1E96A

Structure of the rac/p67phox complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
178
structure length
178
Chain Sequence
PQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
publication title Structure of the Tpr Domain of P67Phox in Complex with Rac.GTP
pubmed rcsb
source organism Homo sapiens
total genus 61
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2000-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e96A00
3SHFA 5KSOA 4BFSA 4DB4A 1X3SA 3T5GA 4IFBA 4URXR 2P6NA 621PA 3TSZA 2GJAA 1XZQA 3QJYA 1OE0A 1VG1A 3K0AB 4JS0A 3K0EA 5C18A 4OQFA 2GEDA 3SBEA 2OM2A 4C0HA 3UIEA 3NC0C 2QQEA 3CPHA 2R2AA 3KQUA 1ZNWA 1NVVR 2IXGA 4L15A 1G4UR 4YXWA 2WKRA 5DGXA 1RVDA 4US2R 4HUQB 4E09A 1GTVA 4OK3A 1JR3E 5CDFE 4OQXA 5JWRA 1E2FA 1YZNA 3IEVA 2ZR7A 2ZRCA 5DI3A 2GXSA 2VA8A 1V43A 2QI9C 4URWR 1S0UA 1FMLA 3NH9A 3B82A 1RRPA 3U3OA 4OI2A 2GETA 3THOA 2OV2A 4G3XA 2O8DA 2WTUA 2VHQA 4HDQB 3ZQ6A 4RKFA 5DYIA 2AKAB 3K0AA 3ND9A 3RABA 4ZCMA 2AL7A 4ZPXA 4YMUA 3H2YA 1WRBA 1T5IA 4DSOA 3IUYA 2GCNA 3BH6A 1EGAA 4DLSA 3BS4A 4PX9A 2NO0A 2WJGA 3WNDA 2Q3MA 2QT0A 2V54A 4MGIR 1CBUA 1P62B 2FU5C 5TMPA 4HUQA 4PPNA 1TQ2A 3AH8A 4GNKA 1JR3D 1JBKA 4ZKDA 1SKYB 1Z0FA 3ZVMA 1XMJA 1SVIA 3TUZC 4MDEA 1N5JA 2QENA 5FFMA 4D81A 4GSYA 3F0TA 3FYHA 4DLZA 3WBKA 1W36C 4AD8A 1E9SA 1FFHA 5DI9A 1A82A 1MV5A 2ORWA 2G83A 4DSTA 1OYWA 3IQWA 1EWQA 3PUWA 3VR2A 4DIDA 2GZDA 3A58B 2WJIA 2MSDB 1H8EA 2PCLA 5CK4A 3SQXA 4TT3A 2B7CA 3QPUA 4TYPA 3AVYA 3C7KA 2IW3A 1QDEA 2WWXA 4M4SA 4F91B 3KFXA 3VFDA 1U0HC 5C1BA 1R6BX 1IQPA 4YMTA 1HH4A 2JJ2A 1KK2A 2ATXA 4JBYA 1Z63A 1XDBA 4F92B 4ARZB 1T8UA 4XOIA 2OESA 5JHHB 1B23P 4ON9A 1FUKA 3L2OB 1VPLA 2GNOA 2W58A 2FMXA 4OQMA 3EW9A 1YR8A 4JVNA 3H86A 4BUJA 4S2EA 4HZIA 3FKSD 3QVUA 4B34A 4M9ZA 1HQYE 5LPNA 1QG2A 2XNDA 1VKJA 3MAAC 4IKEA 1AJEA 3GP8A 1JEEA 2HXSA 1TEXA 1RRGA 3BXZA 1E2JA 3F5FA 4HB4A 1RYFA 4E03A 3ASYA 2EFHB 2CL0X 2W2VA 5FR2A 1BH2A 3LXRA 2IYQA 1UDXA 3IILA 3IO5A 1G8GA 3BK7A 3CBQA 5AJVB 4XSGA 3VR5A 1QBKC 1AS0A 1R5BA 4ARZA 1N0WA 4LBZA 3CX7A 3D31A 2DWQA 4V0OA 1NLZA 3BFXA 821PA 5G41A 4LHXA 1KYIA 2IK8A 3GJ7A 5ANRB 3DZ8A 3GJ0A 3E5HA 4RD4A 2IA5A 2A7QA 4IHQA 4B6EA 4IVRA 1P7CA 2PH1A 5CIWA 1F3OA 3X1ZA 2O8FA 2XJ4A 2OFXA 3TJZA 1VCMA 3HP1A 3MWLA 3BBPA 3IO3A 3CWQA 4IRUB 1NBMA 4JLMA 1XF9A 4YMVA 2GEUA 1QVAA 5SZIA 5FUWA 4I1SA 1W5SA 3PUVA 1ZU5A 3TUIC 1W4BA 1R0ZA 3LBNA 1DOAA 1MRSA 3NIBA 4MYCA 4UJ5A 2D7DA 1JAIA 3Q9LA 4QKQA 1QHYA 4HEJA 2ZSFA 3BFVA 2CL6X 4ESVA 4GT1A 1ZNZA 2DY1A 3AVOA 3RS4A 5AJZA 3IPYA 4YDHB 1GNRA 3W3AA 1N25A 4TQUS 3RS0A 2Z43A 4BGDA 1R8QA 1ZJ6A 1FTSA 4M8NE 1VIAA 1MR3F 2PT7A 1DPFA 1KY3A 1OW3B 1W0KA 3LBIA 1MABB 1P72A 2PEZA 2DFTA 4ZI3A 1OIWA 3W8NA 3KKPA 5SZJA 1NNEA 4ZO4A 4ABYA 5B2ZA 3ADBA 1EFRD 1R10A 1YZQA 2MSCB 2J7KA 1PLJA 1OF1A 2W0SA 4LJ5A 2F9LA 5FOSA 1E2HA 4Q9IA 2F7SA 1Z5ZA 5CIQA 3CRW1 2XSZD 2ZE7A 1MOZA 2CBZA 3NVAA 2ERYA 2WWWA 1W7AA 2NO9A 3A4MA 2F9MA 5L3RA 3TIFA 1XPOA 3SNHA 2B8TA 1G7TA 4TN1A 4DEYA 1IAQA 4XVQA 4A0RA 2GAOA 4M21A 3LW7A 4NONA 4KBFA 1MABA 4TLBA 1E1RA 1KNXA 1OSNA 3AP1A 3AUYA 2WJVA 2JCSA 3HPQA 2HCBA 1Q3HA 4DSUA 4WZBE 1OT3A 2DFKB 5KSYA 1HE8B 3AGPA 4I99A 2ZI6A 5KYKA 1JAHA 1KDPA 1V5WA 1RW4A 2FE4A 2OCPA 2XX3A 1G7CA 1LY1A 2FPKA 2GDJA 3U3KA 1SZPA 2W6JD 3CX6A 2ZAMA 3GJ5A 3TAUA 5KNCA 2W0MA 3VX3A 4Q7MB 1GFIA 2C98A 1SVSA 4XD7A 3TVTA 5H1YA 1NF3A 1WP9A 4PQFA 4A0GA 2FFHA 2FSFA 3EA5A 5EJEA 4TLDA 2ZJYA 3TLXA 3DEFA 2CCKA 1NVUQ 1E79D 3IBGA 4MRRA 2J7PA 5KNBA 2RCNA 4B71A 3UMSA 4ASUA 3NWJA 2PZGA 2XJ9A 1IY0A 4M1OA 1L4UA 4QGAA 1E2EA 3GJ3A 3ZVRA 2JLVA 2ZR0A 5FR1A 5AWFC 3RS2A 3ZIAA 2JLQA 1UEJA 3QBTA 1Z29A 3I3SR 3A1VA 2F6RA 1BYUA 2FNAA 1P9WA 2YV5A 3OE7D 2P6RA 1AK2A 1EFCA 1ZNYA 3K09A 4KO8A 1SXJD 4IOJA 5EE5B 5FOUA 5CM8B 1U0JA 1Z8FA 3WY9A 1LTQA 2ZVPX 1GKUB 3TVDA 4DLRA 3BE4A 2IWHA 1OXTA 2D4HA 2BEJA 3W5JA 2WPDD 2N1BA 3DVLA 2OHFA 1DBSA 1N0UA 1U8ZA 4DRZA 1RYHA 2ZRIA 5IRCD 1G21E 1M34E 2H1LA 2W6IA 3MWYW 3CKLA 1KDRA 1SKYE 4LZZA 4TL7A 1KO4A 1E0JA 1J7KA 4FIDA 2ZI4A 4DBLC 2ZRDA 4AKEA 1R7RA 1YZTA 5K8TA 2ZRGA 3LDAA 4ZCLA 3ZZTA 4CGZA 1VCIA 3FDIA 3U3MA 2QPTA 1P2SA 4NCNA 5HKKA 4GMDA 3EPHA 3CO5A 3KJGA 2OILA 3QXXA 4TYYA 2X77A 3UWKA 2VLIA 1GUAA 3NG1A 4I1OA 1Z0DA 2FN4A 4AY2A 1TMKA 2YOFA 5BN3A 1TF2A 4JLBA 1AZTA 1LS6A 2RGDA 2ZYVX 3BB3A 3QF7A 3SI7A 1OXXK 3RC3A 4HZUB 3K0FB 1E2MA 2ZANA 4PC7A 1FP6A 4IDHA 4TQAA 2XTZA 1L8QA 4QM7A 1UM8A 4KVAA 1JECA 4EUNA 3AVXA 4B47A 4R9UC 1W36B 4PHHA 1H65A 4BASA 3FMFA 1ZUIA 3ZVLA 2DYKA 3U61B 3PENA 3EWAA 2X8AA 3ZS9A 1DO2A 1R5OA 3SC3A 2OCBA 3FOZA 2NTYC 2QGZA 1LW7A 1U90A 2YJTD 4KLZA 2OAP1 1YVDA 4P0TA 1U98A 1HY3A 1SVMA 3W6NA 1YR7A 4JBXA 4KJZA 4YMWA 1XTRA 4HZUA 3K0FA 3DOFA 1FP7A 5EUQB 3UMRA 1UAAA 4IDQA 1F2TB 3HJNA 3DO6A 4A6XA 3ZLJA 2KI5A 3HR8A 3CR7A 1G6OA 1GZSA 5JBQA 3V4RA 5GJBA 4MUAA 3NBXX 4C0KA 1KIMA 2R6FA 4C2TA 1N6IA 2QSYA 2J59A 1IY1A 4MKHA 3K9GA 4PO8A 1D9ZA 2W83A 3CM0A 3PEWA 2LCFA 1FX0B 1S8FA 2FZLA 5J47A 4FD2A 3C41J 3AB3A 4OHYA 1KI4A 3L82B 2G0NA 2AX4A 2WWIA 1XJ0A 2O0HA 2RGNC 4MYTA 4PTLA 5LD2B 1TF5A 4PC6A 1J2JA 1F2TA 4JJKA 2JATA 1E2GA 3FHCB 5KPJA 1ZM3A 3BWDD 4HDOB 