1CZOA

Comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWGVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Comparisons of wild-type and mutant flavodoxins from Anacystis nidulans. Structural determinants of the redox potentials.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Electron transport
total genus 58
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1czoA00
5ULLA 4U7GA 3U7RA 1CZHA 3NHJA 4DILA 2A5LA 3ESZA 1DX9A 4YAOA 4N9QA 1YOBA 1CZOA 3FW1A 1AKRA 4CETA 4F8YA 3UXHA 1XI2A 4U7HA 2D5IA 1H66A 1X77A 4QOFA 4M0CA 4QOHA 2FOXA 2M6RA 4ICIA 4LTMA 5LVAA 1FUEA 4YAFA 4QOIA 1F4PA 1FLVA 1J9ZA 3O2NA 2Z98A 1SQSA 4QOGA 1T5BA 3ESYA 3NHKA 3TEMA 5EMNA 3OX2A 5FA6A 3LT5A 3FNIA 4BMOB 4LAFA 5FX2A 5F12A 3NHRA 4ZVKA 3NHSA 5FUQA 3N3BC 1FLAA 1RLIA 4LA4A 3B6JA 1AKWA 4BMPB 2N1MA 1CZRA 2FX2A 3F6SA 5JROA 2R97A 2QMZA 5LBUA 4ZVMA 3OX1A 2W5UA 1WSWA 1CZLA 3NHLA 4OXXA 1ZWLA 5F4BA 3QFCA 2RG1A 1OBOA 2KQUA 3UXEA 3D7NA 1AKUA 2R96A 6NULA 1BVYF 1AKVA 4J8PA 4GQIA 3L9WA 3HR4A 5TGZA 4HEQA 1OFVA 2GSWA 2QX4A 2X2OA 4QOEA 2QX8A 1D04A 4YALA 1QRDA 1KBOA 1J9EA 2Z9CA 3GFRA 1D4AA 3OJWA 1WSBA 1YCFA 1C7FA 2X2PA 2V9CA 3B6IA 4D02A 5F51A 3FJOA 4XDGA 4ZVLA 2BZSA 3NHYA 2HPVA 1SG0A 1CZKA 2HNAA 4YQEA 3NHWA 4N65A 1T0IA 1TIKA 1V4BA 3KLBA 3LCMA 2BPOA 2OHJA 2ZKIA 1XYYA 1JA0A 3RPEA 4N82A 1FLNA 3F6RA 1ZWKA 3F90A 3P0RA 4FGLA 4C0XA 3TE7A 3K20A 1QHEA 4C0WA 1XT6A 2MWMA 5LJLA 2FLVA 2MTBA 2MOKA 1AG9A 1TLLA 2MT9A 1QBGA 4H6PA 1FTGA 3OJXA 3KAPA 3W78A 2M6SA 4NLLA 3FX2A 1DXOA 3N39C 3OX3A 1AKQA 4FGKA 1C7EA 3O73A 2FCRA 2V5VA 1RLJA 3W77A 1AHNA 5LBTA 3OWHA 2B3DA 1VMEA 2ARKA 2FZVA 5B3KA 2QWXA 1GG5A 5EAIA 3B6KA 3GFSA 3B6MA 4FX2A 4C14A 3EDOA 3OWXA 4S24A 4ZVNA 3HA2A 5NLLA 2QX9A 1CZNA 2XOEA 4YAWA 4DIKA 2OYSA 3R6WA 3NHFA 3G5MA 2OHIA 4PU0A 3FVWA 4C76A 2Q9UA 2FVXA 3HLYA 2FZ5A 4GI5A 1B1CA 1QR2A 2QR2A 2BN4A 5EA2A 1YKGA 3KEGA 2OHHA 4PTZA 4FGJA 3ZHOA 3N3AC 1OBVA 3KAQA 1BU5A 3QE2A 1J8QA 4QOJA 4ESEA 4HS4A 1E5DA 4YAUA 5BUCA 2XODA 3F2VA 1D03A 4Y9UA 2BMVA 2V5UA 5LMCA 2QMYA 4QODA 2KLBA 4H2DA 3GAMA 2FAXA 3EYWA 4CF6A 3ESXA 2AMJA 1JA1A 1I1OA 4LTDA 5B3LA 1YCGA 3QFRA 1YCHA 3W79A 2Z9DA 1FX1A 1DXQA 4PTYA 3ES9A 4Y7CA 2Q62A 3SVLA 3L9XA 4NULA 1NNI1 1YDGA 1AMOA 1J9GA 1CZUA 4LTNA 1H69A 5LJIA 5A4KA 2F1OA 1YRHA 3S2YA 4R81A 3K1YA 1RTTA 2QX6A 1AZLA 1FLDA 5LLDA 3GFQA 4XDHA 2BF4A 3JSXA 5NULA 3OVMA 2HNBA 4DY4A 3NHUA 4Y9RA 3NHPA 1RCFA 4U7FA 1XYVA 4GR9A 3TZBA 3NLLA 2Z9BA 1FVXA 1KBQA 2FDXA 1ZX1A 1AKTA 2WC1A 3W7AA 3U7IA 3NFRA
chains in the Genus database with same CATH superfamily
5C7YA 4M9RA 1PIWA 3GT3A 4BKUA 1SOWA 1YZUA 4L51A 1CVLA 1E3TA 2CNWD 1W0KA 1ZBQA 5BWOA 7GPBA 3D64A 1IUPA 1FSZA 1FDIA 2ODAA 4LXIA 1ZVVA 2H59A 3IR5A 2OOSA 2DBZA 4YP6A 3OZVA 4DM3A 5K3SA 4G0ZA 1G4HA 4YAOA 3HRIA 2MIIA 4KVFA 4OKIA 1GL9B 5IFLA 1A1VA 4W8OA 5BYAA 5IXYA 1M75A 2FW6A 3TX6A 4UBLA 4ML3A 5DI3B 1CK4A 2VP3A 4PM4A 3RBAA 4Y1RA 4XJSA 2ZBDA 2CXNA 2ZSBA 1QF7A 3EYAA 1E9CA 4GUDA 5L53A 5U4QA 2QTZA 1DIRA 2WVJA 4TLLB 1R6DA 5KWJA 2D5IA 1K6IA 3CMMA 3P9SA 2SCUA 3ZWBA 3W7VA 3HB0A 4ZOLA 4CODB 3CWQA 2C0PA 2HH9A 3MTAA 1CQXA 3BGSA 1Y4SA 3EULA 3RYCB 4ZTZB 1FUEA 4U2DA 3ZV3A 3WBFA 3SP1A 2RCYA 3SY8A 3KRTA 4NV3A 4QOIA 4YROA 3MUNA 4BKMA 3N75A 3PTLA 3U7EB 3AR4A 3PUZA 2JBAB 4J94A 3QBJA 2A0FA 2XR1A 4GR4A 1SQSA 3NGMA 4QOGA 4DV0B 2B2CA 4W99A 1ISPA 2EBHX 4B6PA 2OB2A 1GZVA 1YQQA 3WBJA 3TL2A 2R4UA 1QYDA 3KHTA 2G72A 1V5EA 1F3LA 1TFRA 3GJ7A 1U11A 2BBTA 5THXA 5TV2A 3AJ8A 1WMEA 5HG0A 3V8MA 3QVKA 1DWPA 7MDHA 2DHCA 4F72A 2DSTA 4XEHA 2J1LA 2J4DA 1GUFA 3AM5A 1U0OC 2I2WA 2XVMA 3KBBA 5A6SB 3FTNA 2ZTSA 5C0OE 5EXXA 3T1QA 1YQ9A 2ZDGA 4JR0A 4KXFB 4FBGA 5FBZA 4UCWA 3NNSA 1XQYA 2VQ6A 2Y1GA 4HLUC 3WLRA 5B1EA 5IBCA 1XVLA 1ACJA 2X4DA 3PC8C 4JU9A 3HN2A 4J4BA 1ECCA 4HXEB 3U9SA 3G5LA 5DLEA 2O2IA 1QH1A 1FEZA 5CU7A 3U49A 2FWJA 2VOJA 3CM0A 1AKWA 3K09A 1VJDA 2ZIXB 4XW2A 1Q50A 3U7HB 2VUTA 4BVKA 2E6UX 1LNZA 3NYRA 4G1EB 2F48A 1F6WA 2GK6A 3K0HA 4LYYA 2YS7A 1YMUA 2P68A 4O4HB 3GZNA 1YXMA 4OU4A 4DA8A 4GZ6A 1NT2A 4FB4A 1AUVA 4CKZA 1X70A 1U3DA 4CM5A 2HTEA 2OZVA 3T1OA 1PI3A 1SCIA 4FB5A 1D2HA 1R0WA 4TL8A 1JTEA 2HQ1A 1DIHA 2RI6A 1GGJA 1O9HA 2QT1A 1BEUB 2YWDA 4LY3A 3SYKA 3A1VA 4URWR 1XAHA 1LFDB 2ZBUA 3WB1A 2FJPA 2QYSA 4S05A 1YZGA 4RVUA 4UAGA 1RPAA 4INAA 2RFLA 4YJ2F 3Q8MA 3EXEA 3OIWA 4I55F 4Z4GA 1HF3A 4LDPA 4YRBA 3U4MA 1HOTA 3IQZA 2DQYA 1E63A 2R6DA 2AJLI 3N8NA 3GLIE 3ROPA 4DIUA 2ZUEA 1RM4A 5IEBA 1RE1A 1EE2A 1RQGA 2O2GA 1Q3TA 2V03A 1FFDA 2JHAA 2V6GA 2AFHA 4JXJA 4UPEA 1Q0HA 2VRNA 1ZM4A 4KKXB 4OYHA 5A0TA 3GROA 2ACKA 3H65A 4K9LA 1LEHA 2QN8A 3R3UA 4KO3S 4J0DA 1MT0A 3SR3A 1Z35A 3C70A 5E4JA 5FWDA 4R71A 1SBQA 2XD4A 2GJAA 2QZPA 2HK8A 1F6DA 3QU2A 5DYYA 4ZOAA 3BXFA 2B37A 2BHLA 3NHBA 4M0DA 3ZX5A 4BC1A 4KXYA 4X6LA 3T5GA 4DHEA 5CB4B 3U62A 2V98A 5L3QB 2H7XA 1VL6A 3KB2A 1R5NA 4O63O 2C31A 4B6QA 1UWVA 3K9WA 1YTUA 1XMXA 3LRPA 2QM3A 2AMYA 3KSDO 5EHNA 5G1OA 2QX4A 2PGIA 3QA9A 1SXQA 3RIEA 3I2KA 4DQVA 3UJ6A 3FBGA 2IPMA 5TX7A 1OPRA 4RIIA 4DC0A 3IRVA 4HZUB 3LT2A 4DSUA 1VSQA 4HXGA 5FFMA 2ZT7A 4GLFA 4HLUA 5IKEA 2QK4A 2OILA 4EUEA 3VR4A 