1CZOA

Comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWGVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparisons of wild-type and mutant flavodoxins from Anacystis nidulans. Structural determinants of the redox potentials.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Electron transport
molecule keywords FLAVODOXIN
total genus 58
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1czoA00
4YAOA 4ZVLA 1V4BA 1I1OA 2FZ5A 4PTYA 5LJIA 3K20A 2FVXA 1BVYF 3NHLA 4LTNA 1KBQA 3NHSA 1AKRA 1AKTA 3OWHA 4OXXA 1YOBA 3FNIA 4NLLA 3OJWA 4S24A 5NLLA 5BUCA 3N39C 3FJOA 5JROA 3K1YA 1H66A 2V5VA 3LT5A 2QX4A 2MOKA 1YKGA 2OHHA 1DXQA 3KLBA 1NNI1 2V9CA 1D03A 2XODA 3ESZA 3R6WA 1AKUA 1QHEA 5FA6A 1XT6A 1OFVA 4QOHA 4LTDA 4YQEA 1FX1A 3KAQA 3OVMA 2Z98A 4XDHA 5LLDA 2OHJA 3NHWA 2Q62A 2MTBA 4ESEA 2M6SA 2FAXA 1CZUA 3GFSA 3W78A 3HA2A 3F90A 2FDXA 4GI5A 5EA2A 1T5BA 3F2VA 5F51A 1FTGA 1XI2A 2GSWA 2OHIA 1YCGA 3B6KA 1J9GA 3TE7A 2V5UA 1TIKA 4ICIA 4U7GA 4DILA 1SQSA 1D04A 2A5LA 4FX2A 4FGLA 3OX3A 1J9ZA 2N1MA 4YAFA 3KEGA 3EDOA 2ARKA 5TGZA 1YCFA 2ZKIA 3G5MA 3O2NA 5A4KA 4N82A 4C14A 2BMVA 3L9XA 2MT9A 4H6PA 3NHJA 3EYWA 1QBGA 4FGJA 5LBTA 2Z9CA 5EAIA 2FZVA 1J8QA 2KLBA 4YAWA 3F6RA 1FUEA 2BF4A 3OJXA 4N9QA 3FVWA 3OWXA 3W79A 1FLAA 3FW1A 3N3AC 1XYVA 4YALA 1TLLA 4BMOB 3NHKA 4BMPB 1YCHA 1AKQA 1DX9A 2HNBA 3F6SA 1F4PA 1GG5A 4ZVMA 3S2YA 5ULLA 2R97A 3NHRA 1CZHA 1D4AA 1AMOA 1CZLA 1RCFA 3GFRA 4M0CA 1CZKA 1QR2A 2XOEA 3LCMA 3QE2A 2AMJA 3W77A 5F4BA 1WSWA 1SG0A 1XYYA 2BN4A 5B3LA 3TZBA 3P0RA 1OBVA 1X77A 1YRHA 2KQUA 4C0WA 4PTZA 4C0XA 2QMYA 4Y9UA 3U7RA 1CZOA 1VMEA 6NULA 3TEMA 3UXHA 4CF6A 4N65A 4GQIA 4QOGA 1RLIA 2QX9A 4QOIA 3ES9A 5FUQA 3ESXA 5EMNA 3HR4A 2D5IA 2FX2A 2MWMA 4U7HA 1AKWA 1AKVA 2FCRA 4PU0A 2B3DA 1ZX1A 5B3KA 1H69A 1YDGA 2F1OA 2Q9UA 3OX1A 4U7FA 1AZLA 2Z9BA 2QR2A 3JSXA 2X2OA 4FGKA 5LMCA 2HPVA 1ZWKA 4QOJA 1FLVA 3HLYA 4DY4A 4F8YA 1OBOA 3GAMA 5LJLA 4LAFA 5FX2A 3SVLA 2WC1A 4QOFA 1AG9A 2FLVA 4Y9RA 2OYSA 4GR9A 4C76A 2BZSA 4QOEA 1J9EA 2QWXA 4HEQA 1CZRA 4DIKA 1RTTA 4J8PA 4QODA 5LBUA 3B6JA 3FX2A 4ZVNA 1RLJA 3B6IA 1E5DA 3NHYA 1CZNA 1T0IA 3L9WA 3RPEA 2QMZA 4XDGA 2FOXA 1C7EA 5LVAA 1WSBA 2R96A 5NULA 1B1CA 2RG1A 2HNAA 4NULA 3D7NA 3O73A 1QRDA 3N3BC 5F12A 1JA1A 3U7IA 4ZVKA 4HS4A 3NHPA 2M6RA 3ESYA 3OX2A 3NHUA 1KBOA 4LA4A 3UXEA 4D02A 1ZWLA 3GFQA 4YAUA 3NHFA 4CETA 1C7FA 1FLNA 3KAPA 1FVXA 2QX6A 4R81A 4Y7CA 3B6MA 2Z9DA 3QFCA 3QFRA 1DXOA 3W7AA 3NFRA 2W5UA 1AHNA 2BPOA 4H2DA 4LTMA 3ZHOA 1FLDA 1BU5A 1JA0A 2X2PA 3NLLA 2QX8A
chains in the Genus database with same CATH superfamily
4Y1EA 2XSZA 4OSPA 3ZWOA 5B7QA 4YONB 4CWAA 4UPEA 4LJSA 2FU5C 5B1SA 5UKDA 4KV9A 2CVPA 4URYR 5JFTA 3ZDCA 2Z4TA 1WQ3A 1G6KA 4FKBA 2HKIA 5ALDA 4CNQA 3A6PC 2GN6A 1EM8B 4G1MB 3R6WA 5BSWA 2V45A 2LRHA 2H0QA 3EEIA 2R6ZA 3CE6A 3OCJA 3O1HB 3A2LA 3B7GA 5DHSA 2YZGA 2MTBA 4M22A 1NYTA 3CMMA 4CQJA 1KTIA 2WVGA 2HCTA 1GITA 3JVUA 4CMEC 1IJEA 4Q21A 1VDMA 2J67A 1AUVA 1PD1A 2D1SA 3ME5A 4ZDIA 4JV5B 1Y6ZA 3HP1A 3G17A 1VIVA 2D2EA 3TE7A 2ZJAA 2WT4A 4ZJYA 4GZ6A 4GX2A 3NUQA 1DRJA 2LCIA 2N1MA 3MOSA 1ORHA 2Y6VA 2XY4A 3ESQA 3NGMA 2IXFA 1ZONA 4FINA 4QEKA 2AN5A 2JVKA 1N0WA 4C89A 4IRUB 1PD0A 1T8UA 2AFVA 1JJFA 4MCIA 5AIAA 3VKUA 2OE2A 3QKUA 4CF3A 5IMSA 3K72B 2AVNA 1PFYA 2BV3A 5EAIA 4D0NA 3B3GA 4DY6A 3ROQA 3AVVA 1AKYA 1LZKA 4N03A 1JSLA 4R1TA 4QYTA 2CL0X 4EI7A 2WTAA 4R9RA 2QLNA 1C1DA 3N87A 5LIRA 2BMDA 5LZ8A 3E48A 3I5MA 3N0VA 5J2UF 4UUBA 3A8TA 1WKBA 2CMHA 1CJUC 5KYKA 2X0IA 1U8YA 2DOKA 1V41E 4H7IA 1X7WA 1AMUA 5A3SA 4DG9A 4A8HA 3X1XA 3ECCA 3G13A 2NU6B 1KR5A 1NP7A 1OLOA 2NZWA 2ZATA 3HYLA 3BXEA 3A37A 3WBFA 5CBPA 1M6NA 2GD0A 4QLOA 3PEFA 1NOJA 3ZY2A 3DUWA 5GZ1A 3A6DA 2MSEB 2JLVA 3ONVA 4IV0A 1NKTA 3DPUA 4BECA 2W6IA 2QUBA 4KTVE 3G0IA 7REQA 4IIDA 2ZRBA 3LYAA 4F6LA 3Q41A 1YVRA 1GAXA 1PGPA 2H6EA 5FBVB 1OWOA 4C4PA 1RQPA 3LWNA 1I10A 1U7UA 3BL8A 3AF0A 5HF5A 4BZWA 1TLFA 4YRTA 1WQ4A 1AVTA 2P41A 2J9RA 1ZSNA 5LKRA 5LOVA 1WOYA 1V48A 4F85A 4J0CA 4DIFA 3N2KB 2A5DA 2J0UB 3TSCA 4P98A 5CAEB 1ZAYA 2GA8A 3FB4A 1R0WA 4NFYA 1JE1A 2BDUA 2IHZA 3C5CA 1BC5A 4WAUA 4LHEA 2JL1A 2OG1A 1JEEA 4IEIA 4MK4A 4PFKA 4TUYB 5IXSA 1JQ5A 2YNMD 5FTKA 1JXAA 5IBQA 4DPKA 1Z6ZA 1PBNA 2CNWD 2H2IA 1B6GA 2HRZA 1PT6A 1BFKA 3IP6A 5BP7A 2FX5A 1P7ZA 3GT7A 3HUUA 1COWA 2PE5A 2AVDA 4BCBA 3AETB 1UIMA 3H5OA 1Y4AE 2AF3C 2FXIA 2ZYDA 4REMA 3TTXA 1QVRA 1H05A 1G18A 3QFCA 4OKIA 5HF6A 1JEQB 1GGHA 3A1VA 2FSHA 4O3FA 5MF6A 2V0CA 3FOBA 3UT6A 3Q3EA 3ILXA 2XCOA 1DLJA 5BNTA 1T29A 3RVOA 4CLRA 4MVJH 2G80A 2VJPA 4CCYB 2PO5A 4EX6A 4K6CA 2CWWA 3QMWA 2WUDA 4AS1A 4E2FA 1OFHA 3PC2A 5LNK6 4GAEA 3KQHA 1E3WA 3MJDA 2H08A 5DHQA 4MW2A 2ZIWB 3OE4A 3JASB 1CEXA 4JLWA 5D87A 2EJUA 5EJ4A 5HRAA 5CPFA 4OQQA 3ZY5A 3VR5A 3MPUA 5EPUA 4D9CA 1QE5A 3VZSA 4EIWA 2P6MA 1FK8A 2OO5C 3MWGA 3PZRA 4TM7A 1GZHB 1VB3A 1CZUA 2C2OA 3C39A 4JT8A 1DEHA 1AH2A 2J4FA 1YZYA 4PX3A 5CPBA 1RMYA 3UMCA 4MIKA 1LFAA 1YCGA 5TF0A 5JCXA 4RTQA 4DBLC 3IIIA 5KVSA 4H3VA 1Z5UA 3WV5A 3B5JA 3INGA 4JNKA 3OQIA 3ZHYA 3WRXA 1N5KA 2PS9A 1CY1A 1ZQ1A 2Y1DA 3UUEA 1OVMA 2O8BA 4AM8A 4F9GA 3FHLA 3QUTA 