1DEKA 1TUIA 3QI2A 3X1YA 3OZXA 1UEIA 3WHKA 2D62A 4TYWA 1EFUA 1IN6A 3QXHA 2ZI5A 4BWYA 2V9PA 5DH9A 1DAEA 4JSTA 2N42A 3CZQA 3IBYA 2VQSA 4OL0A 2W2TA 5FL7D 4OKSA 1XWIA 5E7IA 1G7SA 1WBDA 1ZC4A 2HCJB 1XTKA 4XJXA 4JLOA 2EFDB 3GFOA 4PC3A 1UKEA 4IOMA 3DMDA 5L8VA 3LO5A 3E70C 4P4UA 1NKSA 4D0GA 4ZCIA 1LS1A 1OIXA 5TVKA 5P21A 2CMKA 4CEHB 3LBHA 3LW8A 4M1YA 2H17A 1U81A 4LUCA 2B8WA 1ZVQA 2WMOB 2DHRA 2Z0MA 4C0SA 3CNNA 4TZ6A 3L0PA 2LKDA 4G5GA 5FTJA 3VHLB 2R6AA 2OO7A 4QGHA 5E95A 3C4JA 3U60B 3KQLA 2J3EA 1S9HA 2C77A 2ODWA 3UKDA 2GAAA 4IVQA 4EQ6B 3RRNA 1XBTA 4QNMA 1JR3A 1UKYA 5CDFA 4UNPA 1EXMA 1IN8A 3Q7QA 2FPMA 2ZU0C 2ORVA 4TMKA 1EG7A 2G6BA 3VR4A 2YOHA 3A1UA 1GOTA 4QL3A 4B44A 2PMDA 4LJ4A 5H70A 2PZEA 5FBWB 5GADl 2XNSA 3FFBA 3EZFA 4Y0VA 2RAPA 3MWKA 4CEHA 4NL4H 2MMGA 5CLQA 2UKDA 2CLCX 4P31A 3I61A 4DCNA 4QJ5A 4II7A 1KI7A 4GDFA 1DELA 3TW8B 1RKBA 4NCJA 2V55B 1G8HA 2O52A 2IYYA 2NPFA 3C5CA 3A36A 4NYIQ 4EQ6A 1JNYA 4N3NA 1MO3A 2CE7A 3QOFA 4K81B 3FMOB 3QPVA 5BN5A 2RGCA 2VO1A 3OIVA 3AVQA 3CH5A 4Q66C 3HYTA 2ZJZA 2KSQA 4MYHA 1G64A 2HLDA 3ZDQA 2ZEJA 4OI1A 4I1VA 4C3ZA 3SJAA 3VNVA 2AD5A 1CJVC 4GP6A 1DG3A 3LFUA 3FKSA 2IXFA 2ZSAA 2XB4A 1Z0JA 5J4HA 4V03A 2IC5A 2Q9CA 1GVNB 3MCAA 3REFA 4OI0A 5FBQB 4I1UA 1E2DA 3GJXC 1ODFA 2CJWB 5EXSA 1G20E 4KYIB 4WA7A 1OJLA 4AG6A 3EX7C 2ZE8A 4GBMA 1VHLA 3BH7A 3E2IA 5A5GA 3BORA 1N6PA 2A30A 1Y63A 1G8PA 1E96A 1TADA 2JIZA 4HLUC 4RKEA 1KI9A 5AJWA 1D5CA 4B3GA 4QG7A 1ZUHA 2A5JA 1CEEA 4BQSA 2A5GA 4JT2A 2JLXA 4L4UA 2X1VA 4LHWA 2IYVA 4W7SA 4UJ3A 1FNNA 4LC1A 4NP6A 1I2MA 2GEVA 4KFRA 5BYKA 5DE3A 1ZIOA 1KGDA 2OBLA 521PA 3Q85A 1I4DD 4QGGA 4FMBB 4MRNA 1Z2AA 2VHCA 4B3BA 5FTNA 1IN5A 5KSZA 2Q9AA 2HV8A 1KAGA 2IBMA 2CJWA 4LYAA 4YLGA 2GJ9A 4E5UA 4ZKEA 5FI0B 2BIFA 5FUVA 3LLMA 1E6CA 2JLRA 3R7WB 3A4NA 3G82C 4UXJA 3ADCA 2IX3A 3ETLA 1QRAA 4Q4JB 3T35A 2QE7A 1CS4C 3K53A 4LHYA 2C99A 4CF7A 3D7MA 4BFZA 1CIPA 4HLDA 1TF7A 5EE0A 1XU4A 2PLRA 2XB2A 4P4SB 3NBYC 1GILA 1OPXA 1TTTA 1HT1E 1RJ9B 2BDTA 3VNUA 4KCGA 1BO6A 4PQRA 4CEIB 1Q20A 1HA3A 1KJWA 2IYLD 3C15C 4Q9KA 1QVRA 1E9RA 2UVQA 4PO1A 3N2IA 3U2QA 2X19A 2J0VA 2ZYTX 5EE9A 3PJRA 4IDOA 3CNLA 2ODBA 3MSXA 5FPHA 1XD2B 3EZ6A 4ACAA 4L16A 5TB5A 3R7WA 4BRUA 1VCNA 3QKRA 2ZQ5A 1NI3A 3A4LA 2EYQA 1E0KA 1YHNA 3AVTA 3VR1A 3THYB 5ELXA 4HI0E 4JYBA 2YNMA 4Q4JA 3IPXA 1NVXQ 2D7CA 2EW1A 5CJ2A 4HB3A 1Q1ZA 4URZR 1EX7A 3BH0A 4GMXA 3RWMB 1TQDA 4P4SA 1II8B 5G3ZA 1RJ9A 2P2LA 4LJ8A 1XCMA 4FXPA 3UATA 3X1WA 4CEIA 5DN6D 5H68A 4BLTA 1JQJC 5CK5A 3T1QA 3CF6R 3KKOA 1QHHB 3UXMA 1S1MA 2QTFA 4B75A 1DAHA 4HAVA 2NO6A 4PO9A 2A3RA 2TMKA 5LB4A 4A15A 2OAQ1 1LB1B 3CF2A 1XD2A 1YZKA 3OAAD 4ZDWA 3PUYA 4Q47A 2VL7A 2GK6A 4NU0A 3U7EB 3R9IA 3THYA 5SZKB 5FOTA 3PCRB 1CRPA 2WVJA 1OKKA 4XWAA 1YZGA 1N6NA 2RGXA 4BLOA 1DAIA 5FTKA 2VF8A 3PFIA 2EU8A 1IOZA 2ZAOA 1E2QA 3B9PA 5JCZA 3SYNA 1U2RA 1XTSA 2OLJA 3A8TA 1T91A 2CK3A 2I4IA 2BOVA 5AJYA 2REXB 3AP2A 1SULA 1E79A 4XWOA 1M7HA 3G0HA 2GF9A 4I81A 5KPDA 4QNRA 1FOEB 2ZPTX 1JB1A 2CLSA 1PUJA 1ZINA 3CF0A 4GPTA 5IT5A 4DSNA 3CONA 2AFHE 3OIUA 1HQCA 1W48A 1JXMA 3BC1A 4DDTA 3QXCA 1G3MA 5FPSA 1XMSA 1F48A 3OEHD 2PCJA 5CYOA 2GBLC 4CIDA 3OE7A 2YOGA 2FA9A 3M1IA 2JA1A 3OEED 4Q1BA 2GXUA 4HB0A 1M2OB 1COWA 4NZYA 4Q9JA 5KDLA 3VKWA 4F38A 2NO7A 1AQUA 1XCGB 2CNWD 2QPOA 4Q48A 1P75A 1GITA 4C4PA 3HYRA 5JWOA 3AVWA 4EPWA 2SHKA 2WPDA 3R20A 3MFYA 3NTUA 3L8YA 1G3IA 5FPTA 5BW8A 2W00A 3LVRE 2J0QA 4Q4HB 4R2HA 1IJFA 2GCPA 1VG8A 4C30A 1NSFA 5IF9A 1CR2A 1ZAKA 3T61A 2R44A 2CE2X 4NH0A 4EAQA 4TSFD 1KNQA 3EG5A 1P5ZB 3A1TA 1CTQA 2BBWA 3BOSA 3U6BA 3QE0A 3EPLA 1NN0A 5JJLA 2RGNA 3QNUA 4LK2A 4FW9A 4CDGA 3VAAA 6Q21A 2BHRA 3B2EA 3BB1A 1XCPA 3RDPA 2JJ1A 1CJKC 2VEDA 4NYJQ 1W47A 3ZQJA 2WSSA 1T4GA 3KXKA 5JCPA 4IXMA 2VP4A 1NG9A 1OFHA 2H5EA 1KO1A 2DR3A 3Q5EA 5EZ6B 3MG9A 2O8CB 3I73A 1YKSA 1HEIA 1QHNA 4M0LA 4A4DA 1UFQA 1ZC3A 5F3WB 3ZH9B 5FTLA 2VP5A 2YYZA 1B0UA 2GKSA 3CRQA 3FMIA 1TPZA 4DUGD 4NYMQ 1R0WA 4M1SA 4S35A 1Q22A 2YWHA 1E1QA 1N2CE 1NIPA 1QHSA 4TTQA 3UWOA 3I5YA 2QTHA 1KO7A 3LH5A 4A82A 4LYHA 1NVWQ 2ZRKA 3AKCA 1HV8A 3FFAA 4FN5A 3WP1B 2AK2A 4AKIA 5HPYB 2WIAA 4BFUA 2OXRA 4B3FX 4TMZA 5E3HA 4ERNA 1G16A 3SHWA 2REOA 3EXAA 3P27A 3RRMA 4EFNA 4TYNA 4KXFB 3SYLA 1HURA 1DAMA 1OFIA 3CRRA 3F8TA 1ZIPA 5BN4A 2O8CA 1NLYA 2EVWX 2ZS8A 5FBLB 1QF9A 3NH6A 3KJEA 2I3BA 2IYUA 5IK2A 5AUOB 3RSLA 1P4SA 1Z2CA 5LD2C 3CLVA 2ZI9A 1UPTA 3QVVA 2HF8A 2RGAA 2VPPA 1AQYA 4OBEA 3UANA 4AKHA 1XTIA 1PV4A 3I5XA 4KVGA 3ECCA 3B8HA 2CHGA 4B2IA 4QRHA 5TXGA 2ERXA 5HE9A 1CR1A 5D3MB 5EZ5A 2ZR9A 5L3SB 1G3RA 4K46A 5FL3A 4TTPA 3TGPA 2VRWA 4Z1MA 1YE8A 2G3YA 4Q1DA 4URUR 2W2XA 2A9KA 2JEOA 1FQKA 1E32A 5AUPB 3FHTA 5J4KA 1SVKA 1XJQA 1U9IC 2J41A 3ZYCA 4KYUA 5KO2A 1WMSA 2QP3A 1GNPA 3H0KA 1MO4A 5HZKA 4JLJA 3UK6A 2V7QD 4JVLA 4OJQA 2FEMA 3LNCA 3KQNA 1WA5A 3KJIA 4JYCA 1QHGA 4TMTA 5FL7A 2J45A 2C04A 3VMFA 4I4LA 1H8HD 4HLQB 4EPRA 3QXJA 4HLUA 5L3SA 1JXOA 1PUIA 4K8OA 2XGJA 1U8YA 5GJVC 1XRJA 1ZD9A 2ZROA 1ZM7A 2PJZA 4YONB 3P32A 3T5DA 2ANCA 1W4RA 4G1UC 2BMEA 4PZYA 1MO5A 1N6RA 4PC2A 4UKDA 4BEBA 2CL7X 1D2MA 4FMCB 2C2HA 1W44A 5F9FA 5M04A 1L4YA 4FMDB 3HU2A 4WXPA 5AJXA 