1CZOA

Comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWGVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Comparisons of wild-type and mutant flavodoxins from Anacystis nidulans. Structural determinants of the redox potentials.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Electron transport
total genus 58
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1czoA00
1FLVA 3NFRA 4LA4A 3ES9A 3F90A 2BN4A 4C0WA 1XI2A 5LLDA 4HEQA 4YAWA 4YAUA 3NHYA 4Y7CA 3B6KA 3OX3A 5LJIA 3UXEA 4NLLA 3QE2A 1XYYA 1YCFA 3JSXA 1XYVA 1CZHA 2QX4A 2FLVA 5F4BA 1YRHA 2HPVA 6NULA 3KAQA 1TLLA 1I1OA 1YCHA 4FX2A 2M6RA 1F4PA 2Q62A 1OBVA 4BMOB 1CZRA 3RPEA 2OHIA 3EDOA 5EMNA 3NHSA 5FX2A 1AZLA 1AKUA 2OHJA 4QOIA 2V5UA 4LTMA 4N9QA 2QWXA 1SG0A 2QMZA 4CF6A 1YOBA 5BUCA 5LBTA 1FLAA 2HNBA 2Z9CA 3LT5A 3NHFA 3GFQA 4FGLA 1FLDA 1JA1A 2FCRA 1NNI1 5F51A 4Y9UA 5TGZA 5A4KA 3GAMA 3TZBA 5LMCA 5LVAA 3U7RA 3UXHA 3SVLA 2MTBA 2QMYA 4BMPB 4QOFA 2QX8A 3LCMA 4H2DA 4DIKA 4NULA 2ARKA 4ZVMA 5EA2A 1FX1A 1YDGA 3ESYA 3F6SA 4PTYA 1V4BA 1QHEA 1CZOA 4QOHA 1FUEA 1AHNA 5NLLA 3ESZA 4DILA 4QODA 2QX9A 2HNAA 3HA2A 2MWMA 1CZNA 3GFSA 3B6IA 3P0RA 3FJOA 4ZVKA 3NHJA 5ULLA 2BZSA 3K1YA 1OFVA 4GR9A 1FLNA 3O2NA 4HS4A 4H6PA 1WSWA 1E5DA 1AKVA 2N1MA 2KLBA 3HR4A 5LBUA 1YCGA 4S24A 1J9ZA 4U7GA 5B3LA 4YAFA 4J8PA 2OYSA 3G5MA 3OVMA 4QOEA 4M0CA 1KBOA 5FA6A 3O73A 3TE7A 3NHUA 2FX2A 1C7FA 4N82A 2XOEA 2A5LA 1CZUA 3N39C 1ZWKA 1AKTA 3B6MA 1SQSA 3B6JA 4YALA 1OBOA 1D04A 2ZKIA 4GI5A 1AMOA 2F1OA 4CETA 4C76A 1QR2A 4LAFA 1WSBA 3L9WA 4FGJA 3TEMA 1XT6A 2Q9UA 2GSWA 2XODA 3FX2A 1AKQA 1ZX1A 3NHKA 3ESXA 3GFRA 1VMEA 1FTGA 3NHWA 1C7EA 2Z9DA 2Z98A 3F2VA 4QOGA 3S2YA 1DXQA 3KLBA 1RLIA 4YAOA 1DXOA 1J8QA 2D5IA 1AKRA 2KQUA 5LJLA 5NULA 2RG1A 4XDHA 1AKWA 3NHPA 2AMJA 4XDGA 3QFRA 1B1CA 2R96A 4GQIA 2BF4A 1BVYF 1TIKA 3ZHOA 4C0XA 1J9GA 1QRDA 1ZWLA 2R97A 2V5VA 4LTNA 2WC1A 2FZ5A 1RLJA 4LTDA 4Y9RA 1GG5A 4ESEA 3W7AA 1AG9A 3W79A 4D02A 3R6WA 4OXXA 3QFCA 1T0IA 3OWHA 3W77A 2QX6A 4DY4A 2M6SA 3FVWA 3F6RA 2MOKA 5JROA 2BMVA 1RTTA 2FZVA 2Z9BA 1D4AA 4FGKA 1JA0A 1QBGA 5F12A 3OJWA 4PTZA 2OHHA 1X77A 3OX2A 2V9CA 1H69A 2B3DA 2FVXA 2MT9A 3NHRA 4C14A 4ZVNA 3NLLA 1RCFA 4R81A 3D7NA 2X2OA 4N65A 1DX9A 4U7HA 3FNIA 4ZVLA 2FOXA 5FUQA 4QOJA 1D03A 1CZKA 3KAPA 3EYWA 3OX1A 3N3BC 4F8YA 5EAIA 1J9EA 3K20A 4YQEA 1CZLA 3N3AC 3L9XA 3FW1A 4ICIA 4U7FA 3OWXA 1BU5A 3NHLA 3HLYA 1YKGA 3OJXA 1FVXA 2QR2A 1T5BA 4PU0A 2BPOA 3KEGA 5B3KA 2FDXA 3U7IA 2FAXA 2W5UA 2X2PA 1KBQA 1H66A 3W78A
chains in the Genus database with same CATH superfamily
1GXSA 1F2TA 4HMQA 4YV0A 4LA4A 3FCAA 3PCRB 4QBFA 3F90A 4D3SA 2P2SA 4V0ME 3IL2A 3MJSA 1W9HA 1Y9ZA 2GNAA 4BMNA 3VDXA 5DP2A 3LT2A 3QG1A 4LGCA 3MXTA 4OXNA 4YX9A 2BFWA 4G0NA 3T3PB 3K9QO 3H6HA 1TJ3A 4IOMA 1C50A 4KCGA 2WJAA 3OC6A 5D1HA 2XWQA 3TWOA 4OHBA 4AO8A 4P4SB 1XXHE 4N0DA 4R6WA 2RH4A 2FMTA 5HR5A 1EVQA 1NONA 1O94D 2D7DA 2XVYA 1UBNA 4JLKA 1DC5A 1CYDA 2D13A 3TKLA 1TYBE 5AUNB 1TF2A 5C7YA 2E37A 3IO3A 1P0PA 2DBZA 3RREA 1M6WA 5IDWA 2W6CX 1SZPA 5L4SA 3C1AA 2JHFA 3IR5A 3U44A 1Z28A 4KWHA 4ZT6A 1JLKA 2BGKA 4GVXA 3KSBC 2P0EA 4IH9A 1VKNA 4TTRA 2VJAA 3BMNB 5LQJA 2HIHA 3I83A 4NR0A 1JECA 1RQPA 2PSDA 4B3RB 4ZAFA 4B2LA 1T9CA 3ZWWA 1NJ5A 1DX6A 4J75A 2R66A 2HCRA 3LPLA 4P08A 4R54A 1P60A 4QE3A 4HHEA 2I62A 2DLNA 4H16A 4OI2A 1DC4A 1QTIA 1VL5A 2VTKA 1K97A 3HSSA 5JS7A 3WK9A 1E7WA 3QY9A 3VBCA 2ES4A 1KERA 1OF1A 1Q11A 1M1ZA 1ZUIA 4KGXA 4FFPA 5EERA 3TOVA 4EY4A 1R5NA 1DC3A 5JH7A 1OXKB 1ECGA 2KB0A 5K4AA 4DDMA 1P0IA 4XQEA 3X1ZA 2B2CA 2OHIA 4QUIA 3TW8A 7ADHA 1IMOA 1MJGM 1AM4D 2ID4A 1YV9A 4MCHA 4XGQA 4JYZA 5AQEA 3F7OA 3IIMA 5EMNA 2NXJA 1ZHOA 2YIJA 1KKMA 1DKNA 4JKOA 4M0DA 5FWDA 3VGJA 4LMRA 5CUQA 4ZQEA 2EP8A 4CV1A 1OAOC 1T3GA 2CYCA 3GRPA 3LP8A 2EHDA 1V3QE 3M2TA 1NZJA 4GL4A 5LLTA 1AIPA 2ZOSA 2FF5A 3PIRA 3ZBQA 2IZ5A 3JQ8A 2D0IA 4Q37A 2JC3A 3SAJA 3D5EA 2UAGA 4KR7A 1MEOA 3CZQA 1T8PA 2XMGA 3I01M 1Z2AA 3WTBA 2VT2A 3FR8A 1F2DA 4QAQA 4QPPA 2NU6A 3DMGA 5JEEA 5E3JA 2VYQA 3NANA 2PAFA 3T9BA 1NBME 2B25A 3PT5A 2GYUA 4JZKA 2QM3A 3TPCA 1EJBA 4L0QA 3ZC3A 2JS7A 5B64A 4TYMA 5I7OA 1VL0A 1JA1A 1GRRA 4JJKA 1BKSB 4ZOLF 1ZRNA 3LUJA 5FNZA 1JLMA 4WW0A 3RUDA 2WAOA 2GZSA 5KSOA 1PZMA 1N5RA 1RJ9A 4IUYA 1IJBA 1PU2A 2Z2XA 2H0AA 5FBZA 1L4NA 5EIOA 2RJNA 3TZBA 5BQ3A 1LI4A 4QIHA 2Y1LA 3U7RA 1AJEA 4ENPA 1PW5A 1ZESA 4NEQA 2OCLA 2B4RO 3KYCA 1E6LA 3QNUA 2CJYA 4ZAVA 3PQEA 2GUWA 5HBGA 2QSYA 3SZOA 2XUZA 3AP2A 4BFXA 1W8DA 1P2UA 3VPSA 1WOYA 4J91A 1PR9A 1PYOA 2XT9A 3TTSA 4X85A 1IG3A 4RM2A 2XT6A 4TUYA 5HS6A 3VO9A 4GKKB 3JQ9A 4DV0B 1Z47A 5KJ1A 1GL7A 1OC4A 5EHXA 5IKEA 3DNPA 2QAJA 4BGIA 4F12A 1BWRA 1GADO 1RMYA 2B5OA 2B9EA 2YN0A 3L1VA 3NBMA 4GOMD 5CLFA 3FHJA 4LSZA 1YBHA 4DCGA 4A0FA 2I78A 1H2XA 3VO1A 4B2PA 2XQKA 3ISJA 4WBNB 1J2TA 4YXWD 1PZHA 3HO8A 3SFVA 1MNQA 1NUQA 2C97A 3G6KA 3W9UA 1PS0A 4D3FA 5KPDA 1EUDA 3HBFA 1C0KA 4AP9A 4MQLA 2VPTA 1T6XA 5FUVA 2PD3A 4P7KA 1AQIA 5CFNA 1RC1A 2FGKA 4RV5A 1E7MA 1Q7CA 1Y3AA 3X1WA 5K5EA 2AEMA 5AVRA 1ZA2A 2G04A 3F5DA 5DBGA 1ZH2A 1VC2A 3A9CA 4L2IB 3H2KA 1ZU4A 3K4QA 5D1NA 3U7JA 2XTNA 2HNAA 5K8LA 