1GA4A

Crystal structure analysis of pscp (pseudomonas serine-carboxyl proteinase) complexed with inhibitor pseudoiodotyrostatin (this enzyme renamed "sedolisin" in 2003)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
369
structure length
369
Chain Sequence
AGTAKGHNPTEFPTIYDASSAPTAANTTVGIITIGGVSQTLQDLQQFTSANGLASVNTQTIQTGSSNGDYSDDQQGQGEWDLDSQSIVGSAGGAVQQLLFYMADQSASGNTGLTQAFNQAVSDNVAKVINVSLGWCEADANADGTLQAEDRIFATAAAQGQTFSVSSGDEGVYECNNRGYPDGSTYSVSWPASSPNVIAVGGTTLYTTSAGAYSNETVWNEGLDSNGKLWATGGGYSVYESKPSWQSVVSGTPGRRLLPDISFDAAQGTGALIYNYGQLQQIGGTSLASPIFVGLWARLQSANSNSLGFPAASFYSAISSTPSLVHDVKSGNNGYGGYGYNAGTGWDYPTGWGSLDIAKLSAYIRSNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords SERINE-CARBOXYL PROTEINASE
publication title Carboxyl proteinase from Pseudomonas defines a novel family of subtilisin-like enzymes.
pubmed doi rcsb
source organism Pseudomonas sp.
total genus 140
structure length 369
sequence length 369
ec nomenclature ec 3.4.21.100: Sedolisin.
pdb deposition date 2000-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ga4A00
4DWWA 1BE8A 5CW1A 2XRMA 1YJBA 2WWTA 1SUDA 3PTLA 1GTJ1 1TO1E 2PWAA 1TK2A 3VV2A 2W2PA 4B5LA 1C9NA 2WUWE 1SCAA 2G4VA 1WSDA 1EGQA 4AKTA 1ZVJA 5AVKA 4NMXB 2TECE 1SUBA 1Y3BE 1KE2A 1AH2A 2ID8A 1TM1E 4LVNA 1AVTA 3EE6A 4DJ5X 1C9MA 1YU6A 3VHQA 3BPSA 2W2QA 1AV7A 1EA7A 4C3UA 2SICE 1TMGE 4OMCA 4OV6B 4HVLA 4RYDA 1TM3E 5ARBA 2Z2XA 4OMDA 4KPGA 1P7VA 4CFZA 3T41A 3AJ9A 1AF4A 1SCNE 2IY9A 1GT91 5SICE 1ZVKA 4NE9A 1P7WA 3L1KA 1OYVA 2W2NA 1Y1KE 1ST3A 2SBTA 5ARDA 4C3VA 2DUJA 2ZWOA 3DW1X 5AMXA 2Z58A 3QMPA 1DBIA 1NDUA 1V6CA 4LVOA 3GT3A 1Y9ZA 3DE1X 4ZARA 5FFNA 1Y3FE 2HPZA 5ARCA 1Y34E 1IC6A 1R0RE 1SUAA 1GA1A 3F7MA 3WIVA 1PTKA 1ST2A 1S02A 3ZXXA 3D9QX 4KB5A 3EDYA 3Q40A 2PQ2A 3UNXA 3DE6X 2PRKA 1OYOA 4WOCA 2P4EA 1WVMA 3F7OA 1SUCA 3H42B 3A3NA 4KG7A 1SH7A 1GTL1 1HT3A 3SICE 1R64A 4DZTA 1PFGA 1AK9A 2W2OA 1C3LA 1SBTA 1BH6A 3GCWA 1SBCA 3OSZA 1SCDA 1KDYA 3Q5GA 1WMEA 3VYVA 2ST1A 3P5BA 3QTLA 4Z2AA 1SBHA 5I9SA 4AKSA 1SELA 5JXJA 4JP8A 4NE7A 3DYBA 2WUVA 4ZOQI 2Z30A 3DE7X 2Z57A 3LPAA 5FAXA 1LW6E 5JXHA 1GA6A 2IXTA 3I34X 3TI7A 3SQOA 3WHIA 2E1PA 1VSBA 1SPBS 1AQNA 1Y33E 3DE5X 1CNMA 1KDVA 1GTG1 1SCBA 4CFYA 2ZWPA 1JEAA 1TECE 4YN3A 3A3PA 2PWBA 1S01A 1TO2E 1T1IA 1GCIA 4M1ZA 1SBIA 5FBZA 1UBNA 4H6WA 2DP4E 3AFGA 1SUEA 1IAVA 3F49S 1SIOA 1KDZA 4MZDA 3HJRA 5AQEA 2V8BA 1SCJA 3TECE 3VTAA 1YJCA 2XTJA 1NDQA 3I2YX 5AVJA 4H6VA 2WV7A 1WMDA 2GKOA 1MPTA 4H6XA 4GI3A 3CNQS 3I30X 2SNIE 1CSEE 1BE6A 3DE0X 2X8JA 1TM4E 3AJ8A 2DQKA 3LPCA 3LXUX 4FONA 1SUPA 1GNSA 3DVQX 1YJAA 3DVRX 3CO0S 1THMA 1GA4A 3VSBA 1Y3DE 1Y4AE 3BGOS 1PEKE 1S2NA 3DW3X 4I0WB 1AU9A 1C9JA 2Z56A 4K8RB 1Q5PA 2HD4A 1P8JA 5B1DA 5K7SA 4WOBA 3D43A 1BFUA 1BFKA 1SBNE 1OT5A 1BJRE 1SVNA 1T1GA 1DUIA 5JXIA 4HX2A 1Y4DE 1A2QA 1R6VA 2Z2YA 3TI9A 1V5IA 1SIUA 1Y3CE 1T1EA 1MEEA 3EIFA 5JXGA 1GNVA 1Y48E 1PJ8A 3DVSX 1TM5E 2Z2ZA 2W2MA 3VV3A 3GT4A 1NLUA 3PRKE 1SN7A 2PYZA 2ZRQA 3LPDA 3BX1A 1KE1A 2B6NA 2QTWB 2ID4A 3DE2X 5B1EA 3GCXA 4CG0A 4J94A 3WIUA 3QFHA 2PMWB 2PKCA 1WMFA 3WQBA 3DDZX 3A3OA 5JMOA 3DWEX 3ZXYA 2SECE 2X8JB 1XF1A 1TM7E 1SIBE 3I37X 3DE4X 4BWGA 3DE3X
chains in the Genus database with same CATH superfamily
1Z8NA 2IXFA 1XKXA 3P0RA 4NMHA 1HDZA 2FQQA 2R7KA 1YQDA 4JYPA 1E64A 1VCHA 2KB0A 3K0FA 4ZOLB 5SYMA 1NBAA 5DVZA 2Y4NA 4CM1A 4FDTA 4YACA 3SSOA 1USVA 4F21A 5G41A 2C1ZA 2CHQA 2M6KA 1HBJA 3SM9A 1HR0B 4INPA 4QJ3A 2ZR0A 1K27A 2JFUA 1AIPA 2JH8A 2XV1A 5FL7D 4Z1MD 3DPSA 1VPDA 4XFDA 1V47A 2OEPA 2W42A 2IUEA 3R6DA 1XK7A 1J99A 4UMFA 1E7MA 1DBSA 2AE1A 1XRLA 2MJLA 3OCZA 1TIBA 2ACEA 5HPYB 4YV0A 2HSEA 4IJVA 2OG2A 4DCOA 1BO6A 5EJGA 4B3XA 1YK1A 2OHFA 3F5QA 5JVDF 1FYXA 4BB0A 4L76A 2O2JA 2J3MA 4MRNA 1I7QB 4NFLA 3AVVA 3GC6A 3R3HA 1NR7A 3UKDA 3B3FA 4E4TA 2XT6A 5L3QA 1DKPA 3KPYA 1C3JA 3G79A 3A9VA 4IV0A 4MWZA 1A82A 2YHSA 6NULA 5JRDS 3MS7A 4AMZA 1IOVA 1NTOA 2FSUA 2ZUDA 3OLWA 1IZYA 1E9DA 3OZFA 5EP3A 2RGNC 5JSZA 2FETA 2IKQA 2XMCA 5U9CA 2DQ4A 5C34B 5G4LA 2QLFA 3X1JA 3CG0A 1DEXA 2JIPA 4EYGA 3EEOA 1JWLA 1REQA 3KJIA 3LCCA 2Z43A 1EFPA 4C0AC 2Z98A 1SXQA 1GSOA 2R9VA 1P91A 2XDWA 2BVNA 4M49A 4W4TA 4IHAA 4RK7A 4P2BA 1D8TA 1YI0A 5FBHA 1AD2A 3I58A 2LBPA 3IA7A 2DWPA 4KZKA 3UK7A 5BUZA 2FN3A 2N42A 2PPLA 3HFGA 2Q4EA 4RVFA 3UAYA 2WHXA 1PGOA 4DLBA 1H4SA 3UGKA 2Q7OE 2A9PA 3B7WA 1G16A 2I6GA 3HN6A 3MJ4A 1OYWA 4M46A 4MKIA 2PKXA 1ID8A 3ZE9A 2DU8A 4MW2A 2FN4A 1I2AA 3OQIA 4JA2A 1S6YA 3AHJA 1OBCA 1LF5A 4OL9A 2R7NA 2WNIA 1GZDA 3VOTA 5A6SA 3LQ2A 1XNJA 2APJA 5M7EA 1H94A 5F3WB 3EQZA 1T1RA 4PONA 1G8MA 3IVGA 3S2ZA 3N3AC 5LLTA 2BTOA 3OQMA 1PZEA 2DHEA 4FUQA 3NDBB 2PD3A 3AVUA 5ICMA 3RYHB 3IT0A 1Q21A 4F1WA 2G9VA 3FFBA 2P41A 4PGMA 2QNRA 4EPYA 1NVVQ 5JQWA 3WYBA 3K2IA 1RQXA 1XTTA 4BVBA 4UULA 1JEJA 1FYFA 2X9NA 5B55A 4B2LA 4WXYB 3JATA 3P8ZA 5BPFA 2XXAB 5D00A 1J9GA 5KYKA 1L1EA 2J07A 4RJLA 3S1AB 1MTZA 3CGWA 4FILA 3N75A 4HQKA 2G83A 3HHEA 1PG2A 3QV1A 4KU4A 3NXSA 3PNQA 4RS3A 5HMMA 1QG4A 2X0EA 1JJVA 4ZK2A 4HXGA 5JDIC 2GZMA 3R6LA 1BVYF 3NYWA 3OQBA 2GJSA 4XGKA 2WTBA 1DADA 1K0UA 3D6JA 4UARA 1KJNA 5AKZA 3MVEA 1XYVA 4OPMA 5HS4A 3KG2A 1D0IA 1K8YB 1UP4A 2HKIA 3DDHA 