1E96A

Structure of the rac/p67phox complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
178
structure length
178
Chain Sequence
b'PQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
publication title Structure of the Tpr Domain of P67Phox in Complex with Rac.GTP
pubmed rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 61
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2000-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e96A00
2GJ8A 2ZRJA 4A6XA 4B3FX 1NVWQ 2GWHA 2GILA 4A8JC 4BLTA 2OAQ1 3MCAA 2A2ZA 2IXGA 4TT3A 3A6PC 4B6FA 4MQBA 3I32A 4DIDA 4C0JA 1KY3A 1OE0A 4JS0A 3B1YA 4B3GA 4KLZA 4DCSA 4A4DA 4TL9A 1P9RA 1MO4A 4GPTA 5JFGA 2HEIA 1P2UA 2QROA 5CLQA 2IXFA 2EFGA 3KB1A 3B1ZA 5DYGA 5HKKD 3ZS8A 4KFUA 3FPAA 4BPBA 3PR1A 1ZMXA 4WZAE 5C46F 3IO3A 1EFUA 3A1VA 4AK9A 2GJAA 1KI7A 2O8DA 3O8CA 2B8WA 5F9FA 1S1CA 3C4JA 1XB2A 1ELOA 3WY9A 3CNOA 5EP2A 2Z83A 3FGNA 4PC3A 5CDFA 4TSFD 3NEYA 2GXQA 4KHZA 3C5CA 5KSPA 3RC3A 3WMGA 4IHQA 1HH4A 3UG6A 2HYIC 5IK2D 2G1KA 4PAMA 2ZR0A 1UBCA 1XEXB 3K0FB 3FFBA 2QPAA 1NMYA 5FL7A 2JATA 4ZPXA 5TV2A 5B57C 4DLXA 2FZLA 1US8B 3K0AB 3SJZA 3Q7QA 3WMFA 5DE3A 1KZ7B 2H5EA 2NPFA 2F3TA 1CR2A 1T4GA 3A1TA 4OK3A 4UXJA 3THYA 4K46A 4XD7A 3PV0A 4DLUA 1E9CA 2QTFA 3E5HA 4Q00A 3O47A 1OLOA 3ZZ0A 2YWFA 3QXSA 1MOZA 4NYMQ 2PCJA 3GPLA 1G7SA 2YJTD 2VTKA 3QPUA 2IYSA 4FD2A 2QAGA 3I61A 4ESVA 2CL6X 3CPEA 2IYTA 2RHMA 4HAUA 4AYTA 3DEFA 3KUCA 1E1RD 1VHLA 1ZC3A 3K09A 3OAAD 4GBMA 3W8RA 2WJGA 1E69A 4C0SA 4UJ3A 4C9BA 1R5OA 4OHXA 1XU4A 3U44A 4M1WA 5C2JB 3L8YA 4U02A 5JRZA 2BCGY 2BC9A 3BJIC 2F6RA 1E2GA 3MG9A 4AWXA 3FTQA 1HQCA 2P65A 3QKRB 1HE1C 2VQSA 3MMPA 1G17A 4TLEA 5KNCA 1KK2A 2WPDD 3ASYA 3UATA 1BS1A 4IOJA 3QG5A 2QBYA 4Q47A 2BM0A 5FOVA 3O8RA 4OL0A 4AG6A 4AY2A 1ESNA 1ETUA 1FOEB 1D2NA 1WXQA 2AKAB 2BIFA 3A1WA 4HZUB 4LZZA 3LX8A 1SXJB 2PEYA 1S96A 3VX3A 4C0QC 3N2IA 5CJ2A 6Q21A 3U6KA 2WOOA 3D6TB 1LV7A 1XFAA 1GL7A 3BC1A 1Z0AA 4BQSA 5SZKB 1U0HC 3FMIA 3AVWA 4LHXA 1U0JA 3U4QB 1NVUQ 5GJWC 2ORIA 1TF2A 3M6AA 1CF4A 1E2EA 1R2QA 1DARA 3GFOA 1KYIA 1MABB 1WQ1R 3EPHA 4PHGA 4BLRA 3LRPA 1W36C 4B43A 2IC5A 1LF5A 2E9SA 4KODA 3OEED 4C7OA 4YC7A 2G3YA 3MSXA 1IN5A 1LY1A 3QQ5A 2W58A 1CEEA 2ATXA 4A0FA 4JLKA 1QHNA 4RD1A 5JHHB 3VKGA 4AKEA 3GLHE 3LW8A 1E2JA 4CYMA 3TUZC 2N42A 3SFVA 1YJ5A 2IS6A 2OCYC 3C15C 5D3MA 1GNPA 1BMFD 1ZM3A 4LHZA 2QE7A 1N6LA 2QAGC 521PA 2EFCB 1XRJA 1T3SA 1G291 1A2KC 2D2EA 1G3QA 2IUSA 2P3SA 3B1WA 2CVFA 2WIBA 4QJ3A 3ASZA 1R0WA 3WRXC 4EPWA 1NI3A 2Z43A 1N6IA 1W0JA 2QQ0A 1R0XA 2QT1A 4M4SA 2NQ2C 1N3BA 5HR5A 2F1RA 3T1OA 5K8UA 4DDTA 1KI6A 2NG1A 3NXSA 2GK6A 1G6HA 2AX4A 2CMKA 2WZQA 3GLIA 2ZJAA 5CM9C 1PJRA 3GJXC 1ZAKA 4U7DA 3LY5A 1AKYA 1NG9A 1KI3A 4XWOA 2JLRA 1II9A 1W4CA 2WJHA 3X2SA 3CWZA 1GFIA 3RLFA 1KMHB 4B32A 1R0ZA 5KU1A 3T1TA 3DOEA 2BDTA 3ZD6A 2XJ9A 1OSNA 4L9SA 1V5WA 1WBDA 3U7EB 2H1LA 1II0A 3HDTA 4IVPA 4UXIA 3CF6R 1G4UR 2ZSEA 4ZI3A 3RS3A 2V7QD 4TMVA 2F55A 1Z6YA 4LJ8A 3T12A 1YHNA 3U7FB 2CK3A 3FFAA 4TWZA 1TTTA 3MJHA 4A15A 3AKYA 4LDJA 1YZGA 1D9XA 4TYQA 4JBXA 4C30A 5JMTA 1IM2A 1WF3A 3KQUA 4QKQA 3PEYA 2HYDA 2ERXA 4CDGA 4WIAA 3GP8A 2E1RA 1E4YA 1IXZA 4LJAA 5KNBA 1ZCBA 3VAAA 1P60A 1WB9A 4LPKA 4G5RA 1N0VC 2BEKA 4LYJA 5DH9A 3NDPA 2WOJA 4LJYA 4A36A 4GT1A 1A7JA 2KSQA 3KJHA 5FOTA 3QKUA 5FUXA 4W9MC 4XH9B 4MUBA 5GADl 4TMWA 3EARA 2AK3A 4EFMA 1P2TA 2IYYA 2OAP1 4W7SA 4D2IA 4K8OA 4IOLA 5KSYA 1J90A 1FX0B 3HYRA 4ZDIA 1S2MA 1E1QA 2FA9A 5FI0B 1OYYA 2IUTA 3G82C 4NYJR 2RHDA 3LXXA 5BXQC 4HLUA 3W3ZB 1EFTA 1AGRA 1P5ZB 3AEZA 5IDVA 5B2ZA 3NC1C 2WJYA 1NL3A 1OV4A 4FWTA 1M74A 2AD5A 4EPTA 1R8SA 5CYPA 2BM1A 3RS7A 3KL4A 2X2EA 3K0CA 1YR9A 4HAZA 4V0KA 1JR3E 1R4AA 3LNCA 5JJIA 4LRWA 1QHHA 4PSVA 2C04A 3TGPA 3W5IA 1IY0A 1NBME 2W2XA 1VG8A 4L15A 1COWD 1ZYUA 2JGNA 3F3YA 3GJ6A 2ZSBA 1GL9B 2W6JA 3U3RA 1P3JA 1IOZA 1G41A 5B30A 4WXRA 1SVIA 4G5QA 2IYUA 