYSAISSTPSLVHDVKSGNNGYGGYGYNAGTGWDYPTGWGSLDIAKLSAYIRSNGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE-CARBOXYL PROTEINASE
publication title Carboxyl proteinase from Pseudomonas defines a novel family of subtilisin-like enzymes.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Hydrolase/hydrolase inhibitor
total genus 140
structure length 369
sequence length 369
ec nomenclature ec 3.4.21.100: Sedolisin.
pdb deposition date 2000-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ga4A00
4NMXB 4AKTA 3DW1X 3DE0X 3AJ9A 1SIUA 1V5IA 4CFYA 1TM1E 1GA4A 1S2NA 1DBIA 1AH2A 4DJ5X 2SNIE 1ZVKA 1Q5PA 1P7VA 3EE6A 1NLUA 5JXIA 2W2PA 2DUJA 4OV6B 3F7MA 3AJ8A 4AKSA 1GTG1 4C3VA 1BH6A 1CSEE 1GTL1 1HT3A 1C9NA 1IAVA 1SBTA 1P8JA 3QFHA 1WSDA 4WOCA 2QTWB 2W2MA 1BJRE 3VV2A 1GNVA 1C3LA 4OMCA 1WMEA 1ST2A 1WMDA 1SCNE 2PMWB 2Z2ZA 2PKCA 1Y3CE 2XRMA 4M1ZA 1C9MA 1TM5E 1AQNA 5JXJA 3BPSA 5ARBA 4HVLA 3DE4X 1SBIA 3I34X 3D43A 1SBCA 2W2NA 3F49S 3TI7A 1OYOA 3TECE 3ZXXA 1PTKA 3WIVA 3P5BA 1SUBA 3F7OA 1PJ8A 1SCBA 3I2YX 1SCAA 3BGOS 4YN3A 1R6VA 4Z2AA 3A3NA 3Q5GA 1SBNE 4I0WB 1S01A 2ZWPA 3DDZX 1KE1A 4H6XA 1BE6A 4KG7A 1VSBA 4GI3A 3CO0S 5AMXA 1SCDA 1ZVJA 1NDUA 1SBHA 2W2OA 1TM7E 3DE1X 4NE9A 1SELA 2E1PA 1A2QA 4JP8A 2DP4E 2GKOA 2Z2XA 3OSZA 1P7WA 4BWGA 2ST1A 3GCWA 2Z2YA 1GT91 2SICE 5AQEA 3WHIA 2ZRQA 5ARDA 1SUPA 5K7SA 1TM3E 2Z30A 1NDQA 3SICE 1Y1KE 3BX1A 3VTAA 3TI9A 2WUVA 1YU6A 5JXHA 3EDYA 3A3PA 5AVKA 1WMFA 4ZARA 5SICE 1KE2A 4MZDA 3DVSX 1C9JA 3VHQA 4ZOQI 1SIOA 1UBNA 3I30X 1Y9ZA 3H42B 2V8BA 5ARCA 2PWAA 3DWEX 3SQOA 1WVMA 5FAXA 3VV3A 1R64A 1AK9A 2HD4A 1TO2E 2Z57A 1SPBS 1T1GA 4DWWA 1EA7A 3DE5X 1TK2A 1TO1E 4J94A 2ID4A 1TECE 3L1KA 4CG0A 1MEEA 1TMGE 1SN7A 4NE7A 1XF1A 2IY9A 3DE2X 1KDVA 3D9QX 1Y34E 5FBZA 2SECE 3LPCA 3DE3X 4K8RB 3A3OA 1AV7A 1PFGA 3UNXA 3PRKE 2G4VA 4KB5A 1GCIA 2ZWOA 2PQ2A 1OT5A 1Y33E 2IXTA 1AVTA 3LXUX 1Y3FE 4WOBA 1EGQA 4FONA 1V6CA 3DW3X 3ZXYA 5CW1A 1GA6A 1GNSA 3WQBA 2XTJA 3I37X 4HX2A 1SVNA 1OYVA 2W2QA 3VSBA 1YJBA 2Z58A 1IC6A 5I9SA 3Q40A 5B1EA 2WV7A 4OMDA 2X8JA 1JEAA 1Y4DE 4DZTA 1SUDA 1BE8A 3GCXA 1MPTA 3DE7X 4CFZA 1Y3BE 4H6WA 3DVRX 4H6VA 1SIBE 3VYVA 1SUCA 1Y3DE 2SBTA 3DYBA 1YJAA 2PYZA 2WUWE 1SUEA 1LW6E 1T1EA 3HJRA 2X8JB 2ID8A 5JMOA 1PEKE 2P4EA 1SH7A 1Y4AE 3DVQX 3GT4A 2PRKA 1KDYA 1DUIA 3LPAA 1YJCA 3QTLA 5B1DA 3QMPA 1KDZA 3CNQS 5FFNA 1CNMA 1AU9A 3DE6X 4LVNA 1TM4E 1GA1A 1T1IA 1S02A 5AVJA 4KPGA 2PWBA 3PTLA 3AFGA 3GT3A 1SUAA 2TECE 1ST3A 1BFKA 1GTJ1 2WWTA 2DQKA 2HPZA 2Z56A 4LVOA 3EIFA 1BFUA 1SCJA 4C3UA 3T41A 1THMA 4RYDA 1Y48E 3WIUA 1AF4A 3LPDA 1R0RE 5JXGA 4B5LA 2B6NA
chains in the Genus database with same CATH superfamily
4GMHA 4UBKA 5EYPB 1QKKA 4UHBA 2R11A 2R7AA 3SBOA 2H3HA 3R5JA 4O4LA 2J09A 1U3CA 1ADCA 3CR8A 1NONA 3FW1A 1EFHA 1L6RA 1Z83A 2GCEA 3DE0X 3GT7A 5ALLA 3X1DA 3H0CA 1RXCA 3L82B 1N34B 1J0DA 2HA7A 4LHVA 5IVKA 4EQZA 3V9PA 1SKUA 4HFJA 1OLXB 1OI2A 3ETCA 2KE5A 1NYTA 4U2DA 4F45A 2BGTA 1XT6A 2CW5A 5IVHA 4LJ4A 3AOEA 1LK0A 3ZI0A 1N0WA 1NXSA 2IU0A 2ZUFA 1PFUA 2UZ3A 4X7RA 3DWGA 1OJLA 2GNAA 2SNIE 1O3YA 4NS1A 4V39A 3UT6A 3IXMA 4D3XA 3RS8A 4XVCA 1E2QA 4CEIA 4MSUA 4E4TA 2QRVA 4KBGA 2HFKA 1THTA 2QXYA 3VU3A 3AIKA 3EVZA 4G56A 3VHRA 3T99A 3TLGA 5DBIA 4DLTA 2P75A 1NTRA 1TC2A 2I66A 3LQKA 4RMGA 4JKIA 3SQLA 4PYRA 3WL6A 4DR5B 1SCIA 2P9FA 4NICA 5A4JA 3WHLA 1O97C 4AL4A 2PX2A 4XFDA 2APJA 3MJHA 5LUBA 3IESA 2WPDA 1BDHA 2DTEA 4QTYA 3GCGA 4GGPA 4FKBA 2F8LA 2D6FA 2DQYA 4OSOA 3D4LA 4CM8A 3PYXA 4PGAA 3U44A 5A5VA 1I7QB 1VQ1A 4MINA 4TMFA 5FOTA 2XECA 4PYJA 3QPVA 2BE9A 4TYMA 4NSNA 5D6NA 2KJQA 1T9KA 2W6ZA 1GTG1 3QLJA 4OL9A 1HDYA 3NAQA 5EERA 4O2LA 5K4GA 1N2XA 2WWHA 3BRSA 1CHDA 1HT3A 3NVMB 4Y9SA 5KQMA 1RZRD 3PUKA 3R77A 3ZHSA 2P35A 3C3XA 2C92A 4C7MA 5EJEA 3OQIB 4KXFB 1SR8A 1OB5A 1E32A 3FDZB 2V6BA 3OQPA 4RVGA 3RC8A 5I4IA 3VI4B 1Y8CA 4CLOB 1DARA 4PIPA 1EVYA 2Q3LA 1T1SA 3JZIA 3KQYA 3KWFA 3KOOA 3D0KA 2IKSA 3A4YA 4M1TA 2QYHA 4JENA 4ES6A 3FMIA 3FMOB 3RT7A 2P9EA 2D0IA 1EJ2A 3K70C 1X1RA 1ZNYA 1DMRA 1CR4A 2VK1A 3UUFA 3LO5A 3B2EA 1ZMXA 2J5BA 1SM4A 3HVKA 3QUTA 3IO5A 2HUPA 2XT9A 4AY2A 3QE2A 1GNVA 5AT1A 4HJXA 1JHVA 4PG8A 3FF4A 3F7NA 1FVOA 4Z49A 3G5AA 3JAWB 4M9ZA 4ESOA 5JOQA 4LSWA 5E4FA 4YGYA 3GOQA 3MRSA 4RTNA 3CR3C 3N0WA 1X1SA 5CAEB 2OHFA 1U7WA 4ZQCB 4WFJA 2V4ZA 5LM3A 5FLYA 4G84A 1ADYA 1QKIA 1X2BA 2C97A 3SK0A 1MX3A 2W5UA 5L9AA 4ABYA 1D5CA 1XE3A 3N87A 3D6JA 1ORHA 1L4YA 1Z0DA 2GD1O 3ZWMA 3ZHVA 8ABPA 3TB4A 4NCIA 2Z43A 2P65A 1IN8A 2XQGA 4RFSB 1QHHB 3MWYW 4DN6A 3SJZA 4JA0A 1IWBB 2BEVA 5FBLB 1ENPA 1G5IA 3ZJVA 4COKA 4AC9A 1WDKA 5DCWA 3NWOA 5DXAA 3SM3A 4D0LB 1QRAA 2LCFA 1CQIA 4IQ8A 3KK0A 4C06A 1Z4MA 2JFHA 3WIVA 4YASA 1E62A 5IDYA 1PZGA 2H4ZA 4R3WA 2YKGA 1M3SA 3OECA 1E6MA 1JR4A 4P08A 1UFKA 4JVLA 1PJ8A 1G66A 5J4KA 2QSYA 3ETDA 5E9QA 2PZEA 4KN6A 5K0NA 4F85A 1Y7IA 4QYXA 3M1AA 2GERA 2R6ZA 3TUJC 4JUCA 4PINA 1JJFA 5KU7A 4RANA 4HEHA 3ABRB 4RKEA 1Q7CA 3NG1A 1CY8A 3QX3A 2WAOA 4EMSA 1WL8A 3GZ4A 4J29A 4Q1AA 5ENDA 2ZJ0A 2F90A 4IDEA 5KCMA 4YVFA 1W46A 2QDXA 3AU8A 3BREA 2DZDA 3CW9A 1VYVA 1ZQ9A 1UDAA 3HCRA 2ZUEA 1FXWF 2P9HA 1Z5GA 2JZNA 3KYDA 4TXNA 