3K35A 3OAAD 1GZ4A 2ET6A 3LYUA 3PC8A 3NDPA 3PRKE 2IGBA 1N5IA 2ACVA 4EG4A 6LDHA 4S1NA 3VZBA 1CLUA 2XH8A 3VR5D 4AXXA 1ZCFA 3LL4A 4S3MA 1V2HE 1QTIA 3BOSA 4M1ZA 3P26A 4RETA 1I01A 5SY4A 3T7JA 3ZCSA 1UJ2A 3AHDA 1DOZA 3I5AA 3Q72A 3QU5A 1W36C 1VE9A 2OGSA 4R1LA 2X8AA 3PQ7A 3QPAA 4U9IS 1LF5A 3A2LA 3MILA 1P1FA 3QJ5A 1AGXA 2EGGA 3FVRA 3ILVA 3DZFA 2AKAB 1A77A 3JQ7B 4JEUA 2O23A 1JHOA 4GLBA 3RT9A 3T95A 5HKKA 5KCZA 1KRHA 4M1WA 4IYRA 1RC1A 3CVVA 3GELA 3H11B 2CHUA 3ZV5A 3FJOA 2ZVPX 3UCFA 4L9SA 3HJNA 1LBSA 3GEIA 5LLSA 1P60A 3VU3A 2WM3A 2XMDA 4TL6A 4B2IA 4ME6A 4LZNA 1R1DA 5LZ7A 4R0NA 3KQMA 4JP2A 2V6MA 4HPXB 3CHYA 3NZEA 1THZA 3RK4A 2WUDA 3AGPA 3B9RA 5IWAB 1A8UA 1JHQA 4WZBE 4EFMA 4KCGA 3GJQA 1KKLA 1U5BA 3VHLB 2PT6A 3ZZ0A 5DLDA 5LZ4A 1C0KA 4YJGA 3ZVMA 2I6QA 1UDBA 2JD2A 4KTVE 4Z49A 5D5HA 4X7RA 2J4CA 2GZ2A 3RBZA 4TKLA 3KOYA 3IO5A 3T5DA 5JYEA 3NKFA 1YQUA 3QF4A 1OB2A 2VBGA 3B2QA 1US8A 4CMCA 4ZAZA 2CUTA 3BRSA 2WF7A 1ESNA 2DFTA 4AO6A 2QJWA 2Q3LA 3F90A 2WNSA 1GCGA 1A95A 2PZGA 2ZDQA 2J9XB 5E38A 3J81A 4MHOA 1FW6A 1G3UA 2ZIUB 2DKOA 3ZIAA 4RTNA 3KSRA 2ONZA 4MKIA 3H99A 2RGWA 3OECA 2GMWA 1GPLA 1K27A 5A05A 5LNK6 1YZQA 2VIIA 3ICEA 3EGWA 1NUUA 1MQ8B 1N7GA 3UPUA 2C8KA 3GEDA 2Q3CA 3K20A 3F7NA 1Y5IA 3VXKA 5CM8B 2PG3A 1R8XA 3FVQA 4KVAA 4NIMA 3R6LA 4XX0B 3VR6D 4B3DA 3LUGA 1RKBA 5K3FB 1QO0A 1JPVA 3OPYA 3SS7X 3TNDA 4YT8A 2H2AA 3P9PA 2WIKA 5JO9A 1L9KA 1QLJA 1JHYA 2ES4A 1CUGA 2QD3A 2XMSA 4KPUB 5JNVA 5IRCD 4CN8A 1LVUA 2C1XA 3ONFA 2EQBA 2ZE7A 3CLSD 5HQ3B 3MA0A 3K9QO 5BMVF 2ZSIA 4HK4A 4AECA 5JFTA 1KO7A 2R7LA 1ENYA 2IOYA 5K0SA 3TLMA 1CNFA 1XPJA 2QW1A 3DHYA 3PG5A 1GZ3A 2WZDA 2Y93A 1IZ8A 3U1VA 2OQIA 4LBVA 4LBYA 1FC0A 3RVJA 2EX4A 4WESB 3I39X 4NE2A 5EY5B 2NSHA 3OLXA 2EKDA 4IRUB 3OFJA 1I32A 1DGQA 5EMHA 1OBFO 3SLGA 5JBNA 2B5WA 4FHFA 2ZJOA 2EW2A 3PJEA 3PUYA 3W77A 4C2BA 5HS6A 4U2GA 4TPKA 2E9SA 2PKXA 4D0NA 2J5RA 1DJOA 1QOPB 3NOOA 4QT0A 2FZVA 4M83A 2P2YA 3HJRA 3NIWA 1WXHA 4GWKA 1ZXLA 2J08A 4NE9A 4KYUA 5EAIA 3R5FA 1PQWA 1N3IA 3BFKA 2ZJ2A 4D8TA 5AM2A 1Y6FA 1O89A 5CDSA 3RUEA 2HIHA 1I2MA 1J6UA 1G20E 1G6Q1 3GFGA 5CURA 5AK6A 1UPUA 5ANRB 2RI0A 1C3OB 3LQYA 5I6DA 1M8KA 1G21B 2HSEA 3KKEA 3VHXB 4HTAA 5BQPA 2PSEA 2Y76A 2ZWAA 2KM1A 3MINA 3PC6A 2UVPB 3H42B 4NH4A 4WV3A 5CA1F 2DBYA 3MUOA 4DBLC 5EFOA 3PNVA 2JA1A 4DWWA 1WNTA 3LVQE 3TM5A 1UDCA 2G83A 2BDTA 4RD2A 2WFMA 2PLWA 4YJKA 4DAEA 3GFVA 2X42A 4M7RA 1U9YA 1QG2A 1Q22A 5JMWA 5ALXA 2EFCB 1TQHA 1M1YB 5DM2A 2GRJA 2OHIA 4GL4A 5F52A 3R9XA 2C2YA 4D4KA 2FVXA 5DLYA 3BXGA 2A86A 2CLIB 4EKYA 5LQUA 1JN0A 3M1YA 5AK0A 3CY6A 3AFHA 2CL7X 2ONJA 2X86A 4PAOA 4QNMA 2CE7A 5I7SA 1IVSA 4M7WA 1YI8A 1IBCA 1XAGA 3SZ3A 1WMFA 3TAHA 3PEWA 1NBOA 5JG7A 3SQNA 1PYGA 3U3MA 3HUFA 1YB2A 3AZQA 3BIJA 1J49A 1LNSA 3ZY4A 3KKNA 1FXUA 2H4HA 5EA2A 1ZUWA 2CFTA 4XLTA 5K8VA 3F74A 2DM6A 4C6TA 4ETNA 1JH9A 1EFUA 2FK7A 3PLNA 1JQDA 1DC4A 1F38A 2V6FA 1GY8A 3OSZA 4QULA 5K4AA 1WY7A 2Z6AA 3HKDB 3OBBA 3HP7A 5JI3E 2GBLC 4JK3A 3Q41A 2BEVB 4Z0TA 2ZAYA 4UVHA 4GOJA 4K86A 4MA5A 3ZY6A 5GONF 3E6AA 2QRVA 3KYJB 5BN5B 2XA9A 1P2DA 1RBQA 4X9XA 3OPNA 2O8FA 3UATA 5LYJB 1RRKA 4OK5A 3K70C 3SCZA 3AL3A 4D6PA 3KT0A 5BT8A 1IFXA 2D5LA 4HS4A 3LT1A 4MQBA 3RC3A 2PMCA 3A27A 5H82A 5FTKA 1TTQB 3EGXA 4Q1BA 4BVEA 1MQSA 5A0VA 4IIFA 4FFLA 4DJFC 3RLFA 4RDIA 2PIDA 1GJRA 4V24A 2O8EB 5AW0A 4HS9A 1O6BA 3P9NA 6YASA 4HHEA 4C5CA 4CIWA 2G8LA 2MMGA 2PO5A 4A73A 1V11A 4DIOA 1QE0A 2ZIWB 4QXMA 4BX3A 4DN6A 1SKYE 5HBGA 5EERA 4IWNA 2HLNA 3IV7A 1O57A 2YBDA 2H08A 2YDYA 2VDOB 4TS1A 3QNMA 2AG1A 1B3BA 4O8ZA 3ABIA 4LK2A 3TOCA 3OC0A 1TD1A 1OLOA 4PBSA 1FF9A 3L8HA 4EQ6A 1T3HA 1NGSA 2Q99A 1UEJA 3PX2A 1G4UR 4YI5A 1GL6A 3B5IA 1QMGA 1NXWA 4WCFA 5ECDA 3SXJA 2OCLA 2OCIA 4A0SA 3C7TA 3K0KA 4MWEA 5I9BA 1B16A 4RZSA 5ENZA 2KHZA 1UP7A 2OHFA 4AKGA 2Q9CA 3NBQA 5KZMB 1RRVA 2Z09A 3U4HA 3MW8A 1T2NA 3MXTA 3D8UA 4Y2UA 2CWWA 2PEYA 4Q3LA 1XSEA 3LQ4A 3BSWA 4F8EA 1ZINA 3FSJX 3JY6A 2F3UA 4IKOA 4CM8A 1IDOA 1JXQA 3GUYA 1DL5A 5LUAA 5ICEA 3GUUA 3NIDB 2ZSKA 2XVXA 3GJYA 4YUYA 4DR7B 3GI1A 3ILXA 3L1KA 4N7RA 5C1BA 4H27A 2D2IA 1TNDA 4YV2A 3VU9B 3VR5H 4NULA 4A0FA 2ZFUA 1NNI1 2XWPA 2CLLB 3K0EA 3GRFA 4GRAA 1SKUA 1UMCA 2GBLA 4AMGA 4ZQCB 1W85A 2J3IA 2VP9A 3MWEA 1FS6A 1AH2A 4XUGB 2F1IA 2YICA 1CJMA 1IOWA 4QXRA 5AIAA 3DE3X 3H3FA 3PKIA 5DO9A 5ESXA 4DG9A 1OI7A 1JFRA 3AFIA 2A0YA 2IDJA 3N2LA 4J2TA 1XZ8A 2Q8PA 4D4IA 2BZGA 3PIIA 1P33A 3MS7A 3EVCA 2CJFA 2G70A 4QGHA 5MN4A 3EQ9A 3PGJA 4DLKA 1KFJB 4L95C 3H8JA 1NJSA 4CGYA 3ZHTA 4RF2A 1WW8A 3OQ6A 2IHZA 3A04A 3CGGA 3M9XA 3MPOA 4I81A 4MUAA 4K1LA 2NV0A 3M4XA 4X41A 4K6CA 1L7MA 8MHTA 3TTVA 1RCTE 4O2BB 5FHQA 5BSUA 4RF4A 5DV9A 2FSSA 4O4IF 2PS0A 3OU2A 5KYTA 3ET4A 1BXRB 1N8NA 3D4OA 3OM1A 2FP4B 1CD5A 1K6XA 4RY2A 4OAPA 1V1JA 2Y9PB 5JLAA 2P6MA 4FDAA 1SBYA 2I2DA 4IJ5A 3VR4D 1QQ5A 1T9ZA 2ZI4A 1MZVA 4KQ2A 4MB0A 3CB4A 1WZUA 3Q12A 1JDVA 1DMSA 1SN7A 3LVBA 4KQ6A 3WQQA 1PEKE 1KORA 1PKXA 4D4JA 2Q2NA 2HLPA 3HEBA 3CN7A 4IJUA 1JTVA 4M0UA 3PF8A 3W2HA 4AXBA 3HB5X 1E4EB 4PICA 5TB5A 2M6KA 3UK0A 2OZPA 4QJIA 2Z6VA 3NHPA 2FUNB 4NBWA 1YAJA 1D4ZA 1QFJA 2C2MA 4MGHA 4C5AA 3TPZA 2WA2A 2P2ZA 