1EWVA

Crystal structure of metabotropic glutamate receptor subtype 1 ligand free form ii
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
477
structure length
448
Chain Sequence
RSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of glutamate recognition by a dimeric metabotropic glutamate receptor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords METABOTROPIC GLUTAMATE RECEPTOR SUBTYPE 1
total genus 119
structure length 448
sequence length 477
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ewvA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ewvA01
1QO0A 1ZH4A 5CNJA 1EWTA 3KYIB 2O20A 3KSMA 3OLVA 1Z13A 3C3MA 2KYRA 3QX9A 2GKGA 3OLWA 2Q5CA 1YS6A 3LFTA 1EAYA 2GX6A 2FKAA 4EY3A 4D6XA 2QV0A 1TJYA 3C97A 4Z4EA 1XHEA 3K9CA 2JB9A 4F8JA 1M5TA 2ID9A 5IEBA 2HSGA 1FFSA 5T7BA 1ABEA 1WETA 3O2SB 4MYRA 3H6HA 1JFSA 1K68A 3JS5A 2LIVA 1NXVA 3LUHA 2FLKA 1ZITA 2FMKA 3OMXA 1Z15A 2CHFA 3EDCA 4DQDA 3QK7A 4TLMB 1W9HA 3O75A 4G0YA 4RWEA 4KRFA 4IMJB 4RXTA 4LZLA 5EWLB 2FN8A 4TMYA 4EYOA 1EWKA 3H5WA 4OTZA 2QR3A 4MS3B 3HJFA 4UHKA 1A04A 3A10A 1JFVA 2PAFA 1P6UA 3OQMA 2FTKE 1C0EA 3NNSA 2XDYA 2E4XA 1JH9A 2VYCA 3OLYA 4Q6WA 4QPJC 5KI6A 1NXWA 5KQLA 2JVIA 3LUJA 1D1PA 5IEJA 4IILA 3O2JA 4Z0NA 2IPAB 5TPWB 3H5LA 5DCLA 4PEVA 1URPA 4D6YA 3QLUA 1DJMA 5CNKA 3HUTA 4MPTA 3CTPA 4RXUA 3EQ2A 4EUKA 3FDFA 4FB4A 2F8SA 4MR9B 4S05A 4N76A 3RH0A 3GV0A 3L49A 4QICA 4RU1A 3E61A 3OM1A 3GT7A 1I3CA 1RZRD 1VPWA 4RK1A 2E4YA 3IPAA 1D5WA 1Z18A 4LE0A 4WUTA 4TN5A 5FBHA 3BILA 4RK0A 1ZN2A 3CZCA 3QLTA 4ETIA 2OENG 3K4HA 3QEKA 1DC8A 5FBKA 4XLTA 1ZHHA 2M98A 5CHYA 4OBBA 1P6QA 2FEKA 4HNQA 3FGZA 1SXHA 2PL1A 4KNYA 4TLLB 4HNSA 3LUCA 2HQBA 2RDMA 4FE4A 5KQGA 3LOPA 1DBPA 1D1QA 1LBHA 1QP7A 2E4WA 1NY5A 3QLVC 4G0QA 2PUCA 4GNRA 5DLEA 4EVSA 3JPWA 2H3HA 4WXMA 5T3YA 2PUEA 3HDGA 1F4VA 2NUBA 3I45A 4RS3A 3RVRA 4YRZA 3OO1A 2MYNA 3BBLA 3DBIA 4YGXB 4IMIB 4LE1A 3Q7TA 4PZ0A 3HUUA 4KV7A 3HSYA 5TPZD 3Q7RA 4KZKA 4XAQA 3ILYA 2VUIB 2WY2D 4YV7A 1ZH2A 2NZVG 4S04A 4Q6BA 2AYXA 3GBVA 1SXIA 1KGSA 1RXEA 3N8IA 1VRVA 4N0PA 1RXIA 1RNLA 5HSGA 3E3MA 1USGA 4ETNA 1MB3A 2MYUA 3GA5A 3H5IA 4MRMA 2PUAA 2LPMA 3RVLA 3IP7A 3URMA 5KC9A 2JBAB 1LJLA 3CLKA 1FQWA 3H1EA 1ZAYA 2AYZA 4YCSA 3OMWA 1MB0A 4RY0A 3KJXA 1PHRA 3O21A 2X7XA 5IBQA 5DTEA 3OM0A 5CNMA 2WWVD 2FQXA 1VLZA 3LUDA 2NZUG 4KREA 2RJOA 2L18A 4NICA 2QSJA 4JP1A 4PICA 4LDAA 1DCMA 2R4QA 1FFWA 4EVQA 1A0OA 3QELB 4MS3A 2YHBA 4RKRA 2IPNA 3DGFC 3TB6A 3HV2A 1U2PA 3F73A 3I09A 1Z2EA 5JNVA 3FFXA 5F64A 1OXBB 4OLAA 1PEAA 2CD7A 1SXGA 4MLCA 3F6CA 4N41A 8ABPA 5D2CA 1PEYA 4IF4A 4M88A 4MQFB 4MLDA 1YVUA 1DC7A 1XHFA 3B2NA 2PJUA 5IULC 2W42A 1BAPA 3RVSA 3KKEA 4WWHA 1M5UA 3GRCA 4B09A 3IP5A 3C6QA 6ABPA 1JHZA 5C5EA 3HK2A 3CNBA 1LBIA 2QXYA 3D02A 1DG9A 1AB5A 4MAAA 4RSMA 2JVKA 1DBWA 4F12A 1BVHA 3QLVA 3UKJA 3W9SA 4G0ZA 3A0UA 2CHEA 2H0AA 1TLFA 3DZDA 2FMIA 1Z26A 1APBA 3ROTA 1EWVA 3UK0A 2MSWA 4GPAA 4MR7A 1RZRA 3NNNA 5EWMA 1DP4A 2P4UA 4ML3A 4NCBA 1J56A 3RVOA 2QVGA 4RK4A 1DZ3A 1D2AA 3CS3A 2HQRA 2LUOA 4QYMA 2A9OA 2R25B 3N0RA 3T8YA 4NCAA 4G97A 1IIBA 5TQ2A 3KLNA 1S8NA 4KPYA 5IUKC 1ABFA 3KYJB 2BGGA 2JRLA 1PNRA 4JASB 2M1ZA 4Y9TA 4G0MA 3HEBA 3JPYA 4MS1B 1USKA 1NATA 2GWRA 1P2FA 3RVKA 1TM2A 4PE5B 1Z25A 4ZYLA 2B4AA 1A2OA 1YMVA 1ZGZA 1HEYA 5KQMA 3O1JC 2FN9A 4O1HA 4Z9AA 4FE7A 4L4UA 4EYKA 1E6KA 1QQAA 2IPMA 3HZHA 3QEMA 3GBPA 3NBMA 4JAVC 5TPWA 1BDIA 2GBPA 3CZ5A 3KLOA 3GL9A 1JYEA 1Y1LA 2YHAA 4Z4CA 4P1ZA 1M2EA 3RVNA 4Z4GA 4WXEA 5EWLA 2MYPA 5EWJB 3F7NA 3BRSA 4RZSA 3OQNA 2PMCA 1DRJA 4EYGA 6CHYA 4KQ9A 5DKFA 4O5AA 2E4ZA 3CKMA 4G0XA 3Q41A 3OLZA 2QVCA 3LTEA 5BR1A 5JNTA 1MAVA 3DLBA 2WJAA 4YR7A 1TMYA 2FEWB 1NTRA 3G85A 1TVMA 1YK0A 2L19A 2PKXA 3FFTA 1E2BA 1JL3A 3A0RB 3HVRA 3N6VA 1Z16A 1LJUA 5TQJA 5ABPA 3JY6A 4F06A 3HCWA 5FWXA 2NT3A 3H1GA 3CRNA 1DRKA 3KG2A 1PNTA 3TD9A 1QO0D 3QELA 4MR8A 4XARA 1YK1A 2IKSA 4MR9A 2QW1A 5TQ0A 3CU5A 1D4ZA 2JVJA 2FSPA 3O74A 3LMKA 4G0PA 3SM9A 4Z9BA 3HXMA 3SQNA 1CHNA 4ZMSA 5IUJC 1PUXA 3C3KA 1NXTA 1L5YA 3RVMA 1GCGA 2B1JA 3CFYA 3HDVA 1NXSA 1JX6A 4W5NA 3NHZA 4MQEB 3MYYA 3SAJA 4ETMA 5GOTA 5FWYB 2R48A 1E6MA 3ILHA 2GI4A 1F51E 3FFWA 5HM6A 1JFTA 2F8TA 1JDPA 3F6PA 3N53A 3SY8A 2PUFA 3LKVA 5IUNC 1U04A 2HPHA 3Q15C 4PYRA 3KHTA 4N47A 4OG2A 4F11A 5BRAA 3NHMA 2PUBA 5TE9A 3O1IC 3DLHA 1RPJA 4Z4FA 2MSKA 4JOQA 1ZGGA 5BQ3A 4LE2A 5BRJA 4H60A 1UDRA 4CBVA 1QPZA 3O1HB 1ZESA 5JNRA 4MR7B 3DGEC 1BDHA 2PE5A 3CG4A 4WT7A 4MS1A 1EHCA 3MQ4A 2E4VA 1QP0A 2R47A 4JA2A 3JVIA 3LUKA 4OATA 3QX8A 3IDOA 4ZMRA 4MQEA 4QYWA 4E7OA 4KVFA 4NQRA 5FWYA 5JS2A 2RGYA 5ED4A 2FQWA 3UUGA 4MS4A 4RY9A 2PLNA 2RJNA 4EVRA 4E7PA 3Q7SA 5JS1A 3RVJA 1M2FA 3OO0A 3H6GA 1QMPA 3EJWA 4RK7A 7ABPA 1JYFA 1VKRA 3EULA 1R8JA 5JNUA 3N0XA 1QNLA 4MRMB 4KMRA 2P9HA 2JBAA 9ABPA 3MM4A 2QU7A 1KRXA 4RKQA 4ZJPA 4OLBA 4MQFA 2IDMA 4RK5A 2QZJA 3G1WA 3SG0A 2WMYA 4N0QA 3L6UA 3TO5A 3MA0A 3I42A 5DGCA 1K66A 4YWHA 4JB0A 3HM9A 2A9PA 1EFAA 1USIA 3GYBA 1DCFA 2FVYA 3MMNA 5HQJA 3LUAA 2PUGA 1YS7A 3T6KA 4MR8B 5EWJA 5KC8A 2IOYA 2CWDA 4LX8A 3A3KA 2FQYA 1B00A 4Q7EA 1CYEA 4YO7A 3M9WA 3N0WA 5IX8A 1L5ZA 5PNTA 4EGSA 4F3TA 