1KYXA 2FR0A 1NJFA 3MRXA 1LQTA 4KWEA 4EELA 4W6ZA 5ITWA 2P6RA 1NG1A 1Z5NA 3QHPA 2A9PA 2QRUA 4KG7A 1H3FA 1II8A 1XXHA 5JC1A 4R83A 4C7BA 2EP5A 4EEKA 4F96A 5I3ZA 2C8KA 2FPGA 1I1HA 4M98A 4RWEA 5K0TA 4Q3BA 3MCUA 4I4TB 4AN1A 4WK6A 1JPUA 2YIDA 4IO1A 4N0DA 1V4NA 5EIBC 3V4LA 3PEEA 4ZIRB 3IE1A 2O8BB 1FX1A 4KZPA 2G9ZA 2HA3A 2E4ZA 4JVNA 5B36A 3M3DA 3L0YA 4EYOA 4DBLE 5EKDA 2ZRPA 4PZUA 1G8YA 1GGFA 1T6XA 1FVHA 2GEDA 4X3OA 3KFLA 4DTIA 5D87A 5JAMA 3DBVO 3E0QA 1QX4A 3D8NA 2GYWA 4P4UA 2ZM5A 3FLEA 1FPQA 2OBBA 1P1RA 1EE9A 1GT6A 1KYTA 3M6FA 2UXCB 3MWJA 2RGCA 2ZW9A 4A1FA 2XYHA 3O2JA 4IQ4A 2CSXA 2CNWD 5IK2A 4LVCA 1DDOA 4PRKA 2OCAA 2X9QA 4JQYA 1QG2A 3STHA 7ADHA 5JSFA 2AOVA 4JB8A 5DNWA 5TMBA 4NZZA 1MO3A 2YQ4A 3KTAB 4MR9B 1QDUA 2WWRA 1WX1A 2VPQA 1HRKA 3UGKA 4D0NA 1G5TA 4IUYA 4OMFG 2MWMA 3O3NB 1R0SA 2C2MA 2P3QA 1A4UA 2WIFA 3R23A 4XWYA 4JI7B 2BHRA 2RHWA 1RVV1 4CT5A 1KI2A 1PUXA 3DTVD 4MRRA 4N6NA 4RZ2A 4F5WA 5LXTA 1R9MA 3N76A 3PYLA 2OCPA 1RRVA 2F8MA 3F6SA 4WZAE 1CUFA 5IJ0A 4U7DA 1PK9A 4UZFA 2EFCB 3ROZA 3OZWA 1J90A 1ZICA 4MKXA 2A0WA 4U6NA 1MA3A 2JGNA 4C78A 1E89A 3R7WB 4ERXA 5CBPA 1IZYA 2AEJA 1PV4A 1Z8HA 2D3WA 3I12A 1WMFA 1FY2A 4HK4A 4KGZA 3LKDA 4RZSA 1IOVA 1L4KA 2L0XA 3BTVA 4U3JB 2GBGA 5BSWA 1CLEA 3PGKA 2C07A 1DGQA 2WA2A 4UATA 1IOWA 1MQSA 2E6UX 4B79A 2Q0XA 5EIBD 3S7ZA 3SX2A 4BLUA 3SEFA 3SF0A 5PNTA 1SZDA 2I3ZA 1GADO 2FN3A 3L7KA 1O5OA 3TE7A 1M1YB 3HO1A 2R2AA 2WM9B 4YP9A 3ZKWA 2FWNA 2PJDA 4RKYA 1ORRA 2B35A 2JZOA 1WG8A 1ZIOA 5K3AA 3EWSA 2AXNA 3OAAD 2HU7A 2QI9C 2TYSB 1JFVA 2YV4A 4I1PA 5EKXA 1KPIA 4ND1A 4ALIA 1P73A 3M6XA 4TMYA 3AP3A 2R0QC 2CUTA 2VDNB 4HDNB 2ZJ2A 3I23A 1WVMA 4H27A 2IJGX 4JLUA 1A4IA 2VTVA 4PQEA 5L3SA 1G9SA 3SQXA 3COPA 4LQCA 1RRGA 4Q00A 4H31A 1EJBA 2X5KO 3OE1A 4HEQA 1PWYE 4ZK2A 3R7NA 1C7QA 1I7PA 1JW9B 2BBTA 3NHUA 4B3BA 4RD3A 4GC5A 2C7BA 1EA7A 2EOAA 2NAFA 1X19A 4HWSA 4DA8A 1MW8X 3MA0A 4ZOLA 4QKQA 1O95A 1PJRA 2ID4A 5EWMA 1RZ3A 1UEXC 4O4HB 1WRBA 4CWAA 4D99A 1DKNA 4U7PB 1PWEA 2Q1SA 3GP3A 3MQFA 1U5BB 3OEYA 4ZD6A 4FOLA 4JYZA 5FD8A 1X74A 5G0SA 4GVLA 4BGUA 4KQMA 4GZLA 2OGZA 5G4KA 4B73A 1FMFA 3REGA 4ESVA 1RCTE 4F4IA 5K5EA 1RT9A 1U8AA 4PHHA 3OLYA 3NC0C 4H2DA 3QU2A 1B2RA 1XZLA 3TZKA 4MJXA 1YS2X 4KE6A 3OJXA 1QV7A 4L95C 4M0UA 2QAGC 4Q02A 4BVBA 2XE8A 4D9EA 3ZUPA 3C5VA 2A0KA 3BTSA 4B4UA 3A6ZA 3C1AA 4YMVA 3AK4A 3FOBA 2C94A 1JG1A 2IQIA 4Q9DA 1KOJA 3AL2A 4ITUA 3A10A 4EB6B 4DEXA 3TXYA 3UAVA 3Q1LA 4XLZA 5I45A 1U9IA 1ZK4A 3OOJA 5DMXA 1MQ8B 3TOZA 3OA2A 2Y67A 1OXBB 2GLUA 2PK3A 4ZVSA 5SZIA 3UKJA 1IK4A 1RPTA 1GSHA 1J8DA 2D1SA 3NHPA 1UPCA 4G1MB 3CU5A 4HB0A 4NBVA 4I14A 3KETA 4MH0R 5HZMA 1FK8A 1TA0A 4OBXA 4X7BA 4CV0A 1Z22A 2YQZA 3MWFA 1CDZA 4NNPA 4RPHA 4EZIA 4I5EA 4E1VA 1XRNA 1ULHA 3GIDA 1CUGA 1W8IA 1XA4A 3G8DA 5IVIA 4C21A 4CCYB 3FR7A 3HYLA 3WYBA 1FJGB 1UZUA 2B3TA 2F8TA 2XSZD 3CLTC 3I37X 3RJ9A 1DPGA 3CONA 3PQ7A 4AP9A 4TSFD 1M6WA 2F1OA 4CI0B 3OLCX 4Z99A 1HE3A 4PLFA 3VMFA 4BOYA 3EXEB 4CV1A 4MO9A 4L2IA 4YR7A 5A7FA 3BXGA 1VL8A 3D4OA 3IRVA 5FI0B 3T6KA 1N36B 1OTHA 3L7MA 1JDTA 2QW8A 3EFOA 4LHEA 1UWLA 1J00A 4ZVUA 3S2FA 3FTQA 4BB5A 4E31A 4R0MA 1E2LA 4KFTA 2TMYA 1C14A 5BYAA 1I3OA 5JCOC 1G59A 5KUTA 4YH1A 5LYJA 2JAPA 3O2NA 9ATCA 1I2DA 3TW4A 1N9KA 3FMGA 1UANA 5DCYA 4FNAA 3MRTA 1OBCA 5IUKC 4IIJB 2ZETA 4FOPA 4NMWA 1OH5A 1JSCA 3F46A 1IPFA 2BGIA 4M0EA 5ICGA 5J4VA 4UULA 1G63A 5AKXA 5CVEA 2GAAA 3IXLA 1N8TA 3ZGXA 3HJUA 3G1WA 1YOBA 4QL3A 1MKYA 3QSGA 4PC6A 1R37A 1U0GA 1VI5A 2FMFA 3H5AA 1JPVA 2CNDA 2JHAA 3IXQA 2QBYB 2SBTA 3DYBA 1S2GA 4FE4A 4S1WA 4WXYB 1ZN9A 1ZU5A 1SUEA 1Z73A 2OD2A 5FORA 1AB5A 4GLFA 1UFQA 2XLCA 3DT8A 2BIFA 2KX7A 3HCOA 5KJCA 1O94A 2IUYA 1KETA 5H81A 4D1YA 3MOGA 4HAWA 4GOND 3IOYA 1XFAA 2WAMA 2VQDA 2R84A 1R0WA 4G97A 1U3FA 4KRXA 5FR2A 5THQA 4MO2A 2VP9A 1WW8A 1TQ6A 3MMXA 4TKUA 1NXVA 3CLTD 5TPZD 3HCPA 3M70A 2BEKA 5DHRA 3ACDA 3E1SA 5A05A 1DBSA 3RFTA 3CGGA 4LXQA 4TL7A 3T5CA 5SZHB 1WPQA 4EY7A 3K6RA 4F12A 5B3KA 4BP9A 3WWPA 1GZSA 3KKMA 4RNCA 1RLMA 3HP4A 2VO1A 3A6EA 2WJGA 4OX9Y 1XTIA 1EP3B 1RC0A 4WZZA 2DBVO 1DBPA 2Q9UA 3RBAA 3H18A 5DI9A 3IQFA 3R0IA 4XX0B 1QAMA 3ZLBA 3L8DA 4OBEA 5EP4A 3COVA 4HMOA 1X9GA 4REMA 5JMTA 1M2VA 1WY7A 3VC2A 1TK9A 4NC9A 4CDNA 4TZ0A 1Q91A 3I30X 3DQQA 3OZBA 4ZAFA 1Z2AA 4R0VA 3TLCA 1YI0A 1S2OA 2QL5A 3DDSA 5CCEA 1QRDA 1U65A 3KSDO 1LDBA 1QGED 2JVKA 3TIIA 1ORWA 4BB0A 5LZ2A 3A05A 3MOSA 4NV3A 5COQA 4LDPA 1L5ZA 4Z4QA 4AJOA 3DM9B 3RVPA 1ZMOA 3QVLA 4AS3A 1QFZA 4AO6A 4X5OA 3H0KA 1MIOA 5M5BA 1GTJ1 4KE7A 4KXWA 4DOMA 1UXIA 3S5JA 1TC1A 1VPLA 1ULZA 4KNYA 5LQNA 1V7QA 3EG9A 1Z74A 2A6PA 4B09A 1WF6A 1MOQA 5HF6A 1C7ZA 5ICEA 2ZSJA 5DBHX 4LGCA 1JG4A 4TWZA 2NU7B 3AVXA 1KRWA 1XZBA 3GROA 4NX2A 4WUTA 3AVWA 2CY0A 4DZZA 2I4TA 5HBRA 1M8PA 4W7HA 4IEIA 4DNOA 1R8XA 3MAJA 5BSRA 3IT1A 4GVXA 1AD2A 1UPUA 3IO3A 4RVSA 3SFVA 1QHGA 2PR7A 1F1JA 4BGEA 5H9WA 5IANA 4M83A 1GYPA 3LZDA 1ZM2A 4HYYA 4O4LF 1N7HA 1YVUA 2DBQA 3V8QA 3WK5A 3EEOA 2HFJA 3DZDA 1S2IA 1EINA 2D8AA 3EVDA 2CFSA 4D41A 2FZKA 2EP7A 3OJLA 3OX3A 5FA5A 2A5LA 3PB3A 3CV3A 5DIZA 1AQIA 2C61A 2IU3A 2B6NA 2W83A 2AQHA 4B2LA 3AC0A 4PGMA 2FFAA 2WWGA 3HKEB 3NTUA 1YR7A 