3AUUA 5EZ5A 5EJAA 4PINA 4ZYVA 5HKKD 4QBGB 1A8HA 2UUOA 3OOEA 2ZJ3A 2XNDA 4X63A 3VR6H 1C1DB 4HDOB 1WCYA 3PNLA 4JA0A 1PK8A 3SOPA 2CVPA 5HOEA 4RVNA 3R7FA 1SEVA 3VA7A 3BKWA 3T7CA 4BQOA 2X2FA 4DA7A 5L7WA 4CEJA 4ZXPA 1Y6RA 5YASA 1JDTA 4TWBA 2PUEA 2R6R1 3KQSA 2EARA 1JB1A 1I9CA 2DTDA 3I04M 5K6AC 5F7XA 4B4DA 3WBKA 4OQNA 4CM7A 1TYAE 4CHGA 1CRWG 2FW0A 5HFJA 1TVCA 2GNPA 4W9NA 1PEYA 4N41A 1U80A 3VMFA 4AMVA 4J75A 1JHPA 4B3JA 4IV8A 3WNZA 3EF3A 1YOBA 1EVJA 3DBLB 4I9FA 4BFSA 4BMXA 3EVNA 3G0HA 2NQTA 1V1RA 2XKBA 3REFA 4P3OA 1NUAA 3F3SA 2JI7A 1L4MA 4P36A 1OZHA 3UJPA 4E03A 3ICOA 3OCZA 2FUKA 2O0KA 3WG9A 2D1RA 3I9V1 1Q2UA 2YYZA 3S5JA 1DVRA 5HQTA 3ZIAD 1TC2A 5CLHA 1E7RA 4ZREA 4RMJA 3BXXA 4PNZA 3V3KA 2WVGA 4NPCA 2XOXA 3CCCA 5J58A 4HI0E 3GZ4A 2Q45A 4MS3B 4L6CA 3PV0A 4D4MA 1W52X 5AVJA 4AX4A 1E0DA 3QLVC 1T8UA 1CX9B 3KLNA 3OJ0A 4X45A 4AG3A 4UVGA 4D0GA 5JDIC 2WVAA 3ESBA 2FWPA 3KE8A 3KDPA 4FYIA 1QO0D 5JO0A 1YZLA 5L3ZA 3P45A 1DEOA 3I4CA 4KFTA 3ZD9A 1W5SA 3OOYA 4LBWA 1TT7A 5EP4A 4HDKB 1FTQA 1T8SA 1W44A 3PNYA 4OQDA 3OEEA 4X1IB 5KTNA 4US2R 2I7TA 4A5OA 2WFZA 2FXIA 2R8XA 1H2WA 5AI9A 4QU9A 4A23A 4KIFA 3DA8A 4E4TA 4TL7A 3V6MA 1ZJYA 5JSZA 2ODTX 1X80A 3GLIA 2QAGB 3G6WA 5KNCH 1P44A 1QE5A 1MOZA 4PR0A 4R8SA 1Z4NA 4US1R 4XQCA 1HYBA 3EFOA 3UT6A 3WLEA 1RYBA 5JS7A 4G23A 4G24A 4U6NA 2C58A 4TQUS 5ITVA 1DTWA 1J0BA 1DFGA 5K4HA 1L4FA 2W2OA 3QUBA 2FSUA 1PYOA 2EIXA 4WOPA 4YUZA 1X1BA 5E7MA 5CCDA 2GHTA 5K6AA 1UFQA 2QRKA 4ND8A 4YC7A 1G7TA 2Z4TA 4X3CA 2H51A 2YRFA 4O4JF 1T0PA 1C3VA 2FSHA 3KQYA 1IULA 3QJGA 3LHSA 4P86A 1GVNB 4MQFB 1OJLA 4TLEA 5CM9C 3OFSA 5F4ZA 2CSUA 5TXGA 1TD9A 1T9GR 2CZCA 3AR7A 3T7AA 4BAZA 1MGOA 1XZAA 3IALA 4NYMR 3PHHA 2AX4A 1KJ9A 3TB6A 1JI3A 3Q7RA 4ZDJA 3LL7A 1KO4A 2I8AA 4F5ZA 5DRTA 3U0VA 1A97A 2E89A 4ZI5A 4OO3A 5A06A 3VFDA 3FHCB 5C37A 4TROA 1V39A 4RY0A 3QFCA 2OL4A 4MO2A 1OI2A 2E49A 2IEZA 2FN3A 1MMFB 2Y4OA 3DOOA 4AJEA 4MIEA 2HK9A 3ZVLA 3G0BA 1H1LA 2DHRA 2VF4X 2BFDA 4YQYA 2O5CA 5AI8A 3H2YA 5IW8A 2MSEB 2ZU6A 3WFIA 3O2JA 3QLVA 3EZ2A 4RJLA 1CEQA 3NP7A 3UJAA 1ZD4A 4NFYA 1ZITA 1Y8ZA 3PFWO 1EFKA 3H05A 1OAOC 4WN3A 2Q0HA 2YMLA 2ZRLA 4JXKA 1TKCA 2R96A 4FFMA 3URMA 3HP4A 4ZAXA 3WLSA 1YBHA 2Z3ZA 3VSDA 2QROA 5JRJA 2Y77A 4A6EA 1E1DA 2P9GA 3KKMA 3WMEA 1Q1QA 1OFTA 1QP8A 3L92A 3Q5GA 3NKVA 2A5YB 1XQ1A 2KI5A 4JLUA 3QI7A 4RO0A 2AOXA 3TXXA 2IDZA 4WZBA 5CFZA 5JH7B 3FTFA 1MPTA 1H2XA 1SCBA 2VXCA 3NX4A 3QUCA 3LLUA 2P67A 4Z86A 5DHQA 4LWZA 5CJ2A 4QEKA 2P0YA 4D7AA 4RTKA 4JYCA 1HL3A 3QPDA 1X38A 4BLVA 3A1UA 5JZMA 5KOHB 3CPHA 4BO0A 3RV4A 2ORVA 3LPDA 4CUKA 2JATA 1T9KA 1GQRA 2DOKA 2FZWA 2ZT8A 4A2WA 1QYIA 5ENDA 3QU4A 3G9ZA 5DP1A 1J2UA 4CCSA 1AZTA 2R47A 5FV4A 3IUSA 3TLAA 1KMMA 4QDTA 1FMTA 4Z2YA 4K9NA 3HU1A 3MUEA 1QDLB 3WDLA 4LJ7A 1Z4OA 1EDDA 5ERXA 4EHIA 3FAKA 2YR0A 1U6KA 2P4EA 2ZYVX 5F7ZA 1LDNA 2JCYA 5ESWA 4YCSA 3UN1A 2VCEA 3N9IA 2ZS8A 4OL0A 3W2GA 3QNWA 3ANNA 2QVZX 3Q7PA 1LDEA 4OTZA 3NHYA 1T4GA 1XRRA 2ZSEA 4K03A 1OLXA 1PL7A 1K66A 3IVXA 3KJGA 3U0BA 4PCLA 3HYSA 1EE1A 4P7FA 4HV4A 4ALJA 4LN1A 3UWMA 3NHWA 3KALA 4JHXA 3Q9UA 3T34A 1K97A 1OI4A 1E5XA 4QUDA 3FWNA 3Q9SA 4JI3B 3QWBA 2OG1A 3UHFA 4QECA 1E6EA 3GPBA 5B7QA 1RI5A 4GW3A 1XTUA 4PLPA 1QHSA 2QPOA 3PCTA 4G5QA 2FP3A 3VR4H 2B20A 4AIIA 4DQKA 3HCRA 1OI3A 2YWJA 3FOCA 2GTHA 4KE7A 1OAOA 1T9AA 4OV6B 2NXNA 2YOFA 1HO3A 1VE7A 2YOHA 4TVOA 4FNMA 1KEZA 3DZJA 4A8HA 1WIWA 5BNWA 3LCVB 3FF4A 4Y2YA 2XB2A 4ASUA 1KI1A 1VG9B 3QYPA 4MGZR 4A82A 4GPZA 2CUKA 1H1DA 2IHVA 2D2FA 4OJQA 1P2GA 2IITA 4BQSA 4MUGA 4AW9A 2OHOA 3O8OA 3D8RA 3UO8B 5K0JA 2EF0A 2AFRA 2FGJA 3I09A 4DM7A 5F5XA 2VJMB 3NANA 4N6NA 5MFZA 2VQEB 1JIXA 1SU6A 3RT1A 1PW7A 1C7IA 4X6XA 3FSGA 1G20A 2MWMA 3HZZA 3LVFO 1G8SA 2MU1A 5SYAA 3FCOA 4TYWA 1XXHE 1CS0A 3G9XA 1HMYA 1JX6A 3RB8A 4C7KA 3WK5A 3TX2A 4YV0A 4IDHA 1FBNA 1IK6A 2ODNA 2X9NA 1ZCAA 2EIHA 3B78A 1GTVA 2B6NA 4P3NA 3WWDA 3EISA 3ZJTA 4LZWA 2VDRB 3UMCA 4XPZA 4H7IA 1WOYA 1WJGA 4D92A 5M29A 5HWSA 5KYUB 3TDNA 1DU4A 1IIRA 5HM8A 4D9BA 2QTVA 4K88A 3UAGA 1DJMA 1YDMA 3DHEA 3K2EA 3OFKA 3UJCA 2A1UA 5IAOA 1U81A 5KTOA 1N7JA 1S89A 4M88A 3N5CA 1DQPA 2V7QA 3FPCA 3UQZA 4XIGS 3VC7A 4NOKA 4DMHA 2WHEA 4GQBA 3T99A 2P6RA 1F8YA 3D8BA 1K8ZB 2OCYC 1DPFA 3ZGYA 5FHRA 5IT4A 2OVBA 4OIMA 3HDVA 2A8YA 3O73A 1X42A 1E4YA 1U9IA 2CNNA 4L57A 1T8YA 2XSZA 3QLEA 1LDBA 4BNYA 5JE8A 1MX1A 3WHPA 1KDVA 3MT7A 2XQFA 4WTOA 3R3XA 4N5LA 2WHYA 1ITZA 1DG9A 2ZJBA 4BP9A 4H6VA 2XDQB 3TLJA 4A5SA 3GFSA 1IHYA 5G53C 4YCJA 3FOBA 3OTHA 2XNDD 5HHTA 3WNDA 4PN7A 4KBFA 4OFWA 2FW1A 1W93A 4DEXA 3IPLA 1BQ3A 3JATA 1T9GS 1NY5A 4L4YA 5AM0A 3ZHZA 4BGUA 1UBLS 2IXAA 2D0OB 2FSPA 1IXSB 2PZMA 2HXGA 3V4SA 2P4QA 3QPBA 1LX6A 4HADA 2QYHA 1YR9A 4RL4A 5KYVA 1ZC4A 5BNFA 4BQFA 1AQ6A 5C53B 2NG1A 1XDUA 2B69A 1FJXA 1VE5A 3JALA 4BV3A 2HT6A 2JIOA 2OYSA 3GLGB 4ESVA 2AKEA 3LHDA 3K1TA 3SJBA 1T36A 3OZUA 1IBLB 4CLHA 2QTCA 3OBIA 3D43A 1TO6A 4N7JA 1NIJA 2J09A 3F73A 3DDWA 3BGIA 3VVLA 1OAKA 3B1VA 3N59A 4Q4CA 3W3AA 2XCIA 5E8JA 3QLTA 4E1VA 3ZJ4A 1P3Y1 3UMGA 1F51E 2EWWA 2F4VB 2WUVA 1M2JA 3B2EA 3U6BA 3BE8A 3WTBA 2KBFA 5KKAA 3U4QB 2XPCA 5BOSA 2PS9A 5BWLA 1IE3A 2SICE 