4GZMA 4QJ4A 1KO4A 1KDPA 2H18A 4L9WA 3GEIA 4M2LA 1DADA 4DIEA 1OH6A 1DBSA 4BFXA 4HUTA 5AR1A 2V1UA 2JJ2D 1NVVQ 2ANBA 1N6PA 3RANA 4GOJA 1OIWA 2EWVA 3ZLJA 3AP2A 1NLZA 1ZUHA 1ZNWA 3CX7A 1SVKA 3OIWA 3U2QA 1H8EA 1CRQA 2JDIA 2X19A 2BBWA 2EFDB 2WWXA 4A2PA 1XPUA 3BORA 1XXHE 4JLNA 3B8HA 1E96A 1HUQA 1KK1A 5AUPB 4IFBA 1VHTA 1I2MA 5F2EA 3ZH9B 2PEZA 2QRNA 1J8MF 2O0JA 4M1KA 4NHOA 4QGAA 3GD7A 4Q21A 5DI3A 2P6NA 4BLPA 3AF3A 4L8GA 3U61B 1ZU4A 1CIPA 1SVWA 3WXMA 4I1VA 1E3MA 3K9LA 4HLUC 2CCKA 1OH7A 1NN1A 2WJIA 2ORWA 2CLSA 1XJCA 1GM5A 1FUUA 4CF7A 4K81B 1K6MA 2C5LA 2WJJA 1KDTA 3BD9A 3TBKA 1OPXA 3I92A 2W2VA 4MRVA 1NF3A 5F98A 3QKSB 2ZSDA 3TVDA 4JLJA 1N5LA 3QUSA 1N25A 2OG2A 1CXZA 1D9ZA 1XTKA 1Z6TA 2RGNC 4RD6A 3VFDA 4B3BA 5A4JA 5TMPA 3WYFA 1XCPA 4PPQA 3QKTA 3NIBA 1AN0A 3LBNA 4URYR 5JBQA 3LO5A 5J47A 1YVDA 2C98A 5E4FA 5G3ZA 1L7VC 1AA9A 5FR1A 1NNEA 2FZ4A 5AJZA 4NP6A 1PLJA 1SXJD 5EXXA 1NJFA 3FMFA 1HYQA 3LD9A 2IYZA 4Z1MA 2FJUA 4OHVA 3THXB 4V0OA 2ZRGA 2ZUBA 1XZPA 4HB4A 1LS1A 4EFNA 4Q9LA 3VR3A 1X1RA 4FCVA 3R9IA 2ECKA 4EQ6B 1QHIA 3MWJA 2QT0A 2WVJA 2X1VA 1P72A 5H68A 2REBA 1VG0B 5L3SB 3ND9A 5GJBA 2GBLC 4DBLC 1TU4A 5EE5B 2DYKA 3TQFA 1CJTC 2XTZA 1G20E 2YWEA 4Z51A 4BGDA 4MKGA 1XX6A 2CXXA 2R6FA 2WWHA 1E9SA 4FCWA 1X8KA 2P67A 4IOKA 3RNLA 4ZV4A 5E7IA 1W4BA 1W4RA 5IK2A 2ZJYA 1XF9A 3LXRA 2CL0X 3TLXA 1AS3A 2LCFA 1ZINA 2ZRIA 2VA8A 2DPXA 2ODWA 2OT3B 2F1JA 2H57A 1DPFA 3KTAB 5BN3A 5CK4A 3NVAA 1XD2B 4GNKA 4Q4JA 5KOYA 4LJ9A 4M9XA 1XMJA 4NBSA 1OT3A 1CR4A 2D7CA 1GKUB 1CLUA 1UEJA 3K70C 1WBBA 3OIYA 3LBIA 5FOXA 4TLCA 1SQ5A 1QRAA 1ZC4A 4PFSA 2WSSD 2A7QA 2JJ8A 3LVRE 1YR8A 3O8BA 4ZO4A 4LV8B 2G6BA 1QHXA 2GZHA 1W1WA 4GZLA 4Q48A 1E1RA 3OAAA 1NKTA 4QGHA 4B3DA 2PZFA 1SZPA 1FW6A 2FPMA 3EA0A 3D31A 2IYLD 3GLHA 4QBHA 4BECA 4M1OA 3KXIA 2DHRA 2QM8A 3CUEF 3VR1A 5JWRA 2NO6A 2O8BA 4QOSA 5H8WA 1SKYB 2JLZA 4NH0A 1E99A 1ZRHA 2GRJA 3UMRA 3ZVRA 5JSZB 3W6PA 1VCNA 1Q1EA 2XX3A 3KX2A 2FV8A 5G41A 1TX4B 4CEIA 3QI2A 2X8AA 1GL6A 1T0JB 2WPDA 4JVLA 4JBYA 5L3RA 2Z6VA 4XVQA 1KNXA 2RGXA 1G7TA 1M7GA 3OIUA 1Z0IA 5AK0A 2CBZA 4KYIB 4O0MA 3GQBA 4PPFA 3VKHA 1UKZA 1YZNA 4LBYA 5FUYA 2F43B 1N5IA 3GJ3A 1KZGB 1N0WA 1W49A 2ZJ2A 3MAAC 2HDNB 2OILA 1QZXA 3Q7PA 4HATA 4I1SA 4JVNA 3SI7A 3NDBB 3R9WA 4AKHA 5H70A 1OH5A 2ZRPA 1OFUX 4QJ5A 1F2UA 3AP1A 2QU8A 2REOA 4TYYA 4PAQA 2I3BA 4NCJA 4XOIA 1Q57A 2OFWA 2HXSA 2OCBA 4NTZA 1CJUC 2R2AA 3VR4A 2J7PD 2ZI4A 4QBGB 2D2FA 3OEEA 4I81A 4TL6A 3EPLA 2J0VA 4PC2A 3SDZA 1GUAA 5JS8A 3QE0A 1P4SA 4A92A 1ZM7A 2LKDA 5EZ6B 4KLNA 4DCVA 2ZS8A 2ZRMA 4LHVA 4Q1FA 4YQFA 4URXR 1G8PA 2J3EA 4PZLA 3BERA 2QUZA 3N5CA 3CPHA 4B6EA 4F92B 4V0ME 5CJPA 4QRHA 2O8EB 1NKSA 3C5HA 3CZPA 4EPYA 1T9HA 2H7VA 1MO5A 2MMGA 4B2LA 2BJVA 4QNRA 1E2FA 3JZAA 5BN5A 4DRZA 2V3CC 2FGJA 2PL3A 2O8FA 2KE5A 4R2IA 2OUKA 2RGAA 3QXCA 2YZ2A 1E94E 2ZAMA 2C95A 2IYWA 4QM7A 1ZUIA 3GLIE 1IHUA 5K8IA 1Z8FA 2J0UA 2XAUA 3SYKA 1BYIA 1FP6A 5JI3E 2ZPTX 4NYIR 1GG2A 1Q12A 4GRAA 1OHHD 2BBSA 2FEMA 4FN5A 1S3SA 4UXHA 1GZSA 4MRNA 3W34A 1FTNA 1OJLA 3ND8A 4JJKA 1YRBA 2OBMA 1TMKA 3QG1A 4TMXA 1DAFA 2QSYA 4KYUA 4XWKA 4NYMR 4XSGA 4YMWA 4OK5A 3TSWA 3SBEA 4M22A 4CIDA 1JAHA 2B7CA 2YVUA 3FKSA 5DHFA 2FX3A 3OFNA 5JWOA 3PFIA 2YOGA 2X77A 1T91A 4AIIA 4QBIA 4X8OA 4TYWA 2DCUA 2V7QA 2IUUA 4IXMA 2H17A 2V4ZA 3DM9B 4LV6A 3W5JA 3ZZUA 4BRWA 1KAGA 1S1MA 4ZDWA 3TR0A 3SYLA 3BB4A 1NBMA 3A1UA 3TH5A 3ZDQA 2UVQA 3T61A 3VR2A 5LPNA 3WHLA 3CBQA 3D3QA 4OYHA 3HWSA 2OXRA 2R6GA 3CRQA 4II7A 4D4LA 2AFIE 2YKGA 4TTPA 1G3IA 1Z22A 5FR2A 3TW4A 5J4VA 3T34A 5IHPA 4DB2A 3JVVA 2G0NA 5AJYA 1TPZA 2RMKA 4RZXA 3GLGA 4OHYA 1RJ9A 3DL0A 5KDLA 1J99A 5TB5A 1A2BA 2D3WA 4A82A 4EAQA 1CULC 5B58C 5M04A 3OEHA 4URVR 4D6PA 2UZ3A 1IN8A 4A2QA 4WA7A 3ZVLA 3CRRA 3P27A 4P0TA 1U8YA 1R0YA 4G3XA 2OLKA 2VEDA 1G8FA 4RCYA 1QG4A 4PX9A 1OB5A 1QHSA 4BZPA 1WE2A 5J4YA 4A8JB 1RYFA 4KO8A 3EZ2A 4Q1EA 4HAYA 4Q7JB 1P62B 