3DZFA 3RM3A 1OV6A 4AJPA 4ZJZA 2YWGA 1WBJB 2AZ4A 2P5SA 1JE1A 2DERA 4YCNA 1E2KA 2J9FB 3B6MA 1L7MA 3JQDA 3NWEA 4Z8XA 5EEGA 2AZXA 1IY0A 1JH8A 3MHTA 3MWEA 4G0YA 1PYOA 3FYSA 4DDKA 1DHTA 1NFRA 4RAOA 4X24A 4F21A 2DXIA 1JKXA 1KH1A 1PQ4A 2FMHA 5CDGA 3GN1A 1T5HX 1GA4A 1FTNA 1W96A 2V0NA 1MT0A 1TCAA 2FMIA 3E61A 4LTDA 4LSGA 5HA5A 5TNXA 1FLVA 4Z0TA 3KQLA 2XPCA 4FC7A 4LF4B 2WTXA 5BQPA 5TMDA 3SC6A 1A71A 1HT0A 1QO0D 2C5FA 3WLMA 4FMBB 3I8OA 4F7WA 1G16A 4WOPA 4I1OA 1WJGA 1CJKC 1ZN7A 3RGGA 4ZYXA 6ABPA 5FPKA 2WTEA 4FDAA 4D0RA 5AW5A 1QYDA 3AEXA 1C9KA 2J4DA 3VR5D 2ZXEA 4WBNB 2WPNA 2RGUA 4HWKA 4PPGA 3R3HA 2DSNA 4E6EA 1Q7RA 4AUMA 1YJ8A 4RL4A 5GY7A 1UXOA 1VL1A 4DGQA 1IXKA 4IDNA 5H5JA 1IN1A 2Z6VA 1AGPA 5EFOA 5T57A 2XW6A 2IUEA 2WP8J 1DEXA 1OILA 1G291 3HDVA 4RESA 1M54A 1QAQA 3JYOA 4KXUA 1VLVA 4EY6A 1R0YA 2OBLA 3M4ZA 1CNFA 1Z6TA 3ENZA 3QX7A 3JQAB 4M1MA 1P60A 1V7ZA 1FYWA 2GHQA 3IOMA 4JU8A 4I55A 4AN4A 4NJMA 3JATA 4MQFA 1CULC 3UPUA 3SJ7A 5JQGA 2Z5LA 1GNQA 1YDWA 1CY4A 1CSEE 1XI2A 1NN5A 4OJMX 4QVKA 4AZ3B 1VYHA 1E3DA 4NENB 4J0DA 2ZIVB 4KSYA 1NBEA 3VR5H 4UXIA 5ECDA 4BVHA 2NO9A 3MGAA 4FHFA 4EVSA 4FIZA 5FJJA 4PN3A 3IAS6 5BMOA 4QDJA 2B69A 2AZMA 4QO8A 1EFPA 2CYBA 3B3AA 3K0EA 3RC2A 4ZOEA 1JDPA 1XDUA 3LSYA 4JNKA 4DIEA 3O90A 4FZRA 3RS5A 3RU2A 3DZCA 5CDSA 5FX2A 1QS0B 3PHJA 2QXTA 1RWVA 1U2QA 5AM2A 5HX7A 2JIZD 3MINB 1VGVA 2JG3A 3SNKA 4EGAA 4TWJA 4C89A 4CIDA 1D9ZA 4DG5A 3OJWA 3BFXA 4ETMA 3FA2A 1F12A 3DGFC 3VV2A 4D6XA 3DBLB 3PQFA 1EVQA 1C3LA 1Z75A 2GN9A 3IQZA 1GKLA 1H0RA 2ON6A 4EGJA 1TT7A 4WJKB 4UZSA 3WGNA 3WQRA 1FMCA 5C9ZA 3P26A 1RYFA 2ODPA 4FQ5A 4NQRA 5EP2A 1QHXA 3VJLA 4ER6A 5B7GA 3G17A 5HP4A 3LUBA 1IUNA 3Q0IA 2BSXA 4LCBA 3WGOA 3ETLA 3UUGA 4Z7NB 1ILEA 4MGKR 2WK1A 3IDAA 5DO9A 5ITVA 4C88A 5AK3A 2WHPB 1X70A 4HSEA 3KQMA 4Q3DA 1L9XA 4CTOA 2VYQA 1Z0UA 2RHRA 4V2IA 3OCUA 4LF5B 3ND9A 4AXXA 4JSRA 1SWWA 4MVJA 1GHTA 4TL8A 4QPDA 3NTRA 1MAHA 3VR6H 4ZCPA 3H7AA 5D6OA 2E4VA 1NKVA 4RIEA 3FDXA 3KPJA 4N7BA 2JGAA 4EABA 1L5VA 1I80A 3NBXX 2GGSA 3PNQA 1GEGA 1M66A 1OI4A 1QGUB 2CVPA 3AUSA 4JVOA 3T5TA 1RJGA 1ZS9A 4YEDA 1ZONA 1ZM7A 2JGLA 4ALKA 3NNSA 3IJRA 3N8HA 2R4QA 2BGGA 1TF5A 5KJEA 5K8IA 2R47A 4U63A 1T9GS 2IYLD 4RKWA 3JTEA 1K2VN 1HFKA 3W3AA 2WLSA 2DECA 2IP1A 2XUDA 3BGOS 3DLIA 2F1IA 2G28A 2LNDA 4KUHA 4TQGA 2GETA 1YULA 3HYSA 4M54A 3ROEA 4B74A 3OTHA 2R44A 1Y5NA 4HGRA 2PX4A 3A3NA 3ZXSA 3L8MA 1IG3A 1KO7A 1N2EA 4H7DA 1SBNE 1U1DA 4OHCA 4PYIA 3TD6A 3ZVMA 3R9XA 1PVOA 1BHJA 1V11A 1Z8FA 1XPUA 3IA7A 1DJLA 1CUSA 1I4LD 1N57A 3CUWA 3ENNA 1KE1A 3IVAA 1BE6A 1PS0A 3JWPA 1A9ZA 2IHZA 1S5PA 2ZI5A 3Q7SA 3T12A 1V45E 2FEKA 5AIAA 3PLRA 2J67A 4HH3C 1E20A 2PL1A 4JJZA 4OMUA 2P8JA 1L7NA 3IKVA 4RGBA 2XNSA 5H80A 3ZXUB 3B78A 3NDPA 1P4SA 1C4KA 5D2CA 2EDCA 1VSBA 1WQ3A 3F6EX 3VPSA 4KFCA 3JVEA 4IDAA 1GGJA 1SCDA 2V7GA 2VAVA 2HXSA 3BBPA 3F4LA 3NX4A 5K3OA 2YJNA 3DF7A 4J0QA 4BRWA 4OI4A 1WPXA 3RAJA 3AF4A 4CG1A 1F8GA 1SD2A 1XWIA 2E6KA 3NATA 3OKCA 3JR3A 3B7WA 2WWFA 2GVZC 1J24A 2JBWA 4MS3B 4OGFA 5EZSA 2QTRA 1MNQA 4QPNA 3VDXA 3P9RA 2B4YA 1UOQA 4G4IA 5HPYB 1DELA 3A6GA 1JF8A 4L5YA 1PTJC 4IINA 4B17A 1OIWA 4KP7A 3J81A 3JWHA 2CEKA 2GNOA 3BSWA 4JP1A 4NEGA 3TR5A 5TJ9A 1KQOA 4ERNA 3T52A 4K46A 1EGMB 3M89A 3MCWA 3HCFA 3IUJA 2UVPB 3JD0A 4OYRA 3PI6A 4YMLA 2Q6IA 1YMVA 4FHDA 5EZ5A 1THZA 2PZGA 3K0BA 3MFYA 1FUIA 4AZ0B 4NABA 5LXTF 4FILA 5F2NA 3E9RA 4B3MB 1GL3A 2NAPA 2XB2A 4L8WB 3GRPA 1B6RA 1W9HA 2B8WA 4II7A 1NURA 2ZRQA 3R4CA 4PLPA 5CLQA 3H1GA 2AZTA 2JZCA 4TYQA 3BE6A 5JFTA 5CNMA 3OZXA 4YO8A 1VGRA 4QXRA 1RPNA 2ZYRA 4Q18A 4N3NA 4XGKA 4B80A 2P91A 2VF8A 3B6KA 4QXAA 4CG2A 3A7DA 3O8DA 5ADVA 3GVPA 2C3OA 2Q7XA 1CCWA 1XDZA 4Q37A 4C0WA 3IDZA 1NOKA 2O8CB 3G79A 3QUCA 2X0IA 3IODA 2NQ2C 2IYNA 1IWPB 2PSJA 3BHMA 3GEDA 1U3UA 5GOTA 4EP1A 1ZVQA 5J23A 4CEHB 2ICAA 3OHMA 5E4TA 5B7PA 3SF8B 2R6DA 2MOKA 2OZVA 3MM4A 2Q5QA 1QCZA 4GPEA 4MMZB 1KZYC 2ESRA 1O08A 2FFJA 2PSEA 4Y6QA 3JAMA 5JD4A 2XE4A 1CIPA 4KRYA 3A04A 4TMVA 1ZGAA 3KXDA 1FP1D 4H7KA 1HDZA 4YV1A 1LPSA 1Z5OA 5CFLA 1T8PA 4BQRA 1HRDA 4RD1A 4DJJA 1N5RA 3G23A 4PHFA 1RRCA 2RFLA 1XMOB 1NY5A 4UNPA 3EZ9A 5F35A 3IDOA 4OI1A 1XELA 3CVOA 4P80A 5B6IA 3LZCA 1YA8A 1K4YA 1IVSA 2PGDA 3H42B 2AA3A 3I6YA 3LCMA 3MJEA 5B7QA 2A92A 1I7NA 1XHEA 4O4JA 3ADOA 2P1RA 4TMTA 4G01B 1E4EA 1DX4A 1ISHA 1J20A 2Q29A 3JASB 4QAQA 5AHWA 1GCOA 4JIGA 3QPBA 4OFXA 2YN4A 2IZ6A 2WKSA 3DKIA 1E8DA 1KL7A 2QE7A 4TYPA 4ZOLF 4ZCLA 3R24A 5E0OA 1E1CB 1ZA1A 2E4AA 1Z0AA 3I52A 2B4TO 4F2GA 4U0KA 5KYYA 4U9HS 4W1QA 2H29A 1XGKA 1N6HA 3H9UA 4MGHA 3RVRA 5K8UA 4ICIA 2GD0A 4E5UA 3VAAA 3QKSB 2QRNA 2P78A 3CNHA 2RARA 4AM8A 3VKWA 3KSAC 1HQDA 1HMPA 1E6WA 4JZYA 4ZANA 3K9CA 3HWWA 5EE0A 3S2ZA 3VHLB 3VXKA 3OT5A 4MUMA 2FEAA 5FO0A 2ODEA 3CNEA 4A5OA 1B73A 1JDZA 1F48A 4PQYA 4EFKA 3ANSA 5IX8A 3Q9SA 4BJ5A 3ADBA 5ALDA 1CE8B 3EGDA 1W8DA 1GQSA 2H4FA 1ONPA 1XZAA 3FNFA 2ZB3A 3C8ZA 4G6ZA 4S1PA 5GJWC 3RRYA 1E63A 1X42A 2GM5A 4ZALA 1V5WA 4TXJA 2GTIA 4AYTA 4BLTA 5E3HA 5KQPA 4OHBA 4JUFA 3X2EA 3K8QA 4S2EA 3EEYA 1N2IA 4IDGA 4JBHA 3AVUA 5HMLA 3VYSB 2I62A 2PD6A 4Y2YA 4B8YA 3VZPA 5KNCD 1K66A 5ISMA 4R9VA 1VIYA 4F5YA 4KX3A 3FI0A 