1E96A

Structure of the rac/p67phox complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
178
structure length
178
Chain Sequence
PQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Tpr Domain of P67Phox in Complex with Rac.GTP
pubmed rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
total genus 61
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2000-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e96A00
4IRUB 2N42A 3CF0A 4D4KA 3WNCA 5TMPA 5FUVA 1OH7A 3GEHA 4YONB 1W36B 2WICA 3RS4A 1CF4A 2FN4A 4JLAA 2V54A 2D74A 1KAOA 4OQXA 4O25A 1M7HA 3I72A 1FPMA 4LV6A 3KKNA 1GNPA 4RFSB 2BC9A 1JXMA 1UJ2A 1OJLA 4W7SA 3PXGA 2BCJQ 3VR1A 2ZIAA 4LBZA 3EA5A 1OPXA 4S35A 2I3BA 4RJLA 1YZKA 1G9XA 2WHXA 3LXXA 1JR3A 4UNPA 1E4YA 3OEHA 1KDOA 1X1SA 2ZSEA 2GXUA 3BWDD 2JCSA 3LBHA 4M9ZA 2DHRA 4TSFA 1CBUA 1TEXA 4LHVA 5KO2A 1GILA 1HT1E 2QY9A 1MO6A 4GBMA 2AHOA 1N5IA 2R8RA 2YV5A 4V02A 1E1RA 2PT5A 3R9IA 4A8JB 4BZPA 1HH4A 2JLYA 4IEIA 4LJ5A 5LDDC 2D7DA 4AG6A 2BIFA 4M4SA 1TMKA 2OUKA 3C14C 4KSCA 1XJQA 1UBFA 1P4SA 4QGHA 3WHLA 4YLGA 4A8JC 4XJXA 1I4DD 3AH8A 3AQ4A 5JSZB 1ZJ6A 3ADKA 4HUQA 1KDTA 1OSNA 5GJCA 3EXAA 1J7KA 2FJUA 5B2ZA 3OIVA 2O0JA 3AP1A 3IEVA 4NYJQ 1VYVA 2ZE5A 2IF2A 1M7GA 2NO7A 3W6OA 3A36A 1KSJA 4E5UA 1E9CA 3L2OB 1RC8A 5FPHA 1WRBA 3IDQA 2XTNA 2JJ1D 2ZUBA 3CWQA 3HYTA 2CNWD 4KVAA 2O8FA 1SGWA 3R8FA 2F9LA 1QG4A 1HEIA 2W2VA 4XOIA 2MSEB 4C4PA 2FG5A 4ZDJA 1KO7A 2QTHA 1E2LA 1IN5A 1SZPA 2D62A 2ZU0C 4JYCA 5J4KA 1DE0A 3U7EB 2AXNA 3AGPA 4MGKR 1GRQA 2F1HA 3QI2A 5CITA 5IRCD 3G5UA 1KY3A 1G3QA 3AF2A 1Z3IX 1S96A 1E1QA 1T5LA 3FB4A 1XTJA 2ZPTX 2IS6A 3LV8A 1FZQA 1YQTA 3GJ8A 4KI0A 2WOJA 4UXHA 1GKYA 1EK0A 1AGPA 3THYB 4ASUA 1KNXA 4HB4A 3B85A 1VCOA 4I1OA 5F98A 4DVGA 1Q0UA 2GCPA 5AUOB 1NN1A 3SBDA 3A4NA 3UK6A 2A5GA 4BLSA 1E0JA 2XJ4A 2FSFA 4IOMA 5EQTA 1QHNA 4C0KA 3LVQE 2NTYC 2YHSA 1ETUA 3MJHA 4OQLA 4L5BA 3EA0A 2XX3A 3QXJA 3EPKA 1W2HA 4HDQB 1G6HA 5KSZA 2C77A 5DO9A 3GLGE 3I5XA 2CCGA 4M2LA 1P9WA 5G3ZA 2O8EA 1RYHA 2ATVA 3ZIAA 4BZQA 5JI2E 1XD2A 4TTPA 4QM7A 3BJIC 2REBA 2G0TA 2HLDD 4KYIB 4DUGA 3MUFA 5GVRA 1RFLA 2CDNA 4DRZA 4GOXA 2RKOA 3CONA 4US1R 5CB6A 2H92A 1DO2A 4W9MC 1BMFA 3FYHA 1Z63A 5E7IA 1XD8A 4GOJA 4TMWA 2H7VA 3THYA 5HPYB 2Z4SA 3ZD7A 1CJMA 521PA 2VYFA 3DDCA 2YKGA 2QT0A 4HLCA 1OFUX 3ZD6A 3DPUA 1RRPA 2MMGA 4FN5A 5AUNB 5KNDA 4V03A 1YZUA 4FCTA 3RS7A 3KQUA 2ZI7A 4PO1A 1G291 2YWFA 4NYMR 1ZUIA 3B82A 3H4MA 3CZQA 2VF7A 4J0QA 5FI0B 2W6JD 4KHZA 5KNBA 3LQRA 1YKSA 1ZD1A 2VSOA 2PBRA 4IXMA 1JECA 1ODFA 1L2TA 4RY2A 1NMYA 3THWA 4C2UA 4JSTA 2ZRLA 2BMEA 4ARZB 3BB3A 1RPZA 1D5CA 3CRRA 2ODBA 4IDHA 3X2SA 1E2EA 4AD8A 3VHXA 3BD9A 2Z5FA 4QXAA 1BO6A 3LD9A 4QHTA 4AI6A 1Z07A 4EDHA 1JQJC 4EIWA 1SXJB 3FKSA 3WMEA 4RD2A 2WWHA 4EPYA 5F9HA 1BS1A 3LLUA 1QVRA 2DFTA 1SKYE 2JLSA 4Q4HA 4AWXA 1G8FA 1QDEA 5C46F 3A37A 5AJZA 5K8UA 1ZD8A 2AFHE 2IF0A 3IILA 3LDAA 3MMPA 4RZ2A 1T0HB 3VKHA 1E9DA 1OXVA 5H68A 4TMXA 4KFRA 2V7QD 1D8TA 1TU4A 4QC2A 5IF9A 1FTNA 3K0CA 2JLVA 3EZ2A 5HTKA 3OF5A 3KJIA 4PHTA 3O8RA 2QM8A 3CRVA 3FKQA 5HKKD 3RANA 1FOEB 5IT5A 3V4RA 4HLUC 1F2UA 2GDJA 3AVYA 3NBZC 1II8A 2QG6A 4CW7A 1FMJA 1CR0A 2QI9C 3EC2A 1CRQA 1EFCA 4KVGA 4D0LB 3M0EA 4M1MA 2ZANA 5LPNA 3KFXA 2OV2A 4BPBA 2ZI6A 2FSGA 1GM5A 4UNQA 1F60A 4QBIA 5F3WB 1R5OA 2IUSA 1NVUQ 1Z0DA 3CX7A 3ZVRA 3PUVA 2WSSD 3EARA 3O8BA 4JVMA 2QAJA 1F48A 4FMDF 1CJUC 4CEJB 4W5HA 4PX9A 1TAGA 5GJBA 1YZTA 3FVQA 1M1YE 5FOSA 2JJ1A 4MDFA 2ZS8A 1YR9A 1QHHA 5JJLA 4IOKA 1CXZA 2GVDC 5JWOA 1COWA 2IHBA 2ZRCA 1MRSA 2Q3HA 4EKDA 4HB0A 4M1KA 1LNZA 1PLKA 2ZR0A 4JT2A 4ABYA 2IWRA 1XP8A 2CJWA 5DYIA 2IYTA 3TAUA 2DPXA 3VKWA 2BKEA 2J59A 4OJQA 2EWVA 1FP7A 3OFND 3BK7A 2HYIC 3VNVA 4A2PA 3P4YA 1P6XA 3L0SA 4MKHA 4PZZA 1XEWY 2WAYA 3NH9A 2PCLA 4LC0A 3RAPR 3TRFA 4Q18A 4YDHB 2VP5A 4AY2A 2EFCB 4MYHA 2VA8A 4CEIA 2W83A 1NG9A 3GLFB 1DS6A 2FFHA 2P67A 2ZJOA 1W36C 1BYUA 2A5YB 4DT1A 5FR1A 2HT6A 2F7SA 4DWJA 2H1LA 1Q3HA 3ZDQA 1DTSA 3W6NA 2OLKA 3LAWA 3PUZA 1KI9A 4HUQB 1KO8A 2BMFA 2GAOA 3OFNA 3LA6A 3MCAA 3Q72A 5JECA 1FUKA 3I5YA 3BE4A 4YXWD 4M1TA 2YC2C 3RS2A 5JRJA 3NKVA 1JR6A 2NO1A 2GETA 2FGKA 2GF0A 3GQBA 4DDVA 4DEYA 2EWWA 2ZXUA 4Z8XA 1LW7A 4RVCA 1G64A 4G5OA 3P26A 5CK4A 1FW6A 1V5WA 4A0GA 4P4TA 1TQDA 1RRGA 2CLDX 3SJZA 1UDXA 4Z1MA 3MWLA 1P61B 2IEYA 3PG5A 3QVUA 2J7PD 3NDPA 4AURA 3GLHB 1E2JA 2CEAA 1E98A 3NEYA 4IW3B 2REOA 2J5XA 4V0OA 1NIPA 4TL9A 1JJVA 3SYLA 1K5GA 5CDFE 2FOLA 4ZDKA 2Z6VA 2ZI4A 3AKYA 4WZBE 3FOZA 2JLXA 1XX6A 3ICEA 3GLGB 1E32A 1M74A 4GP7A 3X1WA 4DB4A 3QBVA 5DGXA 3RSOA 3HDTA 1OV4A 3CM0A 5EP1A 2FFAA 5DHFA 2FFBA 2RGEA 3MFYA 5FR2A 1NBMA 4YC7A 3K0SA 2FF7A 2C9CA 4KFTA 1J99A 4OK5A 2OESA 1DEKA 2JLZA 1U8YA 3TK1A 4B32A 1LS1A 1OXXK 1Z2CA 1WB9A 1G3RA 1CP2A 4JL5A 4CT4B 1M8PA 2QSZA 5E3HA 3OIWA 1EG7A 1G5RA 1GWNA 5IHPA 1T3HA 3U60B 3QEOA 2F6RA 1ZRHA 3GLIB 1HQYE 2CL6X 3B60A 3OE7A 4OKSA 5JFGA 1F2TB 5L8VA 4JVNA 1BOFA 1WDTA 4GNKA 3REGA 2QMEA 1EWRA 1Z0IA 3H2YA 2CE2X 4LV8B 3KKMA 2J87A 1D2NA 5EZ6B 1OH6A 1Q21A 2G77B 2YWGA 2G88A 3MSXA 5CIWA 3A4MA 1DAMA 1IN6A 2EW1A 8OHMA 5FUXA 1O87A 3A58B 2Z43A 1Z6GA 4NTZA 4EJSA 3RC8A 5FTMA 