4K28A 2W70A 2ZBDA 1H5QA 1TGYA 5LXTB 3IAAA 5FA5A 3W2EA 721PA 3VNBA 4EA8A 3LBIA 4YCAA 4UDYX 1X38A 1SXPA 1R3UA 2CF6A 4Z51A 5FD8A 3JQ7B 1JPNA 4C6TA 4LRUA 1Z6TA 4RH3A 4I5IA 4TTVA 5KTYA 2PYDA 3Q8KA 4EQ6A 4WASA 5CJJA 3RLIA 4US0R 1U6JA 3QUQA 4GX1A 4NESA 1TD1A 1FSSA 1GN9A 1OXSC 2I2DA 2PQ0A 5BSTA 4I81A 4WZAE 4KBFA 4Z1MA 2BSQA 2BW0A 3IVRA 1QZZA 1Z4IA 3FRIA 3P2EA 1U1CA 1T8WA 1VDZA 3ZV5A 4IUBS 3FKJA 3QVWA 5ED4A 1Y89A 1U0NA 3QFRA 1VPLA 1V6CA 2JRLA 2VUIB 2Y1XA 1WHTB 3W2HA 1U1GA 3ER9A 5FNVF 3VAYA 4NBNA 1KSHA 1FS6A 1XEXB 2RCYA 3O4HA 4CLOA 1KI4A 4OJKA 4DUGD 1GWNA 4L4RA 1G66A 1AO0A 4K46A 2RHGB 1P60A 4UXIA 5DEOA 5GGXA 4QTYA 2B82A 3A6GA 2NO5A 3AHHA 3OY2A 4B3BA 3RVQA 4RORA 3DGFC 2X0DA 3PKIA 1FJXA 2R6HA 4OK3A 3C1TA 3UAZA 3BF8A 1VB5A 3OZRA 4PV7A 2FN7A 2X19A 4JEIA 8MHTA 1QXSA 4H77A 2WM3A 3W3ZB 4OXYA 2C9YA 1GRRA 3R44A 4JXKA 3WR5A 3BE4A 5E3HA 2Y66A 3EXIA 2IYAA 1MOQA 1L5VA 2HM7A 2YV1A 2HMVA 4NATA 5AK4A 4A3SA 4EJ0A 4TTSA 2XADA 3VI3B 5EJ5A 3RE1A 1RFLA 5LZ5A 1GPKA 4BX2A 1CZUA 1H3FA 3DBRB 1FMJA 2C4HA 1N6IA 3I01M 1WMBA 3A32A 4LJLA 5SZJA 4AMBA 3H9QA 3UK0A 3JYOA 5IJ0A 3GLRA 4RFLA 1NP3A 1X3SA 3ELYA 4YMLA 5JXWA 2IYEA 1UMDB 4PLZA 5ALXA 2NU6B 2E0IA 3EZYA 4PO1A 1JQJC 3PHGA 2JLQA 3ZNQA 4L73A 2HHJA 2WAXA 1L7VC 4F4HA 1SVWA 2ONKA 3C6KA 4MI9A 2IU0A 3SICE 1JIIA 3VOAA 4PEVA 4KQHA 1AK9A 4C4YA 2AC4A 5C1IA 2G5TA 3MJHA 1J06A 2UXCB 4IXNA 4LY3A 4U2CA 5C3UA 3GCWA 3WHKA 5LQUA 2H1OA 2H7YA 3RK4A 3FBWA 2I6UA 2WHPA 3QLEA 2VHEA 4MQ5A 4D3DA 1UZMA 4IJWA 4ZGGA 3QVKA 1KDYA 3OUTA 3MSCA 3EGOA 5T64A 5HJ5A 3W5JA 4J1SA 1ENPA 1XQVA 3AR2A 2XMRA 1SCIA 3DDUA 4GO1A 4J7XA 4DYHA 5K0GA 4JXZA 4ODIA 3DBLB 3WQRA 2QT1A 1P2UA 1KI6A 1WUTA 1Q6ZA 3N6VA 4D82A 1O9GA 1SBHA 4D3FA 2UZ3A 3ZLUA 1Q83A 3T9AA 1XTRA 4BVGA 2I6QA 2J7PD 3DBVO 3HXKA 4AKSA 5JU6A 2P1RA 5KI6A 1XQ6A 1S9HA 1JI3A 1E2KA 4EGJA 1KP3A 1ZJ5A 4MVJG 4CXMA 2H85A 3PCTA 1UFRA 3ZE2B 1XYGA 2CNLA 3CY6A 1JYFA 3DCIA 1TMOA 2H11A 2JEOA 3AP2A 5E4JA 3VBEA 1G0NA 1HLDA 4RPKA 1VTKA 1MR3F 4RO0A 2OCKA 1CUWA 5G3YA 3TQSA 4LFAB 3TLCA 2E6KA 3OQHA 3DV9A 3V2UA 1V71A 2YIJA 3E7PA 2PFGA 1POXA 2AXNA 2XOKA 1GL7A 3CLUC 1RWPA 16PKA 3CZCA 2XGMA 4KR0A 4MR7B 1RTTA 1TLLA 2HPHA 5IBPA 3SOPA 3FVTA 4EBFA 1N77A 2L42A 1RYNA 1UPUA 1QYWA 2XDQB 3DWFA 4LGMA 1KDVA 2PSJA 3VPXA 4OQXA 3HEAA 5HZHA 3X1XA 3MINA 5FNVA 5LIPA 4C7OA 4XEUA 5G0WA 3MOIA 2A6PA 1GTVA 1JZTA 2E4UA 2E2WA 4WZBA 1AQLA 4YJHB 2QP3A 2VAMA 5HRUA 3E35A 3WK8A 3TEJA 2OWEA 4PZ9A 4A1OA 5F9HA 1SHUX 4LQLA 3KL4A 4REOA 3BL5A 4MIYA 1I5RA 3IP7A 5KPDA 1WUKS 3BD7A 5JAMA 3MTDA 1B93A 3BEOA 5FO1A 2A3RA 1ENZA 1TLFA 5AJUA 3QOFA 5LUBA 3ZBTA 2ZB4A 4RK6A 1M2GA 3SSMA 2YICA 1G5PA 1RE0A 1ZM2A 4IV8A 4YH1A 5BW8A 4EYQA 4DCCA 2W4MA 3P32A 1SUEA 3A28A 2GRAA 3H9CA 4RIHA 4TZTA 4F6RA 4IDPA 3WS7A 1CUIA 3EQ9A 2E48A 1PS9A 3A6LA 3V33A 1PWEA 3PQCA 4PG6A 4W5HA 1WY7A 3BRQA 5HXAA 4BV3A 3GLTA 5HA5A 2QAGC 1QK4A 4TRNA 3QLUC 3UKOA 2RK4A 3FRJA 1XRPA 4FOSA 3HJTA 5G3ZA 5TVGA 5JQGA 2AG1A 2A5DA 4GOKA 3VNSA 3SYNA 3CVWA 3N6XA 4GQBA 1J0DA 1UAYA 1I36A 1P6QA 1AQIA 1NF8A 3FG9A 3NOVA 4FEAA 4G3XA 5TQJA 1YHZA 1JZQA 3MGCA 1OVMA 3SS9X 4Q3AA 2FFJA 2WZDA 3OEHD 4M1QA 1SVIA 2V7QA 1PDVA 3RAGA 5B7GA 2PT7A 1AZSC 4AM8A 1EK5A 1G8AA 2ZSAA 4DDUA 3ORQA 2QJRA 2PK3A 3PLAE 1QR2A 1MPTA 3FDIA 1H0HA 1XQ9A 4TLCA 4AMUA 2F8SA 1EG7A 4J90A 4J3FA 1L5HA 1K2WA 4DDMA 4C5CA 4XJTA 5BR4A 1L7MA 4RY8A 3WFJA 2EZ9A 2O7QA 3L93A 1E98A 2RGRA 1SVSA 4M98A 1T2DA 1U1IA 2D5BA 1YL5A 1X2EA 4HATA 2BDEA 1ZMXA 3U4MA 3AJ8A 2CJWA 1EB8A 4YMUA 4HWOA 1N1GA 1QYCA 2VNAA 2XTNA 3E53A 2FN8A 3IESA 2R6R1 3ASZA 3WL7A 3ZHUA 4YX9A 1B3BA 2B6HA 4IVQA 4ZWNA 3ZTWA 3PE4A 3WSWA 3L9WA 5EE9A 4F4JA 2RGUA 1BQ3A 3D3QA 3ADBA 3QWHA 1OLUA 1T1SA 1O0SA 3DVRX 4J2HA 1VKNA 4BCCA 3GLHE 4D74A 4IJMA 4DFDA 3T3HA 3J81A 2HEGA 3I2JA 4QDUA 3CZ5A 2W8BA 4MGKR 3UVEA 1H1LA 3AY0A 3FUVA 3L7KA 3C15C 3FIUA 3JASB 1CNEA 3K72B 3WY9A 1CR2A 2PA3A 3A1TA 4KV9A 1NFFA 2XYPA 1LQ2A 3L02A 4GUDA 3CZRA 3HMQA 1EKXA 3KXIA 3T9EA 3JWJA 5LNK1 4LJRA 1B0UA 4WECA 3G2OA 2OAGA 4UPEA 5U4XA 1CE8A 5FAKA 1O89A 5L40A 2WTUA 2AHOA 3HGQA 4I5FA 5EKXA 1OLOA 1FE8A 3UEOA 4K9DA 1G98A 4FR0A 5E1BA 4NJOA 3VZCA 4F3CA 1CQIB 4Q1DA 1DBRA 1JIXA 4J0FA 2QXYA 4YS6A 5ALFA 1Z7GA 1G7TA 3B9PA 4L7QA 1BFUA 1K89A 4EI7A 3KYCA 3CX3A 3INRA 5CXSA 4M7WA 4OHRA 1BS9A 1MQ9A 4B6QA 2H6EA 1M1NA 3H8JA 3KHUA 3FHJA 1VCOA 5FX2A 3MRVA 1DE0A 5JXIA 3MRTA 1TXGA 2ZRPA 1NLFA 1Y4DE 3AFHA 3KQYA 4YI5A 5I8PA 4A2WA 3GVHA 3ZWPA 1EE9A 1OWPA 2YQ5A 1UUFA 2I4OA 2OBNA 2Z2YA 4IYJA 3PXEA 2UUPA 2ZI6A 4JVNA 4K6HA 4PPGA 2JF0A 1T1EA 2HV9A 4K03A 3FZGA 4YXFA 2WD8A 1E7RA 4JJEA 1OXVA 2LDBA 3SX4A 2EKPA 1X1EA 2X7JA 1KH1A 3LBAA 1T91A 2BEUB 2ZM5A 3DUWA 1RXUA 1MZVA 2H1LA 2QJFA 3PHJA 1KQFA 3B8HA 2NYAA 2EARA 2Q45A 1C7QA 1S4MA 3JU3A 3NHZA 2V6GA 4AQYB 3MNFA 4G5YA 2JIRA 1U0OC 1VYTA 3IV7A 1RVV1 3L1IA 4N01A 3ZS8A 3DD1A 4Y2JA 2ZRJA 4ZAGA 2PS1A 3WLMA 3C70A 4QHSA 2G82A 1DNPA 3OH8A 5CX4A 4PGFA 3G5MA 1SCUA 3AESB 4U02A 5IFKA 2G71A 2JIDA 4CM4A 1E60A 1J09A 2SCUA 5EYPB 4FEEA 1GUAA 3H2KA 4DB2A 3X1ZA 1XT6A 2F8TA 3HU5A 3ITEA 1QVVA 2IP1A 3FY4A 5CLQA 3EBLA 1QCCA 3L7OA 4AB1A 5KYUB 1MVLA 1TJ5A 1TEZA 4IZIA 5ALDA 3T5CA 1G3UA 3W5AA 1YF3A 3OPNA 4QRIA 4RMHA 3I61A 1P31A 3GB9A 4URHA 2OC9A 