3HO1A 3BRQA 3D8UA 4HYEA 4RK6A 2WJWA 3KCNA 2LP4Y 3RVPA 3LUFA 2JK1A 2WB4A 4W5OA 1YTUA 4XASA 1NXOA 2PL9A 4Z4HA 2HJ9A 3BREA 3SNKA 2V0NA 2DRIA 3ROFA 1U0SY 4EYQA 1QP4A 4MS4B 4JB2A 4KK3A 3H5OA 3H5TA 1BA2A 2IPLA 5E3JA 3JVDA 2A9RA 1JBEA 2ZWMA 3M6MD 1SD5A 1XWWA 3R0JA 5TQ0B 3RQIA 1GLGA 1FSPA 2ZAYA 5JNWA 2ID7A 3RVQA 3O2QB 4YS6A 2LBPA 4KQCA 4Z4IA 3KS9A 3S99A 5KQPA 4DADA 4W5RA 4RXMA 3EAFA 3IP9A 1CEYA 4O1IA 4IRXA 2FLWA 4MGEA 4WZZA 3VNAA 5CNIA 3CHYA 2VUHB 2A9QA 4RDCA 4KFCA 1DBQA 1DCKA 4DN6A 2MYTA 1W25A 2WRZA 5B3JA 2E4UA 4LRQA 3MF4A 3OLXA 2L2QA 1E6LA 3JTEA 1NXXA 1C4WA 1JLKA 3T95A 2FMHA 1U8TA 2FW0A 1AB6A 3EGCA 4YP9A 5FWXB 3IP6A 2PUDA 4H3KB 2J48A 1U2QA 4W5TA 1QQBA 5GQSA 1MIHA 1LK0A 2N9UA 3LKBA 1Z2DA 1YMUA 3MIZA 2MSLA 3HS3A 4P98A 5HKOA 3H1FA 1ISRA 3EQZA 2JCGA 3EODA 3N75A 3IPCA 1GCAA 4HNRA 4L85A 2FXIA 4NV3A 1NXPA 3H5VA 4XXHA 5C5CA 4Z99A 1H9CA 5B3JC 1FFGA 1QKKA 3Q9SA 5KWSA 2HQOA 1ZVVA 3QEMB 3TX6A 3LUGA 3I5AA 1GUBA 3H75A 3FMVA 4XFKA 2NT4A 2VK2A 1P8AA 3TMYA 3VNBA 3OQOA 1ZDMA 1ISSA 2L17A 3NNDA 3KTOA 4KK4A 1SRRA 1Z17A 2FEPA 5IC5A 3QLUC 1ZY2A 2IYNA 4D74A 1YIOA 4LDZA 1GUDA 3M9XA 1MVOA 4W5QA 1T34A 4H3HB 4RV5A 1OXKB 3GWGA 1JWLA 3P9YA 4G0OA 1KRWA 5EWMB 1Z12A 5JNSA 4G86A 1KMIY 2TMYA 1JDNA 1BDJA 2I6FA 1JF8A 4UHJA 2FMFA 2OQRA 4RY8A 5I4CA 3C3WA 3CG0A 5TQ2B 5TPZA 4IGAA 4N03A 3T38A 4ZPJA 4YLEA
chains in the Genus database with same CATH superfamily
1DV2A 3KKNA 3OIYA 1U1EA 3FYDA 4MO2A 1K08A 5DSZA 4V38A 4ZRDA 1E3IA 1EM8B 3JQGA 1JQKA 4XGQA 3DW3X 2PEZA 1PI3A 2OLKA 3UOAB 1QFZA 1WB6A 2R8PA 3K9QO 2ONKA 4DPMA 4L73A 2XQGA 2I7TA 3U7EB 3WIDA 1NYTA 2WJYA 3AF2A 4FNAA 3MILA 4IS2A 3TFOA 3W1VA 4OAOA 1P1FA 4IGKA 3AIKA 1WU7A 4EYKA 5T7BA 3N87A 3EC2A 4MYRA 3NU1A 4CLOA 2R9VA 1ISFA 1NI4B 1U81A 1ZITA 2WAMA 2QRKA 3GRKA 4UUPA 1GPLA 3VR3D 5KOHA 3MXTA 3LLMA 4GZMA 3W5AA 1GKYA 3O8QA 3H84A 5JH7B 1Y4AE 2V8BA 1ELOA 2FN8A 2X23A 4QUDA 3DEZA 1SBIA 1ZZEA 1WTCA 2C5HA 4LCEA 4MVJF 4QAQA 2B3DA 2OQIA 4ZQBA 3BWXA 1WCIB 2ZP1A 4O2BB 3WYCA 1PJRA 5AVTA 1SKBA 1IRXA 2H59A 4JUFA 4QQ8A 2CMKA 3B1XA 1XYYA 4JYMA 4Q39A 5EMHA 1X1EA 2CHVA 1M10A 3EPJA 1EIWA 2EX4A 3GEEA 5JANA 1M1NB 1CUXA 2GEFA 3KSUA 2JKYA 5LUAA 5AXBA 2FSUA 3NHWA 3ZNPA 5WRFA 4EJ0A 1AN0A 1UJBA 3RYHA 2Y1FA 5E6RB 4CE6A 2BGJA 4GS5A 1M0SA 2I22A 2XE7A 4RXUA 1FCJA 3ACCA 2ISSD 2V7XA 5FJIA 2R7NA 2V6FA 3GFSA 4S05A 2R87A 1NR1A 3TGLA 1OWNA 2AUNA 5HE8A 2ZRJA 2FX5A 5FUBA 2RGCA 3H7IA 2Q3DA 2QN2A 3COPA 3ILVA 1HI9A 3SEZA 1Y9DA 4H6XA 3FX2A 3IX7A 2W22A 3K9GA 4AULA 3ER6A 3CUUA 1M1UA 3KOUA 1LSSA 4CDRA 2QTVA 4HN9A 3T9DA 4HEA6 1WHTA 1ESMA 4FFLA 3MWEA 1NQOA 4OFBA 3WWCA 3KLBA 2FK8A 3ZZNA 1HUQA 2FEKA 4B79A 2P2YA 2ET6A 5AM4A 4YP0A 2PKEA 4KMSA 1PJ8A 2RFLA 1IN8A 3PIDA 1E79D 3NP9A 3R6GA 2VAWA 3STHA 1LBHA 2WTBA 1UXOA 4RJ2A 4CW7A 1RR6A 1Z8DA 2QU8A 3IT2A 3KDAA 1OWPA 4NNOA 4NYJQ 4UCWA 5JS6A 4MPDA 3C43A 621PA 5LP6A 1QH8B 2JI4A 3JPWA 2XCQA 5J4LA 5CEEA 3D2BA 1ZR2A 3U4IA 1QGYA 2GS9A 3EIQA 5DHAA 5AQEA 4CTKA 1SAYA 5E95A 4P5DA 1CQWA 2X1VA 4QYTA 2PJZA 2HM7A 1QG6A 5JSQA 1MFPA 2ZRPA 4N9WA 3HP1A 3QQ5A 1PT5A 1K3TA 4HEHA 1SA0B 1VJ0A 1AOXA 1MB4A 1ZC4A 3N76A 5FI5A 5IDYA 3WGGA 5A5DA 2DU8A 3LCUA 5K3OA 3AHCA 2WY2D 4XAQA 2VDVE 4IUCS 1WDKA 3FJYA 4S04A 2JFOA 1PG5A 1Y82A 1E77A 3PL1A 3TWOA 1RXEA 4X45A 2I71A 1AS0A 4ZOQI 3HJHA 4LYHA 5JAZA 1S1CA 2AI1A 3ZDDA 3I9FA 3IAM6 3RBZA 1Z56C 4HAYA 1T2AA 4AUNA 4R3NA 2JJMA 5IANA 3FVQA 1MX1A 2NYVA 1IEWA 4YCSA 4TWIA 3WBFA 2YTZA 2AB0A 3BH0A 3O21A 1G20A 4R2JA 5CNMA 3HCCA 2AF3C 3L7IA 1HNWB 1FTSA 2A5GA 2HK9A 1QX4A 2I7DA 2JAQA 3HSKA 1YQEA 3M5WA 3Q3GE 3ROPA 3ZCQA 4CCWA 4LG1A 3ZBTA 4KREA 5E9JA 2G08A 2AX3A 4WBXC 2CV0A 4JP1A 1XDSA 3DR3A 3EUWA 1KYYA 4A2CA 4E03A 3F4LA 1UPAA 3B9RA 4RKEA 3EFOB 2FUG1 3AR7A 3F7OA 4WH0A 2VPIA 5EZ6B 5AI6A 1TTHA 2HDOA 3P5SA 3ICVA 4BMYA 2QP3A 4NE9A 3W3AA 4YVFA 4KC0A 2YIDA 4PLGA 3CVVA 3OUTA 4HXFB 4IZ6A 1YMQA 3Q0TA 4MJ7A 5B4VA 4XX1A 1XHFA 3NM4A 5DN9A 1ZBQA 4KE7A 4FX5A 2BE9A 2C97A 5ER6A 4URYR 4HQKA 1W4ZA 3EK2A 1KA9H 3VU9A 1QE3A 1TUEA 2G71A 3EIXA 4KZPA 4QZVA 1RYFA 5JCJD 4HX9A 5LXTA 3AUKA 2QI9F 2XAAA 1LBIA 1NBME 1V7CA 2YZ2A 4I1OA 4HO1X 5HUHA 5LZ4A 1GKLA 3TS1A 3B6EA 2GEUA 3OJLA 3IEPA 3AZOA 3GAAA 3JRXA 4YGYA 4W7IA 1NVEA 4CODB 3DZDA 4LZPA 5AJUA 2J3LA 2EG9A 2VNIA 2EL7A 2MSWA 2HZBA 2V7PA 3KTAB 3L6OO 4BV9A 5AQ1A 2PU7A 1NMQA 2P4UA 5KNCD 2I5PO 1Y8QA 2JFGA 2W5UA 4LBVA 2RCNA 2AR0A 3F5DA 4B0PA 3H2SA 3Q4GA 4PXYA 2O8VA 2QIOA 2HHJA 3EXIA 1UEXC 1W85A 2ZDHA 3N0RA 5JOQA 4LWQA 4MH0R 4QNNA 1DLIA 1II9A 2WSYB 2PTGA 4G1MB 1P7YA 1IIBA 2HC9A 3S3TA 4AUMA 3QX3A 4PWZA 2D5BA 2FFHA 4M7PA 1KEZA 2EKBA 3RBVA 1G19A 3B48A 3B3GA 5A4DA 2IGBA 4Q00A 1V8OA 4Q5IA 5A4FS 5L9AA 1WMEA 2DT8A 2C82A 4Y8VA 1QIIA 4R8VA 3GLGA 2Q27A 1A9SA 3RC3A 4OSEA 3A28A 2PSFA 3UKOA 3ZIAD 4DLLA 2ODWA 2ZSJA 3NORA 3F9RA 4FDUA 1JRLA 3HBJA 1A5TA 2PMDA 2FWMX 5L8VA 2UZ3A 2FG7C 3I34X 4D9EA 3GG2A 3VPGA 2GCOB 3WX0A 4KR7A 5D3QA 5KYWB 1QH1A 1CJMA 1KH1A 2P91A 3RM3A 3NDBB 1EDDA 1VCHA 3QFHA 4QJ4A 3QV1A 2PD4A 1GTJ1 4WKOA 1T5OA 1WKVA 2OP1A 2I6QA 1G6HA 1N5MA 4IQFA 2LZ0A 5IDWA 1MG0A 2ODTX 1MH9A 3Q8LA 3OE7A 1S02A 1USUA 4LQ4A 3C5WP 4L8YA 4NCKA 2CXSA 1X9GA 