1WCV1 5TB5A 5KUTA 4ZCIA 2KSQA 3GLHE 4C0LA 1B23P 3VX4A 4LYHA 4Q7MB 1SKYB 4D0GA 4WXPA 4BFXA 4XWOA 3TKLA 2FPKA 1J2JA 2UZIR 4UNSA 3RRMA 1F2UB 1NLZA 3WY9A 3ADBA 3Q3JB 4TMZA 4BRUA 2NPIA 3RS5A 5FBLB 2FU5C 2YWEA 4PZYA 3UANA 5L3VA 4DLZA 4P33A 2A5DA 4LJ4A 4HEJA 4R2HA 4PPFA 2VLIA 3LY5A 1OYWA 1I2DA 5KDLA 1NN0A 1P62B 3GLIE 3BFXA 4OK3A 2JJ8A 2J45A 2YC4C 1Z29A 3RWOA 1OF1A 2RHDA 4Z1MD 5JEEA 2FEMA 1P72A 4OI0A 1WF3A 3MWKA 2JA1A 3K70B 2OXRA 5FTNA 1W44A 4K81B 1M6NA 3LNCA 2OAQ1 4ZCMA 2JGNA 4HUTA 2PCJA 4PHFA 1G3MA 3T12A 1Z5ZA 1XWIA 1ZCBA 3QKUA 3MWJA 4B2IA 4BLOA 3EPHA 3THWB 4PC2A 2FV8A 4GZLA 2NG1A 3PQCA 2RHMA 4ZIRA 2XSZA 3D6TB 3SOPA 5IK2D 2QT1A 2B8TA 4BWYA 5FOVA 1BH2A 5KDOA 2GA8A 2BWJA 4TLAA 5D3MA 1G8PA 3SFZA 3RRZA 4Q4HB 2HLDA 1U0HC 1HQCA 5EXXA 5FOXA 1TEVA 4K46A 4DJTA 4Q1AA 1QBKC 1SXJA 3B9QA 5SZIA 2PLFA 4LI0A 3RRNA 1GG2A 1T5IA 4EJSC 1PUIA 2VL7A 1YZNA 4XWAA 3QPVA 3WXMA 2B8WA 2YZ2A 3I1FA 1BIFA 4G3XA 5KHOC 1XTIA 5SZHB 4C0QC 2HF8A 2OBLA 3DOFA 1SVIA 5FBVB 3K0FA 5EE3A 2QBYB 3AVOA 2HT1A 5CLQA 1MABA 2OZEA 3EPJA 5G53C 1LF0A 2OSBA 3H1TA 3LWNA 2ZVQX 3R7WB 4MQBA 4LBWA 3CH4B 3PR1A 2O8DA 1IY0A 1G8YA 4NCKA 5FL7D 3OEHD 4LBVA 5G41A 1CU1A 3HYRA 4IVRA 4QKQA 3C7KA 2ECKA 2RH5A 1KNQA 3D31A 4Q66C 3ONWA 2FWRA 4Q1BA 1R0XA 3MG9A 1DG3A 1GSIA 3SHWA 2EYUA 2X2FA 4IKEA 4A6XA 3HU3A 1L4YA 2GEDA 2R6DA 1OT3A 2J3EA 2XNDA 4PSVA 2IS1A 2G6BA 4PSKA 3BB4A 3O8CA 2ZSBA 3B2EA 4B73A 1UKYA 3EIQA 5BYKA 4JZKA 4BLRA 4BFVA 4RD0A 1XCGB 3A1SA 3RS0A 3RYTC 4BASA 5TY0A 2A30A 1XD2B 2X77A 3OESA 1VG9B 2IWHA 2R6GA 2NO9A 3P1JA 1E2DA 1RVDA 2HXSA 4ERNA 4P4SA 2GEVA 2GXQA 1N6HA 3ZZTA 1RYFA 4PC1A 2A7QA 5TV2A 4MKIA 2OHFA 2YOHA 2RGCA 4GI7A 4TYYA 3FHTA 5EUQB 1TADA 3AGQA 2XTMA 2R62A 4GDFA 4JBWA 4WZAE 2XXAA 4PHHA 1VG1A 4B35A 4NBSA 1N2CE 1YVDA 1PZNA 1B0UA 2CK3A 3CKLA 4EQ6B 4Q1CA 5A5GA 1V43A 3B13B 3SFVA 4A2QA 1HE1C 1IXSB 1QRAA 3W5IA 1NY6A 3UMFA 1E2HA 1UF9A 4DCTA 2J9RA 4MRRA 1ZW6A 3A1TA 2DFLA 2WJYA 4WOPA 2OCYC 2BV3A 4QJ4A 4A4DA 5JCPA 2QUZA 4XSGA 1VKJA 3NHAA 4C30A 4TMKA 4Q9JA 1ZVQA 5EE1A 1J90A 1P73A 1W49A 3QE0A 4QRHA 2VF8A 1JR3D 3HWSA 2JLWA 4DLVA 1U9IA 4PC3A 4TQUS 1RRFA 4JIMA 1Z06A 3U7GA 4F91B 3TSWA 2JIZD 3FTQA 2GHIA 4A82A 4LC1A 4AYTA 4D26A 1OIWA 3KXLA 2BMDA 4E03A 2WJGA 3F3YA 4IOLA 3KZ1E 1KKMA 1US8B 2WWXA 4Q1FA 4WXRA 4ZKDA 1EXMA 2R6AA 2V4ZA 5EE5B 2QP3A 1U90A 2PX0A 4XH9B 1OXTA 4JVSB 1X8JA 5L3RA 4L8GA 5DH9A 4BRWA 2EFHB 5P21A 4QGFA 1NMZA 2MSCB 2D2EA 2NQ2C 4ZDWA 3ZQ6A 4Q7JB 2FA9A 3CWZA 2C96A 1Q44A 2VIIA 3ZH9B 1W4BA 2WWFA 3E2IA 2GJ8A 4LJ8A 5B58C 4JL6A 3UG7A 3OHMA 1AS0A 3B7GA 1ZC4A 3NTUA 4H1VA 5DN6D 2QGZA 1TQ4A 4DDWA 1WBBA 4WAUA 1P9NA 4LBYA 4N1AA 3ND9A 3FMOB 1N5KA 5J4LA 2AN9A 3IGFA 3IIMA 3L0OA 1KSGA 3WP0A 3GCGA 1KAGA 1IN7A 4Q02A 1MOZA 4V0ME 4G5RA 1XPRA 3K70C 4PAQA 2JASA 1MRNA 4HDCA 4Q47A 4HLUA 4BLQA 2WPDA 2WZQA 3IQXA 1K5DA 1P2TA 4B3GA 2GESA 1VYTA 4FCWA 3L8YA 3MAAC 5HCNA 2DWPA 2FPMA 5SZKB 2Z83A 1JEDA 4A2WA 2LCFA 3K0CC 1U81A 1X8KA 3BERA 1T4GA 2A5FA 4P31A 3ADCA 2ZETA 2WMOB 3TSZA 5LD2B 1XU4A 1IBRA 3EAQA 3AVUA 2QZ4A 3MGCA 2ODNA 3SI7A 3U2QA 3JZMA 5JI3E 4IEEA 5TVKA 2EU8A 2DCUA 2CK3D 1R0WA 4M53A 4Q9KA 4U02A 2PZGA 4ILEA 4HAVA 4CZ2A 1G8HA 4NYIQ 1G3UA 2JATA 2W6ID 2LKCA 3B1VA 1XFAA 2GJ9A 4TL7A 2XB4A 5KOYA 2F55A 2HCBA 4L9SA 421PA 4RZ3A 1FX0B 3BS4A 2OBMA 3RRYA 3GLFE 3QOFA 3KFVA 4W5WA 3ZVMA 4NDZA 4CGZA 3THXA 4FMCB 3CPEA 3JVVA 5JZVA 4ITRC 1E9FA 1NVVR 3I61A 5FUWA 2IT1A 3BAFA 3U3OA 1DO0A 1VHTA 3GLFA 2QE7D 2YWHA 3K9NA 3BC1A 2VH5R 3IBGA 2ZI9A 4U00A 3V9PA 3REFA 4D82A 3RABA 5TDHA 2GK7A 4O2RA 4X8LA 1NNEA 3K9GA 1LVGA 4JLMA 1T8UA 5J4VA 1Z0KA 2ZJ2A 1I2MA 2ZS9A 2IW3A 3NG1A 2J46A 3EX7C 2QA5A 3S1AA 3U44B 1W46A 4DIEA 4E07A 4GSYA 3GJ4A 2C9YA 4P32A 2DB3A 2WWIA 1OXSC 2Y8EA 5KSPA 4DXAA 4R2IA 1HA3A 1LTQA 4F38A 3TW4A 3IEUA 3BRWD 1FFHA 1KIMA 2AL7A 3C41J 4I81A 5CM9C 2GWHA 2FE4A 2VBCA 1U2RA 3CRW1 1DG1G 3SS8A 2ZSAA 4M1OA 1TL7C 2DBYA 2VP0A 4C7OB 3SC3A 3QKTA 3A8TA 3I92A 3SU8A 5FBQB 1E0AA 2IUUA 2WWGA 1QHHB 2C78A 4KV9A 2FMXA 5AWFC 1IXZA 3QKSA 2O8BA 2RGGA 4BUJA 3I8SA 1E2GA 3UWOA 2F3TA 4ZV4A 3T5DA 1U0JA 1NN5A 1VMAA 1G4AE 4AKGA 3A6PC 3L43A 3AB3A 1KSFX 3J81k 3HP1A 4RFVA 4A0HA 3IIJA 2IYZA 3B1WA 1ZNYA 4WA7A 1XZQA 1NY5A 4JVLA 4LWZA 4LCBA 4CEIB 4XIGS 1R0YA 2QN6A 3LFUA 4IFBA 1Z6AA 1E4VA 4BEJA 3I32A 3SJBA 5DIFA 3AKDA 1WQ1R 5KSYA 1OIVA 2OBNA 1GTVA 2QE7A 3BB1A 4AC9A 3F8TA 1AGRA 2EFGA 3QKSB 4UJ3A 1U8AA 2X8AA 3JZAA 2HV8A 3C4JA 3L8ZA 1MO5A 1KO1A 1OLOA 3B6EA 1ZU5A 5C2JB 4HZUA 1NI3A 1KTVA 2KBFA 2WKRA 2CL0X 2UVQA 5SZJA 1S2MA 2BBWA 1SVLA 1FQKA 2AXPA 2W6IA 3EWAA 3EW9A 3IIKA 4DLUA 2OFWA 2QTFA 2XGJA 4Q5IA 3DM9B 4E09A 1SULA 2OLJA 1OW3B 3QXXA 3EZFA 3AF0A 3P4XA 4JLJA 3SZRA 4XVQA 1W7AA 1UBGA 4LHZA 4B3XA 1AA9A 4B76A 2ONKA 2ZRFA 2BVNA 4AKEA 4B3FX 4BQSA 5DI3A 5JBQA 4NH0A 4A8JA 1KZ7B 1CTQA 2EFEB 4IHQA 1GZSA 1BKDR 2ZRAA 4Q03A 1G1MA 5AUPB 2ZRBA 4DSTA 3LX8A 4I1UA 1E79D 1GFIA 1LY1A 2IK8A 3CRQA 2RGXA 3P32A 1EFUA 2HUPA 3DMNA 3ZS8A 1KGDA 1G21E 3NXSA 4I1SA 2ODWA 2ASEA 3I3SR 5KSOA 1P2SA 4U7DA 1KI7A 4TN1A 4C0JA 2FSIA 5L3QA 4JYBA 3AVXA 1VHLA 2NZJA 2C03A 4TL6A 5FOUA 2O5VA 4O2LA 3C16C 4OL0A 3TJZA 5BWMA 1JPJA 