1NJ5A 2OCGA 2QTWB 4RU1A 2XD4A 4I9UA 4UFPA 2YHUA 2IZZA 3L8HA 2ZANA 4RTOA 4D80A 1UXOA 1N2ZA 2CZGA 3GJ6A 1M2EA 2NV2B 4X3OA 4FGKA 2DPYA 3ILXA 1YDFA 1DHRA 4HPJB 2XCSB 1FX0A 2ASEA 2Q4DA 3ZV3A 5BV1A 2QZ4A 4AI6A 1ETUA 5CJPA 1EFHA 4Q4AA 3UIEA 2OORA 3C87A 1BC5A 3OM1A 1X7YA 3PHIA 4O4JB 2VYVA 2I71A 1AKUA 2A14A 2CZQA 1A5TA 4XJXA 4PG8A 3LXRA 1M6YA 3SFZA 4D7AA 2DF8A 4L1KA 4P54A 3H84A 1WXQA 4EY4A 4GYYA 4R41A 1Z0ZA 3CIOA 4QJ4A 1Z47A 1VFPA 3A1NA 1HGXA 4ZC8A 4DRYA 1H8EA 2WUGA 3TPCA 2X4LA 3LRXA 1LF0A 5AVYA 1NKTA 2CLDX 4GZ5A 4NIMA 2Z4SA 2XZPA 1KFBB 2FF5A 2PXCA 5GVSA 4I1YA 4N5MA 4B79A 3EPJA 1FJ2A 2VSQA 5CA0B 4HD8A 4UBJA 3QVVA 2FPWA 1WAMA 2GTHA 4J75A 2I5PO 5I6DA 3R8CA 4H17A 4RESA 3MUEA 1CG6A 2XX3A 3H2ZA 4M8IA 2CHUA 1XMVA 3I5AA 2V9ZA 5GIOE 2VFAA 3UJPA 1F1BA 4C0XA 3V8QA 2FP4B 2XUGA 3NRCA 3KOOA 3QVJA 2UZ4A 4LBZA 3KPWA 1E32A 3BRWA 2PZLA 4QVKA 1G9TA 4MUMA 2I78A 4FFBA 1T5OA 2CXHA 3I9V1 2JLZA 4K9RA 1AS3A 1FLVA 4DBLC 2AYYA 1PVVA 1XD8A 3MSXA 1DG3A 2YDYA 4I99A 4C05A 2CLMB 3ZLJA 1SXGA 2O1WA 1XELA 1VFNA 5DYGA 4FWTA 5REQB 4MIEA 2FW9A 4RVDA 3GLIE 4WH0A 1XVIA 1GO2A 4WY8A 1Y82A 3LVRE 1VKHA 4MVJI 4RSMA 4ECEA 4O0LA 1TD9A 1T4CB 2RHJA 5FTWA 4J4BA 3RKSA 1QV6A 3BGDA 3MOGA 3F2VA 4II3A 2BBSA 4MYDA 5AICA 5B37A 1MV5A 3FNHA 2Y6UA 1SU6A 4K9KA 3SMQA 5I7RA 1TYEB 2OTCA 1GPNA 4B7ZA 2GSWA 2QZJA 4IIEA 5A62A 3KQLA 1I80A 1LSJA 3RADC 3V7YA 4RTKA 2JZOA 1MW8X 3P4XA 3GJQA 2ERXA 4TM8A 4BJ1A 2C83A 4URFA 3MCUA 4WLNA 3CVYA 4ER3A 1ID1A 1ZD8A 1M2FA 3NHWA 4JYBA 2Z6UA 1BNCA 2OZKA 4I8DA 4M1YA 1K8ZB 4EATA 1ILWA 1LFAA 1X1RA 1L5QA 1WQ3A 4BNUA 1DLIA 2LGJA 3TZEA 4UHJA 3QOXA 1EA7A 2ABWA 4ZVPA 1U9ZA 4D0SA 2AJTA 4NNOA 1I0IA 1PLJA 4LWOA 2Q5CA 4PFJA 5E9AA 5A7GA 2WKRA 4UBKA 1Z0IA 2J30A 4LGVA 1KYIA 4P7KA 4A8JB 4M1OA 4ZZIA 2Q6VA 1N5JA 1DGQA 1YDMA 2Q3EA 4EB6B 3VVCA 1KJ8A 1PHPA 3A2KA 2M98A 3FOBA 5FEMA 1P7VA 2FX2A 3IQXA 4OD0A 2VTKA 4CFZA 4B76A 3THSA 4RQUA 1PNVA 1MO6A 1TOAA 1UC5B 2B9VA 1Z83A 1BX3A 3OIYA 2PUFA 5CA1B 4ZCRA 5EQDA 3ICQB 1XCLA 4X0EA 2E5LB 3GMDA 4NJEB 1F8FA 1SUSA 1NR5A 2CL0X 2DH5A 4IDAA 1N0VC 2YV5A 1RJ9B 1LVUA 5E9JA 1LK0A 2I9KA 3CEPB 1R9JA 1TZJA 2CXQA 4MWEA 2XB4A 1XPUA 1EVKA 3P5SA 1U1EA 2R68A 1KORA 1RVDA 3ZU2A 3PEWA 3I6YA 1GU1A 1P7WA 1TADA 2K5UA 4YMSA 5LZ4A 2D1TA 2FQYA 2BFNA 1HYHA 1RHQA 1YB7A 3D3JA 3I9NA 3RD5A 1C7ZA 2GT1A 1MEOA 3QUTA 4HUQA 1FSGA 2OCAA 1JMYA 3V1TC 3N8GA 3SS8A 3IMEA 3HYLA 4MICA 1SUWA 4HNGA 4RCVA 1G5TA 5IAAA 2BISA 3L4KA 3F1KA 3VVBA 1BDHA 1YRBA 4KZPA 2WSIA 4F7WA 4UM8B 4YRDA 2IV2X 1OB5A 1UBUS 4HNAB 1ULAA 4LBWA 5DX8A 4C4OA 1QUEA 1J2EA 2EDCA 4DJAA 5AI4A 5KC8A 1GT6A 1HT0A 2GBLA 3EXFB 2PL3A 1A9RA 3R0VA 4D96A 1DO2A 2BGUA 3SEZA 4OX9Y 4TUYF 3RYIA 4B80A 2YS7A 2HH9A 4OMUA 4WACA 1BZYA 4XWOA 1QH0A 3WB2A 5KJFA 3JQRA 1JHVA 1R9NA 2BR4A 2IXAA 3KSUA 5KYXB 1E7WA 3TG8A 4TV8F 2VAXA 1V2GA 3PIRA 1SR8A 1U5BA 2Q7XA 4FYJA 4LRYA 4Y1GA 3TFQA 3ZX4A 4BQOA 4HVCA 2H59A 1GNQA 2G7MC 4ZZ2A 2NTEA 4TXNA 2JLUA 1KMMA 3LG2A 3PIDA 2P6UA 5JHGB 3EDYA 3F0TA 1T5BA 1GL9B 2XQGA 1H2HA 1A4IA 1QMGA 3VYUB 4M8SA 1ENOA 1K2VN 1Q7EA 5ICGA 2IHNA 4WESB 1K98A 1Q1GA 2ORWA 3IS3A 3FJYA 3L8MA 1N7GA 4GKKB 2GHIA 3NW9A 3RANA 2R84A 4Q7QA 1RSZA 1OYOA 4Y9RA 2DPMA 5CDSA 5EJ8A 1P17A 5AOAA 3KZMA 1ACLA 4J9VA 4UZFA 3TVYA 2C2BA 3IMKA 5KOJA 2EJVA 2PBLA 1R3DA 1LY1A 3OO1A 2C2HA 4HI0E 4U9HS 2ZG6A 3RTGA 2ONYA 2V59A 4XDGA 2FPUA 5J4KA 4DV3B 2IK8A 2G04A 4FC7A 4G1EB 4RZ2A 1GTL1 3AIIA 1HT3A 4QNMA 5ECDA 3KE8A 2OZPA 5ALJA 4JBNA 4LOAA 2C2ZA 1Z22A 3VTZA 4Q3CA 3O1HB 4IJQA 2R65A 3A6PC 2BMJA 2EP7A 5J2UB 4QXOA 2LTAA 3SF0A 2J0UB 4B0OA 5C7YA 3HDJA 3ROKA 1ADGA 5HYVA 2X6QA 1B26A 2QX6A 1H4VB 3IAS6 3LUHA 3KQNA 4CBVA 2OO7A 2DUNA 1DX4A 3EZNA 4HLUC 2KLBA 1TM2A 3F6YA 2IEIA 4MPTA 4JH0A 2NXCA 1Z2DA 2P9QA 2XCQA 2WFMA 3EYAA 3UHOA 2GK6A 3RS0A 2ZK7A 3HKDA 3SJCA 1RM0A 2J9XB 3D2BA 3OM0A 1FDIA 3PUWA 1CVRA 1OXBB 1U4NA 1Z16A 2ZKIA 5FHQA 1O6ZA 1UEIA 2HF2A 4MI3A 4QO7A 3MPOA 5CNIA 3F7TA 2YJZA 5J23A 4ZEWA 3U26A 5LDHA 5CD9A 3DC2A 1IWPB 2QVYX 3DEKA 3IDFA 5JNSA 1HWYA 2CBGA 3IPLA 4JCCA 4AQDA 2VBCA 3QG5A 4OKIA 2PH5A 3FBTA 1ZNXA 2H16A 4CDRA 4DIDA 2EWWA 1S1MA 1IMOA 4C4TA 2ZFUA 1NJ1A 3MCVA 5AJZA 4ZCPA 1A98A 1XZEA 4ZOLF 5HBGA 1EAMA 4PICA 1ZGAA 3FI0A 4LYJA 2PV7A 3R23A 5FLXA 4DR3B 3VNUA 2Z83A 4BWVA 2G40A 4ZK6A 4MAMA 4E1AA 3ZZUA 3PPYA 1ONOA 1W96A 4MRPA 2JGDA 2P4QA 1UPBA 4ML3A 2E1PA 3UB3A 2I2WA 1G4AE 4BL5A 2QR2A 4EL5A 2QE7D 3K9LA 4B2IA 3DE5X 3IDSA 1YRLA 3ENNA 2E55A 4FFWA 4ND7A 5K3BA 1EXDA 3K9NA 4TUYA 3ORHA 1F8UA 2ZS9A 5KTSA 5DM60 3ZHZA 3EG9A 2AVNA 1PR2A 2I76A 1JSCA 3DQPA 3G2NA 4EJFA 1Q7GA 2WYIA 3IP1A 8OHMA 1A4XA 2P9HA 4XAQA 2R48A 4EAAA 5T8KA 1YU9A 2H5IA 3A3PA 2Q4TA 3GFBA 2JDID 4N0EA 4PY2A 4TV8A 1MABA 1U31A 4M99A 1W36D 4Q1CA 4C0LA 2IFTA 4KVGA 3U3MA 4EGSA 4ZRMA 5JC8A 2W6MA 2V7WA 3K09C 4CHGA 4YDSA 4EW1A 3ER8A 3OZAA 5FBZA 2Y76A 3PU6A 2R47A 1R7RA 3IOEA 3CZMA 3PC7A 3DAPA 4H1UA 2YWRA 4OHPA 2QV7A 4E51A 4BQFA 1GM5A 2F62A 4X3CA 2FSHA 4DAEA 1NVMB 2VT2A 3B6IA 3G68A 4O3FA 1PU2A 2CC2A 3FNFA 1PYOA 2P9FA 4NPCA 3PD7A 4XB6B 3WL5A 1T3HA 2QVZX 2GJKA 3L1UA 4QOGA 1ZVVA 1TTPB 1GNPA 1WUHS 2AOUA 4UVDA 3IBCA 4QXQA 4DQDA 2VT3A 4L07A 1XCMA 2C96A 4C1NA 5HHTA 3HCWA 4JUCA 4JC4A 2V7BA 2J5KA 1E3TA 2IS4A 3FPAA 3IPYA 