5IABA 1T36A 2O7VA 1IBSA 3EZFA 3HBAA 3TSAA 4E7OA 1HGXA 3HR7A 4EP1A 2WG2A 2HBRA 3REFA 1NY6A 1GKIA 4HVLA 3HTXA 3W8NA 3C48A 3M2TA 3UMGA 1MH9A 2C54A 3ROMA 4ENTA 3HXOA 2JCGA 5B64A 1ZVMA 2X2FA 4KDCA 1R0SA 5FNZA 4M1TA 4PO8A 5AUNB 2OV1A 1OT3A 4DJFC 1Y8RB 3HKDA 4CN8A 2N9UA 2B2NA 3HQ4O 5DE3A 3TM5A 2XW6A 3WRYA 4PZAA 4BU0A 1M3SA 4JB3A 1G8JA 4G6ZA 1Y6JA 5ILOA 4NXNB 1EJ6A 3DFMA 3AJDA 4HDMA 4X66B 2REOA 3I6QA 3L49A 2IOQA 2W00A 1AO3A 1BX3A 1KVUA 2VH5R 4HQRA 3G8BA 5JCJA 5JRJA 4EO4A 3RIEA 1XP5A 1OI2A 3L41A 1NN0A 4H3SA 5C8VA 3RRYA 5F7OA 4CU5A 4FHFA 4D4GA 4RE5A 3ZCTA 1EZZA 3OE7D 1D2MA 2XUJA 3JZIA 3TCKA 4CM6A 5BXYA 3C4QA 2V96A 1QZTA 3C74A 3CZQA 2ZEJA 1XK6A 5ENVA 3T7EA 4C7OA 3CE9A 3EZ7A 1F0YA 5DFAA 2WAAA 2P68A 1YA8A 1QHNA 4JT4A 5M3BA 421PA 3PDUA 4BZQA 2R8YA 1IATA 4QX6A 1NY5A 2FV8A 2ZUWA 3DMPA 4I9FA 5FAXA 1L3IA 4UDYX 3ORHA 2OR3A 3TX2A 2RH9B 4NCXA 1PJ3A 1I30A 5JSZB 2WF9A 2ZI4A 5BSRA 3L0YA 1NQ5A 3WB2A 2NPOA 1NW3A 1XRQA 4RADA 4DBZA 1VMDA 1L1QA 1P0PA 4W7IA 1RPNA 2G25A 5K0EA 2X3YA 3QVSA 4D8TA 1Z5PA 1YBFA 1OGJA 2WQZA 3EXHC 3FKSD 1KKLA 4GZ5A 2PQ2A 3VPFA 4D9BA 5JNUA 3A32A 1U2GA 4LGYA 1Z5GA 2IWRA 2X0EA 4DZTA 3LPNA 4IZOA 5CNIA 3RRFA 2AWOA 2JCVA 3UXYA 3U3MA 2YWJA 3CVJA 3SF8A 2A9JA 4QBKA 4QPNA 3K0CA 2QVCA 2G4LA 2C2MA 4HNGA 3FDJA 4LOAA 4AC9A 1XQ1A 1LPSA 5J2TB 1SVSA 1WL8A 3U5ZB 4CQLA 3IO5A 3ZLTA 3RK4A 4ETNA 1HR0B 1M0WA 2J07A 4HFMA 2QQEA 3V4SA 2QP9X 4EB0A 2HWXA 4PC6A 5B1HA 5CT5A 3PWKA 3G1WA 1I0ZA 4IOMA 4Q47A 5CDFE 3PUKA 1IMOA 4MKGA 1PRYA 2CXPA 3DDZX 3F5FA 4MV8A 5G41A 3SR3A 1N36B 1X19A 4FFRA 2YJTD 3SSNA 1GU1A 3KB6A 3L79A 3W2EA 4MKRA 2P9QA 3C3EA 1LNQA 3IQDB 4I6EA 4XFJA 4RLSA 2O2JA 3D6AA 1UDRA 1U9IA 3JQAB 5LQDA 4KQFA 2TECE 1NW4A 1P4RA 1N92A 5KX5F 1ZVKA 3EIHA 3MHPA 2IS4A 3H11A 1XZJA 5GGXA 3O8CA 4KMRA 1U0SY 1UANA 2YJ6A 1VJRA 2GZRA 5AKXA 5FBZA 2BMEA 1IOLA 5DI3B 3E3AA 2GZ3A 3T9CA 2XB2A 5I4BA 4WZZA 1RQ2A 4ZMSA 1PEKE 1MX5A 1F9EA 1LPNA 1U0JA 1L7EA 2C8JA 2MYNA 1L4KA 4JFAA 1X0VA 4MUXA 2J59A 4RD2A 1K6EA 2F1IA 4RVUA 3N7UA 2GHQA 5EIFA 5FDFA 1MAVA 5LU8A 1IG0A 1SKMA 1UM9B 3BXHA 4IZ6A 4ARAA 2FG5A 2XKBA 1TUEA 3RR2A 1ZK1A 1EP3B 2R6CA 4OJQA 4MDFA 3THXA 3GA5A 3CLTC 4OLJA 3U0BA 3SC4A 1ZZGA 4RTMA 4EY8A 3LQKA 3V8MA 3HVIA 1KQNA 4IXMA 4DRYA 1N57A 1IXSB 4OBWA 3X43A 4A9AA 1WZ2A 1UKEA 2C1EA 1PZNA 1NSFA 2OXFA 4CUJA 4K9NA 1T0HB 2BFCB 3DVQX 4GE3A 4P5PA 1FSZA 2JLAA 3AHDA 1FPQA 3ORYA 5B4UA 5FUQA 3HDYA 1TX4B 4GYYA 3O8QB 5JHGB 1Z4NA 2IK8A 2YDYA 2DJ5A 3GRRA 1FQJA 3E0XA 3KSAC 1SWVA 1JP7A 1UXJA 3OBIA 1N1GA 2MMGA 4XEUA 3DE7X 3DAOA 3CEPB 3PQ3A 2QTWB 4BQFA 2ZVQX 1QAQA 4NARA 3TE6A 1U5BA 5CDHA 2A0XA 1IOVA 4AMZA 1X0XA 2CNLA 2FDRA 4ZTZB 3G0OA 1F6BA 2GN4A 1N6OA 1VYTA 1QIHA 3NAGA 5CUQA 5KYWA 4YYEA 5D6NA 4D25A 2D0IA 3IOBA 5BYJA 4MSUA 5J5VA 3UB4A 4CZ2A 5TC4A 2FI1A 1Q0PA 4E5YA 4B35A 3IULA 3SQLA 1YV9A 4G4GA 3EX7C 1VSQA 3G9QA 3P96A 3VFDA 1UJNA 1ORDA 1ULTA 5FJJA 5BQ5A 3TI7A 1A77A 1YZUA 4L8VA 4RVNA 1JU9A 4QGAA 3DZGA 4CEJB 1UPXA 2GTPA 3PX2A 3W90A 3N7TA 3ZEIA 3RUFA 1G9XA 2C7BA 3JQ7A 3KOUA 1PP4A 3DBHB 4IV5A 4TX1A 5AI4A 1KWKA 3R09A 2IDJA 4L74A 3BIJA 2II6A 3HUFA 1XR3A 5C7YA 2YVUA 4XWAA 4ZZ1A 3FCXA 3BB4A 4FLMA 4G5QA 3DZ8A 5BMVA 4LX0A 2O8NA 4RLQA 1AKTA 1OCEA 2OG2A 1DAKA 2VPIA 4AY4A 1RYYA 4PSAA 3WLKX 1C0EA 2B9EA 2R00A 2W2OA 2FZLA 3ZZUA 2IZ1A 2YJNA 1R12A 2UZ1B 3HCRA 4YCDA 2NVUA 2QG9A 3F5QA 4M9ZA 3WRYC 1PNRA 4WUVA 4G0WA 3DLBA 1NSYA 3W3AH 3PHIA 4G3XA 3N07A 1ARZA 5A9SB 1DAFA 1LK0A 3WJAA 1YR2A 3GJ6A 2NSHA 1FP1D 1H8EA 4PCLA 1GPBA 1AGNA 2XYHA 4OA5A 4TT3D 1HI9A 2JAHA 1DL5A 3UMMA 2P5UA 2GF9A 4PX5A 2I55A 2PWAA 2O52A 4ZVUA 3RRZA 1P7WA 3RS8A 2HPHA 3EB9A 2EIXA 1XZ8A 1Z0UA 4BLVA 4D6XA 2FB9A 1J2YA 1RBZA 3BL6A 1B6TA 3OF5A 2AG0A 3KKLA 2EFJA 3D0KA 2I4TA 3D6JA 4FEYA 2NTNA 2V6MA 5B3JC 5ITSA 3AY7A 1F51E 3AX6A 3M4JA 1JLSA 3NWBA 5AVWA 3GC6A 1WHSB 2AK2A 1OUMA 3CKMA 4PZEA 2DUJA 2R68A 1AUXA 5C5IA 3CZCA 3D8SA 2I3AA 3C1OA 2LKDA 4G01B 4DR4B 2C59A 3L93A 3T12A 3IEVA 1LC0A 4BZXA 1NGSA 2W0MA 3CO0S 4X8OA 5EUMA 4PN3A 1EG7A 5HZMA 2Y76A 2IEGA 4G25A 3T7JA 1R6AA 5LQKA 2OO3A 3RC1A 3B48A 3EZNA 1AM4D 2WIGA 4XVCA 2XUIA 4HUQA 3QOXA 1SXPA 1RWQA 1AUPA 4D6YA 4RZQA 5U4XA 1VJGA 2FQXA 4GXRA 4GLFA 2EHJA 4Q9JA 2JAQA 4ZU6X 4R8VA 2Y1KA 4EGSA 5M29A 5A9SA 1J2UA 4II7A 4OU4A 3EBLA 2HDHA 1VSVA 3ZE0B 3H6HA 3LGAA 3R5SA 5DIZA 4PYNA 2XF2A 5ALYA 5KEIA 2NU9A 1IVSA 1J2RA 4CQNA 2BR3A 2XE4A 3G0DA 2WU3A 3AF2A 5C4MA 3QLJA 5F9FA 1GOTA 1TYCA 5LMCA 2XQGA 3MGKA 5AW3A 2BGGA 4JH0A 4ETIA 5JZ9A 5TQJA 3I0ZA 2OK7A 1LW6E 3G5LA 3I04M 5ARCA 1JFVA 1HBJA 3JALA 4GKAA 1Q92A 4AG6A 1MJGA 1O5IA 4BN5A 5BN4B 4XDGA 4RZIA 1FFXB 3JQEA 1NA5A 2V7QA 1OKKD 3WKAA 2JIZD 4HYQA 1VKZA 1WVMA 1B2LA 1KSFX 2OPBA 2F6RA 1UQRA 4IRMA 2WSSD 2YXEA 1EDDA 5CIYA 2GVZC 4KE6A 2GNOA 3H19A 3N2YA 2ZR0A 4P4NA 3OZUA 4TTAA 2YY7A 4DRZA 1LSJA 4AMGA 2AJTA 1CERA 4ARCA 1G8AA 3G2OA 4LF5B 2G82A 2GO7A 1XQ6A 1ML4A 2QJFA 2I3GA 3AF4A 3HEAA 3ZWKA 1ZHOA 1KMCA 3RRJA 3QU4A 4LWOA 1ONSA 1X1DA 4ZI3A 3OD5A 4LCJA 2QBYB 2JCXA 4IIFA 4GDFA 5E6SA 4DLSA 1EAYA 3CUUA 4LKOA 4OQXA 1DQNA 2Q2NA 4MULA 2C20A 3T3DA 4DMHA 3JARB 3F3MA 4U2BA 4DYVA 4LC9A 4OOEA 4A36A 3HCNA 1U7OA 