2HCBA 2A3NA 3TX2A 5AXAA 1JWLA 2H08A 1VJDA 1D4AA 4J6FA 3OZTA 4I3FA 5EIAA 1HKHA 2ZIXA 2UV8A 2BUCA 4J0JA 5HR5A 4FGUA 4I3HA 1FQKA 2DQSA 2GZ2A 3P0EA 4Q12A 1E3WB 1E61A 2I2AA 2QLBA 2QZ4A 1IY2A 3EQZA 3P45A 5B4VA 5K8CA 2UVQA 1XVTA 4UU7A 3ITKA 1LB1B 1Y3FE 3KVOA 5KSPA 3D5TA 4DGSA 4ZZ2A 1N2CA 2O20A 2EKLA 3INRA 3W06A 3N8GA 4FONA 1FS4A 3WX0A 3RIXA 4YRPA 5JZBA 3B6ZA 1KGSA 5A71A 1HV8A 2FCAA 2WKRA 2E0IA 2GRJA 3ZK9A 5JS6A 3KEOA 1C8LA 3TLMA 3WTCA 4HVTA 4N54A 4N7RA 3ZYZA 3IKMB 1B8NA 1ZWLA 3U4GA 3KQHA 1REQB 4HWOA 4UE2A 2W8ZA 2G82A 1YCGA 2PV7A 3G59A 3HA7A 3A06A 4FZ5A 1CS0A 1SVNA 4NZOA 5KNCH 2D0PB 1FP4B 3IBYA 3QBVA 1Z82A 4KAAA 4G5QA 4LY0A 3WB0A 5IAAA 1TU4A 3NKVA 4HH1A 4O2AB 5LYJF 2OE2A 1JSLA 1ND6A 2V98A 2WZBA 5TF0A 4DDTA 1U8EA 3PF8A 4Q9HA 3THYB 1KYZA 2G09A 3UWPA 3GLFE 1JEDA 1PR6A 5AJTA 2BF4A 4FGSA 1I30A 1MG0A 3OJOA 2YZ2A 2IU4A 2ZZNA 3P4UA 3P9IA 1Z68A 2Y0BA 4XWKA 3ITNA 4Y6GB 1E6CA 3GRVA 3MEQA 4V38A 1L1QA 3MB8A 4CKCA 1JDNA 1E9RA 2IZOA 4E46A 5I9NA 4KR7A 2DUMA 1RYDA 1TLLA 4YAOA 3N0VA 4G0UA 3RFUA 1DIRA 5C0OE 2JCVA 3CZCA 3SYTA 3K0CA 3QA9A 2IHTA 3A4NA 5TJHA 4R8MA 3CWZA 2RH8A 2Y1EA 3B6EA 3AV3A 3GNLA 3EVGA 1U8ZA 1OR8A 2RI6A 2FR1A 2XAAA 3F5DA 5BNTA 1DRKA 3SX0A 4GO1A 4I2NA 2PUDA 1G5QA 4KR3A 2O2SA 3ZQ4A 1IU9A 1ZIYA 1OLSB 1F4PA 2FUCA 2R60A 3VR1A 5BPHA 1UMDB 2JEOA 1E9EA 1ZGCA 1X2EA 2FQWA 4QAJA 5SV2A 5CFMA 4W9MC 4X9XA 3QW2A 2BGMA 1E2EA 1P1CA 5H70A 5AM1A 4NKRA 4QEZA 4OJYA 3PC7A 5ALJA 2AOUA 2DOKA 2BN4A 4Q4JB 3DTYA 2XOEA 4AP6A 1PDOA 2V59A 4ZCSA 3JV7A 3PRJA 2XYQA 2Q9CA 4ZYTA 4V0OA 2HK7A 1WEHA 1KKUA 1Y5IA 4UCQA 3QVMA 3W8EA 3ZE6A 3TIFA 5D7BA 2XZDA 4M89A 4OIFA 4A6PA 5A3VA 2L82A 3DVQX 4IFBA 4PXAA 4NAUA 3UK7A 2VKQA 2XA2A 3PPVA 4IW3B 2B34A 5IARA 3AESA 4KCGA 2ISQA 3AM4A 1Y81A 3NVAA 2HHHB 1NJ5A 2B8TA 3H17A 1TYEB 3MB5A 4UAJA 1OAAA 4JUDX 1A9YA 5CVUA 2YJ5A 5JJKA 1XMIA 1ETHA 3U3KA 2BTQA 2AXQA 4W5RA 4CEJA 2ETVA 1GITA 1LI4A 2C4TA 3P2IA 4I1UA 3LUJA 4CMIA 3BMNA 1X8JA 1KRXA 3LUKA 1DAFA 3LL7A 5FPYA 4P54A 3ICVA 3D8TA 3VU0A 4Q6WA 3KE8A 5LSAA 4WLNA 3CF4A 2CLDX 1XCJA 3I2JA 2HWXA 4AY3A 5KCZA 2VHZA 2IOHA 2ZR8A 3LQ1A 4HXFB 2YY7A 3MF4A 4PZ9A 1AZTA 3R0QA 4R2WA 4P4NA 4P4GA 3PUWA 4OB7A 1HQCA 2PYDA 2VWHA 2KS6A 1W1IA 5TQVA 3CWCA 2KM1A 1JFLA 4LZWA 4BV9A 3BWYA 3PQ2A 2IV7A 1D04A 1XVIA 1DEKA 2QMEA 2TECE 1CHNA 1UKEA 3KBOA 3DDCA 1XEXA 4H15A 2OHGA 3AR9A 4BNLA 3S81A 2RH4A 2PH3A 5KVSA 3AT1A 1VKJA 4PLCA 4H4EA 3PYMA 1Q11A 1RSZA 5LNK1 4OJNA 1M72A 1NMSA 3G2PA 3JAKB 4F2HA 3D7RA 2GWRA 2YFKA 3ROTA 3FFXA 1X8XA 2P3SA 3CH7A 2E89A 3TTYA 1ZXXA 3DKPA 2YWDA 1RC1A 1VMAA 3N5CA 4AECA 4CDGA 4D4KA 4DCNA 1ODLA 4H7HA 3HXOA 5BN1A 2RGWA 4E12A 1IQUA 4DDUA 2WABA 1QCCA 2XV1A 1JVSA 3GFRA 3OA0A 3EIFA 4NNOA 1K1EA 2BFOA 2IGTA 1RYZA 3T41A 2YW9A 3LY5A 3QQPA 3E53A 3J7TA 4HN9A 1GGNA 2ZUVA 4B3JA 3W05A 3COZA 5T3UA 5AVSA 3LHFA 1GAJA 1MB3A 5DNVA 2JLUA 3CVJA 4LHWA 4OOEA 4Q3CA 5DLYA 5IULC 3WV5A 4EYGA 4JXJA 1XNQB 1I0ZA 3I64A 2JDIA 4GR4A 4R68A 3VOSA 3EOBI 2PPLA 4WASA 2B9EA 2X2PA 3F3KA 2QUKA 5CB4B 4UBIA 5FNZA 2WHQA 5FAKA 1WKVA 2R5WA 3GGJA 4IJMA 3CZ4A 4TS9A 3R7AA 4E5DA 4W5QA 1Z5WA 1N5LA 5FA8A 2FGJA 2AOTA 4HAXA 4YC7A 2NGRA 1Z4OA 1G8FA 1ZMRA 3ZU2A 5IWAB 4IH1A 4R3UC 2CJYA 4D98A 3GO4A 4P33A 1SQFA 3GL9A 5I7AA 2XCTB 3SHOA 3TQRA 2V3VA 4BB6A 1F2TA 1WSAA 1OREA 5AM4A 3UM9A 4NU6A 3BK1A 1YVPA 1AH2A 4BV3A 1Y4SA 3OPXA 4L7VA 2H2AA 3G5UA 5FBQB 3RWOA 4BO6A 5BV8A 2CNKA 3C4QA 3AUTA 3EF3A 4M9XA 5KWSA 2HCFA 1RYEA 1BMDA 2VT7A 5KQRA 2YZKA 2IYUA 5H68A 2EQAA 4GDFA 4AUNA 4XGRA 3OWOA 3TBKA 5KHLB 4DBZA 4XD2A 2O0KA 1PD0A 1W25A 4GUAA 1C1XB 5JZVA 4I55F 3AHGA 3KIPA 3RKUA 4IUCS 5JQGF 1ZOPA 1AIPA 1IEQA 3E1GA 4IIEA 2VR1A 2OGUA 4C2TA 3I6IA 3M8KA 4F6RA 2FW9A 3OU6A 2KB0A 3LWNA 5KNLA 1KMMA 4AD8A 3CSSA 1DC4A 5IUJC 1JKIA 2FDCA 4R2IA 2PQMA 4MYCA 4UNNA 1V9CA 4FTWA 2GXUA 2CWWA 2YDXA 5THXA 3TOVA 2BEJA 3AF5A 4JYCA 1EWYA 1TA4A 1JMVA 1U2RA 2EEZA 2PSFA 1BH6A 1FFXA 3O4IA 1AGNA 4HN2A 5LLDA 3CRMA 4DJTA 2WT4A 4INZA 4Z4HA 2WJWA 3U39A 1NBMD 2YV5A 3PA8A 4E03A 2ZTUA 2EZUA 2O4UX 1SKYB 5AVZA 1PRYA 2FMUA 1OD6A 5IN4A 2QV0A 1X94A 1YQWA 3FMVA 2RGEA 3M6MD 2VS1A 5CA1F 4UOZA 2A8YA 4IMJB 3TH5A 3TCXB 3LHSA 3KNZA 1PCXA 4B4WA 3UPTA 2QN8A 2VJKA 1RWMA 2WSBA 2FN7A 4JI6B 3IAFA 2OCKA 3TZLA 1XQVA 2NVWA 4NMLA 4MWSA 4WDRA 1NIJA 4R7GA 3VZBA 3ZGYA 3MC1A 2VHQA 3KKLA 3WVNA 2DKNA 4FX5A 4ZZ0A 1UC5B 2GNPA 2PS9A 1CFJA 2R6AA 1E99A 2OV8A 3ZHTA 2DWPA 1DXYA 5HGXA 1K68A 1KFEB 3BWEA 1TQHA 1VI2A 2Y1WA 5ESWA 4QEKA 3WAJA 4NBRA 3L06A 3IIMA 4MCHA 3V2HA 3ZIAD 4ZTUB 2IXBA 3X1WA 2RB4A 3VDRA 1JXOA 3TRDA 3FPLA 4MVJF 1XVUA 1IHXA 2RIPA 3PFFA 4PLTA 2P4SA 1Z12A 1EIZA 2Z2ZA 3COSA 4LX0A 3L7NA 4MUHA 3OZEA 5G1NA 3WBBA 3WP1B 2BFMA 3O84A 2C4HA 3OEWA 4DAEA 1ICEA 5DHTA 2O2XA 3O4VA 3R6TA 5HJ2A 1GPBA 1SC4A 3PEWA 1HC7A 1U6JA 2PVPA 5ER9A 3W79A 2J08A 5A7GA 4TTAA 3I34X 4O1IA 2I29A 3KZOA 4OK5A 2A78A 4YAKA 5FEUA 3DUWA 4MV1A 1XKLA 5E6UB 1V1JA 4TV8A 1JEYA 1CUCA 4RLQA 4JT9A 3KDSE 5FOUA 1T6NA 3PSAA 4RTPA 1I2CA 3BFJA 1VM6A 4HDRB 3U3DA 3PA6A 2ZYAA 4KQGA 4RW0A 5ECYA 5KC8A 2W4QA 4O0LA 2QP3A 1MD9A 2F6RA 1S6YA 1W4RA 2ARKA 3CKLA 2WQ7A 2O0JA 2VCEA 2EARA 3CYFA 3E5HA 3D1JA 4MICA 