1CUVA 4I9GA 2QVLA 4M1SA 2ZJ0A 1P4SA 3OZDA 2ZBFA 2A0UA 2QGNA 3AJAA 3MMNA 1IHXA 4JMLA 2NPIA 4YMWA 1W47A 4TZ6A 3LG2A 2WMDA 2X5OA 1E69A 5LZ5A 4ND4A 5CA0A 2VC2B 4ZIRB 4NYMQ 2I4OA 3CF4A 4TUYA 4TV8B 3EQZA 2IF0A 2IUFA 4YRFA 2UZ0A 4CLRB 1H65A 4OLJA 1S3FA 1P9RA 3AVWA 1JG1A 2SKDA 4EJ6A 5DFAA 5K45A 5IJWA 1DG1G 3OQHA 3ZKWB 4ESEA 2EJTA 1PLLA 2LIPA 3PC3A 3TXAA 2PBRA 4QDOA 5CFOA 1MIOA 4JYPA 5IM4F 3GJ3A 3WYNA 4YAUA 3G2JA 3OEED 1GU0A 1GIAA 2VZ0A 2WD7B 1OV6A 3NT4A 4MUMA 1ZG3A 3TUIC 1BJRE 4G4GA 5H9VA 5CAEA 1VPVA 5KYKA 1LLQA 1BYIA 1CDZA 5CB6A 4PXAA 4Y2GA 3NC0C 3JQ8B 4XVRA 2XMPA 4FDMA 2NZVG 4K6FA 1L5VA 3L2OB 1Z6XA 3DR5A 3CRRA 5BSWA 1TMGE 4NDAA 4FFRA 1BVHA 3ICPA 3EC1A 4LDNA 4E5YA 1QVWA 2X8JA 4F2PA 1WP4A 5TQJA 1IUNA 1FTYA 2FRXA 4FR5A 4IVPA 5LIRA 2VCHA 4C06A 4W5QA 2O59A 4MW4A 4RU1A 4TSFA 4F7WA 4CQMA 4P81A 1ORWA 4CKXA 4WBNB 4ECEA 4PQRA 3ND8A 4JI7B 3EMBA 3GGPA 1PQ4A 2G08A 2WR8A 3D1VA 1I1OA 1M67A 5I4IA 3FCXA 3B1ZA 2OPHA 4JITA 4QJ4A 5BRNA 2VDKB 1BVUA 5IKPA 1KDTA 1VL0A 2ATCA 2C42A 2VBIA 3E61A 4MV9A 4TTRA 4YXWA 4ZGGA 4F2HA 2QJOA 4HC4A 5KQRA 3THYB 4OHPA 4ZYLA 2W43A 4BFVA 3CUTA 3FZYA 2QENA 4W8GA 2YVUA 2CW5A 4HDCA 3FSRA 1PTKA 2AXQA 4H18A 1YVRA 3GNQA 1FQKA 2IUSA 1NVGA 4G89A 4W5RA 5JSQA 5LDDC 3KUXA 4B3CA 2O3JA 3O7WA 3WLQA 1TCCA 1HYEA 5IMSA 5DBFA 1DADA 3IX7A 1MEJA 1MIHA 3TVTA 1L7NA 3SVLA 3M2TA 4QUGA 3ADKA 4F9TA 1PZMA 3PXAA 5CVTA 2KPOA 3RI3A 2Y6VA 2VZEA 1ZRHA 3V32A 1BW9A 3E2IA 1IRXA 1T1JA 2PT5A 3MQ2A 5AM1A 3RS9A 3RS7A 1DS6A 3IUEA 1ZRMA 3DGFC 3SN6A 1NRWA 1P9LA 1QHXA 3BD9A 4E5KA 5JNTA 1JEQA 4GYYA 1FA9A 2X1HA 4JELA 1V37A 3G1UA 1Z7EA 3W5UA 2VYVA 2PZLA 2C5EA 1J99A 4G01B 3DC7A 1PG0A 3ENWA 4HLQB 1TT5B 4R81A 3PNMA 4L0CA 3ZBPA 4G67A 4G8JA 2VQSA 3KB6A 4UW9A 3FA2A 1GPJA 4AJKA 4C4SA 1FS5A 4YHBA 1F8FA 1Z47A 4GT1A 4ARZA 1GCAA 3S1SA 4IIJA 4MO9A 4YH1A 4ZZ2A 3NWJA 1YV9A 2VT3A 3AEUA 4EP1A 4RTQA 3EDQA 5CM2Z 1QYWA 2QRJA 4FZJA 4Q3EA 2MSKA 2YY6A 4JFAA 1RKQA 1GGKA 1TM4E 2GCOB 4R0VA 3VPGA 1KK0A 3HDJA 3RAFC 2ZI6A 5D86A 2R7AA 2CFIA 3FLAA 3R7SA 2CFSA 3BCSA 3B8EA 1NYTA 4INPA 4F86A 1JG2A 4HG2A 4WXMA 1TGVA 4FMDB 5FPHA 3VKWA 4TTVA 5CVVA 4PXYA 5GJVC 4BZPA 2Q27A 4LQCA 1VYVA 1OD6A 2VLBA 5IN5A 3ZE7A 5BR7A 2CT8A 4CLXA 4MULA 4ZT2A 4EGCB 4YLYA 3TAXA 5EIBD 1XCJA 2Y99A 3B3AA 4K0RA 3TZBA 3LW7A 2GVDC 1TAQA 4Z51A 3CVOA 5EFZA 3WKDA 4D8YA 4UPDA 3V1YA 4NCAA 5AHRA 3E5NA 4MRMA 3ZS9A 621PA 3OUTA 4Q3BA 3JQBC 1C9NA 3PGXA 3FUXA 3MFYA 4I3GA 4RDHA 4YCLA 1DIBA 1XD9A 1SXIA 1LQ2A 1YB5A 1CQWA 3UENA 4BGDA 3HNOA 5ULLA 3BSYA 4YO7A 3KYCA 5BYBA 1XZFA 1VIMA 4OHCA 1OIVA 3DNFA 4JUDX 4ZODA 5EJ5A 1UMBA 2HFKA 3BXHA 5C1OA 1GDTA 1N78A 2X15A 2G76A 4DMGA 3V4PB 2W2NA 5HS4A 4XJVA 3SS9X 2AOVA 2P9QA 3OQMA 5FOTA 1VLQA 4MKHA 3P9ZA 1Z8HA 4KTTE 1YR1A 4KDRA 1F0PA 1UQTA 2HWYA 4YPFA 3A36A 1KZ7B 2ODWA 3DE0X 1NTOA 1MDFA 4JEHA 1G0NA 3ONVA 3ROTA 2CLSA 3HGQA 4ASUD 1NQUA 2RAPA 4NE7A 5K6TA 1X14A 3P4UA 3SC3A 2IKQA 2Q0SA 3KLMX 2H57A 1LKZA 1RJ9B 2PPLA 1C1XB 5CB4F 2QNIA 1PGJA 3EDCA 5IT9A 5CDFE 4P0QB 2Q29A 4B44A 2IU4A 4E14A 2GSDA 2YQZA 3BREA 3FSGD 1DC6A 3IDAA 2GBIA 3NIGB 3K05A 1U1GA 5LVAA 4WZAE 2QUJA 3W90A 4DLVA 1WZCA 4HTFA 1ZMBA 3LTNC 4RV5A 2NM0A 1Q14A 2YVQA 1E3SA 4L5IA 1EX9A 1WTAA 1BHJA 2XE6A 3C6KA 5ALEA 4G0WA 3K6SB 4UM8B 1NLFA 2TMGA 3PFNA 4RPJA 4UAJA 4AY5A 5ITZA 3C3CA 3TEMA 2OC9A 5IBPA 3QITA 3MQ4A 4BRWA 2QP9X 2B4AA 4IR7A 1A7JA 4GI2A 4B6FA 2WICA 5ABPA 5AR1A 5AW1A 1QFSA 4ZQFA 1WDTA 3HB4X 3HB9A 2Y1LA 1WKBA 3DAHA 4HLNA 3K7EA 5ALJA 3HB7A 3FYSA 4A2QA 5IU6A 2V7QD 1CLEA 5IASA 4O2RA 2XYRA 3VRHA 4OKSA 3W7BA 2I2AA 1EFTA 2YIVX 3HKCA 2P79A 4LGMA 4HPWA 3JQBA 4RD0A 1JYFA 5G3YA 3L82B 2V0GA 3WLNA 4E5NA 2VNAA 3EPHA 2XSZD 3KZVA 2AFIA 1QWSA 2G0NA 1ZN8A 1UBRS 2BRUC 2I4MA 2D7JA 4W8HA 2W2QA 2XMRA 1HK7A 3HB1A 2X58A 3LDAA 5HIIA 1MV5A 1DDIA 2HMWA 3AR9A 4OQEA 2EHJA 4B48A 4DA9A 4I8XA 2Z83A 2I3GA 1JHRA 3VO8A 1N1DA 5B6PA 3KPYA 1RADA 2JGJA 1JA9A 9ABPA 2QE6A 5FOUA 2QV0A 4HUQB 4EW6A 3UY4A 2PX2A 1CZRA 2R25B 1VPLA 2R8BA 1MAUA 3G0GA 3OQNA 1BMFA 3PT9A 4ZPJA 3IAUA 5A4FS 1QHNA 4Q7QA 2PFSA 4YLEA 3WLOA 4K9PA 3UFXB 3B9BA 4XJTA 3FR8A 4ER5A 3ZVKA 1NFRA 1U7XA 2P8SA 4CG1A 2H1HA 4P38A 4UUQA 3I30X 3S5UA 3L7MA 4IOJA 3IXLA 2VZ8A 3Q9LA 4ZYZA 2AG8A 3L7BA 1I7LA 2I8CA 1Q1AA 4X00A 3TUJC 3W0LB 1F20A 3HRHA 4WZZA 2CYBA 5C8XA 2EVWX 2BFEA 3LPMA 2DJ5A 4HNQA 3W3AD 4DG8A 4KGXA 3C3BA 3JPWA 1ZZGA 4ZVOA 4YUAA 2M6LA 5C5EA 4RMIA 2Q4BA 1Z2CA 1YVEI 1XNJA 2RDMA 5EXEA 4DQDA 2J30A 3SX0A 2IKSA 4OBEA 2PKRA 2YFKA 2A5GA 3NCTA 5FI5A 1J5EB 1KP3A 1VTKA 3MFQA 2J5KA 3PNKA 4H7JA 3ODPA 4KSYA 4QGFA 2L17A 2ZI5A 4BLWA 1JKFA 4U9UA 3CEJA 4RZXA 4X1YA 5LA6A 3WQBA 3S6JA 2BFFB 1GNTA 4QLBA 4HUJA 3SE7A 3O4HA 3TCKA 3SC2B 1E5TA 3OQJA 4C88A 4DNFA 3LBAA 3INTA 3G7SA 3M5DA 5ADHA 1RKUA 3UT5B 1UXIA 5GP1A 1AHIA 4XJXA 2PJZA 2HGZA 4QUKA 3TSOA 5AUOB 3SXUA 4BV8A 3RTEA 3ZQ4A 1GPWB 3RARA 3NYIA 4LKRA 1UBUS 3L7JA 4MGYR 4RY9A 1VB3A 4WECA 1L5SA 4D0SA 6REQA 4JI0B 3TBFA 2ZJ6A 2GF2A 2I6TA 5SYMA 2QD1A 1G41A 3DL0A 1ORVA 3BRCA 5FEMA 3V48A 4PSVA 2OV1A 4IM7A 1B4DA 3IULA 2BRUA 4L7QA 1JLMA 1XCPA 5J63A 4CJXA 4HF7A 5CDGA 3GP5A 3GFRA 3IESA 1V48A 3KE9A 4LQLA 2PS1A 