5ALJA 1FNSA 4RVFA 1N36B 2H5JA 5IAEA 4I0WB 1MUUA 1PWHA 1RRFA 1YAHA 1EXMA 2ZUWA 4Q4JB 5DKFA 1GITA 5AVOA 3RSZA 3AB7A 4CF4A 1YFLA 3VC1A 1MW8X 3CJRA 1FDRA 1D4AA 5A1TA 4YR7A 4RTKA 2A14A 1YK0A 1EK0A 4NKRA 4Q3BA 2A0FA 2Q5FA 3GEBA 5TMBA 2UUAB 4I6JA 1K8XB 5K0GA 3OICA 3FZYA 2Y76A 1CJTC 3I23A 5BOSB 1VCNA 4WK6A 2P68A 1H8HA 1FJGB 4YXWD 4F06A 4X0EA 3BF8A 5FNVB 2PGIA 1O94D 2NT3A 2QZSA 3CLRC 1H1DA 1HL7A 2EG5A 1U6IA 3NEYA 1OILA 4G9BA 4LJYA 4PLPA 3SJZA 1VQ1A 1RJFA 1YK1A 4I5GA 4RVCA 1DJLA 4DWWA 3PF9A 3RHTA 4CM8A 5LSAA 3FVRA 2AUMA 1W0JA 2D06A 2G72A 3G2KA 3BVPA 3E5NA 4IFEA 2O5VA 4EFDA 3WMGA 3R7WA 4MICA 1PK8A 1Q50A 3SHVA 1OB5A 1N6OA 3HLKA 4L75A 3W6OA 5L3SA 3H2GA 3VMFA 2QTVB 3MYYA 4UHEA 5B4TA 1E3SA 5HM6A 4H7FA 4G4JA 1CETA 5MF6A 3O0DA 4IYJA 4GR4A 1CR6A 4LBZA 4R7GA 3KQNA 4I14A 3KR0A 3PUKA 2Q21A 1ZRHA 3Q15C 3KHTA 2GM9A 4BN4A 2WD7A 3PRKE 3UOGA 4CM5A 4BQEA 3I04M 1DJOA 3EQ8A 5TE9A 3ROQA 4WZAB 1SVWA 4GOOD 4OO3A 4C9BA 2PS1A 2ZSEA 1JZSA 2A57A 4WACA 4WESA 4XQEA 4X1KB 1KI3A 5GMOA 3GT0A 1E94E 4UVGA 1XDUA 3II6X 3RPEA 5DNUA 3JQAA 3N2YA 1ZCBA 4KFTA 5U1PA 1GPNA 3BTOA 4HFMA 1I0IA 5C4IA 5TDHA 1NV9A 2YQZA 4YRTA 2E4VA 3NDJA 3IV7A 1Q0ZA 5T8KA 1KZ9A 1SZJG 1PJLA 1E5VA 3IDOA 4IJ6A 2C2MA 1TZCA 2QGZA 4YBRA 4CV3A 5IDXA 1NUTA 3DDSA 4DRYA 4HDOB 4YRIA 1C7RA 1XZBA 5AO9A 3LZ6A 1JHYA 3T94A 3RAGA 3DZBA 1GGVA 3DUFB 1AMUA 4JQCA 3FOWA 3NZEA 1CUAA 1CVIA 4BNJA 4DQKA 3NHPA 4JROA 5DEIA 1YDGA 3EJWA 4COKA 1JDTA 1J42A 4KQ2A 1NIJA 3IIEA 2R6CA 2YRFA 3H9JA 2JI6A 2P1ZA 4Z9XA 1E3QA 1KJQA 5JNUA 1Q91A 1YS9A 3WMWA 4EX7A 2X1HA 4MRMB 1PYDA 4DSTA 3QVOA 5EXEA 3TEJA 2A86A 1FYXA 3E81A 3CZAA 4ID3A 4D99A 2QU7A 2XBLA 3KTAA 4NHOA 3GDWA 1X2EA 5CRIA 2HRBA 7REQA 2ZJ4A 3C39A 1L4GA 5BO5A 2TMKA 1X13A 3EXHB 3W4IA 2H2AA 2ZYRA 5ALFA 1BW9A 1PIWA 4HTAA 3LRTA 2JJYA 3PFCA 4OLFA 2W2TA 3UCEA 1ISJA 2EZ4A 2HK7A 2VF7A 3CRVA 4DANA 2A0KA 4LV6A 5KMGB 3OZBA 4C6TB 2W6ZA 4RTQA 3GLFA 4O2AB 1X8LA 2YZNA 1E32A 4MR8B 5IXSA 5K7SA 1A4IA 1JG7A 3UATA 1PKEA 2DWOA 4MPPA 4W5WA 4CMBA 1GAJA 5B7NA 2WQ6A 4FNOA 5FOXA 4V0OA 5EKSA 3EPRA 1L4NA 1N8KA 3ZTWA 4D6PA 2JBWA 5T4EA 3VBCA 1FXUA 4KR9A 3BRQA 2F59A 3MQ2A 4BNMA 3LD9A 1OLXA 3KCNA 4I99A 5G3ZA 1EWRA 3T9EA 1A82A 4W5OA 1YKGA 2XKKA 2P90A 1QO9A 2DBQA 4F46A 4JV5B 2Z2YA 4RDIA 3UMBA 2IYPA 4LDPA 3IR5A 4B3RB 2Z8ZA 3K2QA 4MUXA 3T3IA 5KVVA 3ETGA 3GRFA 3R09A 5D6NA 2FW1A 4FN5A 4ZQEA 5DWDA 1FUUA 1EEXB 4PHTA 1SD5A 4N49A 4TROA 2FZLA 2AGVA 1HT1E 3FPJA 4RLHA 3UJ3X 4ZI7A 4OMFG 5CB4B 3PYMA 2ID7A 1OFTA 5K4AA 3HLTA 2I7CA 4ZPXA 4M37A 3DBVO 2JFYA 4LNUA 4QXOA 3JR7A 3T5GA 1T5LA 1R50A 3EAFA 3OCCA 1N6LA 2YASA 4N40A 2CLFB 4GQAA 4O1IA 3WQBA 1I2MA 2Y2UA 3NRJA 2PSEA 5AMXA 4BMSA 3KXPA 2A9QA 4D8TA 2FFBA 1TTPB 3T5PA 4B3MB 1IOZA 3IUMA 3DD1A 2BMAA 3ST7A 2I6XA 3OLXA 4LMPA 3PUXA 1IUOA 3TOCA 1NQXA 4OQYA 4EJSA 4ENUA 1ZHOA 1NXXA 2WBLC 5B1EA 3FRIA 4AIIA 4C5BA 4PYJA 1VL5A 1DKPA 2P2GA 1KO4A 1XTUA 3LVBA 2AW3A 3RUIA 5B57C 5IM4F 2BT4A 3OX2A 5F73A 1IWPB 1NZFA 1NMSA 2GCEA 4C0AC 3F6SA 3E8XA 4W5TA 1FDUA 2O07A 1K5DA 3O95A 4B73A 4P98A 2ZUTA 4HFJA 2QNIA 4GPEA 2HMYB 3VZQA 3MS2A 2E85A 5IVPA 3BMCA 5DIFA 4G1VA 3IHLA 4DQLA 4HB3A 3H3XA 4O4JF 1FEZA 5B2FA 3M83A 2PGDA 1GTRA 2PFGA 2I03A 4LEIA 4BX8A 5L3SB 4LF7B 1AN9A 2VYVA 3AUUA 1BVRA 3DVQX 3LUGA 1WVIA 4ROTA 5DYWA 1VYUA 4CIBA 5LPNA 3H75A 1KAGA 4KH0A 3X44A 2DFVA 3HN7A 3CISA 1D2RA 4LHZA 1ZD4A 2BFMA 1GPAA 2FI1A 3TQCA 4BLSA 4ABYA 3O03A 3ESXA 1Z63A 1Q1NA 3L8FA 1L5LA 1B2RA 2WUVA 5C5IA 3EBOA 1ZY2A 4KTTE 5TLSA 1R5OA 1SXJC 1NVXQ 1K5PA 4M49A 4MUJA 2VPTA 4H4EA 4H9GA 3KQPA 4Y0VA 2YZGA 3TQRA 4C7JA 5C80A 3HEMA 1IN1A 1R2QA 2VH1A 3WV4A 3ZY4A 2Q62A 1OWMA 1NF8A 1F3OA 3JTMA 3PU6A 3PXEA 5F23A 2GHTA 4ALNA 1F7VA 1BU5A 2X9QA 4FP9A 4CMEA 5K51A 4G86A 2OHVA 4GBJA 3UT5B 4P4LA 3H99A 1E2DA 1VLMA 4GUDA 1BQ3A 2YWEA 4NECA 3QZUA 4QVKA 1RMYA 1UJCA 4GGOA 4KTVE 5JE8A 1R0WA 1UWCA 5C34B 2WG1A 1KSHA 1FQJA 3CLHA 4XEHA 1P4GA 5TPZA 2C9CA 1E0SA 1J9ZA 1BGWA 3MJTA 1NJ5A 1UC9A 3KYIB 4GXNA 1B8VA 3BIXA 4J07A 3JQ6A 1NRWA 1VSUA 1PTKA 4L16A 4MYUA 2EWMA 1F48A 1M0WA 2HSZA 1SOWA 4M8NE 3G2HA 1CEEA 3K70C 4IO0A 4ZXFA 1B8PA 1SC4A 1DS6A 1M34A 5B4UA 4D4HA 5FKJA 2IU6A 5AJHA 1HZZA 3FOBA 1ZJ4A 3K9CA 1MV5A 1TZJA 1RBQA 1X7WB 4B3HA 3ZQJA 2QLJA 4TTTS 3R0XA 4LMBA 3X2EA 2SNIE 1F0NA 2QD4A 1K68A 4MGYR 5DBFA 4YCCA 2YXDA 4ENQA 3FTQA 1OIWA 2A4KA 4HDCA 4A27A 4AF8A 2X0KA 2Y99A 3EDCA 3JD1A 4NZYA 3ZV4A 4BKRA 3DONA 3C2QA 4B5KA 4JR1A 4IVQA 1JKMA 5HFNA 3VZCA 4IWNA 4HZUA 5D5HA 1JEOA 4D9MA 2HDNB 4B6QA 2I54A 4HSEA 5EIBD 4Z1MA 4UTNA 3BULA 1ZNXA 1A1VA 4L9AA 3AVXA 1ECJA 1XDDA 2RBGA 3L1VA 3NFRA 4BZWA 1XTQA 1FP6A 3HB7A 3F7TA 4JUIA 2OHOA 4B6EA 1NBWB 3FAZA 1IFXA 1O5TA 4FW9A 1GQ2A 2PGNA 4TYNA 3GROA 1CZUA 3P96A 3A9UA 2OTCA 4D9GA 4RKYA 5M34A 4PEVA 1L4MA 5EERA 4IJKA 2WMDA 4CMAA 1ECGA 4GKJB 5K99A 2WFLB 3FDFA 3ONFA 2AC2A 4NBSA 2GK4A 5JEDA 2H8GA 5FWAA 4H4CA 3S1LA 4UHHA 5JMOA 4JLWA 1ZMBA 1D5WA 1GTZA 4TV9A 3OPXA 3RSLA 3MJDA 4DM4A 5LU9A 1DEOA 3KPWA 3THSA 1CJSA 3KOYA 4CEJB 4TYQA 2V96A 1A5SB 1CJUC 3DCJA 1HO3A 3KT8A 4TQUS 2QZ9A 2CDBA 3R8FA 2RBEA 3KBOA 3IAS1 3GZ4A 2XCIA 2Y4OA 3IKTA 2R8BA 4Y0NA 2YRXA 1IM2A 3R3UA 3DOJA 3UJPA 