3AF4A 4P4UA 5F3WB 2XZOA 3GLFA 2W0MA 1XTJA 1XXHA 5TXGA 4TMKA 4PQRA 5GJVC 2R8RA 4R9UC 2JLQA 4H1VA 4RVCA 1BYUA 4RD2A 4PPNA 4US0R 1SHKA 4X8MA 2GDJA 4XTRA 5ANRB 1JECA 1IONA 1KJZA 4EJSC 5JWHA 5JCPA 2FDCA 4FXPA 4DXAA 2PJRA 4DSUA 4U5XA 4HSEA 2L0XA 4E5UA 4G1UC 2CHGA 4HUQB 2YWGA 2EFEB 2DBYA 4DHEA 3TSOA 1T3LA 1HT1E 5CIQA 2ONJA 2IEYA 3PUYA 3SFZA 4HI0E 4MDEA 5FUWA 1Z07A 3FB4A 4KBGA 5GVRA 1A1VA 2BVNA 4LV5B 4M9SA 1KKMA 4KSCA 2ZUDA 1UDWA 1AIPA 4JBWA 2Z4SA 4ERNA 2XOKA 3TRFA 1FNNA 3K0FA 4EPRA 2IYRA 3B1VA 4OQMA 1DO0A 2P0EA 1T8UA 4RJLA 3AUYA 1TQ6A 4RZ2A 1OXXK 3VU9A 1ZIPA 1VTKA 1HT2E 2O52A 2PMDA 3IHLA 2BV3A 3HYTA 3PCRB 1GAJA 2D7DA 2O8CB 2WWIA 4B71A 2BBTA 2R6DA 5KYKA 2ZI7A 4WOPA 1I4LD 1OXTA 3KXLA 2YV5A 4Q1CA 3A4MA 3SU8A 4BFTA 3SBDA 3IIMA 4V02A 5KHOC 5HCNA 4DT1A 4CEJA 5CIWA 2VP4A 4GMDA 3CM0A 1RW4A 1I2DA 4NCIA 4BFWA 4DSTA 3IILA 1E6CA 4JT4A 5JHGB 1NY6A 2Q6TA 3W3AA 4Q9JA 4ASUA 4S35A 2W83A 2WWGA 4KU4A 2OXCA 2ZI3A 4ACAA 2YINC 3BRWD 1W5SA 3QXXA 3RDPA 4MYHA 4Y0VA 4JL5A 3QOFA 3ZYCA 4BRUA 1EESA 1O3YA 3J81k 4KXFB 1J8YF 4ZI2A 5EUMA 4HB2A 4XVUA 1F48A 2IK8A 3WNBA 4XTCS 4TN1A 1MO6A 3NKVA 5KO2A 1W0KD 421PA 4D25A 1XCMA 1EFRD 3ZQJA 2ZETA 1NIPA 3I8SA 3KDSE 1T6NA 5UKDA 4PO1A 4YDHB 3TMKA 4Q4AA 4BFSA 5C4MA 2RGGA 3TSZA 3I5XA 2F9MA 2O8DB 4DEYA 3SOPA 2JIZD 3OE7D 4MH0R 1YR6A 4B2IA 4LWZA 2V6JA 1MRSA 2EYQA 2IYXA 3PQCA 3OESA 5JEDA 2N46A 4MUAA 3BWDD 2V1XA 1XP8A 4NPHA 2ZVQX 2RGBA 4QFMA 1G16A 1SVSA 4M21A 2J87A 4LC0A 2KBFA 4BE7B 1T8TA 2PLFA 2UKDA 1AZSC 4M1MA 4ESHA 5K8TA 3I1FA 2A30A 2GAAA 2JASA 3HP1A 4H1UA 1P61B 4Q02A 4A9AA 2IBMA 4IJMA 1KJWA 2KB0A 4MRPA 3Q9LA 4PQYA 3VHLB 1KO8A 1W36B 4UNRA 3FE2A 4LGMA 4AKGA 2LKCA 5E3HA 1Q1QA 3CB4A 1OIVA 2ZEJA 2ZI9A 2HV8A 3AF0A 3QF4A 2VL7A 1P9NA 5GVSA 4LCBA 2ZRHA 3ADBA 3AGQA 1KKLA 2NZ8A 1M8PA 3THYB 1JR6A 3BOSA 2B6HA 1RRPA 4S2EA 5HZKA 3KFVA 3A4LA 3EX7C 4C0HA 1IJEA 1KDOA 1M34E 3ZVMA 1IXRC 3ADKA 1Y63A 3AV0B 5EZ5A 1Z0FA 1GILA 4IVRA 2XGJA 2QAGB 2RGDA 1VMAA 2K5UA 2GESA 1U90A 1NSFA 2VHUA 3CO5A 2EU8A 4J0QA 3AVXA 1Z28A 2ODBA 3HPRA 2FSGA 1UKEA 3RYTC 4YMVA 4XJXA 4C4PA 1F6BA 1CBUA 3U44B 1E9DA 4M1TA 3T5GA 3U6BA 1ZM2A 4N0DA 1TAGA 1GP2A 1YE8A 1MT0A 3F5FA 4DLSA 3H2YA 2YOHA 2R65A 1TQDA 2ZRFA 3R20A 4H9GA 2GK7A 3RSLA 1DAHA 2XXAA 1QHYA 2RKOA 4X8HA 1Z29A 3LQRA 1E9AA 2WSSA 4AI6A 1G4AE 4NKRA 3KKPA 1SVOA 4A6PA 3CH4B 3THWA 5IT5A 3FHOA 2QBYB 3TUIC 1QF9A 3K9HA 1R5BA 3QVVA 3W8NA 1Q1BA 3L0PA 1E9BA 3X1ZA 1Z2AA 4TMTA 5KPDA 5KSZA 3SZRA 2FGKA 1GVNB 2NIPA 2VP2A 3BS4A 3BAFA 4M1YA 4B47A 5JJLA 4Q9HA 4HDQB 2GETA 2ZYUX 1D8TA 4P33A 5A0FA 1LTQA 4V0MA 4CW7A 2J0QA 5SZHB 1SXJC 1OFHA 1E9FA 4OBEA 2GXUA 3BH7A 3X1YA 4P31A 2XJ4A 1U9IA 3AP3A 3DKPA 2ZE8A 1E79D 3B82A 4MRSA 1ZNZA 4W5WA 5DSZA 1UM8A 1K5DA 1QVAA 1E2QA 1ODFA 2V6IA 4PZYA 3WNCA 4DDUA 4O2RA 3UPUA 4JT2A 3TVTA 4BUJA 1E0JA 4QC2A 5AUQA 1AQUA 3G0HA 2BMJA 4CEHA 4HAVA 3AVQA 1JPJA 5DO9A 2I4IA 4RFVA 2QSZA 4C7OB 2RGEA 2ZE5A 2C03A 4CT4B 3K1JA 1NN3A 2CNWA 3H86A 3ZJYA 1L8QA 1F2TA 4D26A 1NIJA 3AVOA 4O3MA 2V8OA 3MWKA 1G19A 2IF2A 2P2LA 3IGFA 4OI2A 2QGNA 4LJ4A 3R7WA 3RS5A 2JJ1D 3X1WA 5BQ5A 2DWOA 2VSOA 3PITA 2BCJQ 2HLDD 4QG7A 3CRW1 3SHWA 5BWMA 2GNOA 1YQTA 2R6CA 2J7PA 2ZS9A 5D3MB 2VRWA 4OI4A 3CF2A 3FMPB 1VCOA 3VHXA 1CJVC 4R71A 1VIYA 4JZKA 2NO1A 4MITA 1CU1A 3NBXX 4MGKR 2F1HA 4YMSA 2IWHA 1AKEA 5J4LA 1D5CA 3KJEA 5FPHA 2VP0A 3IKJA 3H0KA 4C3ZA 2GCOA 4DCNA 1C1YA 2IWRA 1TF5A 1U99A 2J46A 1IJFA 3NG1A 3BFXA 3VTKA 3OIVA 1KI6B 5FOSA 5BYJA 4DUGA 5KUTA 3L0OA 3PVSA 3GLIB 2ZJZA 4ZDJA 3EZFA 3GEEA 3QIAA 3SS8A 3PUZA 4R98A 1JNYA 4UNNA 2GJ9A 3AUXA 4Q1AA 2JLVA 1OFIA 3U60B 2XTMA 4FIDA 3TQCA 1GRQA 1T5IA 5AJVB 3A58B 5CLLA 4OJQA 3W90A 4C2UA 3S1AA 1RRCA 2ZSAA 1PUJA 4FINA 4D0LB 1OHHA 4BLOA 1P9WA 4C0BA 1XTIA 821PA 1KDRA 4IOMA 2JEOA 4P32A 2DY1A 5FBQB 1FNMA 1U9IC 3HU3A 2FU5C 4RZ3A 1OB2A 2F1IA 4ABYA 1DO2A 3DOFA 3ADDA 2RGNA 2WWWA 1MRNA 4M1SA 3TR5A 