4K5QA 3C3PA 4KE9A 4MQ4A 3ED5A 1CJVC 3SKYA 1WMFA 1M54A 3O8QA 4WJKB 1QTIA 4RVCA 2I2DA 1VSUA 4TQ9A 3H4IA 3TLAA 3BD7A 4GUDA 4IKOA 4CCAA 4Q7QA 5I5GA 1E1MA 3PSHA 4AY6A 4A0FA 2ISQA 2WUGA 2BP7A 3ZX4A 3LSTA 1PYGA 4TLBA 4UCFA 4BFXA 4DC0A 3RUIA 1W36B 2ES4A 1T4DA 4DUPA 2EVWX 1O89A 2I1VB 5J5AA 4RNDB 1I33A 1QO0A 1FU4A 3R6LA 2CJWA 4DMLA 2E6UX 3AGQA 4JL6A 4NONA 5K51A 3FZGA 2RHRA 5F76A 2COUA 1N0IA 2HXGA 4EGFA 4ERXA 1QH1B 2BMVA 3MWEA 1UM9A 4EA9A 1DCTA 4MDHA 2JIMA 3ZY6A 2NV2B 2O8BB 1G20B 4M8NE 4CIDA 1HNWB 1LBHA 1VL6A 4Q6BA 4BBZA 4TVKA 3BDVA 3TOCA 1DV2A 4C6TB 4PGGA 3ISJA 4E32A 2VA9A 2VPXA 1Z35A 2OL4A 2ZAGA 2H2AA 4P4TA 3IP5A 3VTAA 1NI4A 5I7FA 4UZEA 4V0KA 1ZH6A 4IUBS 1KHHA 1PR6A 2AYZA 3H11B 3ITKA 3O91A 3THSA 2IHNA 4CQMD 4K9MA 5AJUA 4AKGA 1E5LA 2PWYA 2IRWA 2Z2KA 1GPH1 3V32A 1SG0A 2OXCA 2QUHA 4LBWA 4R2JA 5DI9A 1CUHA 3HKBA 5AOAA 1J0DA 1ES9A 3I1FA 3CH7A 2VPTA 2PWBA 1GSIA 4CI9A 2IYAA 1E2JA 4Q9IA 4E5SA 3A31A 2CYCA 2Q4DA 2Q2OA 1JIQA 4IL5A 2FP4B 5FUWA 4O1HA 4AJHA 4YV0A 5FYDA 2OA0A 1YHYA 4FC6A 3DR5A 3DE1X 1WB9A 2QLTA 1KEEA 3HGTA 5IMBA 4ROTA 2PUBA 2V03A 1ELOA 1ZU4A 2MYTA 2PL9A 2WLSA 1VLMA 4QT0A 1I5EA 3BJZA 4TTQA 3V2HA 4LGVA 4CG2A 5KSWB 2Q5FA 4MOWA 2XCSB 3AJ9A 1QZXA 1MNQA 4F3KA 2P6OA 2YV1A 1XZMA 1KYTA 1C4XA 4FYVA 2O59A 1HZJA 3OEED 2PZFA 2JFUA 3PQCA 5L7YA 4L3OA 1Q83A 1VMAA 1Q3TA 4YUZA 3ILHA 3NHYA 3DTNA 4X84A 2QMZA 1M8FA 2FR0A 4XCVA 2OCDA 2VRCA 3O4JA 1N1DA 1B1CA 1F2DA 1XLWA 1ZIDA 5HMMA 2PMEA 4Q9DA 4DSTA 3FOEC 2C5SA 2ZSKA 5MGBA 1OX5A 4RGQA 1DDIA 2X5XA 5ALKA 3L1JA 4RPHA 4CEIA 5C1DA 3B9RA 1I3KA 2G07A 1P81A 4Y67A 1FMCA 5GV8A 2ZDHA 2IDMA 4LZOA 4ZCIA 3LP8A 1CKEA 1CRQA 2ZQZA 4AY3A 2CLMB 2P11A 3CRMA 3LQRA 2Z6QA 2WHPB 1P7VA 2C03A 1GO2A 5F2OA 5C8YA 4WASA 1MZPA 5TRTA 2HPZA 1KQ3A 2QKYA 2HA6A 1UBJS 2WJ4A 3FF4A 1E9CA 3CS3A 1XU4A 1U1EA 3A58B 5ESRA 5KSYA 3FMGA 1HRDA 1Y4SA 4ND4A 3SF8B 2ZZMA 2F62A 2B8TA 4G5YA 3RTGA 2IGTA 3CVOA 1E9BA 4MRNA 4YMSA 1U63A 1T4MA 3E8XA 1TQ4A 3G59A 1YH3A 4EB6A 1RQNA 1R6VA 1E8MA 2J8ZA 3M89A 4EG6A 5F1YA 4UBNA 3EAGA 4X1IB 1G1AA 2HXSA 1NWHA 4MWTA 3R3ZA 3W78A 1XZBA 1S2DA 4Z4GA 3GGPA 3EIXA 4E3ZA 4C29A 5KC9A 4U7WA 2Z6VA 3QA3E 1TCUA 4JWKA 1RFGE 3ZYZA 1FRNA 2P30A 1EKXA 3EE6A 3U1TA 4QLAA 5BT9A 2I87A 3QWIA 1QC5B 2VQ3A 3BFPA 1BU8A 4MQ5A 2QYOA 4D4JA 1FNBA 3RC8A 3GP8A 3AJEA 3TK1A 1W48A 4YQYA 3T4EA 1E4EA 3MWEB 2XGGA 2LCQA 5CYGA 3MBOA 2BZGA 5MN5A 3KUUA 3KZ1E 1ID8A 1JHOA 1PX0A 1LC3A 3LIIA 1XB2A 2NO6A 3DVLA 1JHDA 2GM5A 4YALA 2WWTA 3SGLA 1DC3A 4I4CA 1QZZA 4WK0B 1M2GA 4DGQA 4F1KA 1I94B 1WDTA 3LOQA 4X24A 1F14A 4FM9A 1J8MF 3N6XA 1X8XA 2J6CA 4DDUA 1AC5A 4LXQA 4B7UA 5JJ5A 2WDPA 1ZGJA 1PS8A 4E88A 4CG0A 2E87A 1ZI9A 3UK7A 1EEHA 1TJPB 4FOPA 1NVGA 2HCRA 3ACCA 1KYWA 3NHBA 4KDEA 2PQMA 2WHYA 3BJIC 3EH2A 2ZR9A 4MUBA 5DHFA 5B1YA 2JD2A 2AG5A 1X2EA 5K3CA 3ZWWA 3FDIA 2GKSA 3AIIA 4Z9FA 1OAAA 3W2GA 1SM4A 4N65A 3FWNA 1RRVA 4LSZA 1KGSA 3WY9A 3N76A 3E7DA 1O95A 3U81A 4E15A 1HOTA 1YONA 1SMKA 4MLCA 3TNLA 1L4GA 2H85A 3BWEA 5E6SB 4K0KB 2BHNA 5JMWA 5COBA 4Z0NA 1N5RA 1J0EA 3DQQA 2AOTA 3QX3A 2X6TA 3DZJA 2WTEA 5IPFA 1T2EA 3AOEA 3LK7A 1G0NA 3WQQA 4DY4A 3PQDA 5JIBA 1QQAA 2I6GA 3IH5A 1J5PA 4JJFA 2JJ2D 3DMTA 5DX0A 3W8EA 4HDKB 4WADA 5B6JA 3PJFA 5AXDA 3KR0A 4YMTA 2UXBB 3ZBQA 1CUCA 4PM4A 2BCJQ 3E7PA 2B9VA 3DVRX 1CT9A 1NUUA 3D7NA 3WLAA 2R1VB 1R74A 3MUNA 3OZDA 2QSZA 3DLTA 5CTAA 5I7AA 3IVAA 3JALB 3NHUA 1SIOA 3W4KA 2O6LA 3GMDA 1I24A 1R6UA 1G9SA 2LV8A 5JDCC 4KGZA 3NFYA 5TF4A 1YZLA 1VC2A 3SN6A 2VHJA 1E3WB 1KDPA 4EY7A 4GG1A 1W1UA 4D9KA 2P62A 3IPXA 1ACLA 3V4OA 3WKDA 4D8XA 5BPHA 2B2XA 5BR8B 1UPTA 1QCZA 4HQOA 4DCCA 4MEJA 4YCLA 3PRYA 5K03A 2WJWA 1VLLA 2GEJA 5AHWA 5IEJA 2W22A 2XXJA 4QGBA 3S1AA 3ILVA 2GILA 3GCGA 3NKFA 1XCGB 1Y8QB 3TFQA 4NL4H 2ZPAA 2XWJI 2FPPA 3CZMA 4J7AA 3MYRA 2TYSB 1AX9A 4RAQA 4B0OA 1BHO1 2WG1A 2XMBA 5D51S 2AJ8A 2AI2A 1U4SA 3TPZA 1H3NA 1XU7A 1NP6A 3OI7A 4X92A 4Z8XA 4DLVA 4I5DA 4ZHQB 1ZH2A 4XQCA 4OIFA 4ZO8A 4KWIA 2Y77A 2AF4C 3TXAA 1TK2A 2IYNA 3IQZA 1E5VA 3K8YA 5A9TA 1E2QA 1I4WA 1YK0A 4EA8A 1Z0FA 4W8GA 1TJ3A 2DHEA 3M1YA 4V0NA 3T0IA 2WD9A 3A2KA 1ZD4A 5K6RA 4U7PB 2CW5A 4NECA 4KODA 5T4HA 1CDEA 5FADA 1YQUA 1EESA 1BX0A 1QGUB 4NICA 1D2EA 4EGQA 5AVVA 3KXPA 3OJLA 1R6DA 4MV4A 3V1KA 4B3GA 5E4TA 4M6WA 1Z34A 2OORA 2CDBA 5H4GA 5IU6A 1YTLA 3Q7QA 5TEVA 1UJ6A 4HR7A 2B3TA 3LY5A 1T6NA 1QPGA 4Z9AA 1BFUA 1M10A 1F4PA 3D3EA 5KHAA 3WGQA 2GZDA 4P7KA 2VHEA 3AVQA 1T9HA 4UHEA 4MARA 1ATIA 1BRTA 1FP4A 1ISHA 4G9GA 3MSXA 4KNVA 1M6VA 4A73A 4IGKA 2DH6A 2EAUA 4HO1X 4QWMA 4RO0A 5ALVA 1IPFA 2VQDA 2I62A 3GEPA 5GONF 4KRFA 2GAFA 2YIMA 3CU5A 3MWYW 1PGOA 1E1CB 1EDOA 2YOHA 2X9GA 3EZLA 1K5PA 1MO5A 2PX0A 2NV0A 5FI3A 2IQ5A 5A1JA 3GX1A 1WUHS 1SD2A 4B3CA 5JZOA 1Z0IA 4PLPA 3RK0A 1AXGA 5D7BA 3KE8A 1XMJA 2UXDB 1PR2A 3A6FA 6GPBA 3ERCA 4OHWA 1CUIA 1SWWA 1EUDA 3SZLA 2WU4A 3OHSX 3L7JA 2WU8A 2DPLA 1PR5A 3CPSA 1U3TA 3FWPA 1UDXA 3HMKA 4BMXA 4EUFA 3WB0A 3NVKI 3EXEA 3IAFA 2PZLA 1NIJA 1T1RA 2I67A 2WP0A 2XMPA 3BXZA 2V4MA 3HI4A 3VR5D 4ES6A 2PUCA 4MCJA 4BLTA 1IONA 5JQWA 1R9NA 4JIMA 3LYLA 3MUFA 1PGQA 4LOJA 2JGNA 4N3CA 1ZESA 1JBQA 1RZ3A 4NCKA 1H6BA 2NQ8A 3RSSA 