3B1JA 3KZVA 2YW9A 2OV4A 1C9DB 1YZFA 3CC8A 1KKMA 4BAUA 1JHRA 4FFPA 4J4BA 3WNDA 1O97D 1QIGA 2NUBA 4H1WA 1U2EA 1NW7A 1GRVA 1SU8A 3F0TA 4RS3A 4ZYYA 2OCBA 1T91A 3RUCA 3TIIA 2EIHA 4FGLA 3CWCA 2F3TA 4KEAA 4TV9B 5KUTA 3KJIA 1OAKA 3TXXA 4CIVA 4YGXB 3S2EA 3SM9A 2VQSA 4KJXA 3Q88A 2G80A 2OBXA 3HWSA 5EESA 4YMGA 5K3DA 1A71A 1F2DA 4UQPA 1L5OA 4A23A 1T9HA 2CFCA 1VJDA 3D7MA 4GYKA 5C35A 2C98A 3M70A 3RK1A 4F1JA 1AA9A 4ALKA 1UC5B 3FB1A 5DGXA 3AV0B 3G23A 3SVLA 1RNLA 4JC0A 5DOVA 4YRLA 3OBBA 3TLGA 3GA5A 2GLTA 1CV2A 2Q2QA 3ZBQA 1DIOB 2P9TA 4F38A 2PXAA 4RENA 1WF3A 4DIEA 4X85A 3OHPA 1AKQA 4QEZA 3ZZTA 1LGYA 3GLRA 4LHXA 3JV7A 1QIJA 4J1TC 4QLBA 1GUZA 1M54A 2RMKA 3OM0A 2C3UA 4TKZA 4XD7A 3RC9A 4DLSA 5KTTA 1KNQA 3VAYA 2QLBA 4OSPA 2XBUA 3H8WA 4ITUA 5FWNA 3RJTA 3U49A 2C9MA 1N32B 4ARZB 1QU3A 4K6MA 4EEXA 3ZV5A 5HZMA 4QWWA 1P7VA 3EB9A 5TSDA 3D7KA 4GOXA 1E7SA 1BJRE 2FVXA 4H3VA 5CIWA 3DGFC 1GLVA 4L1KA 4MV6A 4MKXA 3I5XA 4J0FA 2VJMB 1UJMA 5JNVA 1P1KA 1NSTA 3JQ8A 1M2KA 5KYVA 4GC5A 2Q49A 2CD7A 3L4JA 1VPLA 3GUHA 4MLCA 2Y6VA 4FR2A 4FMPA 5IF9A 2IIBA 3E48A 3MINA 1MX3A 1NBEA 5T57A 4KOEC 2ZOSA 1UBKS 3T34A 5C2JB 1ZONA 2JNWA 1SUIA 4Y2RA 3PI7A 3WKBA 2MWMA 2X8JB 3BH7A 4XQCA 3HK2A 1JMYA 1ADFA 4KB5A 3NMUF 3P2MA 2EF0A 4RSMA 4RVOA 3ABZA 4LSZA 2Y0PA 4QXQA 3TTXA 5I7SA 4G0ZA 4G1CA 1RYEA 3P52A 3ZS9A 1XO1A 2H0AA 4KG7A 1EEHA 3PENA 3RS5A 1TPYA 2FMIA 5MN6A 4JK3A 2A1UB 3SX2A 2IX3A 1E98A 3EDOA 1X7ZA 1ZA1A 1CT9A 1ZGAA 2BHLA 3PX3A 3NHAA 3KO8A 4HXGA 3WWYA 2ZCUA 1DUVG 1YOVA 3FKSA 3K5PA 1G21B 2BM1A 5BQPA 4S12A 4EG0A 3N2EA 3I8XA 3IBTA 1U9YA 2GN8A 4QYMA 1TTQB 1U2GC 4P6VF 3I3OA 2GEVA 5CEJA 3QKSA 4FGSA 1F12A 4EGJA 1L3IA 3MPUA 4FHZA 1KC3A 2ONCA 1E89A 4EF6A 1YR2A 4IIJF 2ICAA 1MO6A 4U9HS 3U1BA 3AUFA 3EWSA 1EFDN 5EMKA 3NWBA 3OTGA 5CAEB 5ICEA 5I9MA 1EFVB 1JI0A 3JPYA 1NV8A 5AVJA 2H2FA 3UA3A 3AVTA 1USKA 3R0VA 2YBDA 3UMMA 3ETHA 1S2MA 4JC4A 1RXYA 5BWMA 2P3OA 1Z25A 1U2GA 3D64A 4J90A 4X7MA 3B6IA 3TW8B 4NEQA 4PAGA 4D3SA 2VHXA 5TMPA 1M8GA 4FMDF 4NENB 1G9TA 2CJWB 4XGIA 1W36B 2H6EA 2QG6A 2WF7A 4KVGA 4E6PA 1QQAA 4PSCA 2XNKA 3DKPA 3I6YA 3PITA 3IQDB 4G41A 2NP7A 2C4HA 1NVVR 1VSBA 4OXRA 1YJCA 2Q3MA 3ETCA 2HLDD 4Z4GA 1OH7A 5JCPA 3AIIA 4R81A 4YCNA 1UOEA 1QE0A 4WOBA 3AXSA 4JLPA 5ALNA 3QE3A 4O5AA 4BJ1A 1W0JD 4AS2A 4C4YA 1N33B 3Q41A 4L28A 1IBMB 2PX8A 2RHHA 1TKAA 1H42A 3B12A 3I83A 5GJVC 3DLBA 3FZEA 2PS9A 4B87A 5JPCA 2MINB 3R23A 3CRRA 4QJ5A 2L82A 4Y9RA 5A9RA 4Q4AA 1GXSA 7REQB 4C4ZA 2ABWA 5JXIA 2IHBA 3HVRA 3BB4A 2ZSBA 2VJBA 4R8MA 5JI2E 1EQAA 1PR0A 2CSUA 2FHPA 4UULA 4RLQA 1WP4A 5DNAA 3KV1A 4QGBA 1K7CA 3CRNA 3L0BA 4BFTA 4M0LA 1J2UA 3U7QB 1H23A 4GR5A 1KXZA 3RU3A 2NSHA 1B0AA 2Z8YM 4ZI7B 3ZWXA 3MUNA 5CJPA 4WERA 1XPUA 3B52X 3SQNA 1JFRA 4P3OA 2G9NA 2GERA 5ESDA 4NMMA 3USZA 1GCGA 1FNCA 4WVFA 2VBGA 2D1YA 1ZD8A 1BD4A 5JQWA 3NHZA 2Q3EA 1WY7A 1ZCAA 1DQZA 3SDZA 4L6CA 3N53A 3LW8A 3GNSA 4K03A 3TVTA 5K3FB 2HB6A 2B82A 2OBYA 3WLSA 2LVBA 3UYKA 3MW8A 2Q0SA 4LJRA 3NHMA 1G16A 1U0TA 3MMZA 3UWOA 4CL0A 3LRPA 5A4IS 1U7OA 1ADCA 2MSKA 1M2NA 4S3MA 2ZJ3A 4Y2PA 3U48A 1DX9A 3OX1A 4OK5A 5LMUB 2E1PA 2DR3A 3O1HB 5JNRA 4ZOLA 2H2GA 1Z6AA 1LBQA 2QHXA 1Q95A 1M8JA 2A1TR 3QP9A 3EXG2 1EHCA 2CNKA 1HMYA 2JPDA 3VHXA 4FHFA 3UJNA 2XHEA 1YCGA 3V4PB 2H9YA 2Z4SA 2GPJA 2IHNA 4LVNA 4RDXA 3C8MA 4M3NA 4P4SB 1ZUHA 1U7ZA 2VHVA 1U28C 3IVAA 5ESRA 2FPKA 3ZK9A 5FWYA 4LRSB 1FP4B 4ZHSA 1LSOA 3AEQA 1ADGA 1KJ9A 4ONEA 5F3DA 3VV2A 2D1RA 4O4JB 3T1QA 4KDRA 1YSCA 2BFWA 1PSDA 2FZ5A 1HE3A 1VJGA 2QM0A 3MT7A 4WADA 2PFKA 5CG1A 5JXWA 1Q74A 4R68A 3AQ4A 5HGJA 4YRDA 4Q9AA 3RRJA 5I01A 4KFUA 1RW4A 2WP8J 1FSGA 2JKZA 3KR1A 4QECA 1J09A 2XYVA 1C8KA 1RRMA 3D6TB 4JBGA 4N5MA 5KDOA 4FIZA 1G63A 1V2HE 3HGQA 4PZYA 1EJ6A 1KDZA 2ZSKA 3LGAA 3MM4A 3VHXB 4OLBA 3BAZA 3VAAA 3SSMA 5JCZA 2F3PA 4PG6A 3TNLA 3G1WA 2XDAA 2B83A 1E7YA 2AKAB 2A7XA 3HJBA 4N0QA 1PZGA 1GCUA 1QV6A 1XGKA 2FG6C 2Q50A 2SICE 3D4IA 1DGQA 3HGTA 4BVKA 4E08A 4M0DA 5JRDS 5CVCA 1B6GA 1ZD9A 1ZOIA 1XMSA 1VGRA 2W4MA 3I2IA 4R9RA 5KHAA 2BEUA 2WTEA 4OQPA 4EG8A 3KHUA 1Z5UA 3BWBA 2HL6A 3ZWKA 3WO0A 5HF9A 1XP5A 4MUAA 2PSDA 1X14A 3HB9A 1WCYA 4U2DA 5FX2A 1Q7TA 3UGQA 1E2KA 1GZHB 4BNDB 4FXPA 1Z2AA 3REGA 4IX1A 4FPXA 5L3RA 3CO5A 1E3DA 2HUNA 4ZAWA 3WGZA 4P38A 4OA8A 3FTFA 1QHEA 3UMRA 1HDOA 1K5HA 2ZBQA 4XIIA 2JFFA 1LV7A 1N0WA 1PZHA 4MUGA 3OTOB 3R6WA 3NEAA 2V0NA 2JGRA 4UZSA 3ROFA 3T1HB 3WXBA 5EIAA 3AEUB 1UPBA 1CWUA 1KBQA 3LLCA 4KK3A 1UXJA 2H51A 4B4OA 1ENOA 2H2DA 4XVHA 5LA6F 2CHGA 1NJSA 2X8AA 1JBEA 3ZWYA 4NYIQ 2Q4TA 2YDXA 1J9EA 3UHAA 2IS1A 1YGYA 5EL0A 4H7HA 2WHXA 1IY0A 2H9IA 1S4QA 4MWTA 1C7IA 3O2QB 3PP8A 1ONBA 4GW3A 3DV0B 5HDBB 2IU0A 3M8KA 1ATIA 4TZTA 4OHFA 5NULA 3UFXA 2QG4A 1L8XA 4FHDA 5EAIA 2BEVA 1FBNA 2P5TB 4JJ7A 1BVUA 1Q22A 1D2NA 2QRZA 1KJWA 4WZZA 1RC1A 3PPYA 3O3CA 2NXWA 4PN7A 2SKCA 1HE1C 1NYLA 4XJXA 1N0IA 4DR7B 3GD5A 3I0MA 2E4UA 3KJNA 3MF4A 1NZJA 2WINI 4XLLA 4BYMA 1E6CA 1QRTA 1VIYA 4DQVA 1UP4A 2BFDB 2RH8A 5DHQA 1P75A 2XTMA 4M8LA 3DZGA 3PXAA 3TPFA 2Y66A 2PRKA 2YMPA 3HHEA 4KWCA 4E5DA 1B23P 5EIXA 3H9GA 1NL3A 3MIIA 4NMWA 3HI6A 1IIRA 4H3KB 3FCUB 5EI5A 1KERA 3SVTA 1O5OA 2BMFA 1MIHA 2W6MA 