4B48A 2I1VB 3VKWA 3IEVA 1AJEA 2OM2A 4A0RA 4RKEA 4A0GA 5TY0A 3OF5A 5LB2A 2IEZA 1XMVA 1LB1B 1UBFA 2B7BA 3B9PA 1CRPA 1GDDA 4MKHA 3RS0A 3C14C 1PV4A 1KI2A 1DVRA 5L3QA 3GJ7A 3GLGE 2E87A 3B6EA 3AVVA 4E09A 4TLAA 1G5PA 1GNRA 5LDDC 1KMQA 4HYYA 4KVGA 4GOKA 1J2JA 5H1YA 4Y0AA 3DM5A 3WBKA 2GBLA 3PJRA 2F3RA 5E95A 3LWNA 2CJWA 3ICQB 4TT3D 2QEQA 1JJ7A 1XPOA 3T06B 3HU2A 3SJBA 1IQPA 4DLYA 3GLFE 4I99A 4TTQA 2GJKA 4WBSA 1QHHB 1Z63A 1FMJA 3WHKA 1O87A 3PXGA 1DAKA 3AVPA 3B5JA 4URZR 1WDTA 2WTUA 4C0LA 4IDNA 2FG5A 3B78A 1TNDA 3CRMA 1YU9A 4Q4LA 4DLTA 5EE0A 5C4GB 4KVAA 1MV5A 2HT6A 3I5YA 3KKOA 4QXAA 4RFSA 3H1TA 5DHAA 5JCZA 2HCBA 3FWYA 3UMSA 2ZRDA 2QQEA 4EIWA 2JLUA 1NN0A 4Q01A 3TJZA 4O25A 5FTLA 4FMDF 3RC8A 2ZITA 1A4RA 1QDEA 3NBFA 3C8UA 1XMIA 3IBGA 4FMCF 4FMBB 1XJ0A 3K0SA 1U8ZA 2FFQA 1E2HA 2QL6A 3NWJA 1Q20A 3L0IB 1UAAA 2R62A 4EFLA 4JYBA 1N2CE 4Q1BA 4EUNA 2RGCA 2ZI6A 2GF0A 3F8TA 5AUOB 1IBRA 3QY0A 2JLXA 1M1YE 2FPLA 4E07A 3EWAA 2XEXA 1RKBA 3RRNA 2EFHB 3BIFA 1SHZA 1P75A 4I1UA 1Z6AA 3CF0A 3BBPA 2G9NA 1ZNXA 2OZEA 3RS4A 4N1AA 1YZQA 2ZRNA 5HKKA 2WJVA 3DZ8A 3BH0A 4US2R 1VG1A 4QGFA 1EX6A 3QPWA 5DI3B 1ZBDA 2NOAA 4FMDB 4U00A 3EC1A 4MKIA 2J41A 4LOAA 1BO6A 2A3RA 1G8GA 1X6VA 2V55B 2FSFA 2BBOA 2QN6A 3O8DA 4TQAA 4V0NA 3EASA 4TSFA 1FFHA 2VP9A 5C1BA 1NJGA 1XMSA 2D62A 3AF1A 5EE1A 3LBHA 4JSYA 3EC2A 5BN4A 3GJ8A 3LDAA 3KQKA 5KPJA 2ZR9A 2C99A 1Q3TA 2GKSA 3RWOA 5HPYB 1U98A 2XSZD 2GA8A 2ZRBA 2REXB 3ZVNA 1TUEA 5FBLB 2ZR7A 3SNHA 4OHWA 2FH5B 4IKEA 4DLVA 3VNUA 3TAHA 3FHCB 2EYUA 2ZROA 4IEEA 1DAIA 4KFSA 1B23P 4PC7A 4CRWB 3QBTA 1ONBA 1G3MA 4Q9KA 4AYXA 2CL7X 4OKSA 1CJKC 2G88A 4KCGA 4DSOA 1PZNA 1OF1A 1W0KA 5G3YA 4FWIB 2VHQA 5HTKA 1N5KA 4G5OA 1SXJE 1EFRA 5AWFC 4IXNA 5JSZA 1CP2A 4GOXA 2QTHA 4PHFA 3RS2A 4D81A 2DFLA 4R2HA 2O0KA 3QXHA 4NZYA 2G77B 5FL3A 2JIZA 4PHHA 4QHYA 5LB4A 4DLWA 4GDFA 1MO3A 1P2VA 4I1OA 1IY1A 4IDPA 4RKFA 4ACBA 4F38A 3PEWA 2FPKA 1YZLA 1KO1A 1TEXA 1EWQA 1EXMA 4LC1A 1N5JA 4M9ZA 1TUIA 5EXSA 1OIXA 1K5GA 1TL7C 1E2PA 3F0TA 1JEEA 4M0LA 2IX3A 2A9KA 5KTYA 2IHBA 3THOA 4TYPA 1ZCAA 5B64A 1VCMA 4LYFA 3DVLA 2GCPA 2OFOA 4PO8A 3PEVA 4Q4JB 2D4HA 2QE7D 3AVYA 4LUCA 3LFUA 1N6RA 5AJXA 1UPTA 4BASA 3HR8A 3FDIA 1ZD8A 1YZKA 4OQNA 3GEHA 1VKJA 1AS0A 2OSBA 4LHWA 4CT5A 5BYKA 2WAXA 1VIAA 2ZREA 1NY5A 3ZIAD 1W0JD 4XVRA 3LAWA 4JIMA 3QENA 2BMEA 4LBVA 3UWKA 2J1LA 2HCJB 4HLCA 3WRYC 1FPMA 4NCNA 3KKNA 3N2EA 3PUVA 2IL1A 4MGZR 1Q0UA 2NTYC 4MKFA 4P4SA 1KK0A 3WMEA 2YOFA 3V00A 3T15A 3GLHB 4KJZA 2O8BB 3H4MA 1OH8A 4GFDA 3LH5A 4YMTA 1MR3F 1DTSA 1JQJC 1Q44A 3Q3JB 2ZANA 3HR7A 4LJ5A 1KSGA 5FBRB 2O0HA 5AUNB 2WBLC 2WWYA 2A5GA 5SZIA 4ZIRA 1NN5A 2HJGA 2ZRCA 4B74A 4CEIB 1XZQA 2QM7A 4OI0A 4QGGA 5TDHA 4PHTA 3ZGXA 2C77A 1BMFA 2ONKA 2A78A 1QBKC 1XD8A 4POAA 1FP7A 3RHFA 2OBNA 5L3VA 2D06A 3ZD7A 4E22A 2BEJA 3A8TA 4OI1A 2QMHA 2ZUCA 1D2MA 1T0HB 4B33A 4L4UA 5IRCD 2BKUA 4Q4HA 2VLIA 1TEVA 4TTRA 1KI9A 1F2UB 1RFLA 2VHCA 3K9GA 3UIEA 1W2HA 1Z0KA 1II8A 2V54A 2ZSFA 1ZNYA 4EJSA 4AURA 1YR7A 2ODEA 1TF7A 1KAOA 2ZM5A 2ZYWX 2KJQA 2P5TB 2Q9BA 2UZIR 5FH9A 1S9HA 1FL9A 3DO6A 3P4XA 3KKMA 3TIFA 4QM6A 2WICA 3VMFA 4F93B 1UBGA 2DWPA 2GEVA 3IPXA 1W5TA 3EIQA 1GTVA 4WZBE 2MMCA 1RC8A 3MD0A 5LBIA 2HLDA 4GL2A 1RRFA 2PZGA 1W47A 2Z4RA 1LVGA 2W2TA 4D4KA 2ZXUA 4UKDA 1GSIA 1JI0A 1K8RA 5FPYA 1HY3A 1YKSA 2O8FB 5CB8A 3U3OA 4M53A 4YXWD 1NLFA 3BB1A 4DZZA 3NH9A 2IF0A 3P26A 3DMNA 1N6KA 2DFNA 5EXPA 2J59A 5FTKA 4B3XA 1I4DD 2J0UB 4ARZA 1H65A 4BWYA 4IDQA 1A5TA 4YDSA 3EAQA 2NO7A 2ZJ5A 2PX0A 1FQKA 3NEJA 2BJWA 1Z83A 5P21A 3UMFA 1NRJB 1OW3B 4V03A 1Z6GA 4JMPA 2ZU0C 1T5LA 1D6JA 4PZZA 3L8ZA 3AQ4A 4LJ6A 3WYGA 2GJSA 2C9OA 2P6RA 3K9NA 3BGWA 2YWHA 3RRMA 2PLRA 1KK3A 3V9PA 1QVRA 1G9XA 4DCUA 1S4QA 2OE2A 3GCGA 1ZIOA 3RSOA 1ZM9A 1VDZA 4PC6A 1LW7A 4OQFA 1W46A 4F91B 1E32A 2QPTA 3KQLA 1MKYA 1E0KA 1OKKD 3PG5A 1KI4A 3PIRA 3B7GA 2J9RA 4WVFA 1M7HA 3I73A 4ITRC 