4GAEA 4PO3X 2ZJAA 2IZ5A 2LD4A 3STVA 4OPMA 1G9TA 4HY3A 3C3YA 3DOOA 1MT3A 3NLLA 2IHUA 2VDWB 1P0QA 3F9CA 3T5MA 4K6HA 3ADDA 7REQB 3BKXA 4QD3A 1E3EA 1UZMA 4KE9A 2BZGA 4B35A 3F4BA 2ILTA 3C7TA 1ZNXA 4L4RA 1EA5A 3TD9A 3VU9B 4DQDA 3OQ6A 3RVBA 2XKKA 1Q92A 2ZWPA 3LQFA 3QKUA 3WMFA 1G6Q1 3E9YA 3L79A 1Q21A 4RUKA 4XVQA 5CFQA 3RK4A 2BBOA 1UFVA 2XCQA 4RQTA 5DTQA 3UC9A 4Y1FA 4HGZA 4F9TA 3IIEA 4AN0A 2WQ6A 1JJVA 1LU9A 1P74A 1J8QA 2VPXA 2WIBA 3F90A 3HDQA 1HT2E 3DR3A 4YV7A 5A04A 1QQ6A 1AMUA 2XA1A 2X4LA 3F74A 3O9ZA 2BCGY 4N5NA 5GV8A 1HQKA 1Z39A 2DYKA 3L7BA 2V03A 4PLYA 4XPZA 3E84A 1U1EA 1XX6A 1ZVJA 2RAFA 3PL1A 4ARZA 1ZH6A 1AA6A 1K8ZB 1VXRA 2DPXA 5KTSA 4QXPA 1TM7E 4OLHA 3LUHA 1JKJA 1V47A 4IHAA 1E8NA 1P19A 2DUNA 4L16A 4RX1A 3HZOA 4NFHA 4FFPA 1I5OA 3V3TA 4ZU3A 3RAEC 5I9TA 5I7HA 1EESA 4JP8A 1KC1A 3D59A 3JZMA 4MYHA 4QQ8A 3RWMB 3AKDA 4HMPA 2Z2XA 1W36C 1D07A 2W7TA 3ZCXA 4OU4A 3RV3A 1D2MA 4ZT2A 5HBGA 621PA 3L9WA 4LCEA 4DY6A 3GWGA 3AJDA 5BR4A 1Y80A 4AP5A 3LGXA 1HLDA 1CQJB 4ZI7A 3SIWA 1NBAA 4LY6A 1H69A 4R69A 3PC8A 3IC5A 2I3BA 5LU8A 2H31A 5G0VA 5JD5A 3AR8A 4HAIA 1SUPA 5I4BA 5DFAA 4UVGA 3C24A 2BFDB 4OLBA 3QVOA 4AYWA 5A2GA 2R7NA 4D3DA 1E5QA 2DETA 1S3GA 1YS9A 4JR1A 1SHJA 4WKBA 4ENRA 5HJ7A 4GI1A 4L6AA 2AC7A 4M7RA 3KPVA 2WUVA 3HO6A 4Q9NA 2DFNA 2W9XA 4ARUA 5I5EA 1O2DA 4P6VF 3V8NA 1H4QA 5A2QA 2DFDA 3J80A 2MMCA 3H1EA 1H2AS 2VIIA 2ZDGA 4HEJA 4EJMA 3UWKA 4WLVA 1A1VA 2B2CA 1UEJA 2C1ZA 2ZLBA 3K9NA 4AS2A 2WTAA 1AHIA 2ZVPX 4I50B 1N2BA 1LPPA 1MJGA 3OIUA 4P92A 4X93A 2IDMA 3ABQB 1VHDA 4UU0A 1GKKA 5C8ZA 2P8SA 5A5EA 5JZOA 5E95A 1TUBB 2X8BA 2CMGA 2QORA 1HGXA 1MQ9A 2VL7A 3BL8A 1NPDA 4MYDA 1Y8RA 4HMQA 6CHYA 1S7CA 1QLHA 3IULA 3V1KA 1T4CA 1OI3A 5T67A 1XF9A 2X9GA 2BI7A 3BFPA 3ZIDA 2X0FA 5G41A 1F8FA 4YREA 4HNAA 4TOIA 4FWIB 1CUJA 3RU9A 1SZCA 2Q0QA 2FJPA 1UBEA 3AH8A 1XAGA 3L7CA 3OZAA 4MJ7A 2PWAA 3BRQA 4B3TB 1KMHB 3OOWA 3K32A 1AY0A 1RWKA 2WJJA 5REQA 5IKPA 5CIYA 4U9UA 5A3QA 1WIWA 2YV1A 3FPEA 4A15A 5JISA 1XTQA 3Q15C 3DZGA 2BFBB 4N5DA 3L6BA 1O54A 5DGCA 3JWEA 4LY3A 4TT8A 1LZLA 5FCDA 2GN4A 4JOQA 5BSHA 2W6MA 5FFFA 2HBQA 1Z0KA 2JCBA 5CB6A 5CD9A 2QHXA 4XCXA 2Q21A 1RQRA 2VAPA 3BMQA 3T9AA 1CRPA 2C54A 2ZUBA 3VR3A 3O4GA 2BCJQ 3H4TA 3OUZA 4CLXA 2C9ZA 1FFBA 1FOEB 3K09C 4CQMD 1HXHA 4F4HA 1TMGE 3ED1A 3M5CA 2XIQA 4L27A 2NYUA 3WDSA 1LX6A 2AFIB 3FPAA 4UASA 4IZOA 4G0VA 1E2IA 4MXDA 1TW3A 2BGRA 4ZGWA 2IH2A 3CJRA 1RJ9B 1AQYA 4PG6A 5FI3A 4OB6A 2IV2X 1YL5A 5EESA 1PR1A 4RMHA 4RF5A 1WQ1R 3CRVA 4XR4A 4MQ4A 3CTMA 2WTMA 1ZD2P 1E7RA 3UJ9A 1CPYA 1G60A 1SC9A 3CRQA 4C9BA 1NASA 1OXMA 3WK7A 1CQWA 3V1UA 4X94A 2OBFA 2RK3A 3DCIA 1LS1A 3NEYA 3PXUA 4K28A 3VO1A 1JHYA 1N3LA 1QV9A 1ODKA 1KEPA 1UKYA 1VC2A 3LXUX 2JIOA 4DYVA 2V4MA 3IT3A 1J0CA 1YS4A 4Q3LA 4CM9A 3DBOB 1FYFA 3IHKA 2D1TA 3ZXYA 3LDAA 1XCOA 4OHPA 3C3CA 2OYSA 5EFZA 1S2DA 2D62A 5JSHA 4ZT6A 1PI3A 2G9UA 3IPLA 4IXNA 4NQZA 4S12A 4C20A 1R0BA 4DMHA 4F4DA 3HN6A 4P86A 1Z8NA 2I6TA 4EF4A 3W8FA 1TAUA 5IS2A 4RF2A 3OKFA 1E94E 3JPYA 3K0HA 2XY4A 2GN2A 4PE5B 3R3XA 5F12A 1AM4D 4QTXA 4GP9A 4DMMA 4MQEB 5BOSA 4OUDA 1KHHA 2AN1A 3GJ0A 3P9YA 1ZOLA 3DV0B 4ZJYA 1Y7HA 2IOYA 1RNLA 1TZMA 2P41A 2OT3B 3R5XA 4DC9A 2E4XA 1KGDA 2FEOA 4GL2A 2VHUA 3F47A 4M8LA 3AHHA 3WRVA 1JA0A 2XMSA 3GGCA 1T9BA 2WU4A 4AJJA 3I9OA 4AZVA 2FX5A 1U9CA 1NSYA 2QYSA 2ZXUA 3INNA 2BEWB 4WA7A 1PJ2A 3LKZA 3EEBA 5AJZA 4NJEA 2O6HA 4LGMA 2O1SA 2CHFA 4E21A 3DQZA 3HGTA 4EX7A 2HREA 1KYQA 1GSAA 2BD0A 3OG9A 4ZQGA 5FPTA 1QYRA 2HPHA 5AKGA 3UCXA 1S8NA 2A1TR 1BWQA 4CF6A 1C7FA 3EY4A 1L5NA 4EH1A 3H2SA 4ZT7A 5EI5A 1NMEA 4QUGA 2POQX 1YBVA 2MYNA 5D3MA 4G1VA 1LFAA 1MFPA 1DKPA 1F9EA 3KL4A 2MSKA 4REQB 2GZSA 4YLEA 4AURA 1EK6A 3OE7D 2FZGA 4QXQA 3HZHA 4CEIB 1UK6A 2ZU6A 1DAPA 3L4BC 1TYDE 3R40A 2QVCA 1DCFA 1JHMA 4KLNA 1XJWA 2QRVB 3T61A 5LMCA 2IWHA 1MPXA 3UIEA 5AW8A 3SJUA 1QYWA 3WJ7A 2CWDA 2VDRB 3PTAA 2I3AA 4C7OB 2A9OA 4AUEA 3Q88A 3P4XA 1HNNA 5JDCA 4XB2A 3K0FB 4FBLA 4DUGD 1E69A 5I7UA 5BSKA 1W7AA 1UBJS 1W4LA 2A4MA 2C2OA 1YZNA 2CCJA 3KKOA 4CJXA 5DCUA 4QDKA 4QYSA 3RDPA 1AQJA 5KI6A 4RHEA 4A3SA 5AW4A 1FIUA 2NZWA 5B4UA 4OXYA 3UHOA 2RC6A 4IDHA 3ZV6A 2BF7A 4YPOA 4QM6A 1X39A 2DKFA 5GTDA 4G81A 1BE1A 1AXRA 3EDRA 4P5DA 3IB3A 3NC1C 3R20A 2MSLA 2FNAA 3ZNOA 4EL5A 3UMCA 3U44B 1YAJA 3UFXA 4MS1A 4PANA 2DULA 2NO0A 4XGQA 2OZLA 1UM9A 4XUGB 4GYYA 3D3JA 1DAHA 3KSMA 2FXIA 2JIMA 4PG5A 2H48A 5SYMA 1C0EA 1YZQA 5ICFA 4B32A 2Z3ZA 5CNIA 3B6IA 5AVQA 1RZRA 4C4AA 1MH1A 3MWKA 3EF1A 4I19A 3MILA 4L51A 3QJYA 5HCUA 1XMPA 4PZ0A 3WGUA 5LC1A 2XUOA 3WNDA 2ZJ5A 3GW8A 2NU8A 4C4OA 1YF3A 2GXAA 2VNAA 4KO1S 4GBED 2XA9A 2I4LA 4AMGA 2W8BA 1E4VA 4LWOA 3A1SA 1CF4A 3GGOA 1KBZA 3R5KA 3U48A 4BLRA 3DAOA 1VA5A 4TZTA 3OQMA 3N0TA 1FJHA 2WSYB 3ZTYA 4AG6A 1G8KA 1NQTA 5EXTA 3U09A 4IIHA 1BX0A 4HG2A 1NV8A 4BX3A 2FFRA 3SZ3A 3ORRA 3QPCA 5TGTA 4KTVE 4L9RA 3K2QA 2HADA 1DINA 3OEED 1LDMA 3AZQA 4ONEA 4JBWA 4JJGA 2HMUA 4GQIA 3QP9A 1C9EA 2FPSA 1CQPA 1KAEA 4U7JA 3QFSA 2KLHA 3TSCA 5JYBA 5GGXA 3FVWA 3T3HA 2YWHA 1QMGA 1Y6JA 4IZHA 1D03A 4MHSA 2FG5A 1RQLA 2Z4SA 1AS0A 2ZSIA 3JYLA 4KLZA 1SBQA 4UTZA 5FTKA 4TN1A 2A58A 1NVVQ 4XX1A 5AXCA 3WNZA 1FDUA 