2HRRA 3AINA 4G5SA 1QPZA 2PFGA 2OCAA 3N86A 4IVQA 3BQNB 1DC4A 3KQLA 1BVRA 2O0LA 3H65A 4E4TA 4RK6A 2DP4E 2H8GA 2IIVA 2GN1A 3K6KA 4Q02A 2FR1A 5JANA 2BZ0A 5M04A 1USWA 3W6ZA 2PYIA 1E2KA 1U3UA 2WTMA 3PRHA 4FWTA 3LFHA 4WKCA 2AD5A 4LNUA 1JSXA 2MOKA 5HZHA 5HKAA 3CVVA 1KOFA 5SYNA 4YBRA 3L6RA 2H65A 1EGQA 3SDZA 3H0CA 3VSDA 1X1EA 3RVBA 4M0UA 2PKQO 2AI1A 1GVHA 1BKYA 3WLPA 3V97A 4B76A 4RHEA 3TR5A 4BQNA 3D54D 5JBIA 3QX7A 3HA2A 3D4IA 1GUFA 4YP1A 2C9BA 4BNHA 4D0LB 5H9VA 1AKMA 1H42A 3B1YA 4ZVVA 3JRNA 3K2EA 2VL7A 5E3HA 2ZCJA 2BH2A 1AV6A 1RLUA 1SCDA 3WGMA 1UZUA 3NVAA 2IBSA 1W9MA 3DKVA 3I42A 2QTHA 3LWDA 5A02A 1N5DA 1RYFA 1AE1A 1ULUA 1CNFA 3VXKA 1SCUA 4F5YA 5A6SA 4C2TA 2YFYA 4CF5A 1NBOA 4CTMA 4D4IA 5DN6D 5HW0A 1E2DA 4ZYTA 1P73A 1U9YA 1HKUA 1N2CE 3VC2A 2ZAMA 3UBMA 1FC0A 2X4DA 2QMEA 1TEZA 4F56A 2GCGA 2PBFA 3AR8A 3ENWA 4RCYA 4BO2A 4UCXA 1G19A 2EFCB 2FSFA 3S55A 4YR7A 2NUAA 2PO7A 3DFKA 4P3YA 5CT8A 2H17A 3ZZ1A 3R8FA 3RASA 1CZLA 5E9WA 1PR1A 5DLYA 3COJA 4YCCA 1MVOA 1WNTA 3GRAA 1DTWA 1VJ0A 3LDFA 2H11A 2QRKA 2J4CA 3D1JA 2OFFA 3HPQA 1WSWA 3BCUA 2VDWA 3P0RA 1BYIA 4ILEA 2ODPA 3WL3A 1SCJA 1O58A 2VDQB 1QYRA 3VVCA 1YS2X 4EO9A 3ZU4A 1ZC3A 2PS1A 3K09A 4BVBA 4R01A 2WFLA 2QTVA 2YY5A 5J59A 5AVSA 1YS4A 2AR0A 5AMXA 4QJ3A 5H68A 1FZTA 1V2GA 4BLQA 1M66A 1ULSA 5DASA 2WPDD 1TMGE 5IW8A 4MHTA 1QR6A 3Q40A 2B35A 4NNOA 4NTZA 1WW2A 3D1LA 3ENKA 2YZ2A 2JH8A 3TD9A 5H83A 3NASA 5L4SA 3K4HA 5K01A 3CN7A 4AZ0A 1SD5A 1KRHA 2P4QA 3W4JA 1VI5A 4BVEA 1KZ6A 4YDHB 4V1CA 4M1EA 2LE0A 5KQSA 2O8EB 4D81A 3EZ9A 5JBQA 3TUJC 2PUJA 3TQTA 3GLHE 1IHUA 1E5XA 2E9SA 1E7RA 1M6VB 4NJMA 2IH5A 3CQ9A 1OMOA 4QUKA 1WVGA 4P36A 2C77A 1NYRA 5ICGA 3I6BA 1Y3AA 2XQJA 1ECLA 3WLSA 1ZMBA 4LYGA 3TIFA 5CDSA 5JD6A 3ADOA 1AZTA 1G3RA 2NYRA 3AO0B 4K6HA 4N0DA 2IC5A 4MDEA 1US8A 4I9GA 3H5NA 3W5UA 2HA4A 1Y63A 3KJHA 4BMYA 1NUSA 4Q1EA 2WP8J 3P0HA 5EI5A 1N6NA 3BGIA 3DE0X 4NV0A 3ONNA 1ZM2A 3VOBA 4BVAA 4R8LA 1SUCA 2AZ4A 1CCWA 2V4ZA 1AQLA 1KZGB 4CM4A 4EJSC 4EG4A 3ZH2A 3JQFC 2R47A 4CKBA 1RI1A 3UXMA 3QJYA 1BAPA 4NBRA 1PQ4A 1GU0A 4RCZA 1SHJA 1TMKA 4X1KA 4BP3A 5IDQA 4BJ6A 4RTSA 2PU7A 3A0RB 2G77B 2O5RA 2Z1NA 2DETA 4CMCA 2HH9A 1E0KA 1CLUA 1MNAA 5E9QA 5CVCA 2YVKA 4M98A 1SU6A 3LKZA 5E3IA 5E4FA 1RKQA 5BMOA 2XRFA 5EIEA 3KQKA 3OQJA 5H16A 5KJCA 3RRNA 5HIAA 5DHRA 3AEUA 4D96A 2NX2A 1QTNA 1A27A 1ZXXA 4LOIA 4ZYVA 2I76A 1QONA 2CHVA 3F7MA 1SQSA 1S7GA 2QL6A 1LBTA 1U2QA 4ZTUB 3VYRB 3HLTA 1H0SA 2CUNA 5IM4F 3GK3A 4Y7DA 5JD4A 1VKNA 1XBTA 3AR6A 2BM9A 1Y7HA 4N82A 2SKCA 1V1MA 3WIOA 3KUDA 4DIEA 2JKZA 3R4VA 4YWHA 4UM5A 1GPNA 1VJTA 5BYAA 3WOHA 3VGPA 2GO1A 1RLTA 2PL5A 2QD2A 4IHKA 3VH1A 3DL7A 4LISA 1QANA 1J8FA 1WPQA 2MSDB 1C4KA 1CWUA 2O2GA 1WD7A 2VZEA 4F3TA 1MPXA 1G98A 2HNBA 3BMCA 2ID9A 2PJDA 2G76A 2PLFA 3SXPA 2FPPB 4XW2A 1T91A 2ZROA 3FLBA 2Y8EA 3AL0C 3VX4A 3QXJA 4BWVA 5FV7A 4Z9YA 1A9YA 5HQTA 3GAZA 2VAXA 2FSUA 1N2JA 3CH6A 5GJWC 2JI4A 3TW8B 5ETJA 4NQRA 4MWGA 3SIWA 2FP3A 4KR0A 3UATA 2YDXA 4LF4B 1CETA 2YNMC 5H0IA 5JNRA 4FNMA 2YXDA 1JDTA 3KETA 3B8EA 1DCKA 4J0HA 1ZK3A 1Z6TA 4I55A 2A86A 4Q24A 1LV7A 1FP6A 1L8OA 3DQZA 5K99A 4B3BA 3ELDA 2WIJA 4J2TA 2VUSA 4DE5A 5CEJA 1F6WA 3ZV3A 1RHRA 1L5WA 2XDYA 1N0UA 1C4OA 5D3QA 1U0HC 3SSAA 3D4PA 4NH4A 1W0KD 1G291 3QFTA 4G89A 1ZL2A 3EJWA 4EK9A 4JGBA 1Q0HA 3VPSA 1U5CA 2R6AA 2DVMA 1QHHB 3I2GA 4ME6A 3UYKA 5L45A 2WMDA 4AECA 2DQKA 2OXRA 1KWGA 2PSEA 1QCCA 2JEYA 4OAQA 3KELA 1XZFA 1DBWA 1W88B 4B6GA 5F3WB 3GNLA 4H3HB 2ZJOA 3UOAB 2Y93A 1GCGA 4ZQBA 1G38A 1LJUA 1RM4A 1CEEA 4GPTA 1G0OA 4N0EA 1NBME 3KPVA 2F1HA 3H5LA 4FEEA 2AOTB 4M1YA 4Y2RA 4A8TA 1OXMA 1P17A 3IOEA 4Y7CA 3WGTA 3U3OA 3PEVA 1QIFA 1M8GA 1YO6A 4XH9B 1LRJA 3PUJA 3BAFA 4FDLA 4R0NA 2PMBA 3VU0A 3U62A 1ZGGA 1EDEA 1B16A 2WM8A 4YAOA 4I81A 4P4SA 3EZXA 1UT6A 3FKSA 4HAVA 1WR8A 1NV9A 2C2YA 3AL3A 1RKXA 4RQBA 5JYEA 4EZEA 1DC8A 1UC9A 1Q50A 2VXCA 1NVTA 1XD2B 2CNNA 4NZPA 5IAAA 4GL2A 3H18A 4LPSA 5F98A 1SUSA 1B73A 1KFJB 3LHIA 1A1SA 5P8WA 4NEQA 3BQMB 4PRZA 5EJMA 4YQEA 3Q85A 1HA3A 4LUCA 4PQFA 3UANA 3U4MA 1YS1X 1MG0A 3HN2A 2DKOA 2E4VA 1DAIA 4X97A 3CNQS 2PMFA 3WAJA 1JG6A 3AEQB 2C83A 2GPWA 4S1OA 2PBRA 4CMHA 4R1MA 1CEYA 1T5BA 3W9YA 4NOLA 2HQSA 3L0CA 3GELA 2D1FA 3E1SA 2GN2A 3L6BA 3LF2A 2HC9A 4L4RA 5D3MA 2YFHA 2IIPA 3DA8A 5HGXA 4N8SA 3BBPA 4CXMA 3F4KA 4AKEA 5K2OA 4QLBA 2FJPA 4H6XA 4KNWA 2A67A 4YC7A 5BQXA 2GZSA 5FTJA 1BDBA 1RYBA 4K05A 2ZYUX 1SUEA 2IKSA 3NHJA 4JHLA 2PWZA 4R2MA 4TWZA 5HKKA 4C3OB 1GDTA 3A1UA 2VXOA 1EGVB 3DULA 1Z16A 1X7DA 3RODA 1M6WA 2Q1TA 2F4NA 2PS0A 1LEHA 1Z36A 3A36A 2A59A 2FRVA 2I9PA 3ZU5A 5FI5A 4NABA 1G9TA 1HT1E 4WDRA 3S28A 1L4UA 3C3KA 3GHHA 2CE2X 1IC6A 1MXHA 1L7XA 1EZ4A 1S2GA 2JFNA 2CL6X 3HVJA 1WMSA 1XDZA 3MK31 4FGWA 4FPXA 1VKJA 4KR6A 3H86A 3CO5A 1XQ9A 2VAWA 3OESA 1KXJA 2Q99A 4QUGA 4C05A 3EC7A 1MC8A 3DZFA 3LBHA 2XMSA 5HBRA 3IT1A 4ZT6A 4D1YA 3IOMA 5AVZA 3A1NA 4LGCA 4YRPA 1HNXB 1QRUA 2W48A 3SC2A 1XMPA 3E9ZA 3OUUA 4ENQA 1X7GA 3ER9A 2PTGA 4ALMA 2VF8A 5PGMA 1GTVA 1GNRA 4JHXA 3ZNOA 1MOZA 3LX6A 1T34A 2I6FA 4RPLA 2ROQA 2QF7A 2FW9A 1NPDA 3CW2A 4ZU3A 1ZEJA 2AEFA 2W2MA 5DCLA 4C0HA 2N42A 1UPBA 4K2AA 3SJAA 