3DFMA 1V35A 3NPAA 3PGLA 2CL6X 2P41A 3HI6A 4NC9A 1W4BA 4I19A 5DWQA 3LOUA 2NV6A 3OJWA 5IFKA 3GV0A 2R8PA 1NWHA 1YCFA 2YN0A 3C14C 1WVIA 1Y8QB 4FCVA 3CZAA 4IMPA 2XY4A 3BJRA 4JC4A 5KI6A 2G7ZA 3G88A 4DT1B 3CF4G 4QE3A 4QXAA 4TSFD 1PBTA 4DAOA 2QVYX 4CQMD 3TK1A 4EGAA 2YHIA 1WXFA 3QSYA 2CV1A 1PJRA 3QVTA 3KJNA 3F6EX 1S6YA 2RH8A 4R51A 1N2CE 2ZT6A 3DTYA 3NBAA 4HDMA 4W63A 1XXHA 3TSAA 4ZJYA 3M6VA 1JG4A 3PWZA 2BZSA 5AVTA 2X1LA 2OBBA 1A9SA 2VTBA 2QV7A 4ZRDA 4YXWD 3AFMA 3H8SA 4RE6A 4EGJA 2J3MA 2XRMA 4ZTBA 1SMKA 4Y0NA 3G68A 5DTIA 3WWOA 1QGUA 4OI0A 3HU2A 2IL1A 3O83A 2D62A 1KVTA 1VMKA 3E2MA 1BKDR 5DNCA 2OXCA 1V4BA 3DZBA 3T7KA 1GPYA 2BPOA 3IHLA 5AOAA 5GZ3A 2K6GA 1ZJ6A 1PNRA 1ISGA 4RYDA 2HL6A 2W00A 4ZCTA 1VL1A 1WXXA 4QG7A 1IUOA 1Y42X 3A31A 3VI4B 3WR5A 1QORA 4I6GA 3R09A 5GTDA 4KWIA 5LZ8A 3PVSA 4LRXA 3DNPA 1DX6A 1P6QA 1UDXA 1Y1KE 4H3KB 4B3RB 3IA2A 1V3QE 1U8ZA 3PQCA 2X22A 1S9DA 2HUNA 3TQHA 1Y5RA 1SNYA 4LJ8A 1OASA 5CDTA 2CXSA 5EZQA 1C41A 2DB3A 3NHAA 5DE3A 5KTKA 3GRKA 3C74A 3A4IA 3K4QA 4O0MA 1YR7A 4RJKA 1OGJA 2VYVD 4UPVA 3T7EA 4AJ1A 1PTJC 4NDNE 5FRDA 3W5AA 4CEIA 1MOPA 3F7MA 1CUSA 4QD3A 2JLWA 2JGNA 1UODA 2IEBA 5LYJF 3CB2A 2IYQA 5EGNA 2CSXA 2N1BA 4M99A 4FT2A 4FD3A 2AN1A 4QYMA 1R74A 5ALWA 4C3OB 1K86A 4LYGA 3EPLA 4O5OA 2PX0A 3WIVA 5LCXA 1CP2A 3V1LA 1VLVA 1NHGA 1USGA 2ZJ8A 3PSHA 4J0IA 1NKVA 2XYQA 4M22A 4NAUA 2R8OA 1S7GA 1U0BB 3HYNA 2I34A 3QTTA 5AVWA 1CUFA 2CXTA 3KAPA 2GCEA 5JS8A 1X86B 3IERA 1DKRA 3W78A 2FR0A 1Q0QA 1Z62A 3Q40A 4LXXA 4C07A 1YMVA 3BK1A 1MX3A 5G4KB 3R3VA 2DHDA 3ZHRA 3RC7A 1GPKA 3KQTA 1B76A 3QVOA 2XWQA 3DAFA 5F2EA 1YACA 1Z7YA 1L8AA 4IUCS 4BZQA 1AHHA 3AB3A 4A1FA 1S2LA 1KO1A 4DTCA 1CEYA 1LRJA 4IIEA 5DBGA 1PHRA 2ZAGA 2B9EA 5HKAA 4IO1A 1A2KC 4XA8A 4OK6A 3ZXUB 1NT4A 1GAQA 4QJ3A 3DMDA 1NAIA 3NATA 1ISMA 1FDVA 1CY7A 4OHWA 2IA5A 5BYJA 4UE3S 5JDCA 4UKDA 3EZXA 4RWZA 1LC3A 1UJ4A 4NPAA 1WETA 5D3KA 3A37A 2V4ZA 5E1DA 3NNNA 3WAGA 1J5XA 4QGSA 3K9FC 4WOJA 1EFRA 4C4ZA 3HK2A 5ADVA 4B31A 2Q0QA 1E9AA 4JCCA 1WVMA 4W5HA 3ZYZA 3P19A 4LECA 1U5CA 2B1GA 3OIUA 1PT5A 2QW0X 3ZDYB 1AQYA 3PE4A 4R2XA 2J07A 3B7WA 5TY0A 1TDJA 1V45E 5EE5B 4KUHA 4R69A 1Z2NX 3AUJB 4IXTA 3CEAA 1RMQA 5LWQA 3SHOA 1M6WA 4K6HA 4QGAA 5A0FA 5FAKA 5IDXA 2EGUA 2ZULA 3A4VA 3WJ2A 3DO6A 3A32A 4UOZA 4XH9B 8GPBA 4DIFA 1Z12A 2HFJA 5CFQA 1QWOA 1VL2A 3JQDA 1B1CA 3V3TA 1ZIXA 3GCXA 1GA1A 1X87A 2B7BA 5DNVA 4R68A 3VR0A 1HT1E 1I6KA 1EP9A 1U2DC 3P9QA 1TUBB 1OH8A 5AM5A 1NSFA 1TTTA 3GL9A 3QX9A 3KEGA 4K3UA 5ALLA 3PNOA 2CD9A 4F3TA 3JQ9C 3K9HA 1MC1A 2AHOA 5ALDA 1NJ2A 3DOHA 1OBVA 2PL5A 3GJSA 3I1JA 1SXHA 3GDHA 3O8RA 1YKSA 2H5IA 4PZ9A 3AEYA 4Y1EA 5CAEB 5CH8A 1CY8A 1O8CA 1O94C 1KYWA 3OT4A 3OTQA 3KO8A 2JBWA 3DAPA 4O2BF 4D3FA 4DTIA 1HBJA 2DWCA 3BKXA 3N8DA 3BBPA 1U0LA 3ME5A 4K7JA 2DKFA 3A10A 4FNGA 4Y6GB 3ISJA 1SCUA 2B4TO 4DYDA 5IK2D 5CIQA 4US0R 4EO9A 3EQ2A 5IJ0B 3E5MA 4NU8X 5BUCA 4E70A 3KP1A 3KPUA 4AT1A 1G7RA 5KU7A 2JKVA 1IEWA 3F2VA 4G0VA 4KI0A 3ZI4A 3PUXA 4FN5A 4I6EA 4DLPA 4A8JA 4YT5A 1CSEE 4C7BA 3ZNOA 2GDZA 3KWLA 4NBKA 1RACA 3AWIA 2PMDA 2Z5VA 3SXPA 3ACBA 5JS6A 5LMCA 3F6BX 4DKXA 4QM6A 2JIMA 5DYGA 1T5HX 3AY7A 2CNOA 1V3UA 4U5XA 3W3AH 2PQMA 4B45A 1WZNA 3W6ZA 4PZDA 3VYTB 1GV0A 5LQCA 3E7DA 2LDBA 4ODIA 4HRXA 4URUR 2RBKA 2YHBA 4P2BA 4Y18A 4OX9B 1IXZA 3SC6A 4EAAA 4OQFA 4NYIR 1QXSA 1U3CA 5FD8A 3LZ6A 4OQ4A 4CG0A 2H4YA 4ZVSA 2AR0A 3RK0A 4DMFA 4ANFA 2E21A 1DRUA 5JXGA 3GMSA 4H7FA 2TSYB 3QW2A 4QFCA 3QHPA 3DZKA 1VSVA 1VRCA 3H3JA 3IP3A 1KJNA 1J2EA 1O5TA 2G77B 2WMNB 2YN2A 2GJ8A 1VE6A 2HWXA 1R0KA 3HXTA 4KXUA 4PPGA 1YA4A 2A1IA 5ESRA 1VYHA 1BMFD 1NU8A 2D3WA 4FHEA 1OQAA 1RW4A 4GXTA 5FJIA 3V42A 4MH0R 1M6NA 3HCEA 3HHEA 5C7LO 2O8DA 4PC1A 1J0EA 3P9KA 2ZDHA 4MWSA 4E12A 2P2SA 4YJ2A 4GG1A 3E9MA 4XTCS 4I55A 2X0EA 1H4QA 4G26A 1ZNWA 5FWXA 4Z1OA 4L5YA 3ESQA 1U2DA 3DLAA 2GDJA 3QBVA 3BJZA 4KX5A 3THWA 4J4TA 3EGEA 1QIIA 2YV3A 4N54A 2EFDB 1YB4A 1G6OA 4EL0A 2F1RA 2I3BA 4XSGA 4DJEC 5KYYB 4FFBA 2BTQA 2V55B 3BWVA 4ILKA 4XI9A 1BMDA 1E96A 4L08A 2GTPA 2FPPA 5DB4A 1OX5A 1COZA 2ZW9A 3L8MA 4QFMA 3DQZA 5DTQA 5IXSA 3I9NA 2OO3A 1O94A 3CJTA 3D2LA 1MQAA 2J31A 4HWRA 4JCOA 1EG7A 1UK6A 1V1MA 3GPDG 1XZJA 4FLFA 4IG4A 4UE6A 1QFZA 2J41A 4Q16A 3WNCA 2GPJA 3QVGA 4BCBA 2H17A 4DCGA 1YFJA 4AJ4A 1KY5A 3Q6NA 2GARA 4K05A 1PJ8A 1NY6A 2BFCA 5LQJA 1M0SA 3CUUA 1U65A 1R4ZA 3T0GA 4GECA 2P4SA 2J3KA 3NM6B 5T6BA 1IXYA 2OBNA 3I8SA 4HX5A 1EXVA 4JQYA 4P4TA 4FFSA 1NDQA 3NWOA 4R3WA 4XWYA 2XIQA 5IARA 4Z7OB 5K03A 4PLZA 3X0DA 2CMDA 2C98A 3HG7A 1OA0A 3TCXB 3X1YA 3DVLA 1NNLA 2VA9A 2FWIA 2O8BB 1QX4A 4GPAA 4FDLA 3RO7A 2YCLA 3KKPA 5CDYA 1E9BA 4JL8A 4QJ5A 5BSHA 4FDUA 3D54D 2JB9A 1ZEJA 5I7VA 2FTKE 4PPNA 5CH3A 1RAIA 3EBOA 1ZA2A 2VSOA 3K30A 3J81k 1NONA 3NM4A 4OJYA 3LHIA 4GBJA 2HA7A 3R0IA 4XCVA 3EZFA 5DYTA 3A7EA 3LNCA 2A5JA 3MYYA 1ACMA 3MF4A 1KI2A 1X1SA 3AX6A 4WN9B 3AP2A 4YCCA 3LM8A 1AKEA 1LU9A 3O9MA 2OD7A 2VAXA 1KDOA 2XEXA 1CUJA 4M8IA 5CMLA 1REQB 4BWFB 1Z34A 4C4AA 4IUYA 5CDFA 4K2HA 2YZ7A 3A6DA 1PV1A 4MPTA 4UXIA 2EP5A 4UHFA 3DFIA 4ZU1X 5JWOA 1GPMA 1MBZA 3OT1B 1IB0A 2GBCA 1CV2A 3SF0A 5I7HA 4LXHA 1R2QA 4GIBA 3KXLA 4WZAA 