1CZOA

Comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWGVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FLAVODOXIN
publication title Comparisons of wild-type and mutant flavodoxins from Anacystis nidulans. Structural determinants of the redox potentials.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 58
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1czoA00
1KBQA 1YCHA 1YDGA 1YOBA 1XYVA 4Y9UA 2QX6A 4XDHA 4LAFA 3KAPA 2Z9BA 1FLVA 2FX2A 2Z9DA 3K1YA 3FJOA 5F12A 3NHJA 5LBTA 2FZVA 2GSWA 3F6SA 4C76A 4J8PA 1WSWA 3O73A 2FZ5A 5ULLA 1CZUA 5BUCA 3G5MA 4C14A 2OHIA 4FGKA 3ESXA 1XT6A 1T0IA 2BZSA 2FOXA 5EA2A 2QX4A 1RCFA 1JA1A 5LLDA 4DY4A 3NHYA 4CETA 3QE2A 1QR2A 3ESZA 4OXXA 3W77A 6NULA 3LT5A 1CZRA 4QOIA 2OHJA 3FVWA 2QX8A 1YCGA 1J9GA 1AMOA 4ZVNA 2FAXA 5B3KA 3ES9A 3RPEA 1SQSA 3GFSA 4H2DA 4C0XA 3GFQA 1FVXA 3QFCA 1YRHA 3NHSA 2BN4A 5F51A 2V5UA 1AZLA 2Q9UA 3HA2A 1T5BA 4ZVKA 4PTYA 2W5UA 1CZHA 2FVXA 3OJWA 3SVLA 3GAMA 3F2VA 1ZX1A 2X2OA 4N9QA 5NULA 1SG0A 1KBOA 4YAOA 3TZBA 1ZWKA 2FCRA 3FNIA 4GI5A 2X2PA 4Y7CA 2QR2A 3OX1A 4M0CA 3U7RA 3K20A 4NLLA 2AMJA 2V5VA 3KEGA 3W78A 5F4BA 3NHPA 5LBUA 3N3BC 1YCFA 3OWXA 1DXQA 1AKVA 3B6JA 3HR4A 4LA4A 2Q62A 4FGJA 4N82A 1CZKA 2R96A 5LJLA 3HLYA 3OJXA 2OYSA 1JA0A 4YAFA 1BVYF 3W7AA 3TEMA 4QOJA 2QWXA 2R97A 1F4PA 1RLJA 2BMVA 4GR9A 4FX2A 4U7FA 2QMZA 1V4BA 2M6RA 1DXOA 1AKQA 1AKTA 1D03A 1CZLA 2F1OA 4ICIA 2QMYA 2FLVA 3R6WA 4PTZA 3O2NA 4HEQA 4BMPB 1RLIA 1FLAA 2HNBA 1E5DA 1H66A 3QFRA 2XODA 3OX2A 1XYYA 3ZHOA 1J8QA 2Z9CA 4Y9RA 2M6SA 5NLLA 3GFRA 2BF4A 3NHWA 3S2YA 4QOGA 3KLBA 3NHUA 1FLNA 4H6PA 2V9CA 4GQIA 4U7HA 5LVAA 1DX9A 1D4AA 4ZVMA 4LTMA 5FX2A 2MT9A 4YALA 3B6MA 1C7FA 1I1OA 1H69A 3L9XA 1YKGA 4BMOB 2ZKIA 1X77A 4QOFA 1TIKA 2MTBA 5EAIA 5JROA 4D02A 3B6IA 4S24A 4DIKA 2N1MA 1C7EA 2KLBA 5FUQA 4F8YA 3NHKA 4QOEA 1AKWA 3KAQA 4YQEA 3N39C 3NHRA 4N65A 1J9EA 1BU5A 3L9WA 1OBOA 2A5LA 1AG9A 4FGLA 4ESEA 2Z98A 4HS4A 2QX9A 1J9ZA 3OX3A 2XOEA 2RG1A 4YAWA 5TGZA 1NNI1 5EMNA 1VMEA 1FX1A 1OBVA 2OHHA 3TE7A 1FTGA 3OVMA 3JSXA 2D5IA 2MWMA 3NHFA 3F90A 2MOKA 4NULA 3D7NA 1CZNA 3FX2A 2HNAA 5A4KA 1QRDA 1AKRA 1GG5A 3EYWA 4XDGA 4QODA 5LMCA 2HPVA 2B3DA 4R81A 5FA6A 5B3LA 4CF6A 4DILA 1OFVA 1AKUA 1FLDA 3B6KA 3UXHA 1RTTA 1QBGA 4YAUA 1D04A 4LTNA 3F6RA 2BPOA 5LJIA 3EDOA 1XI2A 3NFRA 3NHLA 3P0RA 3FW1A 1FUEA 4QOHA 4ZVLA 3UXEA 1AHNA 1TLLA 4LTDA 3OWHA 3U7IA 2ARKA 4U7GA 1B1CA 2KQUA 3W79A 1CZOA 3NLLA 4PU0A 3LCMA 4C0WA 3ESYA 2FDXA 1QHEA 1ZWLA 2WC1A 1WSBA 3N3AC
chains in the Genus database with same CATH superfamily
4HVAA 1P6QA 4KUEA 3W6PA 1B41A 3D4LA 3ED1A 4AO6A 1R64A 2V7WA 2ZPTX 2XA1A 2RI1A 3TRDA 3AETA 1HE4A 3PNPA 2R3SA 1V16B 1FFWA 1KJWA 5KX5A 1NIPA 3U3DA 1JWLA 1C81A 3UG7A 1MRSA 4QPNA 1QH8B 3IMGA 1ECLA 3FUWA 3ZW8A 1MGPA 4EKIA 3ZDZB 3VNAA 2PBFA 2WZQA 4B3GA 1JKFA 4JVOA 2B4QA 4EW6A 2DBZA 3QX3A 1CUEA 1WB4A 2WHPB 1P81A 3QKRB 3U6BA 1Q1ZA 3V55A 5K0FA 1TCCA 1X7WB 2CLKB 3GFOA 5JJIA 3JYHA 2JKVA 4FSHA 4JLMA 2WJIA 1RYYA 3P9RA 1DMSA 5IVKA 2JD1A 2A9FA 4S1VA 3WGMA 1DIGA 3AESA 1EFTA 4OMFG 5IBPA 4RTMA 1Z5UA 4HYYA 4JEIA 3GA5A 2IS2A 4LCJA 3ZZ1A 4H3KB 4ZN6A 4ZYWA 4KR6A 5CVEA 1PL6A 3PXAA 2WAAA 4J8PA 4R1UA 4I14A 3GJ4A 3K2QA 2ZR9A 4UUOA 1BE8A 2GDZA 1RXIA 2ERYA 2FZ5A 1E79A 2GYWA 3KT0A 2YJZA 4MA5A 5CW2A 4CM9D 1FDOA 4ZZ0A 5AK0A 1RQ2A 2EJWA 4FOPA 3WWYA 1BJKA 1PN3A 3DZ8A 2AC2A 3GMTA 3STXA 5LPNA 1YBVA 3H04A 4WXEA 3GL9A 1ZD2P 1YB7A 2JGNA 1LDMA 2JDIA 2GAIA 4P32A 3ER9A 2NACA 4FGKA 2BF7A 5EZYB 1ZM7A 5KQGA 2XDWA 3DV9A 4CIVA 4XA8A 1Y6JA 2PZEA 3EXIA 2FOXA 2VJAA 1EUCB 1Y1KE 3H86A 5H0IA 3G8BA 4W9NA 4OSEA 2NZ2A 1JA1A 1UC9A 1T2UA 4QRHA 2AH5A 1Y8CA 1TIBA 4LF4B 1UQTA 4DY4A 5JCOC 4RJJA 4MWTA 1Z8HA 1TF2A 3QBDA 4OQMA 1U0GA 2G9ZA 1E3WA 3TG2A 2FJUA 4V0OA 3T9CA 2R2AA 1K8YB 4J1TA 4UFPA 2Z83A 4BVGA 2OBYA 2ZS7A 1LVHA 2PT6A 1ZQ1A 2VNAA 1VLJA 2HEGA 3KBBA 5AHOA 2CXQA 4UDXX 5MN6A 1E3DA 5AVXA 4JJAA 4RVHA 5CT6A 5IT9A 3KXIA 4U0JA 1DQNA 5IDXA 1WPQA 2OHJA 2OG2A 3ETHA 1HEUA 1TZ2A 2EF1A 2QW0X 2QV0A 4H18A 3VOTA 2ETVA 4JDUA 5J47A 3THRA 4G0UA 2IHNA 2H8GA 3X1MA 3QEBZ 4ZQIA 3ICOA 4ARZB 5BSTA 4EJFA 2IZ1A 3ZZTA 4C0LA 3AF6A 1MEOA 1T24A 2EGGA 2RK6A 3DOFA 3QG5A 4OQYA 2BEUB 1P5FA 4QELA 3GW8A 3BIOA 4RMHA 5TQJA 3V33A 1QIHA 3LQFA 3LI2A 2Q3CA 4QYMA 1U7PA 2HBZA 1JN0A 1XU7A 4XOUA 3F6YA 1IM8A 4JVSB 4X1KB 1QM5A 3RV3A 2PZ8A 4MS1B 1EJ0A 1WD5A 2YY5A 3HB9A 4CMJA 4L5JA 9LDBA 3HDHA 2PY6A 1Q0SA 1ML3A 3JZAA 3RH0A 5BMVA 4AS1A 3PQ5A 4CM3A 3GCDA 1Y4UA 1I33A 3IS3A 1RWBA 3NNSA 4N7RA 5J59A 1CD5A 1GAEO 3C3CA 3L01A 1FMLA 3DMNA 5A6SA 3MS4A 4ZI7A 2QVZX 1GLVA 1OXKB 1F2TA 2YVUA 2YZKA 1BCRB 2A5GA 4CMGA 3I6MA 4WJKB 1E8NA 1S01A 3U0BA 1JPVA 1YZTA 2R5FA 2ZQYA 4WOJA 3WGVA 3TUZC 3NC4A 4R2IA 3BDIA 2J9XB 2VSOA 2PV7A 1W25A 3NQ41 5M04A 1ATIA 2OAEA 3D4NA 3IKTA 1CE8A 1GPYA 2D0OB 2RGCA 1XFDA 5BQXA 4H7IA 2LCIA 3F8TA 3HB0A 4GVXA 4ZO7A 3LUBA 3O8DA 1DTEA 3IHWA 2A86A 2IS6A 4R0NA 3NXSA 1LTKA 3V42A 1LJLA 2EHJA 2J4FA 2XECA 2NUAB 4KRGA 4N9WA 4WCFC 1G38A 4RDHA 1E9SA 4CQNA 2EP7A 4ZGBA 4B8WA 3FWZA 4JMPA 4N5HX 1E6WA 2Z5LA 4R69A 3KKMA 4WFJA 3OAAA 1NM5A 1ZU5A 1UBGA 2Q4RA 