2SHKA 4QBGB 2D4HA 5J47A 2V3CC 2QRZA 1MO4A 2Q9BA 1VG8A 2CCKA 3CF2A 4L9WA 3BXZA 3H84A 3CR7A 4PO8A 1A1VA 4LOAA 3W5JA 4HLQB 1EFRD 3LO5A 4KCGA 2HCJB 4EPTA 4UJ5A 4C0AC 2Q3MA 3NDBB 3WRYC 2OXCA 3UXMA 2OFXA 1XEFA 2YYZA 2GKSA 1Z0JA 4B71A 2C04A 1X6VA 2C2HA 2WWWA 1J8MF 2E87A 4GRAA 4IVQA 4R7ZA 5LB2A 1JQLB 2A9KA 1TU3A 4QGAA 4B33A 2GCNA 3Q8XB 3CH5A 3EC1A 1JEEA 4LY6A 3ETLA 4QNMA 1XMIA 3B1YA 1MABB 1KK2A 3ICQB 3VNUA 2JJ2D 2PEZA 1X8LA 1PVOA 3H86A 2G83A 2ZYUX 5FOTA 1NLFA 3R7WA 2W0MA 3GJ3A 3VMFA 4I1VA 4Q1EA 2F1RA 2AD1A 1GUAA 1N0WA 2CHQA 2GZHA 4MGIR 4KSBA 2PL3A 3HU2A 1DVRA 4EQ6A 4A15A 5LD2C 3EG5A 4ACAA 1ZBDA 3KL4A 1YR8A 4M1WA 2YNMA 3GLHA 3I4LA 4A36A 1AS2A 2HDNB 5CM8B 4URVR 5A4JA 3SBEA 1W4CA 2GILA 4F93B 2ORVA 4JLOA 2CBZA 4DSOA 1X1RA 1P2VA 3HR8A 3HU1A 1EWQA 1OB5A 1CJTC 4E22A 1TUIA 4UNNA 4KAXA 2FX3A 1W0KA 2JLUA 1Z2AA 3AKEA 2O0KA 1R7RA 3G0HA 4K8OA 4OQMA 4DLSA 1E6CA 3KJEA 1T3LA 3PVSA 2W0SA 3SNHA 2XZOA 3TR0A 3Q9LA 1KMHB 3UMRA 4MH0R 3UMSA 1HTWA 3X1DA 3DL0A 1EX7A 2KI5A 4N0DA 1Q20A 1JPNA 4P4SB 1QZXA 4YMSA 1KK0A 5FUYA 3ADDA 2QQEA 1G5PA 4II7A 5G3YA 3SE0A 1GKIA 2IYRA 3RVBA 3DMDA 5EXPA 2TMKA 1GL6A 3CZPA 2IXEA 1FQJA 2YOFA 2FDCA 1UFQA 1IJFA 2G9NA 1RZ3A 2O8CA 2Q3FA 1S1MA 1X3SA 3GFPA 4LRWA 3QF4A 1XD9A 5J40A 2BCGY 1W5TA 4JL8A 2QBYA 4L4UA 3SJCA 3LRPA 3OAAA 1G18A 1DAKA 3PV0A 5JWHA 3K0AB 1YHNA 4LSGA 2ONJA 1XBTA 2R6FA 4Q01A 3SHFA 1JAHA 1G5TA 2F1JA 3OZXA 3QJYA 1IQPA 3PENA 2ZS7A 3QPWA 4URWR 1RKBA 1SKQA 3NEJA 1R8QA 2ZR9A 5F2EA 4BFUA 3FGNA 4TZ6A 2WM9B 1R5BA 4NL4H 1IY2A 3RS3A 3K53A 3QNUA 2PJRA 2J7KA 4CDGA 2XB2A 5BN4A 3TMKA 1ZUHA 3ECCA 5GVSA 5CYPA 1UKEA 2WIAA 3Q85A 4F4CA 2FSHA 4Q1DA 4I99A 4EFMA 3LW8A 1S3GA 3LX5A 4C3ZA 1OKKA 4UXIA 4JJZA 5DI3B 1SVKA 2C9OA 1SVSA 1XTQA 2YOGA 1LB1B 3PFIA 4JBYA 1A5TA 4M1YA 4CVNA 4Z54A 2QM7A 2RGDA 3WP1B 5GJWC 2ZJ5A 3ZGXA 2VHTA 3H0KA 3QQ5A 4NP6A 4PQFA 2ZI3A 1XEXB 1Z28A 1PJRA 3WYAA 1SVMA 2VHJA 4BE7B 4YXWA 3F0TA 3VQTA 1DELA 1E9RA 5JEDA 3C5HA 4DLYA 4M9SA 4DCUA 3TW8B 5KYKA 4F7WA 1PV4A 3EZ7A 3LW7A 1XXHE 2OAP1 4GOKA 2OILA 2VP2A 3CW2A 3QXCA 4QJ5A 1H8HA 5GJVC 1ANKA 1GAJA 1NP6A 3Q7PA 4PPQA 3NC0C 2JLQA 1FX0A 1E99A 1W36D 4LGMA 3QSYA 3AF1A 1S3SA 1E3MA 1MKYA 3TR5A 2WAXA 1EFTA 1LF5A 4FMCF 5CYOA 2A3RA 1Z83A 1P5ZB 5DNYB 4NU0A 2GTPA 1E2IA 5EZ5A 2QENA 2BBOA 2WJVA 2MMCA 1Z0FA 1DOAA 1XZPA 3JVUA 2C8VA 4QL3A 4RKFA 1IAQA 1G7TA 1R10A 2ZYVX 2FEOA 4IDOA 4HYYA 5FPYA 1KY2A 2O8EB 3WNBA 3AP3A 4UXJA 2KB0A 1GNQA 3AV0B 1XCPA 4MRSA 121PA 1OB2A 1ZM7A 2EYQA 2VO1A 3IPXA 4C0HA 3GJ7A 2ZSDA 5FPKA 1OH8A 1AJEA 1WE2A 4POAA 3U5ZB 1UKZA 1T3SA 1UADA 2P2LA 4B2LA 4B3DA 3KXIA 5D3MB 4FW9A 5F9FA 3GLIA 2D2FA 1IXRC 3K0EA 4LK2A 2O8FB 4PC7A 1KI8A 3G82C 1A2BA 5JLJA 1JALA 3NBXX 1A4RA 3T61A 4ZI2A 3BGWA 1KOFA 2D3WA 4RD4A 4XD7D 3K70D 2CLSA 1G41A 2ZJYA 2EFDB 2PH1A 2PEYA 1KKLA 3EZ6A 1ESNA 2JLRA 2IL1A 4KO8A 4B3BA 3KXKA 5DISB 4C9BA 4ARZA 3BH7A 5EJEA 4DIDA 3FHOA 2XJ9A 3N2EA 5DLQC 4LJ6A 4UKDA 1WXQA 1U99A 1VDZA 4M8NE 2O0HA 2PMKA 3GFOA 1JJ7A 1YE8A 3W34A 1NF3A 3QXHA 4HAYA 4KODA 4KYUA 4EPVA 4XWKA 2KE5A 2B7CA 3VFDA 5IDVA 1QF9A 1U9IC 4G0NA 1W0KD 2ERYA 1C4OA 2QRNA 4A6PA 621PA 3PEWA 3U3JA 1FMLA 2WSMA 2XITA 4H1UA 1JB1A 2BM0A 1OH5A 4HB3A 1E1QD 1Q57A 4FXPA 1I4LD 4KFUA 2BOVA 2IYWA 1D6JA 1TTTA 3QG5A 1XTKA 3SYKA 1ZM9A 4DCNA 1GL9B 2QP4A 2W00A 2PZEA 2ZROA 3K8YA 2WOOA 1KJZA 4NE2A 4RD3A 4OHYA 2R9VA 2ZVPX 4M1SA 1Q1BA 4V0NA 1L8QA 3PEUA 3FKSD 3QF4B 2F43B 3KX2A 2CHVA 2J0QA 5EP4A 1E2KA 4B6FA 4DLRA 2XSZD 2ATXA 2VP4A 3K0AA 5H1YA 4HB2A 4TLDA 4AYXA 5JS8A 3DM5A 3IKJA 4HAXA 1CRPA 2GK6A 1II8B 3KQLA 1OXUA 3TVDA 1KHTA 1Z47A 4MKGA 2NOAA 3BIFA 2C99A 2QPAA 4L15A 4URYR 1GOTA 1JR3E 2V8OA 1AKEA 1GITA 3IO5A 2IUTA 1NIJA 2ZUDA 3E70C 2ORWA 4IOJA 5DN6A 1XMJA 1TF7A 2NO6A 3WMGA 3T06B 2X2EA 1F3OA 3TAHA 3PITA 1OFHA 2R65A 1F2TA 1R0ZA 2ZRHA 4M0LA 4U5XA 4C0BA 2GZDA 3TE6A 1OYYA 1GNRA 4CEHA 3W3ZB 1CJKC 2GZAA 1NJFA 4A0FA 2N1BA 1GDDA 4A92A 1T6NA 3GMTA 3AKCA 3M1IA 2GBLC 4HATA 4PHGA 3MWYW 3P20A 4KU4A 4X8HA 3BBPA 4HZIA 3EPLA 4MYUA 1XMVA 1F5NA 3ZYCA 2ZYTX 4KBFA 5EE0A 1GVNB 4KLZA 4QHYA 4DDTA 3S1AB 1L4UA 2ZJ8A 5BN3A 2G1KA 1KSHA 3BH6A 5C18A 1F6BA 2QROA 4IJMA 4TYQA 4ZKEA 3KQHA 3HPRA 1OHHD 5BN5A 2H18A 3SJAA 1KI1A 1A2KC 3PJRA 1IN4A 2WV9A 2RCNA 4QG7A 4NMMA 3QBTA 3VHLB 2GVZC 1VCIA 1G16A 3FE2A 2N46A 1RJ9B 2BDTA 1S0UA 1ZMXA 2NO0A 2QAGA 4DT1B 3U3RA 3D3QA 4JLBA 1AS3A 2CHGA 4CYMA 1SXJC 2BEJA 3EZ9A 3AVVA 1FUUA 4LJAA 5E7MA 3BOSA 1IY1A 4LV5B 1HYQA 2IXGA 4LHYA 3CB4A 3R9XA 4B43A 5JJKA 3SDZA 3PIRA 2AFIE 4B6EA 2Q9CA 3MD0A 4NYMQ 4AK9A 4B74A 1IONA 1K8RA 4F4IA 2BM1A 4D0NA 1CEEA 4X8MA 3GD7A 1NVWQ 2RGAA 2ZRJA 3B8HA 4A0RA 2A78A 4IFEA 3UG6A 3QENA 1ZP6A 2DY1A 2QSYA 2X19A 4JLDA 4XTCS 3ZLJA 5CB8A 1Z6TA 4BEBA 2BHRA 2ZE6A 1OE0A 1T8TA 3FDIA 3CO5A 4KITB 4XVRA 2XXAB 1PLLA 3EIHA 4AKIA 2VHQA 4ZO4A 1CLUA 2DWOA 1DARA 3PUXA 4JSYA 4UQOA 4Q9IA 3ZVNA 3U4QB 1EFHA 4QOSA 2GJSA 4KJZA 3NVAA 4EPRA 4GMXA 4WW0A 5FPSA 1A7JA 1ZIPA 3CIOA 5CDFA 3SR0A 3V00A 4URZR 5J5CA 1EESA 3EWSA 1MT0A 4L16A 4PZLA 2WKQA 3FFAA 4I4LA 4Q9LA 1LV7A 3O8DA 1QVAA 1Q3TA 2ZRMA 4MUBA 1TPZA 1JXOA 3RLFA 2P6RA 4MGYR 2DWQA 5FL7A 2ZI5A 2HF9A 1RE0A 