3WHLA 3LV8A 3OFND 1KMHB 2RGBA 1HE1C 5EE3A 1S96A 5CJPA 1SHZA 1CU1A 1Z47A 4PQYA 2P67A 4XTRA 1WDTA 4WVFA 4QC2A 1MKYA 1LVGA 2CXXA 3MGCA 1YZLA 4PFSA 2AXNA 2F1HA 4DCUA 1DG1G 2HUPA 1DVRA 1OHHA 1TUEA 2FFBA 1LF5A 3MJRA 3GCGA 3K0SA 4W5HA 2KWIA 3KXLA 5KUTA 1A1VA 3B1WA 2G1KA 3QEJA 4RD3A 1D2NA 1BMFD 1E69A 1SXJE 1E99A 2GJSA 3C8UA 1UKZA 1N3BA 3FHOA 2ASEA 2ZM5A 2GZAA 3AGQA 221PA 3IHLA 4LV6A 4Q19A 3EPKA 4BPBA 3PG5A 4IJMA 1TQ6A 2KB0A 2QGNA 2KJQA 3QUSA 5FUYA 2G0TA 1KO5A 5E4FA 4BLPA 3SDZA 3OIWA 3WYFA 2JLZA 2DB3A 1TX4B 3L0SA 3TR5A 1X6VA 4LY6A 4BFWA 2VHTA 2GWHA 3GFPA 1ZP6A 1HUQA 3HU1A 4UNNA 4OI4A 1M7BA 2QN6A 1ZM4A 2RGEA 3LRPA 1KJYA 2VSFA 1VTKA 2FG5A 3W34A 2HEIA 5HZHA 2ZRFA 2ZJ5A 1GSIA 1GIAA 3KKQA 1NJGA 4YMSA 3SZRA 1W46A 4YXWD 1XEWX 5JI3E 1QG4A 5BWMA 1G291 5DHFA 3Q5DA 3TSWA 4B6FA 1NMYA 4DXAA 4BFYA 3K1JA 2GXAA 4CZ2A 1MH1A 3KX2A 4CEJB 1TQ4A 4M9QA 1S3GA 4NTZA 1XX6A 4O25A 5DYGA 2XZPA 3SQWA 4V0NA 4LWZA 4E22A 1E9CA 4LX0A 3GMTA 2QBYB 4B3DA 2HXYA 2WWFA 2QP4A 1G3QA 4EIWA 1NN5A 4AK9A 2GZHA 2RH5A 4G5RA 1E2KA 1K5DA 4RZ2A 5GJCA 2FSIA 5EQTA 2QM8A 2LWIA 3KKNA 4LPSA 3RS7A 2PBRA 4XWKA 2FEOA 1KDTA 2ZRLA 2GRJA 3IIKA 2ZREA 3MUFA 4JLPA 3A1WA 4CEJA 5G40A 3BERA 3LQQA 2WV9A 1UBFA 4DHEA 3MD0A 1IXSB 1LFDB 4A2PA 2WWHA 2QBYA 2P5SA 1JJVA 1YRBA 3I8XA 3GLIE 2JDID 1L2TA 3D3QA 3I8SA 3N2EA 4PPQA 1UBEA 1XEFA 4LV8B 1ETUA 4KFTA 4LBVA 1BKDR 4Q9HA 4BE7B 3LA6A 4V02A 1H8ED 2BMFA 2B7BA 4TT3D 2GBLA 1PLLA 2ONJA 1WQ1R 3EC2A 3RWOA 3B1VA 4XVRA 5JLJA 4EPVA 2BKUA 4B3CA 2JJ2D 3AVVA 3T12A 1T3SA 3NEJA 3W8RA 2HDNB 3ONWA 1EK0A 4WW0A 2IT1A 3B1XA 4JZKA 3NBFA 4IEEA 4LJYA 3SN6A 1II0A 2QTVB 2YVUA 1OH8A 4WBSA 2V8OA 2O5VA 5IDVA 4AYTA 2WAYA 1JALA 1N6LA 1SXJC 1P61B 2OZEA 1XMVA 3R8CA 4H1UA 3Q3JB 1YR9A 1P2VA 4FMDF 1E0SA 3O8DA 4RD1A 2IWRA 2XZOA 1J8MF 2VHUA 2XNDD 4Q7KA 1FUUA 3GLGE 1KSJA 2NIPA 1A7JA 5DIFA 3L0IB 3FTQA 1G5PA 1Z28A 3QG5A 1E3MA 4FCWA 5AK0A 4Q5IA 4M9XA 1P2UA 1E0AA 4D0NA 3C14C 2RMKA 1Q1EA 3IEUA 2QG6A 1OFUX 1E2LA 4WIAA 5JFGA 2IF2A 4D82A 5CB8A 2Z4SA 4Q02A 3KFVA 3SR0A 2QMHA 5B64A 3DZDA 1RRFA 1G8FA 2CVHA 4KU4A 2V1XA 4LJAA 1W2HA 3QIAA 4JIMA 4NDZA 4KLNA 3J81k 4ITRC 2I1QA 4POAA 1XD8A 3RRZA 1YZUA 2AN9A 4HAYA 1XTJA 1F60A 1KSGA 2GF0A 4F93B 4GOJA 1NBMD 1OYYA 2IUUA 4ZDIA 1FL9A 4GZLA 1CJMA 3V00A 2ZIAA 3RLFA 5HR5A 1WB9A 1Z6GA 1S1CA 3AF0A 2ZVQX 2H8KA 5DISB 2BBTA 1J8YF 2WAXA 2IS2A 3TH5A 2PT5A 1ESMA 3WMFA 2AD1A 3EASA 1Q1QA 2XOKD 1FX0A 5FPYA 4X8MA 5DSZA 2IYWA 2WOJA 2N46A 4OHVA 2OSBA 5FUXA 1KK0A 3OEHA 4NYIR 4A2WA 1MO6A 2BJVA 4RD6A 4LYFA 2AHOA 2GJKA 3QSYA 3OEEA 4Q01A 4CVNA 2IS6A 4BEJA 4Z8XA 3GJ6A 2VBCA 2CNWA 1G41A 1SVOA 3H4MA 2O8EB 3CPEA 3T1TA 1JR6A 4UXIA 3KQHA 3AF4A 5IHPA 4LHVA 4B2PA 2MMCA 3AF3A 3ZZ0A 4IXNA 2NMVA 1KI3A 5KSPA 3NBZC 1U0LA 2CHQA 2HT1A 2CVFA 1P2TA 4JMPA 4DC9A 3TK1A 1VYVA 4B43A 4RFVA 5LDDC 4QHTA 2OLKA 4QBGB 4Q21A 3DOEA 3AEZA 2FSGA 1KI1A 2QY9A 4ZI2A 3BAFA 1E4VA 2Z5FA 2Z83A 2IHYA 2DWPA 3K8YA 1U9IA 2F1IA 2FSHA 1D9XA 2DBYA 3N70A 4V0KA 2V4ZA 4TL6A 1RZ3A 1O87A 4EFMA 2WKPA 1U99A 5CM9C 1KK1A 2YC2C 4AG5A 3JZMA 3TRFA 3PITA 3VQTA 3KTAB 2RKOA 3PIRA 2QAJA 3BJIC 3NHBA 2OEPA 1RPZA 3L8ZA 1BYIA 4D4LA 2BEKA 3GPLA 2IF0A 2V6IA 1Q0UA 1AA9A 4L8GA 3K70D 4ZV4A 5L3QB 4HUTA 4BFXA 2JJ8A 1E9BA 5FBRB 4BZQA 1AZSC 4PPFA 2ZS7A 4QBHA 1EX6A 1VCOA 1IY2A 4D4KA 3HWSA 2H18A 4BFTA 4JL5A 5KNDA 3PEYA 4GRAA 1WXQA 1HTWA 3QKTA 3FE2A 4RZ3A 2GCOB 4CT5A 4W9MC 1NLFA 1D6JA 1YRAA 4DLTA 3PR1A 1CRQA 2YC4C 4P4TA 4UNSA 2J7PD 5G53C 3AUXA 2ZRJA 3BRWD 2YKGA 1Z22A 3TUJC 4YQFA 5TV2A 4F4CA 1T0JB 1GG2A 2C95A 2WWGA 4AURA 5JECA 4N0EA 3PEVA 2FFQA 1G18A 3TNFA 1ZCBA 5C4GB 4KV9A 1ZBDA 3EZ7A 3K0CC 4RJLA 3RS3A 1IM2A 4Q7LA 5J4VA 1NIJA 3B5JA 4LDJA 1P3JA 5L3QA 3ADDA 3VX4A 5HCIA 4PAQA 3UMFA 1JPJA 5DHAA 2CCJA 2P0EA 1E2IA 3CW2A 4G5OA 4PZZA 3W9YA 2ZRBA 4N0DA 5J40A 4DDUA 5BYJA 1AIPA 1EESA 1GWNA 5DNYB 2R8RA 2WMNB 2AR7A 1Z6YA 4JSYA 1Z06A 2QP9X 2ANBA 4OYHA 1E2NA 4P3YA 5HCNA 5JWHA 2BMDA 3WYAA 1K6MA 3EC1A 4MITA 3FMPB 4RVCA 1Q3TA 2C9OA 3QG1A 1VMAA 3GLHE 4RCYA 4TYQA 4HB2A 2Z4RA 1G19A 2IYZA 4EKDA 1U94A 4JJZA 3SJBA 2V7QA 4QJ3A 3ZD6A 1GNQA 2CDNA 1MT0A 4LC0A 1OXVA 3FKQA 4P32A 1GL9B 3U5ZB 4PXAA 1L7VC 2BKEA 4HAUA 1WBBA 5FI1B 4TQ9A 5JRZA 2QRNA 4BRWA 4PHFA 2BBSA 3M6AA 1ELOA 4LJ7A 4QHYA 2E1RA 4DCSA 1EFRA 1BIFA 1XD9A 2WZQA 1VIYA 4TLEA 721PA 1X8JA 1Z6AA 3W6OA 2PX0A 2ZJOA 3K70C 2XSZA 3SFZA 4JKYA 5EUMA 1XPUA 1NMZA 4G5QA 1M1YE 4AYWA 2JLUA 3WBJA 4PAOA 3ZZUA 1OH7A 3R8FA 1GKYA 5F2EA 1Z0AA 3U7GA 4ZDJA 4JL6A 1E9FA 3EIEA 4PZLA 3LAWA 3DM5A 3PUZA 4A8JC 5JRJA 3DKVA 3RC8A 4DLWA 5EXTA 4D26A 4G0NA 2ZUBA 4B35A 1OB2A 2QPAA 4MUBA 5GVSA 421PA 2VF7A 3GQBA 1VHTA 5F9HA 1XEXB 4GZMA 2ZXUA 2HT6A 4HSEA 2QMEA 2ZJ8A 2ZSEA 1W0JD 3NXSA 5TARA 2IS1A 1KTVA 2C78A 3QKUA 5JSZB 4MH0R 3QQ5A 4U5XA 3KL4A 4OJKA 2CEAA 2W6JA 3VR3A 3DL0A 1NRJB 3DPUA 4LJ6A 3ZD7A 1NMXA 1KDOA 1DAGA 1BMFA 1SXJB 1II8A 3CZPA 3I92A 4C0JA 4FINA 1W36D 4LGMA 1R0XA 2WKQA 2ZI3A 4V0ME 5D3QA 2WIBA 4RCZA 1X1RA 4V0LA 2VSXA 1TAGA 3MJHA 1QHHA 3H1TA 3UG7A 2GILA 2PMKA 1GAJA 3NDPA 2QAGC 1DAKA 1J90A 5H8WA 1F2UB 5F98A 3FB4A 2ZRNA 4B3XA 1AGPA 3EARA 2XTNA 1XEXA 1M7GA 4Z8YA 4NYJR 