4F71A 2YWBA 4QUDA 3VZSA 3MD0A 2WJ4A 5GONB 2J0VA 3MJCA 3FTFA 1VKZA 3CSUA 2Y1XA 4P4TA 1ZOOA 3LYHA 2DQZA 3NV9A 1WO8A 4ZO8A 4IHKA 1L5HA 1MC5A 1NR7A 4BPRA 3TTVA 1SIUA 4DB2A 1N32B 5SY9A 3V8RA 3ZNNA 4CFYA 3GLHA 1IBCA 1LDNA 2BEVB 3D54D 5EA2A 4F60A 4BBJA 1H9AA 2B5OA 3G5TA 5F7OA 2PKQP 2GLXA 4NU8X 4TV9A 4Q5IA 2HPAA 4BLOA 5IMSA 1ABEA 1P3DA 3EF0A 1YB4A 2HJRA 2CXNA 4HCJA 4BO2A 1UMBA 1XEWY 2C4KA 3QY9A 1KWGA 3QM1A 2J07A 3ILVA 1O57A 1APBA 1JBQA 1K4KA 4TTSA 3GFPA 4UMFA 3WOHA 4MIKA 5I48A 3IOCA 1ML4A 2VJDA 4AJNA 2L42A 1BROA 1E0JA 4GC9A 2W00A 3KHSA 1G20A 3WIEA 3ZY3A 4F38A 4ZQHA 4QUAA 1U3TA 4UNRA 3RADC 3FYHA 1DP4A 2E18A 1GZ4A 2PZ8A 4MYSA 1ZK3A 3BS4A 4O4JF 4A8JC 4AKEA 4NMMA 3BJRA 3NHFA 4BWVA 2PS1A 4P3XA 3KYDB 3B1VA 3H87A 3RTEA 3FD8A 5E1OA 1K7SN 4RTLA 5C32A 2PKRA 1TKAA 3ULKA 3A2LA 1BQ3A 2AF3C 4FGLA 1II8B 3TJMA 1XXHB 2IH5A 3SOPA 2BI4A 2CE7A 4G86A 1MO2A 4UEJA 3NYWA 3U3ZA 1L5YA 1GL9B 3G2KA 1A88A 4TYNA 4HDAA 3RHFA 1GTL1 4PQFA 1MU0A 3L1HA 2XUHA 4FDUA 3HGQA 2HDOA 1P2TA 5CT4A 3W8NA 3NVKI 1V25A 4FI3C 1P2GA 2J9XB 4BXOA 1R0CA 1SCQA 3UY4A 3E82A 2C2GA 1P8JA 2DQ4A 2WHEA 1JBKA 1F9AA 2Q9BA 2OD9A 2XEDA 4J0EA 4FHZA 3CS3A 1QRUA 1Z36A 4P4SA 2W6OA 4A6EA 1M2JA 1V2GA 1WBBA 1WSDA 1H8ED 3KU1A 4WOCA 3GGSA 5JS7A 1JIIA 2IS6A 4MUJA 3VZQA 4LYJA 2AWOA 4A0SA 3VGPA 1O89A 2IHBA 2FHSA 3SLRA 4ZO7A 4RY8A 2H1HA 4B47A 3DPSA 1WQ4A 2OHIA 2V6JA 4ALNA 4ZRNA 1OIVA 1QYCA 2Q5OA 1XPJA 2UUOA 3G85A 2VF5X 3SE0A 1BHSA 3C6MA 3ZY6A 3ETEA 4ZV4A 2R751 4O8CA 1RQGA 4RJLA 1K0UA 1ZM3A 3FSEA 5EG5A 1RAGA 3S8EA 3PD7A 2WI8A 3V4FA 3EVEA 4BJHB 1HK7A 4R2HA 4HRAA 5BNIA 2I2CA 3DTVA 3U9SA 4KXNA 4AB1A 1ZCBA 1ZIDA 3DHVA 4R9UC 4U4AA 1NAIA 3SDZA 3ZD9A 1C9MA 2CMHA 3H04A 3VR0A 5IJ0B 3CLSD 1IJBA 4TV8F 1EXNA 1H8HD 4HB3A 3LFUA 5JXJA 5ARBA 1R4NA 4GEKA 4OQNA 5IH3A 2VCYA 4OXXA 4C08A 5CBPB 5SYAA 3QUQA 4QPZA 5K0GA 2DFPA 3D43A 1CRWG 1ONNA 3NHJA 3AUAA 3BB4A 3WY9A 5T7BA 1NFFA 4LJLA 3UB4A 2Y1GA 3DHNA 4GI5A 1OPRA 2WJHA 5C34B 5AHXA 3DMDA 4D44A 1ACLA 3C5HA 1ZGGA 2IHNA 3Q3JB 5LVAA 1Y1LA 2VJYA 3Q7EA 4HGOA 1FU4A 1ZMBA 3KYCB 2D5IA 1O6CA 5BNWA 4IMIB 1FXUA 4CKZA 5IASA 3A6FA 4EUEA 1KYWA 2QLMA 1FQJA 4TL9A 3V1LA 5ALKA 1DCMA 3H6HA 3WLTA 1MO5A 3OAAA 2DCMA 1ELOA 4HBZA 5KAPA 5BSVA 3TSAA 4ER5A 1QTQA 2H16A 3CZRA 4RVOA 5KX5A 2IC5A 3AR3A 1A9PA 1ZUWA 2J4CA 1Q0RA 2OAGA 4W9RA 3F71A 4WK4B 1Z0ZA 1QK4A 3UBTA 5EMNA 4X8OA 5BRNA 1D9XA 2BVNA 2X0EA 2BE7A 4GRAA 4U7HA 3ZEIA 1VSTA 2JAQA 4RDCA 1JHDA 3DVAB 3LCCA 4KJXA 5FTWA 4DIOA 4NEQA 3PGXA 1ISGA 2D1FA 5P21A 1FBTA 1RI3A 2C5EA 4X84A 5I8ZA 3ACBA 2ZBRA 2V6GA 3E81A 3L43A 4MPTA 1EFKA 2R5FA 4NF2A 2TRSB 3I1IA 4X1YA 4D8UA 4RH0A 3RFXA 1G21E 3HYRA 4QT4A 3TTUA 2GF0A 2FJUA 2JGEA 4YYZA 1KKLA 4FYVA 4Q19A 4C30A 3RO7A 1KF0A 1Z2DA 3AEZA 1J1UA 1JPNA 2CEAA 4F9GA 1E1DA 4YRKA 2R8EA 5G4KB 5CCDA 4BKMA 3A4TA 1SELA 1W0JD 3WLOA 4Q4AA 5JYCA 3S68A 3HHPA 3I72A 4PHGA 3U0VA 5DNUA 2NXEA 3NCHA 1WDWB 5LB4A 3SHTA 1ULUA 3IPYA 4FYIA 3N0XA 2E4UA 4YRCA 5H16A 1URPA 4L4SA 1NF3A 4DHWA 3FTNA 4ZI7F 4ZU1X 3D2CA 3TEFA 1Q84A 3HSKA 3TDNA 5H02A 1M34E 3RLFA 1GQRA 1E59A 1QLJA 3V9AA 4BZZA 2W6NA 5BN5A 1RPZA 1NYRA 3USCS 4PYQA 5C35A 2XCOA 4C0SA 4I6EA 3QLUA 2PKEA 2ST1A 5DP2A 3PIDA 4POOA 3HMKA 1WDTA 2FSIA 4XM1A 3VRHA 1A7UA 4MHTA 1T91A 3MIZA 1U0LA 1UZLA 2VJQA 3LPLA 3IVMA 3RAGA 1AGRA 4G9BA 4N03A 1RLOA 3D4PA 4NDNE 3GELA 2FN8A 1GPDG 3VHXA 4NYIR 2XUZA 3ZZ0A 1MF7A 1PGQA 3SS7X 2ZZMA 5AICA 3SBEA 1UBSB 4B4OA 4U2CA 4TQ9A 3H9GA 3STXA 4QG3A 2CLIB 3IHTA 3GFQA 1H2HA 4I9NA 4NL4H 1KIAA 2OQVA 3RIGA 1KEZA 4PYOA 1TKRA 2L18A 3Q3GE 1R9JA 3ET5A 2ZR7A 3FR8A 1M2FA 1FQWA 1HKUA 3V55A 1MXFA 3VTAA 4AS1A 1US8B 1QIJA 3L7JA 3THWB 2OCBA 2JFNA 2H18A 2XSZA 3D8SA 2J3HA 1X7WA 2FRVA 1OGJA 3A11A 4TSFA 1ZEJA 3ZWYA 1SCKA 1W5TA 2HQBA 4XI9A 2B92A 1PFVA 4YA6A 3RQIA 3KL2A 4E5SA 1Z0SA 3GJ6A 4F3KA 1CZHA 1TOAA 2I8AA 2NTYC 2QVYX 3UTCA 3KHKA 4XEHA 1G18A 1MAAA 1UC8A 2H2FA 4XPIB 2A84A 2H06A 3TZHA 5T8KC 1C8BA 1DADA 2AKEA 4Q93A 1DQSA 1YDEA 2BFPA 3BM5A 5LU9A 2F9FA 5LYJB 5T4BA 4KNWA 4Y2XA 3GXBA 4ZCTA 1X6VA 4LISA 2QAGA 1E9CA 2EBUA 2BJHA 2AI3A 2HWYA 5JAUA 2AQKA 4I5GA 4AQ7A 3DV2A 1BN6A 1M6HA 3CZAA 2F2TA 5IVDA 1U1CA 4PSKA 4RULA 1Y89A 5J4LA 4QM7A 2HA5A 3NIDB 1DNPA 4JLWA 2QTGA 1M73E 4ND6A 3W2EA 1FVXA 5AKKA 5E2IA 5FIUA 1J0EA 3U7GA 4A0HA 4BATA 1W29A 4GSLA 3FUWA 4CUZA 1ODFA 121PA 4Q9IA 3WIBA 1SXPA 4FCTA 3HXKA 4FMPA 4OXRA 2J30A 1I8TA 5CEEA 3NM4A 3RC9A 1XN1A 4ZT4A 1GG9A 2B1JA 3ZU4A 5IT5A 2Y4NA 4A0RA 3A2KA 3PXCX 1U1GA 1SOVA 1LLFA 2ORVA 3PFWO 4GOXA 4RH1A 1ZVVA 3L18A 3GH1A 3WLIA 4EI8A 5KYGA 1H6AA 4XIFA 1VP3A 4J94A 3EVBA 5LKRA 1CBUA 2ZDHA 4RVNA 1CRZA 3EQ8A 2Q8QA 2XTAA 3U0BA 3P1JA 4Z4GA 2O8VA 2X9NA 4KR0A 4TKUB 5TPZA 1PG0A 3DVLA 2EV9A 3JQFC 3VMMA 2PCJA 4FFSA 2G9QA 4CKEA 3II6X 3ABIA 4KO2S 1G5FA 1NRWA 4JB2A 3RTCA 1LXCA 2XYVA 1YRQA 3DOUA 4ZMRA 2ZWAA 1XCBA 2FQQA 5HXAA 1ZSYA 1UMCA 2J9RA 3N2ZB 4D9IA 4WD3A 3C6KA 4B33A 1VJGA 2JJ1D 2XEXA 3L0SA 4GECA 1A8UA 4H7JA 1MDFA 1LKZA 3AI2A 1WTAA 3C43A 2CSUA 1GGVA 4Z9XA 2VJMA 2FZEA 1KY2A 1U90A 3PSHA 4IDBA 4Y2RA 5BN4A 3P2OA 1J0BA 2BFCA 3PDCA 4Z8YA 2C1EA 3QPUA 1ISFA 1NUSA 3BEDA 1OI7A 3TLEA 3QTBA 2O06A 1Y33E 4YAGA 5KTNA 