3QG1A 1HURA 2CVHA 1W48A 4QBHA 5AJXA 2IEZA 4LDJA 4URXR 1D9ZA 1VCMA 4JLPA 3WMFA 4BFZA 1IM2A 1QHYA 1KI2A 5BYJA 3FMPB 2BMJA 5FBRB 3A1VA 1CULC 5HKKA 3KTAB 1RIFA 2V7QA 4LHWA 2YINC 1P75A 4US0R 3SN6A 5HZKA 3U7FB 2EVWX 2GEUA 5CIQA 4PANA 3TNFA 1XTRA 2AK3A 4RZXA 4YMVA 2BJWA 3NBYC 1G19A 4Q4JA 4V0KA 5J4YA 4EPWA 2QMHA 4G5QA 4H9GA 4BLPA 3QXSA 4RKEA 4NCHA 4D80A 5ANRB 1W47A 1ZINA 1KMQA 1E2NA 1E79A 1X86B 4PPGA 1OHHA 1IHUA 4MDEA 3C15C 1Z6XA 4MRPA 1EX6A 4JKIA 4URUR 2WWYA 1FP6A 3W90A 1SVOA 1C1YA 1W0JA 3O47A 3ZVLA 2ZE8A 1YRAA 2QMUA 4EJSB 5G40A 4NKRA 2QP9X 3RNLA 1NL3A 3ND8A 3PEYA 3MLEA 1CR2A 4AKHA 4Q7KA 3Q7QA 1P2UA 2J0VA 4Q48A 1O3YA 4Q9HA 1XXHB 1U98A 2AKYA 5E4FA 1NJGA 4CF7A 1E9BA 2F3RA 4LPKA 3WBJA 1HT2E 4Q19A 1DAGA 4JMPA 4DCVA 1ZNZA 2IHYA 1JI0A 2F9MA 2AX4A 1EFRA 1N6LA 2VP9A 3NC1C 3UKDA 3QKRA 1ZAKA 1TUEA 2GNOA 2WJJA 2PJZA 2Q9AA 4CIDA 5B57C 4OHXA 1XEXA 4GP6A 5FL3A 4UNRA 3DOEA 2WTUA 5HE9A 4B75A 3UPUA 2FPLA 3B1XA 1TQ6A 2GXSA 3A1WA 2RAPA 5E95A 3GLGA 1BMFD 3MRSA 2QPOA 3SEAA 2CLCX 3RC3A 2JJ2A 3CUEF 3LXRA 1E69A 1XXHA 2B92A 1ZD9A 2LWIA 4PTLA 4JT4A 3VX3A 1JBKA 2P0EA 1TF5A 1HUQA 5AJYA 1H8HD 3D8BA 4TZ0A 2P6UA 5FTJA 1GL7A 1NVXQ 4JLVA 1P60A 4MGZR 1W0JD 3L82B 3RSLA 4TTRA 3KQNA 2HEIA 2AKAB 4G01B 2PMDA 1W4AA 1W4RA 3GJXC 2Z0MA 4FD2A 2FNAA 2V55B 1YJ5A 2RMKA 3GEEA 1NSFA 1AQUA 3GJ5A 3K0FB 3K9HA 2OO7A 3RHFA 2OCPA 2UKDA 3DZ8A 5FI1B 3WYFA 1AQYA 1UEJA 4A1FA 4TQAA 2MSDB 4S2EA 1CS4C 2HYDA 3TUZC 3B9PA 3UWKA 4DC9A 1YR7A 1NMXA 2CE7A 1UAAA 5L3QB 3M4YA 1TF2A 1ZM4A 3VTKA 2I4IA 1S9HA 4HAUA 3CR8A 4EFNA 2FZLA 1Y63A 3BH0A 4NHOA 4ZDIA 1G7CA 1KK1A 3GPLA 1R4AA 1CR4A 5JHGB 3BORA 3E5HA 1QG2A 5K8IA 3HPQA 5KDDA 3THOA 4OI2A 1Q1QA 1NSTA 2G0NA 5JS7A 3WNDA 1NBME 4FWIB 3HJNA 3V4FA 2RGBA 3CNLA 5B64A 2AWNA 1FNMA 3KKQA 3AVPA 1YZGA 4KXFB 2CNWA 2ZJAA 4OI4A 1J8YF 1T9HA 5K8TA 1W2GA 3KKPA 4F92B 3RDPA 1E9AA 4CEHB 1N25A 1NRJB 5UKDA 1XPUA 1E0SA 1AZSC 1II0A 4XTRA 4ZPXA 4RFSA 1RRCA 1N6IA 3KKOA 3W8NA 4D6PA 4D25A 4TSFD 4W5JA 2IYVA 5C4MA 2ODEA 1IOZA 3ASZA 3AUYA 5BXQC 1D2MA 2GXAA 1TX4B 4V0MA 1DAFA 3VR2A 5B30A 1DBSA 4BFYA 3TH5A 2O52A 2ZQ5A 2XZLA 3ASYA 2IYXA 5DYGA 2WKPA 1LFDB 2HJGA 2IYLD 2V6IA 4O0MA 3T34A 3SQXA 3ZZUA 5A0FA 3R20A 3DKPA 1E96A 4OJKA 3X1YA 1QHXA 1CIPA 1P3JA 3I73A 2VSXA 2C95A 4TLEA 5AK0A 3RWMB 1DADA 3K1JA 3U6BA 2H5EA 3CLVA 3DZDA 4IXNA 2NZ8A 1E1RD 2IS4A 4TT3D 1H65A 1XCMA 2JAQA 2OE2A 2BJVA 3DVLA 3AP2A 5TXGA 2IXFA 3WBKA 3IHLA 1XTSA 1ZIOA 2V9PA 3UIEA 2ZJZA 4XVUA 2OM2A 2L0XA 3IPYA 4EFLA 3OEEA 2GCOA 3GFTA 2ANCA 1E2QA 1S9DA 5CLLA 1VECA 5CJPA 4EUNA 4JLKA 5JMTA 3GP8A 2Q6TA 4LZZA 3D7MA 1G20E 2QNRA 3KUDA 1WBDA 2PT7A 4TYNA 4M9XA 1A82A 1S4QA 4RD6A 4MUAA 4Y0VA 3AUXA 5HZHA 2CL7X 4DB2A 2R44A 4JKYA 4ESHA 4RD1A 5L3SB 1CR1A 4TWZA 5DSZA 5D3QA 4DZZA 1AK2A 3P27A 3WRXC 2DFKB 3U4QA 2ERXA 2V6JA 1YRBA 4G1UC 1XPOA 3VKGA 1WMSA 5FFMA 3ZIAD 2B21A 3GEIA 2FH5B 4V0LA 1XEWX 3B1ZA 2WBLC 3QUSA 4GFDA 1FNNA 1SVWA 3UATA 3QKRB 3DKVA 4HDOB 4OHZA 2F43A 2ZITA 5KU1A 1XB2A 3AVWA 5EP2A 4OI1A 2DFNA 3K9LA 2XZPA 1VYUA 5C4GB 2ZRNA 5JWRA 2G3YA 3KJHA 4DSNA 3EASA 2ZU6A 2WVJA 3B5JA 3KQKA 3FMIA 821PA 2XAUA 2JDIA 1E9EA 3A4LA 1PUJA 4BECA 1NVVQ 1R6BX 3QEJA 5J4HA 1XRJA 5EUMA 4R71A 4O3MA 1N0UA 1FTSA 4TYPA 1NKSA 3NH6A 4D2IA 5K8LA 2F1IA 2REXB 1GIAA 5FTKA 3KTAA 4GZMA 3KDSE 5E7JA 1KYIA 1ZUNB 5L3SA 4NYIR 5DE3A 2R6CA 2P6NA 3LLMA 2P5SA 4GT1A 4TLBA 2ZM5A 2Q0HA 5C1BA 1GRNA 3PCRB 3TQCA 4BFTA 2J0UB 4JS0A 1C9KA 4DDUA 3T35A 4JJKA 4NCJA 1Q22A 2KWIA 1M34E 2QAGC 4TTQA 4P4UA 2XNSA 5EE9A 5FTLA 2KBEA 3LBIA 1KDPA 2BKUA 5ELXA 1Q1EA 1ZM3A 4QGGA 2C5LA 2QORA 1N6NA 4QM6A 3NIBA 1XNJA 1N3BA 3TGPA 2CXXA 3W9YA 4OQNA 4ZIRB 3CX6A 1YR6A 2UZ3A 3L0IB 5M04A 5KPJA 5HCIA 4GMDA 4ACBA 3LVRE 1R8SA 1CKEA 4CRWB 1BYIA 4HSEA 1VTKA 2VSFA 4DHEA 4MKFA 2AK2A 2W6JA 2IS2A 3TQFA 2AD5A 3X1XA 4TMVA 2WJHA 3C5CA 1UM8A 4MITA 5JRZA 1SXJD 4C0SA 1AKYA 1WA5A 1MH1A 2J0UA 2PZFA 1ESMA 1KDRA 4PO9A 2GAAA 5HE8A 2GBLA 4XD7A 4HLDA 1DAEA 1QHIA 3VU9A 1SXJE 3OIYA 2VRWA 2ZRPA 4WIAA 4N3NA 1G6OA 1KI4A 1KMHA 1UBCA 1UDWA 1XMSA 2C98A 2ZRKA 3PUYA 3R8CA 4B34A 2VHUA 3EIEA 3AVQA 4KBGA 4RZUA 3DHWC 1UKVY 2CCJA 2IC5A 2IA5A 2WPDD 3TLXA 1ZC3A 4CT5A 1H8EA 4TL8A 4YMTA 2ORIA 3QF7A 2CJWB 4NONA 3CBQA 1N6KA 3C8UA 2O8DB 1AIPA 2GJKA 2PX3A 5AJVB 4DLXA 1KK3A 5JJIA 4YMUA 4DUGD 5FOWA 1NLYA 4FMDB 2JIZA 4MRNA 5EP3A 3T5GA 1VG0B 3A1UA 3TBKA 1T91A 4RSGA 2X1VA 2ZRGA 4GPTA 5FPTA 2NPFA 3KB1A 1NN3A 2H8KA 4Z51A 1XJCA 3CPHA 2A5JA 1QHGA 2OCBA 2QQ0A 3VR3A 2P5TB 5AUQA 3L0PA 5TARA 4D4JA 4C7OA 3I62A 4PFSA 2O8CB 1KJWA 2IBMA 3TUJC 4ZCLA 1AN0A 4LYAA 4LYFA 3QPUA 3VU9B 4BFSA 4US2R 1EGAA 2B6HA 5FH9A 3SQWA 4IDPA 2NGRA 1CJVC 2OT3B 2LKDA 3PEVA 2IYSA 4G5SA 2QL6A 4TLCA 2VHCA 1J70A 3B78A 1SQ5A 4TYWA 2ZAMA 1D9XA 2XEXA 4M9QA 3THXB 1ELOA 2WJIA 4M21A 2XOKD 4R9UC 4WVFA 5KNCA 2BEKA 4A9AA 1JAIA 2H16A 1N6PA 3CX8A 4LJ7A 2J7PA 4QHSA 1OKKD 2VP6A 4LX0A 1HE8B 1ZM2A 2QAGB 4LYJA 1II9A 2FGJA 2HJVA 2WSSA 1XDBA 4TMTA 4QFMA 4WZ6A 5JSZA 2V1UA 2WIBA 4PXAA 3BFVA 1VIYA 3VR5A 3DO6A 1AM4D 1HV8A 2XOKA 4KFSA 4NZYA 1DPFA 3W6PA 5BQ5A 1K6MA 2ZJBA 2J0SA 3F5FA 5AR1A 4BFWA 1ZCAA 2ZR7A 3QY0A 1LS6A 2AWOA 3CPJB 