1SO8A 4HEJA 4K7JA 3SP1A 4A0QA 3QHQA 4C6TA 5IBCA 5C81A 5JBIA 1KEEA 4UNSA 5JJKA 2R8ZA 5DTQA 4KAXA 2JFZA 3CKLA 3AM5A 1WHTB 4BB9A 4FBGA 4NYIQ 4RZIA 1SELA 2XDAA 5HE8A 5KX5B 4EKYA 3OTQA 3CONA 3FIUA 3J81k 4Q4LA 4GBMA 1YC5A 3I5UA 2IYAA 1N9KA 2AG0A 2VDNB 3GRUA 3NUGA 4MUIA 4A8HA 1EXDA 4IZIA 2ON6A 5A4MS 3D43A 1RJ9A 4D6XA 5KDOA 2CLHB 2RBEA 2B20A 2PQ0A 1RHJA 2W98A 4GMKA 3T9DA 1FFDA 1E0DA 4Y0NA 4HJXA 4B6GA 3K6SB 3R24A 1VGRA 1XNHA 4UHJA 3WDSA 1F8GA 5JI2E 4FCVA 2GZ3A 4WTOA 5I8WA 4ZZIA 1AUPA 3EQ2A 3B3AA 3SSAA 1QVZA 4Y6RA 5EQJB 3WWPA 1ZMOA 1DXQA 2VHQA 1UMDB 3GZNA 3U4IA 1ADYA 1AKVA 1RJDA 1G2PA 4N5LA 3U3ZA 3WHKA 5HS4A 4RKQA 2IS4A 3WO0A 2EXXA 4TGLA 4FMDF 3IQZA 2HD4A 2P8JA 4K9SA 4MI6A 5HJ2A 1XRJA 3ECCA 3O3MB 3PL5A 1GAWA 4YCDA 1G9TA 2ATEA 1GIAA 2BCJQ 3BHIA 1J24A 4R54A 1X1DA 2YCBA 3AVYA 3OA0A 1I01A 3TFOA 4Y1RB 4PCVA 3DEJA 5CT9A 2WB4A 2JZOA 4XVRA 1WY7A 2OQ2A 3VMMA 2PGXA 3R7SA 4CU2A 1ZR4A 2WG1A 3SZ3A 2HA0A 3F74A 2Y67A 3VDQA 3AJEA 4HAIA 1OIXA 3RKRA 1SZDA 2HF2A 1PGJA 1H93A 2RK4A 5EGSA 4MIKA 4XFDA 3N8IA 5HIAA 5CNKA 3WRWA 3PJGA 3GVIA 2G77B 1SC9A 3H19A 3IBGA 4G4SP 3SSMA 4ENSA 2R97A 3QX9A 2OBMA 1WJGA 1VCHA 3FMGA 4MGKR 1ZD1A 5CFOA 2NAPA 1EP3B 2I22A 1XZAA 1Y63A 1KORA 4JEMA 5LZ7A 1MENA 1B0UA 4BNVA 3AY0A 5LXTB 2BTEA 3HZZA 5DHFA 5IAEA 1CEYA 1CQJB 2Z56A 4J1SA 3R0ZA 3DUFA 1KZ6A 2Q1XA 3EFOA 1WQ3A 3WY9A 4G25A 4MB2A 2K5UA 2A4MA 2ZSKA 1TUGA 1UQRA 1L4GA 1X7HA 2R8OA 3SHQA 2GM4A 1RPNA 3NETA 3Q5GA 1P0QA 2F7SA 2GHIA 4XZ3A 5I9TA 3KR2A 4PZEA 2IYWA 3C4QA 5C7YA 1YAHA 3LT2A 4DQUA 3L41A 4PHCA 3B9BA 3JVDA 2X0FA 4BMNA 3AR4A 2ZUTA 3AEYA 2IYZA 4MWDA 4F5EA 4X6XA 4ZCLA 3HNPA 4RK7A 1O95A 3OEHA 4K9KA 3UN1A 1HYHA 4B8YA 4BQQA 4ESOA 3CZQA 5FTMA 3EVBA 1EAMA 1CDDA 1VRCA 2IXBA 5FORA 3U7EB 1AQJA 4C7OA 1AXRA 3ZIAD 4AUMA 1XBTA 3EFEA 4AD8A 4KFSA 3TNFA 1KTIA 4RTJA 1CY7A 1E4VA 1TPYA 2VTEA 1EAYA 2R1ZA 3THXA 4NV3A 2ZE8A 3S8MA 3UUFA 3W5JA 1CV2A 3IPXA 1W5BA 1BKSB 2HRZA 4E33A 1OFUX 3VMFA 5C32A 5AKGA 2CBZA 1AQNA 4R8SA 2VWPA 1WEHA 4RH0A 5JRDS 4DMFA 2PRYA 1A2BA 2FPRA 4JJGA 4BVJA 3A6EA 5CLQA 1TUEA 2PUBA 3OE7D 4ND3A 4XIGS 2NVOA 3CRZA 5TSDA 3NAQA 4RPGA 4GPZA 3PJRA 5DGXA 2YXEA 1H8ED 1XTJA 3LLCA 1GQRA 3KL4A 1Z4NA 1JTVA 4M1SA 1RZRD 1KDYA 1RBQA 3EXAA 3BTUA 1VKNA 5HRUA 1YQEA 5KHOC 4RTKA 4LN1A 4YV1A 3GPLA 3TRKA 2FWJA 2FEWB 2IF0A 3K8YA 4YJFB 1E6KA 5GOTA 3ADBA 4MITA 4NC9A 2XGMA 3RW9A 3PE3A 5KKNB 1YFJA 5JJ5A 3HY3A 1U1IA 1GVHA 1NNUA 2IC5A 3O83A 2DUWA 1Y89A 1YT5A 4NH4A 3TLJA 4F85A 1MX9A 4DZZA 1W4BA 5CA0F 2M6KA 1LH0A 3M4XA 2IY9A 1GRCA 2AJ8A 3IJRA 4MX8A 5K0JA 4W5RA 2VTBA 4NFHA 4GX5A 1SRRA 4OFWA 5A9SA 2AXEA 3V4PB 4X3OA 1UEIA 4F1JA 4LWZA 4LBWA 3LIPA 1WNTA 2AX4A 2QUIA 3ON5A 3W5HA 4BLQA 1UFQA 1PGPA 2ZUDA 4JEHA 2VUTA 3W9SA 1Y3DE 3ET4A 4U3JA 2MTBA 5I6DA 3QMMA 2Q9BA 3OIVA 4FYIA 4KH1A 1KI6A 3QBEA 4M9UA 3TBKA 4TV8F 1TEXA 3GCGA 1N5OX 1NG1A 1SIBE 3H5RA 3A6FA 4MRMA 4PVCA 4QFBA 4R2WA 4LF7B 4K86A 4MUJA 2A1UA 3TTVA 1J22A 4KQJA 4EVQA 5ED0A 3RBXA 3UWMA 5DBHX 3E03A 3GC6A 5FUQA 5ALHA 2IITA 3KBOA 4R2MA 5A71A 3BF7A 4DL9A 3PD1A 4QM7A 1ZGAA 5CHYA 4BLPA 4A10A 1PJAA 4FJ2A 4QXRA 4D3ZA 2JEOA 5BVGA 2DWOA 3PPXA 4RSHA 1EFPB 5FTJA 3U5TA 2ZJBA 3L0OA 1KFKB 4LJAA 3VAAA 4S1NA 2C8LA 1I2AA 2PN1A 2PR2A 5DGTA 4FFNA 3ZD7A 1Z18A 2F8MA 4CTNA 16PKA 1J70A 5B2EA 5ALPA 4H77A 2XVAA 4YT4A 4JI5B 5AKZA 2X58A 1U94A 1LPOA 2H9YA 2ZBFA 3I04A 2WTAA 1Q0PA 3BTOA 3DKVA 3BB4A 1T4CA 4I50F 3VHXA 9LDTA 4BTLA 5KB3A 2H1FA 3OHMA 2PTHA 3BSSA 3GT4A 1DRJA 1R6DA 5FWDA 5G41A 4CLEA 4EIWA 4XVCA 5C5EA 3W9YA 2I76A 4B6OA 2QJRA 4JT4A 5IKPA 1KGSA 1M2JA 2VEOA 3L46A 3L7LA 4MWZA 4OQPA 3X1DA 4NBVA 4EW3A 4YLEA 5AKKA 1DGQA 3OMLA 4PNEA 1KY4A 5C1DA 4IQ0A 2R2GA 4WUTA 3UV3A 2RH8A 1QB8A 1SA0A 2VAXA 3CLSC 3LCJA 1VC2A 1S3GA 3ESAA 3PNLA 3WMFA 3C8UA 4R68A 4A0RA 3NVDA 1OXSC 4KRYA 3DV2A 5BR1A 1JB9A 1ZC4A 2GTPA 3EPRA 3GZJA 1A8SA 3KJNA 3QVTA 1DEAA 4MB0A 3M3DA 4DBZA 4S05A 1RVV1 1GYRA 1TX4B 3TINA 4ILKA 1BC5A 2OC9A 4J9UE 2LR0A 4PF1A 5CK4A 1YD7A 2ZI4A 2VJMA 5L3ZA 1U80A 3N07A 1PZHA 5LZ5A 1EVIA 4ED9A 3LLVA 1AGNA 1Q15A 3RYIA 3QX8A 5A05A 3R7WA 5LD2B 1J2YA 3PEUA 4HEHA 2FFBA 1YK0A 2I2XB 3N7UA 4OAPA 1T2NA 3NATA 3WKBA 1T5TA 4PFSA 2IZ6A 5C8VA 3BGWA 4QUAA 4W8GA 5JYDA 5H16A 1I4LD 5JSQA 2HT6A 3MERA 2PL1A 2R8PA 4ZXFA 1N9GB 2Q4EA 4KQGA 3OJCA 3DFKA 2PBLA 1LF5A 4DG8A 4UVGA 1ISFA 4JOQA 4DGQA 3BBPA 1A97A 1JSLA 3ZY2A 3VR1A 3PC6A 2X7XA 2FP4A 3EULA 4D25A 2CHQA 4BE7B 8AT1A 3WIVA 4D9HA 5ES4B 4HN4B 3WL3A 4POOA 4NXNB 4LJ9A 4CKCA 2GUGA 1BFKA 3KJFA 4M2LA 3IFSA 1Z0FA 1JALA 1N3IA 4Z9FA 3WLMA 5SZIA 2J3QA 4MVJG 2CDRA 4RM2A 2GEUA 1STOA 1EDEA 4RAQA 1XF1A 3AM4A 5LMZA 5LP6B 1EIZA 3QF4B 1JI0A 1J0AA 1Z4JA 2VDOB 3M81A 3O1JC 3V3KA 1P18A 4FZRA 5CM2Z 5GONB 4UUPA 3PNOA 1QF7A 4YJDA 2XQIA 3PA6A 4OJQA 1NXSA 1B1CA 1TLFA 3NRBA 3QTLA 4KIUA 2P9YA 3HCWA 4IHKA 3QE4A 2I0FA 3JD3A 4MR9B 3WGJA 4WLFA 1JBEA 1N6HA 1QGDA 3VUEA 3TFWA 2VIIA 5A5FA 3BWVA 2I4LA 3PBKA 1D0VA 1TU3A 4G01B 1E1QD 2DBRA 1G8MA 3KB6A 4RE5A 5FOVA 5KVQA 3S0JA 5CCXA 2NUPB 1RXUA 1JR2A 3W6OA 5FD8A 1TJPB 4DBVO 1HQKA 1CUZA 4OB6A 3FB4A 1LLFA 3MBOA 5EVCA 5IXSA 2HV8A 4HDRB 4K2HA 5TQ2A 3SK0A 5BWLA 5C8YB 