4XIJA 2KW5A 4I9GA 3VU8A 3ZWDA 5CB0A 2EQAA 3L92A 3WNCA 4BKUA 4OXRA 2WJAA 3GUYA 4I19A 3TQFA 5A5VA 2DY0A 3L5KA 2WJVA 3MS2A 4BCDA 4JGBA 1HZZA 1ZGBA 2V7XA 4RSRA 4UMVA 4UTPA 1LBQA 2GXAA 3LXMA 3QVXA 3PDIB 4TS4A 4UCXA 5EIAA 2WF7A 4KPUB 5KOIA 1BDBA 1QDLB 3TQTA 1ADJA 4DABA 2REXB 1M2NA 4FYIA 4KAJA 4RUKA 1A72A 3I30X 1KEUA 1EP3B 4NRDA 2FK7A 2X0NA 2X0KA 3O6VA 4O2AB 3WXMA 3VI4B 5C7IO 2WQZA 5DRYA 2PZ8A 1BD4A 1X74A 3FETA 1E0SA 3M6FA 4D9IA 3ENQA 4Z53A 3GELA 3VHLB 3Q3HA 1R0BA 1ZIPA 5HFNA 2YJNA 3EEBA 3O8QA 3SBXA 3G7UA 4KLRA 3PA6A 1DAMA 4G01B 3ON5A 1UIMA 3ROEA 4CV3A 2C92A 1MB3A 2IYFA 1FYEA 4MCHA 2C5HA 3RRJA 3FLMA 3YASA 4MULA 4ZOLA 3ZR4B 4WFIA 3RWMB 4GZ6A 4MQBA 2X58A 3KJGA 4RJKA 3BOSA 4EG6A 4CDNA 1ZOIA 3B9RA 1JG3A 3N2GB 1XA0A 4X94A 2J0VA 2WZQA 2BV3A 5LXTF 3ELWA 4DEVA 4LXIA 4YDQA 3HXMA 1ZLYA 1LLDA 1Q15A 4RGQA 1ND5A 3SQMA 2ATCA 4E5NA 1V3UA 1YS7A 3BHNA 3CZPA 3BGOS 1EUQA 4HYEA 4F6LA 2HZBA 1IBMB 4EG7A 2ZWIA 2EL7A 3TXXA 1RWOA 1Z6QA 4GSKA 4WGGA 1WXHA 1MRNA 3V7FA 1ABEA 2P68A 2QVBA 3E58A 2K6GA 2Q29A 2WIDA 2OGTA 3IP3A 4IMPA 5F5XA 4LZAA 1NP6A 1WZIA 4U2EA 3AI2A 3CM0A 5KJEA 3WQQA 1HL7A 3COVA 3CF4A 3U9LA 4CMIA 2QE7A 3EQ7A 4HDRB 2OQIA 2OZLB 1ULSA 1RKBA 3DEIA 1P8JA 4I4TB 4N7JA 1LBHA 3ETJA 1HEUA 2X23A 3D43A 1HDXA 3A10A 4PFKA 2W90A 3N8IA 5F35A 5DK4A 4AT1A 4PZLA 1Z35A 2H48A 3DTTA 8ADHA 1EFAA 1A2KC 1OT5A 3R0JA 1QYDA 2YVQA 1T9DA 1TX4B 3EVZA 5EVCA 4BPRA 1V1JA 1MRSA 2HB6A 1COWD 1J70A 1L4NA 1Z4OA 2GYYA 4TV9F 4MUIA 4X90A 1LVGA 3QW4B 2NNLD 4R2MA 2WDPA 4XLTA 4ZO4A 1Z12A 3SNHA 2FZLA 4QSHA 3VR5D 5EERA 3HR8A 1YONA 2OAQ1 3R8FA 4LY0A 1MO5A 3AF4A 2QTLA 1OI2A 3LBFA 8ABPA 2QLJA 4QC2A 3O2QB 2EF1A 1YMQA 1JFVA 3EASA 4K3VA 5LA6B 3BK7A 2VHXA 1PQWA 2FR8A 3D3WA 5H5JA 4BV8A 2MSWA 4EYSA 4Z4CA 4E94A 3TSWA 5LQNA 2IBTA 3DVSX 4X6UA 421PA 3NC4A 3UMFA 4F5DA 1QGYA 4MMYB 4YAGA 5JEEA 3OA2A 1U3UA 3C3YA 3CJRA 1KIMA 4L4ZA 4R98A 3VZRA 6LDHA 3I5MA 5FWXB 3GBVA 2OXIA 4EJ6A 3LC7O 3OQPA 5ALEA 5CRIA 1YDGA 2A0WA 3G0IA 4DUYB 2GOYA 3A7DA 4IOKA 4WXHA 1XZFA 2FI1A 5AKLA 1OBVA 2QMQA 4IAOA 2R86A 1NE2A 2EVWX 4ER5A 1CUYA 2ZU0C 3SHFA 4TMXA 1LEHA 3GCGA 5AK3A 4CMGA 3Q6MA 2B98A 3R5FA 3OEEA 5DK6A 1KZ1A 2CBXA 3A04A 1SUIA 1J0XO 2IDMA 3X1YA 2YVLA 5CG1A 3RSGA 1NL3A 2OYSA 2F3PA 5EMNA 5TSDA 4GZ3A 1A95A 3GVPA 4A0SA 5C81A 5CFQA 5CFLA 1I1HA 4QPNA 1XAJA 3SVLA 3LF2A 2VJPA 1JDSA 1BU5A 4C20A 3C41J 2JNWA 4PYLA 4Q82A 3BH7A 1OV4A 2H1VA 2CDBA 5E6UB 4RTSA 3S1AA 1CB7A 2ZSKA 3LE8A 4NYJQ 1Y9JA 3BTOA 3QEJA 2XCIA 1LTQA 1ODCA 2P79A 2CFTA 4FGWA 4LSMA 5CK5A 1GZ4A 2QRPA 3FOWA 4Y3UA 1TA9A 4LYYA 3PVCA 5L3RA 2PKCA 3QI2A 2H8KA 2HI0A 1LPPA 4BJ3A 1IAQA 4ZQGA 4JJ7A 2JAWA 5FWYB 5LXTA 1CQPA 1ODJA 4OQEA 1CRLA 4WCFC 3A3OA 1YR7A 3FYHA 3T7TA 3UMBA 3BAFA 1J8DA 3ZXYA 4QREA 3LD9A 3OZGA 2P30A 4OUDA 3ET5A 4CMAA 4P5PA 3B89A 1MUUA 2FQXA 3GVXA 1QDEA 5C1DA 3VR6D 1W1WA 1SB9A 3TZQA 3AQIA 3OQJA 4ZQIA 5LR6A 1BG6A 2IGBA 2VP5A 3OZ7A 4YCSA 2YJ4A 1A5ZA 2ORYA 1P2TA 3JAKB 1EG2A 3K05A 2XRMA 4MUGA 3HU1A 2IBSA 4CKWB 1FVOA 2WWIA 2ZT8A 3OPYB 4MXDA 4UMDA 2ZIGA 4D42A 1M2WA 3GF4A 2BP7A 3MMZA 3W8RA 1TB4A 4XEHA 3SXUB 2IU6A 1WHTA 4NMMA 3TAHA 4C07A 4DHWA 2ECKA 3ZKWB 1HORA 3ECAA 3VX4A 5FDFA 1RYEA 3OSUA 4TPKA 4V2UA 4X1YA 2XUIA 4EA9A 3Q3JB 4TS9A 5IBRA 2NSYA 2YS6A 3EPHA 4GMXA 2RGXA 2C99A 1TUGA 1CY6A 4ZA2A 3ND5A 5C5CA 4E22A 3AP3A 3ILYA 3A14A 1K3UB 1IG0A 1QZ3A 5JFOA 4DLUA 4Q39A 4TV9A 1USKA 4KBYA 1XV5A 3RUCA 3W8FA 1CY4A 2WD7A 1VSVA 3U9TA 1I30A 1RRVA 2PFKA 3WWDA 1CHDA 2EWMA 4BGVA 4DC0A 3Q8XB 4MUKA 3ND7A 3VRHA 4BN4A 2X4GA 3EWSA 5AHKA 4EHLA 4BTVA 5J43A 4M7RA 4TMKA 4BYGA 2WA1A 2FWMX 3G1TA 2WWWA 1ZH0A 1Z5ZA 1R12A 4Y7CA 1KQGA 3TQIA 1C80A 2ZXFA 4IQGA 1ZINA 4HL6A 2BFCA 4EFNA 3DBRA 2XUQA 5HQJA 5BYJA 1G6HA 1X7XA 3INTA 2HCJB 1E59A 1T2NA 4LQ4A 4UDOA 1NVFA 1UMDA 3EY4A 1NV9A 2NU6A 3I9JA 2PEYA 2H5JA 3G0OA 4EMBA 4G1MB 9LDBA 5KHAA 3NHUA 4ZGBA 1O94C 3MRXA 4QU5A 3EE6A 5IN5A 1XVLA 2CNKA 3CRZA 3RTEA 4DA8A 5AUPB 5C31A 3NH9A 3O7WA 2BM1A 1NE7A 4JR0A 5A0FA 3GNSA 3GHHA 4RZXA 3WLKX 3K5HA 5DBOA 3T1NA 3NHYA 5EKSA 1A88A 3ISJA 5I7UA 1FFAA 1RKVA 2ADMA 1N33B 5DM0A 5EZQA 2DR0A 3TBFA 4PNHA 1CUGA 3AUSA 3RDPA 3E05A 4BAGA 1IRIA 1BWSA 4JR2A 4K6MA 3I05A 3TAUA 1HE2A 3USZA 5LPNA 4HAXA 5DGDA 5IN4A 3DBLA 4LPKA 4A6PA 1A9OA 4ENRA 2QYHA 4NZNA 4ZMRA 3DLPX 4IICA 3JTEA 5ES3A 3GQVA 5TEVA 3TQQA 3G0HA 3Q7PA 2IWRA 2VK8A 5KWJA 4LXYA 4NFYA 1I7PA 1NQVA 2XMPA 3DM9B 2FEXA 3PQ8A 3H9EO 2JFPA 3RTDA 3HJBA 1DEHA 4G5RA 4IFIA 1UDRA 2YNMC 2ZYDA 4U7HA 5IDXA 4CW7A 5JJKA 4EI8A 3TN7A 2QMOA 3PC4A 2GA8A 2XTAA 5ICEA 4KQ2A 1AQJA 1NRWA 3LGXA 4O2LA 4JY7A 5BWMA 4DTIA 2W0MA 2HYIC 2IY9A 5PGMA 5FBVB 3U48A 3DFKA 2QGNA 4Z5XA 1GT91 3RQSA 1G7SA 3FPEA 1QLHA 4FJ0A 4UHBA 1LNQA 1FFEA 5BQFA 1NULA 5L9AA 1PT9A 3QMVA 4K9PA 1PD0A 1K9SA 1LSSA 4MYRA 4EHDA 3DYIA 1ESDA 4JELA 4P38A 2V3VA 2W2TA 3KJEA 5DHQA 4MR7A 1A9YA 5FLYA 3DOHA 2QMZA 4OLHA 2D13A 1Z34A 2RGAA 2K4MA 4R3UC 4MRRA 2DQYA 4R1MA 1D6NA 5LSAA 1NGSA 5D5HA 2XDYA 4RHUA 2JZNA 3DFIA 1I6KA 2QRHA 3R0XA 3G0DA 4RM2A 2AE2A 2COKA 1NM5C 5DGXA 3ZV4A 5DNUA 2WVHA 1ZGJA 3H6GA 4ZCQA 3NMUF 1CCWA 4AZVA 4UUOA 4QG3A 4GH5A 4ITUA 3ZC3A 4MV1A 4YJHA 1IM5A 1FS4A 1ZUNB 4D41A 1LRKA 1EUYA 2FZWA 3PQ7A 3LCRA 3BFPA 3S2FA 1E1KA 2O7VA 1U8FO 