3SN6A 1IY2A 1COWA 4KFRA 5FPKA 4LI0A 4BFUA 3KJGA 3BE4A 1BIFA 2EWWA 3GLGB 5EP4A 4BZXA 1RJ9B 4MYCA 5IF9A 1X8LA 2DWQA 2QMUA 2DFKB 4AYWA 1NVXQ 4GSYA 1WP9A 4PSKA 1WCV1 1LFDB 2VYFA 4PSAA 1Z47A 3I3SR 4HB0A 1JEDA 1NP6A 3ECCA 2GVDC 1GKYA 1G6OA 3IIKA 2IA5A 4Q19A 1KIMA 4BLSA 1E0SA 1OXUA 1XEXA 4GI7A 4PO9A 2H8KA 4IVQA 4EPXA 3SHFA 3VX4A 2JJ2A 2KWIA 4MDFA 3FMOB 2QI9C 4ZKEA 5LD2C 1US8A 2WHXA 3A1SA 3K0AA 1VPLA 2CLDX 1C9KA 3CNNA 3GLFB 5DIFA 5KDDA 1R5NA 1J70A 1XXHB 2Q3HA 3HJNA 2C9YA 3BB3A 2KI5A 3Q85A 1PUIA 3DPUA 2F7SA 2ASEA 2ZS7A 2FF7A 5FTNA 4PTLA 3RVBA 3I72A 4DLZA 3GJ4A 4Z1MD 4HDCA 4QNMA 3FOZA 3UG7A 1CR1A 1EGAA 4GMXA 3U3JA 4D0NA 4I4LA 4DJTA 1E2DA 2WIAA 2FWRA 5DI9A 2RB4A 1TQ4A 5FBVB 4ILEA 2CHQA 3I4LA 2XNDD 3B13B 2G1JA 4D4JA 1GNQA 1Z6XA 4R7ZA 3EIHA 5AJWA 3DHWC 2WSMA 4OHZA 2VBCA 2EW1A 1G8YA 5KNDA 3ADCA 2N1BA 1G3UA 4DB4A 1RYHA 1Z06A 5CYOA 1DELA 1X1SA 3QKRA 4Q7LA 4IDHA 4JVMA 5L8VA 1W44A 3VU9B 2MSCB 1M6NA 2IW3A 4X8LA 3QF7A 2J5XA 1V43A 1SULA 4NYIQ 3EPKA 2R6AA 4ZCMA 4RSGA 4HZUA 1KY2A 4UJ5A 4DT1B 4CEJB 1HV8A 1SXJA 3OHMA 4KAXA 3T1VA 4OQLA 3KQNA 3ICEA 2CLCX 4DDWA 1XCGB 2IYQA 1X3SA 5EP1A 3GFTA 5JZVA 2BMDA 4B75A 2FOLA 1L4YA 2GZAA 2RAPA 3A37A 3IUYA 3U4QA 3BFVA 1GWNA 1ZW6A 3B9QA 3U7GA 3KKQA 3R8FA 1MABA 3LX5A 1P6XA 1KSHA 3KXKA 1E2KA 2AWNA 2I1QA 4JLMA 3REGA 3ONWA 4IDOA 1HQYE 1HEIA 2QORA 3A36A 1KNQA 4IFEA 1BOFA 4KBFA 2WKRA 2XSZA 3U7HB 1UFQA 2CE7A 1H8HD 4NU0A 1SKYE 4TL7A 3OZXA 2QMEA 2X2FA 121PA 3NHAA 2QA5A 4Q4AB 2AL7A 3JZMA 4B35A 2Q0HA 2ZRLA 1NMZA 2A5YB 2DB3A 2OESA 1NG1A 3KZ1E 1ANKA 3QEJA 2ZU6A 4Z8XA 1G3RA 3B1XA 3WBJA 4DVGA 3AM1A 4XIGS 4NDZA 3SQXA 2H16A 1NVVR 2PT5A 4EPVA 1LNZA 2Z5FA 2HXYA 3Q72A 1FMLA 5K8LA 3LA6A 1XTRA 3CKLA 4QHSA 5D3QA 2WMOB 2FFAA 2VHTA 2VSFA 2CCJA 2XITA 4IEIA 3IHWA 4M9QA 2BKEA 1D2EA 3QF4B 4JLDA 4OK6A 3A4NA 4D4MA 4TZ6A 4A1FA 2OHFA 1XDBA 2VO1A 2NZJA 1KJYA 5EE3A 2WKPA 3B2EA 3TK1A 1E2NA 3GMTA 1KMHA 4XSHA 1XEFA 5FTJA 2BOVA 1CJMA 1KI8A 3NBYC 5CITA 2R44A 1IN7A 3M0EA 2ZE7A 4MYUA 4BFVA 1TU3A 3C7KA 5C18A 2IS1A 4KV9A 3P32A 1U81A 2F9LA 1J7KA 4PAOA 4YLGA 1AS2A 2ZI5A 4ON9A 4C0AC 4LJ7A 3SJAA 3VQTA 2QENA 1RVDA 1Z08A 2WMNB 1JALA 3K09C 3Q8XB 4HDOB 2B92A 2G0TA 2SHKA 3R8CA 5TARA 1AM4D 2DR3A 2GVZC 2VPPA 5DN6D 3EG5A 3CX6A 4Q1DA 1RPZA 1YRAA 2QNRA 2XXAB 3ZIAA 2NMVA 1Y3AA 1VYTA 3NTUA 1G8HA 3AB3A 3THWB 2AD1A 1GRNA 5FUVA 1YZTA 3REFA 1XPRA 1AK2A 2FEOA 5E7MA 1ZD1A 1FX0A 4RZUA 4QHTA 3FHTA 3CNLA 3E2IA 3M1IA 3CX8A 1DAGA 4JSTA 3FKSD 4RD4A 1BKDR 4DWJA 3LV8A 4V0LA 1ESMA 2P5SA 3T35A 3OFND 5G40A 1FQJA 1HURA 4Q7KA 3G5UA 4LSGA 4AG5A 1JR3D 2GHIA 3Q5DA 3E1SA 2H92A 3SC3A 3WNDA 5EQTA 1AGPA 4TZ0A 3L2OB 2XNSA 2Y8EA 1NBMD 4CEHB 2ATVA 4DLRA 2JLWA 3L43A 3ZQ6A 2PJZA 4JYCA 3IO5A 2MSDB 3IEUA 3L0SA 1XEWX 4WW0A 2QP4A 1F2TB 3MLEA 4TQ9A 5EE9A 5JEEA 3R7WB 1I4TD 1GRRA 5F9HA 1PLLA 3SJCA 2FFBA 1X86B 3TW8B 2ZAOA 3QXJA 1DOAA 2B21A 5FPTA 3RRZA 3OEHD 5FFMA 5JECA 1S3GA 3KB2A 3X1DA 1P7CA 1WA5A 3AVUA 1N6NA 2OCAA 4DC9A 4KFTA 4UNPA 2FE4A 2ZRKA 2QAJA 1VECA 3HU1A 1W48A 3P4YA 4HEJA 4HZIA 1Z0JA 5FI1B 4BEJA 621PA 3SE0A 1GOTA 1UBEA 1KO7A 5JJKA 3CWQA 1UKVY 1EX7A 2NO0A 1E9RA 2WKQA 1EFCA 3C16C 2GCOB 4G5SA 4Z8YA 1IXSB 2ZQ5A 2W6ID 1KSJA 1SKQA 1GITA 2WM9B 4KI0A 4IRUB 1KTVA 2C8VA 4YXWA 4PPGA 2ZYVX 4B44A 2QMOA 1U94A 3GFPA 5FTMA 5DLQC 1G21E 2BWJA 2IS2A 1S0UA 2B8TA 1E0AA 4UNQA 4P3YA 1U0LA 5HE9A 4G5GA 2XB2A 1DE0A 2QP9X 1KSFX 3P20A 2GAOA 2OFXA 1JAIA 3N70A 3S1AB 2FFHA 2HF8A 4G0NA 1IAQA 2AHOA 1UJ2A 3I8XA 3WYAA 4KITB 2V9PA 2QTVB 4OQXA 4DSNA 2BMFA 5CM8B 2VP5A 2XOKD 2ZVPX 3AGPA 2TMKA 4JL6A 3QKSA 3MUFA 4URUR 2GF9A 4NE2A 2JLSA 1B0UA 2QG6A 1EK0A 2VF7A 3W9YA 1GKIA 1FUKA 1KHTA 4KSBA 4FCTA 1N6HA 3IBYA 5TVKA 3UK6A 2YYZA 2HF9A 5L3QB 4Q66C 1AQYA 2Q21A 5BW8A 1KOFA 1XEWY 4HLQB 4GP7A 2C96A 4JKIA 4JLOA 1R8QA 3ZZTA 1HA3A 4L16A 1EG7A 4B73A 2PMKA 4RD0A 1OKKA 3SR0A 5EJEA 1ZM4A 1DS6A 2PZEA 1XWIA 3AKDA 1DEKA 