2ZPTX 4QKQA 3IAFA 1WUYA 1RIIA 3K6JA 4I9HA 5EINA 3G5TA 1YUMA 4JGIA 4RD4A 1WB6A 4R2LA 2OQVA 4NR0A 3S8MA 3IP5A 5LP6F 3TPFA 5FNVB 5FQNA 3U3KA 1E60A 3IDZA 3R41A 3SEAA 4TKVB 4GZLA 4DLLA 3DEFA 2K7ZA 2Y2UA 4IIXA 4FW9A 1Z4JA 7ABPA 3R76A 1S1CA 3FZEA 3GXBA 2D00A 2Q5FA 1QHGA 4RORA 4B7AA 1X7WB 3LFTA 4WLEA 2QLLA 1JBEA 2Z8YM 4G3XA 2H11A 2VYQA 3ELUA 4IFIA 4MLDA 1FDTA 2PX8A 1O3YA 3QEJA 4Q7LA 1QGED 1PFYA 5KVSA 4B34A 1D1QA 2D7CA 4BZWA 1XD2A 2OECA 4FYWA 4V1CI 4OXIA 2R1ZA 4QL3A 5I9TA 1XRPA 2WE8A 1VFPA 1CUWA 1HRKA 2QT9A 1EVIA 4WE3A 2RGYA 4HR7A 3L6CA 4JUFA 2XVAA 1N2IA 5EL0A 2WKPA 3WISA 2GN8A 1BGXT 2R60A 1P74A 1ULBA 2GN4A 2P5TB 2ZJFA 3ISTA 3MWFA 4GWLA 4DHWA 2OUKA 4I5EA 2YYSA 2P77A 3DQPA 3MT9A 2ZM5A 4ENVA 2BFNA 4PPYA 3ROMA 4YJHB 2M6RA 1IL0A 4MV4A 5CX1B 3UTCA 1EWYA 3QG5A 5IHXA 3NC4A 5IUKC 4OGKA 4EFDA 3WGVA 2JBHA 3WQSB 2J9FB 5D1NA 4JZYA 2VXOA 1GKKA 3KHKA 3ZU5A 4NSNA 5DGDA 1AU9A 5JH7F 1QRSA 1U8UA 1JLHA 4DSZA 5FYDA 3QQ5A 3DQQA 4CCYB 4G5OA 3ZCTA 4U3JA 4KAXA 1Z36A 2GJSA 1IATA 3RS2A 1CUCA 5EWJB 1Z75A 4MYSA 4B74A 2A30A 5FA6A 5ERGB 2CVOA 3LUFA 3RM3A 3EOBI 3LNTA 1FY2A 3ZBTA 4MRVA 2XJ4A 4KN9S 4FEEA 3WIUA 5AM3A 4NDZA 3HDGA 3RHFA 1JAXA 1T3GA 3IPAA 4B43A 4BBPA 2HYIC 3Q3HA 5JNWA 3KUCA 1SHZA 4Z0NA 2A58A 2H7VA 2XIJA 2BFPA 3THOA 2DFLA 1QYRA 2YJNA 1JT9A 3D4BA 4GOMD 4KQEA 1L8XA 4MTLA 3AB7A 3AINA 4IQ0A 5C81A 2ZRDA 3MAGA 2LD4A 2A9JA 3LBNA 3VI3B 1N5KA 4ZGWA 1WB4A 3O93A 5I7AA 1RI2A 1XIVA 1G4AE 4DRXB 4O29A 3WXBA 3B12A 4LVCA 3WSTA 1PG2A 1KO8A 3KVNA 4IY1A 4PAMA 1TC1A 4NBLA 3B6EA 1N5OX 4TRRA 2HAEA 3GVCA 5CA1A 1QP0A 1QQ7A 4EG1A 5IXJA 4WFQA 2CLMB 3HL0A 3OMWA 4K87A 3KQHA 2H4JA 1L5FA 4HGNA 1NN5A 1GAEO 3W5JA 3ZE6A 3AOGA 4C29A 1T0UA 5BQXA 5JROA 2G1KA 2C7BA 1SM4A 5H9WA 3UV7A 4M9UA 1SZCA 3WIBA 3PPYA 5AKJA 4HWPA 1FUIA 4CDGA 4ENWA 3NBKA 2Y6UA 5EC8A 1EFRD 4V1CB 3EXFB 1MA3A 4ZARA 5F2NA 4E30A 4H1HA 1X13A 1NI5A 4QATA 3KZMA 1CUEA 4Z6KA 2V5AA 4C87A 3DL4A 2OZLB 2E7ZA 3UH1A 3WDKA 4MQEB 4Q9IA 3QX7A 2NT3A 2XTZA 3JR3A 5GQSA 1E9RA 3O8DA 2CYAA 4RACA 1R0XA 2ILTA 1RAFA 3OI7A 2BV3A 4KKVA 1MN6A 3R20A 1OH5A 3OUZA 3V2IA 1A9XA 1B73A 4UFPA 4KO8A 1LBTA 3V8NA 3AETA 4R1TA 4Y7DA 5B1HA 3WGJA 2B83A 1DPGA 1ETHA 3T3HA 4U2KA 3SIRA 2O54A 4BBJA 1GQ2A 4RNDB 5E7JA 1KPIA 1TEXA 3B1WA 3BHNA 4X91A 4FR2A 1ZUNA 1CJUC 2ZJ4A 2QZ4A 3BERA 6NULA 5CDHA 1N2CA 2LRHA 1BG6A 2M2IA 3DZIA 1JALA 1JR4A 2O2HA 3FG9A 4FMCB 3X1XA 1ZJWA 1T1GA 3WYGA 4MKZA 5CG1A 3HYLA 3HCBA 2IH5A 1GRQA 2GLTA 1VL5A 4E13A 3OM9A 4N18A 5AYVA 1CY6A 1KL7A 2J7PA 4YT2A 4EY7A 4IFTA 2QX8A 2Y2VA 5LU8A 4MKXA 1JXOA 2ZIAA 3TZEA 1A7AA 2BFBA 3AWDA 4XUDA 3KVVA 3MAAC 3MWKA 4KUGA 2VJBA 1ONOA 3MERA 2DT8A 1DT5A 2ASVA 3CLUD 4RA6A 1RYEA 5EZYB 3H16A 5TJHA 1XVVA 4DY6A 7REQB 2WWIA 3EJWA 4GX2A 3RTAA 3KOUA 3A6GA 4C0LA 4JVLA 1YVUA 3T12A 2VUUA 3KYBA 1GGHA 1OYVA 2D1QA 3QHAA 5IAAA 1VRVA 4UQLA 4F4JA 5DHUA 2P2GA 2VF8A 1R16A 4M1YA 5IYZA 2D1YA 4Y9SA 1RRPA 2PVPA 4JDUA 4DC1A 4Y2QA 3F1KA 5ER6A 1ZNZA 2B36A 1EZ1A 3QYFA 3FWPA 5ALIA 3VKVA 4U2BA 1IM5A 4KYVA 1ORHA 1XEAA 3D7LA 4UM5A 1OU4A 3A9SA 4LF5B 2GXQA 3M1AA 3JYQA 2K7FA 1HPLA 1PT7A 4G86A 4R40A 4OQXA 5KJEA 4MP3A 4KGZA 4FILA 5I5EA 4ZV4A 4G65A 3C3YA 1HLPA 4N49A 1U0TA 4M53A 1MO3A 2ZQ5A 4HWOA 1JEOA 4UQPA 5CNMA 5EMJA 1KAMA 3VTZA 4BUZA 1DDGA 5A5GA 1NJ8A 1T0IA 4MV3A 2A3RA 2FPGA 3NHMA 4DMLA 1NW5A 1SCNE 2PUJA 5BV1A 2PRSA 1CR0A 3MWDB 4KLRA 5AO9A 3RRMA 1SD5A 4ZEMA 2RCNA 3TEFA 2QN2A 1I4LD 3CRW1 1ZK2A 3L8YA 1W87A 4PAWA 5HDQA 4B5LA 1Q1BA 2HR1A 3OE1A 4E21A 1L5KA 2JLSA 1CNMA 1XYYA 3L7LA 3RPEA 1MB9A 2GGSA 3H97A 1TCVA 3MN1A 2NNWB 2EKLA 3HC7A 4B3BA 4DV5B 2Z4SA 2I62A 1RBZA 1P7PA 2OBLA 2RHMA 1BCSB 3WL7A 1XRMA 2JDIA 4FFOA 4FGLA 3U6KA 3FTCA 1OREA 2OBYA 3GDFA 1I8TA 3I9KA 5G0UA 2GXAA 4DXHA 3HUDA 4Z0HO 2IT1A 3QFFA 3Q8KA 3KV1A 2WK1A 4OH1A 4BB0A 2IU6A 3BM5A 5I3CA 1YIOA 1O94D 3DAGA 3VVMA 5BQFA 4CMAA 4GICA 4MP6A 1OILA 3BULA 3VKHA 2C7GA 4HMPA 3SFTA 3ZI0A 4TV8F 4C0WA 1XT6A 1ST2A 2R85A 3LWDA 3MWGA 1PV4A 1C8BA 2XGGA 4MR9B 3MTJA 3NXKA 2A9QA 4Q9HA 4LJ6A 3ZD8A 1SUWA 1Z38A 4CFSA 4M9QA 4YGXB 2XUPA 4LNUB 1AG9A 2JFFA 3PUIA 4OMFG 5CLGA 4WERA 1VKNA 2J0UB 4XGIA 4C43A 1BH2A 2AFVA 1BHSA 1F6BA 3THXB 5F3DA 2JIQA 3K31A 1D7OA 4OREX 1RXEA 3G9TA 1LPNA 3GEHA 1A98A 3IBYA 4X60A 5H68A 4WK0B 4F8YA 3LX4A 3ON5A 3PR2B 3OJXA 5FBWB 5BSVA 4QVIA 3W1EA 4M55A 4CM3A 4MVJM 5KPJA 2X0IA 4OLBA 1C3EA 1ZU5A 1ULHA 5I45A 3D6AA 4KIJA 2Q2VA 3G7NA 4FYVA 4NU5A 5ALRA 3NEPX 2C3UA 3EF0A 2AOUB 3GLSA 1AKQA 1GYRA 4OMUA 2D1FA 3FZNA 5LXTB 1U2EA 2VJDA 1I7SB 1Y6GA 2A14A 2BF7A 4HNTA 4AYTA 1ULUA 3IKTA 4BE9A 1XMSA 3Q7TA 4WBNF 2EG5A 1JBQA 1L7VC 3ZZTA 3LO5A 2AWNA 2HMTA 3H9JA 1NF3A 5B3KA 2ZBGA 4ZYUA 2RONA 1OA1A 1C9KA 3LZCA 1CEXA 2UAGA 3RV3A 4K6OA 4QM7A 1GU1A 1DAPA 3E22A 3DV2A 3GK3A 2Q46A 1KZ6A 2W6CX 3R3YA 3TD2A 1Z5UA 4M0KA 4BTVA 5KSZA 3RVOA 1P7YA 2SNIE 3PXBA 5K0FA 3OWXA 3ZDCA 1YT5A 1FP4B 4RXTA 5HE8A 2H2IA 4UBMA 2B8TA 4WHMA 1ODJA 4MUIA 2O2CA 3ERCA 4KX3A 2LKDA 2PFGA 4LCEA 2FR8C 2GHIA 4B6GA 2UUCB 3BBLA 4DCSA 3CNBA 5JSHA 4UAVA 1SU4A 5GPBA 3R23A 4DSAA 3WK4A 4DIKA 3TMAA 3N28A 4G0YA 1HG0A 4JBYA 4XM2A 4O1HA 5JOQA 2H3HA 4PLHA 2HA2A 3HH8A 3NBYC 