1DADA 2NGRA 4DCVA 3WXMA 2FV8A 4GI7A 5FTMA 5JSZA 3TMKA 1CXZA 1W4CA 2NZJA 3EA0A 1I4LD 2XTMA 2F3RA 2OUKA 4QBFA 1DAFA 3SJCA 2D2FA 2ZJAA 3T15A 5K8LA 5DLQC 1SXJA 1YQTA 2BJWA 2BWJA 1DARA 2Q3FA 2BMJA 1AGRA 2C8VA 1XEWY 2R65A 3I4LA 1A4RA 4NYMR 1KK3A 4TLAA 2A5FA 1RC8A 4B73A 2GXQA 1DS6A 2YZ2A 4EFLA 3NEYA 4PAMA 1KY2A 1F2UA 2F1JA 1HYQA 2NOAA 2NQ2C 2D3WA 4TTRA 3SBDA 4EPTA 1NG1A 1G6HA 2YWEA 4JVMA 2ZJBA 4TWZA 5FH9A 2WJJA 5AUQA 4BZXA 1ANKA 2AFIE 2DPXA 3THWB 2FWRA 3D8BA 4IW3B 4US1R 1PZNA 2L0XA 1A5TA 1KKMA 2G1JA 5E7JA 2A5YB 4LYJA 1KO8A 3QF4B 1FNMA 1N0VC 2R62A 4IDNA 2FFAA 3U4QB 4HYYA 1KMQA 1M74A 1IBRA 2QMUA 3IIMA 2FJUA 1N5IA 4EJSC 1N5LA 4YC7A 1QZXA 4QXAA 3B1YA 1NKTA 3MLEA 3I1FA 2ODNA 1X86B 2WM9B 2XEXA 2F3TA 3LD9A 3GJ8A 1S9DA 4DLVA 3SYKA 4Q18A 1YJ5A 3WNCA 4Z54A 1X8LA 4RD2A 1NP6A 5AUNB 3ND8A 2ONKA 3WRYC 4LSGA 3LQRA 4DKXA 1FTNA 2ZITA 2GA8A 1NVVQ 5LB2A 2QL6A 4GOXA 2QUZA 3HDTA 4Q4HA 4NHOA 3LX5A 2ZRAA 2IYRA 2JDIA 1KOFA 2BBOA 3CB4A 1AN0A 1W2GA 5A0FA 3GLIB 5E7MA 3THWA 4C0AC 5LBIA 4DJTA 2P65A 1AKYA 3A37A 3BD9A 1TU3A 5GVRA 4O2RA 1G5RA 2GVDC 3AVPA 3AKEA 3QF4A 2BM1A 2NG1A 3GLFE 2J46A 3U4QA 1QHIA 4CRWB 1ONBA 4M2LA 2J9RA 1N6OA 3TQFA 5C2JB 4NKRA 2GK7A 3T1OA 2EFCB 4URVR 1UDWA 3U3RA 4NBSA 1IJEA 3AQ4A 5JJIA 5TY0A 1KHTA 3RSOA 1IHUA 1Q57A 2FX3A 5K8UA 4Q00A 2QROA 2HLDD 2C96A 4TLCA 2YINC 2ECKA 3AF2A 4BLQA 1GL6A 3OIYA 2MSEB 1GRQA 2BV3A 2OBMA 3Q8XB 4IFEA 1OB5A 2ORIA 3A1SA 3B85A 4MRVA 2HYIC 2O8FB 4A1FA 1YR6A 3GLIA 4FCVA 4XSHA 3GLGB 5B57C 1VDZA 1SKQA 3QY0A 1ZU4A 1YU9A 4OHZA 1G1MA 3RS5A 5TDHA 3X1XA 1GDDA 1JI0A 1D2EA 3DHWC 3TW4A 2AK3A 1T8TA 1CJTC 1Y3AA 4XH9B 2JIZD 2H92A 4R71A 1IXRC 1VYUA 1J99A 3C5HA 1KJZA 2EFEB 2ZRMA 1LV7A 3JZAA 4GP7A 1N5KA 4DLYA 4D0LB 5G3YA 1AKEA 2EQBA 4KBGA 3W90A 5EXPA 1RFLA 1SHKA 2IYTA 3AV0B 4MRPA 3AVUA 4M1KA 3AF1A 3HU3A 1G17A 4NE2A 3I72A 1C1YA 2BC9A 4KODA 2PLFA 4R98A 3W6PA 1J70A 2FF7A 4YDSA 2Q6TA 4MGYR 2WHXA 4Y0AA 4C7OB 1M8PA 3TQCA 2DFLA 4GL2A 3ZS8A 2P5TB 2IEZA 1G4AE 3GLGA 2ATVA 2QU8A 3IKJA 1XXHE 3BFKA 5KDOA 1BS1A 3NKVA 2OBNA 3FWYA 2VIIA 2A78A 2F1RA 2IYXA 4OQNA 3PEUA 4QBIA 3SJZA 1T6NA 1IN7A 3Q7PA 5JS7A 4X8LA 1JQLB 2QNRA 1GKIA 5FOWA 2QE7D 2QSZA 3PXGA 1IXZA 2XOKA 2ZYWX 5D3MA 3TKLA 2HJVA 4RY2A 1S2MA 1MRNA 4C2UA 4Q4AB 1Q44A 4GFDA 3B1ZA 3AKYA 3REGA 1TL7C 4Q1AA 4LJ9A 3O47A 1P6XA 3T1VA 4H9GA 5JI2E 2OFOA 2G77B 5C4MA 5HTKA 4C7OA 1P60A 1GP2A 1NN1A 3K0CA 4UXHA 1UF9A 4JKIA 1Z6TA 3V4FA 5BXQC 2Z6VA 2EWWA 4IDPA 4XTCS 1XFAA 2NZ8A 1C9KA 1ZUNB 1Z6XA 3RAPR 1SVLA 1RIFA 3V9PA 2R9VA 5KTYA 2FZ4A 4TMXA 2D06A 4NCHA 1HT2E 3H84A 5GJWC 5CYPA 3S1AB 4PANA 1EFTA 2DWOA 2F43B 2R6DA 2RGGA 3PV0A 4PHTA 3THXB 2Y8EA 3K70B 3K9LA 5JJKA 1FPMA 2KE5A 1G3UA 4Q4AA 1AS2A 3TE6A 4U7DA 4LV5B 1K8RA 2RHDA 4E07A 4XVUA 3RYTC 2O8BB 4LRWA 4JVSB 1KI6B 1UBGA 1R4AA 1NSTA 1TNDA 2IEYA 4PSVA 1WCV1 4RD0A 4ZIRB 3EZ2A 2REBA 1XMIA 4Z51A 1KI8A 2V3CC 1P9RA 1KI2A 4A8JB 2JLSA 1ZM9A 4DDWA 1G7RA 3IIJA 5CITA 1KMHA 4C9BA 2VYFA 2HYDA 4KFSA 2ZU6A 4A92A 1NY6A 3JVVA 4OQLA 3P26A 2UZ3A 5EE1A 1OKKD 3S1AA 1JJ7A 5EP2A 2F43A 2H7VA 3GJ4A 3THXA 2IYSA 3AM1A 3IGFA 3Q72A 5SZHB 3X1DA 4B74A 2GHIA 4HDCA 4ILEA 2OCAA 1IONA 4O2LA 2ZE6A 1TEVA 2CK3D 3WMGA 2O8BA 4AKGA 1KI6A 1TU4A 4C0BA 3B7GA 2H16A 1F6BA 3KZ1E 3W3ZB 4ZIRA 1XP8A 2J0SA 4FWTA 3FGNA 1CP2A 3UPUA 3I62A 2GVZC 4A8JA 3L43A 1C4OA 1X1SA 2QAGB 3K9NA 4LPKA 1ZNXA 4PHGA 3SE0A 3ZJYA 2I1VB 3CH4B 3AP3A 3JVUA 1P9NA 4AC9A 4HAZA 1NL3A 2C5LA 3BIFA 4MGKR 1KAOA 1AS3A 2ZS9A 2JGNA 3DM9B 2KBFA 3B13B 3QEOA 4IEIA 1R8SA 3SS8A 3CIOA 5EP4A 5EP1A 2EFGA 1ESNA 1GRRA 3KDSE 1COWD 1O3YA 4L9SA 3ICQB 4DLUA 3KB1A 1OV4A 4ACBA 1IN4A 4QM6A 4TZ0A 1NY5A 1R5NA 1F5NA 3GFTA 1E2PA 3RNLA 1T0HB 3P4XA 3B78A 4IVPA 3RHFA 2IUSA 1OXUA 4JLAA 4D6PA 2J1LA 1U8AA 1ZM2A 2ODEA 4Q7JB 4TMVA 1K5GA 3FVQA 1RE0A 1XB2A 3EIHA 5AR1A 1SVWA 2QAGA 4TL8A 3GLHB 2X2FA 4MRSA 4CW7A 1S3SA 2GTPA 4A0FA 1W5TA 3TAHA 1LNZA 1ZYUA 3OHMA 3KJHA 2VP0A 3LX8A 3N5CA 4EPYA 2VHJA 3DDCA 3NHAA 1KZ7B 1S4QA 3ASZA 4UQOA 1D8TA 4LHZA 4B76A 1Z08A 3QPWA 2JLWA 3U3JA 2JJ1D 4O0MA 2FGJA 2WSSD 2J0UB 2PEYA 2QEQA 2R6GA 2ZJ2A 3AKDA 2ZRHA 2VP2A 5JZVA 4EJSB 1UADA 4NMMA 4Q1CA 3VKGA 1VG0B 1CR0A 1ZCAA 2ZUDA 4M9SA 2BM0A 1X8KA 1CKEA 3M0EA 4NCKA 2FH5B 3VTKA 3CRMA 5UKDA 3O8RA 2CHVA 2HJGA 3GLHA 3SFVA 4W5JA 2QQ0A 3CR8A 4FMCF 1E1QD 5DN6A 5B58C 3WMEA 4D25A 4LBWA 3WNBA 3QKSB 4DDVA 2VP9A 3RANA 3KKMA 4JL8A 2Q21A 3B6EA 4H1VA 1FZQA 3U7FB 1SQ5A 2ZSDA 2BVNA 1NBME 3PVSA 4Q9LA 2YHSA 2K5UA 1W4AA 1JEDA 2CLDX 1AM4D 3OAAA 4OHWA 4R2IA 2J0UA 4B33A 5FBVB 2QMOA 1M6NA 1W1WA 2D2EA 2PL3A 2C03A 4EJSA 4JLKA 1CLUA 1W0JA 4PSAA 4KHZA 4QFMA 1Z0IA 4XIGS 5IK2D 1UKVY 1ZD1A 4QGFA 3TSOA 5J4LA 3MMPA 3KQKA 4AI6A 2A2ZA 2C9CA 2Q3HA 3KXIA 2E87A 2WSMA 4IOLA 2ZRPA 3L0OA 1G5TA 2QORA 1CR4A 3BB4A 4LCBA 4A9AA 3CPJB 4B32A 5JEEA 2IUTA 2OG2A 4DWJA 2WWYA 3QKSA 1E94E 4J0QA 3OESA 4JBWA 4QJ4A 2JAQA 4D80A 4OK6A 4BFVA 3CUEF 4B48A 2QT1A 4KI0A 4MGZR 4Z1MD 1A2BA 2WICA 3WYGA 1VG9B 1KSFX 2QRZA 4X8HA 3B9QA 2O0KA 3LXXA 5B30A 4M1MA 4JLDA 5L3VA 4A2QA 2GESA 3ADKA 2WOOA 3MRSA 4UNQA 5CB6A 4M1TA 4D2IA 5J5CA 3P1JA 1Q21A 2DCUA 1NN3A 3DMNA 2BCGY 2P6UA 1G8YA 4V0MA 1PVOA 