3CR7A 1SPXA 2DY1A 3WHPA 4HN2A 2HGSA 4LWZA 3KP1A 5IJXA 4ZO8A 2C9OA 2AZMA 1EVJA 3FRHA 3A6FA 2PA0A 2CE2X 4R5MA 2WWVD 2ZAYA 3L4BA 4X6YA 4XD7D 4CKBA 5LWQA 3EHEA 2K7FA 1NVVR 1C3EA 2JBWA 2J9YB 4P3NA 2AR7A 3V6MA 4IQ8A 1BKYA 1V95A 4GKBA 2ZZNA 2Y1OA 2V6BA 4M6WB 1G2QA 4EB3A 4AG6A 2WVGA 3M4JA 2O6LA 2O4UX 2W6OA 3RBZA 3OMLA 4AS2A 4DEYA 1GG2A 4MA0A 4YYEA 3ESAA 3LC0A 3MMNA 2AW3A 3ZXXA 3TB6A 2B4RO 4I3HA 1RXWA 5J3JA 3FSGA 2PQMA 4MZXA 3UT6A 2NVOA 1AUQA 1BJKA 3QELB 5BUCA 4PLTA 5IASA 3NBKA 2ZP1A 5LLDA 3GQBB 3TUJC 3K9QO 3PGMA 2VBGA 1GZ3A 3BORA 2W2VA 4PZCA 4BNXA 3AR6A 3AOEA 3P9RA 2CXNA 3R4CA 4HFMA 1DQZA 1XTVA 4HQOA 4HXFB 3T7RA 4R1QA 5JCPA 1CY8A 4R40A 4RF5A 3WWOA 5DM1A 2FYTA 1IXZA 1OFUA 2HREA 4PXAA 4Z7QB 2O8EA 2CLLB 2HUPA 1GPDG 3EMVA 4HDQB 3SJZA 3TRFA 3HBFA 5AK5A 3U4AA 1GQOA 1L1FA 4WBNF 5IFLA 2Q62A 1N8TA 1B6GA 3OBIA 3RPEA 3KVYA 4UTNA 5EUCA 3L07A 1Z38A 1BHSA 1KL7A 1WB6A 3KAPA 4RELA 4IX1A 1SBTA 1MORA 3W90A 4MK4A 1K5HA 1N2CB 4FW9A 4BYMA 5DXAA 5HM8A 2B37A 3PTZA 1A9XB 5L3ZA 3BFKA 3RABA 2HEIA 5K6AA 4WN9A 4FHCA 4F5EA 3U7FB 5IYZB 2MSCB 1F6BA 3QTLA 4HWRA 2A0KA 1KY5A 2BKAA 2JH3A 4UBOA 4JKIA 4XW2A 3MS4A 3BIOA 3TCKA 4PYNA 5IMBA 3TRIA 5LM3A 1ZVMA 3VO2A 3WTCA 4G0ZA 4CIWA 2H31A 3OZTA 4AZTA 3RV4A 2HUNA 4F8EA 1O9BA 3VZSA 1SXJD 1Y8RB 3VU3A 4RIFA 4AZ3B 2ALJA 2HSWA 3NB0A 4TKUA 2BCJQ 2WAOA 3WKDA 3ISVA 1X9IA 2AL7A 4TWZA 4JXJA 4JDPA 1YAHA 5SZHB 1KSGA 3SK0A 4BB9A 1FJGB 1IUKA 5A0VA 4MX8A 1HX7A 4UNSA 1KDPA 1G2PA 2X7HA 1ZM3A 3K0AB 4HS4A 3F6EX 3F9RA 3OFJA 4GYKA 2ODQA 4NH4A 2B3DA 5A4IS 4IDDA 5DNCA 4DDWA 1D1SA 3COSA 2C0CA 3E5MA 3SAJA 1P1CA 5AJWA 5G0VA 3TZBA 3RBVA 1SPBS 3KZNA 1QG6A 1XZDA 1F5SA 1PQYA 3QFSA 1OBFO 1CRZA 1IH8A 3GJRA 3VZQA 3JYLA 4R6WA 3RC3A 3GRYA 1TW3A 3K20A 1IZZA 3B7PA 3S40A 4BNNA 4TYYA 3CMMA 4B43A 1J0BA 3QPWA 1JEAA 1PN3A 3WO0A 1LJLA 1TJ4A 1I4OA 5FIUA 4C7XA 1EX1A 3PPWA 1HT2E 1X8JA 4ZKDA 1WXDA 2CLFB 2Q6IA 3ZHTA 4AKIA 2KBEA 3LDGA 1Z39A 2BEUA 3K32A 3PRHA 2B99A 3PQ4A 4PPQA 2V4MA 4PZYA 1G2IA 4QYMA 4BE7B 2O06A 3BSYA 5BVHB 2BDTA 4MDYA 5LZ8A 5IF3A 5BT9A 3ZW9A 2J45A 4DJTA 2IEDA 4R84A 4DVJA 4EQZA 2QVLA 5TB5A 4E7OA 3L77A 4FM9A 1QF7A 4Q7KA 1P5JA 1UBGA 1LD3A 1BMFA 1CJUC 3KVNA 4WE3A 3R0QA 5FTNA 1ZD5A 3KJFA 5SV2A 2V5AA 1ZISA 3QWIA 4G5XA 2C4NA 4W8HA 3VJKA 2C1XA 3KT8A 3WGYA 1K8RA 1FQOA 4KWCA 2JI7A 3IP5A 3AESA 2VJAA 1NBWB 1WB4A 2H1HA 4PLFA 1W94A 2EW2A 3TDNA 4TMVA 1E1QD 4M8LA 3UXMA 4QBIA 5CIWA 4L5AA 3ZD9A 2FWJA 2A30A 1DCKA 3AKYA 1C30B 5KYUA 3HFSA 3CUYA 4R3NA 4Y6OA 5DB4A 4BLQA 2VF8A 1KFJB 4WBNA 2MSLA 1UK6A 4LZNA 4TMYA 1EFUA 1S3IA 3H5TA 3DH0A 4D9EA 1D1PA 2QTCA 4JUFA 13PKA 1GFSA 1EJ2A 4R2HA 4DEXA 5EEGA 3MWKA 3KCQA 2XNKA 3KC2A 3ONVA 2XTJA 2QD4A 5AIBA 2GASA 1PBTA 2QRMA 3HC7A 4QGGA 3GX1A 2BGNA 3MRSA 1OPXA 4PPYA 3GR6A 5FOTA 1WMDA 3MTJA 1R8XA 4GR5A 5CLIA 5ES4B 3G1WA 1XMPA 2HXYA 4TLBA 5IT4A 4BEBA 4E5UA 4QOJA 2P3OA 1JXMA 2ZZMA 1U7DA 1KU0A 2WTMA 4I1OA 1K68A 3PUVA 1UZUA 3E9NA 1Z0AA 3I2HA 4Y9SA 1LLQA 2NV0A 1EDDA 4Z86A 4G81A 1VGQA 3DZHA 5FBLB 4MLPA 1T9CA 2MR5A 5HKKA 5CA1F 2J3HA 1CUEA 3I9MA 3L7CA 3ZVNA 1XFDA 5BQ3A 4A26A 3UWKA 1DSSG 5KREA 2NT4A 4N41A 1ULHA 1FEZA 1OTXA 3P94A 4D8UA 2D2XA 1MCZA 1JA9A 4OHOA 4YAJA 5HRCA 4FQ8A 2HIMA 5IXJA 3GDWA 2XQIA 3NXKA 3DCJA 2XE6A 5CIYA 1Z88A 1K7XB 2P4HX 3FZQA 4KFUA 4LZJA 1B23P 3LVQE 1RBZA 1NLZA 1PL6A 2AWNA 1L5NA 1M5TA 4NNJA 4CTNA 3R5TA 4GP7A 4MR8B 1PZXA 5IHXA 4J43A 3OWXA 5KOHB 1I4EB 3LF1A 1X9HA 1UBLS 1BFDA 2BPOA 2O14A 4RK4A 1GADO 4NAVA 3WLRA 4BBPA 2IW1A 2FP4A 3E6AA 1E0JA 2FY8A 3L1JA 5IM5A 3X44A 4O4LF 1KZ9A 5CD1A 3F5DA 3LRTA 5CP8A 4E7PA 2FSIA 3F6BX 4LX8A 1HE5A 1BRTA 1C9JA 3WIOA 1TIKA 5I4KA 3ZDFA 3BMXA 4ACAA 4YMTA 4GC9A 2BJVA 1M0EA 2LPMA 4NF2A 2JFYA 3Q3IA 4MKRA 1WA5A 1NUSA 2B25A 5REQA 1RM5A 1EJ6A 3MD0A 4REQB 2AC2A 2XUAA 4TKMA 3RAFC 3PNYA 3DJFA 4W9MC 1PVDA 5L4SA 1LI5A 3OFKA 3UQZA 1DWPA 3CZQA 2IXBA 3T3OA 2VG8A 2ASVA 4N54A 3AB3A 1C7EA 1QHYA 1VIVA 2FFHA 1BJRE 4K0RA 5JYEA 2ZXUA 2XMBA 3PC3A 1FLAA 4BDSA 4N12A 1JDPA 2AK2A 3EGXB 5A02A 1GNRA 3CUVA 5FULA 1KO4A 4HN4B 1FXUA 3MD9A 2MYNA 3HU3A 1JIUA 3KUXA 4A5SA 4UEWA 1V5IA 3E82A 3H87A 3I2KA 5IJ9A 4TZ6A 3PD1A 1GG5A 1HPLA 1U80A 1N4DA 2IYXA 3ISTA 2XNSA 2AFHB 2VA8A 1G8YA 1BW9B 3C3AA 5H81A 3CJTA 3G0BA 1EWRA 1G19A 3DNMA 4WNYA 4E2FA 2OZVA 4DQXA 1XU9A 3I0NA 5KDLA 5T67A 3LCVB 3JYPA 1GGMA 4UUNA 4EABA 3AR3A 3F9IA 2CE7A 5F23A 5HGXA 3S68A 4YUXA 1POWA 3AEQA 2UVDA 1E1QA 4U6QA 5B3JC 1R0XA 1U2GA 1U98A 2V7VA 3GT4A 4I46A 3UMVA 2IH4A 3CONA 2PGNA 4Y2YA 1NY6A 1U0RA 2R8EA 1JECA 2ZJ0A 2YWGA 5BNFA 3WFIA 2CMDA 4GOXA 2Z1NA 5CGQB 4YRKA 4XWKA 3U7RA 4YR7A 1ULUA 4A8JA 1R5BA 1ZM4A 1SBZA 2YTZA 4IDNA 4OXIA 2QPTA 5FL3A 5A1TA 1EGHA 3D8HA 3BH6A 1CUBA 3CS3A 5KOYA 4EB6A 2PX8A 3UUEA 4IVNA 1OU4A 2YMLA 3K1AA 1HSZA 1IK4A 1V41E 3GDOA 4X8MA 3BMOB 5F64A 1DUVG 2I66A 1JKXA 4X6LA 4ZVUA 5CA1A 1AHNA 4YR9A 2KLHA 4NJEA 2ZVJA 5K8LA 3EODA 4YHHB 4FR2A 3DLHA 1DKQA 1Z8FA 2PGDA 1BIFA 4F2HA 3KXPA 1JGTA 4K05A 5ADWA 1P2SA 1RJ9A 4KQXA 2F59A 1E5XA 3BIXA 3OZBA 4I8IA 4R9NA 1SM4A 1H23A 2J5BA 4EJMA 3IJ5A 1NVGA 2Z3VA 3HE3A 3OX1A 4JJ6A 3CVJA 5J4YA 3EFHA 2J5RA 5AI8A 1Q0PA 2AEMA 4HVAA 4RNDB 1JHZA 4O29A 1KK3A 5HE8A 1VIYA 1NMXA 3CRQA 3A1FA 4RKYA 4IIHA 4MEAA 4WXEA 3ZBPA 5H7XA 3BKWA 