2OG2A 1BMFD 4JI6B 1C3EA 1GA4A 5IH7A 4ZCSA 5U4QA 4X66B 5FTWA 5CIQA 1BQ4A 4EPRA 1CF9A 2OGSA 3PF8A 2VRNA 2BDTA 3RS0A 5KX5B 4BMOB 1O77A 2A9VA 4Q19A 1QKKA 3A4YA 2FPLA 2WTAA 2AOTB 5AJTA 4YJHB 1KNXA 2W48A 1M8KA 2Z83A 4YUZA 5AHWA 3R0ZA 1R0SA 5J5CA 3AL0C 2EKDA 3L8GA 3OBIA 2HMAA 3S5JA 2NU9A 3ZX4A 5HKAA 2I3BA 1L7BA 2X0JA 1B4DA 1V1MA 1NBAA 4OBXA 3RQSA 3UICA 1QORA 3UWKA 1GVHA 1RC8A 5AI5A 1Q6ZA 4AO7A 3AHFA 2QLNA 3BK7A 2CLIB 5FTMA 4A8JA 4GMXA 1BFUA 2OO3A 1RYZA 3QMWA 4GM1A 1JP7A 2Q6LA 1YFJA 2EKPA 2GEDA 2F43B 3UUWA 4I55B 4C4AA 4TRRA 1MZVA 3T12A 2FZVA 1C9EA 4C14A 3OSZA 4K81B 2B8TA 4BMVA 5DTRA 1Y4DE 2FMUA 1DAGA 4FHEA 3BKXA 4I4LA 1Q92A 1UWKA 3O6VA 3NOVA 1BDJA 1GSOA 4L9RA 2NO7A 3MGKA 3OCZA 1T3HA 2JI8A 3K2IA 2YUIA 5LQKA 3ZVMA 1FVFA 3VNVA 4IIXA 2HFKA 2WIBA 4IDDA 4KKVA 5BQXA 4HDKA 5I4CA 3TRFA 2A59A 2RIPA 3JAKB 3PVZA 4IGAA 4IEEA 5H82A 5EN4A 1USWA 4WBSA 1QO0A 5I8ZA 1M1YE 4RSRA 1GV1A 1QPGA 5UKDA 1CUZA 2WU0A 1C81A 4I5EA 5F78A 5EIOA 4RAQA 3D0QA 2OB2A 1EAYA 3DEFA 3T4XA 2P67A 2Q1SA 4KE9A 3TEMA 1TU0A 4DCSA 4DNPA 3SIXA 3ZD7A 2J0UB 2QV0A 1YQQA 1T0UA 2VNAA 3I61A 1Q0SA 3N5CA 4NNJA 3W8NA 4WFQA 1AKRA 1JBQA 5IM5A 1FLVA 1NPTO 3GBSA 2W6OA 2XCSB 1HORA 2OO5C 3CF2A 3VVBA 2H1SA 1F8XA 2BMDA 3FI0A 3B13B 1K75A 3G2LA 1JQJC 2JBHA 5EHGA 1K6MA 4YY3B 4LX0A 1U1CA 3WJAA 1Z0ZA 1OTHA 1PL0A 3OMXA 2HGSA 3NETA 4LXUA 4D8XA 1BNCA 4EDHA 1ULSA 5IYZB 2O9JA 1F4PA 2EZ8A 2G0TA 1P18A 3HMKA 3NO4A 4TKUA 4IMJB 3KKKA 1G2QA 4UAUA 3CR7A 4WECA 5LQSA 4AY6A 1XZKA 3BJRA 2IPOA 3I58A 4X92A 4G8DA 3CSUA 3Q3HA 1BTOA 1WXFA 1M7GA 4H0CA 3B3JA 4DY6A 3QYAA 4WJLA 5B3KA 3RS7A 5F3WB 2YWCA 3DPSA 1YVDA 4C3VA 1YJ8A 3KPYA 1F2UA 2P27A 1Y6RA 1OT3A 2ZZNA 1ZIXA 3INYA 2XADA 4KR3A 3O2JA 3CH5A 3NC0C 4NSNA 3UY4A 3SPXA 4NPCA 1XZEA 1L5FA 3RT1A 4AECA 3REOA 5INTA 3ZHCA 4ND5A 4XSVA 3E9ZA 3HBLA 1ISIA 4OD0A 3SICE 2BLNA 1LRJA 1X1DA 2EC5A 2M6RA 1SBTA 3EQ2A 5F4ZA 5K3AA 4M60A 4DSOA 1AIPA 1FYEA 2KBEA 4PHFA 4RPGA 4B6RA 1ZSYA 3ZHRA 1T3SA 4ZIRB 2Y1CA 1FS5A 4OMCA 2OQ2A 3SSAA 2ZSUA 2BEVB 3TM5A 2C31A 5AVQA 2I3ZA 1G9SA 2AQIA 1X92A 3BILA 4M38A 4LVUA 4R9NA 5JFOA 2AL7A 3I01A 4OHXA 1VE9A 2FSHA 2P69A 4I2VA 2KPOA 3PKIA 3FAKA 1G2IA 2F17A 3DZFA 5T64A 4L9WA 4DCCA 1OA1A 2QAGA 3DV2A 4RJJA 1NNLA 2CBGA 3D6MA 1E9SA 4HGYA 1WXQA 4ND2A 4NBLA 4BQQA 4KNYA 1T6YA 4KXVA 4MULA 3SEAA 3TLBA 5B7PA 2D62A 1AZLA 5KQGA 1UBFA 5I4KA 4TKLA 2XR1A 1QF9A 2HA7A 3IO5A 4JXZA 4QM6A 2E4WA 4GMHA 1YOBA 3SSNA 5HX7A 5AVUA 3HRKA 4I5DA 8AT1A 2RG1A 1GP2A 3CUTA 4X97A 2TECE 4G0VA 1KJZA 4A1FA 3S1AA 3N7AA 4NXMB 2X7HA 1AV7A 2H3HA 2XTZA 5EZYA 3A06A 5BXQC 3PRYA 4M55A 2JIRA 4X3PA 1JA1A 1PRYA 2XITA 1TFUA 3RVRA 3IILA 1L3BA 3WI7A 4YPOA 3DXZA 3NHBA 1L4FA 5FBLB 3KKLA 3JXEA 3UV3A 4RTRA 2JFWA 3ULKA 4IDBA 2AJCA 2HHAA 3D4BA 3N8HA 2JGEA 4NARA 4C6TA 4N7JA 4CL8A 3LGSA 1ISPA 3TIVA 1BW9B 2CXPA 4P33A 3CX4A 5BYBA 3UAGA 3ZY5A 2PRSA 3RROA 1U3FA 3Q7RA 4KXUA 4TOIA 4HGNA 4WXPA 1FZQA 2WU8A 2BLLA 3ROEA 3TL2A 2OSVA 4EHKA 4CKCB 3L1HA 2XYQA 3C3BA 3CMMA 3PD0A 2JIPA 2C5GA 2HJSA 3ONEA 1FQOA 3E3MA 3OLQA 4G56A 4NZ9A 4TUYF 3T7IA 3VI3B 3PLAE 2YZ7A 3NDIA 3URMA 3OMLA 1OXTA 2F1KA 4A1OA 4MVCA 1J6UA 1OLXB 1S2IA 2VG8A 3ENKA 2EL9A 2AYZA 3EQ6A 4F96A 2JKVA 2YMLA 3LAWA 4FFNA 4AP9A 1JKIA 3HBNA 1VCOA 4GWLA 3DF7A 4YJFB 3U3MA 2OLJA 1M34E 2GPSA 3B7WA 3PBKA 1QCDA 2AQHA 4AWAA 4ESOA 3NH6A 3QWHA 4C0WA 5H3CA 3HVKA 3U5TA 1KARA 1NM5A 1LKZA 1T36B 4Y6RA 4PCLA 3BZUA 1DFIA 4US2R 2IXBA 2GJ8A 3VPDA 4PC6A 4MB0A 4UU1A 4LOKA 4QUIA 1TMKA 2CXQA 5KYGA 2BBTA 1LC3A 4OH7A 1JKJB 1THZA 4JJFA 1Q77A 4GM0A 4DMUB 1F8GA 2UUPA 4OL9A 3I0ZA 5DLDA 1H4TA 2VPZA 3RRZA 1MDFA 3HJNA 3KFVA 1N78A 4E1VA 1SUWA 2W42A 3TIXB 4A9AA 2IYUA 1LY1A 1SG6A 5ALPA 1WY5A 5K5EA 2VYVD 1Y1KE 2IHTA 4LF4B 1FSZA 4CQLB 4X54A 3ROGA 1I01A 1N6PA 2QXYA 1KEUA 3BEDA 3C3AA 4I9GA 1U4SA 1YNOA 3D0KA 1SPXA 3G8YA 1GGKA 3K0HA 4Q34A 2QVXX 4DWOA 3I62A 4QDXA 1KDOA 3U40A 4KQIA 3EAGA 4L7QA 2VHEA 4L0MA 3CKYA 5I9LA 5KPJA 1E18A 1FP7A 2J45A 3L8MA 1COWD 5BNFA 5CLJA 3A1WA 4IXWA 1ITZA 1J90A 3W8EA 2W9XA 2VZEA 3IB6A 4RMIA 3UTCA 4J49A 2RGGA 1KEEA 4U7DA 5JISA 4EJ2A 1DMRA 1U7TA 2GILA 3GGOA 3JQDA 2R79A 3DDOA 3GRAA 5AW3A 3IE1A 3CVYA 4JNCA 3ENQA 4CQMB 3H2IA 4NCAA 1JPNA 1VE7A 1SKAA 1SR8A 3O31A 4IHAA 3TXYA 2C29D 3H04A 4RAOA 4AW9A 1H6BA 2HO4A 1GZ3A 2FF5A 3BN3A 2AXPA 5BWOA 3MTQA 2QORA 3W79A 1KPIA 3S6JA 5HW0A 1K4KA 5K3SA 1P60A 4HDNB 2OCKA 2WNIA 4UHDA 1BH2A 5CFZA 2GUGA 2ZZKA 2BFEB 3NOXA 4MYSA 2KM1A 3U81A 1VP3A 2VUSA 5AHKA 3C5CA 4L0DA 4YMSA 3NTQA 3CGGA 4MARA 2VRCA 3TKLA 4DR6B 4DC0A 2RGEA 5KYUB 1L7OA 2AFIA 2GWRA 2CL0X 3ZK8A 4UTVA 3RVKA 4CIWA 2HD4A 3O7MA 4DOMA 3G49A 3KQMA 1O96A 4FDLA 5E7IA 2JCVA 1K3FA 2X0RA 2XLCA 1JDSA 1YFZA 4O1HA 3B5JA 4FT4A 3GNLA 1X77A 4PQFA 4Z9AA 4B31A 5LOVB 3S8YA 3NM5A 2X19A 1PVDA 2XB4A 3Q8XB 1D0VA 1TI7A 5AVKA 4HNVA 5CFQA 3CZ5A 3LQQA 2F8MA 3IMCA 2QTGA 3TZHA 3EMKA 4N8SA 1ODCA 2XNDA 2B4QA 1ILWA 1T5HX 4JHLA 1FTNA 4INPA 3S29A 3KSZO 1R9JA 1DC4A 1MRZA 4GYWA 5DASA 4W9NA 1S3FA 2NU7A 3KKQA 4D98A 1J1ZA 1T6XA 4P4NA 3CEMA 3PGXA 2BL4A 1DOAA 4C76A 3KLMX 4CHGA 4ZJZA 4XQGA 2BFPA 4YAGA 2A30A 1UADA 4I3HA 2JHCA 4G5SA 4L5BA 1UJ5A 3GFBA 5KWVA 4RTSA 1L7RA 