4LVOA 5AYVA 5ELXA 1AHHA 3VO1A 4QM6A 2KHZA 3ND6A 1E64A 2D7JA 3Q3CA 5BT8A 4EY6A 5TGDA 3SN6A 4C43A 1J5PA 1KAMA 1AVTA 3A4LA 3P26A 4G0VA 1DL5A 2V7VA 3RS5A 3W3ZB 2B98A 5H82A 3WYBA 1W0KD 3GARA 2D1QA 1V3TA 4MGYR 4YAGA 1KBZA 5LA6B 2NSDA 4NBLA 4CQLB 3VR6D 5FI3A 5I7EA 4L73A 1Y3HA 2QX6A 2R7LA 1BS9A 5AVJA 2G25A 3EGDA 1FDVA 2FLKA 4QGSA 1WBBA 2B1JA 4C3OB 2R7NA 2IDJA 2I87A 4RFSB 2IYYA 4N76A 3GJSA 1XHFA 3LRPA 4XLZA 3EVAA 3SIRA 4BP8A 3ZGOA 4KR3A 1ZO8A 1TZKA 4FQ8A 4OGLA 3ZE8A 2WKRA 1C8BA 1W6UA 3IULA 5DZSA 2X9LA 3JYOA 3W8DA 1DJOA 2F90A 2GCOA 3K5HA 1Y5RA 4NZMA 3FSJX 2VKTA 3TTSA 3UAZA 1VZ3A 4AUNA 2VJYA 1T36A 1PT8A 2FFJA 5DV9A 3RVQA 4MI3A 5K3FB 4B2IA 2E82A 4IRXA 2QRKA 2BR5A 3QKUA 1WIWA 1PQWA 1P2SA 1RI3A 3MTIA 3FTEA 4YJ2B 4ZQEA 1B6SA 1MLDA 3Q88A 1RI1A 1YIOA 2Q8PA 4M98A 2WWXA 2V4MA 5E95A 5HCNA 3ABZA 5EYPA 5FOSA 4G5RA 3W05A 4BO5A 1TJ5A 1TUIA 2GBLC 3T7DA 4A0SA 2YMPA 3MRSA 1QFJA 3UOAB 5ALDA 1C1HA 1PNOA 5JMOA 2DWQA 1XTQA 1SGWA 1UWKA 3NRJA 3KQQA 3QSYA 1QS0A 1UC4B 5EWLB 3RIXA 3A3NA 4B3SB 2ZTSA 3QITA 1ICIA 1KH2A 4H6XA 4UASA 1HFKA 3UK6A 3RO7A 3ROFA 2V03A 3HP1A 5EE5B 5MN5A 1JEYA 5CXQA 3SEFA 2E4XA 3DP9A 4H31A 5CGQB 1O0CA 5CUQA 2DH6A 1RYEA 3D7LA 3HP4A 3MJSA 4AQDA 2DYKA 1T35A 1ZICA 3DWGA 3R3UA 4OQZA 3EMDA 5BV0A 2I6XA 3BBLA 1ISMA 4EW1A 3TMYA 5AW4A 3D2LA 4L15A 3NBXX 4WZAE 4DABA 5CTAA 2FK8A 1YZFA 1GNRA 3BD9A 3AJAA 3DVRX 3EY9A 3IAUA 3NEJA 5LP1A 3ISTA 3EGXA 1LDBA 3FROA 1Y7LA 3JV7A 3JW8A 2IODA 4PPNA 4M54A 1K5GA 1FX0A 4U5QA 2AN4A 3WNCA 4EL0A 3BERA 3JRNA 5EZ6B 5A03A 3I05A 3KVOA 4MARA 4KDEA 1VMIA 1YRBA 2JS7A 3H9CA 4CM9A 1WUJS 2HUNA 3REOA 2D5AA 1POXA 1B0ZA 4FUQA 2IVZA 5A5VA 4IDPA 4OQDA 3L6RA 3KM0A 1SH7A 5TR9A 1F1JA 1TEZA 3TD2A 2J9FB 2P11A 3KTOA 5BV7A 2Q1SA 1R66A 2V6BA 3O74A 4IVNA 1NN1A 1DOAA 4FOTA 2XRYA 4ZVOA 1BSVA 3EIEA 3NO4A 5EIFA 3HYLA 5EIWA 3SZGA 2W71A 3IAS6 4IIGA 4TV9B 3UUEA 3H0EA 4IJKA 3SYLA 4MRPA 1GUYA 4AIRA 3ZDBA 3M6XA 4YXWD 4AWBA 3RRZA 3B60A 1TTHA 4DT1A 4AK9A 1GCGA 4CI0B 2ODTX 3CEJA 4ETMA 3B48A 1VE3A 3DEHA 3ENVA 2WQ6A 5J2TF 3I83A 1F6DA 4G5FA 3ZHUA 8MHTA 4EFLA 3KWFA 1K86A 4I3GA 3QMWA 5AI8A 4BX0A 5IC4A 3TQIA 2Q9UA 4I4TB 1ZCZA 5DK6A 2YMQA 1CUCA 3FHCB 3QIAA 2XYPA 1Q7RA 2J33A 3UHPA 1Z17A 2QT0A 1PSDA 2W37A 1NC3A 5KOHA 1V6SA 2ZSIA 1KR2A 1A95A 3WC4A 4BQPA 3CEAA 5ILOA 1QDEA 1A2OA 2CYBA 3LNCA 4PG5A 1TM7E 1Z3IX 3HN6A 1XTSA 4BC0A 5CDTA 5AVWA 3T1TA 1SVKA 5AUNB 4EGSA 1K5HA 5B1EA 3RUAA 3R0IA 1SHKA 4NBTA 1D8AA 1Y82A 3EBLA 4QWWA 2AI2A 4OHVA 1XWIA 1AGYA 4AG6A 3D02A 3FMIA 5JPIA 4DGSA 2Q1WA 1M6NA 1SC3A 2XWJI 3F71A 3M3PA 1E6MA 2ZPAA 4LRTB 3A58B 3A9UA 3JQBA 3FVQA 3KJHA 4M8LA 2JI4A 4WVLA 5K4GA 2ODBA 3V8RA 5A1TA 2XNKA 1Q7EA 1T0UA 2FUCA 4DCSA 3QEAZ 4K9NA 2EAUA 3H8SA 1CUJA 1HXHA 2B35A 4BZQA 5IXYA 2PUWA 1L4UA 1VJGA 1X7DA 3R7FA 3HH8A 3ZI7A 1Z5PA 4UCFA 3PWKA 5JSZB 1YZHA 1GPDG 2ZPUA 3AHDA 1KO8A 2B4RO 3RT9A 2A9VA 3BIXA 4Q3LA 5EXSA 1XTRA 2PDAA 5BR7A 2CKDA 5HWSA 5I51A 4MCIA 3QLEA 3DHVA 1Z08A 2VPPA 1QIMA 4LG1A 3OP1A 4LRUA 3VU9B 2FQQA 4MKIA 4CR8A 2RGNC 1US8A 4BWVA 1UJ5A 2GT1A 1FRFS 3DFFA 2OAQ1 3PGXA 5D5QA 2DWPA 3V9PA 3T3HA 4BLRA 1K7CA 1T36B 4HBGA 4UREA 1Z33A 2C0QA 4NE9A 1A4UA 5FOUA 2Y68A 1QK4A 2GDJA 5AMXA 2V3WA 2BGTA 4LNUA 1L5FA 4P22A 3FMOB 1KQOA 3MJFA 3OTIA 3EVCA 2E5FA 2P4SA 3OPVA 1C1YA 1T9KA 2DUNA 2NW6A 3QV1A 4BFLA 1J00A 3TNYA 2NSLA 2V9ZA 2ZP1A 1BEUB 2NSHA 3K9BA 1RPAA 4YRRA 5K51A 5JVDB 1L7EA 1JJIA 5A06A 1C0IA 1NX9A 1KAGA 4DAOA 1Q0QA 3LL7A 3EZ6A 2ZE7A 3IVGA 2KE5A 3MILA 1B42A 3WOVA 2AZTA 4AURA 3PFFA 4JNCA 1YIAA 3C7DB 1QS0B 3FCYA 1OU0A 5F3DA 4ZYXA 2G76A 5D5PA 5K8JB 2QLLA 2HBRA 2CDNA 4MKRA 2CNNA 2QBYB 3VYUB 2ZT6A 2ZJ6A 4L0DA 1TQ4A 2A78A 1DRWA 3AR9A 2WUDA 4IGFA 2ZYVX 1XALA 3OLXA 4LYJA 4OXNA 3KZ1E 1XYGA 2GBPA 2V0NA 3PLRA 2FZGA 1UBMS 4P2GA 3RS7A 3W1VA 1K97A 2WBLC 3TEJA 1N0HA 2B0CA 1UKYA 1HNNA 2JJ1D 4DIUA 4GXQA 1XTPA 1Z5OA 2XBLA 1FU4A 1QWSA 2GNOA 4C89A 1U2EA 2A33A 2XTJA 1A8PA 5CDHA 3IUSA 4CEIB 3GNQA 5FT9A 4LZWA 3T4XA 4J75A 4Q9NA 1U1CA 3DDWA 2ZLBA 4PBRA 1Q17A 2RI6A 1JQ5A 2N75A 3RAGA 5I48A 1R8JA 3CY6A 2GVZC 1K1EA 4F60A 5T3UA 3HCBA 1NQAO 3HI6A 5HIJA 3QEMA 2IPMA 2A94A 4Y9SA 4MDYA 3GQVA 3M82A 1OV6A 1XVIA 5CTJA 5JC8A 3B9RA 2VKQA 2ZZKA 1WDKA 2G8NA 1IL0A 2X0JA 1UOQA 3GELA 1KP9A 4P7GA 1XO1A 4PXSA 1XYYA 1RXSA 4G1MB 4IUYA 4PLYA 3VNUA 4BMZA 3S99A 3HK2A 1XAHA 1IG3A 2GLTA 4R1TA 2HZBA 5LUBA 1JSRA 4NCXA 3H9JA 5A5EA 5D87A 1K4MA 1Y9AA 5EC8A 4L95C 3ROKA 2JVJA 4RZQA 3C2QA 2JH8A 2ZJFA 1EMDA 2NTVA 2DY0A 3REFA 4BCDA 3PGVA 3UICA 4E2WA 5JXWA 1XZCA 4JJFA 3EXHB 2QPLA 3NHUA 1FRZA 1NLZA 2BFPA 3BH6A 2GH1A 3HWWA 1F38A 2II6A 4OYYA 4RNCA 4WZAB 4MQFB 4Y0VA 1AA6A 4MYRA 1KPHA 2R25B 4DEXA 1BQEA 1UMKA 2Q3MA 1WMDA 2R9VA 3UKOA 4NCIA 3ITNA 1TW2A 3OEWA 1G8FA 1X86B 2D7DA 4F3KA 5LVAA 2OMKA 4NMMA 3L04A 3VKVA 4XEUA 4BVFA 1SVMA 3CH4B 2ZU0C 2WUFA 3WBJA 4DWJA 3ZIAA 2HQSA 2NQ8A 2HCJB 1R0LA 1KO7A 3NR2A 4QOSA 4B76A 3COWA 1OTHA 2BMJA 5EOVA 1CY0A 2I55A 2WJYA 4H3VA 4Q7JB 1E7WA 5GINE 5HNKA 4KK3A 3EEYA 5DTMA 3P9IA 4EPYA 1GRRA 1VI5A 2TMDA 4TLLB 2YZGA 3I2HA 4YH1A 4R2HA 1JBQA 1J90A 1A2QA 2O2DA 1VPLA 2VH1A 2XMCA 2ZIZA 3CLHA 3LBHA 4OKIA 1ZP6A 1PT6A 