4Y2YA 5J2TB 2X58A 4RTMA 3TRHA 1E1QD 4M9XA 1EM6A 3WLEA 1J23A 2Q21A 3GLIA 2AWOA 3E2IA 4X20A 4ZT3A 2P8SA 5KNBA 1DO2A 1ZITA 1OIWA 2PQMA 3DFMA 3ZIAD 4YI5A 4OHZA 1MB4A 1KI2A 4QGSA 1NLUA 2FUG6 4OBEA 3V9AA 4MLDA 4EI7A 2IYUA 4GL2A 2QAGA 4Y3UA 2Y3IA 5C5EA 4U00A 3AY7A 1VA5A 2P9FA 4HQNA 4OK3A 3AF6A 5BYJA 4PFJA 4FILA 4TLAA 2I8AA 2ECKA 5D3QA 1K8ZB 1GUDA 1QAQA 2F4VB 4A26A 4D97A 1IQPA 2ZLBA 5BRJA 3PFNA 3C48A 1KU0A 4M0UA 3HDGA 5KYVA 4C43A 5H59A 2YNMA 5DV9A 4EHIA 1AKVA 3HFRA 2V4MA 3K5IA 4NCKA 3TLYA 4F1JA 3STHA 1XC7A 2J32A 3NETA 5AVWA 1RYMA 1MOQA 3RADC 3TIVA 1LJLA 1B4DA 4QJ4A 3VJMA 2GOYA 4J43A 3WBFA 1AGNA 2LUOA 1EIZA 2NVBA 4F9GA 4JUDX 1EX6A 1GGNA 2BELA 4OMFG 1E79D 1O77A 1VCMA 1A4IA 2VP9A 3FUWA 4QUEA 4F46A 4WLEA 2WIDA 2OG2A 4QOEA 1ISSA 2WSLA 3QVUA 5DIZA 1FTNA 5FA6A 1BDMA 4O2LA 4FUTA 4X1IB 2WUGA 5BQFA 1ZLYA 3AI3A 4D0SA 4KKVA 1TOAA 4WZ6A 3ZPXA 4PN3A 2IY8A 4NY1A 4Q1AA 4W7IA 4RD0A 4ONEA 2WHYA 1OWNA 3ELYA 3R7DA 3EMKA 4RTLA 1HLGA 1QWSA 3AR4A 3CZ4A 3G5AA 1TT5B 4QYIA 4XTRA 1GPDG 3DD1A 4V3CA 2W2KB 1XVAA 3T9FA 3ADKA 1WOMA 2CMFA 3IHLA 4PLFA 4R8RA 2HF7A 5FNVB 3UKOA 2CLDX 3CZCA 3ZHYA 1JA9A 1VE6A 3BTVA 1A2BA 1KO7A 2YJGA 3MTQA 2KMLA 3QUSA 2VF5X 4TSFD 4UAGA 4WOPA 5EJMA 5TS2A 2HJVA 4IFEA 1XEFA 3TZCA 1CDDA 2BEVB 2C96A 3MBIA 5EWMA 4LF5B 4CF7A 4QQNA 2D3TA 3KLPX 1EK6A 3TSZA 4B7AA 3LCVB 3Q7QA 1TMKA 4P3OA 1TT7A 2GJSA 1UXOA 3T5GA 3H83A 3W9BA 2BE9A 4A5OA 1PGQA 5DT2A 1D9ZA 1YUNA 3GCWA 5J5CA 3TRFA 4DKJA 3P9RA 2D1SA 2OKGA 5CA0F 5EP4A 1UXKA 3QYFA 4XEUA 2O1WA 2QUJA 3H99A 4QYMA 3A9VA 4C5BA 4LV6A 1YE8A 1P17A 1QR2A 2R9VA 3PGKA 1G3MA 4GUDA 1SKYE 4QUBA 1WZUA 3NS7A 5K8CA 3PFHA 2Z4RA 4ZYVA 3ZI0A 1QH0A 1Z15A 4AIRA 4KE7A 1UJ2A 1T9KA 2A5GA 1VECA 5BSGA 3MN1A 3EPRA 4RV9A 1EA5A 1RWNA 1AX9A 3FCSB 1U31A 4J0JA 1PI3A 2FJ0A 2GSWA 1AKQA 1Z2NX 2E4XA 4JCCA 1IMJA 2Q1YA 1EM8A 3ZK8A 1GNSA 1ZX1A 3JQ6A 4DBLC 1BFDA 2RG7A 2I1LA 1GY8A 3R0QA 4MLCA 4D42A 3QPAA 1YRYE 3G9QA 3E9DA 4JI5B 2GEDA 5BNIA 3UC9A 1FDUA 1HQCA 2NMVA 5GJWC 1IQUA 3UXYA 2WOOA 5EXSA 1RE1A 1LDMA 3PXBA 1KDTA 3LP5A 3OZRA 5CXSA 1ISMA 1F0KA 1JJAA 1OKKA 1E0SA 3E9ZA 2H1VA 4MICA 1W0KD 1YZTA 4OHFA 3MCUA 3RVOA 2DUMA 1KJ9A 2QB5A 4EHKA 1K89A 4DUGA 2QRKA 2ZAYA 3BK7A 5H70A 1N6NA 2P75A 5JSUA 1JDZA 1CX9B 2OORA 1EVEA 4TV8F 1AKRA 1PT5A 1Z7BA 5CDUA 2ADFA 2GPYA 2B0CA 2RI6A 1U8YA 4MW5A 1UM8A 3NHPA 2PRYA 3PNLA 2AZ4A 2P3SA 2R25B 4C22A 1NHWA 1OPXA 1EWVA 1PEDA 3OPMA 4W5QA 4QGGA 1RWOA 1JYFA 1QPBA 3PNYA 1J97A 4JI2B 4R1LA 5BVHB 3MD0A 1WMBA 1ZM3A 2GARA 4HEHA 1O4WA 2JJ2D 5HZKA 5JR3A 1Z68A 4BKQA 1H0SA 4JI8B 3ID6C 2GF2A 4XYGA 3IPRA 1JF8A 3Q3GE 2NACA 5BV8A 4IQGA 2ZRJA 1K75A 1U8ZA 3L8GA 4UC0A 3L7DA 4QJ5A 2NO1A 5AK5A 1X9HA 3WJ2A 4PHCA 2O8EA 3NTOA 5AVZA 5JRDS 3AEQB 5FFNA 5JSKA 4JLPA 4AJEA 4E3ZA 1XN4A 4NL4H 1CSEE 2J9ZB 2AK3A 2XMSA 5DGDA 5DX1A 1XQYA 2EFGA 3Q0EA 3NNSA 3QMMA 5BR4A 5IT5A 2QRUA 3IQFA 4JJEA 4MUEA 1D2HA 5CX1A 4YLYA 1TUEA 1GJRA 2ALJA 2HA5A 1OWMA 2VOEA 3LFTA 4HFNA 4MWEA 3V48A 2BSAA 4K1XA 4AJOA 1EUQA 3VU9B 2C77A 2CJFA 4J1QA 2AZMA 2LW7A 3OLVA 4MZDA 3Q3VA 4P8RA 2EZTA 5BR7A 1ETHA 4O08A 5AESA 6GPBA 3ZHCA 4ALLA 3OLQA 3WLJA 2CKDA 1E1CB 2P62A 1THMA 1E60A 1KNXA 4O1IA 1II8B 1EGAA 2JFOA 2VHCA 4EX7A 4Z2AA 1A8UA 3E3AA 4Q0MA 3Q0TA 1X70A 2K7ZA 1DX4A 2H1IA 3G3EA 1GPH1 4XFKA 1JDJA 5DLYA 3IV7A 3FFXA 1ZK4A 3CLUC 3QLEA 3FKSA 4NYMQ 4N41A 3GFOA 2B78A 3F9CA 3MGCA 2GAIA 1S01A 4KPGA 1KFBB 3I4FA 2I2BA 2EF0A 4NPAA 4N9WA 3N58A 2BMDA 2ZXUA 2LD4A 2H4WA 3BSSA 5AJZA 4WJKB 1Q1EA 1AE1A 3C97A 3KIPA 1ENPA 1BX3A 2HA2A 1GTL1 1U3CA 3RVRA 3KZCA 1CP2A 1AA9A 4UMVA 3W8FA 5JAZA 1Z0IA 5CVDA 1QP4A 1KDZA 1C2TA 5HEKA 4JHXA 1EYZA 3QEKA 3N2GA 4OI4A 4DR3B 3B2EA 2O2CA 3EGDB 1NZFA 5J1SB 4QWWA 2KLHA 2OC4A 2OAP1 4NPHA 2C9ZA 3UG6A 4GDMA 3VH1A 5A5DA 3KPWA 1MB2A 2RGNA 3MUOA 1PNOA 3JWJA 1CT9A 4PCUA 4MRMA 2PBFA 4M9QA 5I9NA 1XA0A 2WT9A 3HPRA 4JK3A 5LNK1 3JQFA 3MCVA 2O3RA 2W6OA 3L8MA 3TSOA 4PY2A 5IVHA 2C98A 5DASA 3OCXA 1BS9A 5DYWA 1S5PA 4PGAA 3A25A 2PL5A 3GWZA 4C0QC 5FCDA 1MC5A 3LDAA 4XPZA 3DOJA 2DFLA 2H8KA 1Z56C 4V03A 5CFOA 1C8VB 1GTG1 2QLJA 2YZ7A 2COUA 3IMCA 4V3BA 1Y8AA 2RBKA 3BBLA 1CY0A 5HCUA 3WJ7A 2QDXA 1D0SA 4IBOA 5J4HA 1JIKA 1XJ0A 3N6RA 3IEPA 2HOQA 1X1QA 3KVRA 1DG3A 1KPGA 4X5OA 3RS9A 3JWIA 3L07A 4M4SA 3CUWA 1MRZA 1TC2A 2VAXA 1NN0A 1Z0UA 1FVOA 1MJFA 4CHTA 4LWQA 3R5KA 2J46A 4D46A 4DLXA 1WPXA 4OVKA 3IQZA 2F1KA 3JASB 1VKRA 1DAOA 4PZ0A 4DIMA 2J7KA 4BUZA 1NRWA 1UK6A 5IXSA 3S3TA 5EN4A 1GAEO 4G3XA 5FL7D 1UBSB 1UEIA 2R87A 3D7MA 4RNCA 3U1TA 3GFFA 4PIVA 1YI8A 5BV0A 1B41A 4S1PA 5U1PA 1ZA1A 3C39A 1UM9A 3AWIA 2QUBA 1G2IA 3RKUA 5G40A 4DCTA 4ZK2A 4G1FA 2CFRA 3L05A 1OLOA 1R9GA 3DMRA 3K53A 3Q5DA 3FCCA 4G5XA 2H51A 2Y05A 5LP1A 3LW8A 1FTYA 1OBFO 1Y3CE 2M1XA 2QR3A 2WM8A 5E2BA 4U2FA 1YFZA 3OJLA 3RSFA 4CLDA 2QTNA 1JLSA 2PMEA 4WX2B 3TEFA 2PPLA 1FVXA 5KSPA 1Q0ZA 1T5BA 2X8AA 4JOQA 2AEJA 2KI5A 3CH7A 2B34A 2I67A 5B3KA 1RXEA 2I0FA 2V96A 3F8TA 4EKDA 1W36D 3U9LA 5J4KA 1GM5A 2GPTA 2P78A 3UPTA 1VKOA 1J24A 3JQ9C 4G9BA 4AUMA 2CXNA 3OTQA 5B3AA 1KEEA 3OPVA 3KB1A 2FH5B 3DDCA 2PR2A 1PHPA 1X3SA 3Q11A 4LWPA 3HGTA 5IDXA 2D74A 2IU0A 1ACMA 3NFRA 5CU7A 