1W0KD 3LVQE 1XNJA 3O8BA 5J4YA 1WE2A 4G01B 4DVGA 4KSBA 1Q1BA 4URYR 1UBCA 2B6HA 2V1UA 2B92A 1WF3A 2AWNA 4MKIA 4QOSA 5KDDA 4OHXA 1T5LA 4L9WA 1DTSA 3QBVA 4M53A 1ZW6A 2GJ8A 2ZUCA 4HATA 4MDFA 2OFWA 4C0LA 4TSFA 4PPGA 2PX3A 2AKYA 4US0R 3K9HA 4F7WA 5K8IA 5JMTA 4EDHA 1Z3IX 1FMJA 5C46F 2ZYUX 4MKGA 3CWZA 1OIVA 3UG6A 2PJRA 3R9XA 4D4MA 2P3SA 2UZIR 4BECA 2NO1A 4QHSA 2YWGA 2QZ4A 3NC1C 1CJUC 2O8EA 1E9AA 1E9EA 3U44B 4WOPA 1E1RD 2WBLC 1I4TD 2ZTSA 1SGWA 4BZPA 3PQCA 3VHXA 3IQXA 4W5WA 4MA4A 4RFSB 4D4JA 2EYUA 1W49A 4WZAE 4G5SA 4AIIA 2J87A 4AWXA 3ZVNA 5JS8A 4DUGA 3T06B 1OHHD 2OXCA 2FDCA 1OH6A 1NJFA 3QXSA 1R2QA 3F3YA 3OF5A 4R7ZA 1EFHA 8OHMA 5JEDA 3WRXC 2VP6A 1JPNA 4TMWA 2XZLA 2BCJQ 2XAUA 3ICEA 3GLFB 4L5BA 4WZ6A 2G9NA 5JHGB 3RVBA 4XD7D 2V6JA 4MKFA 1XPRA 1XJCA 4F4JA 1E9DA 1A2KC 1KZGB 1P73A 3B60A 3U44A 1II9A 2FGKA 3CX8A 2VSOA 4PSKA 3HR7A 4Q1EA 4HAXA 4IOKA 4A36A 2PZFA 4RFSA 1RRCA 4ASUD 3I32A 2RB4A 4JT4A 4M1WA 1T3LA 3KTAA 1N6HA 3BGWA 3EPJA 3QENA 1OXSC 3X2SA 3TBKA 3ZIAD 1OFTA 5HE8A 3VU9B 4BLRA 4UNRA 4P33A 4B2LA 4ESHA 1E98A 3NDBB 4Q4LA 4LBYA 1UJ2A 2VH5R 2OE2A 3GLFA 3IHWA 4DZZA 4X8OA 3U7HB 4FI3C 3IDQA 3LLUA 2AXPA 2QM7A 2FPLA 2OCYC 2R6CA 3RRYA 2H57A 2YWFA 4DEXA 2B21A 2AWOA 1US8B 3SOPA 2GCOA 3W5IA 4LOAA 4U00A 1PJRA 3CNOA 4F4IA 3LY5A 4BLSA 4KITB 1OLOA 2ZETA 2D74A 121PA 4OK5A 2IXEA 2W6ID 4Q1FA 1XZPA 4DB2A 1Z0KA 4TL9A 2JLYA 3P4YA 3O8CA 3VR6A 4M22A 4N1AA 1CULC 3C16C 1XXHB 3KUCA 3SU8A 1G9XA 3VU9A 2F55A 4HLCA 2O0JA 1T9HA 1Z83A 3QKRB 2WJYA 5HKKD 1Q12A 2JASA 3DKPA 3KUDA 5A4JA 1H8HA 1ZD8A 3U6KA 4JLVA 1OH5A 4U02A 2A5DA 1CF4A 5KHOC 2XITA 3G5UA 4FCTA 2ZE5A 3D6TB 3PUXA 4JLNA 4RSGA 3FPAA 1T3HA 5KOYA 1US8A 4A6PA 1BOFA 1R0YA 2IL1A 2DFNA 4Q03A 5EXXA 1ZMXA 2HF9A 2RHMA 5EP3A 4WXRA 5FOXA 2Q0HA 3TR0A 5CLLA 1XTQA 1PLKA 3KB2A 1FW6A 1EWRA 4O3MA 2J5XA 2WJHA 4AYXA 1QHXA 1XXHA 1ZRHA 3EZ9A 1VYTA 3CRVA 1FQJA 3EWSA 3OFNA 4PR0A 2C9YA 4DT1B 4DCTA 2ZSBA 2G88A 1E4YA 2Q9BA 2ZI7A 4WAUA 3EIQA 2XXAB 3ZGXA 4HAWA 1N6KA 2LKCA 4CT4B 5KU1A 3A6PC 2IS4A 2KBEA 4DIEA 4KSCA 4FWIB 3MWJA 5DO9A 2IHBA 1I2DA 5FPKA 3SEAA 3GEEA 3GEIA 3E1SA 3K09C 3GD7A 4KAXA 4RZXA 1KKLA 1KSHA 2VTKA 4C0QC 4GOKA 4RZUA 2EWVA 5FOVA 3VKHA 5BQ5A 3LWNA 1GM5A 2X2EA 4MQBA 2QA5A 3M4YA 4KFUA 4PC1A 4A0HA 4MYUA 1VECA 2FOLA 3P20A 2OT3B 2NPIA 4CYMA 1GL7A 3WP0A 5DI3B 4EPXA 1Z07A 4DT1A 4LI0A 4ZDKA 3R9WA 2XXAA 1GRNA 2CCGA 3T34A 1LF0A 4NPHA 1DE0A 1DO0A 3EAQA 3GEHA 3HPRA 4DLXA 4NCIA 2O8DB 2E9SA
chains in the Genus database with same CATH superfamily
1N78A 2OC4A 3AEKB 3T5GA 1G8MA 2P6NA 3OFJA 4EJ2A 1JNXX 4V1CI 2OZLB 3ANYB 4G9GA 3CF4G 3KWJA 2GJAA 4JI2B 4KXWA 1UK9A 3K0AB 4QICA 1QHFA 5C18A 1U1CA 4OQFA 2GEDA 4HEQA 3SBEA 4CQJA 3HCAA 4F97A 4HL6A 4RUKA 5HEKA 1N32B 4R1UA 1USWA 4YT5A 3KQUA 1U4NA 4I08A 3ZZNA 4D43A 1G4UR 1XRLA 4BGIA 1N7HA 1TGYA 4YXWA 4KGZA 4L8WB 2Y93A 4I4TA 1RVDA 4US2R 1UIRA 2BFPA 1YI1A 1UC8A 1JR3E 5CDFE 5JWRA 3NHFA 3O5AA 3SF8B 4D3DA 2L2QA 3ILVA 2VA8A 1G98A 2QI9C 4Q3EA 2P9QA 4I5DA 4RNDB 4EHAA 3NH9A 1K6EA 4L5CA 1HO3A 3PYLA 3B82A 2HPHA 5FI5A 4EM6A 4Z4HA 1IN1A 3R5XA 3VNSA 4BP9A 2O2IA 4R0NA 3THOA 4F3RA 2XCOA 4H27A 4HH3C 4BX0A 1JBQA 4WEQA 8ABPA 1JDBB 4Y6PA 1J8DA 3ZQ6A 3D3KA 4IHJB 4RTMA 1C7RA 1B0AA 1C8BA 1E2UA 1J07A 5DYIA 2JGEA 2TSYB 4P83A 2ACWA 2A1TS 1CUHA 5ESRA 3KEOA 4N47A 3RABA 4ZPXA 1Z56C 1EZ1A 1J42A 5BYAA 2XUAA 3H2YA 1WRBA 3M49A 4MKXA 2CLIB 3C3KA 1EA5A 3T41A 5KINB 3ONFA 3G5AA 4GYWA 3RI3A 4PX9A 1SNYA 4EG7A 2J4DA 3K31A 2Q3MA 4JU8A 3VJLA 3KO8A 5BNTA 4MGIR 4BX2A 3IB6A 5TMPA 3LTNC 1YHZA 4PPNA 1TQ2A 3AH8A 3QP9A 4GNKA 4HFNA 1A50B 1JBKA 4URHA 4WUTA 2G67A 2X86A 1MUUA 1JJAA 2E18A 1SVIA 1NYQA 1F1BA 1U2DA 3DFKA 4QUKA 4DVJA 2O19A 1GADO 4MVJI 2ID8A 2YBEA 3AHJA 4INAA 3WBKA 2BYTA 4EGAA 4NAHA 4UUQA 2QOEA 4XPIB 3O82A 4RYDA 3ADOA 1WXGA 1OYWA 3IQWA 1WD5A 3QTTA 4L4XA 4NU5A 3PUWA 1QU2A 3EVTA 4AJPA 3ZNNA 1QU3A 5LZ7A 4RY0A 4R6XA 2MSDB 3V1UA 5CK4A 1ECCA 1OR8A 3GGDA 3O31A 3I9OA 1PKXA 3QPUA 4QU8A 2WI8A 4TT3A 3TL6A 1C3LA 1QDEA 1E7MA 2WWXA 1OCEA 3TD6A 3H9CA 3C8DA 3KFXA 1QHEA 4RL6A 2WMYA 2DPYA 4E6EA 4E2WA 2I4RA 1C7EA 2CJYA 2E82A 2IYEA 4L95C 1HH4A 1KC3A 4MA0A 4AZ0A 2ATXA 3FVRA 2W11A 4JBYA 3ND6A 4RFLA 2NUTA 2PKQO 2CN1A 2YVQA 1LBIA 3IBFA 2JH9A 2ZAGA 5NULA 1FUKA 3L2OB 1OLSB 1VPLA 1YXMA 3S5UA 3FCEA 1QE5A 1E7YA 3TE7A 3QVKA 4GX0A 4I5EA 1OILA 3M9XA 4L4RA 2BKAA 5HCUA 2MYNA 1TO6A 4DSAA 1TTHA 3BA6A 1MDFA 2NSDA 4MWGA 3MAAC 4PU0A 4IIXA 2D00A 1S2LA 5A3QA 5LM3A 5JCJD 1IG3A 2IGBA 4U4AA 3R44A 4I5FA 2FMKA 2CXTA 2YWBA 1RRGA 1E2JA 3F5FA 3QYJA 4P4LA 1RYFA 1YZVA 2VCHA 3CU5A 5E9AA 4CMIA 2PXHA 4O2AF 1CD5A 2ZB3A 5CYGA 2ZTLA 3NCTA 1ADBA 2W2VA 3PPYA 4PXYA 2CNBA 4KQIA 2IYQA 4C1BA 5LXTA 1ESCA 3TIVA 1XZAA 4AJEA 1CDEA 3L8GA 3GOHA 3IV6A 3K1ZA 4ZVOA 4C6TB 4FYPA 4NH4A 4E30A 4EUHA 4ARZA 3D31A 2J5BA 1X42A 2NQ8A 1C9YA 1NLZA 3QFSA 4CM7A 3ZDDA 3DFUA 9LDBA 2EP8A 3NC4A 3KVYA 4LHXA 2CVOA 1YNOA 1B8VA 2IK8A 4HJXA 4RD4A 2AYZA 4WKPA 1T2EA 2A7QA 1E66A 1MC5A 4IHQA 1QG6A 1QFMA 3ESYA 4Y1FA 3V8VA 1P7CA 3WK4A 3MZ0A 1HDXA 1JHYA 2OFXA 2EGGA 4QAQA 4FDLA 4NCXA 5G1NA 1LDGA 3MWLA 1CY8A 5GQSA 3SKVA 2XNHA 3CWQA 3RUEA 4BBPA 5K05A 