3THXA 4ASUD 1ZD9A 4NONA 4ZKDA 4RCZA 3IDQA 4CGZA 1F3OA 5FL7D 2AWOA 5JS7A 2Q9AA 4Z54A 1W36D 2J0SA 3VNVA 1M2OB 1QG2A 4EQ6A 4UQOA 1CKEA 2A5JA 2P6UA 1E2MA 3SYNA 4ZDKA 5L3SA 2CJWB 3KUDA 3LQQA 1Z2CA 2FSHA 2GXSA 1W4AA 3TNFA 3AF2A 3C41J 4LBZA 3AVTA 3KQHA 4TLBA 4XD7D 2AN9A 2RCNA 2AK2A 3DMDA 3EWSA 1DG3A 3B60A 3MRSA 4LK2A 1ZVQA 2Q9CA 4Q18A 3K0CC 5DGXA 1IN6A 2LWIA 1XBTA 3TKLA 2VHJA 5A5GA 2XB4A 2MSEB 1XTSA 3D8BA 3LLUA 3KTAA 4FMCB 1XD2A 2PH1A 4WXPA 4B34A 4JLVA 3NHBA 3K70B 4OJKA 2JAQA 4RFSB 4MGIR 3LVQE 3DZDA 2C9CA 3M4YA 5E7JA 2NO9A 1CS4C 2JLYA 4F4CA 1M7BA 2FMXA 5DNYB 2JA1A 4US1R 1JQLB 3QEOA 3QVUA 1MH1A 4LHYA 5CDFE 3NC0C 4LBWA 4W5HA 3B85A 1G1MA 4JL8A 2CEAA 1DAMA 2FN4A 4AC9A 4JKYA 2OO7A 3AKEA 1OXSC 4TYNA 2ZYTX 1OFTA 4ZCIA 5FBWB 1U8AA 3K0EA 3EPJA 721PA 4URWR 4C2TA 1N6OA 3PENA 4IW3B 2OV2A 4G01B 2XNDA 4AD8A 2Q3MA 1R6BX 3RABA 2NPIA 3VR6A 2VF8A 3MWYW 4BFZA 5J40A 1E98A 1T3HA 4PQFA 2OBLA 4WZ6A 2ZIAA 3K8YA 2CDNA 1IN4A 1KGDA 1RRGA 3TE6A 3W6OA 1XD9A 2IHYA 4NYJQ 1UF9A 3TAUA 4BFYA 2A5DA 2ZJOA 2Q3FA 1NSTA 1G7RA 3CW2A 3OE7A 4F7WA 2PX3A 3AKCA 1CR0A 1G5TA 1NMXA 3EZ9A 3CH5A 2HJVA 3CPJB 2F43A 4YMUA 3QNUA 2XTNA 3IQWA 3CRVA 1RIFA 8OHMA 3DDCA 3GJ5A 2QGZA 4Q7MB 3SQWA 4D0GA 3U3KA 4AKIA 3FKQA 2YNMA 2EVWX 1CTQA 1JBKA 4M8NE 221PA 3EW9A 3WP1B 1TQ2A 3V4FA 4C0KA 2ZE6A 1JXOA 5HE8A 1F5NA 2IS4A 2IXEA 3EZ7A 3EXAA 3CR7A 3MJRA 2A5FA 4DKXA 4EKDA 1SVLA 4RD3A 2CHVA 1W2GA 2VSXA 4LYAA 1EWRA 1Z0DA 3U3MA 1SVMA 2O5VA 3L82B 5CK5A 3UXMA 2PCLA 2PBRA 4TL8A 1GIAA 4QL3A 3W6NA 3GJ0A 2C2HA 4A2WA 2ANCA 4W5JA 2YC4C 2HUPA 4BLQA 5DYIA 1H8HA 2GCNA 1F60A 3P1JA 2RH5A 1JXMA 4LPSA 4NCHA 1XTQA 2O8EA 1WMSA 2PT7A 4LY6A 2CE2X 4Q9IA 4PC1A 1NLYA 2C78A 2WV9A 1Z3IX 2J45A 3QJYA 1C4OA 1QHGA 3EA5A 1ZJ6A 1G7CA 3CONA 5KDOA 3UWOA 2ZJ8A 1S8FA 2QY9A 3BFKA 1L2TA 1P73A 1A82A 2QRZA 2CNWD 2R9VA 1N0UA 3MGCA 2WWFA 1BH2A 1OYWA 2IYVA 3T1QA 2OLJA 3BH6A 1Q1ZA 1UDXA 2IT1A 1LS6A 2FNAA 1UADA 5G53C 2CCGA 2GEUA 3CLVA 4MYTA 2KBEA 1KI1A 3T5DA 2QPOA 2NGRA 4N0EA 1DG1G 1TADA 1YZUA 2CK3D 5HCIA 1G5RA 4JVSB 2JCSA 1Q22A 4CVNA 2GTPA 5SZJA 4NCKA 1FTSA 2ZTSA 1KO5A 4HAXA 1UEIA 1JJVA 5EUQB 3SEAA 3BK7A 4Q03A 3R9XA 1S9DA 2GZDA 4LYHA 2ERYA 3LW7A 3MFYA 1XNJA 5GJCA 1Q3HA 3FYHA 2DFTA 1HTWA 5J4KA 3PEUA 3AH8A 1E79A 2W0SA 4E03A 3ETLA 2FSIA 4DUGD 2BHRA 3RWMB 4FW9A 3PUWA 4RY2A 5JLJA 1ZP6A 3HPQA 2OCPA 2ORVA 2ZJBA 4P4SB 4Q5IA 4JJZA 1JB1A 3CR8A 4NMMA 4TLDA 1E1QD 2D74A 5DN6A 4D82A 4CZ2A 2HT1A 3CIOA 4UNSA 1G18A 3D7MA 3KFXA 3IQXA 5EP3A 3QPVA 4NL4H 5FOUA 4ZIRB 2JJ1A 4GP6A 3CZQA 3RRYA 2AXNA 3IPYA 1LF0A 2W00A 3BXZA 3IIJA 3NH6A 2AFHE 2WAYA 4PANA 1DAEA 4MGYR 5EXTA 3RAPR 3X1XA 2QZ4A 4B3CA 3FVQA 3NBZC 4HAWA 4D80A 4A8JA 4PR0A 2CVHA 1UKYA 4HB3A 4YONB 4JLAA 4Q4HB 3UKDA 3EZ6A 3PUXA 1ZU5A 2OEPA 2W6JD 1XJQA 3I62A 5FPSA 1II8B 4O2LA 2VH5R 3UANA 1JR3A 2QP3A 4EJSB 4B2PA 4L5BA 3H84A 1U2RA 1Z5ZA 5KSOA 2AKYA 2YHSA 3TUJC 1E4VA 5J5CA 1E2LA 1AZTA 1OXVA 3E70C 4FI3C 4B76A 4N3NA 4BEBA 1WRBA 1R7RA 4HUQA 4ZCLA 3JVUA 5J4HA 3QBVA 3LLMA 4TQUS 1RE0A 2AXPA 1SGWA 5HZHA 4QBFA 5JRJA 4PXAA 4MA4A 2GEDA 2Z0MA 4XWAA 3DKVA 1H8ED 2JDID 3WP0A 1VCIA 4HLDA 2J7KA 4P4TA 3KJIA 4MRRA 1RZ3A 4JLPA 2AR7A 1VYUA 1X8JA 2YC2C 2ZRAA 1VG9B 4F4JA 5ELXA 3Q5EA 5LD2B 4A0HA 4JLBA 5FOWA 1EFHA 1E2IA 1E9EA 1ZUNB 2G83A 4ARZB 4BZQA 5JI2E 3V4RA 1Q21A 3K53A 4DEXA 3U5ZB 2GXAA 4DCTA 4F4IA 2O8CA 3QSYA 1L4UA 1VYVA 3K70D 4WAUA 2XZLA 1PLKA 2W6IA 1HE8B 3MWLA 1G64A 1PVOA 2VP6A 5DISB 3EIEA 4LX0A 2XZPA 1JPNA 2ODNA 2VIIA 2EQBA 3VR5A 1FZQA 5CB6A 1R10A 1W7AA 4TMZA 4DDVA 3ZS9A 1P2SA 4EDHA
chains in the Genus database with same CATH superfamily