3NVKI 3RDPA 3AERA 1XJQA 2O7QA 1LPMA 3M9XA 5J2UF 2QKYA 1QOQB 5I9MA 2FMIA 4LZNA 1IZ8A 2I65A 4HYYA 1ZK2A 4WQMA 2ZJ2A 2QTLA 3W2FA 4RKWA 1G16A 3LC7O 2AG8A 3GUYA 2ZE6A 4X91A 1Y8QA 5E6SA 4YAUA 3F3KA 3OJEA 1SD5A 2UYOA 4ES6A 1QGAA 4MKFA 4RANA 5FB3A 4FI3F 1Z5ZA 5IW8A 5LXTB 3JQRA 3ZE7A 3ZWBA 1CB7A 1QCYA 2H1LA 2SICE 2CL7X 5JCXA 3OE1A 4HXFB 1RWKA 2WHRA 1RYBA 5SICE 2B2NA 3UMCA 2BDTA 4EYKA 3H8VA 1KZ1A 3SPXA 2BUAA 1WHTA 4NLLA 3ND9A 1BWPA 3IAEA 5DH9A 3RS7A 3T1HB 2QAGC 3K05A 1UANA 3X1XA 3P0JA 4TWRA 3SC6A 1GKKA 3FE2A 3IT1A 4JQSA 1MA3A 2A0WA 1I3OA 1EI9A 3DTVA 2IIBA 4P5EA 3F8WA 1MDFA 2WTMA 3VR4A 1I4OA 1SHJA 2VXCA 3G49A 2FLVA 4OY3A 5AXDA 5ILGA 3KJZA 3F71A 3JAMA 2DKNA 3RW9A 1R10A 3I6ZA 5FTMA 3O90A 4D8XA 1E32A 2YNMC 3AHEA 3WAKA 4EB3A 4DV1B 3PR2B 4LFAB 1CQJB 1I1OA 3O9VA 3PIDA 1V5GA 3IHKA 4E46A 3O0TA 1DTSA 1IN6A 2YHBA 3FOFC 1V2HE 1Z12A 2YH2A 1COWA 4G56A 2FETA 3ZHSA 3LX4A 3MW8A 1AN0A 2BFCA 3EZFA 1HLDA 3W7BA 1FFXA 1F5SA 2AQKA 1W34A 2Q5OA 3U4QA 3FI0A 1LX7A 3A6KA 2J85A 1CZRA 2DWCA 4MIKA 4TOIA 1JDSA 3BEOA 4HPJB 5AI0A 4RA9A 4AJ9A 1AZWA 1M1NA 1R37A 2OBNA 4NMLA 4P3NA 4O2BA 5CMLA 4FONA 4B35A 4ZCTA 1NNSA 4RDCA 5INTA 5AKEA 2F3TA 1H1DA 2VXOA 3VISA 5ALUA 4IQ0A 4TMWA 2FW6A 1M2OA 3CNOA 3UJ7A 5TQ2A 3SICE 4RJIA 1RHQA 3ZZTA 1BZYA 2VDKB 4PO9A 2CC2A 3JAWB 4RCYA 3NEJA 1G8KA 2P2YA 2RGEA 4LC0A 4QM7A 1GPNA 1KP2A 2VPYA 1JDPA 3CR8A 3HWWA 2F3SA 2PBLA 1M2FA 3TQRA 4AO7A 1ESNA 2GZRA 2R1TA 2WJ6A 3VZSA 4F6RB 4WFKA 4Z3DA 4HGPA 4N9QA 1Z8NA 2QWXA 1BSVA 1KETA 3GR6A 1JT2A 1YOBA 2H7VA 4PX2A 4EB0A 1HTWA 3A0UA 1VPVA 1R7RA 3R4CA 4N49A 3GAFA 3EF1A 1SO8A 3EGVA 4AP6A 1PNVA 4GI3A 2AOUB 3LXMA 3GDWA 4KQGA 2UKDA 2H18A 4N5NA 2WWVD 1LK0A 3WL8A 3OZCA 2C5EA 2AXEA 1FL9A 2AG6A 3D6FA 3H42B 1JFFB 4FR0A 3VR2A 4DTCA 2R1VB 1E1NA 4RDXA 1L7NA 3RYIA 4AY4A 5KNDH 5IZCA 3K9FC 4IS2A 1U0GA 3BF7A 3GG9A 1GT6A 1NVFA 1P0FA 1SUCA 2YXLA 3IRUA 1IM8A 3ODPA 1M2JA 2ZSEA 3UAXA 4EGFA 3S5UA 1KZHA 2O3SA 3G59A 3H6KA 4Q3OA 5FOVA 3TL6A 5L53A 1KEZA 3LHKA 3M4JA 3FDXA 2VO1A 2C9YA 4CJXA 4BEVA 2B83A 1IG0A 3KSUA 4RPLA 1QDLB 3CWQA 4XQCA 1DI0A 1RP1A 3E27A 1UFOA 5T4HA 1FNCA 2QLFA 2PX2A 4C4AA 1RHKA 3SVZA 4N03A 2ECFA 3HE3A 1E3DA 4ASUD 2WABA 4DIOA 4OAPA 1SY7A 4OHRA 5EJ2A 2XDYA 2PU7A 3D5TA 4ZD6A 4PEVA 1RLMA 5BN3A 4MXDA 1OZFA 1RYHA 4ILKA 3T7JA 2NAPA 3IEUA 4H7HA 4UBOA 2V74B 4NONA 3BTSA 2Q3LA 5JZSA 4WGFA 1GKLA 3H4IA 1H0RA 5JWHA 1QK5A 1YO6A 1H3FA 2ZSUA 1PRYA 4ZO9A 4XB2A 3ZDFA 3FYSA 2WUWE 3AVXA 2ZE5A 1VYVA 4NZMA 2XXAA 1Y89A 3H19A 4FSDA 2XZDA 1U3DA 3CLVA 3U7FB 2NLOA 4JOBA 1W6RA 3D7RA 5BVGB 2HIGA 2PL9A 3DB2A 3GHYA 3NX4A 1OJ7A 5DGXA 1NI3A 5E1BA 4NQZA 4FFMA 3VYWA 1CUDA 5T64A 1EG7A 5F5NA 3ACDA 5A04A 5BN4A 5I7FA 1ISHA 3ZWCA 3NH9A 3PTLA 2X13A 4UUQA 3WRVA 5U4XA 3EXAA 2VK2A 4EYSA 1FYDA 4RKFA 1E92A 5K3SA 1W0JD 4RELA 4F3TA 3OQPA 3CEJA 5ALHA 1S96A 3GXBA 2QS9A 2F3PA 5K0CA 1L5HB 3DMNA 1XZQA 3QWHA 2H4HA 5EUQB 4HT3B 1B8UA 5JJCA 3LK6A 2Q5JA 4PQYA 3KJHA 4AKHA 2QV0A 2VDUE 3Q7IA 4P3XA 2OXEA 1U2GA 1GGHA 2NQ8A 4WNYA 2VIIA 3TH5A 2DVMA 4I1IA 2FHPA 3L6CA 5DX0A 2AF4C 3PWKA 5KYWA 3ZE6A 2QY6A 4HGRA 2HH9A 4FD2A 4QT4A 1NBHA 4NE2A 4EARA 3KT0A 1UBJS 4KFCA 3E0QA 3CRQA 1IPFA 1NVGA 3H9GA 3DUFA 2ZYIA 4JELA 1VG1A 4LCBA 4MWBA 1PFKA 1WNTA 2J09A 2JZOA 2G4CA 3ZWOA 2A5FA 3CUYA 1P1KA 4L3WA 1US8A 1HDYA 4LYJA 3SHVA 5AVUA 3ORFA 2RHOA 3SFTA 4C7KA 4BKOA 2G63A 1CQZA 3MCZA 4NH0A 4X95A 3LLUA 1SULA 3G13A 2FX2A 3RM3A 1NNEA 1C1DA 3I6YA 2XIQA 1WF6A 5B4TA 1ZMXA 3UGTA 4Y2QA 4TT8A 3UZUA 4BYMA 3H3XA 1XEXB 1ZCJA 5I5GA 4ZZ3A 3I8XA 1DL5A 1PDVA 1ZPDA 4FCVA 5K4GA 3NWJA 1NU8A 2P1RA 2C5FA 4QDXA 3DH0A 1UPTA 4G84A 2XCSB 1Z4PX 4IV5A 3I9OA 1SVKA 1V8OA 1G8HA 2VI5A 3DMYA 3B6JA 2GM9A 4RE5A 2WWYA 3C8UA 1KP9A 2VJCA 3GP5A 4MQ5A 3X1KA 5IULC 4RIHA 5IAEA 3TMKA 1WDKA 3G23A 3V2UA 2XZPA 3HZOA 5DN9A 2VHJA 4ZT7A 4JJ7A 3OEYA 3U56A 5CIWA 2ZAIA 3SZLA 3TEMA 4EG8A 4LZAA 1QAOA 2BAGA 4XX0B 1Q3KA 3OT5A 3EX7C 3FF4A 1XCMA 1WZEA 3MHPA 1TM1E 1DRUA 2W6NA 3RRNA 3WRXA 1ONOA 1JZSA 3FBGA 2DFKB 5ALQA 4AD8A 3DBLA 2CHQA 3H05A 1FXUA 4XCVA 5A2GA 3VPGA 3M1YA 3KJQA 3KYDA 5EQFA 4DQKA 3G5LA 1V8BA 3VR3A 4AB1A 4ARZB 2SCUA 5EZ6B 1IZZA 2RGNC 3HFJA 4EW3A 1F8GA 4IH1A 4PWYA 1UIMA 4G9GA 1ZN2A 1N4AA 1YAJA 4MS3A 4P32A 1TO1E 4C2TA 3JQFC 1VL8A 1TLTA 3PNQA 4B44A 1RLOA 3KWJA 2MYTA 1KQPA 3HN7A 3WYAA 2EHJA 2Z5GA 4U7WA 3G2QA 1TCBA 5BQ5A 4IHKA 1IN7A 4RPKA 1H0KA 2NZXA 1P9LA 4GX0A 1EWQA 2DUNA 5IN5A 4BNHA 4EKGA 3GEBA 2XB2A 4EY8A 5KYUB 3K5PA 2JGAA 2JIQA 4WZBE 6LDHA 1D2NA 1MAVA 5B1YA 1JFRA 3DDOA 4Q4JA 3H84A 1RJFA 3PGJA 3F78A 1PYDA 1DRJA 3H1BA 2ENWA 3EH1A 3V55A 4B9EA 4JEIA 4RVOA 2JZCA 2QPTA 2FQQA 3A32A 3BMQA 3BICA 3LHFA 3LOPA 4U02A 5EKXA 3UHFA 4B7ZA 4FXPA 3MUNA 2YVUA 2YWDA 5IEJA 2X86A 4YJ2B 1T35A 3UK0A 4BTLA 1P9NA 1C1XA 1WV1A 3H87A 2HW8A 1NVKA 4DR5B 1CNFA 1CQXA 1IY2A 2P9CA 1WEHA 2XB8A 2Y1FA 5B7NA 3M49A 2HXSA 4FT2A 3RC3A 2X19A 2C5HA 3SZMA 1GV1A 3HCRA 2ORVA 1VSTA 2OT3B 4Y2GA 3FFTA 2W4IA 3H1AA 5L3ZA 4HADA 3RBZA 3R5FA 1F4VA 1Z08A 2R96A 2GFQA 4JQZA 3WYEA 5JATA 3KL2A 5CH8A 4FWTA 5EJ7A 2OZLB 4I2VA 3TNDA 1EX9A 1Z5PA 3N2NA 4LF9B 2JEOA 2BHRA 4V0QA 4P35A 2G9UA 4BS9A 1G98A 3OTHA 