4ND2A 4AULA 5B7PA 1P19A 3BZWA 1C1XB 3DE4X 4PO3X 4QYWA 4HO1X 4Z8XA 1GVHA 1NNSA 5FV7A 2L17A 1JLKA 4O4LA 3BIFA 3K73O 2O0JA 3H9JA 5KBYA 1WSBA 2CK3D 1RXEA 5BN4B 1I1OA 2ZDQA 3CBGA 1GZSA 3DMTC 3JRNA 3V55A 1E7QA 1FVHA 4LJ8A 3TQHA 1I3KA 1M8PA 1OU0A 4UHDA 4XRRA 2DECA 5EJ7A 3ZJVA 4MHTA 3O94A 2C9MA 3RFFA 2ZRBA 1Q3KA 3FF1A 4JYMA 1O95A 1MJ5A 3QKTA 4GW3A 2QTBA 1NURA 5KYXA 1SXHA 4Z7JA 3KX2A 4XWTA 3VDMA 3MFQA 3JQFA 2PSEA 2WYHA 4OXKA 2JHFA 2I55A 2ZE8A 1TVMA 3OFVA 2FOLA 2QDKA 3DEYX 2HJ9A 1B8OA 3AMVA 3KQVA 3MWDB 5DFAA 4F92B 5C51B 1EM8A 4JJKA 4A10A 4AUEA 4KIGA 4QYSA 1JU9A 2QN9A 3OCCA 1ZFNA 1K4YA 1E77A 1GFIA 3B70A 4YMIA 4CT4B 2ZUFA 4WESA 3T4XA 4Q1VA 1GNTA 2ISSD 2ZJFA 3EC7A 5GY7A 3C8MA 4IDBA 3OD5A 4LVCA 4R51A 3UA3A 3WK9A 2HRCA 2JARA 5EMHA 2UYQA 2X0RA 1M0TA 2DTEA 4FR5A 3M4NA 4JODA 4UTXA 1XGKA 5LU9A 2Y3IA 3MB8A 2ZB8A 4LXHA 2OQVA 4ZICA 4JLAA 5F51A 2M6SA 1I5EA 1WIWA 3FNQA 4MS4A 4PSAA 4Z3DA 4B33A 4MDFA 4K5QA 4K7JA 4BTLA 3U16A 1PK8A 3B1YA 3H5RA 3L6OO 2NUTB 4NG4A 3JS5A 3UO8B 4KREA 2GVNA 1HMYA 2FPMA 4GI1A 4AY5A 3ICVA 4XCXA 1JHPA 2B69A 3GZJA 1HG0A 5ERYA 2IYPA 2I34A 3B36A 3GGJA 3QV2A 4IINA 3IIJA 2J0UA 1EDBA 1XPJA 4XWWA 4PX2A 1EGMB 3O75A 3SZOA 3UXYA 3QMWA 3LLCA 1KRHA 4JP2A 3JQAD 2FR0A 3IUJA 1P81A 2JVKA 1PS0A 3ZJ4A 4QHTA 4HN9A 5IKOA 1EZZA 3FGNA 1N9GA 4R1UA 3G0GA 4XCVA 2MINB 3CF4G 3H7AA 5E0OA 4Z9YA 5KNCD 4XM0A 3Q9LA 1SKMA 2YINC 4DCNA 2OGSA 4FKBA 5JAPA 2VUSA 3N5KA 5ARBA 1X13A 1ZJ4A 4O2AF 1OC2A 1C9KA 4EUFA 2IUSA 1MQ8B 4H2DA 4G36A 3QBJA 4PQGA 4P5DA 2VF2A 2NUAB 4I66A 3HR7A 3SVZA 3GH1A 4Z9BA 4CF6A 4HH0A 1LSOA 2VWQA 3CPEA 4D6YA 3VSCA 1G60A 1E96A 1PGNA 4TSKA 5BWLA 1X14A 2BFPA 4RQBA 4EHKA 1J2YA 4LCEA 3DLBA 3RS3A 5LJLA 1T4GA 5F3DA 3DBIA 1E9SA 3EF1A 3UT5B 1W4AA 2KS6A 1N57A 3C0KA 1LPMA 2UZAA 2ZJ2A 1PG5A 2DGDA 2ZI7A 3ASYA 3COPA 1DKOA 1E5DA 1KVUA 3GA5A 3I01A 1QHNA 3KHTA 3OLVA 3WZLA 3DZIA 4ZYVA 5MGBA 4P35A 3RC2A 1QRUA 1W6UA 1OMOA 1YV9A 2AW5A 2QUBA 4G4SO 4FX5A 4G65A 3VHRA 4JVOA 5ER6A 5CG2A 4I1VA 2OGUA 2D8MA 3ZIAD 5L7YA 3AU8A 1SZCA 1EUZA 4F5ZA 3N2YA 5JPDA 2QX7A 2IHKA 4URUR 2P67A 2W2XA 5K4GA 4OVKA 4YLEA 2BIFA 1ML3A 4RHXA 5KEIA 2IOQA 4OYHA 2HLDA 1N0HA 1Y1TA 2GBIA 1XMSA 2J8ZA 3DOJA 4I4TF 4QDXA 5CFMA 3KHSA 4K9LA 1VPWA 2HHHB 3FMVA 1P7CA 2AFIE 1FFHA 3QMPA 4JQSA 1V1MA 2GEFA 3V4LA 2N47A 2EQBA 1XPOA 1PDWA 2BE7A 3L2OB 4GD3Q 1UFVA 2WLTA 5C80A 3CRNA 1AQYA 2RHLA 1KAGA 1GEEA 2WF9A 4HH4A 2NADA 3LUPA 2PH3A 3ZU5A 1JFTA 1PEAA 4ZO9A 5FT9A 3HHPA 1JEYB 2CV1A 4FLEA 4G2NA 2XWJI 5TQ2B 5L3VA 4OP1A 3JY6A 3F7MA 4P34A 4MNTA 1BWPA 3ZTYA 1NN3A 1NONA 2QMEA 2P0YA 2ZROA 1R66A 1L7AA 1KJWA 3KQMA 4LYEA 4QDTA 2D7CA 1BA2A 3AWIA 4ZT7A 2VQDA 4OEHA 1JFRA 5LA6F 2Q3FA 1WBJB 3QF4B 3HJUA 4COOA 3ZY3A 4EPWA 2HHCA 5C8YB 5GJBA 1YC2A 1F14A 2YMPA 3AOGA 3TTUA 4KL8S 2JI8A 2I7TA 3JAMA 3WYFA 1XG5A 4G84A 3DO8A 3SBDA 3RIMA 3NNNA 5SYNA 4DIBA 1GPBA 1X3LA 3FPGA 3GBSA 3IKMB 3NX4A 1OJ7A 1RWMA 3JSAA 4JLOA 4RK5A 5D87A 4XARA 2X0FA 4D46A 4YJKA 1VE7A 2ZEJA 3L0SA 2LCQA 3BZBA 4CIDA 3GEBA 3N86A 4ZV9A 4OHCA 1U5CA 5BR7A 1GFWA 4FX2A 3FTFA 3PDIA 1A9ZA 2PL5A 1C3OA 1PGPA 1XKLA 2ZIZA 4FIDA 4KPUA 1YDHA 2WILA 1AUXA 1KO5A 1UADA 5KNBD 3A3NA 3HMKA 2ZE7A 3KALA 1NNI1 3K0EA 4ZD6A 4ZJPA 5DWVA 5JJ5A 4Y0VA 4OH7A 2EP8A 4JT9A 1RLOA 2BI4A 4X92A 1A71A 2OHOA 3I6IA 4O2AA 3D6NB 4P92A 2ZPUA 3WNDA 1B74A 1WPGA 4INZA 3BVPA 4R0VA 2MHCA 1KI2A 4DYDA 1KS9A 3E2IA 5A0TA 1AE1A 2OYRA 1Y1RA 3ZQJA 1IHPA 3EIWA 4UKDA 4D79A 5KNCA 4FSDA 4AUNA 3EUAA 1EWKA 1SCDA 3JYHA 3OE7D 2WC1A 3O82A 2P9YA 4JB8A 4ABYA 1DP4A 3A4VA 2DHRA 3CFYA 3Q7EA 1PW7A 1YQ9A 5DOZA 4E3WA 3D3KA 3OWHA 3V4SA 4UTRA 4EO9A 5D51S 4LDAA 4RDHA 3LHSA 3PNSA 1JNXX 1EUDA 3KLMX 3U6BA 1XR3A 2WU8A 3CBQA 4L5YA 3VYRB 4W5RA 4UHKA 1DCTA 3FTEA 4Z4FA 4JIGA 3WJ2A 1S8NA 2AK3A 5LCXA 4M0LA 5AKHA 5HF6A 3T7EA 1K5DA 1XVVA 4O08A 3KYDB 1MN6A 4Q9HA 4P7BA 2PZGA 4WQMA 2EX1A 3CG4A 1JH9A 3OJLA 2AA3A 1XAHA 3NTVA 3GYGA 4BLWA 4CCYB 4OJYA 5JSFA 1NQOA 4QUDA 4F2GA 3AZPA 2IIQA 1QGDA 5A3VA 2IODA 4HDRA 2OZLA 3L8CA 5FAXA 3WWZA 3L8YA 3EXG1 4GR4A 3IEMA 1YR6A 3PXXA 4I4TA 4X97A 2X41A 5M3BA 2GZ2A 1YDWA 2DJ5A 1KAOA 4X6XA 1DHTA 3FFAA 3W79A 2VRCA 2GJ4A 1WNFA 1YQXA 2FEWB 4L28A 3RK0A 4H27A 2W58A 2Q4BA 2R7LA 4HRVA 4TMTA 4BC0A 1FFYA 1OI3A 1QO0A 3I23A 2AOXA 4WN3A 3LQKA 2X3FA 3BMNB 4C0SA 1Y1PA 5KCMA 2G9NA 1ZEMA 1T0JB 2DHCA 2OMEA 3MILA 3NNSA 6CHYA 5EIXA 3I83A 3LUFA 1DOZA 4KQ9A 4M83A 4NBTA 4AY4A 2IV7A 1QZUA 1A2OA 4I6EA 1JR4A 2AZTA 3DMGA 4JK3A 4NEHB 3M49A 5IAKA 3WL6A 2A0XA 1KZGB 3F97A 3UGQA 5L6MB 1ATIA 2FWAA 1VIMA 2QRLA 3E3LA 3CYFA 3G5AA 1D03A 4PX9A 3RWOA 5LA6A 5CDYA 2OCXA 2CJPA 1H5NA 1NUAA 3NORA 4QBGB 4Y9TA 3DUFB 3E4DA 4L6IA 2OMKA 3D6MA 1NXPA 3E7DA 3WKBA 2F7SA 4KJZA 1NFQA 1JA1A 4HFJA 1W59A 3V3TA 2PUHA 5FWXA 3H86A 4YRLA 3DQZA 4DR4B 1XEWY 4AJ2A 3E3AA 1NKVA 4AZSA 4YRGA 5E8JA 3GGCA 4YV7A 1E5LA 1YZNA 3KNZA 4LXTA 3ZNNA 2OVBA 2AG8A 1QANA 3HV2A 1F2UB 4OH1A 2ESRA 3RREA 2R0QC 3IEVA 1RADA 3UT0A 3E1SA 4B8YA 4O02B 3OJWA 2O3QA 2YJ3A 4GOMD 1C4XA 4F06A 2YY7A 4TWBA 1PYGA 4KLCA 3UANA 3OA0A 2HV8A 3VKVA 3TGLA 2J9GA 2PJZA 3IAEA 2J59A 3RCBA 2YWDA 4IJ6A 2CMFA 3H5VA 1NSFA 4PTLA 4ZHSA 3AG6A 2FDRA 4M9QA 3ZWVA 4B4VA 5K0JA 1T4MA 3P9SA 1Z63A 1THGA 1KTIA 3AEZA 2NPOA 4JYCA 5E6UA 