4AP6A 1YZKA 4AZ0B 1JL3A 3A0RB 3OE1A 5EFZA 2FPWA 4MITA 3AHGA 2VOJA 2YNMC 5ENZA 4AN1A 1P5JA 2IUFA 1WB5A 1S2NA 4RZUA 3EDYA 4WOCA 1KYZA 5KJ6A 3K1AA 2OO5A 3X1XA 1NVFA 2YWDA 4KACA 3FMFA 4RD2A 1YDMA 4PXSA 1AQIA 4QOGA 2WPDD 3WYEA 2OKCA 4EHJA 4HFNA 2DLNA 3W7VA 5BR8B 2V6GA 5CH8A 2H57A 3R9WA 4MW9A 3ANMA 3TFQA 1W30A 1XDZA 4FILA 3D59A 3Q98A 2PLFA 4EKYA 1DIGA 2Q0HA 5GONF 3QUSA 3GFVA 3TZBA 3SAJA 4ETMA 1M83A 2HFJA 4W99A 3OUUA 1T24A 4BNVA 2GI4A 1M2VB 5BPHA 5HWSA 1RVV1 1GV0A 3OP1A 1NMXA 1G4AE 3QVJA 5BQOA 1HBJA 3F46A 5HDQA 1Q17A 5JCOC 4DJTA 2GBCA 2PGLA 4ERNA 1LRKA 2I2CA 1DQYA 3P19A 4DCPA 5EMLA 5BRJA 2CMFA 1E20A 1NW8A 1V5FA 4B3SB 3GLKA 2X3YA 5EZYF 3DGEC 4BX2A 3WLHA 3GRRA 3DOUA 3OF5A 4HADA 2BUAA 2ZRCA 3I04A 4LRWA 5C52B 3RBAA 3IOMA 1PQYA 1YRHA 2R47A 3GGPA 3DP7A 5CW2A 4D9BA 3PQFA 3EUEA 4WCFC 4YAEA 3WSWA 4M8IA 2P79A 4B84A 3ZHZA 4ZMRA 1DKRA 3BFKA 3KOWA 3WQQA 5GM2A 2RGYA 5ARCA 3NTOA 1ZXXA 2BP7A 4RY9A 4LZWA 3UWDA 4PLFA 1UMBA 1WUYA 2HLDA 3A3YA 3RRBA 4RK7A 1U6KA 3BWVA 3B9PA 4ARVA 4V3CA 3FF4A 4RF2A 1JYFA 1QZZA 5DNDA 4EY3A 1FX0B 1MC1A 1EUCB 1W88B 3KPUA 3ORYA 2A1IA 3BE8A 3GVCA 2PZEA 3TBKA 2V5AA 3TSAA 2CSXA 3QFSA 2YYAA 4IFBA 1NDUA 3GN1A 2OQVA 4BU0A 2O19A 1J4AA 5K8IA 5IP5A 3IHTA 3GJSA 3I4LA 5T3UA 1BS1A 4D8UA 5BSFA 2QZJA 4W6QA 3K6RA 3V6MA 1H5QA 5EIFA 4HI0E 4H6WA 4OGWA 4F7WA 4JQZA 1UFVA 2H31A 3EVTA 3D7RA 1Z0JA 3D7LA 4PINA 3RUFA 4MW2A 2UZ1A 3RYIB 4M22A 4X8LA 3K35A 3RE1A 5JECA 1Y6ZA 4ARAA 1YBAA 4QOEA 2Q4DA 4M0UA 3TLCA 1I51A 3LUAA 1PR6A 2O5RA 3C3DA 2XQFA 4IX9A 3ZH2A 4E09A 3EFBA 1XC7A 2PUGA 2QDKA 4Z7OB 1W0KA 2IXDA 1W46A 1YUMA 2C83A 4E70A 1W6RA 1ADBA 4N7RA 1B00A 1R6DA 5HIKA 2OBMA 3H0KA 1JJ7A 2APJA 4XYBA 3DEJA 1UMKA 1L5ZA 1TM1E 1WPXA 4U7JA 2EWVA 4U7FA 3PRHA 1QVWA 3A9SA 4HYEA 4MW7A 5B7GA 1SPBS 4J2TA 4GKVA 2F43A 2VAXA 3NUGA 1E2IA 1PJCA 1TUBB 3QHQA 4XASA 3F90A 2PL9A 4BLUA 1JEYB 5CG2A 5K0LA 3DVAA 1QP4A 3NANA 1LTQA 1U0BB 1PHPA 2FE4A 3FPBA 3IQZA 1NQ5A 1S7GA 2YV5A 3A6DA 1PL6A 4LYDA 2QD2A 1XZGA 3KZKA 4L2IB 2GZ2A 5GV8A 5DSTA 3AVQA 4BFSA 2AF4C 4F9TA 5JSZB 5KINB 2BTEA 4YT4A 4BVBA 5HM8A 4MA4A 3M4NA 3KTFA 2ZI9A 2Y0EA 3CNLA 3R5HA 4OYLA 5FRDA 2VWQA 3M6AA 5AUNB 5JUWA 3WAGA 1AQ6A 3RG8A 3SGLA 3I30X 4RXMA 3UVEA 1KFJB 2B98A 3DXXA 5H80A 4REOA 4PS1A 3M6VA 4CETA 1PJ4A 2CNNA 3EC7A 2GUWA 2FYTA 4IJVA 1XB2A 2YN0A 3I28A 2HADA 3TSWA 4PYMA 1QQTA 3JQRA 3MGGA 5H02A 4GRAA 1X7YA 1VL8A 1PU2A 3T9BA 1O6BA 1IULA 4RMJA 2VP9A 3TTSA 4X1YA 2BHNA 3PNYA 5FULA 5A4MS 2REQB 3GNTA 3K1ZA 1U4OA 3BTSA 3ELWA 1Y3IA 4IVPA 1PBTA 3D1JA 2GF0A 5CVEA 4EJ6A 2A7QA 2DFLA 1KVRA 2NQTA 1R4MB 2WDZA 1H5UA 1YMUA 2IHZA 3PUZA 2QTLA 4NX2A 2GXQA 4XWAA 2CCKA 3SF8B 2CXUA 4I81A 2PVSA 2OM6A 1OU0A 2HMTA 3EODA 4GIBA 3HWX1 2HK8A 4JR0A 4NV3A 4M1MA 3O4HA 3ACBA 1H9CA 2KLBA 5B3JC 1MAUA 4RV4A 3QMVA 1GO2A 3V4SA 3THWB 3TAUA 3QKSB 4Z7JA 4JYBA 3PC7A 2HJHA 1KHHA 2ZIAA 2X2EA 3MWFA 2FAXA 1QUFA 3KP1A 2O2YA 4LQCA 4BY9E 3BL5A 2GDZA 2HCTA 3R24A 1B26A 4J16A 3R3VA 5BNIA 2FUG6 4CIXA 3ASVA 2FWNA 2LIPA 2NAFA 3CZ4A 4JI1B 4B3FX 3UAWA 1GL6A 1PZMA 1ZXLA 3FHJA 4ZQIA 4DIFA 1C2YA 4ZXPA 1MVOA 4RL6A 2QYOA 4A73A 4BOYA 2XCUA 5EZSA 4RYLA 2GKOA 1C3OB 1Y6GA 3VZSA 4M1EA 2IITA 2WWFA 3LBAA 3SWWA 2DHCA 5F2KA 4ATNA 3FSGA 4WNAB 1IVYA 1TGVA 4C6SA 1I94B 3L4SO 1YKFA 3I0NA 3N0VA 4J0DA 4EI9A 3WGUA 1HLPA 4FLEA 2H65A 2F8LA 4WVLA 4HRAA 4X61A 2GM3A 1V8PA 4JVLA 1K0UA 3C4VA 4WLNA 3VSBA 1RQPA 3D7SA 4O4IA 2FX2A 4G67A 4JQSA 2R6ZA 4L57A 5ADWA 1ISGA 2GZ1A 3BZWA 3QX9A 1NVWQ 1UBLS 4QBFA 2VK1A 3VR4D 521PA 4D43A 4FFSA 2OPBA 3EASA 1K7EB 3V34A 2PV0A 2J7KA 1L3CA 2FA9A 1I4DD 1LSUA 1C3OA 1ZNQO 1O54A 4JLJA 3SE7A 1TVEA 1GR0A 2O50A 2ZJ1A 4BLVA 1TF5A 1ZSNA 2ODQA 4MUMA 2YCLA 2O8FB 3TM4A 4ND1A 1JQAA 3GCWA 1P7PA 5AW4A 1M5TA 1ZD3A 2YHIB 2ZIGA 1ABEA 5F9HA 2R1ZA 4QDJA 4BE7B 4QM7A 2XXAA 3PNLA 4YRCA 4CG3A 2LIVA 2VJLA 2XMDA 1UXIA 1HOXA 1AXGA 1XMIA 3BXFA 3W1WA 1UJ2A 2VO1A 4A6XA 1MORA 3RKSA 3A6EA 4DPLA 4U3JA 4YXFA 3OZFA 1IXZA 3WIBA 5CBPA 5LMZA 4H1VA 3SC4A 2W8BA 3DMNA 1CNFA 2F1JA 2Q5EA 2HIHA 1UM8A 3F5FA 2O2CA 3X1ZA 1RADA 4ZO7A 1JAXA 1QMGA 2O14A 4R1TA 4OF4A 4OUDB 2IH2A 1CF4A 2PD6A 1JYSA 2D0OB 2VT3A 4I66A 4PY2A 3K6SA 1TIPA 2JFBA 1B0ZA 2GN2A 1DJNA 3DPIA 2NU8A 3LXRA 3TINA 1N8SA 1IG0A 1XZPA 2OMEA 2VYCA 3E9DA 4AKSA 3LECA 1C30B 2R1TB 2VI5A 2JH9A 2ZT8A 1QB8A 3LUJA 3ND7A 4LYYA 2NPFA 2G40A 1UK9A 4FJ2A 3B9BA 5FWDA 4H15A 2OAGA 4QASA 1W36C 2Q5JA 3PE6A 4KODA 4YRGA 2AJTA 4C1NA 4FYJA 1GSAA 1Y7IA 3D2LA 3MMPA 4MQ5A 4PG5A 2IHUA 3FWNA 4URXR 2J7PD 4JI0B 1RFGE 4OB7A 4ZYXA 2EP7A 4QICA 4FJ1A 1JDZA 3ZD9A 1D03A 3BXZA 3ED5A 3MUOA 1ODLA 4HRVA 4MV1A 1LK5A 1O8BA 4W9NC 4LE0A 3G7NA 2Z9DA 3E58A 4HS4A 1ZN2A 1RTKA 1MOPA 4O4JA 1B42A 4Y2JA 2V59A 5GP1A 1PV2A 2VJCA 1AUOA 1T6BY 2CNDA 2OBNA 3PCXA 2WJ3A 1OD6A 5BT9A 4BO1A 5BV0A 3V4RA 1IONA 3PEEA 2JLZA 1TKRA 2IBMA 1SIBE 3ABSB 4EG1A 1G20E 1WHSB 1SCUB 1K89A 4IIGA 1Z5PA 3C14C 4OIMA 5CTJA 1R6VA 1XMXA 3W7BA 4GMKA 5THQA 1ZN7A 2BONA 1QP7A 3TMAA 1CUHA 3Q0IA 2FW8A 4L22A 3U80A 3ZKWB 2R8RA 5DLEA 4JL5A 4KIGA 1X86B 1DSSG 3GMSA 4WZBE 2XA1A 1AG9A 4IJMA 1OHHD 2QLMA 1X19A 4F3CA 4FGZA 5CT4A 1ZZGA 1Z8NA 2PZLA 4LQLA 4NDAA 3NYWA 5LJIA 4LWZA 3BG5A 