3P9CA 1Q21A 3SU8A 4RZQA 5SYAA 4B4UA 1U1IA 4G5HA 2J9GA 2NXNA 4A6PA 4G0YA 4IDNA 2IIPA 1N32B 1FUUA 4BLWA 1QGOA 1XCBA 4KN9S 4RK7A 4HGZA 1JHQA 5C2JB 4MI9A 2R85A 1PR5A 3U4MA 5EIBD 3QHPA 1CETA 2Q8QA 1EFHA 2Z09A 1BCRB 3W5VA 1WPGA 1TIBA 4ZKEA 3DLIA 2YYSA 4RAQA 1I4TD 3S55A 5K6RA 3T3NA 3W7AA 1YI1A 3MAAC 3I3OA 1QO0D 4W9NA 3GVHA 2EWMA 4LRWA 3HJUA 4AUKA 4TVSA 4XWAA 2FPIA 1DIRA 3A3OA 5THXA 4WUVA 1ZMRA 1C4KA 3ZV3A 1A8PA 4ZCPA 4A2WA 1T5DX 3O4HA 3DT9A 4TT3D 4D02A 4OOEA 3PICA 1R00A 1JIIA 1VL2A 3AR7A 3E7FA 3JATB 3OLXA 3GLUA 4V02A 2YINC 2B1GA 3CM0A 2WPDA 1IRIA 3AQ4A 3FTCA 4CCSA 4YECA 3U16A 3QX3A 1RXVA 3H2GA 4KV7A 1L7BA 4EHLA 5K3BA 4HAUA 1Z62A 1AGPA 2BM1A 2GYVA 4FOTA 3OOSA 5ALNA 2GRJA 4PR3A 2YRXA 4FDAA 1NUPA 4KE9A 1A9PA 1WVMA 2ZSJA 2ZUDA 2HDHA 4F85A 2I6UA 2YJ3A 4V0NA 2DHQA 2XEDA 2XJ9A 1C8BA 4LJ6A 3MINB 3IP8A 1LC3A 3CE6A 4NBKA 5HVNA 2J6IA 2PD4A 3PC3A 5EMJA 5TGDA 4D4MA 5C34B 3Q7TA 2JNWA 4B3XA 2CCGA 3OFSA 5F7JA 2OHVA 3W5SA 2HHHB 3TNFA 2DAPA 3VJKA 2XVXA 4DLLA 1GTVA 1IWBB 1V11A 2AGVA 2QV7A 1V1RA 4CCYA 1S6YA 1EJ6A 3B6ZA 4Z99A 4D8VA 4EUNA 3VTKA 3AFIA 4NU6A 3S27A 1YVPA 3CWCA 3AUSA 1WMDA 3VSEA 1LLDA 1I3KA 1VJ1A 2JCYA 2NO9A 2EWVA 5A4JA 3E1SA 2PTGA 3FMGA 1R27A 1YR7A 4P38A 4FD3A 4Q93A 1RYYA 3L4JA 1G2OA 3LLMA 3BWYA 3IKMB 1F2UA 3LQ1A 3N75A 3QTBA 1Y5IA 1Q7TA 4NS1A 1QDUA 3C5CA 3BH7A 3KD3A 4OQDA 3O83A 3DEYX 3QY0A 3QX9A 4PFSA 4AWAA 4EL5A 3N76A 3BREA 9ATCA 4CIAA 3STXA 4LMPA 1W4CA 1W4LA 1P0MA 3EQ2A 4HY3A 4RSRA 3TJMA 1IEVA 5F33A 4MW1A 3RS5A 3W4JA 3GZJA 4C6HA 1L8AA 5JS1A 4RETA 4RH1A 3SIPA 1TYEB 3KXDA 2HRCA 5HOEA 2FR0A 2WWWA 3CH4B 1X7YA 5BMOA 3J80A 2HF2A 3MWEB 1GAXA 1H05A 2WJHA 3T52A 2ZSDA 2ZYHA 5DDIP 4BGEA 4ETNA 4CMGA 3B89A 3BIWA 1EEHA 5LQUA 4NAHA 2JAPA 1G8YA 3WYGA 1HWYA 5DBEX 3M5DA 3C6QA 3L49A 2H8GA 4A16A 2VAVA 1XNHA 1U5BA 1H4TA 4JOCA 1PP4A 4YP7A 1EEXB 2XWBF 1CDOA 3FZGA 4WL0A 5G1NA 1J8YF 3RVSA 4ND3A 2O6LA 3GELA 3UUGA 1A7JA 2FCAA 2PANA 1EFRD 3BD7A 2HA0A 3QHQA 5EAIA 3G8DA 3P4UA 4HI0E 3K8OE 4DYHA 3KU1A 4OLFA 1OFIA 3ZTWA 4D96A 3C14C 1WETA 4UU7A 4R1SA 3K4PA 1FJHA 2AMYA 2BMWA 1WP4A 2IJGX 2ZIUB 3STUA 2M32A 1XXLA 3HZHA 3PWZA 1U9IA 3MWYW 4AQYB 1ZL2A 4V1CB 3UGKA 2H0RA 2WKQA 2YWGA 1ZMTA 3I8OA 3R77A 1DHRA 2VUSA 3INTA 1CJUC 1Z4OA 1A9TA 4F5DA 3QMVA 3R6DA 1BU5A 2YN4A 1NBIA 2ACVA 4NJEB 5FOTA 5A02A 4O25A 3Q8LA 3C3KA 4Q12A 1USGA 4D0RA 2Z56A 3AR2A 4F4IA 3CONA 4UPDA 4MGKR 1YRLA 2BJWA 3L8EA 4GOXA 3Q6NA 3STWA 3ZUGA 3COJA 4IDEA 1T4CB 4DCVA 4IHJB 1H66A 1NX6A 5CYPA 1N8SA 2PT7A 3OZEA 3GJ8A 3OPNA 2DUWA 1EHYA 1Y81A 4F2GA 4FQ8A 3ISVA 2QXUA 4HAXA 2DPGA 4P4SA 1T2AA 4J9UE 4MW0A 2VKQA 4QHYA 1DT5A 1PT6A 2VF8A 2SKEA 2WILA 3GT4A 3HGMA 3R24A 4LZWA 4O4LB 3BB4A 1WXFA 3FZNA 2IYLD 3UK1A 3WVNA 3VC2A 1UBCA 3OPQA 5L4NA 1ID1A 4FWIB 1GYRA 1W87A 5F1KA 1TCAA 4Q1VA 3U40A 2AXPA 5JO0A 5BYKA 4RWEA 4UFOA 4ASUA 2FP4B 3O2JA 4PG8A 1TZKA 1FNDA 3CRZA 3RAFC 2JASA 3BMNA 2OV3A 2Q4BA 4ZICA 3OX3A 2VNJA 2PXAA 5COAA 2JBWA 3Q9SA 1F7VA 1VCNA 3Q8KA 4P83A 4QECA 4WBNF 3MTAA 5KPJA 2YWCA 2PO5A 4Q7JB 2PEZA 5AK0A 1TPZA 5EEGA 1NXWA 8MHTA 1R12A 4C4PA 2X6TA 5LMZA 3AVWA 1Z2DA 2FRDA 3NBUA 1ML4A 2XLBA 4IJWA 2MR5A 2WWIA 2RGAA 1VHLA 1ONNA 1U2GC 3OFJA 2XHZA 5J2TF 4AY6A 3WLFA 4RFVA 2WJYA 1XWFA 2ZR0A 5H3HA 3V33A 5D7BA 5KSWB 1TLLA 2F1JA 4HDMA 4L28A 3EXEB 1G6Q1 2WPNA 1XAHA 3MPUA 4EYEA 3T0IA 2A86A 1R6UA 2MMGA 3A28A 3RU2A 5DNCA 5JPDA 1Y34E 1QUFA 1N3BA 1J21A 2QSUA 1CUUA 1E0DA 1LWNA 3MM4A 1MF7A 2CDCA 4WMLA 1ZIYA 1M8FA 1CUIA 1P2BA 1S7CA 3H5NA 1RVV1 3B20A 1DG1G 2FK7A 4B87A 1EINA 2WICA 4Q1CA 5ALMA 3UT0A 4CG3A 4F5YA 4DUYB 2AUMA 2H63A 1H5NA 3GJ7A 1YQTA 3UG7A 1GZ3A 1V39A 5DPMA 3TCKA 2GPBA 3CA8A 3PEUA 5LPNA 2DPXA 1ENOA 4R8VA 3DMPA 3TQIA 4BDSA 3Q85A 1NYQA 2MSLA 4X66B 1AKUA 4RH0A 5I4BA 5C8YA 3SYMA 4DGQA 4EY3A 3CNHA 3M5WA 3ROZA 3MTGA 2IDKA 4Y2VA 4MP3A 4MIEA 1BMQA 2BR5A 2VNAA 1TA4A 4G4SO 1NG1A 4TKMA 4RQTA 4FCTA 4MVJG 4GZ6A 1GCUA 4UDNA 1KORA 1R9JA 2DMRA 5JPIA 4AU1A 4K26A 1ODIA 1DO0A 2QP4A 4IKOA 4J9VA 4MMZB 4QYXA 1CG6A 2IEIA 3IEIA 1SK9A 2ATCA 3VUFA 4Q1EA 1J90A 3G2HA 4NMHA 2PK3A 1FLAA 3AB7A 1GZ7A 2XF2A 4W9RA 1KZ4A 1D2AA 1FYXA 3KEOA 5KKCA 1SXQA 1ZVKA 4HWTA 1V9CA 2LIVA 2NNWB 1SCKA 3OY2A 5AHOA 4TLDA 2FCRA 3CTMA 4PC3A 3UWOA 5KQLA 1VJ5A 1JI0A 1KRXA 2V7UA 1M0TA 2DUUA 1I2AA 3VJLA 4QJBA 3WRXC 1T43A 5IM4A 2C2GA 5LD2C 5KQGA 4RHCA 2R65A 4GMDA 2ZIWB 1E1KA 1OYVA 5EI5A 5FNVF 2ZVPX 1Z0FA 4PZ9A 4Q1FA 5H5JA 4C0BA 3UKDA 4YRPA 2DBVO 3O95A 2X3UA 3T1TA 2O19A 2O0JA 1SCNE 4WBNA 1T9GS 2IF2A 2RHJA 2BDEA 4EQ6A 4Q34A 4M9CA 3SR3A 3DE6X 4H2DA 4YRGA 1THZA 1YU9A 2MINA 3HVIA 4L9RA 4YMWA 5JSFA 4BLQA 5FORA 1F38A 1DLJA 2Q5EA 5F5LA 5TT0A 2Q41A 1FFHA 1Z7EA 4QOSA 3V1LA 1B6SA 4UTPA 4RVFA 4L2IA 5CD9A 1FX1A 3RIEA 3ICPA 5D2CA 3B60A 3UAWA 3V46A 1DRWA 3F6SA 3L1KA 4EATA 2D8MA 1NSFA 1RZUA 1PJLA 4M9SA 3MUFA 3QE0A 4MW9A 4W82A 5KYGA 2CNKA 2F64A 4RDIA 5DNAA 1G59A 1A82A 1N6IA 1ECBA 5KVVA 5FBVB 3DLBA 1BMTA 3JZFA 4MVXA 4OLBA 1WD7A 3KR1A 4K9PA 4AYWA 4FZJA 5H7XA 3E5HA 3ZXUB 4DILA 4XIIA 3K8ZA 2Z6AA 3ND6A 4Z4QA 3EODA 2EZUA 4IV8A 2GNPA 2ZDQA 4UOEA 2GK6A 4KJXA 5EWJB 4HP8A 2PRJA 4J1NA 3RYTC 1ST2A 4JWTA 4LCEA 4M8KA 