4JBXA 4N0EA 4PPNA 4C2TA 1MO3A 1ZU4A 5H8WA 5DI9A 3VAAA 1OIXA 1IJEA 3VR4A 1UBEA 1D2EA 2RB4A 3ZQJA 3CF6R 1KI6A 3M6AA 3PUWA 2QPTA 3OAAD 1S8FA 3ZS9A 5H70A 3IHWA 3DEFA 4OHWA 2QEQA 4RCYA 1SHZA 3FPAA 4F4JA 2ZRIA 1Y3AA 1UPTA 2I1VB 2A2ZA 2EQBA 2E1RA 4LHXA 4B48A 3WYGA 4PQYA 3X1ZA 4DLTA 1G3IA 4Q00A 1E2MA 1E9SA 3N5CA 5EXTA 2ZE7A 2DYKA 2O8BB 1GRRA 1P9RA 5AJWA 3CNOA 5EXSA 3AVTA 1JNYA 2VPPA 2ZAOA 3W3AA 3OE7D 3KJGA 4DBLC 1WP9A 1IN8A 5DHAA 4BZXA 2RGNC 2AR7A 2VEDA 3N70A 6Q21A 3LBNA 1MV5A 2NMVA 3N2IA 2GCOB 2J41A 4PSAA 4B47A 1Q12A 1HY3A 3HR7A 4QBFA 1P7CA 5IK2A 2ZYWX 3FHCB 3Q5EA 1E94E 4NYJR 4PAMA 4BGDA 3TIFA 1GKUB 3FWYA 1KZGB 2IX3A 1VIAA 2B7BA 1DAIA 5JCZA 2IYUA 4EAQA 3K09A 1AZTA 1Z22A 1R5NA 4PAOA 3U3KA 2I1QA 4NCNA 1N0VC 1ZNXA 3CRMA 1G8GA 3TUIC 2CVFA 1VPLA 4OQFA 4YDSA 3KB2A 1N5LA 4Q21A 4CEJA 4LUCA 3FFBA 1G4UR 1XJ0A 1Z08A 1T0JB 1Z0AA 5KPDA 4HZUB 5CK5A 2NIPA 1XF9A 1TQ2A 3Q5DA 3T15A 1U8ZA 2XTZA 4XSHA 4DLWA 2VQSA 2QGNA 3AF3A 4Q4AA 3T1OA 4HI0E 3IUYA 1E0KA 4MYTA 2W58A 1SHKA 1UEIA 1US8A 3NHBA 1KJYA 4NPHA 2YVUA 2GJAA 2OCAA 1G17A 1I4TD 2FFQA 4OYHA 2H57A 4IVPA 5HR5A 2W2TA 4LJ9A 4QJ3A 3AF4A 4RCZA 1NKTA 4EPXA 1H8ED 3IQWA 1DAHA 5KTYA 1GP2A 3E1SA 1YZQA 4M22A 2DR3A 2BBTA 3AM1A 2E9SA 2OEPA 2D7CA 5GADl 1U94A 3SYNA 4FIDA 1VCNA 1Z8FA 3TVTA 3K09C 3NWJA 4AYWA 5JHHB 1G7SA 4MRVA 3BFKA 4OHVA 1W5SA 4X8OA 3R9WA 1W1WA 2PLRA 2V1XA 4PQRA 2KJQA 1KO4A 1YU9A 1QHSA 4IDQA 2QTVB 5BW8A 3VR6A 2ZUCA 5LB4A 4FMBB 1OFTA 1YZLA 3T1TA 2H17A 2ZTSA 2GRJA 2P3SA 3T1QA 1N6RA 1PLJA 3OIUA 3ZZ0A 3U7HB 4Q7LA 3U6KA 2ZREA 1RW4A 2RGNA 3I8XA 3IO3A 4ASUD 721PA 4IDNA 2IYYA 4Q4AB 1E2FA 3FMFA 3KUCA 3U44A 1S1CA 3WHKA 1OFIA 4LPSA 5CJ2A 4GL2A 2WMNB 2BBSA 4TQ9A 2CMKA 3QVVA 4Q4JB 4PC6A 4DKXA 4YMWA 1COWD 221PA 2ZEJA 5LBIA 4D4LA 2ZRDA 3TSOA 3U3MA 4ZI3A 2FZ4A 4HAWA 1G7RA 4AIIA 4Z8YA 2VTKA 2HXYA 1KO5A 4KLNA 3W8RA 4B44A 4BLTA 4JLNA 4G5GA 4HAZA 2Z4RA 4DEXA 4FWTA 4OK6A 1KI3A 1Z6YA 2J1LA 2OG2A 2P65A 4QNRA 2R2AA 3CNNA 4D81A 1N5JA 4YQFA 1ZNWA 2Q21A 2JDID 2XNDD 1FL9A 2YJTD 3NBFA 4DCSA 1M7BA 1N6OA 2D06A 2QMOA 3IBYA 2QU8A 1R2QA 4B3CA 1NBMD 3ZJYA 1ONBA 4OBEA 3LH5A 2GF9A 1L7VC 4Y0AA 4WBSA 1E2PA 4LJYA 2G1JA 4DSUA 4FINA 3QIAA 1TNDA 2JEOA 1RJ9A 2ANBA 3MJRA 4NCIA 3OEED 4PR0A 4B2PA 1KI6B 4R98A 4P3YA 4FI3C 1ZYUA 2W2XA 3GJ6A 4FCVA 4MYCA 4ON9A 3AEZA 1NG1A 4P0TA 4D4MA 1MR3F 1U0LA 2OFOA 2ZSFA 5FBWB 4MA4A 3T1VA 4ESVA 4AG5A 2K5UA 4TT3A 3GJ0A 4Q4LA 1Q1ZA 1M2OB 3LQQA 3U61B 2IYQA
chains in the Genus database with same CATH superfamily
3CG4A 3OQPA 3JQRA 1P39A 3PFNA 1M1XB 5FUVA 4C4SA 5BQOA 3L7DA 5K3DA 4YONB 1W36B 2WICA 4RZHA 1NXWA 3RS4A 4HZGA 4JLAA 1CF4A 4K7JA 3MJDA 5C4IA 4O25A 1TB4A 5JIBA 2RKBA 1ZK3A 3WYNA 4CLDA 3D6FA 2XHEA 2BC9A 4X1KB 5LKRA 2J6CA 4RW0A 4IYJA 3KT8A 3C3JA 4FNAA 2VDRB 3HJBA 4PVCA 1J4AA 1WABA 3TEMA 5AT1A 1YZKA 1G9XA 3LXXA 1TO1E 1FU8A 3CXRA 4G63A 1X1SA 2HLNA 2GN9A 3QLEA 2V45A 2ZSEA 3V33A 2IH2A 3LBHA 4HGOA 4IJVA 3CQ9A 1CBUA 2OCDA 3M3DA 4PCVA 1TEXA 4G5FA 1YBAA 3BCHA 3COVA 3IV6A 2H2GA 1GILA 4IHJB 1M2VA 1HMYA 2AHOA 3TCXB 3C3YA 1KEUA 2BKLA 2R8RA 2YV5A 1E1RA 4BZPA 2DUNA 1CY7A 5JPCA 2QRJA 1UIRA 3N39C 5DBOA 2JLYA 5LDDC 4AG6A 3KKZA 1ORRA 4XEHA 4WOCA 2IXDA 1UXJA 1TW2A 3L8EA 5D1NA 3HDQA 3RIGA 4RTNA 3WWZA 2G17A 3C14C 3H9CA 1XJQA 2PT9A 1P4SA 1IJBA 4QGHA 1OJ7A 2Z2IA 4ZOCA 1P5FA 4A8JC 2H07A 1EZ4A 2VTVA 1AHHA 3IL2A 1OX4B 3ADKA 1NXXA 4I55F 4ZQBA 3F3SA 1M1NA 4QUGA 3RHSA 4E4TA 4ZZ3A 1PI3A 1C14A 2AW3A 1UWLA 1EFLA 3HDHA 2OGSA 2FLVA 5CT4A 1XROA 5FNVA 4DAOA 1PV2A 1M7GA 1KF0A 3CLSD 4XWGA 3MS7A 5AMXA 3HYCA 3RG8A 2IE0A 3A36A 2CFRA 3SKVA 5JNUA 1IYZA 1BE6A 4E1VA 2XB9A 3L2OB 4MEJA 5KOHB 1SBHA 3RWBA 1KU6A 1VJ1A 2XTNA 1G98A 1BHJA 1M0TA 3MT0A 4ZCQA 1TIPA 3COYA 5ELLA 2O8FA 4G8JA 4JI6B 4P5DA 1YKFA 3A2NA 1HEIA 2H9YA 2OBYA 5IUNC 2QR5A 3AESB 3FDZA 1M34B 4A03A 3I9NA 4WLFA 4JYCA 2D62A 3U49A 5J4KA 1DE0A 4YJ2B 4L0DA 2CBXA 2W2KB 4YRPA 1PT8A 3DBHB 3F6CA 3ZK9A 5CCXA 3JYNA 1ZI6A 2F3PA 3DFMA 1VC2A 1AXRA 3D6UA 3JX9A 4G41A 4GIBA 4UM8B 4EG3A 5A0TA 1X14A 1Y7TA 4V39A 3O8OB 5HUQA 3U16A 2J30A 4LXGA 1G3QA 4EUNA 4I8IA 1Z3IX 3WK8A 4CNQA 2DPYA 5ALPA 4JENA 2IS6A 1XTJA 1RRMA 1QCZA 1FZQA 1YQTA 2O59A 5IUKC 2WOJA 1BHO1 2FPGB 3LG2A 1JEYB 5LZ9A 2VDPB 5D2CA 3THYB 4JDPA 2JHCA 3OZ7A 3Q3HA 1SJ9A 4HB4A 2H51A 2IITA 1ZJJA 5AUOB 2XCQA 3S70A 3PHCA 3UK6A 2A5GA 4TXNA 1E0JA 1HLGA 1EDBA 2FSFA 5EQTA 1PRYA 3V7UA 5DHQA 4Y7CA 5AVQA 4H4EA 2CEKA 2YHSA 3ANTA 1JT9A 4RESA 3D7LA 3K31A 4WKPA 4GO1A 2J3QA 4EJMA 9MHTA 1UXKA 2XX3A 1RWOA 2QF7A 4I2VA 5CUQA 3OWHA 4HDQB 1RAAA 2BGGA 5KSZA 1LSSA 2NXNA 5A9SB 4M2LA 2ENWA 4CIAA 5A71A 4LZAA 2QTBA 2CDRA 1Y9ZA 1DC4A 1NOJA 3JQBA 4S1NA 4TTPA 1ISSA 1JFFA 1T2DA 4UHBA 5DM2A 5TC4A 2HLDD 3SPXA 3W7VA 4ENRA 4YRSA 3VSCA 2C7RA 2AOWA 2VP3A 4RMNA 2VK2A 1DJPA 1NYLA 1VIVA 2JJMA 4UU7A 2CDNA 3WDMA 2ACEA 2R00C 4CPDA 4JCCA 5IMBA 4D9BA 2Z95A 3ZWXA 1DO2A 4W9MC 4BS9A 5F5NA 1RI3A 1VDMA 3GFRA 4QYXA 5LZ2A 3TIIA 3THYA 3E3OA 1CJMA 3ZD7A 1SC4A 3I53A 4FWBA 4JI5B 3DDCA 4CTNA 3P71T 3PGJA 2QT0A 3F7TA 2DXIA 4ZAXA 4HLCA 2F8TA 5ALUA 3BGSA 1C81A 3BE5A 3DPUA 4FN5A 5KNDA 3MWGA 4PAGA 4HTAA 3UOGA 4FCTA 1YS6A 3OZTA 