3VU0A 3OQVA 2ZUEA 1GU7A 2G09A 2NU9B 2Q5OA 3EOZA 4OU5A 4DDKA 1CEXA 2OECA 3TMKA 1N9KA 3NVKI 3P0JA 1LBSA 4M7OA 4AJJA 4B81A 4BFTA 5P21A 5HUHA 4O8ZA 1WETA 3G9TA 521PA 1EQAA 2QP4A 1JWBB 1W73A 1U11A 1RYYA 2ZB2A 5FADA 3WJ7A 5AM2A 2OPHA 2GLXA 3AUYA 2F1JA 3U4QB 2VA9A 4AC9A 2FF7A 2FW7A 5K3AA 3JYQA 2L0XA 1B16A 4O4HF 2IPOA 4MKHA 5KTKA 2Z6AA 3SC3A 5KHOC 2O8VA 3D59A 2BF4A 1NTRA 2ODAA 3HADA 2HPVA 4MPDA 2A2ZA 4KGVA 3NT2A 3LPCA 5HKLA 4ENSA 2QAIA 1X8KA 2H2FA 5DP1A 3WGTA 3K9FC 3C6MA 4L9AA 3AG5A 2NIPA 4TS3A 3JAKA 4DWOA 4E1VA 2I4MA 1LH0A 1V11A 3IAUA 4CKWA 1FTWA 4O5OA 4E2ZA 4H0FA 1QQBA 2ECQA 2YXNA 2V8OA 4LV6A 2I9PA 3BGSA 2W2KB 4ND8B 4PQFA 2ONZA 4W9NA 2BGWA 4PLYA 1ATZA 4Q7JB 3SXUA 2W98A 3VSBA 3WMXA 1OH8A 3JWEA 3GGSA 4LTNA 4V1CA 3H0KA 4W1SA 4G26A 3OLXA 2Q9CA 4ARZA 1R0WA 1Y4AE 2D4HA 1QAMA 2HRRA 4NMWA 3SJAA 1N2JA 5A9TA 1TAUA 3L6RA 2C4TA 3K2EA 3TTVA 1XJ0A 5JROA 1VHLA 4D3XA 4PN7A 5FB3A 4FIZA 3E22B 4WRRA 2IOYA 2H2HA 3OWOA 5JCOC 4QQFA 2YZNA 2WJPA 3GT7A 4E2XA 2P6MA 3B3GA 3FYTA 3P9ZA 4R1PA 1DWQA 2ZSHA 4KACA 5DYTA 5F21A 1FLNA 3D6HA 1HZJA 3LCJA 1Z5OA 1BXKA 1YCGA 5IT9A 4L8LA 4ZOCA 4DA4A 3UAOA 1M75A 3SYTA 5TARA 1JQLB 1FMFA 2X9GA 1R10A 3LECA 3PXUA 3OJFA 3RRYA 3FWZA 4WOBA 4AO6A 1SQSA 2ZJ4A 3LO5A 4IQ0A 2XNDA 3SIWA 1W35A 1U0GA 4NCJA 4QBTA 4MYSA 4Z0TA 2VDUE 2YWXA 3TQOA 4EHFA 1P4SA 4URWR 2XBLA 3PGVA 5EXSA 1ORTA 5T41A 2D1RA 2GTPA 1DJQA 3DT8A 3SIPA 2QGFA 1WABA 1NP7A 2JGFA 5AHOA 3H2IA 3T1QA 3QUSA 4G0YA 4GWGA 2G6TA 2A7QA 1Q0UA 2HLNA 3GEMA 3TQRA 4ZDJA 1KFEB 1P2DA 1JHAA 4NEGA 3E3NA 4AUMA 3V48A 3LUCA 1ZIYA 1Q1AA 2QN7A 4L9WA 4MJXA 3RHTA 5EMMA 2XUKA 4FEGA 3R3YA 4BFXA 1RJGA 3H6KA 1N0WA 2PJRA 3DFZA 1J1IA 2HMWA 4LTMA 2GO1A 4HEA6 3ITDA 1ZC4A 2CXUA 4O5AA 4OG2A 1CQJB 4R5HA 1AKEA 3FHCB 2FW1A 3V8RA 5IF9A 4Z3OA 4R2IA 4NCXA 2GDZA 3DOUA 4C1BA 1N1MA 2O07A 1W5EA 3JAWB 2MYPA 2G80A 3BBLA 4JT2A 3PSAA 4I1SA 3NGLA 3WQHA 3HVKA 3KPJA 4MW0A 4HAOA 3T52A 5ICSA 3MQFA 1JH8A 4XZ3A 2G17A 2ZBUA 3OBBA 4I9HA 5CMLA 2F48A 4C22A 5HQ3B 2H5EA 4FNAA 1JAZA 3OOYA 4ZI5A 3U5ZB 1D2RA 2IYQA 1PFYA 4KNYA 3Q5EA 5J5CA 3TDMA 1B4DA 4CHTA 1UBSB 2RJNA 5EWMB 1RAAA 3OAAA 1FYDA 3LPMA 1P8AA 1VE5A 3C7AA 1RXCA 3P9XA 3CRMA 5L8VA 5BXQC 4YT4A 2XPCA 1SC1A 4LZLA 3V4ZA 3WAGA 2HCFA 1RWVA 1E4EB 4PX3A 2OD2A 1GHTA 2CHVA 4WZAB 3ONWA 2WE8A 3KWJA 1UOPA 4MQEB 4NFHA 3TFWA 1OH5A 4QSMA 4R01A 4KUGA 4Z7NB 5FEUA 1GQQA 4X20A 3RS4A 1GEGA 3CUSA 4CIVA 3VR3D 1WMFA 4E13A 3IIEA 5MFPA 4XXHA 2RHCA 1W5AA 4QULA 1PTJC 1I33A 5FA6A 3T5AA 2O8BB 2GZ1A 3EIQA 3UKJA 4GHWA 5E8RA 1ZXXA 3IIMA 1KXJA 5EFOA 4ZZ0A 2XEXA 1QX4A 3FFTA 4JZKA 2JEYA 1GDTA 1MX1A 2X14A 3PJDA 1JW9B 4LNHA 1DC3A 1OXKB 4V3CA 1AMNA 1J5PA 4FFDA 1ZUNA 2WTEA 4X45A 1JTEA 5DLPA 1S89A 3A6KA 3M81A 4BBZA 1T9BA 3QLJA 4J1TA 3HZRA 4X7BA 5EE3A 3W9UA 3MHTA 1N6RA 2IXEA 2QI9F 1I2CA 4PW0A 4JLUA 4BMVA 5I7WA 2XGSA 2ZI9A 3IE2A 4F96A 1Z5PA 5IBQA 1CEYA 1NF9A 4G1BA 3T8YA 2VDLB 3PZRA 1P75A 1AKRA 2IYNA 3FX2A 4MB6A 1JALA 3QJGA 4NQZA 4V0MA 3R9KA 3KXKA 1G42A 3BQNB 1NMQA 4IV5A 3HK2A 4M6WA 5T3YA 4PLVA 5B1YA 3NUQA 3PDUA 4QASA 1RI1A 1SXJE 4X41A 3T54A 5JWHA 3RSSA 1BWRA 2W6CX 4X1KA 1U1DA 4E5KA 2DERA 4MR9A 2FEOA 4W5OA 2PUBA 1XZBA 2IHTA 3N28A 3SU8A 4AF8A 4U00A 1H2FA 3H19A 5SYAA 3VDRA 2JFWA 3S28A 2MMGA 4CM5A 2QD2A 1KOFA 1Z45A 2DWUA 3GQBA 3ZWBA 4ASUD 4YMGA 5IM4F 1T8SA 2GPYA 3MLAA 4GAEA 4ZMBA 3O4GA 3IQEA 2CT8A 1BH2A 4PC3A 1TMKA 4DSNA 1YVRA 5DTIA 3NM5A 3Q3VA 4LRXA 1NBEA 4XGRA 3PUZA 4DZZA 4DCJA 2QMHA 3IUSA 1JPUA 4R2LA 1E1MA 1I5OA 5MN5A 4MW6A 2IC5A 1L7BA 3BMCA 3GDFA 4CM9A 4GBGA 2OKCA 4RAOA 2BFEB 1I6MA 3IUMA 4QVIA 4IM7A 3NM4A 2XA1A 2W22A 2FSVC 3HJAA 1M5UA 3IEXA 3LUJA 2J3KA 2W2QA 3GRZA 3K3PA 4FFPA 4OGGA 2O52A 1KJZA 4YQZA 5IUNC 3OQOA 3GRRA 1QRRA 1WV0A 4BO7A 4YIKA 2D0IA 2MWMA 2B1RA 1WXWA 2HDNB 1R8SA 2RC5A 3HGMA 1FBNA 3CKMA 4GVLA 4JP3A 4KO3S 1GAXA 1C3VA 4GI5A 1A9XA 4JHLA 1MIHA 2I4LA 3KKQA 3CNNA 3LZ6A 4RS4A 1GPYA 4JI3B 3MPUA 4GM4A 3V8BA 2GEUA 1WEKA 2J7KA 4DYVA 1KYYA 2GD6A 3ZNOA 4ZPJA 1D2EA 5EMLA 4CI0B 1QWSA 1Y1QA 4BX8A 1M6WA 2ZZKA 4X1IB 3TPFA 3ABQB 1WMSA 4JENA 3Q41A 3LIPA 3VSEA 1FOEB 1IBKB 2GDJA 2MMCA 2NAPA 3KUKA 4DVGA 3IDOA 2H08A 1ZYUA 4OMDA 3UMYA 2PHZA 1Y8RA 1A4RA 1DARA 1H2YA 1MF7A 1RAHA 3KSMA 1N2EA 4MDHA 4BP3A 1P3DA 3HNPA 1KEZA 1FFBA 1JBQA 1P72A 1BHQ1 2PUWA 1TRKA 4HZIA 3DF9A 2QA5A 3QYPA 2ZAGA 3E1GA 4AAYA 1K7SN 1MGOA 4E30A 4KI0A 4TVSA 2BMWA 5AWFC 4J49A 4PBRA 1WKVA 3MAAC 2OM2A 2J33A 1E2DA 2RHWA 4BLVA 5K05A 1UMCB 3W77A 4L5IA 4HDNA 1G9SA 1JR3D 1CZHA 4XWAA 3KR9A 5SICE 4OM8A 3ZEAA 1QS0B 4YRIA 1O54A 2NYVA 3BXGA 1BA3A 5B3JA 3CT6A 5EHNA 5B3AA 1IZ8A 3T7AA 1LTHR 1H05A 2XSZD 3CIFA 3CN9A 3NHPA 4MYCA 3G2LA 1TEXA 4PYQA 5KQSA 1IBLB 3CLUD 3DXYA 2V9CA 3SSNA 3CLRC 1WU7A 2OXCA 2QL7A 1MNAA 3O90A 2EBWA 4QTTB 4EOGA 5BQXA 5TQVA 4NK4A 3PL5A 4IGIA 4AWXA 4JLPA 4KVFA 4OYLA 5CXUA 1U63A 2ETVA 4ZMSA 3THYB 2GZAA 5BSHA 2MTBA 1FMLA 4JQOA 4YT8A 5AW0A 2XT9A 2C9DA 3AYZB 3RS7A 2O19A 5D2CA 4GOND 4B6RA 2IYTA 5JCXA 4YDRA 5AMXA 4XYGA 2XUHA 4UUPA 1E6KA 1NU6A 1RP1A 2DG2A 2HX1A 3ABOB 3JCZA 3P19A 2FNAA 5BVHA 5HUQA 2J87A 1TYCA 3OIWA 1ADYA 3U0BA 1NDUA 4IOMA 4Q3LA 3UMRA 1CUAA 3UFXB 3ZCTA 5EVJA 5IM4A 3AL3A 2VKQA 4JFRA 4ZARA 2C57A 1OC4A 1T5IA 2HPZA 1U9IA 2GHRA 5IEBA 