1U9IA 3N86A 4ENWA 4U2KA 3N0VA 1W19A 2ZTHA 1FZQA 4BLVA 1TIKA 2WB2A 4X20A 1GN9A 4OHMA 2HWXA 5K3DA 4MK4A 3OE7A 3RFTA 4MWBA 4MIEA 4QHSA 4U2BA 1OX4B 3RD5A 3CNQS 1THTA 4TTQA 3VI3B 3NX4A 4LVCA 3F7OA 4IV8A 4CKBA 3G68A 1H8EA 3PUYA 4US1R 4HNAB 1JEAA 1IUOA 1YZVA 5HS6A 4Y2PA 4GOKA 2OXCA 5ALJA 1RZRA 5TGTA 1YHNA 1QKKA 4LQLA 5FLEX 4R0MA 2GD0A 3D5TA 4GG1A 4C0AC 1SNYA 3K5IA 4RLSA 4UZFA 5AKYA 3MSXA 1T9BA 3R9KA 1T9GR 3OQ1A 4BRZA 3LKZA 3NHRA 1J6UA 2JHAA 3BWCA 3DZBA 4GVLA 3O4IA 1SOUA 2VDPB 3TBFA 1L5KA 3BTSA 4DUGD 1VPTA 2VA8A 3OPYA 3TGPA 3E9QA 2QTLA 3ZX5A 1OBOA 5LQDA 4HLNA 1YJXA 3WGLA 5BNFA 1HQDA 1W4CA 4BO6A 4MZDA 1PYGA 1EZZA 1JG1A 4TMXA 4C7JA 3ETGA 3DW3X 3M1IA 1NUSA 2H4WA 1XQ9A 1IZ9A 2Q3EA 1DQZA 2XNCA 1O89A 1RHUA 2D74A 3GWZA 1LK5A 5I9MA 3SY8A 1Z34A 1A0OA 2D8AA 2RAPA 4WJZA 4DPLA 1E7QA 2WNSA 3CUKA 4TYNA 1WV1A 4L22A 5HDBB 2O2IA 2ZUFA 1JHOA 4BOYA 1N2HA 3SJCA 1X42A 2C9OA 5TGZA 1ZXBA 1NNI1 3CTPA 3KT3A 4ES6A 1FX1A 1A9YA 3O3OB 4DTIA 2HMUA 1JH9A 4OVKA 5EZSA 5I3CA 5FI0B 4JOSA 2PPLA 4GSKA 2GYUA 4ZK6A 1T6ZA 2Z6AA 1KK3A 4MQEB 1B6GA 4OATA 1UMCA 2FN4A 2P75A 3H6HA 4RO0A 4P58A 3ROTA 4EJ2A 5ERYA 1MOZA 2QLTA 5AK6A 4EPXA 2Q3JA 4ZI5A 2V4ZA 1LBTA 1B8UA 3LDHA 4LISA 3TI7A 2NNWB 4DG9A 3TLGA 3USZA 1I2DA 4RK5A 5DN6D 1GG9A 1CQPA 1ZNQO 3L1JA 3F46A 2DR3A 4L9AA 1JLSA 3QEMB 2PJRA 4ZMRA 3GG9A 4HNRA 1YE8A 3UAYA 1W85B 2C98A 3UEOA 1KPIA 4Q34A 1O4WA 2QORA 2WTBA 5CU7A 5EJAA 4G4SO 4K8OA 4Q1VA 3ACCA 4MYUA 2D3TA 2C7QA 2DPYA 3FCOA 1M1UA 4OI1A 4JU9A 4YMWA 4ZK2A 2BFBB 1DKOA 2JLWA 3D9QX 4GVPA 5TQ0B 1ORTA 3RVJA 5KSYA 1FFBA 3AR8A 4TS3A 4EFDA 3WSWA 1T3SA 5KYGA 1N6IA 1NYQA 1U28A 3Q85A 4KR9A 4K46A 4KYTA 2FSVC 3HDJA 1F7UA 3L6UA 4BAUA 4JI4B 1IBKB 3WNVA 4FYYA 4FHZA 5BSVA 5DM0A 1CETA 2WWWA 1H5NA 2P9ZA 5J4LA 2F59A 2H1HA 4AUEA 1H4QA 2VLIA 5H4GA 3LSYA 1PS9A 1O6GA 2P69A 1I5RA 4P93A 5EMJA 4DUPA 5CFPA 1F48A 4MUMA 1EVYA 3NHLA 1U4SA 5K6AC 2MMCA 1Z2NX 1S7GA 3MWYW 4WRRA 1FYXA 1ARZA 1S8NA 1E61A 3Q9UA 3NOQA 1G3UA 2FUG6 3LQKA 4I08A 2NO0A 5DHQA 3PXDA 4EHBA 1YS6A 2KWIA 1IN5A 4UNNA 4FEAA 1L7MA 4R1PA 5FPHA 4KVAA 1RWMA 2XXAA 1B23P 1C0EA 1WTAA 3AL3A 3DCNA 1C3VA 4G1VA 2BM8A 4NV0A 3SXUA 3TQSA 4ZT4A 1JJBA 1PTJC 3GYGA 4HAUA 1XLTC 4L5BA 2DTDA 2CDAA 5JANA 5K0LA 1MO4A 5EIBC 2QD2A 1TXGA 1GZ5A 1T2FA 2NT3A 1IWBB 5ENVA 2J3LA 4HXYA 3U40A 2DUUA 2D13A 2K2WA 1GL9B 3EJWA 5IWCA 4DNQA 2YJGA 5HQ3B 4TWIA 4QVIA 1N7JA 1W0JD 1QV7A 2JGAA 3EXFB 3EPKA 3JXEA 4TTTS 5E6UA 3RYHA 4Z51A 3D0QA 3PX7A 2IVFA 2YXNA 3PJEA 4KBGA 3ZBQA 4LYFA 3FYUA 4OUKX 4X95A 5E7MA 1UODA 1BKDR 2QTTA 1JHYA 3U44B 5JAOA 4L78A 3N2IA 4YPOA 4ZCQA 3FF4A 2WT8A 3TS1A 4GF5A 5FBQB 1DVRA 5C4IA 3L7OA 1OUMA 3H8JA 1JBKA 2ST1A 3HU5A 5CA0A 2HREA 4Z0HO 1KSGA 5ELLA 4EARA 4OBXA 5D7NA 4GHWA 4ZAWA 3T7TA 4B46A 1YOBA 3BULA 1NN5A 1L0BA 2Z09A 2XMDA 3E9ZA 3ZJYA 1UZUA 4WKCA 3REGA 1OTXA 3X1XA 1WPXA 2ZRFA 2Y05A 3H13A 1SOWA 4PX3A 3AVVA 4IMJB 4JDPA 3JD2A 3ND8A 3UIEA 1KAQA 3D4OA 5KYYA 2GF9A 3EB9A 2FMIA 2QPOA 2BVNA 1T1RA 3WLKX 2O8FA 1QU3A 4IQ4A 1RXEA 3ELYA 4TV8A 1AGPA 3MWDB 2WWIA 3KLMX 1WUTA 3FSEA 3ID6C 4C0SA 1RYHA 4Z49A 2B5OA 1TA0A 1KEPA 1U7WA 2BR3A 2FZVA 1OWNA 2UZIR 1V3VA 1X7YA 2F62A 3AEKA 4QDOA 4WH0A 2X5JO 4HHEA 1WF6A 5EIXA 4IDCA 4NY1A 4EYKA 4HQRA 3RWBA 3I62A 4DDKA 3ZTWA 3IC5A 1A5ZA 1J21A 3CWCA 4ZD6A 2GZ2A 4IVPA 3QGMA 4RM3A 1W0CA 1CZUA 3RTBA 4EHAA 2ATVA 2XKJE 1OVMA 4C4TA 1E9RA 4IKPA 3BG5A 1V2HE 1FCJA 4R9SA 3SX4A 3HXQA 3LA6A 4NFLA 1Y81A 3M8KA 1PUXA 2C8JA 1GKKA 3LG2A 4RL4A 1R5JA 2VZ0A 1B16A 1FTQA 3O94A 2OFPA 1RRGA 2X86A 3TAHA 4D44A 2MHCA 4QASA 4DBLC 2BGUA 1GGEA 1HURA 2PWBA 3TLGB 3VR6A 3FDJA 1QQ7A 3FLMA 2DHCA 4I50A 4RXUA 1M6VB 3NVMB 1Q19A 3DCJA 4ZFNA 5K05A 1K0FA 2HTFA 3LIIA 3SC6A 4XDZA 2JA1A 2RAFA 1UZLA 4M83A 5EXEA 1W1UA 3DHEA 4HI0E 1FFXB 3H99A 5KAMA 4PBTA 3T54A 3OZVA 1BVHA 4CZ2A 1EM8A 4HATA 4MVJF 3A4VA 4CETA 1GPBA 2XUJA 2IPAB 3ZU5A 3CURA 1DX6A 3QHAA 3C15C 5TQVA 3QA9A 1ZFNA 1E32A 2NX2A 1T15A 1D2NA 1K3UB 2Q6TA 5FWAA 4ALKA 3THYB 1RKBA 3O8NA 2QVGA 2C4MA 4M36A 3I39X 4PRZA 1QRAA 4CM7A 5C8DA 4CF3A 3LP6A 1PEDA 1SZJG 2VK8A 3IPYA 2ZVQX 2YW9A 4O1IA 4U6QA 3DWIA 1UBOS 2WJHA 5DM1A 4CN9A 1ZMRA 3AKZA 1OAOC 4H1UA 4P5PA 1RYBA 2OEPA 1G63A 4UU7A 1AMOA 1CYDA 2IJGX 3E9EA 5KOIA 5BXQC 3T1HB 2G4LA 2V1XA 3KYCA 2G08A 3C6XA 4KIGA 2R8YA 3B1KA 3DW1X 4P4GA 4K6CA 4UEJA 1RHMA 1ADBA 1G7CA 2GCEA 2RBKA 4B74A 1F4VA 1W94A 3RUEA 3PJDA 3IQGX 2GFHA 2IGTA 3BJMA 2VYVD 4GOJA 4IOKA 5TJ9A 3D8HA 2V5UA 3QA3E 3QPUA 1ZOSA 3N59A 4BC1A 1I9CA 1OX6A 2CLLB 2X6QA 4ZU6X 2H2IA 4B7ZA 3SXUB 3EBPA 5FIUA 3OLQA 5FWXB 5L53A 2FW8A 5REQA 3IP7A 1Z36A 2YIJA 4BJ1A 4AT1A 2GJ9A 1VCOA 4HRYA 2BFWA 3HYRA 5AXAA 1FQKA 1P2DA 1UEXC 2D5CA 4CFSA 4WIAA 3A4YA 2J1LA 5LZ4A 3K09C 4GM4A 2H8KA 1J2UA 3R0QA 1ODCA 2FVXA 1IY9A 2D1TA 3C98A 3IAM6 3NONA 4GGMX 5IRCD 4I9FA 2OCBA 5E6UB 2W6OA 4O8ZA 3AEZA 5E3JA 1CUVA 5ADWA 3BORA 2Y8EA 3KCNA 1NKVA 4WCFB 3WNDA 5JI3E 5KQSA 1GTJ1 3V9AA 2UUPA 2P1DA 2J0QA 3DDCA 1TTQB 3DXZA 5DULA 6REQA 1FP7A 2VATA 5HZHA 2ZWMA 3ENNA 4WOCA 3MN1A 1J8YF 4HX9A 1O6FA 4MV6A 1KYVA 4KHZA 5CA0B 1JE0A 1MX3A 3FVRA 4CL3A 2ZWVA 1FQOA 3PIIA 3NOXA 3HL0A 2QR2A 3OX1A 4O8CA 2NZUG 