4D6YA 3EEIA 1W6RA 3KLOA 2FWIA 2GEUA 2H3EA 3F6BX 3WGUA 1H2ZA 1GPNA 2OHOA 1UBSB 4JQSA 2WAMA 5FUWA 1P80A 2B30A 3PUVA 1LFAA 4XUCA 4Y2XA 3NIBA 2D7DA 4MYCA 2IFTA 4EL0A 3K2QA 4QKQA 4DADA 4C20A 4B43A 1T35A 4GI5A 3BFVA 2X8BA 2C2WA 4PRLA 5DHSA 4GT1A 3CIFA 4F1JA 3G9XA 5ECDA 2DY1A 1FMCA 3K30A 3NATA 3RS4A 1P5FA 3MS7A 4FKBA 1LV8A 1HF3A 4UMVA 3EW7A 3IPYA 5AJZA 4CI9A 3RSHA 2DUMA 5ENVA 1YBHA 1RI5A 1N25A 3OIDA 4QYWA 4KV7A 5CA0F 1AQNA 1ZN2A 4MI3A 4LS3A 3FX2A 4BGDA 2QRUA 1DKPA 1ZJ6A 3P9ZA 3T7TA 1KH2A 4DBLE 4H1HA 2DT5A 1OW3B 3QHQA 1W0KA 2OFFA 1E61A 1JBEA 1P72A 3D54D 3KYDA 2ZB7A 1OIWA 2OO5C 3EZYA 3F5SA 3W8NA 5A6VA 3NKLA 1NNEA 4ZO4A 3M33A 3QYAA 4JUFA 3ADBA 1XELA 1EFRD 5BSMA 1PDOA 1R10A 2MSCB 2ZWMA 3N7UA 2J7KA 2IPLA 2W0SA 1LKZA 3KAKA 1PIWA 1Y6JA 4MI1A 4PG4A 5JNSA 1XYVA 1R64A 3OP1A 4EMBA 4J7UA 1GPYA 3JVIA 1Z36A 2BP7A 4DUZB 2CDRA 2ERYA 2JFPA 1KYXA 4H0NA 1TK9A 4FZ3A 1IPEA 1KRXA 4Y18A 1ZL2A 4YALA 4YRIA 5AVRA 5L51A 4R8RA 4XE5A 1G7TA 2IX9A 4RGYA 4MKZA 1RLOA 4QUGA 4PLYA 4WL0A 4A0RA 2H1CA 4HAIA 5ALTA 1ILWA 3LW7A 5LA6B 3HA5A 5CVUA 4LK3A 3G0IA 4JT8A 1JDNA 1UK7A 3GRZA 4JEMA 1T4BA 2H1RA 1XN1A 3N59A 4IIEA 4XUEA 2ST1A 1QG0A 2JFNA 3L49A 3LJKA 4DIUA 2B3TA 2CYBA 5KOHA 2B2XA 3NASA 2GN9A 1EXWA 3B52X 3EGVA 3PXCX 2VWGA 1HE8B 4KTVE 1D04A 4G0XA 2ZI6A 1KDPA 1UPCA 2PWBA 2OCPA 1TO2E 3CJRA 4P86A 3SHVA 5IAOA 2Y0EA 4KBYA 1LY1A 1H2FA 1M75A 1O03A 2GDJA 3CLSD 2VJOA 4OBXA 5KYVA 1Z75A 3VGJA 2W6JD 1T9CA 2WTAA 3N3AC 2FUG1 4UZEA 5AI9A 4BQRA 3PXEA 3TAUA 3F9RA 1GDTA 2PUBA 1TCUA 2W0MA 3VX3A 2GEBA 3EIUA 1GFIA 3O4VA 3ZV3A 4Z9AA 2C98A 1SVSA 2EZ8A 1NF3A 1A5ZA 1L5HB 2Z4TA 3CLRC 2WIJA 8AT1A 1VA5A 4OQDA 3JZFA 3DEFA 5I4IA 2K87A 3G88A 4MMXB 1W87A 1E79D 1MGOA 3IBGA 4JVOA 5KNCH 1AKWA 1U2QA 4KXVA 4X1YA 4DJDC 3BRWA 4YACA 1ZVKA 4UM7A 3NWJA 1R8XA 1K98A 2PZGA 2XJ9A 4WZAA 5JD4A 2C42A 3EBOA 3ZVRA 2NXJA 1D4FA 4GQIA 2ZR0A 2E5LB 3SX0A 3CUWA 4ZOLB 4R40A 2JLQA 2HM7A 1GZ3A 3FVTA 3JTEA 3QBTA 1Z29A 2I2DA 3TDNA 2GN4A 3A1VA 1XV5A 1FJHA 3TYXA 2FNAA 1AB6A 2YV5A 1KYQA 2AUMA 3P45A 3CO0S 2Z8YM 3OSUA 5D85A 4KO8A 4A8TA 2YJNA 3RG8A 4QGBA 4RF3A 4IOJA 2F8LA 3Q3IA 5CM8B 2VCYA 1U0GA 1MJFA 3WY9A 3OM9A 4L50A 3BE4A 2YNMC 3MELA 4YCBA 2MYTA 2POCA 2W2LD 3DEHA 3WQSB 4M1QA 1U1DA 2VJYA 3W5JA 1ZW1A 1MQ8B 2CW5A 1JP7A 1PDWA 2QG4A 2O9JA 3FPKA 1SXHA 5HXAA 2CYCA 5D51S 3ZCQA 1LRKA 3HCNA 2EJWA 3DE2X 2OHFA 3REOA 2AOXA 2VNIA 3DP7A 1U8ZA 3EIWA 3HP4A 2VPWA 2BFBB 2ZRIA 3OZAA 4KQ6A 5A2GA 3MWYW 1SKYE 1ZBQA 3G5LA 3TZLA 5JTUA 3ES9A 1KO4A 1M6EX 1E0JA 2DR0A 4TN5A 1AHIA 2PQMA 1CDDA 4NJEA 2ZRDA 5C7IO 1VSUA 5AESA 4L75A 2J9XB 3JQ6A 1JWLA 2YUTA 1JHXA 1TZBA 5DGIA 1EBUA 4CGZA 1KPHA 1GPUA 3U3MA 4YRZA 5J5VA 2QPTA 3LYAA 4NCNA 2W6CX 2QX6A 4GMDA 1UMKA 4CL0A 4QQRA 1U7HA 3NWEA 4QO8A 3F6CA 3OX1A 3QXXA 4TYYA 5L4NA 4J2TA 3HUUA 3NG1A 1T0BA 4KLRA 4WDQA 5JXJA 2J9YB 4UD6A 2WHYA 3CVVA 3Q2KA 5BN3A 1TF2A 5F1YA 5CFOA 1YJCA 3BB3A 2UYHA 4C78A 3SI7A 3W8EA 3RC3A 3EYAA 3DEAA 1JPUA 1FP6A 4IDHA 1ZI8A 1ODIA 3G0DA 2CFOA 1OREA 3C6MA 5JAQA 4OGWA 4QM7A 1ECGA 2B37A 1ZMBA 2CJFA 1R9MA 4MB6A 3RQIA 3AVXA 2ROQA 4AUEA 2O2SA 3OQBA 2B98A 1H65A 4G9EA 4PHHA 4WJKB 5TGDA 1HDRA 3FMFA 1AO0A 2NAPA 3P2EA 2LDBA 4P7KA 4W63A 2DYKA 4HDKB 5EY5B 5LIRA 4UHHA 5LUAA 2J9FB 4M0EA 2H4ZA 4CM8B 1R5OA 4YCCA 5CDSA 3ZBTA 5KWSA 2Q6OA 3AIIA 2ZULA 1IBSA 3DV0A 3T6KA 1YS4A 1NJSA 2FAXA 1Z6ZA 2YASA 8LDHA 3OOHA 1CR6A 1FTWA 5A4DA 1VL8A 4QXRA 2V7PA 4P0TA 1O4WA 1U98A 1HY3A 1QK5A 4NZ9A 3W6NA 5C52B 2Z3ZA 3MIIA 4YT2A 4HZUA 4YAEA 3DUWA 2IY9A 3DOFA 2FWJA 4HXYA 1NFRA 2AEMA 5EUQB 4QJIA 4IDQA 4X6UA 5FWNA 3CEJA 1Y3IA 3DO6A 4A6XA 2EQAA 4H35A 5ILOA 3H0EA 3HR8A 4XQ0A 1RYMA 4Y9SA 2M9MA 5IJ0B 1ID1A 3PI7A 3V4RA 3S2YA 2E4VA 3NEAA 1JW9B 4OVKA 4YV2A 1ZOSA 3NBXX 2Q1TA 5MHTA 3DEYX 4INZA 5E38A 1THZA 4KO2S 2R6FA 4LF4B 2G0AA 5M3BA 4UAJA 2QTZA 2SKEA 4BIMA 3UBTA 3K9GA 4PO8A 1LXCA 3CM0A 2W83A 2X3FA 2Z8YA 4L7QA 1SY7A 2P79A 3WSWA 5GZ6A 3P9NA 4G6ZA 4QG3A 3FNQA 1S8FA 3CT4A 1XU9A 3C41J 1A8SA 1CB0A 2XKKA 5D3KA 1KORA 1VJ1A 1Y98A 4LVUA 4FM9A 3L82B 3ID6C 3VNBA 3AF6A 3Q15C 3QU4A 3W5DA 2PUAA 2WWIA 1QTIA 3VISA 3KVOA 3JAWB 4AW9A 3DR3A 2WYVA 4PC6A 1GGNA 1YOVB 3FHCB 1D2HA 3QI2A 3LXMA 4IEFB 1TM1E 3X1YA 4CM3A 4BQPA 1UEIA 4TYWA 1PX2A 5DNWA 3QEBZ 3WNZA 1ULBA 2JFWA 2UVPB 3TBFA 5DH9A 5BV7A 2R1ZA 2R85A 5LU9A 1KEWA 2WYHA 1WXXA 3FUCA 3IBYA 3Q12A 4OKSA 1XWIA 3DBHA 2H4XA 4HPXB 3AETA 5K3AA 3KG2A 3GGOA 4REMA 2SBTA 4PS0A 4XJXA 4TVSA 5KKCA 1L3CA 1MO2A 1IZ0A 3V2HA 1H4QA 4W4TA 2CMKA 2JI7A 2PYIA 4ZAFA 1UFKA 1OC4A 4DCJA 2B8WA 5K0ZA 1LSJA 1TM7E 2P5UA 5SY4A 2LKDA 5I7AA 3VHLB 2R6AA 3ZV7A 2GAIA 2Q3JA 5E95A 4QVIA 3GLQA 2LVBA 1WXWA 5DTEA 3QPDA 1SU8A 1T9GS 3KQLA 5H83A 2CLOB 3UGTA 5BRNA 1J8VA 1NWHA 2C77A 2O07A 4HS4A 5T3UA 4ISCA 5TS2A 2IUFA 2PS0A 4U9UA 4M83A 3GD5A 1WOMA 4YQYA 5EXDA 5BN5B 3MWDB 1KJJA 4R1MA 1B00A 1UKYA 4TXLA 3UKOA 2A6PA 3ZIDA 4CU5A 2GZ2A 5A4KA 4M7PA 1R4ZA 4TWJA 5A62A 3SZGA 1MG5A 2IYOA 3OO0A 4OA5A 5AW0A 2I7DA 3I3OA 5F1OA 2WVGA 1AO3A 1K4YA 4R5HA 2W6MA 3ON5A 4YP0A 3OWXA 3D64A 1Q7EA 1Z4MA 4PINA 1JG6A 2JI4A 2H1SA 4QFDA 4S1OA 3ZHRA 1KVUA 5FBWB 2YWDA 3N53A 4JI1B 4YP6A 2PA0A 5GADl 3AJ9A 4FOLA 