1FRVA 1RCUA 1WPGA 3QSGA 4ZCIA 1GUDA 2Q6TA 1XMOB 4J1SA 1PL6A 1PR9A 2ZIFA 3LO8A 4WNYA 4ECAA 3QXJA 4GDFA 2FG6C 4K46A 1ADGA 4IIGA 3AR6A 1XQXA 3EZ7A 4G36A 3NM5A 4H7PA 4U00A 4UNPA 1EVYA 4D4GA 1K75A 1UT8A 4I4LA 1N1EA 3TNYA 3EW7A 3AVXA 3TNLA 2QRGA 2X13A 1KYXA 2PSJA 1E4VA 2IXDA 4KI7A 2DJIA 1CHDA 1YE5A 1EDOA 2PGNA 2WSLA 3H1FA 2X4GA 4KP7A 4POAA 1Z3CA 1Y0BA 2FPOA 1G8PA 4KN8A 4CF5A 1GSOA 5KQGA 1ORTA 3EQ6A 3CZ5A 2C4KA 1X0VA 2R62A 3RAPR 4G41A 1IZ0A 4EI7A 1NW6A 3QWIA 4CF3A 3O9VA 1SKQA 1ZQ9A 1CQJB 1VHJA 4CMKA 4IDBA 4IDCA 3DDZX 3MJSA 3LRXA 1X1EA 1KP2A 2J9YB 2JZOA 3ND7A 1DINA 4L9WA 3WFZA 5K3OA 1RWNA 3GAZA 3RJ5A 1BA3A 2C5LA 2FUG6 2I9PA 3MT0A 3R5XA 4UJ3A 3P2YA 4RMGA 3I01M 4HH0A 2Q6IA 1TAHA 4LC9A 1UFRA 2PGAA 2QEQA 1Y3CE 1ZP6A 3JASB 4PG4A 2XE4A 3K5WA 4F97A 2WWYA 3FYCA 1Z18A 4D9FA 2VF7A 1KY3A 5CEFA 3AUYA 1A96A 1NLYA 5DHFA 1UIRA 4HO1X 2JJMA 1Z6GA 4P4UA 1C5KA 2LPMA 3AEKA 1EBFA 3CVWA 2RHOA 1S8OA 3JU3A 3FDZA 5DNYB 1GGMA 3LT0A 2ZAIA 2VQDA 3LF2A 3GGSA 4ND5A 4NAHA 1YOVA 3DEKA 1NG1A 2H1RA 5FWNA 4O4JA 3N6VA 2XNHA 4L27A 4XPIB 3RLIA 4BX9A 5EQDA 2PMWB 1JHMA 1YCGA 1KQOA 3UJ9A 3EH1A 1AUQA 1BH6A 1M2GA 2GHRA 4L5JA 1ZXXA 4PZCA 2VDLB 3QELB 5JSUA 4BTLA 1I51A 3ICVA 2RC6A 1U0FA 4Q4LA 3RU7A 3DLHA 2G07A 1IEVA 4AWBA 4A91A 1IN6A 1GGVA 4DDMA 2YW2A 2J6BA 1PF7E 3CF6R 3IJRA 4JI2B 1YR8A 1OHHA 1ESCA 2PUWA 1EP2B 4AQYB 3SAJA 1LC0A 3LLSA 3Q3VA 3EQ7A 4ENRA 3EEBA 2E5LB 3CZMA 3R2JA 2ROQA 5EYPB 4W1QA 2QR3A 1ND5A 2IP2A 2W2VA 4QPPA 4TWRA 3HVHA 2QN1A 2X14A 4H15A 4PNEA 4PZAA 3T7IA 1EGQA 3OPQA 5AUNB 2HSWA 2Z5GA 5KIAA 2BCGY 1SQ5A 4MW2A 3REOA 3BD6A 5KSYA 1WHTB 3IEUA 1QG0A 2O2ZA 3MTBA 4G5SA 1XQ9A 3ORHA 1VGVA 4FUTA 4CF4A 1K4YA 4ZFNA 2IH4A 1D2GA 4F46A 1FFGA 3N2GA 1D8AA 3PD0A 3O1IC 2WM2A 3X2SA 1KK3A 2PKCA 5JJ5A 3F96A 1UZLA 2QG6A 4LJSA 2DUJA 1DEAA 4BBAA 2DR0A 5LJIA 1MRSA 3WLKX 1U4OA 2IXEA 4GAEA 4G1CA 2GAJA 2INGX 3DWGA 4Q3DA 5IUNC 1SOVA 5F7OA 5IJ9A 2AC4A 3K1YA 2P30A 3V7WA 3BD8A 3IBSA 1TIBA 3R40A 4H08A 4Q19A 3RCBA 4HEJA 1L4LA 4D57A 2P7HA 3IJ5A 3L7CA 3HCAA 3AIIA 3EPPA 5JHHB 1XKQA 2QL9A 1Y82A 1AKNA 1RVDA 2J7PD 5TARA 4HUTA 2GPBA 4XOUA 1Y9JA 3CZQA 3PK0A 4Q1CA 3IUPA 1NUQA 3L4EA 1MEOA 4M8NE 4RBNA 5IJAA 1E1QA 4BQPA 4BVJA 1QU3A 2UKDA 3HJHA 4YYZA 2BGMA 3VDRA 1UWLA 2EYQA 1P9NA 2W6IA 5CNJA 2EG9A 2F43A 1M3SA 1F2VA 3C1TA 4H77A 3TDKA 1M34B 3MXOA 3PWKA 1LVHA 2C59A 2NN3C 4JQOA 4NNPA 5AI4A 2D1SA 2WLSA 3CKYA 4JI1B 1VC2A 3ZWVA 4B7CA 5JCZA 3CIOA 5CFLA 4YNBA 1NR7A 3BRWA 5COAA 4KQJA 1Z4IA 4NNJA 5BVGB 3BH6A 1XYVA 4F4HA 1QIJA 1IY9A 2NZ8A 1LLFA 5E4TA 1JNYA 3V1MA 3DKIA 2LCIA 4H0FA 4Z7NB 5HRUA 2H4WA 4BXOA 1HY3A 1RTKA 1SUSA 1ZLXA 3TD9A 4ZV9A 1J4AA 4YTEA 3G79A 2H8KA 3VC3A 3SZGA 3AUSA 2CDRA 1IAVA 3TIXB 1OUMA 4FM9A 5CEEA 5KJ1A 3ELBA 3AU8A 3EWNA 2O3SA 2YW9A 1HMPA 3LDGA 4R8VA 5F3RA 1P7VA 1K4KA 2MYPA 5IKMA 1KZHA 5J4KA 1V25A 1I3KA 4MUFA 1PFWA 2DLNA 3PR1A 4BUCA 1GZ6A 2VI5A 3MT8A 4EQZA 1N92A 5ALYA 3FCCA 3DBHB 3UC9A 5K2MA 4AO7A 1TQDA 3EVAA 1AKRA 4D8WA 3CE9A 1DC5A 4OM7A 5BYKA 3DLCA 5TQ0B 1UDAA 4OJTA 1Q7GA 4NCHA 4DNQA 2I67A 1N0UA 2OLKA 4BFUA 4IVNA 3V4RA 1H2BA 1R6TA 2FR1A 4LHWA 1M5RA 4JYAB 1XVIA 1GNLA 3D5EA 4HEA6 2JDID 2VDWB 4FE4A 1E5LA 4JVNA 1YL7A 1R6AA 4G0OA 1QYVA 2HTFA 3EXHB 1DFHA 4BNDA 4D45A 4GGOA 1G8FA 1QJ4A 3CNEA 3HU5A 4MNTA 2H9IA 2PY6A 4KK3A 4MRPA 2R48A 4N0MA 2GT1A 4I1RA 4DPLA 1XEXB 3HJAA 2PD6A 1YQEA 2ZYIA 2UZ1B 2FOXA 2W8BA 4TKZA 1EK6A 4F3NA 4HAVA 3RNOA 3F3MA 3SMQA 1V43A 3A6KA 3OZBA 4X8MA 2JIDA 2I3ZA 1NMEA 1YFZA 4CF6A 1BQ4A 2Z2YA 3B1FA 4NX2A 5D3ZA 1T43A 3UANA 3ZWXA 3DHVA 2EKQA 1OROA 3DKPA 3QEOA 4WY8A 1AURA 2N75A 1L4KA 5FL3A 1W19A 5FXMA 3V7FA 1N9GA 2RGNA 3EIHA 5EMNA 2J5BA 1NNSA 4I3FA 3QKTA 2W6MA 4R1PA 1T5DX 1OXMA 2V0NA 1HE5A 3EARA 5MN5A 2PGDA 3IB6A 1P2BA 2EP7A 4HN2A 1V5FA 3ENKA 5DKFA 3IE1A 1IB6A 5TDHA 3HWX1 4Z4HA 3AY3A 3LP8A 4CMEC 1KJWA 4BMOB 2HYDA 4LFBB 2PH7A 3WJAA 3DEZA 3VNQA 3FR7A 2VPQA 2XKJE 4KXVA 2YZ2A 1RT9A 2O2YA 3TM4A 3EOZA 4A9AA 1LJLA 1NN3A 2FMTA 4G0QA 3NOXA 6ABPA 4K1XA 4N39A 5GOTA 2PA0A 3INNA 4BX0A 3S2FA 1JQBA 4ETMA 2HBYA 3WOHA 4MIYA 4QA9A 2DQKA 1RLIA 4KFRA 5LP6B 1NOJA 4XARA 4PS1A 5C5IA 3UMMA 2D6FA 5ALKA 4BKPA 4LYFA 2HRQA 1G2OA 4M1QA 4CDNA 2NTNA 2W8ZA 1PZHA 2HB6A 2ILVA 3AERA 3KAKA 3SX4A 3AH8A 3DOUA 5E6SB 1P6XA 5I8WA 1KZGB 3NR2A 3JQFA 3NC1C 3FDFA 4EUHA 5HBRA 1HE8B 5F1KA 2R8YA 3N2KA 3PDIA 4RVOA 4PX3A 3ZE1B 1XZCA 3BIFA 2IWHA 2BGTA 4V2UA 4AIRA 2CXOA 2O7VA 3D2AA 1VCNA 1D09A 3S7ZA 1MJGA 3G1TA 4DJAA 1CF9A 1Q1EA 1U3FA 1YS6A 3G8DA 3OLVA 4QU8A 4UUAA 4B32A 3FUTA 4ROTA 3UXMA 2BP7A 4O2AB 4OVKA 2IY7A 4A0QA 2ID7A 3GN1A 3S99A 3WYAA 4AJIA 2WJWA 4RXUA 2ACWA 4BS9A 3ELYA 4EA9A 5JYCA 4EKIA 5B4TA 4H9GA 2NU6A 2FJUA 2QSJA 2OCGA 4FFWA 5AHKA 1N5JA 3DBIA 2PZKA 3P5SA 1JLLB 3L7NA 3QA3E 4NCNA 4TT8A 4XYEA 4MWZA 2PN1A 1Y8RB 1DQRA 1NFFA 2WJIA 3GVHA 3EAGA 1K06A 3DDSA 4BAGA 4BB5A 1EM8A 5KVQA 4B6JA 4CT0A 3KL2A 3H8VA 1JKJB 3LSTA 4BRZA 4JKIA 3U4IA 4PLCA 1HSZA 4QSMA 2CMFA 2YMQA 1KI8A 1Y3BE 3E9NA 4HRVA 3E23A 1GARA 2VUHB 4OBXA 3JQGB 1HKHA 3PIDA 5AI0A 3KQQA 1NI4A 2PX4A 3A6LA 2CLKB 1W581 3RYIB 5DXAA 1GAWA 1ZR2A 4ARVA 2GSWA 1VGRA 2FOIA 5H59A 3GUCA 5F21A 