1IONA 3NBFA 1ZK1A 2ZJ4A 1MOSA 1HSOA 4BNKA 1EVLA 3JZIA 3VRHA 1U2GA 4YIHA 1TZCA 4LY9A 3TB6A 3AO0B 4OXKA 1NW4A 2VHVA 3MMZA 3E9CA 1OF1A 2EJVA 4UD6A 2ZRAA 4FSDA 1SIUA 2A9JA 5TMDA 1VYTA 3NS7A 4RS3A 2QF7A 4FINA 1PR1A 3OHPA 2ZVJA 2WFZA 3T1YB 1JI3A 2YV3A 4KBFA 3W8EA 5B4VA 5CVDA 3IAAA 2FPXA 3CTMA 2R84A 4OUDB 4Q19A 4YJ3B 3A8TA 4F7DA 5LC1A 4NF2A 3RC1A 1QNLA 2BJVA 3ADOA 4JP5A 4XASA 5D3QA 5TX7A 4PC1A 2HAEA 4IOLA 4ZAYA 3WLQA 2PX0A 4S2UA 2FRXA 4IXMA 5AM0A 3W1WA 3WBFA 1EG2A 3DYIA 1HZZA 1VG1A 4WPGA 1MEJA 4N82A 2DPXA 2Q21A 1CZKA 1U3DA 1S5PA 1DIOB 5JH7B 4YT5A 3TR6A 2PUCA 1XRPA 5B5SA 3ZEAA 2VZLA 2Y1XA 3HCAA 5A3RA 1XN4A 3FBTA 3SS9X 2F64A 3ME5A 3RQIA 4K40A 1IYZA 3ESRA 4MVJD 4NONA 4HZUA 3D1JA 4HTAA 1JU4A 4TVBA 2OC4A 3NI2A 5J58A 4I50B 3TK1A 1AHIA 2ZSDA 3PCTA 2Y0EA 1PV2A 4HKTA 3VOAA 2GPYA 1RADA 2CJPA 2J6IA 2CJWB 2ASVA 3LY9A 4XCXA 4AX8A 4KLZA 1L3CA 4FX2A 4UMVA 2XIQA 1F3LA 4OAOA 4CMAA 3T7KA 1SHUX 1EM8B 2JBHA 3EBOA 2PO5A 4N7JA 3HPQA 3VPAA 4GLFA 5F73A 3CR7A 1IPFA 1NRIA 3ETNA 2BTQA 4AKSA 3M1LA 4ZVRA 4UXHA 3KP1A 1MG0A 2J3KA 2ZBRA 3PD0A 2WT9A 5AJXA 5GWXA 4JP8A 4MYCA 2ZSFA 5JS7A 1XR3A 1NZJA 1JDSA 2F1OA 2OKGA 3ESBA 3U81A 4KWCA 4EY4A 2WJ3A 1TECE 2C9YA 4ICIA 2EOAA 2YICA 4F5ZA 1AHPA 4MV0A 1EDOA 1I0IA 2XXJA 4D1YA 5K3CA 4EO4A 4LOHA 4YECA 1T2CA 1C7RA 1UPCA 4MV3A 1AK9A 2FXVA 3WLSA 4NH0A 3DD5A 5LDGA 5L51A 1TPZA 2VNJA 1VFNA 1BYIA 4GUDA 5CLJA 3AR3A 5EEHA 3P96A 5AOCA 4OXRA 1GAJA 2FFRA 4FKMA 4AWXA 1L4NA 3NASA 2W42A 5H5JA 3A2KA 4N39A 5AI0A 3WFJA 2X8JA 3IE2A 5JFGA 1S2MA 2Q6LA 3TZCA 2AHOA 4ZP1A 3W8RA 1OWPA 3ZY4A 5F3WB 2NZWA 2WAXA 2Y1DA 3GDOA 1KIFA 1IEVA 3ZWOA 4BRWA 2O20A 1UJ4A 5HJ5A 2HHHB 3WO1A 5REQB 3V8VA 3CMMA 1DCFA 3AJDA 5BOSB 3CVVA 1ZUHA 4UE2A 4R1MA 1YL5A 3CPEA 3OIYA 4XOIA 3OU7A 1LRLA 2P9FA 3IHKA 3NHWA 5A4AA 5EP2A 1WLYA 4AF7A 1XJCA 2WKWA 2ZRKA 4IZ6A 1KDVA 5HOEA 1RQLA 1HA3A 4P7JA 1C7JA 2XB6A 1RWKA 1YR3A 3HHEA 3NYWA 2F3RA 1E9FA 4KQCA 2AOUA 5FI5A 4BFVA 4PGAA 3HKDA 4IXNA 1YMQA 1ZA2A 1TLTA 3N70A 4D0SA 2FYTA 3DBRA 4GFDA 4K0KB 4PPFA 5I7RA 3LLUA 4R8RA 1BE6A 1DHRA 4C9BA 3V4OA 3QQ5A 1Y1TA 5J2TA 1DAPA 1P1BA 4G9GA 5K0CA 2JFFA 4OQFA 3LDAA 4MRRA 1GLGA 4ND2A 1FJ2A 3CRW1 2DAPA 1ZISA 2Y0PA 4O3FA 5HW0A 3RC3A 3WADA 4WK0B 2OAP1 2X9NA 13PKA 1MAWA 4WNIA 1MJHA 3V2UA 4XKJA 2VQEB 3PHHA 5C5DA 2TMKA 1I2CA 3I6IA 3NWJA 4EKGA 3RKUA 3BICA 3HA3A 4OM7A 3HSSA 4AZTA 1G8JA 5BNIA 4G8CA 2X0DA 1A9RA 4E5UA 3OT5A 3R0XA 3K9HA 3RDPA 1QCCA 1W2GA 1BCSA 2Z3ZA 4JHXA 5KTOA 4QXPA 4PX5A 1K88A 1MHTA 3NWBA 3OZFA 4PIMA 5ERGB 1M1XB 4JIGA 5FBWB 2UYYA 3Q3VA 3ROZA 2JAWA 2W4IA 2NTNA 4CCYA 4IQ8A 1E1LA 1Q21A 1TA9A 1E9AA 4GGOA 4HGQA 1G8KA 3AHIA 1ESDA 3EZYA 1I4DD 4JC5A 4KVGA 2PK3A 4LGMA 1E89A 3MPOA 4XJXA 1EJ2A 2OV2A 2FE1A 3PDIA 4FVTA 1TIPA 3OO0A 3VNSA 1QONA 2QD4A 4H6VA 4YS6A 4HH4A 5E4TA 1FSZA 2NZXA 4MYDA 4B8ZA 5HOQA 1NMYA 3X3HA 2IIVA 1WABA 2X8LA 2GOYA 4MUNA 3ANLA 5AKEA 3U39A 1AG9A 4BQEA 2I78A 4FNGA 5ILQA 1M0TA 1ZJWA 3QVLA 4FGLA 4WGGA 2NNLD 5EJEA 1VE5A 1JLMA 3VR4H 2PUDA 4XYMA 2Z98A 2PV0A 1AQLA 2FN8A 3OX3A 4L1KA 3ZXIA 5FWNA 1FTNA 3ML1A 3IL2A 3DKRA 1UJ6A 2Q0XA 2WOJA 3W6UA 4LHZA 3UWOA 3AKDA 3DB2A 5LYYA 3U4MA 2Q3DA 1K7XB 3GLVA 1LPSA 1HDIA 4JUCA 1G0OA 2M1ZA 2G4CA 3CZ9A 3W7VA 5CFMA 2VNKA 3MUNA 3SHTA 3NHZA 1E99A 4A92A 1XGKA 2QL9A 3GJ3A 3IEVA 4DS3A 4AO7A 5K03A 4NBWA 1UKBA 4MZXA 3BYZA 3OTHA 3IAXA 4XYGA 1ZJYA 2HIGA 4EDFA 4P3NA 1QG6A 2IV7A 1JZTA 3TW6A 1UAAA 3AF0A 4MV5A 1XZNA 1NRWA 2KPOA 5KQLA 3N7AA 2QOEA 2XSZD 4URHA 5E8JA 5L3SB 5KSZA 1I30A 6ABPA 2ZYGA 3F3YA 1AKRA 3O4RA 3QLTA 4JODA 4CMIB 2REBA 2HH9A 2WTUA 4BEBA 1ANKA 2HPVA 1EG7A 2Y3IA 4PICA 2YN0A 3K32A 4L4YA 4GZMA 1WKVA 5FA6A 3Q4GA 2B6HA 3HDQA 2WSLA 4A0GA 3LWNA 5IFKA 2NMVA 1YDWA 1SVWA 1G5IA 5FTWA 2PKRA 4GMFA 1AKUA 1G0NA 2NVUA 3GJZA 4KQEA 4R84A 4E51A 1XDBA 4TL9A 1GFWA 1X8KA 2C2GA 1U0EA 4IP0A 3UMYA 1ZMTA 2H2HA 3VKUA 4J0EA 1GZHB 4WDRA 3B3QA 1FDUA 3VVBA 2GD2A 4KO8A 2UKDA 4WADA 3ZY5A 4R40A 5LZ8A 1GRVA 1XI2A 2ZUCA 4JAVC 2ATCA 3IE0A 3THWA 2O8DA 1MAHA 4O6VA 3V6MA 4LV6A 2P6OA 1M8JA 3O2SB 4M1YA 2O8BB 2C3MA 1U7XA 3PWTA 3SVTA 2NLOA 1GTRA 1F0NA 5JISA 3HKDB 1YVPA 2PZAA 5AK4A 1ODTC 2Z2ZA 2VT3A 3OD1A 4UBIA 5DN6A 3DBRB 4O2BB 1E1CB 3PQ3A 2HJSA 3WRXC 3MJ4A 3SFVA 2QGFA 3TPZA 4ISBA 3T7SA 4QATA 2AYXA 2GEDA 4FGZA 1TLLA 4G26A 4GKVA 4CKXA 4PXYA 5A62A 5HKAA 3L8EA 4Y3UA 5LN1A 1VSBA 4J16A 3V1MA 3D1VA 1QG2A 5A3SA 3VFDA 2P5SA 5EXPA 2VAVA 3KJIA 4RYDA 4U7GA 2QN2A 4IDQA 5ALMA 5J1SB 4PTLA 1SCIA 2XOXA 5HIKA 3DBIA 4RA9A 1P3Y1 2XUOA 3NDIA 5G40A 1GPLA 3WIEA 4BS9A 4JA0A 4KREA 1Z25A 5DSTA 1U7DA 4GX2A 1OKKA 3V34A 2AF4C 2NXNA 4EG6A 4ZHQF 2O2GA 3ABQB 3KOYA 3P5BA 1F14A 1LPMA 2ISSD 3PNSA 5EZ5A 5JO9A 2UXDB 4AS3A 5HUQA 1JE1A 4DQKA 1WOYA 1X7XA 5F9HA 3WWEA 5LNK1 1GUZA 4KBYA 1RC1A 2B4AA 5A7HA 5DT9A 1CDZA 2CXUA 1RM5A 1WPRA 5BYJA 1QYVA 3K2IA 1V7QA 3MMXA 1OYOA 1MDFA 2AFRA 2GQ0A 3K9NA 3OU2A 4DRXB 3OECA 3UOGA 2ECOA 4Q3CA 3IQEA 3HM2A 5AKHA 5ICEA 4AY3A 2G70A 1TAHA 2I34A 3KD3A 3KAPA 1CTQA 1LZLA 2H85A 3S1AA 3G2PA 3R1IA 4GRDA 4CKEB 2QRQA 2IUUA 3HWRA 2HJVA 4F21A 2GEVA 5DNVA 5JMPA 1U3CA 3HCRA 5IHXA 3FNGA 1JSXA 4G9EA 2GA9A 3VSCA 4HVTA 3OPNA 3O9MA 