1NXQA 4OY3A 5JVDA 3RU3A 4OHOA 2GWHA 4FYKA 4ENWA 4A8JC 3AX6A 3MCAA 4CL3A 2WVAA 2CXOA 5KAMA 3KZCA 1ZSNA 3WRVA 4B6FA 1N0HA 4MQBA 4CMIA 2GFHA 1Y8QA 1XZGA 1KY3A 1OE0A 1IC6A 1UKCA 2Q27A 2DC1A 3D4BA 1GPYA 1DRJA 1GRCA 2L2QA 3NDJA 4TL9A 5T8KC 2YQ5A 5YASA 2XMSA 3JU3A 3ZOZA 2RG7A 5CLQA 5FQOA 4FR5A 1V8OA 5HKKD 3ZS8A 1R64A 3FPAA 2WAAA 1ZMXA 4WZAE 1XEAA 5ALFA 2WF8A 1JIIA 3G1TA 3B2QA 1T2DA 2GJAA 1KI7A 4PSDA 4IG9A 4AK9A 4EHIA 2O8DA 4KPUA 2FWBA 4EG6A 3DV2A 2QN1A 5EP2A 5JPDA 3U1BA 1XQ6A 1QOQB 2D1RA 2XGSA 3NEYA 1HDZA 2GD0A 5GOTA 4B8WA 3C5CA 4QECA 5C51B 4W1RA 3JWHA 4E30A 2R3SA 4KBYA 1RS0A 2NUTB 4J1TA 3QUBA 4JJIA 4PAMA 1JBQA 5AM4A 4WCFA 4ZRNA 5AW9A 2ZBGA 3GRRA 5IK2D 3IX7A 3FFBA 1WKCA 2V74B 4BNTA 2ZJ6A 2JATA 3PJEA 3LIIA 3HSYA 2LV8A 1EA7A 3HA5A 4RZHA 5SY6A 4CM8A 5BR7A 2LDBA 3NGXA 3U09A 2HFKA 4DLXA 3C3DA 3E9QA 3ORRA 1V95A 4FHZA 4LZOA 5EI5A 3I52A 4H59A 4BKUA 4YJDA 2F4VB 1V3UA 1KZ7B 2B6NA 2IYOA 4M0CA 1C7JA 1ZKDA 1E6KA 3NM6B 1VHWA 1Y1LA 3N6VA 4G56A 2Q7XA 4MS3B 4OK3A 1ZOPA 2VPTA 2WHYA 3ELUA 3CCBA 4FHGA 3QNMA 4DLUA 2GO7A 3E5HA 1ZR4A 3D8UA 3O47A 3ZZ0A 2YWFA 3QXSA 5CEEA 1VPWA 1XELA 2PL9A 1FTYA 2Z1DA 3DDHA 3KQPA 4OMDA 2F8TA 1USGA 1X1DA 5DASA 2O19A 3C3PA 3H5NA 2H5LA 4EJMA 4MQ6A 3GPLA 2IVZA 2YJTD 4X6UA 3R7BA 1Z5NA 2QAGA 3I61A 4OJNA 4RAOA 4RF4A 3GEDA 4AYTA 3FJYA 2FKNA 3DEFA 2WM8A 1E1RD 3HKBA 3I6ZA 3AYZB 1E69A 3D0RA 4BB6A 4KXXA 1FY2A 2ZVDA 4CLDA 3C5EA 3U44A 5DT2A 4RLHA 5ICSA 4M1WA 3O8LA 2H06A 4K7JA 1ILWA 3L8YA 3M6MD 2BCGY 2BC9A 4N8SA 5LM3A 2P6MA 1UMBB 2B3DA 4G37A 3ZXYA 5JSHA 3ERCA 1E2GA 3UBMA 1E2BA 3MG9A 4AWXA 2NACA 4IINA 1HQCA 4F2GA 2AJLI 3G2PA 1IYZA 3MMPA 4AN4A 3DH0A 4PLTA 3VU1A 1BVYF 3EMDA 2XAAA 3G8DA 3NHYA 5E7QA 4F46A 1CFJA 4CR7A 4NE9A 1BS1A 3O9ZA 3QG5A 4Q47A 2PSHA 2VT7A 3BILA 4PLZA 5JAQA 4BMCA 1PAUA 2W6PA 4AMUA 3GBPA 4LJKA 3BHMA 2AKAB 5CVEA 3QLJA 5F21A 4B7ZA 4N0PA 4JD5A 4PSCA 3E7FA 3LP8A 4N65A 5FHQA 4C4TA 2C5AA 3BTVA 3N2IA 4P7BA 3IDZA 3U6KA 3H2JA 4F21A 4KR2A 5I9NA 1RLIA 4GPD1 4CL0A 1GL7A 1RWOA 4RHYA 1Z0AA 4Z4HA 4NICA 4CM7A 4V1CB 1RWBA 5SZKB 1Z5GA 3AVWA 1OLXA 4J1TC 2VXOA 4QUBA 3U4QB 3FRIA 3CMCO 3Q9SA 1JQAA 4WCFC 1VLJA 1WXFA 2Q07A 1SCQA 4EYGA 4YCBA 3NT4A 1E2EA 1DARA 3VR4D 2HR1A 4QG3A 3NAQA 3GXOA 4PHGA 2R1UA 2FQXA 2VZEA 3JPWA 3QLVA 5JE8A 3WL6A 4B43A 1LF5A 2YWDA 4V3CA 4XGIA 3TLZA 3TNYA 1M1ZA 3DUFA 1XNHA 3U4HA 3TL2A 1TMYA 2Z9BA 4BB9A 5JHHB 1QHNA 5AI8A 1CLEA 1CZKA 3VKGA 4LQCA 3RHZA 4AKEA 1M6EX 3S2FA 1E2JA 2M6LA 1P4AA 1LNSA 4CYMA 2IY8A 3IH5A 3OOHA 3LCRA 1BDHA 2FYTA 2HCRA 4DV1B 4R7GA 1VQ1A 1YJ5A 5AH0A 5ICFA 4D5EA 2JJYA 4C7VA 1GNPA 2Z09A 3K1AB 2AX3A 1I0IA 3I30X 5ALSA 5D7NA 2QAGC 2YIDA 4HAOA 4IMPA 4CM9A 5KMGB 1QFSA 521PA 3E5NA 3PI6A 4CF3A 5DXFA 1LCIA 1A2KC 4GBGA 1G3QA 3THSA 1N2HA 2WTXA 1NMQA 2C7GA 1WQ3A 3OLXA 4EPWA 2OHJA 2CVQA 2QQ0A 4YLEA 2JZNA 1RKXA 1EGQA 1PT6A 5HK9A 3HA2A 1JIVA 3M9XA 1N3BA 5HR5A 4UEJA 2Y9PB 3T1OA 3WLLA 5K8UA 2H2IA 4REOA 1KI6A 1L7NA 1ZRNA 2D1QA 2MINB 2CMKA 4FONA 3AU9A 4G8DA 5H4HA 1F12A 4GMHA 5FWYA 1ZAKA 4U7DA 1KI3A 3ZLBA 4COKA 1QAOA 2WJHA 3OLVA 3HHPA 3NYRA 3V55A 4CWAA 3T1TA 3MGAA 3ZWNA 3RIXA 4N8DA 3O84A 3ZD6A 2L17A 2KW5A 2ODAA 4L9SA 1WBDA 4HMQA 3T4UA 2H1LA 3HDTA 2HUNA 5BURA 2ZUFA 1V6AA 2GZMA 4XARA 1Q77A 2Y77A 2HSZA 4C04A 1PR5A 3JSAA 4FUQA 3QUQA 4LJ8A 4RWEA 5K7SA 2ISCA 4TKUA 2CK3A 1VL8A 4REQA 4A15A 4LDJA 5AQ1A 3OQOA 1G2IA 1F1BA 3LUKA 5JMTA 1IM2A 1MC8A 1WF3A 3KQUA 4D3ZA 4BATA 2ERXA 4W6ZA 4FFWA 3CR3C 4H6VA 4L22A 4NV3A 4AO8A 2BRUA 2QW1A 2SECE 3LZCA 1E4YA 1Y5LA 4J75A 3ZE1B 4QBKA 2XCTB 5KNBA 3H3JA 3IOMA 1NLUA 3K2IA 4UNIA 1E7MA 3ORSA 1ZIXA 1V7ZA 4LE1A 4WASA 4LPKA 3VAAA 1N0VC 4EGFA 1WB9A 4BTVA 4DXDA 4RKRA 4LYJA 3FMGA 5DH9A 3OCVA 2P2YA 2WOJA 5IAEA 3ZBPA 1AHNA 4GT1A 4B6PA 2HWUA 3NBKA 4U2GA 1USKA 4A36A 3KJHA 3ZDCA 1G63A 3QWIA 5BSWA 4TMWA 5JXGA 4B3MB 1O6ZA 4L27A 1GADO 4EFMA 4XWWA 1D2AA 5BSGA 1IJBA 2CV0A 2OAP1 4N5IX 5JRDS 5IZ4A 1NI5A 5EJ9A 4YJHA 5HGJA 4N4AA 2CB0A 2FA9A 2QLLA 1QQBA 2DWUA 1CK4A 3LXXA 4IQ4A 1U2SA 3P9KA 2C57A 3A4YA 1EFTA 1AGRA 3OZRA 1VCHA 4XWTA 3PYLA 1ZGAA 1KH3A 5IDVA 2WJYA 5LBUA 3NYWA 2G67A 1OV4A 4FWTA 1ZN2A 1ZRMA 2YV2A 1NASA 2B5WA 4ND6A 3WL8A 2J3IA 4DV3B 