4S0ZA 1M83A 4QQ8A 3R7NA 1BHJA 3SKXA 2PS3A 2Q6LA 5CB6A 2VH1A 1MXFA 1NJGA 1IIRA 3AUFA 3PHHA 1XNHA 2WWXA 1MB0A 4EL0A 2IUYA 3ONEA 1M1YA 1P33A 4RPGA 4Y67A 1KOGA 1O6FA 1C30A 1PUXA 2TSYB 1W47A 2OPBA 3I53A 1RQGA 3R7LA 3L6DA 5BW5A 2WSLA 3TLZA 1XOIA 5CVJA 5DIZA 2GF0A 2V6FA 5IS2A 2EKBA 1XZMA 1WSAA 4B6PA 1MJNA 4YRAA 4GUAA 1CRWG 1U0BB 3I28A 4YECA 3FROA 5D6NA 3G23A 2A0YA 1MC5A 2PQ2A 1ECGA 3NCHA 2FFBA 2E5FA 4O2BF 5GOTA 3SFTA 4DMRA 5DI9A 4RZUA 4N39A 3QEMB 4MS1A 1NDHA 5JSUA 2D7DA 1VB3A 2FPXA 2GN9A 1UR5A 3GUCA 4GECA 1Z06A 3HKEA 4IO0A 3GLHB 4LJ7A 3LKVA 5EXPA 4QOHA 5K03A 4RHTA 4JJFA 5EINA 4QBKA 1FFSA 1WULS 4DUZB 1E5TA 2KX7A 3H42B 4PTYA 3BRSA 1JDUA 1PP4A 3H1FA 3KDAA 3FD8A 2IW3A 3NBFA 5ABPA 1TC1A 3UXHA 4C43A 3BGIA 1P1HA 4ZGWA 1TF2A 3BQMB 1MAVA 1LC3A 2RH9B 4Y2XA 4KWEA 1RLIA 1NMEA 5IKXA 2DUWA 2DCUA 1TTQB 4NV1A 3VJMA 3FAKA 5FBRB 4Q1EA 2Z0MA 2GAOA 3ZE8A 3GWZA 1U2QA 4CTOA 5J2TB 4Y7DA 1CQWA 2BMDA 2Q5FA 2WFAA 4LJKA 5CHEA 4E5DA 3D0QA 4YJ2F 5EJFA 4PZ0A 1Q3TA 3DAGA 4GYJA 3ZX5A 3WGGA 3ZHVA 2WM9B 5EMKA 1OFUX 2JHGA 4OAPA 4Q21A 4QUGA 1T9AA 4UHHA 3HI4A 1TAHA 4KGXA 3OLYA 2I1QA 4MR8A 2IUUA 1H3EA 1DS6A 3DVAB 4BB6A 2TRSB 4NECA 4UAVA 5KOHA 2GILA 5UKDA 4JN6B 1AB5A 4DC1A 3OOJA 1T0HB 1T8UA 1NVKA 2IEBA 1YS6A 3MCWA 1II8B 2DBRA 4ZAVA 1OXUA 5GZ6A 3ZLBA 4ZO7A 3ANMA 4D8YA 4J2TA 1G5IA 1O58A 1XKTA 2FPGB 3QXSA 1VL0A 4KOEC 1L4KA 4X9XA 4WSOA 4FZRA 3L43A 1II9A 3NASA 4WPGA 4DJJA 3KTFA 4IRXA 4JB0A 5A4MS 2XSZA 1I32A 1V8ZA 1X70A 3LBNA 3LPAA 5A3JA 3AXTA 4CMEA 3AM4A 2O8CB 1G20A 1O5IA 1Z26A 4L75A 4OY3A 4MKFA 3ZY5A 1GZ5A 4TYNA 2WMNB 1S2IA 3VVMA 4B8WA 3PDCA 1ZSYA 2XYVA 4RFSA 1RRMA 4IG4A 4HB3A 1VCIA 2VHCA 1LPNA 1VRWA 2EDAA 4M86A 2QTVA 2FQ1A 4B3HA 4C0WA 4DDHA 4F3TA 4D44A 2E4YA 4QGFA 5FH9A 1G5FA 1RCUA 3GWGA 2CLSA 4PBTA 3U2QA 3RGGA 2R25B 1RKUA 2IOFA 3PQ5A 3D8RA 3EGXA 2QIPA 2WDZA 3W4IA 1L2TA 1Z2OX 2ZBEA 3Q1LA 1FF9A 3RYTC 2RGBA 3IJPA 4NPHA 2FRDA 2CUNA 3P2MA 1JTVA 5JJIA 2AMJA 1R2QA 2BJWA 4D4HA 1OHHA 3RHFA 2WUDA 2AFHA 1BW9A 1YQGA 4BIIA 4WA7A 1TL7C 3T5TA 1O6CA 1NXXA 3EWAA 4YB8A 1SBIA 4Z9AA 3AVTA 2I8LA 4BO1A 3ONFA 1DRKA 4OAQA 1F4PA 2YJ6A 5A6VA 1OD6A 3WGOA 1V0JA 3IAXA 3UUFA 3BXEA 4DWVA 1JEEA 1GKYA 1NQTA 1UM8A 2NU7B 1E0KA 4P4TA 4O2BA 5JO9A 4A27A 4AS1A 3HH8A 3A25A 2F1KA 1K5GA 3LC1O 4C7MA 4KO1S 1QRDA 2QY9A 1SIOA 1ZW6A 4PNZA 1FFCA 1T24A 3T7JA 1S1CA 3VC3A 4CVNA 4DKJA 4E09A 2PMBA 3EXHC 2QRNA 2GEVA 3GFFA 5K3DA 3HKCB 1VJCA 4UNPA 3LNCA 4WBSA 1R4AA 2QYSA 2X5KO 4JWKA 2EEZA 4YTEA 5EHXA 3BILA 4O59O 5KNDD 4ALNA 4JU8A 5FTJA 5H9VA 3GG2A 1FDVA 1CY1A 2G1JA 2MYUA 3BMOA 1B76A 3KE9A 4CCAA 5CVTA 1O0CA 1WUIS 2GPAA 2R8RA 4FQ5A 4TN1A 4WTOA 3AFMA 3MT8A 2EX4A 5GGYA 3WV4A 3TVTA 3U56A 4LCJA 2ZTLA 4BFVA 4BFYA 3PJRA 2W6JD 4YJ2A 2C2GA 3QHPA 3QUAA 2FDXA 1SOVA 3GRFA 4XX0A 2OUIA 3JZIA 5BNTA 2AD1A 1MO3A 1GTZA 1VHDA 4XB2A 1UDWA 4M7PA 1WDTA 2F3SA 3F6SA 3GP5A 1XVUA 1N34B 4JT4A 1P4HA 1VYHA 3DZCA 2O5CA 2QT0A 1R8YA 2AVDA 3PKZA 3UMCA 3DV0B 3B8EA 3IUNA 2DPXA 2JIZD 4WFQA 2V5VA 1VJGA 4WNIA 2OYCA 3QSYA 3CGGA 5BP7A 1C1XA 4W8GA 2QMUA 4B75A 1ZX1A 4G25A 2VJBA 2I8AA 2VHTA 3BZUA 5BSMA 3WRYC 2H57A 2HIGA 1CNFA 1WS6A 3M4XA 3CZAA 1S2DA 1IK6A 2W6PA 3NGXA 5A05A 3UC5A 3QKSB 4DRZA 5BN4A 3A37A 2Q2WA 1B0AA 3VKUA 1CW2B 2PEZA 3PFWO 1VE9A 1JIKA 4WK2B 3GLIB 1THMA 1XD2B 1KEEB 5KDDA 3V4VB 5MF6A 2H8GA 1ZR4A 3PXAA 4Q3KA 2CV0A 3SC4A 3D7LA 1OIXA 4LHWA 4PE5B 1AK1A 3HUEA 3TBKA 4I2VA 2HK9A 2C5LA 1TT5B 1M67A 1UJCA 3EZXA 2VP9A 3I8OA 4RJIA 4U8GA 5LBTA 2OBYA 1CUHA 4PG5A 5KX5F 5C7LO 2BGMA 5NLLA 4JI7B 2CVFA 1RI2A 3PPVA 3MWDA 1JSRA 3NO4A 6ABPA 2PG3A 1GUDA 4E5SA 2ZJZA 3T9DA 4K6OA 2Y9MB 3OOSA 2AF3C 3HCDA 3IURA 3Q7IA 4J7UA 4MV6A 2OXTA 2JD1A 3KWFA 1RYMA 2G5GX 1XAIA 3E84A 1CJTC 1W0KA 3AERA 4PG4A 1G21E 3KRTA 3KB2A 4NENA 1DB3A 2CYBA 3L04A 1Q1BA 3AW8A 2YHIB 4OATA 1EX7A 2YYAA 4LJYA 1PS8A 3HNOA 5EXEA 4WJZA 2I8CA 1ZH4A 2JA2A 2R62A 1E1CB 3SPXA 5B64A 1I7SB 4KLNA 3AIMA 4WX2B 3RQIA 4NH0A 4BQQA 2ZS8A 4JD5A 2LCIA 3N2LA 2BZSA 3SYRA 3GN2A 5E1DA 4DLVA 2NUTA 5BORA 5C8YF 1ZJZA 1AUPA 2I1LA 4DM4A 1KP2A 4W1QA 4U4AA 4MITA 4OGKA 3EGWA 4Y2HA 5AO9A 1V43A 2KPOA 3M9WA 1O6GA 3VOSA 1CQXA 1Y48E 1TF7A 2BKEA 3UG7A 2YV3A 1I24A 3VYTB 3D6VA 4FE3A 4PZZA 3EFEA 1UJNA 3QLVA 3C6QA 5J47A 1U8CB 1OBOA 2PKEA 1TE2A 3O5AA 4ZKEA 3F5FA 3SLRA 3U1BA 1E18A 1ZHOA 2J85A 2ZB7A 1G41A 4M0FA 1CYEA 2Q6KA 4F8YA 2JA1A 5JNTA 3VH3A 5JJBA 3GLSA 3A27A 3KS9A 1I9GA 3RHZA 4B4DA 4FZ5A 4C5AA 3WLEA 4NWIA 2FOIA 4X93A 5G1PA 2B8NA 3R7DA 3K6SB 1ZM9A 1ZAYA 4MAFA 2FZKA 4ME6A 3W5BA 4GBJA 2NUAA 3L1HA 4LK2A 1ZN2A 1JVNA 3DPIA 4GT1A 1WOMA 2W6JA 4DBZA 2DBVO 4J0DA 4NI5A 4N3AA 3MTEA 4JJZA 5DLQC 5D5QA 3LY8A 3ZGLA 3HWX1 2Z9BA 2B6NA 4ZI7B 2YY6A 1A4UA 4HH1A 4OLJA 2NU8A 1P0QA 1Z56C 4B32A 3D2LA 4DA6A 3UT5A 4ER0A 4CG0A 3C7DB 3QNUA 4Z4HA 2O3SA 4WHMA 1RW4A 5EHZA 1YI1A 4LE1A 3M4ZA 1J2TA 1JT9A 1OZAA 3BICA 1MJGM 3ACCA 4GFDA 2JCYA 1UKCA 3FR8A 4YP7A 4OI1A 2NYUA 2B83A 3KLOA 3TW4A 4CM6A 3OQ6A 2BFDA 2CY0A 4PRKA 5KJ6A 1XVTA 3OE4A 4UUMA 3FVQA 1I7DA 3NHFA 2FVYA 1BYIA 4HOYA 4LJAA 4AJIA 4EG4A 4ZALA 2HMAA 4W1RA 3T5PA 3OICA 4BMSA 3QKUA 2B4YA 2NOAA 2F3QA 4GOOD 3URMA 1ULTA 3K8OE 5DCWA 4CUJA 3BUSA 5KX5A 2X2PA 4OQZA 3VR6H 4IGEA 3ZKAA 1BDIA 5TF4A 2O3JA 4LSGA 1EIWA