4PG4A 3KCQA 2DQYA 2VL7A 4XLTA 1D1SA 2JFXA 3LCUA 1H1LB 1XE3A 4JHLA 1R7RA 4LXGA 4DC9A 1PI3A 3PVZA 3IP5A 3FKQA 3V8EA 1HV8A 2Q3BA 1W0JA 4Q24A 4V24A 2XWQA 3EMBA 3H18A 4IH9A 1ESMA 4AM8A 1M1NA 3BREA 4BGEA 1VIMA 1IK4A 5C7LO 3HFRA 1R0BA 2IEYA 2CWDA 3DFUA 3DDZX 1YZLA 1P4HA 1H1DA 4IUDS 1A71A 2H4ZA 2X3UA 5KC8A 5F35A 3F1KA 1V1RB 4ND4A 3R5XA 2JGIA 1Z0ZA 3DC2A 2I3ZA 3VYWA 2DCUA 1GVNB 1PKEA 1UK6A 2RGWA 1Y5MA 2XYGA 1A3CA 5EIAA 5JCZA 2I4RA 3DL7A 2V45A 4M9SA 5JAPA 4TWBA 3D1LA 1CR1A 2PRJA 1IZ8A 2NU7B 3K05A 1EUDA 3AX6A 3HB4X 5J5VA 1YS7A 3SGLA 2CV0A 4LEIA 5KNCH 1TDJA 1WSDA 4FMPA 4EUHA 4DA7A 4O4IB 4WKNA 1TAUA 1LPPA 3I92A 2WVHA 2IXAA 3KDPA 4D80A 1GTSA 2IE0A 3AUJB 4RENA 1ZM2A 1SBIA 4K87A 3VZRA 1YOVB 3HFGA 3V97A 2QNRA 3L8CA 4K88A 2J5KA 2CMGA 5JSHA 1ZA1A 3P32A 1T5OA 5C0OE 3OLWA 2YHSA 1I6LA 1U4NA 5DRYA 5BSEA 5IANA 2ZVPX 4IV5A 2QY6A 1Z9BA 3PR2B 3STVA 5BRAA 2NVUB 3VZBA 5DNAA 1TF5A 3W34A 1QHYA 2J3MA 3I9V1 1Q83A 3P45A 5FUWA 2CZQA 2V96A 1N6LA 2YOGA 2ZIXA 3S81A 4BDTA 2O6HA 4X1OA 1WXWA 1OIWA 4YRKA 1LB1B 2JKYA 3NYIA 1B4DA 2XJ9A 4LYGA 3WGNA 2O0LA 4G0OA 1D2RA 2MJLA 4NI5A 2A5YB 4U39A 1DIBA 2GO7A 1JDNA 3SZMA 4O4JF 1CLUA 2D06A 3KQNA 4E6EA 4P4SB 3P7MA 4ZVVA 5IJ0A 2I03A 4N0PA 2C2ZA 1JQBA 1EK0A 1HLFA 3K4PA 3GDHA 4B44A 2JCGA 1LLUA 1XJWA 5KNBH 4B3TB 5P21A 2O05A 5F51A 1E9DA 1U2ZA 3FF1A 3PT5A 1TM1E 4LF5B 2Q5OA 2CW5A 4L8YA 2D62A 5UKDA 2PT7A 3M5WA 2QDXA 1Q6ZA 4NYMQ 5E4YA 3ROPA 4M37A 3DH0A 3K1ZA 2JIRA 1NMQA 2XWSA 1KP2A 4TN5A 4OKNA 1AZWA 3C48A 3LW8A 3LT4A 2CD9A 1ODFA 1TMKA 3GNSA 2CHEA 2CXSA 4PFKA 4CTOA 4O1HA 4HDMA 3RRYA 1KEKA 4AJIA 1XIVA 2VPTA 2ZYAA 5CBPA 3ZWKA 3K5PA 1KJQA 2XNJA 4J9VA 4WEOA 1AB6A 1X2BA 3MF4A 4AP9A 2PUGA 4WV3A 3WYFA 4BCBA 2HDWA 2UYCA 1ZDMA 3TW4A 3VISA 1HQCA 3HKCA 2GD6A 4ENRA 5HKKD 1X7XB 4D3FA 5B1DA 4DYHA 4QYIB 3OMXA 1D2HA 1M75A 2SHKA 3E9DA 4ZJYA 4PHGA 2QV7A 4AW9A 1OVGA 3CUEF 2WPNA 1YMUA 3IESA 1MTOA 1PJ3A 1ULTA 1WD7A 2BAGA 1DAFA 2WFAA 4KX3A 3TEFA 2V7TA 3KYDA 1L5GB 2G5TA 4DG5A 1IZ0A 1VLQA 1H3FA 4WBNF 2O2EA 3AIIA 4I1UA 4JJIA 2VYVA 2OHGA 4ZVQA 1R0KA 1BW9B 1DDOA 2WYUA 2X13A 3OQOA 2BEKA 3M5CA 5KWEA 2EX4A 4GPAA 5DBGA 4PWYA 1W9HA 2ZI3A 4DMHA 3SR4A 3E1GA 3G88A 4DDTA 4A1OA 2XIJA 3BJIC 4OXIA 1BHJA 1PL8A 5F4BA 4ZICA 2ALJA 5LBUA 4V0SA 4BDSA 3U7FB 3ZUGA 4F3TA 1D2EA 4RF3A 2NADA 4L0CA 3TAUA 4DLRA 4XI9A 4LJYA 3PXBA 1II8A 2P0YA 2B2XA 3ETJA 3PF8A 1C3OA 1TZMA 4OP2A 4ALLA 4JD5A 4CKBB 3I5XA 3LV8A 3DB1A 1JS1X 4RAOA 1NVVR 2AQKA 1KO1A 2QZ9A 2B7CA 2UZ0A 3LYHA 3OI7A 3OCVA 1L7DA 2ZREA 1QX4A 1DWOA 4WNCA 3F97A 3JQ6A 4TL7A 4AMYA 3USES 5IKXA 1M2VA 1OXXK 4LZAA 1CHNA 5H70A 3RYFA 1VDMA 1QC5A 4AAYA 4D82A 1UC8A 2HTEA 2MYPA 1ZVQA 4M8KA 4BX8A 5AW8A 3I2GA 2X4LA 4G36A 3IJ5A 3UAGA 3FLAA 3EF0A 3T9AA 1GG8A 2GRAA 5JADA 1IXSB 4US0R 3UB3A 2Q49A 2Q5QA 1XV5A 1FSFA 2ZU6A 3CO5A 3JQ7B 4QTUB 1EUDB 3D6HA 5LYJF 5DWDA 3TO5A 2A9KA 3UC5A 5F7OA 4QFDA 4YP1A 5E3HA 3EDCA 3O93A 2E5LB 5SY4A 3D8SA 1Z2PX 2QNBA 1RLJA 4AZ0B 1ZD8A 2EZ4A 3T7EA 4B4DA 3RRNA 3CNNA 3JRXA 3PPWA 4G0YA 4GWLA 3ZE6A 1BQ3A 4AKIA 4R9VA 4G3XA 4ZDWA 4PYJA 5ALLA 4P0QB 4U7FA 1OGJA 1HE2A 4K9DA 4QJIA 1FFAA 4UQOA 3L40A 4D99A 1PWEA 1B26A 1XD2A 2FNAA 1P31A 3CUTA 5JALA 5B4TA 3EG9B 2GSDA 1Q1EA 4WW0A 4WKOA 1PGNA 1Z4OA 3WMRA 3C39A 5GM2A 5SYMA 2BMWA 3FM9A 3ZVKA 2G1KA 1LLDA 4ESVA 2J9YB 1XA4A 3H1AA 4JLUA 5FB3A 1ZL2A 2UVDA 3G6KA 3SKVA 1GNSA 4N3BA 1Y7TA 2Q4TA 3SDBA 3LUJA 4PTZA 3WX0A 2WY2D 4ANFA 3C6MA 1K66A 2GLUA 4PS0A 5TT1A 3S2UA 3O2NA 3OCZA 3C6YA 4QWMA 4TZ0A 4QQNA 3AV3A 3R6DA 3JYLA 4H4CA 4UVHA 1N4AA 2HBQA 2P0EA 1RDFA 4RSRA 4LBYA 1CWUA 2V65A 3OTOB 3PGJA 4RY0A 3ED5A 4MVJA 3ZS8A 3LWDA 4FZ5A 5IJ0B 1JHPA 5DGIA 2C7VA 5ALGA 3V8BA 2O8EA 1OWLA 3R2JA 2DCMA 2JVKA 3DBLB 5JD6A 1ID8A 3TOCA 2PU7A 3UJAA 3WKEA 1DX4A 4Q1EA 1EWVA 1VPVA 4CBVA 5IG2A 1I7QB 5EKDA 1MB3A 1TFUA 4V1CB 3CJRA 4GU5A 2HSDA 5EJ4A 2G83A 3QUSA 3IVAA 5D3KA 1KEUA 4D9MA 1SY7A 2BKVA 4DMCA 4HX5A 4L2IB 1OPXA 4MIOA 5DE3A 1U1FA 4DA9A 1FNSA 4WBSA 3D81A 3COYA 2BHSA 3G23A 3MSCA 3MW8A 3N6XA 4QGGA 3RQSA 3DMTC 1QAMA 4IIVA 1YUMA 2CT8A 1H5UA 2K4MA 4DLVA 3BJRA 3L43A 1Z63A 5IASA 3FSGD 5L3RA 1VI6A 1NURA 2IEAA 3KZOA 2WHEA 4RMJA 4DR1B 1OYYA 2QYSA 2YZ2A 2LIVA 2V9CA 2G9UA 4H6PA 4BLWA 4DCCA 2ZJ2A 3MCZA 1DX9A 3I28A 4RKEA 3ZWNA 1WXQA 2EL9A 3O4VA 2EJUA 5JAUA 1T0JB 1I36A 1O0BA 2COUA 3QSGA 1ZAKA 4OHUA 5DBIA 3TMAA 1GU7A 3ZCQA 1OWOA 5KYWB 3GJ0A 1Y0BA 1O2DA 1XLTA 1LPNA 1KDPA 3BF8A 3HV0A 3KZNA 3OF3A 1F8UA 5FUVA 1O6BA 4ZQGA 2ZS8A 2KI5A 2MYTA 2RHLA 1KYYA 4E2ZA 1L5HB 2BFNA 4CM8A 5TE9A 3X2EA 3EQ9A 4KFCA 4P3PA 1I1HA 2HDOA 2QG4A 2AK3A 3C5HA 4TQGA 2YWXA 3PC8A 4M8SA 4E03A 4XCQA 4EVRA 4IY1A 3GFPA 4KITB 4G2TA 4HRXA 4IDDA 4BMDA 4QOFA 2QR5A 2WYWA 4Q4CA 5KOJA 3C97A 2FSSA 2E55A 2NAFA 2OORA 3EZ9A 3RTDA 2G72A 1N1EA 3WLPA 4DNFA 1XLWA 2ROQA 3KLPX 1ODLA 3E84A 5HIIA 2VBIA 1NQWA 4D0GA 3TLCA 4DBLE 2VPIA 1YDHA 2YY6A 1WW2A 4FILA 5KNDH 3KQOA 2HA2A 1PBTA 3X2SA 4PG7A 5HF9A 4UDOA 4D6YA 1O96B 2HU7A 4K5QA 3W6NA 4DOMA 1Q1AA 4TZTA 1GXSA 3HVIA 1PS0A 3G5TA 3U9SA 4AMBA 4M1EA 1JAXA 1T1JA 5MDHA 2VAMA 3RYFB 3C14C 1CRWG 3IMFA 2Y6VA 3OFND 3AI7A 4DAEA 3LHFA 4LJSA 4BZXA 4Z8YA 4AQ7A 