3IP7A 1LV7A 1AVTA 1IM8A 1OPXA 3RT9A 1MVLA 3ANYB 2H00A 4COOA 5U4QA 2HQRA 2ZUUA 4FYPA 4G9GA 1H4SA 2YMPA 4EYKA 1MAVA 4I8DA 2XMPA 4KPFC 4BZXA 1X7YB 1SB8A 1MIOB 1YBHA 4KMMA 2OFPA 1FNMA 1J1ZA 2R1VB 1TJ4A 3NRBA 1FS6A 5KYVA 3AO0B 1OYVA 2BMDA 3EG9B 1UINA 5DM0A 4K87A 1BEEA 1JEQB 3BXEA 4NRDA 4D56A 2YBDA 1GKUB 1IOLA 1RLUA 5FB3A 2FAXA 4L74A 2BM1A 4KNVA 1B26A 4QFCA 4Y18A 2NPFA 4C4YA 2CHEA 2P5UA 1B74A 2NO1A 3I4LA 4LE1A 1DT3A 1AG9A 1RHUA 4NCBA 3WB9A 2GBFA 1SC6A 1G7RA 4RZ3A 5DOZA 3P0RA 1XROA 2I7CA 3DDNA 3ILSA 3TB6A 4OY3A 7GPBA 1T5DX 1Z6PA 2AT1A 3KHTA 2VDMB 1PUJA 4DMKA 4I4IA 5JBNA 4BEBA 2QGNA 3DE7X 1LJUA 2Q5JA 2V7WA 5L3RA 1PJLA 2O3UA 2PD3A 4RE5A 5DWVA 2PUHA 1ADJA 1N3YA 5AKLA 1EVZA 4NI5A 1ZSVA 2NUAA 3EIOA 2CMDA 1GO2A 3FG9A 4WADA 2V7QD 3JQ8B 3KXKA 1NGSA 1DC6A 4CMEA 3D2BA 4R3NA 5AVXA 4WEOA 3A32A 4GPZA 2BBWA 3LT2A 4MS4A 3BMCA 3QVVA 3ENWA 1YB1A 3MWEB 5L4NA 1LGYA 4OLFA 3ELUA 4CM4A 5DX8A 1MFZA 3HYTA 3UICA 4BNXA 3WL7A 2G5PA 3AR4A 1BQ4A 2XJ9A 1ZI9A 2EFHB 4YECA 4GPD1 3MAAC 4DR2B 2QRKA 4TWRA 4EJSC 3QYFA 3DMGA 4H3VA 3AR7A 1QO0A 3PLNA 4X7PA 3T5PA 1GRVA 1R8QA 3HJRA 3TK1A 4BVFA 3ZDCA 2PBLA 1YR1A 1TTPB 3W1VA 4X90A 1GUBA 4FS8A 4OO3A 3IDSA 4BVAA 1XUOA 2ZYUX 3A1VA 1XL0A 3VR5A 4HS9A 3TX6A 1ZK1A 2J3EA 3VDMA 4B9AA 5IZCC 3EUFA 4U2GA 2QUZA 2IL1A 4TWAA 3WNBA 4KHPB 4PNZA 4FX2A 4EW1A 2XHZA 2H1WA 4W5WA 5CVTA 1LNSA 5JS8A 1CU1A 1P17A 1K6EA 2PUWA 2XCIA 3G5MA 2IE0A 4FGKA 4G24A 5H1YA 5IEJA 4KDEA 1VBKA 2J48A 3Q41A 3Q7IA 1BN7A 3BCSA 2YIJA 4LJ9A 2WWVD 3ESCA 1PNVA 4U7TB 5IM5A 1CYEA 4W8HA 3HCCA 4I3GA 3S1LA 3UG6A 3WGLA 2R62A 3BZBA 4WNAB 1CNMA 4IVRA 2VNIA 2JH8A 3QBEA 4HEA1 4MCJA 4QJ5A 2OYRA 4I55B 2YS7A 2YVUA 4YJHB 3JATB 5JO9A 1BCRA 3BHIA 3HA5A 2IYZA 3TJRA 1PG2A 3QGMA 4JI4B 2WFAA 4WECA 4EDFA 4PFKA 3IERA 4JH0A 1W5FA 1XR3A 3NWJA 4EECA 2ZVJA 5SYNA 4ZMBA 2V6IA 3TRFA 4EO7A 1T0IA 4YCJA 3L8ZA 3LBIA 5DEIA 5EYPA 2QT9A 5DX0A 4LC0A 1OE0A 2DBYA 2NT3A 1YB7A 4P3KA 3CF0A 3U26A 2OFOA 2B3DA 4FYWA 1OWNA 4PLGA 1H66A 2Q3HA 4IXWA 3ZTWA 1NJ8A 1F8YA 4GKAA 3VR6A 4DFDA 3HPQA 1S8OA 3DMFA 5TGDA 5AD1A 1LSOA 3QIAA 2ZR9A 3UGQA 3PXXA 3LCJA 1WS6A 1OLXA 2BP7B 4NHEA 1A2OA 2YVAA 1A9OA 4RSGA 4DXAA 5LZ9A 3D0OA 2IHKA 1NU8A 3TQCA 3AEQA 3C6QA 3EGXB 3NTLA 3IVXA 1W0CA 1Q77A 4ER3A 1V16B 5JAPA 1BX1A 1SCJA 1UPXA 3EWNA 1L5MA 4C3UA 4D4GA 4D6PA 2XXAB 1P18A 1TXGA 1CZLA 1RPAA 3RARA 3CXRA 1SU4A 4RIGA 2XGGA 4XYGA 5AW0A 3LW8A 3OIFA 2VP2A 4N8DA 4F56A 3PEYA 4HQRA 1ESCA 3IJEB 1EFDN 3E7FA 5E9JA 4LKRA 1T0HB 2R4UA 5ALZA 2I03A 3LBNA 5I9IA 3ZQKA 3U7FB 3ZX5A 3GRCA 4FOTA 4B48A 2FZ4A 5TF4A 2CV0A 2OCIA 1Y3AA 2HLHA 3UXMA 3R7LA 1GCUA 4Y1GA 2WVJA 3NAGA 3CXUA 4TV9F 4AX8A 2B7BA 1ODJA 2C96A 1JR3E 3AKEA 3EW7A 4IVPA 4CRWB 2VHYA 4NXMB 2C2KA 1ZD9A 1E6UA 1CUEA 1QORA 2AKAB 1TRKA 3A1TA 4ZKEA 3T1NA 5JNWA 4IJ6A 5C5EA 4K9MA 3QA3E 2WU1A 1E1LA 3IJPA 3A7EA 4QJ4A 3IURA 4WFIA 4DMRA 4YXFA 3W5BA 4R1UA 4UW9A 4BTVA 3TVDA 4TZKA 2XZTA 521PA 4DKJA 1YVEI 3GRUA 2SHKA 4N39A 4E15A 1FYXA 3EFBA 3IFSA 4OHWA 4DSAA 1THGA 4QSHA 1YRLA 3OQIA 3PPYA 1UBRS 4WZ6A 1SUSA 1NQAO 3VX3A 4DPMA 3FDZA 4XJVA 4I4CA 1QH8A 2HWWA 3K6JA 4C0LA 3DHWC 3PC4A 4G2NA 2XE6A 4KK3A 3KUKA 4ADSG 4QPJC 2J3QA 4ZJPA 1QP0A 1CF9A 2B5VA 2E5WA 2WTNA 5L3VA 1P5RA 1NMXA 1AA9A 3O7MA 4IOKA 4PAGA 3ZVKA 3GZJA 4WXMA 4JT4A 3O47A 3B5JA 1G1MA 1E7QA 1VLHA 5HF5A 5ER6A 2D4HA 4L0MA 1ZH0A 4HQNA 1G7TA 5HIIA 1F0YA 3D5QA 1CJUC 5HIAA 2AUTA 3LP6A 4ZQFA 4ZVLA 1LLCA 1T0JB 3IUNA 2I1VB 5E9WA 1AZLA 1F06A 4DLSA 1T8YA 3LX5A 3UJ8A 2MSEB 4GICA 1PUIA 2QNRA 2W6ID 3LL4A 2OCXA 3ON5A 3DZIA 5DWQA 2UYYA 5C8VA 4IRUB 5ALFA 1NNEA 5LP6C 4IQ0A 4XB6B 1CR6A 1COWD 4I8IA 5M34A 2O2JA 4LXHA 5BRJA 4QTUB 1R7RA 4FS3A 3WLLA 4NH0A 4UUBA 1VZ3A 3G7UA 3L01A 1GUZA 4X1IB 3QH4A 1IH8A 1ZY2A 1P9RA 1NUQA 1FFAA 1PZHA 2VF7A 1QX3A 1GPMA 1VKNA 2EFYA 3C6ZA 4EMBA 1PS9A 1XNGA 3FAZA 1MC4A 1I6KA 4L5JA 3W4JA 4R1SA 2HSWA 1K4MA 4X00A 5SZKB 5FNVA 3RYIB 2BDTA 3GUHA 5DTEA 4MV7A 5CB0A 3UMYA 2QX8A 3OF2A 2BMAA 3L8EA 3PITA 1Q95A 3OCWA 1Y4ZA 4O5AA 1QB7A 1FCJA 3DLAA 4TKVB 5DN9A 3T3OA 4B6OA 1WP9A 1ARZA 5K0JA 2VA9A 4ATNA 4J07A 2O4CA 1LDYA 4DV6B 5E7MA 4BGDA 3WK6A 2QRLA 3KQQA 2IH4A 2CXHA 3T4UA 4PBTA 5LQDA 1WMEA 2VPYA 3H2KA 3MSXA 3KT8A 5G4LA 3ESRA 3ND6A 1U0EA 3B82A 5FULA 2FFBA 3MOIA 1N75A 2ECQA 5EUQB 4YQFA 3P9KA 3CM0A 4IX9A 3QU9A 4WBXC 3WSWA 4BWYA 4ZICA 5EHZA 2XRMA 3KQNA 1XPRA 1QF7A 4RMIA 1SXJC 1C8VB 1WP4A 4W63A 1ZUNA 4XTCS 1I24A 4TLAA 4OAPA 3VZCA 3S27A 1PYGA 5JLAA 3U7QB 3GQVA 3HACA 4K05A 2EF1A 2JCSA 2P30A 4NBKA 1DUSA 2FSHA 4TTTS 2XADA 1ESNA 2CHQA 4I9GA 2CCGA 2ZPAA 4MWZA 3ZI7A 4Z3KA 3KOUA 4L4ZA 2CXRA 4Q34A 4OHOA 2VPIA 4JL8A 2CK3D 1GGKA 4HC4A 3SZMA 2J9GA 1OYOA 3GLGA 5HUQA 2ZE7A 3OQBA 5EMHA 1QIFA 5EVCA 4DCMA 2PUCA 2OCDA 4J1SA 5KX5F 3A25A 4I4TA 1L4LA 2CUZA 2XB8A 3CE6A 3ZHUA 3ZCUA 4EFMA 2XQIA 2O8BA 1QG6A 3AJEA 4ZIRA 2IDZA 1PTJA 1JA9A 3OWHA 4JUBA 2WIJA 1SOWA 3FDJA 1IHUA 5EN4A 1EP9A 4PEVA 5TVGA 1YNOA 3ZZTA 1NA5A 3KQVA 3AMVA 3KELA 2PBFA 2QW0X 3R5FA 5EY5B 2J6BA 2YH2A 3UJNA 3ETGA 1SHZA 4PV7A 5HFAA 5DBGA 2XWQA 2H1IA 5CX1A 4XWAA 1QE0A 4EY5A 4UXHA 3L5KA 4WEQA 3HJGA 3EGIA 3K0KA 4EB0A 1Z5PA 2RHCA 1QFYA 3B8EA 5KYYB 4PZYA 