5LM3A 3W3AH 5TQ0B 3GRZA 4GFDA 3W8EA 2VJMA 2YRWA 1JVSA 2JIPA 1E1RD 4RHUA 2FPLA 2CLFB 3HHEA 1XCGB 3QLJA 1ZIPA 5DCWA 1RM5A 3SK0A 4B83A 1UDBA 1FA9A 1NRIA 3OZ7A 4KYIB 2QSZA 3OTIA 5E1MA 1M1YB 1KU6A 2W2OA 3MRTA 4GXTA 1AQJA 3AVQA 1VHDA 4DAEA 4JNCA 1BROA 2ZJ6A 2C4UA 1LX6A 1Y3FE 4QEDA 5DNUA 3B9QA 1L5LA 3Q8XB 4Q9HA 3C6BA 5HOQA 3JRXA 1T9GR 1YQWA 3ZZMA 1EVLA 2DP4E 2J7PA 4JXZA 2HA4A 4CMJA 2J9YB 2BI4A 5A0FA 3SVTA 1VZ3A 1YZHA 3NGLA 1CIPA 1VGQA 1GPYA 1L5FA 4QXAA 3V1UA 3QKSB 3ED1A 3CW9A 1OXUA 4HFMA 3RNLA 4EEKA 1CRZA 3BN3A 1YB4A 3GLFE 1XF1A 5FNVA 3ZXXA 1C7FA 1DEKA 3RFUA 4AS2A 1GSOA 1TAGA 4LXXA 1TFUA 2W37A 4JX9A 3IALA 3OIUA 2G17A 3R8CA 3RGWS 4YRIA 5BR1A 4XI9A 4ND7A 4ZXFA 4ER3A 1JEYA 4EHNA 3QVMA 1U7TA 5KU7A 3ZY2A 2BEVA 1RHUA 4M98A 5LB2A 1NVUQ 2PN1A 1QYIA 4MWCA 3GO4A 4RA6B 2HSZA 1VSVA 3K9BA 4JQOA 4NYJQ 3ZHRA 2HQSA 8LDHA 1TVEA 1E4VA 5GGXA 1QB8A 2OHFA 3KOUA 4FYHA 4ZCQA 1WDTA 3EFBA 3MT9A 3OBBA 4O4JB 3VZDA 2A3RA 1X1AA 5KYYA 2C7BA 1MX9A 3PUHA 4W5HA 1QQ7A 3WBJA 3ASZA 2X4GA 4FJ2A 3WWZA 2FPOA 4OQ4A 2R6AA 4R1UA 3LGXA 3PDUA 4CMIA 2VQFB 2OPBA 2PS3A 1XTUA 2ZAOA 1M8GA 2FPWA 3RTGA 3A4IA 3RQSA 3E9CA 5ERYA 1WUJS 1ZONA 3OG9A 1LDBA 5G02A 3W9SA 6REQB 2D7JA 2BRUA 2X7XA 3GJYA 4UNPA 1I4WA 1SXGA 2F1RA 1PW7A 2VUTA 4PXAA 3PUVA 1WO8A 2JAXA 4DJTA 1RKQA 1SA0B 1VYUA 3GT7A 1ZVQA 2CDBA 1JSZA 1EQAA 1U3TA 2CCJA 3E9MA 3GU3A 1EH5A 1K6XA 2P6PA 3ICEA 3K6RA 4RUKA 3CVXA 4Z5XA 3EB9A 4NU0A 7AT1A 1FDWA 5JZMA 1Q6YA 3IMGA 4H18A 4MS4B 3S99A 2YV1A 3ORHA 5DCUA 3E82A 2Z3ZA 3G88A 1IBRA 8ADHA 2GAFA 4KE6A 1A9ZA 1SVOA 1V95A 3OCUA 1Z6ZA 4PYOA 4IVRA 2C03A 3RQIA 2VNIA 4QFBA 3IPLA 4HB0A 1X9GA 2VSYA 4DMCA 2HQ1A 4U7DA 2OG1A 4JKYA 1VIMA 3IX7A 5K1ZA 1WB4A 3NRJA 1RYNA 3IDSA 3IIIA 4ND8A 1ATZA 3I5UA 4I81A 4OUDA 3DT6A 2QD3A 1YHNA 1XLVA 4DZZA 1A88A 4K9OA 2PIAA 1UZUA 1JUDA 2ENUA 5IVPA 4G0OA 2DGDA 3M89A 1NF8A 4PAOA 1P6UA 2ZGVA 3DYVA 4P53A 4YDHB 4AZTA 4TWZA 1SR8A 3FPJA 4J0DA 3IO5A 4IGEA 1H85A 3LVFO 4U7TB 4X93A 3UOWA 1SG6A 2YCBA 2H4FA 4I1UA 5FUXA 3AKDA 5NULA 1VSUA 2RG1A 3PJDA 3IUQA 4XM1A 3BGOS 3M0EA 5E9AA 4CFSA 1E64A 2NZ8A 4BMCA 3EJ6A 4BMYA 4LX8A 2JJ8A 3HN2A 5F7XA 1M6VB 2HMAA 4MROA 3KQOA 4UU1A 1T8TA 4FCCA 1OH7A 3MIIA 2QN1A 2YJ4A 2VJYA 4II3A 1JILA 1BVYF 2EFEB 4J7XA 1K4KA 4Z1MA 5TEWA 3DTTA 4B3TB 2WTXA 1JJ7A 1OV4A 1XCPA 2YWEA 1RVDA 4JT9A 1NW6A 3HCEA 1TVMA 3SDBA 5FR2A 2ONJA 2OV1A 3WRYA 3GCDA 2YBEA 1UJMA 4K88A 1KQGA 4QXPA 3EEIA 2X5JO 3NAGA 1E1CA 1J09A 3DW3X 4Q48A 4RORA 1II8A 5DZSA 1Z2CA 1M10A 4CLOA 2QN9A 3STTA 1XNQB 1JYEA 2IXGA 2BGTA 4Q7MB 1QIDA 4B4KA 4D9IA 3J7AC 3ENNA 1RXWA 2O4CA 3I0NA 3VOBA 3D2AA 2BT4A 1FSSA 2N9UA 1U99A 5CJPA 1N4DA 4EJSB 3EPHA 3I9LA 5SY9A 5JAUA 1MQSA 4HRXA 1XZCA 2XTJA 4W1PA 5BW4A 2AWNA 1ZU5A 4LZJA 4QM6A 1DIGA 5BO5A 2C1EA 3TL3A 4DC9A 5HJEA 4HEA1 3BSWA 9LDBA 2HUPA 3KZVA 2I91A 3UXMA 2HLDD 4C7JA 3C6MA 4JAVC 2YY6A 4L4UA 5C31A 4B3HA 3PJGA 3HXOA 4WA7A 1ULAA 5MF6A 2YMMA 1FRZA 1RM3A 2JFNA 3KKMA 3R5SA 1C4XA 1DEXA 2V55B 2DR2A 4KIUA 2M6SA 3HYCA 4QICA 3S28A 2D2IA 2F00A 4F84A 1V3VA 4EG4A 3KSRA 3KSAC 2IYOA 3RRXA 4PSAA 4HTFB 4BP1A 5C80A 3SC2B 4JI3B 4HAWA 3GLHE 1VBNA 4YRJA 3IXLA 1D0VA 2CB9A 2CDAA 4FBGA 1RPAA 4B7CA 3QE9Y 2MMCA 5FPKA 2DSTA 4QAJA 5AW7A 3HJFA 1L5VA 4OJYA 1NJ6A 2EJTA 1BHJA 2FRDC 1D4AA 4E88A 1D6NA 4AK9A 3HU5A 1YD7A 2R5NA 3PL5A 4I4LA 3R8FA 1TJNA 2VK1A 3FOEC 4OKIA 1G42A 1E3QA 4M1ZA 1KVUA 4QGBA 2XQGA 4K2HA 5CGZA 5LXTF 3RRMA 4ON9A 2E5WA 4F3NA 3TZQA 1OFTA 1VPLA 5KS2A 5DMHA 4M1KA 1CBUA 3F7NA 2FFBA 1UOEA 4WFQA 1E3MA 3W2HA 5F12A 1TRHA 1GL6A 1O58A 1CJKC 1EHCA 4DHEA 4CR7A 1YJ8A 1E1DA 1AV6A 2G4LA 4REMA 3HJGA 4PSDA 3OMWA 2BEJA 2GN8A 3L46A 1Q0UA 3IURA 1XDZA 3PS9A 1O08A 4GKAA 1DUSA 2A78A 1Z34A 5CFZA 1VPWA 4UHKA 3WLHA 2I3GA 3AETB 1O94A 2V4ZA 4CL3A 4R05A 1X7GA 3TAHA 1MEEA 1C80A 1J2JA 3IGFA 2E18A 1JTEA 3LZCA 5LYYA 3LC1O 1DQYA 1JP7A 2BI7A 3IQHX 3QBTA 4ID9A 1IOZA 2QZ4A 1U2EA 4C6TA 4CODB 3JASA 4X1YB 2DOKA 2XBUA 1KARA 3KUUA 5KWVA 5CYOA 5DHFA 3BUSA 3U3ZA 4OKNA 5CDFA 4WE3A 4KPUB 2PT9A 2ZBDA 4UKDA 2GA8A 4GC9A 4KODA 3ZLJA 3OT1B 1ZW6A 4L7VA 4EG5A 3LTNC 4N3CA 3JZIA 3K70D 4NARA 1VG9B 1OAKA 1KO8A 1D03A 3MIZA 5JCJD 2A0XA 4ZYZA 2BHLA 1CR0A 2X0DA 3SJBA 4DYDA 2LCFA 1QF6A 2RCYA 3RGGA 1JNXX 3MWLA 2VXYA 3FVQA 3P32A 3HJRA 5BW6B 3VQTA 1EXVA 1M2GA 5HQTA 1QQ6A 3FYDA 3EZXA 4YAIA 1RXSA 2RBGA 2Q28A 4V0OA 1AT1A 2YHUA 4F8JA 5DEOA 4CMBA 2YWJA 3I09A 2R1ZA 5K8JB 2Z1MA 2LWIA 3FROA 2REOA 4UASA 3T3MB 4AKTA 1H4SA 2VA9A 4FNMA 3QVKA 2P3LA 4FDMA 4MUJA 1JPUA 2ZREA 5A4FS 3AIIA 3RTEA 4U6SA 3YASA 1ZO8A 3OJXA 1KZGB 4RF4A 2QGFA 3U1VA 4OUKX 4IDQA 2OYRA 1H9AA 2VF2A 2ZWVA 3I92A 3K15A 4FOOA 2GZ1A 2I5PO 4X1KB 2Z2YA 4EA9A 1FRVA 5B58T 1KBQA 4K6HA 3ZHXA 2WI8A 3F2IA 4FB4A 1OQAA 3DP7A 3JYPA 5ARDA 3WIEA 3DEFA 2YOHA 3ZZNA 5J4LA 4DCUA 1RTKA 2Y27A 1R8YA 4MGYR 3ZNQA 1KMCA 3JU3A 1MZVA 1W29A 2XMBA 2XMDA 4U1RA 5JAPA 1KVQA 1U94A 2EFHB 1ZI9A 2CGEA 2IP2A 1AO0A 4Y2XA 1IWPB 4X45A 3WHPA 4UFPA 1NYRA 4RVGA 3T7DA 4U6NA 3MYRA 4LNUB 5JCOC 1BA2A 3TECE 2WVHA 4D9CA 5CXQA 3TRKA 3GLGE 1Y33E 1SBIA 1Z22A 3A8TA 4A0GA 4ER6A 1RAFA 1B8OA 4TTPA 4O3MA 4RMGA 1G3RA 4ZI5A 1JJBA 2HA6A 2W6JA 4ZDWA 2B0JA 