2FPXA 3IERA 1XDGA 1G291 5JCXA 5TQ0B 1FVHA 3EY9A 3P9KA 3H4MA 2H0QA 1R4ZA 2VF7A 1M75A 1X87A 4J0QA 3G5MA 2EGGA 3CN7A 4EB8A 1KYWA 4YN3A 2W6JD 5FI0B 2XQIA 1ZK1A 3EGOA 3QLUC 5ESWA 1L9KA 1YKSA 5JTUA 4IIDA 2VSOA 2BW0A 2OHXA 4IXMA 3DVSX 4J7XA 2OP0A 1NMYA 2WFLA 4PHCA 4C2UA 3NT5A 4UEWA 3PGMA 3RK0A 2ZRLA 3UJ6A 2OHHA 4MWDA 4MVJP 2HCTA 1JFSA 4RTQA 4W8OA 3BB3A 3EEYA 5EFOA 3RM3A 3CRRA 3T9AA 4BMCA 2YWJA 1Y6JA 1ZD3A 4FYWA 1E6MA 4AD8A 3VHXA 1PT9A 4L2IA 3MM4A 3U26A 2Z5FA 2ZT5A 1VPWA 4AI6A 1VQ1A 3QVXA 4HHEA 1P0IA 1R3DA 2NZXA 3OG9A 1SXJB 3C3MA 3FKSA 4EIWA 3UJ3X 3G79A 4BUZA 1LDNA 2YJGA 3DZFA 3N6XA 4RD2A 4EPYA 5C0OE 1U1CA 4PG6A 3L7IA 2JLSA 4YJ3F 4AMUA 4KQMA 4Q4HA 4EB6B 2IQ5A 5HOQA 1QS0A 4YT8A 5FF9A 4YBZA 4MULA 3NUGA 5C46F 4YAUA 1M1UA 5DV9A 1FP4B 3KYBA 2V6BA 1ZD8A 3D3KA 2AC4A 5ER6A 2VUSA 3BFJA 3B9BA 4NLLA 4BUCA 1E9DA 1OXVA 4UVGA 1UT5A 4BVEA 2BPOA 4M83A 1E7YA 1RBMA 2V7QD 4KO2S 1D8TA 2I7CA 5HF5A 3VO2A 5A5VA 5IF9A 1RCTE 1SUIA 2F00A 4WJKB 4EHLA 2HB6A 5TGTA 5ADUS 7MDHA 1SUAA 3O8RA 5AQEA 1VLJA 4UDXX 1SUDA 4WCDA 4DJEC 3A04A 1VRVA 4RTMA 1C7QA 2GM4A 3G17A 3ZGYA 4ARSA 3OJLA 3HCOA 4C3VA 4E31A 1H0KA 1MPTA 1SQFA 2HNAA 1NW5A 3ZGNA 4X54A 3IV9A 5I5EA 4I4TA 5HIAA 3M0EA 1BCSB 4PICA 1JJAA 3FNRA 3KFXA 1L8XA 3HABA 3H17A 4BPBA 1F9AA 4QQFA 4BP9A 3K7EA 2DHEA 3MRXA 5CX1A 4QBIA 5F3WB 2I8CA 2J4CA 5ETJA 1JF8A 1SCUB 1QVZA 1V2HE 1ZOSA 5C3UA 5JDCC 4KDRA 4J07A 4DMUB 4EYKA 5IYZB 3TGLA 2PYDA 4CQNA 2X3UA 3GJYA 3BHMA 3E5NA 3SIRA 5DHTA 4Z3KA 1CJUC 4BB9A 2H2HA 3QUCA 1ULAA 4KN5A 5LZ4A 2VNKA 1JFLA 1U0RA 3ELYA 2ZS8A 1TYEB 1YR9A 2RSLA 4IRXA 4X90A 1N8NA 1P1RA 2ZBQA 2ZRCA 3GCDA 4C06A 1MRSA 3ZY4A 2MIIA 1LNZA 1PLKA 2ZR0A 3R6LA 1LX6A 4Y2YA 1EDDA 1R0SA 1HDXA 1XP8A 2B2XA 2CJWA 3CKYA 4P92A 3VVLA 3VKWA 2J59A 3BK7A 1Z6QA 3JD2A 5CDTA 1AUXA 3C8HA 3KZCA 2HYIC 4IWXA 1Z2OX 3OLYA 3P4YA 1P6XA 1E4EB 4LC0A 1LFAA 4K9RA 3TRFA 2QB5A 3U40A 3ZGOA 4MUNA 2APJA 2P62A 2VP5A 4LVNA 9ATCA 4MYHA 4CEIA 4B7UA 2EZ4A 4N01A 2GLXA 4HNSA 4QUAA 4D4GA 3Q5GA 1MEOA 4YFVA 4L9AA 4AMZA 2YV3A 3IXMA 1Z34A 1DS6A 1RXEA 3HSSA 2BGIA 4EECA 2ZJOA 1TJ3A 1W36C 1CUJA 3BMOB 4OM8A 1T2VA 2JANA 4DSAA 3P96A 2B1IA 2HT6A 3TLCA 3MYRA 3UJCA 1Z4NA 4ZHSA 5BOSA 4HF7A 3ZDQA 3KLPX 1DTSA 3OT5A 2OLKA 1IEQA 2GNAA 1KI9A 4HUQB 4QFCA 2PX4A 3HVKA 3LUGA 2BMFA 3DZIA 3ERCA 3S3TA 3MCAA 5G1PA 4PQGA 3H3FA 3BE4A 3I5YA 7REQA 5JRJA 4C6SA 5LLTA 2NO1A 1NJ2A 3GQBA 4EYEA 1L7MA 1VKZA 3MINB 4FYVA 5JZOA 4DEYA 2YV1A 3OOHA 3W9BA 2C0CA 2HR1A 1USUA 2GS9A 1YA6A 4G5OA 4JA0A 1THGA 4A0GA 3SJZA 1RRGA 1ISHA 5CGQB 1RHQA 3COWA 1N1EA 1TKCA 2A14A 4QDXA 4ZMRA 1P61B 2HA3A 2J7PD 2I3GA 1C41A 1G66A 1E2JA 1MJFA 1T10A 4MVCA 1YZYA 5KNCD 3GAMA 1QYWA 1FLDA 1IMOA 1FFWA 1NASA 3DKIA 3KM0A 4JKOA 1TUBB 2CMFA 2HZBA 5IG2A 3GMSA 4YIKA 4ZDKA 2V6FA 1JSLA 1XLWA 3E1GA 5B58T 2BN4A 2ECFA 4P7FA 3QMPA 2YIMA 3GLGB 1FDWA 5CYFA 2PD6A 4WCVA 3DHYA 4YUXA 1ZR4A 2Q0QA 3RVSA 4CV2A 1XJWA 1U5CA 3FTNA 4JI4B 2FFAA 2YHBA 2FFBA 2RGEA 1J0XO 3EDOA 1NBMA 1U28C 3MFYA 5EIHA 1L5NA 1TLLA 2C9CA 3AL3A 2B2CA 4OK5A 4U6SA 1MJGA 1QUFA 3WQQA 3TK1A 3P5BA 5B37A 2H0RA 3LUHA 4MZXA 5ICMA 4JL5A 3ECAA 1EBUA 1BFDA 3ZJTA 2ZATA 3LM8A 3G88A 3NLLA 2GKGA 1EG7A 3NOVA 4MIOA 1G2OA 4A5OA 1XNRB 3JZIA 2BR5A 1UXOA 2FPSA 4KRYA 8ATCA 2Q28A 2PU5A 1GNTA 1O9GA 1RLOA 2WF6A 1HQYE 2CL6X 4JN6B 5B2EA 3WGKA 4P7JA 2WAOA 5L8VA 3TPCA 2JD2A 4IZ6A 3REGA 1EWRA 2QMEA 1XZEA 3H2YA 4OAPA 3BGOS 3W7BA 2J87A 3WNZA 3V80A 5AIBA 4E5NA 2YWGA 2G77B 3WK6A 3MSXA 3JAWA 1BXZA 4Z9BA 1DAMA 4RHTA 5E2IA 1HORA 4OMDA 8OHMA 4FZRA 3A58B 2OMKA 1F8YA 2MDTA 2V9ZA 4UVHA 4YX9A 1Z6GA 3AUJB 3RC8A 4NU6A 3HJFA 3QYPA 3FPGA 1H2WA 4UU1A 4YT4A 4NS4A 1G21B 1B23P 1ESCA 1HDRA 3VX4A 4LYHA 4B8YA 1O95D 1PGOA 2PUCA 2FQQA 3NYWA 2JGRA 2UZIR 4UNSA 5DLDA 3RRMA 5B3JC 3D0KA 4R3UC 3RS5A 2CLMB 3U9LA 3EIXA 2FU5C 3QUTA 4DLZA 2ZULA 1HC7A 1SOMA 4G4JA 4LJKA 4JP3A 1O1YA 4DRXB 3TLGB 1U2DA 3Q11A 1K86A 4EJ0A 3ZE8A 5A6SA 1ECGA 2I4LA 3GJRA 3QFCA 1ZNQO 3FIUA 4PNPA 1OYWA 1I2DA 5AOVA 3NM5A 1A95A 1NN0A 5H82A 4L4YA 4FEAA 3BWCA 2W70A 1M76A 3IE1A 4BGVA 2JJ8A 3RWOA 2VAPA 1Z29A 3FGOA 4PWZA 1OF1A 4GECA 1CT9A 1JLMA 3WV5A 5BQ3A 2FEMA 3A3KA 3E7FA 2C29D 1NPTO 2JA1A 3UV7A 1M8JA 3LNCA 4P0QB 4GKJB 4FHEA 2RGWA 3LWBA 1JXQA 4ALJA 4ZCMA 2NACA 2QLLA 1MXFA 2O1SA 3AOEA 1K7EB 2YWXA 3FBTA 1EZZA 5JALA 4N8DA 4EVSA 1Y9JA 4LYYA 1YONA 2IIPA 4PC2A 3HUFA 4BYGA 2NG1A 2VFAA 3L8FA 3W8DA 5IK2D 2XSZA 5JXWA 2QT1A 5KDOA 2GA8A 5KTPA 4TLAA 5D3MA 3SFZA 4HNVA 4MI1A 4NK4A 4FLMA 3ANMA 4R9NA 1WNTA 2HLDA 5J9FA 3T0GA 2IU6A 4DJTA 1J1UA 4Q1AA 2FDXA 1X9GA 2VHVA 1KPIA 1E4OA 1SXJA 1E66A 3B9QA 3OLWA 4GLFA 4X94A 2PLFA 3AL2A 3D8NA 3V4SA 2DP4E 2AOTB 1EFDN 1T5IA 1HLDA 2VL7A 4KQ6A 1BROA 4EJSC 4G0UA 1N2CA 2PH5A 3H2ZA 4E7PA 3RIMA 3I1FA 1OUMA 4RY8A 5KHOC 3ROTA 4XR9A 3C7DB 4BO3A 2RK3A 1V6CA 3UHPA 2Q3CA 2YZNA 3GPIA 2BMVA 4RELA 4YDQA 2ZCVA 4FZ3A 3PTZA 1W6UA 1XZJA 2QUJA 2XQVA 5EE3A 3AVOA 2Z5LA 5JCOA 2E48A 1XVTA 2QTTA 5TF4A 9GPBA 1J20A 2ZSKA 2AC2A 2JCYA 3GJSA 5G53C 2CD7A 4RDXA 1LF0A 5EJ4A 1R6UA 2P8SA 1MB0A 2HU2A 2ZZNA 4Q16A 2JB9A 5BT9A 4MQBA 4ID3A 4LBWA 5IDYA 3RRBA 4PVDA 2O8DA 1G8YA 4NCKA 3W2EA 3ZE0B 4F7DA 