1GQSA 3UJ8A 3FSRA 4NL4H 4MPPA 1E6LA 1QLJA 5CFZA 3I61A 2PKEA 4BP8A 5J43A 1KI7A 3FYCA 4TSRA 1CJSA 2WZDA 2C4TA 3H05A 1E3TA 1LDNA 4L8YA 1LGYA 1Y3HA 3AERB 3A36A 3GZTB 3ZCRA 1KEZA 1L4EA 1MO3A 1NTRA 1QIIA 1G2QA 5A4FS 3JAMA 3LT5A 2VO1A 1NOKA 1ZA1A 3AVQA 2JI6A 3JX9A 3ISJA 3LTEA 5EHQA 4C4SA 2H65A 3A1CA 4FDVA 4YR9A 2X42A 2KSQA 4MYHA 3TEJA 2HLDA 2MINB 2ZEJA 4OI1A 4PLFA 3M5PA 1M8GA 4HQ0A 4JJ4A 5CW2A 5D01A 2Y71A 2IXFA 1Y3BE 1J7JA 4K87A 2OKCA 1YHYA 2JK1A 3JPWA 4RNCA 5HIIA 2IC5A 3GOQA 3RO7A 1GVNB 3UFBA 3MCAA 5BOSB 5IT0A 5FBQB 5EXSA 3GJXC 4YRNA 2CJWB 5DDIP 4X97A 3N8HA 3SZLA 4UBOA 1FDRA 3DWEX 4JBGA 2A30A 4K40A 4RKEA 1E96A 3TW8A 4O2BA 3EDOA 2EG5A 1KI9A 2FW7A 4J6EA 4L4ZA 5AK3A 3V1NA 1DI0A 2HU2A 3ZWXA 4BMSA 4LF6B 3EIXA 5JAZA 4QG7A 3IVXA 2I2WA 4WT7A 1YR3A 1ZUHA 2A5JA 4M0UA 2NUPB 3ELWA 4J7AA 5TPWB 4YRKA 4KPEC 1D7OA 2XZTA 2JHFA 1VLZA 3HJFA 4J4HA 4UJ3A 5KNDH 5K3FB 4BVKA 3OTQA 3QE4A 4NP6A 2VK1A 1K1EA 4W6ZA 5DE3A 1ZIOA 2HCRA 1R6DA 3Q85A 1W88B 1I4DD 4D6XA 4F4HA 1OGYA 2XA1A 3MUOA 4BDSA 3BWBA 3IVGA 2ZB4A 3ZHXA 1WZ2A 4BJHB 1W1IA 3G1UA 2J6HA 2P8JA 3K3PA 1E9VA 2GD2A 3FCCA 4L8FA 1N4AA 4FHEA 4LYAA 4YLGA 3V3TA 1R9NA 1PGNA 4E5UA 2D5LA 2Q7XA 5FI0B 2CZGA 1OFGA 3LLMA 1JMKC 1TRKA 3C6XA 3G82C 5FUVA 4BEVA 4AY5A 4C4TA 3NHUA 1XZLA 1P33A 3ADCA 1E7SA 2G5GX 4KKVA 3TIXB 4F6CA 3K53A 1BS2A 1L7BA 3HEMA 3OPNA 4LHYA 4OGGA 4PYLA 4BB0A 2BFFA 4B7CA 2OPBA 1SOAA 2QTCA 3KPVA 3P2JA 1CIPA 2VYVA 3AEQA 1TF7A 3DE7X 4HDMA 5EE0A 4DSZA 4YCNA 3EOAI 2P2ZA 5DLYA 4ALKA 3P9KA 1S5PA 4M49A 1OPXA 2NV2B 2HR1A 2F3SA 3K72B 1RJ9B 4TTJA 2BDTA 2Q3CA 4EG8A 1BO6A 3LKDA 5BWLA 1BN6A 1HA3A 2NYAA 2ICAA 3W2IA 1QVRA 1E7RA 3GRAA 1YJXA 3T3IA 3E05A 5TJ9A 1STOA 1EK1A 3U2QA 2ZYTX 1ZX1A 1XNQB 2JNWA 1RDFA 1XD2B 1UM9B 5CFMA 5FLKA 4UM9D 5TB5A 2IUEA 1DV2A 1VCNA 2Z8XA 4YIHA 1K89A 1CZNA 1E0KA 2EYQA 3N86A 4FCCA 5ALPA 3C7CB 1MJHA 4NC9A 3KSUA 4EA7A 4EKEA 4HI0E 1QIDA 3BE6A 2JH8A 3FPFA 1XRSB 1ZK0A 4HB3A 3A14A 4NR0A 4URZR 4BNFA 2G4VA 5EIBC 1EX7A 1RYDA 1LZLA 3Q9UA 5A6SB 3M3DA 1G60A 1TQDA 3WI7A 4LY9A 1QONA 1G5FA 3D6UA 3E81A 2I4MA 4RJJA 1W94A 3X1WA 2RHHA 4Q6WA 4DIFA 4EGFA 1NQUA 3IBTA 4CIXA 1YB5A 1NBWB 3T1QA 1QH8A 3KKOA 5DF1A 4DAOA 3IMEA 5EWJA 3OUUA 2IEGA 1S1MA 2OXFA 1DAHA 4PO9A 2N0SA 4QASA 4NCAA 1C3XA 2TMKA 2FUCA 3D6JA 2OAQ1 1LB1B 3CF2A 3NVKI 1BEUB 3JQPA 3NTLA 2UUAB 1QJCA 4WWHA 3TQTA 3RSSA 5KWJA 1X19A 1X80B 2QVGA 5A0TA 3PUYA 2GPSA 1Y4SA 3K0KA 1IUOA 2C5EA 3OI7A 5SZKB 2EOAA 1UXHA 3PCRB 5K20A 4W99A 5LDGA 1QVVA 4BLOA 4LI3X 4MJ7A 5DIZA 2VF8A 3HJHA 5FTKA 5J2UA 2GFHA 3V32A 2PLAA 1E2QA 2HU7A 1EDOA 1U2RA 1PTJA 2P41A 3M3PA 4FLEA 5IARA 3VH3A 2I7VA 4P3OA 3FWHA 3VDRA 2BMWA 3T5MA 2ZR8A 1X2BA 2FYTA 5JC1A 1CUUA 3KJXA 2HSGA 2YJZA 1YIDA 2REXB 3SLKA 1PR9A 1QYDA 3H6GA 3ODPA 4K0KB 4RO0A 1E79A 3CY6A 2FWPA 4XWOA 1UOEA 3LC0A 4HK4A 1M7HA 3KOOA 1KEEB 2XNKA 3G0HA 2GF9A 5JARA 5KPDA 1PWZA 3SZUA 1E0DA 3NTXA 4LOLA 3RAEC 3HHPA 2UXBB 1VSVA 4ZAYA 4DPLA 3A04A 1ZINA 3O4GA 5BVHA 5IT5A 3WLIA 5B1DA 2BHTA 1H2XA 3AXSA 5JANA 4ZJYA 5HHTA 5LYJB 2QV0A 2QSJA 5B3KA 3BC1A 4DDTA 1FFSA 4OXIA 3HO6A 1J24A 1F48A 1R12A 3TZBA 1EFLA 4X0EA 4H7EA 4OOFA 2YOGA 2GZRA 4QUHA 3ZXIA 1BX3A 2JA1A 4GBJA 4O1MA 4NZYA 3CBGA 3OCCA 4WINA 4L5AA 3B6MA 2QX7A 5KDLA 4ADSG 2JANA 2NO7A 3EDCA 3OPYA 6YASA 2R11A 4YRBA 1P75A 3V42A 3L7IA 2QRQA 5I7UA 2Q1XA 4C4PA 2W2LA 2Y9PB 3G3EA 2Y6UA 3BILA 1G9TA 3JYQA 3N05A 3IT2A 1EUQA 1G59A 4DYHA 4BBZA 1K4KA 3U7RA 1GYQA 1PNOA 1BJKA 3R7AA 4R2HA 1IMOA 1IJFA 1G21B 3D8RA 1SG9A 4M8SA 1VG8A 1Z7BA 3CLUD 4C30A 3R8FA 1K0UA 1YMUA 3T61A 2R44A 4FYKA 1KNQA 3NALA 3W2FA 2XMDA 1HLPA 1U65A 1P6UA 3OPQA 2R4QA 4EUSA 1TEZA 5DKFA 1DP4A 1EYZA 2Y1XA 4Y6LA 2OOSA 1M5UA 3EPLA 1P7PA 2RGNA 2ZBGA 4DJEC 3PICA 1SCKA 4CDGA 4E7OA 1QYWA 3LYLA 3DVQX 1LDYA 2H1IA 2OV3A 4NZNA 5B1EA 2XGMA 1R1DA 3BG5A 1R15A 3KOZA 4B80A 2R0QC 3VYVA 3DLHA 4EENA 2PU7A 2V7BA 5U4QA 1C3EA 3FUVA 1XHEA 3F8WA 1SVUA 4YXFA 2VP4A 5IJ9B 4TWIA 5DB4A 1KO1A 1EIZA 4RQBA 4Z9BA 4BNDB 3Q5EA 1NG9A 5EZ6B 1Z82A 1AK9A 1CF9A 3RSGA 4AU1A 2Z9DA 4A4DA 1DWUA 5F3WB 5AXAA 3ACCA 3WGYA 1V8BA 1FC0A 4C6RA 3ZH2A 6LDHA 3CRQA 1ISSA 1DOHA 5F12A 1YI8A 1Y7PA 5AVOA 2R3SA 4NYMQ 2RHBA 1F6WA 4XCXA 3HM2A 1FFYA 2YWHA 1N2CE 4BMOB 4JQYA 3ZU4A 4RTQA 1M6VA 4W1SA 2G36A 3KL2A 4KXLA 4BO0A 1YD7A 3W05A 3SGLA 1LRLA 1V6AA 3HVKA 2J3IA 3NEPX 4LYHA 3LG2A 4IO0A 3ESZA 3Q6MA 4RE5A 2MHCA 4XM2A 2W37A 5AK4A 2GM3A 1TI7A 3KCNA 2EQ5A 4BFUA 3A25A 4I50B 4B3FX 1DRKA 2CUZA 3RTAA 2REOA 5FP0A 1WULS 4D42A 4GKKB 1A3CA 2EJUA 4QWMA 2P9ZA 1ZIPA 1PVVA 2EVWX 4WK4B 1GZ7A 2R8ZA 2ZS8A 3D7SA 2OXIA 1V3TA 4PPYA 4KQFA 2IYUA 1O9HA 5IK2A 3RSLA 1P4SA 1AKNA 4MNTA 2AMJA 3RVRA 1KZ4A 2NACA 2ZI9A 3QVVA 3TXAA 2X1MA 1SKAA 3EQ7A 3M8KA 4OBEA 1PV4A 2W93A 1IEVA 1MJNA 2DGDA 3T1HB 4KVGA 1EP1B 4S1WA 5JIBA 3B8HA 1SKMA 1ZZGA 2CHGA 1DBPA 1UINA 4A27A 4QRHA 1P7VA 4NK4A 2QK4A 2C4KA 1EUZA 4HS9A 4JJFA 1JHRA 2Z09A 2A59A 3NIFB 2COKA 4JJIA 2Q5LA 5EZ5A 1Z7GA 1R16A 1XL1A 2JGJA 3LUJA 3TQHA 3FTNA 3LUDA 2B35A 3OTGA 1E1MA 4TTPA 5IBPA 3ROKA 1KFEB 4Q1DA 4UD2A 4URUR 5JMWA 1YK1A 5JMPA 2CWWA 5KTRA 4NDNE 1KXJA 4JBIA 5EJFA 3K6RA 3I6IA 3O4IA 4QXOA 1O89A 4FSHA 