5ESDA 1KYQA 1E0JA 3TAUA 4D43A 4WZBB 1ZBQA 3T15A 3O3OB 5GZ3A 1O6CA 4BUCA 1F1BA 3MWJA 3PRYA 3FNQA 1CQJA 1UMBA 2CW5A 2P27A 4GPIB 5G2OA 4EI9A 4ENUA 4Z7QB 2B94A 5CDSA 5KTOA 3M3DA 2B37A 2QD2A 3TI9A 4JROA 4RESA 2R7KA 4WZZA 2JFVA 1L4UA 4TMYA 4M1WA 4I6GA 4YXWA 1L6RA 4Z6KA 5H4HA 1EX1A 2A30A 4A6XA 1FU7A 2JK0A 4BNKA 4WK2B 2GFHA 2VRWA 2GLUA 1OFGA 4NBSA 3LKDA 3OQOA 1D5WA 2AD5A 2HXYA 2YJ6A 1I8TA 2CL0X 4KVGA 4PG4A 2YUTA 5AKJA 1JTFA 5CEFA 2CV1A 4MLPA 4XLZA 4EKIA 4ZAXA 2VDQB 2FZCA 2X5NA 1EMDA 3WDKA 2G9NA 4CKWA 2C99A 5FAKA 2Q62A 1U90A 1Q0PA 1U8EA 3ILSA 3L0ZA 3B2QA 3QXXA 1OXTA 2VZ0A 3KE8A 4Q05A 1QC5A 2JLBA 4QNNA 1OBCA 5KVAA 4YMLA 1P45A 1F6BA 5TQJA 1I1NA 3L6EA 1T5LA 1U28C 1FU4A 3ZIAA 1ZJ6A 4B3JA 1S9DA 4U2CA 3PL1A 5HW0A 3FHTA 2ZTHA 2QGZA 4MYSA 3ENVA 4F6RA 3QOXA 3I04A 3QE3A 4TTVA 4KWEA 3RIXA 3NG1A 1P9WA 2J9FB 4BECA 4C3UA 5EXTA 1KMIY 5MN4A 2XBMA 1V1JA 2WSMA 1P2DA 1QKKA 1X0VA 1I10A 2ISSD 2WWTA 4YPFA 3RT9A 3ZZUA 5A5GA 2IHKA 4XYLA 3LBNA 5AH0A 3KE9A 4HQ0A 2OOKA 1NIJA 3RFFA 4JLDA 2QM0A 3P2JA 5EVJA 1IM2A 1USVA 3H9QA 3SNKA 5JLJA 1CYEA 1MTOA 4NCIA 1Z0KA 1RCTE 4LOKA 5BOSB 2R1VA 4UM9B 3B9BA 2V97A 1I2CA 5E4JA 3UCFA 4AF8A 3U7HB 5GJBA 4TVKA 3ZX5A 1P3JA 4YACA 2QIPA 2PSSA 3IVXA 5IYZB 2R6ZA 1QCCA 4PLWA 1PZGA 3DOUA 1O5TA 1UKZA 1JG3A 4PGHA 4YA6A 1NNI1 3LIIA 4XE5A 3NV7A 4TTQA 1RJEA 1LRJA 2J5RA 1FFGA 3PQ5A 5DHAA 1P6XA 1X7HA 1SXJB 4Y9UA 4G1EB 2BRUC 2XDAA 3GAMA 3KL4A 4KE8A 1JE1A 3W5UA 3A36A 3U39A 4NKRA 4GHWA 2C2ZA 1I6WA 3VGPA 1NMEA 3ILXA 3NDPA 3TJRA 2G36A 3WGYA 4I7EA 3SVLA 3SSNA 2O07A 4FMDB 1QIKA 1ZN9A 5KNDD 1EZ4A 1VRCA 1U6JA 1QOPB 2QQ0A 2FV8A 3QITA 4NC9A 1N6KA 3BCHA 1IHOA 1E9SA 5CW1A 2C7QA 2NTYC 4NYIQ 1YFJA 5L45A 4IDOA 3U7GA 2SBTA 1BHO1 3UAOA 1TU0A 4PC7A 5G3YA 4BNTA 4PPGA 1AUXA 3TOXA 3U60B 4IX9A 2WWFA 4RTOA 3I28A 2DHEA 4ZQHA 2HWKA 1EFCA 2X9LA 3VOAA 2FZWA 3GBVA 3AI2A 1DWQA 1T2EA 1KI3A 5ALFA 1A5TA 1NPDA 1PN3A 4ZEOA 3SYTA 4RY9A 1CFZA 1KH1A 3UYKA 2G7ZA 4BQSA 2YOFA 1YASA 3AR5A 1HLPA 4FP9A 5TQVA 1XZEA 2PZAA 1QH1A 2GBIA 3Q3HA 3ASUA 3QHAA 2Y68A 4G5RA 1J7KA 4CM9D 4TZTA 1GG8A 3MQ4A 1L5MA 4GECA 1J8VA 3OCCA 5H3LA 1L5HA 2OCAA 4J49A 4G5SA 2H9YA 4ZV4A 1G6HA 4F86A 4OHKA 1UBFA 1F8FA 2VCYA 3MMNA 2ZBVA 4B80A 3BGWA 3OCZA 4ZVKA 4LCJA 3ND7A 5L6MB 3W5BA 1GGKA 2PWZA 4LGMA 2EKBA 3WGUA 5AVSA 5F21A 4N5MA 2X7HA 1CD5A 3QKTA 1RYZA 4PBSA 4H1VA 5HHTA 1HYHA 1XZAA 2GHIA 3P9SA 4LV5B 3FPKA 4Q02A 4REQB 2PFKA 2VPXA 2WVAA 3TSAA 3R3UA 3V6LA 2LCIA 1B76A 1PT7A 4MYTA 3FY4A 3VZQA 4RGQA 5EKTA 4BVJA 1DCFA 4H6PA 1IUPA 4S0XA 2NU9B 5DHPA 5C1BA 4CM4B 1MW9X 2PUFA 5AVJA 3K0BA 1RR6A 2EBWA 4H08A 1TM7E 3CEMA 3PU6A 4YJ2F 1EK0A 1QG4A 3FOWA 4G1CA 1J2RA 3BXFA 4V2IA 1CHDA 3WRYC 5K6AC 3OE5A 1SU4A 2NADA 1UK9A 4JJIA 4N0MA 3BL8A 1GRVA 1K4MA 3CHYA 1ZKMA 4FYIA 5CHEA 3LVBA 2AC4A 4D9NA 4RTSA 2C0CA 1XEXA 4H3VA 4BNJA 4YAFA 3ZVNA 1CJBA 1QNLA 1XDWA 2LXNA 2WP8J 3N2ZB 2Q2VA 4IIVA 4N12A 5B3JA 5CEJA 3C8HA 3M2PA 5J4VA 3JVVA 5KBYA 5J2TA 2ATEA 4GWLA 2B5VA 4QBIA 4FFVA 4DLKA 2VTBB 1KJIA 4UVEA 4ZODA 3N2EA 3RBAA 4OX9Y 1F6DA 4HDRB 2WJVA 2DQZA 2EFYA 2P6NA 3DBVO 3AF1A 2PGLA 1IEQA 3WLLA 2A84A 4PZAA 4BP9A 2JJ2A 4K6GA 3WNDA 1N6RA 3AEXA 2O20A 3OIGA 5LQSA 3C7DB 1KWGA 4QU5A 2VA8A 2WU4A 4R2MA 4Y6OA 5IT0A 4XX0A 2B20A 2V6FA 3K9HA 1NBMD 1ISPA 2CXOA 1MB9A 4UOQA 5THKA 5BQPA 2VPZA 2YCLA 3JSAA 1LPNA 3QFTA 2EG5A 2FP3A 2ZKIA 3NR2A 5KTKA 1EIWA 3MGKA 5LU9A 4IO1A 2JGJA 4X6LA 4B3BA 2O3JA 1R9NA 2PU5A 2CHFA 2ZXFA 1Y8CA 2VHEA 3C5HA 5FPSA 4GGPA 4ALIA 2ANCA 2CBZA 3JALB 3HZRA 5M5BA 1XQ9A 3BM5A 4BQIA 2VHVA 2MSEB 4KI7A 1SAYA 2D2FA 3BRQA 5JVDB 5EIXA 1R0SA 3EWIA 3R4VA 2WINI 3SSMA 3TR5A 2FE1A 4UUAA 3ZWKA 3AH8A 4Q47A 3T35A 4YRZA 1P9RA 1XTIA 2XSZD 3H9CA 2JVKA 3LOUA 3QYAA 4IIYA 4PBTA 5TT1A 4KQ1A 2ACKA 3GUVA 3IAFA 4AC9A 1QOZA 3PFBA 4EUKA 4FGJA 5ICSA 1IBMB 3F97A 3FUCA 2C7OA 1I4EB 1KOGA 1V8PA 1VLMA 3A9TA 2PLWA 2WFMA 1UDAA 5FWYA 4RPGA 3CRNA 1EX7A 1OTXA 1BWSA 1W47A 1YE5A 2ZUFA 1WMFA 4HCJA 4ZI7B 1WNFA 1FPQA 2B6NA 4YRAA 3BGIA 4KPFC 1BFUA 1MFPA 1E7QA 4QU8A 4Y1EA 1R74A 5J23A 2IH5A 3SD7A 4LI0A 1O94C 1HV8A 1Q95A 4J3JA 4WPGA 3OBIA 5KTMA 2ZJOA 1UBKS 2XGOA 3NIDB 3CKLA 3U81A 1RBQA 3GLIE 3GIWA 1IXSB 4UZFA 1VI5A 4YJ2A 5IT9A 1DKRA 3SQOA 1JHAA 2J31A 3ZE9A 4ZQIA 2QMUA 3WFIA 4BEBA 5A9SB 4HDNB 4MR8A 3KQPA 1ZH8A 4Z4EA 3KYJB 1KJWA 2GPSA 4HQLA 2P7IA 3KKNA 5AW4A 1W1UA 4RD2A 4WCDA 1GSAA 2BGNA 2H4JA 2WWXA 1LQTA 1NR5A 5EIFA 2ZR9A 2R2AA 2O05A 1PAUA 3BK1A 4KXLA 1JS1X 3SGLA 1NM5A 4C3VA 1C7ZA 1PZNA 3GZNB 5LA6B 4C08A 5EPEA 2ST1A 1IYZA 3VAAA 1I7QB 4M89A 4TKUA 3I01A 4MPJA 4J3NA 4BZZA 4KWTA 4MVWA 5JXGA 1EESA 3CZPA 1G8FA 2Q9BA 3CZMA 3NATA 2OV4A 1X80A 2AIRA 3KZNA 4XDYA 3ZHTA 3ECCA 4R2LA 5REQA 3WLSA 4F3RA 1Z5UA 2YVKA 5KNCH 3QFRA 3EZ7A 2XYPA 1Y3HA 2GO1A 1WCV1 4YUZA 5A4IS 3NM5A 1XD2B 1CP3A 2BF4A 2XA1A 2IUFA 4R8MA 4XGIA 4OA8A 4YCBA 4X8LA 3S2IA 3P1JA 3QYPA 3ONNA 4BP3A 1Z8DA 4KXVA 2OBXA 4BKMA 2O8EB 1ZN7A 4IIDA 1DV1A 1PL6A 1T8RA 1Y3DE 2YWRA 5IT4A 1S2IA 3ANLA 4FTWA 4REOA 1KWKA 3A27A 5ETJA 2WTBA 3Q9NA 3VJRA 1ACLA 4WY8A 1UBUS 1KY4A 3U7QB 3VC1A 3IPXA 1VHWA 2JCVA 4JYCA 4B7XA 1HZZC 4IGAA 4MH0R 1IN1A 4XWOA 1R0RE 1UJBA 1SZDA 