1PG2A 1I0IA 1CQJA 2JBWA 1M34A 4O4HA 2DTEA 1F8UA 3CWCA 3KKZA 3OT1B 5TPWA 4LAFA 5FX2A 3L7YA 3E84A 4B09A 5KU7A 2M32A 1LVGA 4DR6B 1M1UA 1ZJ5A 1L7MA 1YJ5A 2FPKA 3USZA 5F73A 2D00A 1C1HA 3GVXA 3VAAA 4BEWA 4IHAA 5MN6A 5IWAB 1X1QA 2CKDA 3ZGVA 1OH7A 4EOGA 2H0RA 1C7EA 1RKUA 3GUUA 4DCUA 3QTLA 2VBFA 3EGWA 1X1SA 4MGZR 5JZBA 2AN3A 2CFOA 4JBHA 3AZQA 1GTG1 3GNTA 4W5QA 1G5PA 4UDNA 1S3FA 2HO5A 3FUXA 2G17A 5H5JA 5EUQB 4EF6A 2C31A 1Z63A 2EFGA 2YWCA 2VT7A 1ST3A 3JQ8B 2P65A 4UNSA 4YRGA 2CZCA 5K0LA 1QCDA 1QFJA 3NB0A 4NWIA 1SRRA 3SE0A 4Q0MA 1R0XA 1QP4A 1L4BA 4OGFA 1TAQA 5LYJA 2BBOA 4FHZA 3PRKE 1Y4DE 1W5AA 2WV9A 3LX5A 1TQ6A 4N5HX 3I53A 4JSTA 3KLBA 3MD9A 4KXWA 4XIGS 3W1EA 5K6AA 4JXZA 2RAVA 5KYVA 3EY4A 3MM4A 5KX5A 4PW0A 2BFEA 3F49S 2FFHA 3GLVA 2ZUDA 2ZSDA 4BQIA 3COVA 4HDNB 4GMFA 1CK4A 5TSDA 3UT5B 5DWVA 4B8WA 3JU3A 4F4UA 1JH8A 1QLHA 5IANA 5L8VA 1RAAA 2G0TA 4H7FA 1MQ9A 2QRQA 3T7TA 4JAVC 1OHHA 5B57C 4RHUA 4RMGA 4CPDA 5JSQA 2P9CA 1J9GA 2QTCA 3AI3A 4G0VA 4CYMA 2PGAA 5EQJB 4YCNA 1VPVA 2A0YA 2FKAA 4ZOCA 1EHIA 1KARA 2NQTA 3OZIA 3L0PA 1MH1A 1WZCA 3GH3A 3A3PA 1NR1A 3GCZA 2QBYA 2B4AA 5HGJA 4RDXA 2EZ8A 1YQDA 2QRZA 2K7FA 2GPAA 2C7RA 2CUTA 2ONZA 1UOEA 3O8BA 4X7BA 1TZJA 4M1OA 3BK2A 5JWOA 1HK7A 5K0JA 3SLGA 4WVFA 1MR3F 3URKA 1SOMA 1V16B 3SM3A 3SWWA 2F3UA 1FLAA 1U8ZA 3CFYA 3ELBA 5IYZA 4JXKA 5IM4A 3B7WA 4FYJA 3PEWA 3SIRA 1KYIA 2HRBA 3OIUA 4XJXA 3R3WA 3EGXB 2DERA 3UB3A 1KJNA 3U61B 5AXAA 4IDHA 4B3XA 1Q1QA 1ZCJA 4GLJA 5E2BA 4EDFA 2WA1A 4XEHA 5D3KA 2W90A 5A3JA 2BTQB 2I3BA 3MQFA 1P5JA 2FNAA 3GJ7A 3OP1A 5CM2Z 3IELA 4MXDA 5IXYA 4MW1A 2QMYA 1E1YA 4L8FA 4BB5A 4FBGA 5KSPA 5CDFA 2VAPA 1CRLA 5FR1A 1SXIA 1R0YA 2J6BA 2GZMA 1VG8A 4N9WA 3C3BA 2JJ8A 2QNIA 2UVPB 3KTFA 4GX0A 4K6MA 2PIAA 3R5FA 4O5AA 2RGXA 1FFGA 3H8VA 5C8YB 2OBYA 4WERA 5HP4A 1IXYA 2VP4A 2XUPA 3R9XA 1FYEA 3CJTA 4U1RA 5LLTA 3KJNA 4FCVA 5DSXA 2BZSA 3GZNB 2R2AA 1CQZA 1E2EA 4CEIB 3T0GA 5FOWA 1KI2A 1NKVA 2FSVC 4A0RA 4BE4A 1CRZA 3ETJA 1O1YA 3SJCA 3TL6A 5A4FS 1FTQA 3CH5A 3P9IA 3D59A 4IKEA 3QLUC 1J25A 1K98A 5JJBA 1BA3A 3N2EA 3PFNA 1L5HA 1UJ2A 3UYLA 3VVMA 4BZZA 3NC0C 2YJZA 4CTNA 1VECA 3ND9A 4F9TA 3RU7A 1V7QA 3ONDA 4IDBA 1R5BA 2HIAA 4CETA 4RABA 3KSUA 4ZYLA 2AZXA 4P4GA 1N6HA 4LQCA 4LTMA 3KG2A 5JJKA 3K0AA 4NF2A 2IF2A 1B43A 2NWQA 1VGQA 2C99A 2O8VA 2CVOA 2ZYVX 4HH3C 1H2XA 1RI5A 1QQBA 1X1TA 2ZBRA 1XXLA 3O5AA 4OX9Y 3IUPA 4QXOA 1WNFA 4EJSA 2EX1A 1VJ1A 2CUKA 3DE4X 1QOPB 3I52A 1TDJA 1XRSB 4I3FA 4LFCB 4YJDA 4J0QA 4JROA 1DWOA 4G1EB 4PG4A 3C85A 5JNVA 2GBIA 1NBIA 1Q84A 2VNAA 4YAEA 1NXWA 3RV4A 1KZHA 3IQHX 4RIFA 3P9XA 1V9CA 4B3HA 4TS9A 4Z53A 1U0LA 1I3CA 4UARA 3CV3A 2O0JA 3TLYA 1MB0A 4M9QA 3R20A 4HJRA 1E77A 1U28A 2VNKA 4LF8B 4XR9A 2HYDA 4KWCA 5PNTA 3VZCA 3HACA 3EWSA 3UG7A 3S2UA 4DCSA 3CT6A 5EHGA 1EVLA 2C04A 3MT0A 2CY0A 4ZCSA 1KOGA 2H1WA 2GMWA 1LDNA 1X14A 1EEXB 3HDHA 1UZAA 2XVAA 1WXIA 5F4ZA 5LBTA 1W7AA 1KA9H 4XGRA 1IN4A 2G09A 1TZMA 4TXHA 1YAJA 1YRBA 5HF8A 3DBVO 2VKQA 3MXTA 2WZBA 4FMCF 4HDOB 4NY1A 2LIPA 5JG7A 5JS2A 1PSZA 1RYMA 2VG8A 1WDWB 1KS2A 3FNGA 4FR2A 5K0BA 1QX3A 5CGZA 4MUYA 4LSWA 2EQ5A 2B8WA 3HHEA 1ORTA 1UMCB 1GEGA 3LO5A 4GMHA 1EFPB 4I8DA 4MI9A 1L0BA 2EP5A 3MT9A 4DIBA 1II8B 3OTQA 4GXTA 2OEPA 5TQVA 2R6GA 3HVHA 2VJNA 1XZHA 1S4MA 4B3IA 1A82A 4P82A 1K3UB 3Q7EA 1WA5A 4FS8A 1AZWA 5EJIA 3RUPA 2ZB4A 5ED0A 4EHAA 1ZCFA 3PFBA 5HWSA 4W8OA 4ARIA 2ZRQA 4JBXA 4LIPD 3N0TA 4ZZIA 1NBWB 4OPMA 5B3KA 4WY8A 4MO9A 2PR2A 3KKOA 2G70A 4HDQB 5GINE 3VTZA 2FW0A 3FWYA 1DARA 1LQTA 1XG5A 2IW1A 3L6EA 3W8DA 4JLDA 4BO1A 1DTSA 2BELA 2PH7A 1U3VA 4GR9A 2XE7A 5H3CA 5JQGF 1XTBA 5IULC 4ZVNA 1CQWA 5ITZB 3B6IA 4AQDA 2I0FA 4JB8A 1CZNA 2OKGA 4QGFA 1OQAA 3UQYS 3DEIA 1IPEA 1GKKA 2Q3JA 1NW7A 2BD0A 4MKXA 3UCEA 4JUCA 4WLOA 3ZC3A 1BCSB 5ALMA 1HYBA 2OKCA 5JECA 1V43A 3COWA 4FIDA 2V3VA 5JWHA 1NKSA 4R6WA 2OESA 2QV7A 2HIGA 3U3RA 1L5ZA 1T4CB 5IZCA 2B21A 2JFWA 5JAQA 3NFRA 5ECGC 4BO3A 4K86A 4Q4AA 1QF9A 2G40A 5L4LA 2J31A 1ODLA 5HM6A 1FMLA 2ZULA 2HRQA 3DZHA 4P7FA 4PG6A 1LPOA 1SULA 2FF7A 4UHBA 5EN4A 5CFZA 4J4HA 1XFAA 4TLEA 1KMQA 1JSRA 2AHRA 2FRXA 2HWKA 1M2KA 4AJ2A 1BYUA 1ZHHA 3WFZA 1G59A 3LT5A 2ZAOA 4Z9BA 3A25A 3KPWA 1XEAA 3MQ4A 3L7DA 2OZVA 4JKOA 1U0TA 4I14A 1KYZA 4YIKA 3UA3A 2X76A 3THXB 1Y5LA 2ZW9A 3GT4A 3MJFA 4BKPA 1NOKA 1SZJG 1JR3A 4BEVA 3NIGB 3DEZA 1C8KA 2JFXA 2ZJ1A 4OQLA 1HE5A 5JNTA 5KBYA 5L3QA 4WLEA 2O2ZA 1J00A 4C04A 3NBKA 2XBUA 3VU1A 2EJWA 4C0LA 4FONA 1NLMA 1DUSA 3MAAC 2VF7A 4IHJA 5B1DA 3WLLA 1UDBA 4Q4CA 4QBFA 1MJGM 4PCUA 1JH9A 5BN3B 5C37A 1JHPA 3M4XA 3FETA 4Z0HO 5DBIA 3GMSA 3VV3A 3K6RA 1OSNA 4I6GA 5IDVA 2BSQA 2MINA 4J9VA 4Q4JB 1Y3HA 4CLEA 4YJGB 1CV2A 1QPBA 2VJBA 3OIVA 4ZRDA 5C4GB 4FXPA 1FY2A 3TTSA 5JAMA 3KSRA 1L8QA 2AUTA 3ZXIA 4UEOA 5DISB 4J76A 1ZUNA 1Z2EA 3K96A 2DEUA 1XYVA 1ZZEA 1I6MA 4XQ9A 3PXGA 3I9V6 1CY6A 4KQCA 3AG5A 5E38A 5DM70 5HQ3B 1YE5A 2WDZA 1AGRA 1ODIA 2GM9A 3KZVA 1U8TA 3UAYA 1ABFA 3T1TA 1TO2E 1XMQB 5JY1A 1JECA 3PNOA 3PI7A 4ADSG 2JFBA 1FU8A 3DV2A 4Q1VA 4U02A 1RXSA 1C9MA 2NM0A 3FKQA 3O8OA 3W9BA 1BKSB 4YRSA 1LFDB 3BMNA 4O4LB 1UXGA 2NUPA 4CQLB 2IZ7A 1F0NA 1ETHA 4WD3A 4AZ0B 3ZKAA 1YNSA 