1VC2A 4H59A 1XJQA 1XA4A 3NJ8A 4Q39A 5KVQA 2J41A 5HS4A 3UOAB 1GARA 1NBAA 4F72A 5KO2A 2R96A 5HM8A 2QP3A 2GAFA 3AESA 3CSSA 4G0WA 4HWKA 3BQMB 4PCAA 5KQGA 4CUKA 2FEKA 5TR9A 4JLJA 1A9XB 2BZSA 1WZCA 3LOQA 3N0TA 4RIGA 2EJTA 4OJQA 2JGMA 3LNCA 1UPFA 3H65A 4WV3A 1K8YB 4E5SA 4DQVA 1WA5A 4JYCA 1QHGA 3AOEC 3TLYA 4Y6QA 4CODB 2AEFA 3FDFA 1DINA 4HNHA 4H18A 3WK6A 4HLQB 2G9ZA 2P2NA 1UK8A 1V7CA 1U8UA 4GI3A 3U9TA 4EGCB 3EPPA 3EZNA 4HLUA 1BMDA 4AS3A 4DM7A 4K8OA 2XGJA 3ZU3A 2VK2A 3OA2A 2YWRA 4AWAA 1PX0A 2TMYA 2AJCA 2JVIA 4X61A 1BFDA 3WQHA 2ANCA 3K9FC 2X3YA 3D5TA 3EVZA 1DCFA 4HADA 2Z2XA 5FNVB 1DMRA 2WNIA 1N6RA 4RJTA 2RC6A 4BEBA 1JT9A 1VKOA 4AJHA 4N9QA 5GTDA 1EDDA 2AOUA 3EXFB 4IDCA 4XLLA 1PYDA 1PJ4A 5FWXA 5BSUA 1U04A 3HU2A 1NBIA 4PTYA 5AJXA 5KYUA 1VLMA 1ZH6A 4NJOA 4R31A 5CJPA 1M0SA 3GG9A 1VPEA 3GT4A 3S7TA 4RPLA 2P67A 1B7GO 3WKBA 4BZWA 2WK1A 2Z2ZA 1Y1PA 3DMGA 5ICFA 3I2JA 1L7RA 5DSXA 1HL3A 1MKYA 1BWSA 5AKGA 4A91A 3H3XA 2PYDA 1IWOA 1VE1A 2VT2A 4N65A 4PFSA 2FR8A 4EITA 4DCUA 3IAFA 1T43A 3T52A 4L22A 3ZIUA 1PQUA 1TUEA 2AIRA 1DT5A 1LF5A 4ZQHA 3E5MA 1AXEA 3MJRA 2XKJE 3WIDA 1ZHFA 3K0SA 4MPDA 4W5HA 5J1TB 2Y99A 1XNHA 1A1VA 3B1WA 3QEJA 2YFHA 7ABPA 4RD3A 4CM5A 2GJSA 3C8UA 3HB7A 4F60A 1GAEO 1NR5A 3FTEA 3H04A 13PKA 2UUPA 2JIRA 4WCFC 4X7BA 3ER8A 1CZRA 5LSAA 1HBJA 1TQ6A 4WGFA 1CEYA 2XVAA 3L5OA 3QUSA 2ZP1A 5FUYA 4QTYA 4J90A 1KO5A 3H0CA 1DHRA 1WPXA 4KO1S 1XMPA 4BLPA 1MHPA 3HVIA 2DB3A 3EXG2 3I2IA 1TX4B 3L0SA 4I9GA 3TR5A 3NIDB 4I4CA 3TM5A 2QLMA 3R5HA 1RXYA 4E5YA 1ZP6A 4NHEA 2BPOA 4R9SA 2ZW9A 1GLGA 3HU1A 3DE5X 3NNSA 4YO7A 5GY7A 1U9CA 3H2IA 1G20B 2VDMB 3LRPA 2OENG 4H4EA 4Q24A 4XXHA 1P7ZA 2FG5A 1J1UA 4HUJA 4IS3A 1XQXA 4UZFA 1GSIA 1JFFA 1NJGA 1SOVA 4TX1A 3JWJA 2DH6A 4YJ3B 3CSDA 1XEWX 1SQFA 1QG4A 10MHA 2IZ6A 1C1XA 1M0EA 1TVEA 5IABA 2GLTA 1RT9A 1S2IA 1ML4A 1VKZA 3OBIA 2QW0X 3QA9A 3K1JA 5ERGB 2QQFA 1YS1X 4IJ5A 4B6FA 4BFYA 4CZ2A 1U0BB 3U17A 5C1PA 2VDKB 1B73A 3PE6A 1R8YA 1OLUA 3SQWA 2EKBA 3H11B 1L8LA 1VHQA 2BI4A 3H1GA 4GR4A 3VKUA 1Q77A 4LX0A 1L5VA 4PZCA 2HXYA 2WSBA 4ZQEA 2Q6LA 4UAUA 2EL7A 4YK7A 2D3TA 1WM1A 2DQ4A 1ODLA 5BR8B 1KZHA 4B3HA 1TVMA 2RH5A 3PKZA 4DR3B 4G5RA 3OT1A 1NM5A 1K5DA 1TRHA 3VYWA 2AEJA 4GE3A 4YMGA 2EDAA 5BMVB 4RY8A 1WABA 2AZTA 3R6WA 4YRGA 2H5IA 1ZJWA 3ISVA 2FSIA 2PKWA 4YJFB 1AHNA 4HTFB 3GUHA 3ZCTA 4OAPA 1RI4A 1LWNA 3PNSA 2V45A 3RHTA 2OHIA 1T9KA 2FFJA 2GRJA 2VPIA 3VVBA 1GQQA 3H7AA 2WSIA 4L9RA 3MUFA 2BFDB 5AXBA 1EEHA 5IDQA 2JIMA 4G23A 3G0OA 4DXDA 2EJBA 2WV9A 3T9CA 4IMIB 4KR3A 1B41A 2J9ZB 3FXAA 3WR5A 2P75A 1DWOA 1NFFA 1R0CA 4A2PA 3LC7O 2WWHA 4H6PA 3UHAA 4IGIA 2VWHA 2IZ1A 1TJYA 1V47A 1YRBA 2EZ4A 2PG3A 3SIWA 1L2TA 3I8SA 3JSAA 1LWOA 1UBEA 2PHZA 1XEFA 5BQFA 1ETUA 3N9IA 3NUQA 4R8KA 2RH8A 5DOVA 1UOOA 2HWXA 4B8ZA 3K6SA 1DZIA 2X4DA 2Z98A 3C2QA 2C2OA 3FYUA 1E5VA 2BMFA 4P7JA 2H63A 1Y7LA 1YE3A 1PLLA 2JFHA 3AO0B 1F8FA 2VJPA 2JAXA 2ZBDA 3GJTA 3ME5A 4JQCA 4MW0A 4UC0A 3WFZA 3SPXA 2HJRA 1X7ZB 3ZWAA 3ZBUA 5JLJA 1OXKB 3NETA 3WGKA 1XROA 3MQFA 2AJDA 4NIMA 3O94A 1QO0D 3AVVA 2BTQB 1QRSA 4KNYA 4MJXA 3PQ7A 2HDNB 3ONWA 5B4UA 4WW0A 3DOOA 1JXAA 3A28A 3I0MA 3BXOA 4IEEA 3SN6A 1UJ6A 2QTVB 2CGEA 3MTGA 5IDVA 4AYTA 1JALA 2WT8A 1SXJC 1SA0A 5JDCC 4H1UA 1NW6A 2H11A 3PD1A 4Q3BA 3ROXA 2VHUA 3IAUA 2R1UA 1GTZA 1W5BA 2I7TA 1T4CB 2FXIA 1PL8A 3BRSA 1Y48E 1YCGA 1SCJA 2NIPA 3OT4A 1Z88A 5DGDA 4CR7A 5KEIA 3CZMA 3L0IB 1OA1A 5M34A 2VXCA 1QMPA 5EXEA 3G2QA 5B3JC 3N8GA 4Q5IA 1U0NA 5CCEA 3VO1A 3PNQA 3RBVA 4G07A 2RMKA 1Q1EA 4JJGA 5CVDA 5HUHA 3IAAA 3IUJA 1X3LA 4NZMA 3TNYA 2QG6A 5KZMB 4IZIA 4JDPA 4QULA 4XX1A 1IMJA 1S7CA 1JL3A 2IF2A 2IZ5A 3AG5A 5BWBA 2MDTA 4ZVUA 5CB8A 2QQGA 3DBRA 3SR0A 2ZKLA 4FNMA 3A7DA 2AA3A 1RRFA 2V1XA 1W2HA 3QIAA 4MS1B 3AJRA 4KLNA 4FFNA 2H4WA 5ARBA 4POAA 1XD8A 2OHJA 3OQIB 3LOPA 2Y4OA 4ND5A 1ISIA 3GNLA 4HAYA 4RK1A 2A58A 4BXOA 2O3SA 3VM6A 2I54A 4UFPA 1M1UA 4V1CB 2A9VA 4OHMA 1LCIA 4N54A 1AUPA 1K2VN 1HQDA 1L5RA 3GGGA 3MLAA 4K9QA 4W1QA 3PI6A 4FOTA 1OYYA 5JSFA 4GZLA 1CJMA 2PUJA 1GV1A 2NPOA 4K9NA 3B3JA 2RI1A 1Z6GA 3L7YA 2BZGA 3OJXA 5FWYB 4COKA 2ZVQX 4PN3A 4XDGA 5LKRA 1J8YF 3SJ7A 2A1TR 1BXZA 5H3LA 2PT5A 3TH5A 1JJIA 2V7VA 3E3LA 2XOKD 1FX0A 5FPYA 1FS4A 3RVPA 3TOZA 4EF4A 4F5YA 4CL2A 1SOUA 4BZZA 4A2WA 3JRWA 2Z1MA 1KIAA 1KS2A 2BR3A 2AHOA 3DAGA 4XGNA 3W3AD 4ZYWA 5IWCA 1RYEA 2Q3BA 1OGJA 4DRXA 1AVTA 4XVCA 3QSYA 2PKYX 5B4VA 1D6NA 1NJ8A 3H2SA 2VWQA 3H4MA 1U0TA 3GBPA 4PEVA 3T1TA 4E12A 1RMQA 1GXSA 2XA9A 4L73A 2O0MA 5DM1A 2O5RA 3RODA 3OKPA 2IPOA 2MMCA 3D3NA 4Y98A 3ZZ0A 2BFCA 3PP8A 5JSQA 4GSKA 4TTAA 1NPYA 5ED0A 3RSCA 4TKVB 3BA1A 4CKBB 4JA0A 2XVXA 3SBXA 5CIYA 5JVDA 1NVEA 1OTXA 2SKDA 3IPRA 2CVFA 1P2TA 1EKXA 2WAOA 1RS0A 1MV8A 2WILA 3LBFA 3C6ZA 1L5NA 4DC9A 4FFPA 2FG7C 2PO5A 1WY7A 4GVXA 3T95A 3BMOA 4ECEA 4BC1A 2OLKA 2I6TA 4Q21A 4MWEA 3LHIA 4WNYA 3TQOA 1QGUA 4BVLA 2B3DA 2FSGA 2JIBA 3WBBA 4ZI2A 2Y0DA 2IP1A 4M38A 2Z5FA 1TJPB 5CNMA 1HEYA 4OL9A 2XQFA 2IHYA 4NSNA 3B12A 3DQZA 3DMPA 2CLHB 5B6JA 1U9IA 4ENSA 3UTCA 3D4PA 3E8MA 1XK6A 1E6EA 2XH8A 4FZRA 2FPSA 3CH7A 3N70A 4M3NA 4TL6A 4V0KA 1JAYA 1WCIA 2HLPA 2X9LA 1GFZA 4RLQA 3E27A 1FRFS 2J08A