4X1OA 4LBVA 5G41A 2RAUA 2HWWA 1I2CA 3HYRA 4QO7A 4D7AA 1DQPA 5JCJD 2WEKA 3I09A 1CYEA 3OOSA 4Q66C 2CHUA 4K03A 4WLVA 5K1ZA 4CLXA 3S40A 5I4IA 1VJGA 5HUHA 1R0XA 2F2TA 3SHWA 2GEFA 3DOHA 2EYUA 2LV8A 1LWNA 1XRRA 2X2FA 5EMMA 4YJFB 4I4TB 5AVSA 2GEDA 2R6DA 1OT3A 1A8SA 5C3MA 1XQ9A 2F9FA 2XNDA 3DO8A 4PSVA 2IS1A 2HIHA 2MYPA 3B3QA 2ZSBA 1UJBA 4B73A 4RH1A 1PFQA 1UKYA 3PA6A 4NIMA 4BLRA 2ZJ1A 1BW9A 1DKMA 2BMAA 1JR2A 4DJDC 2IBTA 4ZZ2A 1E3LA 4P3PA 1Y1RA 4QJBA 4JLSA 5L3ZA 4AZTA 4BASA 2A30A 1XD2B 2X77A 3Q1LA 1E8NA 1L5VA 4RQAA 1LPOA 4H31A 3KQTA 1E2DA 4MP8A 5ALKA 1HDYA 1SNYA 1HE4A 4P4SA 2NNLD 2H7YA 2D0PB 2ZIVB 2RBKA 1Z8DA 3CWCA 1G5QA 5JAHA 1PJ8A 4HH4A 4MKIA 3TKYA 3UAXA 1OTHA 3LT5A 5EIFA 2QLTA 2Z9DA 1TADA 1U8XX 3HCAA 4HQLA 3ZDFA 4JUAA 2XTMA 1ABBA 5DDIP 4ZRDA 2Z6AA 1RR6A 3A4VA 1V5FA 2C5FA 3K30A 2QZJA 4CLHA 4GDFA 1S89A 1ZGHA 4WY2A 5D8DA 4B35A 1JDZA 1RKUA 4EHFA 1N2CE 2CK3A 5HUJA 3CKLA 1DXYA 1WL8A 2PGJA 5CH8A 4EQ6B 4Q1CA 3QITA 2R7AA 4KK3A 1EA5A 4TVBA 3SFVA 4BTLA 5A5GA 1QRAA 1XA0A 1NY6A 5K0FA 1B7GO 1RJWA 5TE9A 4AZWA 4DCTA 2X22A 2BE7A 5EOVA 2DFLA 1V35A 3PCXA 3KYJB 1PR4A 1JLHA 2WF7A 2XQGA 4CJXA 6ADHA 5BUQA 4V1CI 5JSQA 2ECPA 1AKMA 1ZJZA 4EW3A 1LRJA 1BSVA 2Q46A 2FXVA 3D4LA 3IAUA 2FZ5A 3L01A 4JB2A 5D6OA 1ZVQA 2CUKA 2VBFA 3GVHA 2LIVA 4IINA 5DGDA 1YQXA 5JT1A 1U9IA 3Q9UA 2P4QA 2NYRA 2IOFA 1T1EA 4B0OA 6GPBA 2PK3A 1R9NA 3FTQA 4JEMA 2YJZA 3JQPA 3M5WA 3C4VA 3LOUA 4LC1A 2NUAB 5JAOA 1OIWA 5B1DA 3S4YA 2H4FA 1UFRA 1RCUA 1PTKA 1NUAA 4E03A 2G06A 1RXYA 3B6KA 3KZ1E 1KKMA 1US8B 5FA8A 4KXVA 5EINA 3WHPA 3RAFC 2C88A 3VPDA 1UR5A 4YVFA 4DWWA 2JFUA 5JBIA 3P8ZA 1QIDA 2QP3A 5F1KA 3HU5A 2YIVX 2PX0A 3GZ4A 3DJYA 1OXTA 2WHYA 2PGNA 3QV2A 4XH9B 5HTOA 1KJQA 1X8JA 3IQFA 5DH9A 2QUKA 5P21A 4X60A 4QGFA 1NMZA 2MSCB 2ONZA 1H2ZA 2ZYAA 3OU2A 1W88B 4Q7JB 2FA9A 3CWZA 5AICA 3STWA 3S2UA 3DOCA 2GKOA 2HBZA 1RJEA 4L4SA 3VH1A 2DKOA 2GJ8A 4HCJA 1GLVA 1BA3A 3TF5A 4KTTE 3OHMA 5DTMA 2LR0A 1WB5A 2OPBA 5JDCA 1KEZA 2QGZA 1TQ4A 2AVDA 1UL1X 1WBBA 3T7CA 5AVUA 1QIIA 1I3CA 1OOEA 2YIDA 2SKDA 3DWGA 4LBYA 3OJXA 3T0IA 3SY8A 1KR2A 2AN9A 2JAXA 3IGFA 3LIPA 3RYFB 3VR0A 1EVEA 3GCGA 3GV0A 3WP0A 3G85A 4PAWA 1L5HA 1JAXA 1VL8A 1XA3A 2JASA 3G89A 1E77A 3N9IA 1YI0A 3IEMA 2O5EA 2QYOA 4HDCA 4Q47A 2CV2A 4HLUA 2PMBA 1K7CA 2WZQA 4XX1A 3WAKA 4A8HA 3VPAA 1BU5A 1E6WA 1JX6A 1MMFB 1P2TA 1RWNA 1RYYA 4NE9A 5IAKA 5GWXA 4D79A 3MAAC 2QVYX 5HCNA 4PGGA 3SM3A 2MJLA 1NXQA 4L6AA 4PLYA 3KJQA 4QICA 1PO7A 1MJHA 2R6HA 4R31A 3KCQA 2WV7A 2YDXA 4GWLA 2ZUFA 1R8XA 1XU9A 3QRWA 1HNNA 1T4GA 2A5FA 3TMAA 2GHRA 2WMOB 3TCKA 5B7PA 3WTBA 5CVUA 3LSTA 3FMGA 5LD2B 1XU4A 2WT9A 2OQVA 1IBRA 5JH7B 3ER8A 1E1DA 4GX1A 4IRMA 2JHFA 4WNAA 1CVRA 1TKAA 2QZ4A 3MGCA 4CU2A 1AF4A 1E8DA 4RTKA 4NZZA 2O9JA 3HDYA 2CK3D 2R6R1 2FJ0A 4TKUB 4Q9KA 3O03A 4XIFA 2PZGA 2PXXA 4R1QA 1P7ZA 1V1RA 1GR1A 1CHNA 1PWEA 1Z4LA 1G3UA 1H6AA 3JPYA 2ZQYA 1XFAA 3Q3GE 4XM1A 3SIWA 3PJFA 4AECA 5KOYA 2XNKA 2HCBA 3RCBA 3AB7A 3G8AA 2FSVC 5T4FA 4BWVA 2G1PA 4CIBA 4TUYF 3LQ2A 3RFTA 1L4HA 3RRYA 5JZVA 4D99A 3TG2A 1EUDB 4YMHA 3ROZA 1RADA 2WUEA 1WUYA 2DHCA 3HUDA 3O83A 1NVVR 4WX2B 4YREA 3ZE6A 2HA2A 3I1YA 3P9PA 1Z12A 1WTCA 3VI4B 1DO0A 1VHTA 1ZLYA 2C5HA 2GASA 2WP8J 3C6BA 2YWHA 3N86A 4F12A 1SXPA 4K87A 3BC1A 1J2RA 4UOZA 1E1NA 5KTNA 1N5DA 3QLUA 2INGX 3KZVA 1E3EA 3TXYA 2YYAA 5TDHA 3E8MA 2OV4A 3MW8A 4X8LA 3P2EA 2H52A 1XK7A 1DT3A 4HH3C 2GYYA 5DP1A 1HBJA 2VT2A 1K6EA 4E5KA 3HJCA 3F9CA 2CHFA 5HMMA 1ACMA 1I3MA 2ONYA 5ECDA 4B3IA 3H11A 3A14A 2QA5A 5HWSA 3S1AA 1AT1A 5I47A 1Y1TA 2A0XA 4OATA 3U3DA 4UUNA 3CISA 5LSAA 5M5BA 4Y1RA 1RACA 2WWIA 2BZ0A 2CSUA 2V3VA 1JDBB 2C57A 4WNCA 4AMBA 2Y8EA 4L5YA 5KSPA 3BXPA 4DXAA 1Y7HA 3R0JA 4OJTA 5J1TB 5CDUA 3TW4A 3BRWD 1KYYA 2HADA 4JB0A 1KIMA 4I81A 4JEHA 2VBCA 2BEWA 2FE4A 2QN8A 4PZ0A 3B7PA 2BCEA 4U3JA 1SRQA 2AZMA 3LGXA 1TL7C 1B16A 2B5WA 3M2TA 3VPSA 3IAEA 5GAJA 3VH2A 3PZBA 4B4VA 1E0AA 1KVTA 1OZGA 5DOZA 3ZY3A 5JSUA 2IUUA 4ZOQI 2R4QA 3LC7O 3DHVA 2FMXA 3FUWA 3K92A 5AWFC 5FBHA 1DRUA 3UC5A 1IXZA 4AFNA 5JMOA 2H1HA 1O96A 1GXSA 1IB6A 4R9SA 4TRJA 2O2GA 3UWOA 4G0QA 4PN7A 1VSUA 4CTOA 3H7AA 1VMAA 3PQ5A 2DQKA 1G4AE 3TTSA 3L43A 2J9YB 2Q49A 5FLYA 2YXEA 2AC7A 1KSFX 5D5PA 5M34A 3SEZA 1FB5A 2FPPA 5IWCA 2WB4A 3IIJA 3R5SA 3ZWCA 4WA7A 4DPLA 3NXKA 1PBNA 2R1VB 1IHOA 1X0VA 4HP8A 4BB5A 1QAMA 1NY5A 2JVJA 2NQTA 3HKDA 2QAIA 4PSDA 2EAUA 4FJ2A 4RORA 2R5WA 2DFDA 3LFUA 1XU7A 3BL6A 1AF7A 1DCTA 5FCDA 4C43A 3E3LA 3SJBA 1P4HA 2BRUA 3FVRA 3B1JA 4YRQA 1WQ1R 1Y7IA 1QQTA 2Q29A 3L1VA 2V7EA 2OBNA 2GHQA 3PD7A 1MLDA 3BB1A 4KACA 1U7WA 1AGRA 1XTTA 2EFGA 3DH0A 3F8TA 3HZOA 3PYXA 4HQ6A 4NJMA 4P7BA 4Z9AA 3T7IA 2YN2A 5ARCA 3R7AA 1XZGA 1OLOA 5CVEA 4FNOA 2GYVA 2IY7A 4IAOA 3NWBA 4OHUA 2E5FA 5HK8A 4CG1A 1H9CA 2KBFA 1IBKB 4IIVA 2CL0X 3R4VA 2J5KA 5DM1A 5SZJA 1PNRA 2RG7A 1S2MA 1Z56C 2CFCA 2QTZA 3GFVA 5LP6F 3GT7A 4KDCA 2G9VA 3I9KA 2XMQA 3JYLA 2OFWA 4X66B 2HSGA 3DM9B 3GFQA 1FMCA 1T0PA 2P6MA 2HM7A 4E4RA 3QXXA 4RZQA 3EZFA 4F3KA 2UU9B 1C1DA 3ABIA 2Y1EA 5K03A 4XVQA 4XLTA 3CVJA 4NENB 3CSUA 3ZJ4A 2PX5A 4LOHA 4YMIA 5P8WA 4J49A 3RC9A 3EN0A 3GAZA 4WGFA 3EUEA 3CLRC 1SUWA 4OHCA 2ONKA 