4OHUA 1QCDA 2D0OB 2J33A 2Y1FA 3DBHB 4DQ0A 4E7OA 1AS3A 1TF7A 4MJ3A 3CVXA 4Z7JA 5AW6A 3EA0A 2QL6A 2EZTA 3EULA 5KYXB 3K6SA 1JN0A 1UKCA 3BGSA 3A4MA 4PBRA 3UH1A 3CG0A 1J9ZA 3LLCA 1V1MA 3AU9A 1BKDR 2ID7A 1S4MA 3H9EO 3L8CA 3M83A 4YFVA 4GQAA 2C99A 3K1AB 4Q05A 5K3SA 4F8JA 2HMTA 3KSUA 3VISA 3I9NA 5IJZA 5CW2A 5DGTA 3V5NA 1DTWA 2P77A 4BMXA 4WAUA 1FDTA 3KEMA 3R7WA 1DZIA 2INGX 2VYCA 2QI9F 4Q21A 1C80A 1A95A 1NNSA 3R8CA 3AL3A 5KNCA 1I1OA 1B43A 1U28A 3ROGA 1J2JA 4NH4A 1YZYA 3INYA 2DFLA 4OCZA 4GI7A 1VJTA 1OC4A 3AM1A 1RHQA 2G36A 2D54A 1UBFA 3OM8A 2VK8A 3KAKA 4QE3A 5BOVA 4JC5A 4KE8A 1XRLA 3P2JA 2DUUA 4D7AA 2CHUA 3ADPA 5IXYA 1MV8A 2Z6AA 2GCNA 1YQ9A 1XTKA 1GT91 1Z7BA 4FMCB 3NB0A 2HDNB 3H2YA 4LDQA 1P2DA 3B1JA 4KUGA 3A58B 1YHYA 4D96A 3HWX1 2HT1A 1LQ2A 3CX7A 4MUAA 3I3OA 5DXJA 2YJ4A 5BUZA 1CC1S 1N2CB 1EWTA 4B3HA 1L8AA 3ZCVA 2QT0A 2Q3MA 3BZUA 4O4IA 4HZUB 5IBRA 3I2KA 3K73O 5GAJA 4E7PA 2O3RA 4ZA2A 3CJTA 1SAYA 1QVAA 2ZSEA 1HDEA 1PYDA 3FUTA 5CM8B 2PV0A 1JZQA 4DQVA 4ZZ1A 2ZQ5A 3AEKA 4LK3A 1WXEA 3URKA 2EJUA 1UF9A 1P9WA 2XNJA 1BEUB 1EFCA 2J3MA 2JI4A 1JSZA 2XDWA 3EDYA 3NIGB 4G2TA 4OSEA 2G9NA 4F1JA 4LRUA 2DFTA 1NPYA 1NN0A 2M2IA 3I0NA 3OFSA 4FR0A 4E70A 5BSGA 1IN6A 1KJNA 4ZVOA 4PZCA 1NN1A 4EGCB 5E3IA 4O4HA 5AKHA 5GMOA 1QIKA 3U13A 1QQ7A 2HQOA 3C8UA 4BNKA 4YRZA 4D79A 4DNPA 4DQKA 5L53A 1KU6A 2CC2A 2FSUA 2QY9A 2H1OA 2X4DA 3DL4A 3NXKA 1YCHA 2CDBA 1XDGA 4WVLA 1DEAA 2H9YA 5NLLA 3GLIA 1G2IA 2AD1A 3OFND 2GO1A 1OXTA 2WZDA 4QHSA 4B3FX 5HKKD 1KI4A 1A5TA 5KJ1A 4EENA 1D5WA 2O8NA 2IWRA 3B52X 1UZNA 2PQ0A 5LDDC 1B6TA 1NW7A 4P22A 4PCLA 4B0PA 3BIXA 3ECCA 4CDMA 5JEEA 5LMZA 2G1JA 4U8HA 3F5QA 2YVQA 3L7LA 4GM4A 3UQYS 4Q03A 1PJBA 3F7TA 5TT1A 4KV7A 1AUVA 1TT5A 5IHXA 2JLZA 4DA4A 2EYUA 4DCTA 1B15A 2Z57A 3NETA 1P8AA 2B4KA 1NT2A 3GJ5A 3CUTA 3FMPB 2G67A 1L4GA 2XOXA 2M6KA 2OL4A 1QG0A 2QD2A 4BFTA 1F5SA 3FRIA 3ORFA 4JAVC 3L77A 1CD5A 1AB6A 3CUEF 5CLGA 4DAOA 4HO1X 4J90A 4B7ZA 1CV2A 4G0QA 1KK3A 1ZK0A 3BSYA 4B83A 1K3FA 4RE6A 4QUKA 2YR0A 1VBMA 2IY9A 2JNWA 3A36A 4RD6A 3RK0A 4QQNA 3PHLA 2WR8A 3BD6A 3ZE7A 2BHSA 2OHXA 2IY8A 3AESB 3O21A 3Q7RA 4GMFA 3SCZA 4ZQBA 4E08A 4RA6A 1T5TA 4F2DA 3R9WA 1JJBA 1FSZA 1VG0B 5EHGA 3X1YA 3QU7A 2Y1DA 4IAOA 3DMYA 5AOCA 3BC1A 1XEWX 3SLKA 2G71A 4MW1A 1I1QB 5BW6B 2HGSA 1ECJA 2PE5A 4CMIB 9LDTA 3RVKA 3BMNB 1N33B 3UJBA 3V7FA 5CG1A 1SEPA 1OH6A 1DJPA 2WYHA 3EZ7A 1KAMA 1A4XA 2Q6OA 3GF4A 5IH7A 1CX9B 1CUVA 1IHDA 2ZWOA 4Y2VA 4MCIA 4KR2A 5DYYA 4X92A 1J8VA 3RE1A 4UCFA 2RDMA 3M6IA 1RRFA 3DEJA 4XZ3A 3HU1A 4BO0A 5EE9A 5JS1A 5HK8A 4FYJA 4B4DA 1VL5A 2A1UB 2C95A 3UWMA 3AUXA 4HFNA 3D6FA 4JJ7A 4P7GA 1G3RA 4JOCA 4Y6LA 3T5DA 4FPXA 1Z28A 4BNVA 1T2FA 3BWBA 1XEXB 1BDMA 3FY4A 2DWUA 3FGPA 2RGBA 4LJAA 1UBLS 4WKNA 2C77A 4O33A 4YCLA 1FPMA 1N0IA 1T4BA 3R7SA 4MWBA 1U0BB 5FBWB 3IMKA 4B4VA 1JLRA 3V8PA 2UKDA 1PD1A 2IYQA 4EARA 5LQUA 1YJ5A 2WZQA 5EWJA 3EIXA 5EJAA 4W9NA 1Y8AA 2A5DA 5JATA 5KWIA 1XZHA 3EC7A 3WYCA 3TMYA 3MLAA 3O26A 1M75A 3IQIX 4ID9A 4QOHA 1Y4DE 3EY9A 2Z9BA 4UM7A 3VM6A 5K2OA 3NBQA 4MAFA 5T4EA 3VNBA 4JSTA 4E3WA 2HAEA 2VATA 1PQUA 1HG1A 3MCAA 4DZTA 3U5TA 5HF8A 2BM0A 2F67A 1KH3A 1PFYA 1OIXA 3A14A 3GCXA 4XGNA 1MPTA 1Z2EA 4EUSA 1QRSA 1WVGA 3A1DA 1MAWA 3GLTA 4YRMA 1EBFA 4GOOD 4B7XA 4HADA 1P7CA 1U3VA 4KO4S 4M1EA 5C51B 2O7RA 3ETHA 2XBUA 5ICMA 3HG7A 4EGFA 2ECOA 1K6JA 3QVXA 3UA3A 2BR5A 3U4IA 2XUQA 3OPNA 1VPDA 3DULA 3LLMA 3HDTA 3PWTA 3PWKA 1TMOA 2XX3A 4R6WA 3I01A 1TYZA 1DSSG 5SY4A 5CDUA 1YJAA 3RBZA 2JFGA 3BHNA 4MPRA 4RPIA 5ED4A 1KI6B 4DILA 3T34A 3NBZC 1W87A 4RHTA 1QIHA 1NW5A 4U2EA 2IUFA 1F2TB 1H6DA 2B5WA 5CVDA 4E2ZA 2WG1A 4G1BA 4Q01A 3ZVLA 4CM5A 3Q4GA 4DA6A 1HZJA 1SO8A 3QVKA 3ZV5A 3IP9A 2DY0A 2Q2NA 2H1FA 3A3KA 3UGJA 3KPWA 2YHSA 1AN9A 5FDFA 1CLUA 3ZR4B 3GZNA 3QVWA 4IG4A 4C3OB 4BE7B 2ISCA 2PRKA 1H5UA 3E4CA 1GQYA 1DXQA 3TJZA 1G0NA 4TVSA 3DFIA 1D4FA 1L0BA 3IT0A 3PDUA 5DN6D 2VXYA 2XXJA 5HFJA 3PWSA 4LRSB 2YHUA 1MR3F 2NU7A 1YFLA 1TLFA 3C3KA 3H2IA 3N3AC 2GFIA 4MEJA 1R16A 3QMPA 1MVOA 3U3MA 2VJOA 3Q12A 4LYHA 4QQKA 4G85A 2QTZA 2R66A 5FFNA 1NVEA 3B60A 5FO1A 3FBWA 1ULTA 3ROQA 1SA0B 3BJEA 3EOZA 4LVNA 1YJQA 4PC1A 4XYMA 2IOFK 4UZEA 2GEKA 3AR6A 3MUNA 3HFJA 1E2NA 5FTNA 1U2DC 2IYFA 2WJ6A 2FWRA 4KXYA 1Z38A 2GXQA 5CT5A 1HYGA 2HSEA 1WPRA 1QRRA 3OM9A 1MXHA 1FFXB 1GA1A 1R10A 2Q0HA 3KLPX 5FYDA 5JTUA 1QK3A 2JAWA 1NBMA 2AMYA 3RTGA 2X23A 1WLSA 4MIYA 2VP3A 4MP6A 4KPGA 3HKEA 6Q21A 1OH8A 3OKAA 4G23A 4LDRA 1NR5A 3NTOA 1P2SA 3BWMA 3RJ5A 2CL7X 1K7EB 4PTLA 2IV3A 1HZZC 1U4SA 4M46A 1WXFA 3WRYA 1G8MA 4RQBA 1JRLA 2FWJA 2A1TS 4RO0A 1JIQA 3V1NA 3LP5A 3DJYA 3RIYA 1CFZA 4LUCA 1VHTA 4C14A 2VUTA 1YRYE 3A1CA 2HPVA 3H1AA 3OURA 5LQRA 1DUVG 2KHZA 3D0RA 4BVLA 4JNCA 4YBZA 1HX7A 1EK0A 3FGNA 1UL1X 1YAHA 1SC1A 1Z4KA 2OESA 5TRTA 4OQYA 3ZGVA 4GX2A 4FHCA 4YACA 2H7XA 4FR5A 1BVYF 1JDUA 2Q6LA 3U3OA 1SUWA 2QTBA 3ZIAA 4ARBA 4ESEA 4YT8A 3QENA 3QLEA 4XWOA 3PC3A 1HE4A 3FUXA 1X15A 3BRCA 1JQJC 4X7MA 4UTNA 1RTKA 1Q14A 4BMDA 2GDZA 3HJHA 3VPXA 3VFDA 4LZZA 3I1FA 2O5CA 1XTZA 4TLLB 5M04A 4AUKA 4XRRA 3GWZA 3P0HA 4QBKA 5I01A 2XYRA 1N25A 2OLJA 2PZMA 4FMDB 4X61A 1U11A 1UPTA 3EG5A 3S1AB 4NMXB