1N2IA 3WQHA 4YMIA 1N1EA 1BX1A 1TU4A 2AEMA 2E1RA 4YPVA 1SBZA 1W46A 3C6MA 3KXKA 3VOSA 3ROXA 1M1YB 3L4EA 4NDZA 1J07A 1Z08A 3EIFA 1U99A 4Q9LA 3ST7A 2CVZA 1GUAA 5JYCA 3H4MA 3HPRA 4JX9A 5SZKB 4DHEA 1R8QA 2NPIA 3EHDA 3J7TA 4KR9A 3IDOA 2FW1A 3WDLA 4JKYA 4NZYA 1UP6A 2WJJA 3V8NA 1BCRA 2F9MA 5ENDA 1Z0ZA 1FZQA 4ZICA 2ZCUA 3CZPA 1V95A 4KG7A 4RKFA 1DTWB 1BS1A 3RBZA 4EPWA 3N0RA 4B4KA 3KOXA 1UFVA 1WZEA 1ABBA 2ZTSA 3BJMA 5LD2C 3EMKA 4MO2A 3N3BC 3L7MA 1P9OA 3O0TA 4KAAA 3BE4A 1ADBA 3EEQA 2IY7A 3JD3A 1UQUA 5IN5A 4F4HA 1ODKA 2MINB 5JXGA 1ZWLA 2OHGA 1DG9A 3I09A 4EYGA 1C3VA 4MHOA 1O9BA 1BMDA 1Z0JA 3JAKA 4N7JA 3FMPB 4ZO7A 1E2PA 2NUBA 1VLJA 2WFAA 1U5BB 4TL8A 4R7TA 1KU0A 4UE2A 4I4TB 4DV5B 3Q11A 1M67A 2X2PA 4R98A 2M6LA 3RYFB 3HKCA 4QTYA 1CFJA 3W6UA 1U9IC 3JV7A 3PVSA 4HDSA 3QPUA 4Y9UA 5THQA 5ADHA 2QDXA 4LHZA 3Q1KA 4W8HA 2XA1A 1U6JA 3AM5A 4FHCA 4J1TC 1XMIA 2OB1A 2AFHA 3X1DA 3ZW9A 4YV2A 5C46F 3VJRA 3AF6A 5BVHA 1XN4A 3QX9A 1UBGA 3K92A 4HXGA 5IJXA 5AVQA 2Q1YA 2X13A 3NW9A 2XCLA 1XT6A 1MC4A 2YW2A 3AM1A 1S1MA 3OQVA 1Z5ZA 4DXDA 3UGJA 2EZ9A 2I1LA 1BH6A 1D1SA 3FBWA 3HWSA 1GR1A 4BNIA 4BVHA 2HHHB 5K0GA 3IEPA 5CA1F 4WX2B 2P6RA 3H9UA 2GJAA 1MV5A 4V0ME 1SCKA 6AT1A 5IT9A 3HDGA 1NQWA 1QU2A 2Q3CA 2BWJA 3FLMA 1JJBA 3V4LA 3W2FA 4BX0A 4QL3A 4QNMA 1JFTA 2A30A 5BSVA 3ZXYA 2ZI6A 1IIBA 4ZQGA 1P3DA 2ZXUA 3KXLA 3P9KA 3W1WA 1OPXA 4L9SA 1ZICA 4F8EA 4ZOLB 4HX5A 3OE5A 3INNA 4IDPA 1E0DA 4M54A 5HIMA 3DEFA 4B81A 3U44A 1KR2A 2H4YA 3R3HA 2QRLA 1CUVA 2J3HA 4LYEA 4R1LA 1EPUA 2PT5A 3RKSA 2XDAA 4ZGWA 5JCZA 2V1UA 1EK2A 5BVGB 4RD1A 1C3OA 2VF2A 5ICFA 1XJQA 3U4GA 3WXMA 3H2HA 5DXJA 1XX6A 2Q5CA 4ENUA 3FMVA 3MWFA 2BMFA 2ZJ8A 3IB6A 1KVQA 3O6VA 4RD3A 4W7SA 1TFUA 2R8ZA 3F3KA 4MRMA 4G1CA 4G67A 4QUDA 5LD2B 2A0WA 3BGDA 4MP8A 1PJZA 4ZOAA 5G0WA 1AK1A 3PFFA 1Q3KA 4TRMA 4Q4HA 4XE5A 5GWXA 5KYTA 2NSJA 3HM9A 2ZWMA 3ZGYA 3D4LA 3QE4A 1DP4A 1V5FA 1ISIA 1YRAA 1OXBB 2AR9A 1DIGA 2IYQA 2R751 4FTWA 2WPNA 5F2NA 4WLVA 5BRJA 4HGOA 3MW8A 1O96A 4M8LA 4BP8A 4QE3A 3N6RA 4FFLA 1JG2A 5DOVA 3P0FA 3WGVA 1G2PA 1BXKA 2YWFA 3K71B 1NW9B 2VYQA 1T5HX 3DXXA 4XIYA 2QVXX 3Q9UA 4Z54A 2OGUA 4MVJF 3TX6A 4JSRA 1XCBA 3FOWA 3H5IA 2TMYA 4IUYA 4MVJE 5FORA 1FVFA 1M2OA 5FO0A 1E7WA 3P7MA 3QELB 4XVUA 1EFPA 3F1KA 1E1CA 1MAWA 1HFKA 1RWBA 2C0CA 2PSDA 5CP8A 1DZ3A 5JVDB 5IJZA 2OMKA 5K0NA 1SBYA 1RXIA 5C35A 1E3SA 2YIVX 3FPGA 3IP8A 2OCIA 3MTJA 2G6BA 1R88A 1BQ3A 1RABA 5DNUA 2LXNA 5JXIA 2H00A 1L3CA 2JK0A 4IDGA 5EGNA 5I8PA 1I9GA 1PFGA 1W6RA 1BRMA 4WH0A 5AM1A 1GQRA 1R6XA 3OA2A 4NULA 4UBJA 4GZMA 5CT9A 1IYZA 5EEGA 5DP2A 5JSZA 1QHIA 3HV0A 1AQNA 2J0SA 3DKPA 2GAOA 2IUYA 5J47A 3S81A 4B3TB 1EFVB 4HQ0A 3AVYA 1WUJS 1LPMA 2XZDA 3EPPA 3AVUA 2LVBA 2BGNA 4YRBA 3PX7A 1WB5A 4YRLA 4ZOEA 1AHNA 7REQB 2GLXA 2Q5IA 2MCFA 1Z3IX 1M2NA 5BOVA 4BVKA 2HU8A 1KK3A 1RLMA 3C43A 3BZUA 2HK9A 3MMSA 1NVMB 2EWMA 3GLGA 1KPGA 1A9XA 1JJ7A 4HLNA 3SJ7A 4JVOA 4HGNA 2Z1MA 4J3NA 2J6IA 4X20B 4A5SA 2I33A 5IFKA 4OUKX 5BRNA 3C4JA 4F4DA 4MJ7A 4YRKA 3QRWA 3M1IA 4WKPA 3BYZA 3CT4A 1LPBB 1R9MA 1OE0A 1ZJ6A 3QUSA 2I2WA 3JYNA 1RZRA 1TE2A 2PY6A 3NHWA 4G0QA 1XRRA 3FIJA 3C6KA 3IOCA 1C9NA 1L1EA 3LCCA 5BW8A 3W8RA 4Y2HA 1GSOA 1NDHA 5J43A 1DJNA 2UVQA 4QTXA 4Q01A 3ISTA 4C78A 3S8EA 1REQB 2R5NA 1CE8A 5CEEA 3DLAA 4ZT2A 4L51A 3P45A 3OIDA 4L2IB 3TVTA 2WIFA 5AD1A 1D04A 3Q9NA 4Q7KA 2WJZB 2X6RA 1PQPA 4GLLA 1NDUA 3EQ8A 4LDAA 3WYBA 3LHSA 1K75A 3UK1A 1J0AA 3TGPA 1CU1A 4FGJA 1GPMA 2JFVA 5B37A 8AT1A 4IQ8A 4EPTA 4AJLA 1OXKB 2I6UA 3PKZA 2JBAA 3D5EA 3MMXA 5JASA 1RYEA 1UAYA 3KXIA 3TLBA 3N2ZB 1CQIA 2DCMA 5DGTA 1F1JA 3GA0A 3ONWA 4A2CA 6LDHA 2C0PA 3VYWA 5A5FA 2LUOA 3NEYA 1M8PA 3NHKA 2VZ8A 3THOA 2CJFA 1A97A 1AKQA 1DX9A 3G1TA 3FROA 4YLEA 1VE3A 4XRGA 4ARSA 3I1JA 4WN3A 1RCFA 4HPXB 1O95D 4DNPA 1LSSA 1V26A 4MITA 4OXRA 3N5CA 2CLCX 2BN4A 4MR8A 1U2RA 2Q4RA 4L0DA 4Q48A 4RFSB 5KMGB 3KHSA 3BSFA 3MMZA 4KQHA 3GN1A 2XEDA 3R3JA 2PZBA 2QQFA 4LCEA 4RLFA 2HU2A 2ZRIA 4ETWA 3DOJA 3FGNA 4QG3A 3KPUA 3QVOA 4DQUA 5I8WA 2YC4C 3OJOA 2ZK7A 3HR4A 4ZIRA 9ATCA 1A4RA 1ONOA 2X0KA 3AGPA 3GRPA 4RKQA 1MVNA 4B75A 1X39A 1IHOA 1XEXA 4IDCA 4E5UA 1HDCA 1RW4A 2XMQA 2GJ9A 4V02A 4TKUA 2CNBA 5TGDA 3D02A 2C2XA 4M8KA 3QI7A 3GQVA 3TKAA 1HYEA 3EGXA 3N8IA 2OGZA 3KZCA 2DQZA 3IA2A 4MPJA 1P3Y1 2C4MA 1W36C 3U26A 4OH1A 2ZT7A 3MGAA 1EGMB 3P20A 2GFIA 4KW7A 2HF8A 3JQ9C 4OJNA 3IQIX 3NP7A 2DULA 2PMWB 3GBVA 5FWDA 3WYDA 2FPXA 2NOAA 3H5AA 4K88A 1WCXA 4M7OA 4C2AA 2A6PA 1ZITA 1T8TA 4HS4A 4EL5A 1CD5A 2I7VA 2WNSA 2XUFA 3DDNA 3BJRA 4OJKA 4I66A 1Y6GA 1ZCBA 2GCEA 4QPCA 1P39A 3OQ1A 1J0BA 1MABA 4O4IA 5F23A 5K8VA 4EF5A 1TAGA 4RGYA 4LJRA 1G5FA 2DXIA 1C7JA 3JD4A 5BNIA 1EZ1A 2BEUB 5KB3A 3R40A 1I80A 3TOVA 1T0PA 1OH6A 4KVAA 1PN3A 1Z73A 1EA5A 3MTBA 1XTSA 4UAUA 1GR0A 1QYVA 4NG4A 4QECA 3LX8A 1DINA 3HWX1 4UUMA 4Z51A 3A9TA 6YASA 2FWBA 3VO9A 3NDBB 1Q0QA 2R25B 1VA5A 2H9IA 3C6BA 1G4HA 4HKTA 2CD9A 1PV2A 4P2GA 2I2AA 4HDSB 3DBLA 4UW9A 5H1YA 4C0AC 5KDLA 1W47A 4JLPA 3SZMA 1IL0A 2VWGA 1MRSA 4AF6A 4W5RA 5C9ZA 1Z22A 5EE9A 1AA9A 5FNVB 3UMSA 3WKBA 1KFBB 2B6NA 3AEKB 4EVRA 4UMEA 3WWYA 2PMCA 3DE3X 3SY8A 4HGQA 1Z47A 5A5DA 1U9ZA 1WZUA 