1H6DA 2ZRFA 4NJEB 4IKOA 1WKVA 2BVNA 4GDMA 4B76A 4EWLA 5DI3A 2G70A 3FWPA 4NH0A 4A8JA 3Q1KA 1CTQA 2SCUB 3C8ZA 1BKDR 4Q03A 3D3JA 3KBBA 3CX4A 1U4NA 2C2YA 4DSTA 3NDRA 1E79D 4R9VA 2UDPA 1GFIA 1UMBA 1VSQA 2CVQA 1BEZA 3H8SA 2RGXA 3P32A 4UUOA 1X9IA 5TNXA 1KGDA 4L74A 1G21E 2PZKA 2M6LA 1XN1A 4H7DA 3OJ0A 4RA6B 1AHNA 4ADSG 4U7DA 1P2SA 1KI7A 4QTUB 4TN1A 2P6PA 3KR1A 4Q3BA 2C9MA 1UK8A 1M2WA 3CSSA 1PR0A 1FX1A 5JV5A 4DWVA 4F96A 5C35A 1JHVA 4QSHA 5BQPA 5FX2A 1E1KA 1VB5A 2BISA 2D4HA 3PS9A 4OOFA 1E60A 4JA2A 3EVFA 3CF2A 1IB0A 3CR7A 4PO8A 5PGMA 1A1VA 1NXOA 3Q40A 1BXGA 1AUQA 3OCJA 3W5JA 5E9JA 3G0GA 4MUGA 4QT0A 1UJCA 2P7IA 3ESZA 4CMCA 5L4NA 1GZUA 2JF0A 3WRYC 2OXCA 1AXEA 2P9YA 4DA4A 4PLZA 3PDHA 1XEFA 2YYZA 3HMQA 2DULA 3C5WP 2C2XA 3FNFA 5IT0A 3AY0A 2RHWA 2WWWA 1J8MF 1SIUA 1TIKA 2VTDA 2W6PA 4G85A 1NQUA 1RI4A 4IVQA 1CZUA 5HJ5A 1I10A 3EC1A 1JEEA 1IEVA 1QV7A 1UH5A 3ETLA 4LY6A 3IPRA 1HSOA 2G5TA 3C97A 1KK2A 8ABPA 4BC1A 3ICQB 3VNUA 2A6PA 2YHAA 1CETA 3GT3A 3H86A 4QLOA 3TLBA 1KJJA 4KR9A 1NLFA 1UM9A 3MTAA 3SHVA 1KORA 5CHEA 3VMFA 1E7MA 2VOJA 5A4DA 1DLJA 3TL2A 2D2VA 3NHRA 2GZHA 3HB9A 6REQA 3HU2A 3RRXA 2Q4OA 1ULHA 4JJ6A 2Z9BA 4PNHA 4LCEA 2BGTA 2FB9A 2YUIA 1REQA 3PXDA 1PV1A 1YCFA 1YR8A 3K72B 4HAIA 4EATA 1UBRS 3I4LA 4HNHA 3RIHA 2HDNB 2IEIA 2PUJA 5CM8B 5K2OA 5EJFA 3GC6A 3U7QB 3BHNA 3SBEA 3WXBA 4WJZA 4ZVMA 1QFZA 2JGMA 5JY6A 2ORVA 3O5AA 4A7PA 4R8KA 4MS3A 4FGSA 4HX2A 5AKIA 1SXGA 1QYDA 3HR8A 3HU1A 4F21A 2WJPA 1OB5A 3L5KA 3MQ4A 1TUIA 4WK4B 3PT9A 4KAXA 1JL3A 3GT4A 3OWOA 4WCFB 3VYRB 3W2TA 2O0KA 2JLUA 1T8RA 3RAJA 3O7MA 4C03A 3KPVA 4OQMA 4DLSA 4LWOA 2W0SA 4CNBA 1XF1A 3AY3A 2XZOA 2G8NA 3INRA 7MHTA 5KAMA 1WY7A 2E21A 3VJRA 4MH0R 5DK6A 2Q3DA 3R40A 1N3YA 1PN3A 1KK0A 2W8BB 4H0FA 4YMSA 5FUYA 3QVOA 2XT0A 1A9RA 1BH6A 4X3PA 4F2GA 4YRLA 2VUIB 2B5OA 3NAZA 4BV3A 2XKKA 5G3YA 1GKIA 2VI5A 4BBPA 2HGSA 2IYRA 2HKIA 2AJTA 2JGKA 5AK6A 1I2BA 3N2LA 5TJ9A 3ON5A 2XLBA 5AW0A 5GZ6A 1JG3A 1N92A 2IXEA 1J1ZA 1SKAA 1K63A 4WUVA 1IJFA 1R0LA 3C2QA 3LVFO 1VJDA 1P2FA 4P53A 2G9NA 3RUEA 1PT7A 3ZV3A 4BV8A 3DOIA 4R2LA 3A1DA 4UDOA 1T2NA 1XD9A 5J40A 6PFKA 3OECA 4U1RA 5I8WA 4L4UA 4EBFA 5IKMA 2NXWA 3RF6A 4MV3A 1UBHS 2OKGA 1YHNA 3OVMA 4QDTA 5IJ9B 3TS1A 3UJAA 4Q01A 1MFZA 1WZIA 2MYNA 3WLSA 2GZ1A 1P3DA 1JAHA 4LMBA 4YAJA 3K71B 1IQPA 2PX6A 4S04A 2ZS7A 3TQRA 4KQGA 4XX0B 4FR5A 5H5JA 3UB2A 5KSWB 2VJCA 2ZR9A 3IB3A 1FMTA 1GPDG 4DYVA 3CNBA 2ROQA 4MKZA 3ZJUA 3V1NA 2DEUA 2MHCA 2H11A 3QNUA 1Y9DA 1COZA 2XB2A 4ZT7A 2DG2A 1GLNA 2JGDB 3SZLA 5BN4A 4WD3A 4AY5A 3JCZA 1PK9A 1TKBA 5CYPA 1UKEA 1PGNA 4YCSA 3QQPA 2JI8A 3Q85A 5BNZA 2E0IA 4BNDB 4F4CA 3LDHA 5B6IA 3U17A 3LW8A 1L1QA 1L4KA 1S3GA 4HDRB 4JJ7A 5FQNA 3OQVA 3DW1X 4P83A 2BGWA 4JJZA 5FYDA 4EJ2A 1SVKA 2IPMA 2C9OA 3AIMA 1XTQA 4UC0A 3S68A 5GONA 1LB1B 3TW0A 1VHWA 3PC7A 1TK9A 2P4SA 5ABPA 1MDBA 1ZK2A 2V74B 5DTIA 4E2XA 4I5EA 3MCUA 2B1QA 4G4IA 2X9VA 5JZ9A 3NETA 2QUHA 3PHJA 3C1AA 2BHNA 2NV6A 5KYUA 5FNZA 4NP6A 3UT5A 3D8SA 2ZI3A 1XEXB 3CSDA 2VWGA 3T7JA 1SVMA 1EWTA 5CFZA 2R5FA 1LJLA 3DDHA 4XIJA 1E9RA 3RSZA 4ZVSA 1DKNA 1C8KA 1QZ3A 4ENVA 5M29A 1N2EA 2VP2A 4X6LA 5GY7A 1F7VA 1H8HA 3A3PA 5FV7A 5JD3A 3NKFA 3OCCA 3T9EA 3L77A 5F12A 5BMVF 5EIWA 4QOFA 4IIEA 2JLQA 4RHEA 3QSYA 1Y3IA 1DLIA 1CUIA 1ZA1A 1I0LA 1WBJB 3K16A 4EITA 1CUUA 2WAXA 5EHGA 1XVIA 2X3YA 2H00A 4TVOA 4BNUA 5KEIA 1ZGGA 3A9WA 1O6CA 1OFVA 2P4HX 1VPDA 1EVIA 1Z83A 2YQ4A 5DNYB 2BGKA 3EEBA 5EZ5A 3ES9A 3CLKA 5IC4A 2A86A 5KOJA 1T4BA 2COEA 4ZJUA 2XYQA 1Z0FA 3A26A 1DX6A 1VRCA 1HYGA 2XIQA 1QP8A 2ZFUA 4R8LA 1MIHA 3QUAA 3EF3A 1XVAA 3ZH2A 4B6SA 5FPYA 1OI3A 2DH6A 1DBRA 4OM7A 4Y9SA 4YEDA 4EHAA 1GNQA 1OLUA 2C59A 1DC8A 4I66A 5TMEA 5DJ5A 3WZLA 3PXUA 2HL6A 4I50F 2EYQA 3WLHA 5HVNA 2F3QA 1QO0D 1W73A 1WE2A 2B37A 4YAEA 1DCKA 2E4WA 3NIGB 3U5ZB 1L5KA 1EP2B 1WSBA 2H54A 1UADA 1P44A 2PKEA 3G0CA 4W1RA 1X1CA 3LPCA 4UE3S 2Y0BA 4B3DA 4B2LA 2FR8A 4FW9A 4RU1A 2WT4A 4K9DA 4MR9A 4RF5A 3U48A 1TM5E 4MPRA 2O8FB 4LHEA 1PQPA 3FX2A 2PKWA 3SC6A 3QUQA 3WMXA 3NBXX 5IH3A 1VLHA 4ZI2A 4EI2A 4DCJA 4I8XA 4O2BA 2D3WA 3TL6A 4D3DA 2CLSA 2BFBA 4RK6A 4X1IB 2ZJYA 2WU4A 3CO0S 2PEYA 3DPSA 1BQ4A 2B78A 3IQHX 1V71A 2EP5A 1BHQ1 3KTDA 4UTRA 1KZ9A 2DPGA 5HFAA 1UPUA 3KXKA 4K6FA 4C9BA 4PG5A 4WINA 2O2DA 1IWPB 3BDIA 1DFHA 3KZNA 4ARZA 4BQPA 1JPVA 4C22A 1JGTA 2QTCA 3V7WA 4LJ6A 4Z4CA 5TX7A 1WXQA 1KXZA 2W37A 4UU8A 1VDZA 3KKKA 4CKZA 3NGXA 2OG1A 4LRQA 3ZI4A 3GRCA 2RIPA 4MNTA 1ZONA 2PNFA 1UKAA 3W34A 1EP9A 1NF3A 1XDZA 4EPVA 5D51S 1W34A 1QYXA 1QF9A 1ORHA 1Z5NA 3V8EA 1NDUA 3OE1A 3QI7A 2DU8A 1FVFA 2QRNA 4WY8A 4A6PA 1JG7A 4HY3A 4YO8A 3U3JA 4WZAB 621PA 2WSMA 4M8SA 5A6SB 1JB1A 1XZAA 4FFDA 4FE7A 4UUAA 3TQHA 1ZMOA 1E1QD 2I2WA 4UAGA 5LC1A 3P0JA 4NOKA 4NXNB 4FXPA 3DF7A 4F85A 2QE6A 1D6JA 1MG0A 2MYUA 3M33A 4TSRA 1U2ZA 3GK3A 4GEGA 5HM8A 4P98A 4WKBA 4I4NA 1C9YA 1PHPA 4DCNA 1GL9B 1EA7A 2PMWB 1A96A 3I34X 2W00A 2PZEA 1YQDA 3E8XA 2POCA 2WOOA 4N39A 4H7EA 5DMXA 5IAGA 4IJKA 4CN9A 3F67A 5CB4A 2R9VA 1JTFA 4CIYA 1Q1BA 4E2YA 1YS7A 2C94A 3GFFA 3PEUA 2WDZA 4UULA 1GADO 2CHVA 4HJXA 4CM8B 1DKPA 3NHJA 2YS6A 4OV6B 3HB5X 4AYXA 2ATXA 2IHUA 1W9MA 2VP4A