3HB5X 1VL2A 1WQ3A 1YXMA 4RVUA 3TCNA 3ZWVA 2XMPA 2GZAA 3V7NA 3H9UA 1JEJA 3BBLA 3AM4A 5CX1B 2D2VA 5JD4A 1OVMA 4YPVA 3N2IA 4MV0A 4BWFB 3DVRX 2CZCA 3GJ8A 3LK6A 2AEJA 3M33A 4L4SA 4O4LA 4NH0A 4KXQA 2BELA 2WAXA 4LHVA 4A03A 4QDUA 3EIFA 2FFRA 1HDRA 1QK4A 1CS0B 1ZH2A 2VF4X 4IDPA 4V3BA 3W90A 1MTOA 2UV8A 1OIXA 2WJHA 1NA5A 3WWDA 1RWKA 4BTLA 5K01A 3UN1A 1RM4A 3ZDCA 1NPDA 4XSHA 3U19A 4LVOA 1P73A 3A25A 5J1SB 2Q6OA 2P4EA 1P44A 1UK6A 1QHXA 3DJYA 2R0QC 3ZR4B 3CZMA 3RVLA 1GG5A 5EHZA 4HPWA 5L3ZA 2GD0A 1C8LA 1VI5A 1P61B 5E2IA 3RBXA 2C4VA 3WLNA 2G04A 1QOQB 1MC8A 3VVLA 1O94C 2X5OA 3CLRD 4ZO9A 2PKCA 2B8JA 1L8QA 3R0QA 5E4FA 5A4AA 4YAUA 2WWVD 1WIWA 3WTBA 2BM8A 1L1FA 3WVNA 4M0KA 2FQXA 1IOWA 2NZUG 1JFFA 3MJEA 2Q07A 4JBWA 4ETWA 1A2BA 4FNGA 4NICA 3A36A 2CUTA 4AMBA 1NUPA 2A4MA 3MJCA 1D0IA 4TLEA 3R6DA 4W1QA 3RD5A 4PZUA 1MJGA 3F71A 3SC6A 4A82A 1OH6A 4MS3A 1SUSA 1YJ5A 4RKRA 1ONOA 1CUYA 3KEMA 3Q1LA 4JY7A 5FUQA 1CRQA 1KI6B 3KWLA 5GVSA 2FUCA 3MXOA 1FDSA 1H65A 1N5JA 3EZGA 1VCIA 3LLUA 4IQGA 3OQIB 2HTEA 3FZQA 1N2JA 5DXAA 4BJHB 2YKGA 1UMDB 5I4BA 1H2BA 1JPJA 3DBLB 3JQPA 1CE8B 1IUPA 1J0AA 2R1UA 2TMGA 1G8PA 2OMKA 2FCRA 3LC7O 2Q6TA 3CNBA 3D02A 2AS0A 4JFRA 1XCOA 3ZCTA 3FWHA 4TXLA 5AVYA 4BECA 2DC1A 5JDCA 2XT0A 1KYQA 2WD8A 4X91A 4ZCPA 1HSOA 4D4MA 4CLOB 4PQYA 1CU1A 4GX2A 2AC4A 3PQDA 4QT4A 2BI4A 1EHIA 1HQKA 2OD7A 4EVIA 1K4YA 1Z26A 4A8HA 1PFWA 4PM4A 2FPRA 4RNCA 3ROTA 2LDXA 1SCBA 4BFLA 4MR7A 4R1UA 5BUZA 2ZSAA 4EY4A 3UK1A 4QNMA 4Y0AA 3P2KA 4L8FA 3FYTA 1EK1A 4ROSA 3ADKA 3EUFA 3TLEA 3NIDB 5FIUA 2QTHA 4AFNA 5GTDA 1CUVA 1CE8A 2R00A 4TMTA 2CF6A 1PNVA 2JCYA 3CUYA 1C0PA 2YXNA 3VC2A 4EYQA 1JEAA 4U6NA 3UV6A 1QV9A 1KQ3A 1QRSA 2W6CX 2V1XA 4RETA 1FLAA 4J1NA 5AM1A 1GTG1 1CIPA 3GHYA 2A3RA 5AKHA 5CB4A 2IIPA 5FTKA 4DCOA 3DEHA 2VT6A 5K3EA 1PNRA 2JAXA 3U2QA 4D4LA 3PT9A 4S1NA 5C81A 2VBIA 3P2IA 1L5RA 3B60A 1N1GA 1R0ZA 3BJZA 2F4NA 4HYQA 1HRDA 3DFKA 4MS1B 4W7HA 4DIKA 4UAJA 4B5LA 6REQA 1VMIA 1GNLA 3LQ4A 5D01A 2G07A 3VBEA 1T3TA 3GD7A 4I55A 2SCUB 1O03A 3VYVA 4DCNA 4NR0A 4HDRA 2DKFA 2RONA 5DGTA 2HPVA 5FCDA 1TK3A 2Q3JA 3GFGA 3TLMA 3KSDO 4KVAA 2FPSA 1KS2A 1JE1A 3LCCA 3S7TA 3VH2A 3WGQA 1BDIA 2I8AA 1SZCA 4EG5A 2WF6A 3G2OA 1YA4A 1Y48E 4EB8A 4BE4A 4LJ9A 4Z0TA 4BFZA 4IF6A 1JEQA 1ST3A 3SE0A 3U3XA 4CMCA 1NSFA 2PJRA 1BE0A 1N7HA 1VCMA 1N6IA 5K6TA 1EUCA 1NVMB 1P91A 1DLJA 1JJVA 1W88A 2SKDA 3C4JA 4BKMA 4EO4A 3IALA 2VJOA 4FJ0A 4PVCA 1CB0A 1OA0A 4AUKA 3DKKA 3WHPA 1DB3A 1L5HB 1N9GA 1BWQA 1KKUA 2QVCA 3CPSA 3NT2A 3O83A 3PFBA 1GZUA 3SHFA 4C4TA 4ZU1X 3KM0A 1SCNE 4U7WA 1QRRA 3AWDA 3ER8A 3JU3A 1JTFA 1DEXA 1B1CA 2PKXA 4PPFA 1QH1B 4JQOA 2BWJA 3AI3A 4IJ5A 5IT9A 5KQSA 2HIGA 3DZCA 5COQA 1P5RA 4O4IF 5FO1A 1XVVA 4XJSA 3TEFA 3P9SA 4EARA 5JSUA 2G63A 5E9AA 5TQJA 4FB5A 3PL5A 4W4TA 2Y1XA 3BIWA 4HC4A 4IIFA 4AY5A 2OEPA 2XXBA 4KMMA 3E84A 1OQAA 3H1GA 3SMQA 4W82A 3QELA 3G0HA 4HH0A 1D4ZA 1V96A 2YN2A 5EJIA 221PA 2VT2A 5E38A 3T6KA 4BGUA 3D6NB 3CRMA 4ZKDA 4BNYA 5BN3A 1QR6A 4BZXA 3LPDA 2O3UA 3W3AD 1T9GR 2DCUA 2YJTD 3LX4A 3L7AA 4PNZA 4TM7A 4LN1A 4Q9KA 3BE6A 1ECLA 2O5CA 1AF7A 4W5NA 1N1MA 4C6HA 3WNBA 1UBJS 5EOVA 3USES 2XH8A 3WB1A 2LKCA 3FKQA 3LKVA 4DLVA 3T3NA 1I1HA 1XTJA 3AGQA 3ZGXA 1SCQA 1TAGA 4JT8A 2JLYA 1E5DA 3BPSA 1XJ5A 3P9NA 3TAHA 2IHYA 4OLJA 4UM7A 4A8TA 2QJTA 3DLHA 3LCVB 3MJHA 2VLBA 3PXCX 2ZAOA 4RLFA 5EINA 4CMEC 3EX7C 2R8XA 1YI1A 1EK6A 4N5LA 4KN6A 4CM8B 1K7FB 3FOEC 1X7ZB 3FR8A 2I34A 4LZOA 4AXXA 1RRCA 4KQ6A 5LLSA 3GELA 3G8DA 2JJ1A 1Y7PA 3MG9A 5JJCA 1K6IA 3NCHA 4QA9A 4Q05A 1KI6A 3OEEA 1XBTA 5MN5A 1C7EA 1GPWB 1S1MA 2VAMA 4XWYA 1EBFA 3GLIB 1G17A 5BYKA 1DO8A 3L06A 2VP3A 2FQWA 2NLOA 2BMWA 1L1RA 4R8SA 4RA9B 4K9MA 5TS3A 1KIFA 4JIMA 4NV1A 1W581 5JS1A 1KMMA 2WJJA 3IUBA 4KAAA 1QMPA 5LYJF 5GAJA 8ADHA 3GG9A 4PAOA 3IAAA 3W8RA 2QUAA 2IIVA 4NHEA 3QNMA 1DIRA 1C50A 5F5LA 2IVZA 4KRYA 3HSSA 2GWHA 3O9ZA 5I8WA 1OC4A 1CERA 1UP6A 5HOEA 2D13A 2W6QA 3EEQA 3EMDA 3H3JA 4ENPA 4LK2A 3DOIA 4MWSA 4PZCA 2IZZA 5HQ3A 4Q0MA 1IHXA 3HU2A 3PICA 4QXMA 4L7VA 4A4DA 5DGCA 1Y8QB 3F78A 2INGX 1KMCA 4KI0A 4EKIA 3FMIA 5I7HA 1VIAA 2W2OA 4GLFA 5LZ9A 1CJBA 1B7GO 1I7PA 2FPIB 1A9PA 5LKRA 3WLRA 2P6RA 5ICSA 1E1KA 1PL7A 3OM8A 3P2OA 2WMNB 4OQDA 2NACA 4NBWA 2WIFA 2HI0A 4LSGA 2GPAA 5A06A 1SHLA 1P0QA 3FUXA 3USCS 5D7BA 2OCYC 2ZM5A 2NZWA 2ZTSA 3P4UA 3E8MA 4HGZA 1Y3BE 4EAQA 1FRQA 4OM8A 2JGMA 2WT4A 3U6BA 4JIGA 3OKAA 2VTBB 2ADOA 3DL7A 2BUCA 3M6LA 3UF0A 2VJYA 1UPTA 2BIFA 4M9SA 1MNQA 4MA5A 5AW6A 1S2GA 1TCCA 2IY7A 3T61A 1YZ3A 3D3WA 1RWVA 4FE3A 3C6KA 3D4OA 2BOVA 3E7DA 4IIJA 1ABBA 1AHHA 4X24A 1IZYA 1T0JB 4NYMQ 2DY0A 2OK8A 5E4YA 1BA2A 2XGGA 5JWHA 3QW2A 3BJMA 5FLXA 4ZVSA 4EB0A 3ZCSA 1MNAA 3DG9A 5ALUA 2P8SA 4TKVB 1QJ4A 2R68A 4HPXB 4KR6A 1B93A 3K1JA 5JNWA 5MGNA 1F9AA 4AM8A 4YRNA 2B7CA 1TT5A 5AKJA 3BK2A 2F1HA 2LBPA 4BTVA 1Q7GA 4KQCA 3QYJA 1ZNWA 3C4QA 3KS9A 3QFRA 3SS7X 2QUIA 2NZ2A 4XIYA 2FDCA 4DUGA 4GM4A 1J7JA 1EU1A 1Z7GA 1CULC 2Q2NA 4Z2AA 4ARBA 3C74A 2AT1A 4MVJP 2UZ4A 1LLDA 4GR9A 1ESZA 1YZUA 3B20A 4MUNA 1T8WA 2JANA 4NJEB 2Q41A 4NTZA 4TM8A 4RVHA 2B4KA 3NVDA 1RKVA 5AK3A 4WOKA 2QZ4A 4RA6A 3ZJ4A 2ZULA 1XTBA 3HY6A 1TZMA 5REQB 