4MPRA 1MTOA 4QOEA 4RJTA 5IZCC 1BOFA 4NS4A 1W25A 4TVKA 3CBGA 1TUGA 1WU8A 1C0EA 2JARA 2PM8A 3IB3A 4H0NA 4R8MA 2X0NA 2BMFA 2X3UA 5DGIA 1UBSB 2QMQA 3X3HA 3L7DA 1EU1A 5FTLA 1RWQA 1THMA 1L5ZA 3UV6A 1ABFA 1R4NB 3NUGA 3R75A 4AF6A 5A1TA 2OHXA 1N32B 5KNBA 2FB9A 1OZAA 2A5FA 3PDUA 2HRDA 2R4TA 3A9UA 3CUWA 4D4HA 4KOAA 1BS9A 4Z4FA 1KFBB 1LF0A 3H2BA 2R1VA 5FWAA 2WG1A 2WV7A 1X1CA 2C57A 1QOQB 2AI1A 2HIMA 3TXYA 2FU5C 2J33A 1G5IA 4PQEA 1USVA 1KDRA 1KMCA 3AESB 2BWJA 3W4KA 4BU1A 4EK9A 4GPIB 1U98A 1KNXA 2XT0A 1E3WA 3DZHA 3IQWA 4W1SA 3VH2A 1M72A 4CIXA 3OG9A 3QKUA 4L8LA 5FPTA 5JWRA 3AI1A 2Z04A 2BKVA 3GQBA 3IT0A 3T3PB 5C7IO 2YV1A 3EAFA 4R1NA 4L6IA 3PX7A 3OZGA 2ANBA 1HYGA 1MB2A 2HPVA 2WU4A 1O08A 1SG0A 3KTDA 3OCYA 3QM1A 1OKKA 5EXDA 5BQOA 3JWHA 2GETA 5JWHA 1M5TA 4M37A 4YK7A 4BNHA 2ZSDA 3NALA 1OGYA 3EPRA 1JMKC 4FI3F 4GI1A 3C8MA 2WWVD 1OHHD 5DI3A 3M3DA 4L28A 2ATEA 3HY3A 3CONA 1Z0AA 1HLGA 2AXNA 1C7QA 1E8MA 2NP6A 3DFZA 1L5YA 1GDDA 3KK0A 3W2IA 4E5PA 1GUYA 1UZUA 3DGEC 2NZUG 4G37A 1HFJA 1LSJA 1M2VB 1KEPA 3JQCA 3RVLA 5JECA 2FEMA 1IG0A 2EERA 3FI0A 2ZYUX 5JANA 2XZOA 1YJBA 2AJDA 2F9LA 3IKJA 4WFKA 4BJ1A 4JGGA 2EV9A 1ENOA 3QOYA 3TTTA 1J0CA 1LRLA 2R5FA 4HQLA 4WVLA 4UU8A 3IIJA 5F76A 3RYCA 5LDHA 5FTNA 5DSZA 2DMRA 2DKNA 1SVOA 2CDBA 1FMLA 4G1MB 2AH5A 4OGWA 4TMXA 2GJ4A 3LLMA 4QDKA 1L4YA 1TJYA 5B3AA 1IWPB 2JBAA 2QSUA 4B79A 3DBVO 1YBMA 3FCSB 4XZ3A 4RC9A 4BVLA 1W8DA 1MAHA 4HQFA 2YMPA 5EE3A 2I1LA 2YXDA 1OE0A 4FGZA 3WGZA 2ZUDA 2QKYA 1XTPA 4GVLA 4MS1B 1U1DA 4EX6A 4XR4A 2MT9A 4RK4A 1X7YA 4PYIA 3HZRA 1ZVQA 2B7CA 2HWWA 2I80A 2QZJA 4HNRA 4YMSA 3UAOA 5A6SA 3K71B 3DE7X 3UJDA 4FOOA 4LZLA 3AIKA 4LPSA 2RHTA 4C05A 3AM1A 3AZPA 2XA2A 1E1QD 3M33A 3IIIA 1CBUA 1MO5A 2FJ0A 3G9UA 2XUKA 1UAYA 1LPBB 2HV8A 3JZFA 4LYEA 4C7VA 4G84A 2M6SA 2MYNA 2W6ID 3O8LA 3IUBA 4FINA 3FBWA 3FX2A 1M1ZA 1UK9A 5FBHA 3CVYA 1FMFA 3SSAA 4RDCA 1C7EA 3LUKA 4FE7A 2HOQA 5A5EA 3BZBA 2FPIA 3OOHA 3AI3A 3L77A 1QH8B 3ZUGA 2VPZA 5D2CA 3BRWD 1I4TD 1W59A 3OY7A 5LBTA 2B3DA 3W04A 1R8JA 4UNRA 2XCLA 3ZXYA 4KGVA 4AG6A 4QZVA 3V5NA 1NJGA 2IYOA 2JGEA 4B7UA 4C2TA 3AVYA 4MRAA 2O5RA 1QAMA 3FYUC 5AXAA 5IAEA 4BGIA 1OFUA 2IH2A 1EHIA 2G0AA 4M1OA 5AVUA 4Q18A 1GTJ1 3CGWA 2YJZA 4RK5A 1AMUA 4WASA 4DDUA 3STTA 4C7OB 2KS6A 4HOYA 1UCFA 3E1SA 3O2QB 3IVCA 3P2JA 4ZCLA 4PNHA 1XTVA 1PWZA 4AP6A 1B8NA 2HRRA 3FKJA 4FP9A 4HNAA 2FA9A 1F0YA 3M5CA 2DUNA 3SC4A 1W2WB 5AJTA 3IEXA 3RDPA 4AN1A 1KSFX 4ZQGA 3PPVA 2PD4A 3R4CA 1GTSA 2AUTA 2PD3A 5DJ5A 2I99A 2XJ9A 4UDYX 3T7TA 4DZZA 1WVGA 4C76A 1G8KA 1Z5GA 4YJFB 4ZVRA 1XLUA 2G6TA 2Q9UA 3AHFA 2HWKA 1T2VA 3DDOA 3QLJA 4LDRA 1E6LA 2C9OA 2OKGA 4PCVA 1BDBA 1QCCA 1A9ZA 3KVRA 4Q82A 3N8KA 4D82A 5F9MA 1AXRA 1ZHOA 1L5NA 4EVRA 3PXXA 3G2PA 1JYEA 1RWMA 3EGCA 3ENQA 4TRMA 1W4AA 2FG7C 3ZS8A 3NTXA 1DHTA 1A8IA 1II8B 5CB4A 5C34B 3H1EA 1HNNA 4OBBA 4K26A 1NUSA 2PPVA 1TTPB 1QPGA 5JRZA 1TXGA 4FOTA 3BFXA 1I4EB 1MKYA 2Y0CA 1EK2A 2D0PB 3EQ8A 4G1UC 1L1RA 1PCXA 2Z56A 1COWA 3IHKA 5LYYA 3ZHSA 2W2XA 4YRSA 4EUKA 1DQYA 4ZQBA 3IRUA 5D8DA 2WAXA 4ZCSA 1G42A 5IH3A 5DGTA 2RC5A 3EZLA 1WU7A 3BMOA 1Y48E 2DQ4A 4P4SA 2XHEA 4WEQA 1YHYA 4DWOA 3P2MA 4PV7A 1NHWA 4NJMB 2XX3A 3QGMA 4PVDA 4GVXA 1J2RA 1WHSB 1D4FA 4YBZA 1N2SA 3CN9A 1D0SA 2PE5A 3RYFA 1ZA1A 2APJA 5AOBA 2FOLA 1T6NA 3WK8A 9GPBA 1YQTA 1CJBA 5C32A 4J7XA 5J2TB 4KHZA 3THSA 1K9SA 3HVUA 4RKQA 3JQ7A 2HW8A 2B21A 3LHFA 1H6AA 2CVFA 3DOIA 4GHWA 5EP2A 3FPEA 2FFHA 1PKEA 1HGXA 1CFJA 5ICMA 3IAM6 4H17A 4JKOA 3H11A 4C4PA 3SI7A 4O02B 2HSJA 3BG5A 3D6NB 4ZHQB 3ZWDA 2X8LA 4WKPA 5T57A 5DXJA 3FB4A 3NNDA 1WX1A 2CXXA 1QCYA 5HVNA 4QLAA 1E9SA 1SURA 1BXGB 1OWMA 4Z4CA 1J06A 1D2NA 1M10A 1U90A 4UJ5A 3IDQA 4V39A 3D6UA 1CQIB 5FNVF 5GGXA 3D3EA 2AN4A 2HPAA 4P3KA 3G6KA 1Y80A 1CE8A 1MW8X 1GM5A 1QFYA 5JC1A 1X6VA 4FLEA 5T4FA 1XALA 3P0FA 1IY0A 3INYA 2WNIA 4X20A 3Q10A 1MZPA 1J09A 1AKYA 1Z33A 2Z08A 3RVSA 4RVDA 1UKYA 3N05A 4Z9BA 3ICQB 3DBRB 3TNFA 2DFNA 4XUEA 1IZYA 4BE7B 2BR5A 2Y1DA 3ZWCA 3SYNA 4XD7A 3L9XA 4FDTA 4Y6LA 4OXNA 4FSXA 2AXEA 1AMOA 1DAOA 5FAXA 5JJIA 1UBNA 4LF6B 4ERXA 3JTMA 4MLPA 5SY6A 5CBPA 5JISA 4P3PA 4GLJA 1C3LA 2J67A 3UEOA 2XHZA 1CPYA 1I3MA 4XX0A 5KHAA 3UXYA 4CU5A 1UP4A 3H7AA 4XWWA 4R9VA 1LLCA 5K3FA 1L7PA 5AKGA 2VWPA 3KSMA 3F5MA 2QSZA 4H1UA 5FPQA 3QENA 1FXSA 2BGRA 4ALKA 1RS0A 3EFBA 4V3CA 4A36A 2Y8EA 5L9AA 1BX3A 4WMLA 1KERA 2DPMA 2A33A 1JLSA 1MNQA 1RTTA 3WV5A 4H3VA 4EB3A 4B3XA 2VTEA 5K09A 3KWFA 3WICA 5GINE 2I2FA 1Q7RA 3BE5A 3GP3A 3GPCA 4WD3A 5EP1A 4YMGA 3SX2A 3D02A 1WO8A 4ZO9A 1CIJA 5I9NA 2Y1CA 4RE5A 3NJ8A 2OORC 4AJOA 4PR3A 3C1OA 4HGOA 4EPRA 5JIBA 3NAQA 4IKEA 2AW5A 1IQUA 1B74A 1VZ2A 4JOBA 3MTIA 2GUGA 1PZGA 3AV3A 3DT8A 3PUHA 3ZCXA 4UM9D 4PPQA 1AKMA 1GT6A 2GF0A 3LPCA 1B0ZA 4KUEA 1I36A 5KNBD 2C7QA 2BTEA 1M1NB 1ID1A 2ORYA 1C7RA 2NXWA 4PRLA 4OJMX 3L1IA 4N01A 4A0GA 4W7SA 4RADA 3EUAA 3QPVA 5FL7A 1TJNA 1YJ8A 3QVSA 3WMWA 2AUMA 1PO7A 3JQRA 5JHGB 1TUIA 2C8LA 3TW8B 3AHCA 2PZJA 3DBOB 3DF9A 1C3OA 4BNIA 1CIVA 2YXEA 5C5CA 2V45A 1GP2A 2P3QA 4FWIB 4WNIA 5JNLA 1NAHA 3D5QA 1BU8A 5EHZA 4V0OA 1VJ0A 5IP5A 3HCNA 2D8AA 3CZPA 3TRJA 2PYIA 3TRFA 4L4SA 5DWDA 4EUFA