3BFKA 3DMYA 4R2IA 4XVQA 1RI3A 2GKGA 2R79A 4RVOA 1UBEA 2VK8A 2WZQA 3IMEA 2A9FA 4P3OA 4MS3A 2Z5GA 4H0CA 3GEGA 3TQCA 4R9NA 2CF6A 3PYMA 4XFKA 4L08A 1M33A 1HTBA 3M6UA 1G8YA 1KAOA 1QQ7A 3DXYA 4WGGA 3RS7A 5I4KA 3TECE 2GN0A 1VBNA 4AJ9A 5DMHA 4DSUA 3H0KA 3L6UA 1UCFA 3IAXA 4D4LA 3W5BA 3ZCSA 1CUUA 3CUKA 1KMHA 3K0BA 3D3WB 1ZI8A 3NIFB 2C5GA 4RY8A 2M9MA 1Y7IA 2B4RO 3FBGA 1H0RA 2DT5A 3FW1A 4E46A 3GN2A 4CMIB 4R3NA 2WSMA 3P5BA 4YAJA 2X0RA 1ODTC 4ZDWA 4MZXA 4RKYA 4WCFC 3BDIA 2VATA 3NHRA 4C7BA 1KFEB 3NM6B 4KCGA 2WUVA 3UGKA 1OI7A 4INOA 3QVGA 3ZV6A 4DEVA 5K9ZA 4LC1A 1T4GA 4YRJA 3HADA 2VF4X 1GADO 1TO1E 4PZCA 4XD7D 3OLQA 5CX4A 4A82A 3PYLA 1IJBA 4WACA 1Q1AA 1Y9JA 3R5JA 4U6SA 4Q66C 3T1YB 3KM0A 5BOSB 5EVJA 4CFSA 4CMJA 1N33B 4PAOA 2HHJA 4GD3Q 1W49A 2VHXA 4OXYA 3KWMA 4C2BA 4C9BA 4ZAYA 3DHVA 1U8CB 2XTAA 1Y9DA 3OX1A 4MCHA 3ZI7A 3AEYA 2F9LA 1EWTA 1NBMD 1G8MA 1PEYA 2NACA 1A8HA 1SZPA 2X2OA 4EZBA 2XNSA 2R65A 4RSRA 3VZPA 2GDZA 3ETHA 3EXG2 4XGQA 2A9RA 1JR3D 2PKYX 4LYFA 1LI5A 4RMHA 3ROEA 3UC5A 4P58A 3V8RA 3VGJA 3U19A 2QT9A 1EUQA 2RGGA 2QWXA 2YQ5A 4HEQA 1TB4A 1P2VA 4D45A 2P9HA 3ZVKA 1OA0A 1YUBA 2F67A 2CBGA 1WULS 2JPDA 1IY1A 1TEVA 2GXAA 4BEJA 3B3JA 4DADA 4ER0A 4ZYZA 1TCAA 3GZTB 1RWXA 1XP8A 5AW1A 3DP9A 3N2LA 3KFLA 2G5CA 2GJSA 1YB6A 2X3UA 2CNOA 3S2SA 2PUGA 1EWRA 5FYQA 4MNTA 1X7XB 2QIPA 3UG6A 4Q19A 4MUIA 1YRQA 4QAQA 5JLAA 5M2QA 1C7FA 5AI9A 1HETA 3KT8A 1OXVA 2ZE6A 1XC7A 4BLPA 3BICA 1PJSA 4X7PA 1DQZA 3ZPXA 4LPKA 1DQSA 3BCRA 5HFJA 3ZWCA 1W87A 4GBMA 4TTVA 5BQ3A 3CM0A 1MENA 1QJCA 2PJZA 4FNGA 1N4AA 5WRFA 1U3FA 4HG2A 5JVDF 1PW7A 1XHEA 1Q6ZA 4DIMA 5CM8B 4UUNA 2DF8A 3T06B 4CTKA 2V5VA 3RT1A 1PJAA 2Y0CA 3IDZA 3WMEA 2D06A 3WAKA 1E2BA 2XTJA 4QXQA 4BDSA 3EJ6A 4UFOA 1GILA 1M5RA 4BUZA 4NR0A 4MP3A 3N1UA 3B60A 5TS3A 3DTVD 4Z2YA 1HEUA 3TIGA 3SQWA 3SHFA 2WMNB 4XYMA 2A3NA 1YBMA 2J46A 5TNXA 3H1FA 1G3IA 1TCVA 2IY9A 4IPTA 4A03A 2OAP1 2XNDA 5DM2A 4HWKA 5IAOA 1JFFA 2OHIA 4WLUA 2HQ1A 3CA8A 1PCXA 5FULA 5I45A 4XYEA 2AJBA 1DXHA 1CFZA 4RVDA 2YRWA 4CRWB 4UNQA 3QPAA 1NUAA 5ADVA 5ITZA 3L0DA 1TTTA 5EJFA 2P35A 4PG7A 1YRYE 2RHLA 2W2KA 2Y1EA 3E5NA 2YBDA 1D2RA 1IN7A 1CP2A 1N34B 5AI0A 1U11A 3NYIA 2Q9AA 3WLNA 1G7SA 2Q0QA 2XCQA 4JUBA 1L5KA 1GDHA 2LCFA 2C0QA 3WNQA 4RA9A 4JQYA 4BPRA 3STVA 2A33A 3T5TA 4EG5A 2VUUA 3QHPA 4A0GA 4RA6B 3G6WA 4L78A 1AQIA 3AVOA 1THGA 3JARA 1JAXA 4QELA 5FOSA 1F2TA 5BW6B 1MDBA 4BYGA 4DNXA 4QIHA 3C5EA 1ITZA 1NTOA 1Y37A 1YSCA 1VMEA 2XDQB 4JU9A 2RAUA 1JWAB 1MJNA 2ZJFA 1Q6YA 3I61A 4K8RB 5B2ZA 3O2JA 1PE0A 1ULZA 3G89A 3CBGA 1HYGA 4BNKA 4FHGA 1AKWA 2JIRA 4CLHA 2QI9F 4LF9B 3PUZA 4NSNA 1UH5A 4Q18A 4QU8A 5DV9A 5KOJA 3GRUA 2X0DA 4OUDB 4S35A 2WIKA 3CUYA 1UEJA 3AZOA 3EDQA 4ZT5A 4MVJD 5AVTA 2ETXA 2KE5A 3MTEA 6REQB 1ZO8A 2UZ0A 4MQFA 8GPBA 3M6WA 4OHPA 4AZ3A 3WDMA 1ANKA 4BFYA 3D2BA 3PQ2A 3T4PA 3P9NA 3PPWA 1KMIY 4JT9A 5JI2E 3LUHA 3H2ZA 3M4NA 4ZOLF 5LN1A 4Z4IA 1M75A 2ZBQA 2AMLA 3KCQA 4K9KA 4D41A 2ODEA 1YZVA 1FL9A 1N25A 3AXSA 3JQRA 2ODNA 4KTTE 5IYZF 5EMJA 3CSUA 3PGA1 5KHLB 3OEHD 3ZHQA 4RJTA 3B9QA 5LQUA 2GGSA 3P2OA 4I5IA 1F20A 3BGSA 2ZI5A 4JX8A 1KDYA 4JN6B 1WRBA 1DAOA 5IBCA 4HH4A 3IEXA 2NQ2C 1QRAA 1YR6A 1LF0A 2XYPA 1MEOA 3LW7A 4I0WB 5GV7A 4ZRMA 3S5JA 2PFKA 5L40A 2JW5A 4NCIA 4NE9A 4YMVA 1MX9A 1X87A 5FOXA 1T5IA 2OCPA 2ZB2A 3CG0A 3QE2A 4ROSA 3CVYA 5JH7F 4J43A 3LQ2A 3WGKA 3H9CA 1XZCA 2WIAA 3KT6A 5ER6A 5BQOA 2PPVA 2VDOB 3GD5A 3Q8KA 5AESA 2HAEA 1FRFS 2XUHA 3MZ0A 4Y9TA 2O6HA 4JYMA 3BFJA 3DV9A 1TMOA 2LR0A 3TS1A 4F2GA 4JI8B 1EIWA 2GHIA 1N6RA 2G06A 5DNEA 2ZI7A 4CHGA 2MYPA 2V58A 3GRCA 3KOMA 3CB2A 3RF6A 3D5QA 1HLGA 4EW2A 4WNAB 3RRXA 2BGTA 2WTNA 5HJ7A 1F06A 2NVUB 5ALTA 1I3MA 1WDKA 3K9GA 2XOKD 3LFUA 1MMFB 1QLWA 5E4YA 2NP7A 3HCFA 5KCMA 3U7GA 3H8SA 1FUIA 1P9LA 1WXGA 1YB4A 1VHJA 3LT0A 3ZV5A 1XU9A 2R84A 4BO9A 4DJAA 1OT5A 2H8KA 1NF8A 3MTGA 4H31A 5JLJA 2ACVA 1CJKC 2MR5A 3D1VA 2O2DA 5A0TA 2HSWA 4GZ3A 1K3TA 3NVMB 4JC5A 3D2CA 4FLEA 4EI9A 1M2JA 3EULA 1MF7A 1JHRA 5GGYA 5FBHA 3JYQA 1BMQA 1SUWA 3JATB 3OECA 3R6DA 4H4CA 1EGHA 5CLFA 2HGSA 2CLHB 3CF2A 3O92A 1WF3A 5CLLA 5TQ2B 3UOWA 3X2SA 3LPLA 3OSZA 1OFUX 4XUGB 3FYSA 1IZ9A 1QHSA 1WXDA 4D9JA 4Q15A 4YP0A 1BFDA 1SVLA 2BI8A 2IFTA 2NT4A 5C81A 4ZQFA 3OUZA 3JQPA 1X9GA 4MS1A 3VNAA 3AFOA 5L7TA 4LFBB 2VQ6A 3FOAA 3BJEA 3GVCA 3G1UA 1SY7A 3JYLA 4DZZA 3CVUA 1E3QA 1E6KA 2YMLA 3N8KA 4JDUA 5E9JA 1GA1A 3KR2A 3U4QA 4LF7B 2BFOA 4GPIB 4NMWA 2QMQA 4XD2A 2HQRA 2OLEA 3GBPA 4C0QC 1SVOA 1OU4A 1MLDA 2FOLA 3O4RA 1AHIA 5CBKA 3ITEA 3NC4A 2QTVB 3QPDA 4LJ7A 2EJCA 3S8YA 1P6XA 1QYXA 4DR5B 1V8DA 3UWSA 3GZ4A 2CMDA 3P4YA 2J3JA 3DDWA 4HDMB 1Q77A 1RE0A 1OFIA 1ZMXA 1USIA 3OT5A 4PLFA 1PJLA 1ZMRA 4C43A 2QR3A 2IH4A 4W9RA 2OM2A 3NDJA 1H9BA 5KQRA 2HADA 3FN4A 1ECFA 4EKNB 1A71A 3OPYI 3HKEA 3WDKA 2QU8A 4BUJA 1KI8A 1BGWA 3TUZC 4BV2A 4OX9B 4NMXB 4ARUA 2HV8A 2NP6A 2DFVA 2Q21A 2Q6VA 4RM3A 1UBKS 4E14A 1JLLB 4R83A 2JKVA 1KJ9A 4QT4A 2G9ZA 2WILA 3A9UA 4EYSA 2O3JA 4TWRA 1KZ1A 3ML1A 4MW5A 5LLSA 4YJ2B 2ZWOA 5CTJA 2QM0A 3PD0A 1Q74A 4IQFA 3WMGA 3RG8A 2JFFA 5FQOA 3O73A 1DADA 3FR8A 4RZUA 3RRBA 3LBNA 5EHIA 2ERYA 3LQYA 1TGYA 2NN3C 1BE1A 