2ZFUA 3FDIA 3DEKA 1J9EA 3O75A 1BU5A 2R85A 4MYHA 3BCUA 2V0GA 4CPDA 2ACEA 1NY6A 3KLNA 1SCDA 4PYLA 3GH3A 1GEGA 4B83A 1J42A 2ZSEA 4BMCA 1XNGA 4YMIA 1UANA 2FQ1A 4AJJA 5JHGB 4MV4A 1AGXA 3P27A 2XE8A 1UM9A 5AK5A 3GIDA 3B5JA 3DV0B 3H97A 2GJKA 4WXYB 2JIMA 3KKLA 3L7CA 3KV1A 3BD6A 2OM2A 1NF3A 3AKCA 3AI3A 5H83A 1Y48E 1MQ8B 1T3TA 1E94E 2Y0DA 2EEPA 3ZH9B 2Y1EA 2EVWX 3OCJA 1CEEA 1BZYA 2ZAGA 3GJ8A 3JWGA 1N2ZA 1NW9B 2E2WA 2PA0A 2QAIA 2ZB2A 5CK5A 4LBVA 3FDZB 4OG2A 1JIIA 5FNVB 3UT0A 2WQ7A 1DELA 2FPOA 2X2FA 1T3HA 3F90A 3HBLA 2P4HX 1C2TA 3T0IA 4DV2B 4L3WA 5CPBA 5KZMB 1QHIA 4UUBA 3VPCA 4BNDA 4J1QA 1DBIA 1T8TA 2EKLA 1ABEA 3MTGA 5CCEA 1AQYA 4YHHB 1MO5A 2HC9A 2H31A 3JZDA 1JVNA 4GS5A 1T8UA 2C99A 1U6JA 3QOFA 4YXWA 3OKAA 4WFKA 4YT8A 3MT8A 2H1LA 4HNVA 2JC3A 3E5RA 2HHLA 1QE0A 1DRKA 1T9CA 2ZETA 4KCGA 4S0XA 2J6HA 3U1TA 4A0HA 5IX8A 5K0EA 3S44A 1Z75A 2R66A 4LI3X 3EOAI 1ZYUA 2WTNA 4NCKA 3FFWA 3BE5A 2OXFA 1OR8A 1IJEA 2O4UX 4KWIA 3NB0A 5LU9A 1DAHA 2JLXA 2XA9A 4PGGA 5CNMA 3ZGNA 2FSFA 4FYWA 4LRWA 2IDMA 1EQ2A 3DSRA 3OWOA 1PFWA 1ECCA 2JJ8A 1OAOA 5JNTA 1ML4A 2C88A 2FPWA 1U02A 4LJKA 4YN3A 3DGEC 3V46A 3QELA 2KYRA 3EDOA 3TYXA 3ZD8A 1DHTA 4NBUA 4G4GA 4L08A 3LTEA 4AFNA 1UP7A 3VKHA 3ZD9A 2HPZA 2BGNA 1H9AA 4W1SA 1SCNE 2E5WA 2TRSB 3NIBA 3AIKA 3M34A 1ZW6A 3BHJA 2XSZA 1ETUA 4V0NA 3ZWWA 4UMFA 3CZ4A 4FNOA 2X7JA 3FE2A 3ROMA 1PL7A 3P0EA 4C7VA 2BKAA 2CZCA 1SK8A 5ESWA 2OGSA 4WMLA 2JK0A 3ENQA 4QQFA 1CIJA 4G1FA 3HJCA 3WK8A 2NZJA 3C3PA 1JTEA 4G0WA 2FZLA 5BP7A 1SUEA 2B9VA 3UFBA 2COEA 1QNFA 2GBFA 3WWCA 5JD5A 5CX4A 2R1TA 5AJVB 3IEMA 1KZYC 1G21E 2X14A 3PUKA 3VOBA 3W79A 1IY2A 1YV9A 3K09A 3HPRA 3T5CA 1N2CA 2Z1MA 4BQNA 4AIIA 4RV9A 1L1QA 2BLNA 2I3AA 3ZHBA 4DMKA 4YGXB 3UGKA 2G71A 1KY3A 4KQHA 4C4OA 4C0WA 1J0EA 5DIFA 2APJA 1ZCJA 1VKJA 4QTXA 3D6AA 3NM5A 2J8ZA 3FWNA 4W1PA 4FB4A 3IUMA 4ZJPA 4O2AF 5AVQA 3PRJA 1FP1D 3VNRA 4UAJA 4YWHA 4KPYA 1YZ3A 2ORIA 3G0OA 1VKHA 1C9KA 1Z0AA 3G85A 3ABIA 5G1PA 4RTOA 2B8JA 4PNPA 1Z5NA 2ESRA 1EX7A 1HRDA 1W47A 2A30A 2ERXA 2OCAA 3D3WB 4WZBE 5DW0A 2IHTA 2BZ1A 3L0BA 3C87A 2JAPA 2X6RA 3GLRA 3JTEA 4JH0A 3Q1LA 3GUHA 5HM8A 4DUYB 4B6PA 3IXLA 2GPWA 3TFQA 2C5SA 5BW5A 4Q3KA 3PUIA 2RKWA 2JANA 4COOA 3RSZA 2HX1A 1S2NA 1M2OB 1W5AA 3LC1O 3SXPA 4ZIRA 2QW8A 3HWSA 1F1BA 1PFKA 1XN1A 3DKIA 2QX7A 5CEFA 1KQGA 4QJ5A 4N3NA 3IOMA 4EQ6B 2N47A 1HE3A 1E2NA 3E58A 5SYAA 4W1RA 5JE8A 3Q0TA 2CF6A 4R16A 3NBYC 1A7KA 1LC3A 1E69A 1CVRA 4WNAA 4RKFA 1OXTA 3WIDA 4C4SA 4BX9A 1H3EA 2XUZA 3VZSA 1XMJA 1URPA 1LBHA 1NZFA 2BFFA 4FR2A 1P6XA 2WD7B 3K2BA 1NSTA 2H7VA 2WLTA 1VOTA 3DQQA 3HN2A 4IOJA 1VG8A 3FRJA 4OY3A 2VK4A 4WESB 1T4MA 1J0CA 3O8OA 2YN4A 1YBFA 1L5WA 5A2QA 3OQVA 4U2GA 3FPLA 3LE8A 2CNDA 2FQWA 1P19A 3WAGA 3BXZA 4B47A 3KC2A 5JCJD 4BNDB 4X97A 3WGOA 5AJHA 3DVAB 1FFEA 3QVXA 3WLJA 1MTZA 5IYZB 5EA2A 1EFKA 1HNXB 5ICFA 4MR7B 3IIJA 3PUZA 2Z30A 5L7TA 5AT1A 2JLYA 5E2IA 5JLAA 2BE7A 2HF8A 5B1HA 2IZ7A 2CLCX 4M9CA 4BFXA 1BX3A 4TX1A 4GR4A 4U7TB 2XUPA 5JNLA 1ZU4A 3A0RB 5DHTA 2VDMB 3LY8A 4H35A 2PL5A 3DAHA 3MWEB 3H1GA 1NXTA 3Q6MA 4LDJA 3DE3X 1V39A 4HYQA 3WIUA 3V7UA 2EBFX 2EWVA 3J7TA 3OFKA 4HBZA 3IV9A 3AK4A 2F1IA 3LO8A 4H4EA 3W77A 4ZVSA 4J7AA 5FULA 4HLUC 1WKCA 3ZQ4A 2YMMA 2X5KO 1ZVVA 1IBSA 3QKSB 4W63A 5DLPA 4AL4A 2F43B 2HSGA 5JFTA 2CMKA 2FF5A 7YASA 3JR7A 3EF1A 4WXMA 2XZPA 1YK1A 3QELB 1JJVA 1BXGB 1EX6A 2WAMA 2C31A 4EG3A 1Z3CA 2RH9B 5B3KA 5IBQA 5DISB 5LQUA 2H0RA 4NAUA 2N46A 1C3EA 2ORYA 4BGDA 3K0AB 2QIPA 5D3MA 1FEZA 1YI8A 4JQSA 5FA8A 1P45A 5CGZA 2HJGA 4IJUA 3AHCA 4DSUA 2VNHA 2XCSB 1KEZA 1PQUA 1A8UA 3HZOA 4BPRA 3ZJ5A 1RLMA 3PQ7A 1H2HA 3EYAA 1T1SA 3SYTA 4DCGA 4LOLA 1BD3A 2J5BA 1UM8A 1YR8A 4C5BA 1E3QA 3UJ3X 2FKNA 1AXEA 4F72A 2XCQA 3DR5A 4JUBA 3EGWA 3LGSA 3K6SA 1EU1A 4EPRA 5EHQA 4K9LA 5IUJC 5HA5A 3FR8A 5I7VA 3BK2A 4WN9A 1DJNA 4Q47A 1M76A 1QP8A 5TT0A 3LFTA 5EIOA 3AHEA 3WQBA 1PG0A 4C4ZA 1U9YA 1SIWA 1MJFA 4LJ5A 2HSZA 3P52A 2CVZA 2DT5A 3D3QA 1UPUA 2HF9A 2JW5A 4LOJA 1MKYA 4L4SA 5E4FA 3WG9A 4DHWA 4MDHA 4CLOB 5DTIA 1L5NA 1XZHA 3S68A 2SCUB 1ETHA 2FMHA 4ECEA 3VPDA 1YWGO 4P86A 1C14A 1KYWA 1ST3A 2C1ZA 5A3VA 3R9XB 1C50A 4DSTA 2FY8A 3HMQA 4YQZA 3U9TA 4RULA 3AFNA 3EVZA 4HX2A 2Q9CA 1JFLA 2XH8A 3JQAB 4YRCA 4E4YA 4BJHB 4EABA 4DSOA 1V11B 3GPIA 3ENWA 5EPUA 4AN4A 2XDYA 2C2HA 3QPCA 4HYTA 4BU0A 1ULHA 2YRWA 1L5OA 3FFXA 3VSDA 4B5KA 2JHGA 2OD2A 3VO9A 3M6MD 4HPWA 4ARUA 2XZTA 4ZHQA 3CT4A 3FHLA 4RSMA 5ARCA 2JBAA 5HE9A 3E70C 1U0JA 1SU8A 2CWWA 3BCRA 3LBNA 2R47A 2BKUA 2R751 4NMXB 1KSHA 2YWRA 1B1AA 3U0VA 1JR6A 4R1LA 1DBPA 1G21B 2AJCA 3ILXA 4ZQFA 2QU7A 3NYRA 5HUJA 4U0KA 5AK3A 1C0LA 1YRQA 1RAHA 4DREA 1JDVA 2FWAA 3BKXA 1TO6A 2C96A 4U8GA 5B2FA 5J4YA 1ZUIA 3MWFA 4PWZA 5C5IA 5IDWA 1C8LA 3BH7A 3EZFA 1OLXA 3TUIC 4LX8A 5D1HA 2DLDA 4KC0A 1O6ZA 2WSYB 3L0IB 3M7IA 3NWOA 2QLFA 4FGJA 4QL3A 1D07A 4RY9A 5HKKA 3GOQA 3F5QA 3UATA 4FWBA 5KJ6A 1H0KA 1RYFA 1WCIA 5KTSA 2O3UA 4HDKB 5LJLA 1L7VC 1EEXB 2PXAA 4ER5A 3F6BX 4LZOA 4UCQA 1NYLA 1R5NA 2JAUA 1FNBA 2QN3A 3FPKA 4FLFA 4OLFA 4DLLA 4EMSA 4DDVA 3IAFA 3AIMA 3KVVA 5JQWA 1KJZA 1V9SA 4P6VF 4C04A 2XXBA 4XTRA 1BHSA 1A9TA 1NONA 3HV2A 4YXFA 