3ZXSA 4HZGA 1R3UA 2Q07A 3JATA 4I5IA 2DCUA 4YCNA 3H2HA 2P3OA 2FQWA 1PX2A 2E49A 2POCA 2RK4A 5JSZA 2XUOA 2PVSA 3EEOA 2IS6A 1HE3A 3M9LA 2PZFA 5DX8A 2JZNA 2JGDB 1QFJA 1JALA 2Y2VA 1JI3A 3A58B 3D0RA 3R74A 2ZRFA 4CDNA 1DS6A 1N2IA 4KUGA 1RC0A 5A3JA 2IOFA 1IZYA 2O2IA 4A7PA 3IEVA 3AKCA 3JQAD 1FP4A 4ISCA 5COBA 1B93A 2OXIA 1O6ZA 2VG8A 3MS2A 1D09A 4YMUA 2GBCA 4I1SA 2QTHA 4IHJF 2PRKA 4NWIA 3C85A 1HG1A 2JHPA 2TMYA 3PDWA 1TMYA 3PE3A 1CUVA 3F6RA 4KYTA 4WJLA 3BS4A 1MAHA 3K2QA 3I9JA 1DO8A 1RTTA 2E5LB 1Z6PA 2J0UB 4AY3A 1Y7PA 5EJ9A 4COOA 2FUEA 5HF5A 4BN4A 4ND5A 2I6TA 2GVZC 2M9MA 3LXXA 1Y9JA 3LX5A 2HHLA 3EXHB 3H1EA 1VDZA 3MJFA 3OCWA 2FMHA 5IFLA 1LSJA 1E5TA 2NYUA 3DNFA 3KHUA 1N2BA 3JQBA 3T1OA 2OHGA 3BD8A 3WGNA 4R7TA 2QM8A 5CJ2A 3V7YA 2HRRA 2F9FA 5ED4A 1SVUA 3WNZA 4J7AA 4GS5A 4AN1A 3BMOB 4K9RA 3QP9A 2WNSA 2BF7A 3W6OA 4E32A 4ESOA 1G2PA 3E35A 2W8ZA 4MJXA 1QRSA 5E8RA 3KX2A 5K0SA 4LJRA 5DOVA 3IJPA 1E2PA 5ALGA 4BWFB 3HABA 3N2KB 1HUQA 2CLKB 1N3YA 1M67A 2P41A 1N5KA 3USES 1EA7A 2OMKA 2PY6A 2FVXA 2B8WA 4KOAA 3MWEA 4GM0A 4RTPA 4MV6A 5FWNA 4OAOA 4C14A 3RU9A 2FKNA 1JE0A 4L6CA 1C3XA 1UWLA 4DLUA 1B2LA 3GAZA 4MQ6A 1MT0A 2HSEA 1TI7A 3C4QA 4NPCA 5L6LB 1Y8RA 4LOAA 4CMAA 4ER7A 4V1CI 5GWXA 3QBJA 4Z53A 5I7SA 1PJ8A 3KLOA 2WYHA 2F55A 1ANKA 3SF0A 2TS1A 2LTAA 4G97A 4E12A 5JV5A 1DKOA 3B1KA 4XQGA 1BRTA 1O96A 4YRLA 2PGJA 4U7HA 3JS5A 1QQAA 2AVNA 3GNTA 4M7PA 4TS9A 5I5EA 2FOXA 1J5EB 3CN7A 3EPPA 4ITVA 4UEKA 1V26A 5AW1A 4F8EA 4ZZIA 1NMYA 1B8VA 1E7RA 2EKPA 4FYVA 3R7LA 1O97D 1W35A 4NQRA 1HORA 3RNOA 2IXDA 1N8KA 4PAMA 1T5TA 1A1SA 2I2WA 2VNSA 5JY6A 2IPAB 4HQ6A 3TTYA 1MB0A 4NJEA 3NUGA 5EXPA 3PPXA 1XNRB 3LH5A 5BSKA 2ERYA 1PK9A 2VYND 3EGWA 2CXUA 2WIJA 4B8YA 4G1BA 5GGYA 3HPQA 5TMPA 2ZVJA 2B8NA 4IDPA 4LISA 1ZAYA 1TO6A 1X0XA 4FNGA 4YT8A 4KREA 1UJCA 1T4CA 2A35A 4NNOA 1MOZA 3G85A 5DHUA 1YS6A 4G36A 3GRVA 4PLTA 2H2FA 3RE1A 4D4HA 1FDVA 3HA5A 1PJ4A 1PL0A 2VR1A 1QH9A 4KMSA 2XT0A 1QRRA 3KEGA 4F9EA 4FM9A 1Y1PA 1RQXA 4C4RA 4NJOA 3S44A 2ZRIA 3QNMA 5IC5A 2C8JA 2E0IA 2G0TA 4ZVQA 4P3PA 4O4LA 3LUHA 3QX8A 2TMGA 3KELA 4XIGS 4NG5A 3KBBA 1UK7A 4JLOA 1XGKA 1TL7C 1HL7A 3L7KA 5E1OA 5DWVA 4O5AA 3K16A 3TQOA 2CL6X 2GRAA 1GKIA 4RS3A 3AUXA 1T9BA 3S8EA 3ZHQA 4K40A 5CR9A 3NOQA 5DI3A 4I1RA 3BF8A 4JI0B 2Y9PB 3LD9A 4N1AA 3OQJA 3K0CA 4HAIA 1YMUA 2WQZA 4OMCA 3ZD9A 2DRIA 4H4CA 3UJNA 3ZVKA 1IZ9A 1YS7A 1TYZA 2YXEA 4TRNA 2TMDA 3QTTA 4JQCA 1I9GA 3IJRA 3IV9A 1GZVA 3H3JA 3RWMB 3AJEA 4A8JA 1JHUA 1GQYA 3AXTA 1AXEA 5L3SB 3LUFA 1K1EA 2GLTA 3H75A 5GAJA 1Y1RA 2VBIA 3NCTA 4WKGA 1Z6XA 3CBGA 5A9RA 3KB8A 3AF0A 3ROKA 3S2FA 5IRCD 3HY4A 1EBBA 1LTQA 3KS9A 4CLRB 4JSTA 2ZYAA 3ABZA 2HMTA 4DE5A 1TQDA 4EUEA 4ENVA 3N0RA 1XDBA 1USWA 6Q21A 2QJWA 4LJLA 5D5HA 3EXEA 1EGHA 1QZTA 1YS4A 2Q1SA 1IM5A 1C2YA 3FFWA 3LBAA 3LVRE 3PRKE 4NV0A 3RSZA 4IFTA 2JD1A 2HT1A 4EW1A 3IB6A 3R3JA 1EQUA 3BTUA 3AUJB 4ZAZA 5JOQA 1YRHA 3LGSA 4XVRA 4Q9DA 2O1XA 5TMBA 3L7NA 3WDSA 2NV6A 4NSNA 1E3EA 3HB4X 1L7RA 2ICAA 2ZJAA 2QMQA 4W1RA 3MAJA 3DBRB 4AMGA 5KKNB 4GKVA 4L0MA 5FPYA 2DY1A 1LQ2A 2DFNA 1ECFA 5A4DA 3F96A 1YK0A 2G1KA 3FMIA 4GEGA 5DYIA 3VR5A 2ZCVA 5EUBA 2GYWA 1N25A 2PVPA 1KDOA 1QFXA 1V3UA 1VB3A 4LXGA 5JBIA 2GZ3A 5E9QA 5PNTA 3IB3A 3MWDB 1DMRA 4EUHA 2P1DA 1QP8A 3FYUA 4DUZB 3CVJA 1XD9A 4U2BA 2IZ1A 5I8ZA 1G4AE 3RUAA 1THTA 4M22A 4MV5A 3N6VA 3VTZA 5B3JC 3CX7A 2ZS7A 5FJJA 4MB6A 4XSGA 3U9SA 4KXWA 3OQIB 3UAVA 3G2IA 1ZRSA 3E5MA 1GARA 1W0JA 1PL7A 5A3VA 3WGVA 2IY7A 4JB3A 5B4VA 4E2XA 3RYCB 4XJTA 1DJQA 3DZHA 4TL9A 2BGUA 2GZDA 4U3JA 5AVYA 3U09A 4RFSA 2EBHX 4QFDA 4GU5A 1DJOA 3K2EA 3PFWO 4YS6A 5BN5A 2EBUA 2R5WA 2JGRA 2JGIA 2DERA 2DLCX 5I45A 2ESRA 1WKBA 1Z0SA 4R1MA 4OLJA 2GXQA 3BHIA 3OUTA 3ZJUA 2PLRA 1G20B 1I7SB 2DH5A 3SHWA 1J6UA 2H4XA 1J8MF 4UVHA 5K3AA 1WW3A 3U0VA 4NENA 5BUCA 1YQDA 2YDXA 5ICFA 1FU8A 4B6SA 3AFMA 4BGDA 5JMOA 4URUR 4KBFA 4L9SA 1P33A 1PV4A 1AZTA 2P5SA 1O4VA 4B6JA 1OZGA 2WWHA 4R2KA 2W2PA 4LECA 4A9AA 4RWZA 4J07A 4QQFA 4DV7B 1AB5A 1QRUA 3IJ5A 1GA6A 3OQNA 5ENDA 4H77A 3TL2A 4GMFA 5TPZD 1JNYA 3PDHA 5JYDA 4KTTE 5ER6A 3HVHA 4XYBA 4D92A 1E3LA 1YACA 5JQWA 1T1JA 5G0SA 4NCBA 2OYCA 4O4JF 1LSUA 3ZGOA 1GFWA 3QXHA 4L16A 4KRFA 5JUWA 1RZRA 3L43A 3LCMA 3K92A 2CSUA 3WOVA 2EQAA 1NAIA 1NVXQ 3D2BA 3FTDA 2HF8A 5DNEA 1G5HA 1LY1A 1JVBA 1SC4A 3ZDEA 4LKOA 2PTHA 2E1PA 2F1IA 2GAAA 2Q27A 2GA9A 4EMBA 2FZEA 2R6DA 2VYCA 4YMVA 2J0SA 1PR2A 2O06A 4YT5A 2VQSA 5IHPA 2ZYGA 3EYAA 4QA9A 4RK1A 2E85A 3DL2A 2AC7A 4L8FA 5JG7A 4H31A 3ORYA 3OSUA 4NI5A 2EEZA 4WZAB 1GUAA 2EP5A 3AOGA 4US2R 4J0FA 1KDVA 2WVJA 2NAFA 1ODKA 1UQUA 1OC2A 3PFKA 1AMNA 4BN0A 2XKJE 1A04A 3OU2A 1BGWA 1SPXA 2AYXA 2GXSA 3AB8A 4IM7A 4KC0A 4NZ9A 1FS6A 4ZQGA 3OY7A 4EBBA 5BR8B 4DNFA 3P2EA 3Q2KA 3ZQ6A 4Z49A 1GNVA 4XFJA 4B7UA 2RKOA 4NFLA 1XLTC 2QQFA 3VOTA 2REQA 3PEFA 1P1HA 1GU7A 4IX1A 4R98A 3BD6A 1VRWA 1SUEA 1WU7A 1G3IA 1J5XA 2WAYA 4I3FA 2ZEJA 1YA6A 4G0PA 4V0SA 4EVIA 3G6WA 3N2LA 1A69A 4UEJA 5JXHA 3G9TA 5KTSA 3B3GA 1OH5A 2X14A 1Z33A 4M0EA 5KC8A 2NP7A 3DO6A 4KVAA 1GFZA 5DF1A 1P0QA 1R4MA 3JWHA 4J1TC 2GNOA 2O8BA 4GSKA 3W3AD 3AL2A 3PPWA 4XRGA 2N75A 4GPTA 1JYSA 4FEGA 