3EA4A 1KHTA 1JVSA 1RRFA 2TRSB 3H1EA 3WK5A 1ZJYA 2QW8A 4H7JA 4R81A 4ARBA 2I34A 2R11A 4O4JB 3G7SA 4LRYA 3MS2A 4XM1A 2V7VA 4TL7A 3VR2D 1UZLA 2IPNA 4MGHA 3MBIA 2EEZA 4EITA 3HJUA 3QHAA 1JHUA 2F3QA 3PUIA 2J9FA 4J1NA 3P0IA 4NQZA 3OZRA 2OCBA 2W0SA 5KX5B 2ZCVA 2PVCA 1B8OA 4B8YA 3JAMA 5DNWA 4ZTBA 1X70A 3A1SA 3TQRA 1WPRA 5IK2D 3TRKA 1V2HE 1SHTX 1T6YA 3H3XA 3QA9A 2NZ2A 4Q05A 4DV1B 2RB5A 1A95A 2AXPA 1Z0SA 2GH1A 2FFRA 2H1IA 2NU7A 1JFLA 1QH8A 2OFWA 3A3YA 4M55A 5GIOE 4OQFA 4EY5A 4ZHSA 1PNVA 3L07A 2PM8A 4BXOA 5GJBA 3B6ZA 4ASUD 2HDOA 2DPMA 4NFLA 2HMYB 4B6SA 2FX3A 2Q45A 4G1UC 5B12A 4P22A 3KJZA 1KERA 4BNZA 3PWSA 2ZBFA 1FTYA 3L1KA 5FLEX 2JJ1A 3RJ9A 5KOIA 2NNWB 2IPOA 2PGXA 5J2TF 2D62A 5K3SA 3R0VA 1RMTA 3GARA 4M0MA 3VKHA 4JBNA 3WNZA 4QTZA 3PGKA 4POOA 5BV2P 3VPCA 3A70A 4X3OA 2WWWA 3BSSA 1Z15A 4QYIB 3T0FA 3SYNA 3D2LA 1E9RA 2I3ZA 1U7HA 1HURA 4LI0A 3EW7A 3Q3HA 4J75A 2IXBA 1D3AA 1YRLA 5FL7A 4XPIA 1GZSA 3ULKA 4L6IA 2BGJA 3UZUA 5KSZA 3OM9A 2BGRA 2A9KA 2JZNA 3TH5A 4DA0A 1OB2A 1G5TA 3GYGA 2BGIA 3LT1A 4JJGA 3H4VA 2AFIE 3HVRA 3UC9A 1B6RA 4PEVA 3T5PA 4UD6A 2YCLA 1M8KA 5ES4B 1M2VA 5HE8A 1P9WA 2ZTUA 1I1QB 4GGMX 5FWYB 5T41A 1ZISA 2CJPA 5B6IA 2BR4A 1AOXA 4JD5A 5KNCH 2CXRA 3H13A 2IYVA 3RQIA 2H2HA 5GPBA 4RTOA 5CLQA 3HFRA 5ALHA 3HZOA 4PTZA 3RFUA 4E11A 4YMUA 3C7CB 4LY6A 3H8WA 1BGVA 2Y71A 4J7UA 4LCBA 5CXSA 4C7OB 1SZCA 4N39A 4F6RA 1RT9A 4K26A 2ZUTA 3KCNA 3T4XA 4P86A 3USES 1RLIA 1OA1A 2A92A 3ID6C 4DBVO 1X1AA 3T5DA 1ECCA 4LRSB 5TPZA 2NU6A 5KOJB 3MLEA 4PVDA 1VPDA 2P9EA 2POQX 3K2QA 1XWWA 2YBEA 1DOZA 1SBNE 5AJXA 3K15A 2CMGA 2R7NA 3QU2A 4P32A 3FPAA 2WUWE 4UBLA 4WKNA 4I1SA 5AW9A 1AQUA 1JHQA 4Q3AA 3UW1A 3MERA 1W4BA 3DPIA 1ZN2A 1X1RA 2FLKA 3OZSA 4IJKA 3AHIA 3CHYA 1RM0A 3QBDA 4ZC1A 5D1HA 4FYPA 3UH0A 2IXDA 1Y7LA 5K4AA 1YDWA 1FYVA 3PICA 3Q7PA 1YDMA 3ZD7A 1LLCA 2C5EA 4MRSA 3C8DA 3D4NA 3G2KA 4FT2A 2ZYSA 4KIGA 2AOUA 4WCFB 2PX3A 4I1RA 4CMEA 3TN7A 3LCRA 4OHVA 1FVXA 2W11A 4NMLA 5DW3A 3TMAA 3GW8A 2WINI 2PSFA 1THTA 1XK7A 1ZIYA 1DQRA 1Z4LA 2QRUA 4PZZA 2FA9A 4QDOA 3D7RA 4AG5A 3K4QA 1ATZA 4LRXA 3AF1A 4RKWA 4BS9A 1JLMA 3F9IA 1CUYA 3FBTA 3KJQA 1E7QA 4P38A 3DZDA 3WVNA 4YYZA 3HYNA 1IUKA 4PLHA 3QOYA 3JSAA 3SVZA 1AKRA 2JBHA 3QWAA 3DLCA 2WK1A 4FN4A 3TNDA 1K0FA 4S1VA 3V80A 1XD2A 4K87A 3FOFC 5LR6A 2QUAA 2Y99A 5DXAA 1ZUD1 2ACEA 1LNZA 3IRVA 3ODPA 1DJOA 4G23A 4D3FA 4PE5B 1XTJA 2YZKA 5CHEA 1KYYA 1SOAA 1T9CA 1Z17A 2NG1A 1B7GO 2O2YA 1LF5A 5CCXA 1I7LA 3N0XA 4LWZA 5DXFA 3I2FA 4NOKA 4KK3A 4XPZA 5I9IA 3C14C 2B7LA 1C7QA 4WNYA 3WGZA 4E5DA 3QLVC 3K5PA 1MW8X 3SHQA 3FYCA 2HSJA 3AEXA 4IH1A 5JCJD 1EX7A 1NVFA 4RH1A 5EIWA 2X0FA 7ABPA 2YS6A 3C7DB 2ZI3A 4WJZA 4BNUA 2YHIB 3LECA 1VPLA 3W04A 2HMWA 3DTVA 1INLA 1YDFA 2C3MA 3ODGA 3SIPA 3OSUA 1EWVA 4U9HS 2IYEA 5C53B 2G0AA 1Z8NA 2TMKA 5AUQA 5T4FA 5KWEA 1EQUA 5C8YF 4OXQA 3FVWA 3CINA 4ZARA 1FQOA 1O6FA 3A9WA 1LDEA 1N5LA 4D0SA 3FNHA 5CW2A 5JS8A 3C3JA 5KJFA 1Z2PX 3CSDA 4JC0A 5EGSA 3OLZA 5CG2A 1K5GA 1Z4PX 2VDJA 3MN1A 2ZWAA 4QXAA 5JO9A 3C1TA 2C84A 4V1CI 3O3CA 3FTQA 3D8TA 2L69A 3KT0A 3S0JA 4LXIA 2DFKB 5CAEA 2BONA 3M6LA 1CLEA 2IP4A 4G0YA 4NZOA 4ZVSA 4XWYA 3RQSA 4CBVA 3V8QA 3GLUA 3RI3A 5LDHA 2OD9A 4Y6OA 3GP5A 5CJPA 4CF6A 3ZV4A 1DRWA 1KO7A 5DT9A 1C7RA 2ORED 3RIYA 4BNNA 3I4FA 3RF7A 3CNEA 4BMCA 5BV7A 1BDHA 1KP3A 3K9NA 1WV1A 5B1IA 1T0BA 5T4BA 1EB8A 1HYHA 1IOZA 4D99A 4Q3BA 4NCBA 4NFHA 4RL4A 4MGYR 3B1JA 2O2IA 1O5TA 5JJIA 5DRTA 4TRRA 1DOHA 1D9XA 3BTOA 3VR0A 2I22A 4KXNA 2G63A 3IEUA 4ZI2A 5IJ9A 5I7HA 4JVSB 1SC9A 2XIQA 3RUAA 1FFDA 2JLUA 1GT6A 1Z7WA 2A14A 1QYDA 3NT2A 2RKWA 5AJWA 4EA6A 1CNMA 4I6JA 2ONCA 2VTEA 3B3QA 3SXJA 5FPYA 3ZD6A 2AYXA 3QG1A 1KEKA 4ZP1A 4ZAWA 5GVRA 3VKWA 4MROA 3KZNA 3T9DA 4AB1A 4FDMA 3H16A 4KQ2A 1VBMA 3HG7A 4KYUA 4QJ5A 1D6NA 3ACDA 5BR7A 3H9GA 1K86A 2HRDA 3KKQA 2HA0A 3ESYA 3OPNA 2OXEA 2IBTA 1QRRA 3C3XA 4C88A 3RBAA 2HT1A 4F86A 2GZ1A 1SG9A 3C87A 3O2QB 1G5RA 3HZHA 3JX9A 5ALIA 4QPZA 3ADCA 4K3UA 3ZNPA 4PAWA 2XV1A 3N53A 5EP1A 1U1GA 5AW7A 2PX4A 1FNDA 2I99A 1YC5A 2EX4A 1P1RA 1UM8A 2ORVA 2RJ3A 4H4DA 2FZ5A 3SYTA 4GPAA 2AFRA 4BJ3A 1PVOA 3HKCB 5EXSA 3EIWA 1NRXA 1O0BA 1HQDA 1TM7E 3GEMA 1PNOA 2Q6LA 1ADFA 4CUKA 2O48X 4CV0A 2QX4A 2DX7A 2ZJ6A 5GJCA 1QK3A 1AT1A 3COYA 3KDAA 3Q6NA 3X2EA 2ZR7A 1GHTA 2ZR8A 5BSEA 1E6WA 3K0CC 3KT3A 5FR2A 4YRCA 3UPUA 1MD9A 2ZT6A 3IBCA 1FX1A 2P78A 2ZDGA 3L7NA 5LA6A 3G88A 3OZTA 1MO3A 3OG9A 1QZUA 5K8LA 3KB8A 2P91A 4JY7A 2D5LA 3IXQA 4O6VA 4KE7A 5SZHB 2COKA 2H1VA 3BIWA 3MGGA 1PQUA 1T1GA 4D98A 1AK9A 4MUAA 2G9UA 1YZHA 2ZRMA 2B4KA 5J4VA 3IEKA 4H16A 4DM4A 4PYOA 1QE3A 3SX0A 3TSZA 2NZUG 3PTAA 2ZTHA 1SH7A 1N2ZA 4PR3A 5EZ5A 1G6OA 4DLTA 2CD7A 4Z7OB 1JPUA 5JV5A 3NYRA 1CUSA 4YAFA 3B5IA 3KAKA 4KQ1A 2JC3A 4HMOA 1XKXA 1VG1A 2ADOA 4LZZA 3RV3A 1AJEA 1SRQA 3HNRA 2P3OA 3GEEA 4S12A 4Z0TA 1XPUA 3OOHA 5EMHA 3MA0A 2P4SA 2R60A 5J9FA 3Q0IA 3K5HA 3UJNA 5IVHA 3AVXA 3G8AA 1O6ZA 4WY5A 3MBKA 1MXFA 2FUKA 4G84A 4ZYUA 5ALEA 1U0BB 1I7QB 2A4KA 3F5SA 3RANA 3TKLA 1UINA 5KJ1A 4B83A 2Z4SA 1QG2A 5JW6A 3CKKA 1KH2A 4TYNA 2KI5A 2XB6A 2O1XA 5KCZA 1D0IA 1X6VA 1EM6A 3TLJA 1XN1A 4MYUA 5DLDA 5B7PA 3TJMA 5CVEA 5CYOA