2GA9A 3WHKA 1C30A 1EUYA 3GAZA 2EJBA 2VS1A 3BTVA 3WJ1A 2P1DA 1ZPDA 4IHJB 4ZVLA 5J40A 3V48A 1KYWA 3T3GA 4Q7QA 1D4FA 3ZWMA 5DBHX 1Y6FA 2D7JA 2DECA 1ESNA 3GH3A 2N9UA 5CM2Z 5JDCC 1CSEE 4O4HA 4RV9A 5TXGA 2I4MA 3HS3A 3ZIAA 2QZPA 4BIMA 3H1FA 5C9ZA 3ML1A 3DUWA 2JCGA 4RPKA 5BN3B 4RANA 3EJ6A 4HNRA 4L85A 5BYAA 3H5VA 1OW3B 4K9DA 3COVA 3NV7A 2P4SA 1NMYA 5C32A 4LJKA 3Q9SA 3KSRA 1ZVVA 2ES4A 4HLUC 2Z3WA 3C5VA 2VEOA 4DJEC 2QJRA 1GA6A 3A7DA 4J0GA 4MV4A 4G85A 4QOJA 2O2ZA 3GO4A 1D6JA 2D5LA 4OYHA 5L45A 2BY4A 2XNDD 3GYGA 1YONA 1YRBA 4TTPA 4YJGB 3A04A 3MYRA 4Z6KA 1M7BA 4AURA 4CKBB 2CKDA 4FXOA 5I6DA 4OJMX 1YIOA 4ZGWA 1GZ4A 3RABA 2B4TO 3MK31 3JQBC 3OCWA 5EA2A 3Q9UA 5HKKA 3L6RA 2FUKA 1XD2B 1TC2A 3BB1A 1RXUA 3M81A 3N3AC 5LR6A 1GADO 1A69A 1T4GA 3Q7IA 1OXKB 1FW8A 3GWGA 4Z86A 3NASA 3IPLA 1Z5ZA 5EUMA 4UW9A 2ERCA 1KS9A 1OIVA 3DFIA 3SX4A 1N2CA 1CQJA 4JD5A 1JHUA 1KIAA 2YV3A 1Y1PA 1YJAA 2UKDA 4KQFA 1C9YA 2FR1A 2IY9A 3CV3A 5ICGA 5IRCD 2UUCB 2ZBPA 3L82B 1IPFA 1X87A 2JI9A 2QDXA 3U9LA 3SQWA 4ASUD 2OQRA 4P0PB 3K09A 4BBAA 4QQNA 2I66A 5KI6A 4EQ6A 1RWNA 3K0EA 3L2OB 3MLBA 3MTEA 3GUCA 1CG6A 4FFVA 2WSSA 3EXFB 1E1DA 1J2RA 4M0MA 1XQWA 1NOJA 2B8NA 2CVZA 3C6XA 3OLWA 2VTKA 2ZJ2A 4M99A 5JVDF 2GX6A 1YRQA 3PUWA 2PSHA 2R44A 2B0JA 4QQFA 4Z53A 1DOZA 2WVJA 3PEFA 4H18A 1EUDA 3RG2A 4X62B 3WJ2A 3HRIA 4LNAA 2XWBF 3CEAA 5AHOA 4D0RA 2R5FA 1RLIA 2QN7A 1P0IA 3KAQA 1TJNA 5C0OE 1GQFA 3H6HA 1HMPA 4EPWA 1CEXA 3O82A 1N2HA 4FWBA 4DLTA 2CNOA 1A4XA 1BYIA 1DXYA 3BWEA 4LTDA 3PNMA 4WXRA 3TLJA 2ZJ7A 3GDHA 3WWZA 5LWQA 2CVFA 3OH8A 2EBHX 1X74A 2BKVA 3LT4A 2HQSA 2W6NA 1RP1A 3QBEA 5I47A 1PTJC 2ZRQA 4P92A 4RGYA 2PAFA 1EVQA 3AIOA 3CSSA 3BD6A 4Z51A 3QEAZ 5HIMA 3AIMA 3DL4A 2B4YA 3AOGA 4DUZB 1E0DA 2GLUA 2ILVA 2CLLB 2Y6UA 2G06A 1M6WA 1DJPA 3HCBA 4BAGA 1QGOA 5EHQA 1X42A 3V1YA 3D54D 5JAMA 1LV8A 4EG7A 1JVNA 3AGPA 1FRZA 3BRWA 2HU8A 2P6NA 3HBMA 4N8DA 5IKEA 4C2BA 2IPAB 4EF4A 2YH2A 1Z07A 4Q1AA 2VYND 2P35A 1IATA 4D0SA 1TK9A 2A58A 3NIWA 4XKJA 2GBFA 3DTYA 4CIDA 2AJDA 1EHYA 4E31A 4M1WA 2AHRA 1S96A 2VP2A 5BR4A 2OAP1 1H69A 1N2ZA 5JO9A 3ZWBA 2PQ0A 1N9KA 3E61A 2VH2A 2J0VA 3IUEA 4DRXB 3I6QA 4QUKA 3OQIA 4E1BA 5FAXA 1UZAA 1H9BA 2EGHA 3LYHA 5KNBH 4ER5A 1TXGA 4ZGBA 2DFNA 1EAMA 1E9VA 1HOTA 2ZS9A 1Z6GA 2P9BA 4ALLA 1E3WA 1GZDA 2JGAA 1U8FO 2ATCA 1X7GA 1FVHA 4EPXA 3RS9A 5I51A 1TX4B 4MVWA 3VTAA 1I4TD 3E23A 3BHJA 1XXHA 3EA5A 2XGJA 4IMPA 3TL3A 4HNSA 1EVKA 2BM0A 3H2BA 1B3RA 1RWMA 2D6FA 2IYWA 1TJPB 5IDVA 2FEAA 1GNPA 1V5EA 4JJGA 3X3HA 3UZUA 7ADHA 3E3LA 1C9MA 1LLQA 2AD5A 4GQBA 4X84A 4RESA 2QSZA 2UYYA 4E2YA 2JIZD 4WXMA 3WK9A 1HTTA 2W2LD 4Q15A 4E3ZA 5JT1A 1RAGA 1CFZA 5F3RA 5ECYA 2HMUA 1SZDA 1P0FA 3C15C 1W4RA 5AP9A 2C2XA 4GE0A 3VH3A 5CFNA 3K9FC 3OSUA 1MJNA 2HNKA 1N7IA 2UYHA 1KSGA 1E1QA 3CUEF 2DR2A 3G9ZA 3MC1A 3WBBA 1MHTA 3OECA 3VPBA 2OYRA 3L6BA 3ZLVA 2CDAA 2GEBA 3IE2A 4QDTA 4YP1A 4EPYA 4V1CI 5JAIA 3RFVA 3IAXA 1N3YA 2GD1O 1IMJA 3Q3CA 3VJRA 2E7ZA 4PGAA 2K6GA 4IJUA 1EX6A 4IV0A 1ZJWA 4A26A 3UO8B 1DKQA 2G88A 3E18A 5G4KA 5DZSA 1HYBA 2JGDA 3U60B 3ZYCA 5IN5A 3BCSA 4BYGA 4Y6SA 1KZ7B 2QM3A 1YQTA 5HZKA 2PUAA 3A1CA 2BM9A 3AC0A 1FFEA 1E2GA 3EPLA 1M66A 2B69A 3THXA 4JX9A 1RI5A 1ZBDA 1IBKB 1GNRA 1PV1A 3ABRB 4FBLA 2CB9A 5KAPA 4C7MA 2C9YA 2FXVA 3T9FA 3CWQA 1R16A 2VHCA 3PUIA 1NC1A 1G8GA 3NOQA 1YC2A 3KRTA 5F98A 4PSDA 2G9RA 1SQ5A 2P3QA 4NDNE 1DRUA 4RZ2A 1TQ4A 1FFBA 3ETJA 3SC3A 2RJOA 4NI5A 1NLMA 4HNUA 2QSJA 2YIJA 3G0BA 1V1MB 1NG1A 4KAJA 2B92A 2VDOB 4AS1A 4DKXA 1LS1A 1TNDA 3QELB 4J29A 4WOJA 4N5IX 3ZGOA 1ZJJA 3VR3A 4XTRA 3HV2A 2JLBA 5CEFA 4UREA 2XUDA 1IEQA 3G0GA 2G9UA 1U9JA 2VA9A 3WLMA 3N2KA 4XWWA 3CE9A 1SXGA 1N9GB 1TA9A 1XK6A 3AY6A 4ZJUA 1SUBA 2D3WA 3OCUA 4L74A 4YMWA 2HSEA 3C70A 4M88A 1D1TA 1R6TA 1YE3A 3DAYA 4FCWA 2PJUA 3ZZ0A 1O5IA 1NNUA 1ZOOA 3AF5A 1V71A 1B0UA 3MAJA 1V6CA 4Q3CA 1N0VC 1XCJA 1PWEA 3MWEB 1R64A 3CRQA 2Y05A 1Y6JA 1LBTA 1G7RA 2G17A 3PQ6A 5DFAA 2ZAGA 5K8CA 2VDMB 4F4CA 4JLMA 3URKA 1CX9B 3LZDA 4MRAA 2R00C 1RYNA 4IIUA 3SYNA 4HH4A 4RD0A 4Y2VA 1NUQA 1VYTA 5GINE 2AI3A 3A1SA 2KS6A 1INLA 3NTLA 4UNPA 3VHLB 1MOZA 4RGQA 5SY9A 3WZMA 1IZ7A 3PEUA 1BE1A 1KJ8A 1XRMA 3CPJB 4KO2S 1UOQA 4P4GA 5HTKA 1SEPA 5EWMA 2P0EA 4NCBA 2EGUA 1KZYC 3PHIA 4Z54A 1H0SA 1MF7A 2QVGA 3PYLA 1V8BA 4TTAA 2P62A 4JHXA 4I6EA 1WRBA 1BEUB 1E2FA 3QE2A 2DLCX 3AW9A 2XA9A 3RARA 1JIIA 1PG2A 2FX3A 3H3FA 5C7LO 2QUHA 4ZDWA 3SDBA 1H0HA 1DBIA 3WGYA 5E1DA 5A3RA 3S2SA 3AZQA 5E6SB 3WNVA 2H3EA 1CIJA 1FXWA 1GNVA 2X5NA 4DM3A 4A91A 3SYLA 1E3MA 2WKQA 4LC1A 4ZVNA 4GOKA 1BROA 4JASB 3CLUC 3FNIA 2XYPA 4MX8A 4TRMA 3VO2A 1EZ1A 4CKXA 5KNBD 4Y2XA 3AUAA 5K9ZA 3P9IA 4PC7A 3ZHUA 1WVGA 1M6VB 1ZGJA 4IZHA 1WV1A 4ENTA 5JTUA 1XG5A 1WPRA 5CURA 4DUGD 3FUWA 2EOAA 1M2WA 4ZYLA 2I87A 2WLTA 4LTMA 1UANA 3C3XA 4S1WA 4CTOA 2QMHA 3IH5A 4F4HA 5K6AA 2P0AA 5CDFA 1TM4E 3EEIA 3HZHA 5DHRA 1E3TA 4HNGA 5TPWA 1B1AA 3H9EO 1D0SA 1EINA 2WOJA 2ZUBA 3NAGA 4OP1A 1L5GB 4I50B 3IGFA 2UYQA 5JLAA 2PFSA 1WNFA 2H18A 3VYUB 2Z8XA 4A3SA 4C01A 1CNEA 5EWLA 2I67A 5EWJB 3BRSA 4HDAA 3OQNA 4G81A 6CHYA 2YOGA 4WA8A 1UDXA 1D4OA 1K0FA 4UEJA 2J41A 2I9KA 2BEWA 4N0EA 3OEED 1BN6A 3P2YA 5DBIA