4TS4A 1Y1QA 3EZGA 5K01A 4KWIA 3I2JA 1X1DA 3A4MA 4FIZA 3UOGA 4BVFA 5FYQA 1JG7A 1T2FA 1O8BA 3QKSA 5JBNA 3TQTA 3MMSA 5JXJA 4MGZR 3MMPA 5CJJA 1ZH4A 4TSKA 4ZYTA 2IYWA 3CE9A 1I0ZA 2ZYVX 4AAYA 1DKLA 1BWQA 2GJAA 4BZXA 4UQOA 1FJ2A 2I3BA 4ALJA 4MZXA 4WUTA 2UXCB 4KX5A 5B3LA 2WSIA 3LK7A 1QK4A 2IXEA 5TVKA 1ODTC 3ESDA 1N92A 1R2QA 1T25A 2JFGA 3KV3O 3BIFA 3QKIA 3RK1A 1ZMOA 4F4UA 3PLAE 4JT8A 4Q4CA 3DDSA 4ZJYA 4YGXB 5E6UA 4FMCB 3O73A 1DAPA 1JMKC 3LA6A 2P30A 3NHUA 3EEBA 3ZLTA 1FMTA 3LPNA 4LJKA 5EZYB 4W1QA 4Q7QA 3R8XA 1IHXA 3ODGA 3RU3A 3PA6A 3DHNA 4WA8A 3JTEA 2PX5A 3CH5A 4O4JA 4UREA 1DKPA 5FUWA 3ZGLA 1HNXB 3E58A 1U0TA 1TX4B 2IKQA 1BGVA 3FZQA 3JARA 4F45A 3LHIA 3JRNA 1QU2A 1A7KA 4WNAA 3QPVA 1SQSA 4MCIA 2Q2QA 4DT1B 5KU1A 2LP4Y 2NYRA 4QQKA 4CLHA 5F98A 6REQA 1RRPA 2ORIA 4RDHA 3RYFA 3L1JA 3WG9A 2AUTA 3DB1A 5CH5A 1AMUA 1U7DA 3RS4A 1PZFA 3UT5A 2XQFA 1KQNA 3OWOA 3HKBA 1HYBA 4ZK6A 4HFJA 1W36C 2KW5A 2Y93A 4PS1A 3OTGA 2C82A 3OZGA 3OU7A 1QQTA 4G8DA 4B1FA 4AULA 3AV3A 1DPFA 2XD4A 5KQSA 2FR8C 4LDRA 4MS4A 3RVMA 1H2YA 2PYIA 3LIPA 3QUQA 5DGCA 4WLOA 4NECA 3U9TA 5FAXA 3B7PA 2X9QA 4WADA 1IE3A 3DOIA 3ZV7A 4DR6B 4B09A 3LWBA 1QO0A 2W90A 3HI6A 4QATA 4G85A 1WSBA 4HGNA 4F1KA 1SEVA 2H9IA 3ZJYA 1R0XA 4BTVA 4WIAA 1HDCA 3CNLA 4O2AB 1E8DA 2YV3A 1NUSA 2VJBA 4RL6A 4TT3A 3CPSA 3BULA 5BSMA 3WO1A 1ECCA 5HQ3A 2HDNB 4WK4B 5F52A 4ZRNA 3VV3A 3LQYA 4JXKA 1JAHA 5EIWA 3VX4A 2IZ6A 2VP6A 2P77A 3MTIA 4AO6A 4F3KA 4AKGA 1JG1A 2BONA 3SLGA 4U8HA 1MV8A 3T7SA 3F49S 1ILEA 1JU9A 5KINB 3GFRA 1W4ZA 4QUJA 5D01A 4F93B 1RNLA 2Z9DA 4OYYA 4LY3A 3CB2A 2ATXA 4B32A 2GRUA 3BXPA 3ZEIA 1IUKA 4NJMB 1I5RA 3HYSA 1QE5A 3KFLA 5ALDA 4D2IA 1E8MA 3R9WA 3H7IA 3H2IA 3WIUA 1OPRA 2MSNA 4LVUA 2I2XB 5CK5A 3SKVA 1KI6B 2HQRA 4PTLA 4JP1A 4HNVA 2CK3D 4GMXA 4IXWA 4JBWA 1P18A 5KC9A 4B73A 2I4IA 2OCDA 4WKBA 2ZTUA 3EVZA 4S2EA 4G8CA 2YZKA 2D5IA 5EESA 3HSKA 3OOEA 4EFDA 1CPYA 4OGLA 3TAXA 1ECJA 1C3OB 4L9WA 2EG9A 2NUAA 4JYMA 4QHTA 4KO3S 1T36B 4IY1A 2PWYA 5G1OA 3ELBA 1QB7A 3BTOA 4L5AA 3K9GA 4LFBB 3ETJA 1BD3A 4XASA 1WABA 2VAMA 1IXRC 1Z2EA 2VUUA 3ZLUA 1UAAA 4OX9B 2Q6TA 3BRCA 2H1SA 3D59A 4OCZA 4K0RA 2RAPA 4MTCA 3VU0A 5KSZA 2PUEA 2LVBA 1A7AA 2Q9CA 3MFYA 4IF6A 5BQOA 3UUWA 3LBIA 3D1VA 3W6UA 3OU6A 1PO7A 4Z4FA 2BHNA 2E48A 4K5QA 3P27A 4L6AA 4NEHB 1A4UA 1F2VA 5LNK6 3D3WB 3A4TA 2O2DA 2BKXA 2PFGA 2GI4A 4EJSA 4ZDJA 1QRDA 2IYSA 1WXEA 2FGJA 121PA 4UUPA 5JJBA 1KYXA 2WU0A 4TS1A 2QT0A 3HUTA 4HAVA 1WXIA 5HTKA 1R8XA 2RMKA 4GPD1 4UAUA 1RWXA 2ODWA 2WA1A 1TC1A 1ZGAA 4ZTBA 4R3NA 3W8NA 1RLJA 1SUPA 2YWFA 1GXSB 5IUNC 1F2TB 1XJ5A 2O14A 4Y18A 2M6LA 4OXIA 3VTAA 1GR1A 4E1VA 4XSHA 3ZH2A 1HDXA 3TOCA 1ADCA 4HB3A 2PKCA 4RQAA 3ZD6A 2IS4A 3I3SR 5B57C 3T95A 3BL6A 3CPJB 2OCBA 1T0HB 1PYGA 2G25A 1B16A 1J49A 3K0CC 1S8NA 4PO1A 4DDVA 1HNZB 4ZKDA 2R8EA 1SPBS 2JAQA 1NVVR 2NW6A 3RLIA 4CM1A 3G9XA 1EBUA 4A8JC 1QIGA 4DY4A 4DZRA 2JFQA 1DRKA 1MOPA 3NHBA 2IV2X 3FVWA 1HE1C 4UHBA 1E59A 1QDEA 3E8XA 3CKYA 2NIPA 5FD8A 3KJFA 2ZTSA 5BVHA 2AKEA 4BO2A 5BV7A 4L8GA 4DQUA 3KQQA 2P40A 2HMVA 1P8JA 2PGNA 4ZOAA 5ALPA 1PR0A 1IVSA 1R4AA 5HRAA 4Y0VA 3U44B 3II6X 1SWWA 4YMSA 4E14A 2YQZA 3QW2A 1I14A 4RIGA 2C5BA 4UCXA 1NXQA 2H2IA 3IILA 2OA0A 3TPFA 3B8HA 4R40A 4Q6BA 4IKEA 8OHMA 3A3YA 1DAFA 1OY1A 3EIFA 5MGNA 1PF7E 5BWMA 4PIMA 3MYYA 3UENA 4G4JA 1W73A 4OK5A 1M34E 4FMPA 3ZCTA 3L4KA 4Z3OA 1TB4A 1FSPA 3V7FA 2Q0HA 4MIYA 2PPVA 1Q20A 1YBMA 3CEPB 3LDFA 3SJAA 4LJSA 4ARSA 4DMMA 3V8EA 1DB3A 3GLKA 3HZZA 1LV8A 3CCBA 5KTYA 3H4TA 3G8YA 1V5WA 3I2YX 1ZOOA 1EKXA 4O59O 1BQEA 1BKDR 1F6WA 1I9CA 1P5RA 2BM8A 3O82A 3ZWQA 2YJTD 3I9V1 3NCHA 3AYXB 4G41A 3T3DA 3CTPA 4ZMSA 1ZD4A 1R15A 3BAZA 2IDMA 3CJRA 3FYUC 4PF1A 1X7ZB 2Z5LA 1DAHA 2P8JA 2JCGA 1T4MA 3OT1A 4BQRA 5CFLA 3E3LA 1O0BA 3K1AA 3NM4A 1QP7A 4JIGA 1SHKA 4D9FA 4NCXA 4MI6A 3KTFA 4P82A 3RS8A 5IKOA 2JRLA 4AIIA 4L27A 5ICGA 5HKOA 4Z1OA 1R18A 3P9ZA 4RZXA 5E2IA 2BVNA 4DLAA 5FO0A 4P0PB 3U3KA 3NNNA 3MWFA 4FDLA 3AR9A 5IJ9B 1E2LA 1OR8A 1RRKA 4IEEA 3EWSA 4P93A 4ABTA 1LVUA 3L3BA 1OLXA 4LE2A 5CFMA 2ZUBA 1R4ZA 2DY0A 4QTXA 1I0IA 1OXXK 1UKYA 1X39A 2IVFA 3M83A 4JL6A 1GLGA 2HRZA 1YQQA 1NQVA 1YAHA 2OO3A 4X84A 4F5WA 5AD1A 4YLEA 1T1GA 2JJMA 1Z17A 2H16A 2WZQA 4MLZA 4QXQA 1XRJA 4KQ2A 5DVZA 4L4RA 5ITZB 1SBZA 1DWOA 1E20A 5EIHA 1N0VC 5G4KA 3ZOKA 4ADSG 4WEOA 3DM5A 3E7WA 3V2GA 3ZKWA 2WKRA 1C9YA 2QRMA 3I39X 1DBIA 1KGSA 1A50B 1QIFA 4YYEA 3GCZA 3UNXA 2J0QA 3SJ7A 3A11A 2BFMA 2Q3DA 4WJZA 2CN1A 2AN5A 1Z75A 2JH9A 1RJ9B 4X1KA 5HE9A 4Y1GA 4Q7EA 1JQAA 2GAJA 3I9MA 4L50A 3AJ8A 4OHVA 5LQRA 4U7FA 3WYFA 2HM7A 1N36B 3JVIA 1RFLA 5CPBA 2RI1A 1E4YA 2P4EA 1Z45A 1ZG3A 2Q2OA 1ZI8A 2Z95A 3KYCB 5AOVA 2VHTA 2XCLA 4YAEA 5ESWA 3W7VA 1II0A 4KVZA 5IYZF 3ZU3A 2TRSB 2D1TA 1XL0A 3HCAA 1ZH0A 2F17A 2IW3A 2UZ1A 3HWX1 5ALRA 4TUYB 1XEAA 1Q92A 2K4MA 4GKJB 1FQJA 4WSOA 1W2GA 4UM9D 4ZU3A 5DULA 1PWYE 1TZ2A 4MRAA 5LMNB 4WTOA 2EU8A 1KR5A 4LNUA 3VKGA 1WKCA 4TTAA 2DKOA 2OKCA 2WKSA 3EE6A 5KWEA 4RTQA 2AJCA 2MSCB 4MRNA 1PG0A 1E77A 1W5FA 1HMPA 1A2OA 4ZREA 4TV9B 2HX1A 1OOEA 3FSEA 4RV4A 3R6GA 2GPNA 2AX3A 4BVKA 3AK4A 3G9UA 4BNLA 1EUDB 4QQ8A 4FINA 2ISCA 4FMDF