1BHO1 1RWVA 2HA6A 4WZBB 5DDIP 3D59A 3L4EA 2JHFA 4RCZA 2OV8A 3ANMA 1FJGB 1J2TA 1V8DA 4WNYA 3GDWA 4ZT7A 2JL1A 4PLWA 4WI1A 3GPBA 3V4ZA 3U1VA 4HL6A 3ETDA 1QYIA 3PWZA 3QLUC 1O4VA 4RGBA 1U2SA 5ALUA 1LZKA 2EBUA 4A91A 3JQ8B 1UFVA 2FOIA 5F2EA 3EVEA 1PU2A 4C4YA 2HXGA 3I72A 4IR7A 2A0KA 3W5VA 1GTG1 1P1HA 1XDSA 1ZL0A 2PX6A 2QTAA 1VE6A 2AG5A 3FETA 4D98A 2MSNA 1EB8A 4LRSB 4LY3A 4YP7A 4EGQA 1VJDA 2P3LA 4UE3S 2Y92A 4BFSA 4Z3KA 6GPBA 3HNOA 1X6VA 4ZAGA 3S6JA 1XVVA 1P7VA 2GK6A 1S3IA 3W9UA 2H1VA 4AB1A 4G1EB 3R6WA 3RFFA 4HGNA 2WD8A 1NDQA 1E3IA 2WILA 2QL7A 4MSUA 1JQEA 3BB3A 2QN9A 2VQ3A 2GGSA 4FMCB 4WZZA 4ZXPA 1QH1A 3JARB 1CQXA 4HDSB 1ISPA 1BMTA 1SG9A 3JATA 4OXQA 4YRDA 5JARA 1RWWA 4BKPA 2ZQZA 2YNMC 3I1YA 4ALJA 1EFUA 4BRSA 2W6PA 3MM4A 3TZ6A 3DM9B 5D3MB 2WINI 4F4UA 1QG4A 1L9XA 2HL6A 3E7DA 4F71A 3EPLA 2EW8A 1YRAA 2G06A 2UV8A 4B9AA 4X6YA 2GCGA 3PC7A 2H2GA 1M1YE 4URYR 4XFKA 3PEWA 3CLTD 4PYKA 3ZHOA 3I04M 1LFAA 3TVDA 3O8QA 4ITRC 1C9DB 1NE7A 5L7YA 3BMNB 5A3QA 2OQVA 1VLVA 3AILA 3VZCA 4WY8A 4UTOA 2FGKA 5ADVA 2ZR0A 5ILGA 3SSNA 5HJEA 2O50A 2BMDA 2ZRIA 3M9WA 3PXXA 4HGRA 3GOHA 4LY6A 2Y1WA 5FBKA 1O54A 3ACBA 1L6RA 4QPPA 3ZKWB 3U16A 4AJPA 2RHWA 5LOVF 1MX1A 1XZEA 1XTVA 1U0NA 4O4JA 3A6ZA 3OIFA 4I6GA 1Z16A 2FWPA 3AWDA 2Y4OA 3AI1A 2BFCB 2J45A 2OGTA 3HZHA 3MMSA 1Q1GA 3O7WA 2F55A 1KI8A 3HFJA 3WXBA 1IK6A 1VCIA 4P84A 2IX9A 2HA7A 1PJCA 1IOLA 3CVUA 5BRNA 1F0KA 3GAFA 2GXAA 4PFJA 2XA2A 5FAKA 3DE4X 4HMOA 1PZEA 3RAJA 3EEBA 2ZRPA 4A8JC 4F6RA 5KYNA 1WBJB 1UP4A 3KPUA 4PSVA 4DWWA 2XNSA 3S55A 2LP4Y 4ZT6A 4F6CA 4FPXA 2X77A 4TTJA 3U19A 4JJ6A 5H9WA 3JWPA 3WYAA 5I4CA 2FP3A 2A1TS 2AN3A 3E53A 4J03A 2PNJA 3VV2A 4CT0A 4F93B 1Z07A 4JBXA 4HO1X 5DX1A 2IOQA 3BD7A 1QV6A 1OFHA 5ICSA 3ZBUA 4NNPA 1ACJA 2ACWA 2ZBEA 4FONA 4JR2A 1TTTA 3BFVA 3O4HA 1PJTA 1M5TA 2V1UA 1YL7A 2EFDB 5AM2A 2ZJ0A 4Q02A 4I1RA 2BEWA 2IXFA 2RB4A 3LQQA 5BWMA 5AW2A 1ZR2A 4QDJA 1RVDA 2O7QA 2PHZA 4ITVA 2XB9A 3KXPA 2DB3A 3B6IA 4Y2RA 5CP8A 1XXHA 2E0IA 3LFUA 1BGWA 3S28A 4DIFA 2YJNA 1LTQA 4DJEC 3KWLA 4INZA 4UW9A 2YYZA 3C3DA 2GKOA 4Q01A 1R00A 5BWNA 1FL9A 2QB5A 3EW9A 3OA2A 5C80A 4G84A 9ATCA 1G5HA 2AWOA 1A5AB 1VLMA 2P2YA 3MUFA 3KZKA 2VDLB 4WBNA 5DHSA 3DTVD 2R6AA 4C6HA 1IXYA 3KAQA 4MNTA 4HXFB 4Z54A 4A6EA 1PNQA 2JFPA 4P33A 1DJMA 1WCIB 1NQUA 2X9GA 4HMQA 1I3NA 1PR0A 2YTZA 3VU1A 3WKCA 1R0ZA 1E3LA 5FKJA 1U6KA 2OO5C 2C57A 3HN7A 3WLFA 1ZESA 4RK0A 3GLHE 4D45A 2CKMA 4CYMA 2PSFA 3SZLA 2VRNA 3I0MA 2FRDA 3INGA 3MGGA 4BJ5A 2VDWB 3RC7A 8GPBA 2R6JA 2VAPA 4CEHA 4AJLA 3ZCTA 3BRWD 2I6UA 3K6RA 3PQFA 1JIVA 3KQYA 1T9AA 3N2GB 3WISA 3Q9NA 5EUCA 4BFCA 2XYHA 2IPLA 2P7HA 3LUCA 4F4IA 2ID9A 2EFEB 5CM9C 5KAPA 1BDHA 1RXYA 4LZLA 1GO2A 2Z2KA 3CA8A 2YBDA 4EMTA 1JMYA 4QD3A 4ZKEA 3KPVA 4ZIRB 3PLNA 5MGNA 1N32B 3LA8A 3IUNA 3VAYA 1WZUA 3A6LA 2HCTA 3VNQA 2C5EA 3KTAB 3WZ2A 1W2HA 2DWCA 5INTA 1BVUA 3WA7A 3TE7A 3QFHA 3JSXA 2HHCA 1G7TA 2A35A 1TJ3A 1QQAA 1N6RA 2RHMA 5ALKA 3CKMA 3V2GA 4E31A 1IPEA 4QXQA 3C3WA 4GX1A 1VYUA 2E7ZA 4XVQA 4L16A 2PGOA 4BGIA 4Z4FA 4XPIB 2H1RA 5LYJA 4E11A 1RM3A 2VEDA 4HEA1 4PCAA 2MR6A 3V4RA 4K3VA 4HS9A 2EWWA 1CZNA 4IJ6A 1X7ZB 1F2UB 2PWAA 4TXMA 3TTTA 2KW5A 4CMEC 821PA 2VBCA 3PHCA 1QH1B 1P0CA 1S8FA 3OFNA 1PLLA 1T8SA 3JATB 1JDBC 3V1YA 3BA1A 3UGQA 4RPLA 5CX1A 3NBZC 2JRCA 1PFYA 3KAJA 1NBAA 1NBWB 2V97A 2QT1A 1WDTA 4PG6A 3VHLB 3LPLA 5IPFA 3RYCA 4RVGA 4JLAA 3GRVA 2I1WA 4DC1A 3CF0A 1DTWA 1FDIA 2PE5A 2Q1UA 3U3KA 3IVXA 2DQSA 5EP1A 1SWVA 3ZWAA 2JFOA 4Y2QA 4JI7B 4CGYA 1F2DA 4LWPA 1X80B 2FR8C 1E8MA 3ZDQA 4U7WA 2ODEA 3VTAA 2SECE 4JNKA 1WDMA 3PICA 4PQFA 1Y6RA 2HCFA 2G04A 1FXUA 1IVNA 5AHXA 3OUTA 2WYHA 2XJ4A 4UBOA 4EUFA 1FS4A 1ILWA 5E2AA 5BUZA 1EFHA 1QMPA 1H2WA 1AUQA 3AR5A 2ZIEA 1VDZA 4E70A 1AN0A 2BP7A 5AWFC 5L3VA 4GMGA 1QJCA 2MYUA 3JALA 3MT7A 4TTPA 1CDOA 4M21A 3ZC3A 3NH6A 2DULA 4RU1A 5EIHA 3AEUB 1YBHA 1FF9A 1ZITA 1SUPA 2JCSA 1YQWA 4UBNA 1LA2A 1I5EA 1ZK4A 3SF8B 1WE2A 1S9HA 3Q6NA 2I2DA 4KMMA 1Q3HA 4DM4A 1F4LA 2BD0A 2V0CA 2B1IA 1KQNA 3WFIA 4BKQA 4F6RB 1W5EA 4TMYA 1E96A 3I9KA 3HNRA 1J8VA 4JY7A 1HDZA 2O7VA 4V0QA 3IT0A 1W36C 2AXNA 4YRAA 3E8MA 1R0RE 2QDKA 3AR6A 4M0EA 1K0UA 4UUAA 2XV1A 2ENWA 1MABA 2PBZA 3C3XA 1N7GA 3TXAA 4MPJA 5BQPA 4FM9A 1CZOA 5EZQA 2PRSA 2V3VA 1X1CA 3LCRA 5ICCA 4OBWA 3KZCA 4A2PA 1PS8A 5KSWB 1FIUA 3GHHA 4TYQA 3IR7A 1M1YB 5C1OA 5JZ9A 4QRIA 1J56A 3CLVA 3FBGA 3K30A 3K4QA 2OGUA 4TUYB 4NK4A 3ESYA 3FTFA 2AFVA 4F3CA 5IHPA 3L7IA 1FRQA 1KDOA 2JGKA 3G2OA 3N3AC 5H59A 3QH4A 1U8ZA 3I45A 1C7IA 2ZXEA 4NABA 4KDCA 4B4VA 1AK2A 5LFAA 1U4OA 1YDGA 2FX3A 1P1KA 4DA8A 1T25A 3ELBA 4G67A 4QUIA 3OZXA 2CLOB 2OXIA 3H3FA 2H5JA 1ULBA 3OUUA 5B1SA 4AKHA 4X91A 4HRVA 2R0QC 1UPBA 4FWIB 4MV7A 4NOMA 4E22A 3GBPA 2YMLA 1NN0A 2W2NA 1EFRD 3ASUA 3CW2A 5AH0A 1SVLA 3I2JA 5E4JA 2QTHA 4B7AA 1MA0A 3Q8KA 4QUHA 3RU2A 3AB3A 2JD2A 1XEXB 5D00A 1UDBA 2JCVA 5AW0A 2Q9AA 3BS4A 4URFA 5BYKA 4DUZB 4E5DA 2GN4A 1TT5B 2GJ8A 2RGYA 3A32A 2FZWA 4I0WB 3KETA 3EFBA 1B73A 3BFJA 1CVIA 3FDXA 3QLVC 3VO2A 4EB0A 1G3QA 2FEPA 4B0OA 2GA8A 4LSWA 5I4KA 1YS4A 4KAAA 5KKAA 1ZK3A 2GKGA 4GZLA 4Z0PA 1G42A 4W82A 4KE9A 1YJQA 4X3CA 4AY4A 2FU5C