1O94C 2GO1A 2ZUUA 4DUPA 2QW0X 2ZAGA 1ZJ5A 3K0CA 4HAZA 5FIUA 4F12A 1F7UA 1VPDA 4V0KA 1JR3E 1R4AA 4J29A 4PRKA 2BSQA 4WY8A 5HQ3A 2I65A 3TGLA 1YC5A 2WKWA 1AKQA 3PDJA 3TXXA 2I5PO 3LS2A 4I1RA 2X58A 1JQKA 1E7YA 1PL0A 1FNSA 1B0ZA 2IZ7A 3PRYA 2ZSBA 3CKKA 3L0CA 1OX5A 3WGYA 3NX4A 4KDEA 1NXVA 4B83A 3EA4A 4PQEA 5KJEA 2V59A 5GTDA 2PBFA 2Y4OA 4IJQA 1A98A 5ECYA 1NVMB 1NVEA 2LXNA 2IYUA 3P0FA 1XOIA 4NMWA 1BN7A 3OCXA 2ZUTA 3QH4A 2YIJA 4FFDA 2PRKA 4L9WA 2I0FA 4BE9A 3NNDA 4GMGA 1C7QA 1HEUA 4AY3A 4B45A 4O08A 5TVGA 3D8SA 1VDMA 3EGCA 4P9NA 3A7DA 3LY9A 3ZU2A 1FYDA 3T4PA 3R5HA 4Z49A 1N6PA 3WSWA 3V34A 3ZU6A 2LP4Y 3MIIA 2BRUC 1SVKA 3NFYA 3OIWA 1EFAA 1L6RA 1QQTA 4YUYA 3EEBA 3F5QA 1QYCA 4MVWA 1B4DA 3LO8A 4TMYA 1XPUA 3BCSA 3B89A 5BUCA 1RI2A 4FYWA 5LQRA 3HH8A 4IFBA 1ORDA 3QX8A 1U04A 1HT0A 1Q7GA 3ZDEA 4RNCA 1IH8A 3ZH9B 1W19A 1DX9A 5HM6A 1U65A 2QRNA 1FPQA 2NXEA 3LF2A 5DI3A 1X0XA 5DSXA 3ZKWB 5K6TA 4L8GA 3FDJA 3U61B 4FFPA 2X1LA 2YZMA 3F2VA 4A0SA 1ZU4A 3G88A 1Z17A 5IANA 1EQUA 1BXZA 1C0PA 1SVWA 2OSVA 1YB2A 2R1TA 4I1VA 5COQA 1RD4A 4DA6A 1I2BA 2XB8A 2ZYSA 3L1KA 1OH7A 4BYMA 1XJCA 1I10A 3W5DA 2YZNA 3UXYA 1GM5A 3N1UA 4K81B 3BXFA 3BD9A 1ZWLA 1OPXA 2W71A 3GB9A 4K1LA 4MRVA 5DBOA 4ENRA 5CDGA 1E5QA 4ZQFA 2E7ZA 2G17A 1OZGA 2HPVA 4H7HA 5AHWA 1U9CA 3PSHA 3K30A 3FOZA 3Q3EA 1D9ZA 1HDIA 3GGSA 4RD6A 4WDQA 5AKJA 3SQMA 3WGZA 2ACVA 3G9XA 4MWTA 3CRZA 3QKTA 3NIBA 3GHYA 5JBQA 1PT9A 5H02A 2X4GA 2X0JA 1DGQA 5T4BA 1L7VC 4C7KA 2AYXA 1SXJD 3ZJVA 2EHJA 1HYQA 1NRXA 3HO8A 2PMWB 4Z1MA 3S7ZA 2H8GA 2DBVO 3KELA 2FP3A 5FP0A 3VGPA 3BGSA 2F3PA 3WQRA 4F4DA 2VPQA 5B55A 2ZRGA 2I03A 1DNPA 1OREA 3NWBA 1JA0A 4LXTA 5GP1A 3VR3A 3EIFA 2NZYA 1P18A 1Y3FE 2G7ZA 4MUKA 3ZK8A 3G2NA 4KTTE 4PX2A 8MHTA 1VG0B 5L3SB 3ND9A 4IZOA 5GJBA 3AUTA 3QK7A 5SY4A 2IZ0A 3AL0C 1VJ0A 2YYYA 3COYA 3EQ6A 2XTZA 2YWEA 3ICWA 4AZTA 4Z51A 3MQ2A 5JH7B 1A9QA 2R6FA 4KN6A 4MJ7A 3RNLA 4IOKA 4JUBA 3PS9A 4LRQA 1KXZA 2HBZA 2R87A 5D8DA 1ZGZA 5DLEA 5JAHA 1A8QA 2PWPA 1QUEA 2ZJYA 3ZIUA 2WDZA 3LXRA 3TLXA 4ND2A 2LCFA 3AR2A 4PAGA 2CLHB 4Q24A 5EWJA 3UO8B 3UKJA 4RCVA 2ODWA 1UFRA 3BJEA 4RK7A 2P4EA 4IDEA 1EBUA 1JHZA 1DPFA 3I8OA 4PYMA 3V1YA 4LZJA 1K7CA 1VJGA 3PFWO 4MZXA 1XD2B 3OC6A 5CK4A 4DMGA 1AXEA 2D5IA 4ETNA 1K86A 2CEKA 2SKEA 2E4AA 2XA2A 4NBSA 4X6LA 1OT3A 4P3KA 5FI5A 2SNIE 5ALNA 2V0CA 3DTVD 3QEAZ 1WBBA 3OOWA 2G76A 1HK7A 1YRQA 2IZZA 1IBSA 2JAUA 2OP0A 3JALB 3T4EA 2CNOA 4X85A 3STWA 4HH0A 3TS1A 3OQVA 3ZV4A 1TKAA 3K5IA 5JNSA 1QRAA 1ZC4A 5K0EA 4GYKA 2R4UA 4I36A 2A7QA 2JJ8A 4HEA1 4XQ0A 4I4TF 3DBRA 2GZHA 3HCFA 3VPBA 2O6LA 3SCZA 2NLOA 3LQ2A 2JB9A 1D07A 4FDMA 1K0UA 4EVRA 3NRJA 3EA0A 1CNEA 4ND5A 4BVJA 1M2VB 2ZP1A 1T8PA 2ZIGA 4M1OA 4BECA 5IAOA 3QX9A 1YL6A 2QPLA 1BMQA 1QYXA 5JWRA 5H8WA 1PEAA 1EUZA 2PRYA 3RVQA 2BSAA 2D00A 4QXQA 1D6SA 1ZRHA 2P5UA 3KZOA 3OJWA 5BVGB 3Q98A 3W6PA 4RHTA 3F49S 3FVTA 2JCBA 2CXTA 5FBZA 1WDKA 2ATCA 3HCAA 1GL6A 1X2BA 3I6IA 1Y80A 2AJCA 3M4ZA 4JBYA 5DNEA 4ZT7A 5LA6F 3W04A 2J07A 4XVQA 1N2EA 2GPWA 5TF0A 1G7TA 1Z0IA 3G7NA 4DLNA 4YO7A 2HKIA 3AR9A 4O0MA 4A3SA 3DBVO 2HHAA 4Y30A 3VKHA 1O95A 4GM4A 3S2SA 1U3DA 3I1YA 1KZGB 4BZQA 4BMPB 2HDNB 3GRFA 4P0PB 2RHJA 2OHOA 4I1SA 3NI2A 2BJHA 2XUDA 3F46A 1RRVA 3ITDA 5H70A 4AMZA 1UP4A 4B5KA 1B6SA 4DAOA 3CF4A 4TYYA 1Q57A 2X1HA 2E21A 1N2OA 5B7NA 1KQ3A 1UBLS 3FAZA 1V8FA 2P9BA 2C61A 2J7PD 3R0JA 4R7TA 2OHHA 4QBGB 3T5CA 1YNOA 3DOUA 1BWRA 1U1FA 1RJFA 4TL6A 2BP7B 2IIBA 1RAFA 4M54A 4L8YA 1KE1A 1SUWA 2H29A 4A92A 1XYGA 5JS8A 4M49A 2LKDA 3HDYA 2PU5A 4QX6A 3PXAA 3I2GA 3W2HA 4ZO9A 2ZS8A 4DCVA 2QZZA 4Q1FA 3GMIA 2X0IA 1QX4A 1PR3A 1R9NA 2PNFA 4IPTA 3BERA 3VGJA 2NUPB 3GELA 4R9VA 4EKNB 3ROEA 2PLAA 1WULS 2HMTA 2TRSB 2QUJA 3AFHA 3GFRA 1A9SA 2UV8A 3HLTA 4H17A 1NKSA 2QZPA 3CZPA 3H3XA 4R8RA 1T9HA 4G1EB 1EQAA 5IVDA 2V3CC 2BJVA 4QNRA 2Y0EA 4NQZA 1HDOA 1ZDMA 2VPWA 3H9JA 2JLAA 3C8ZA 2A9OA 3VH2A 6ABPA 2XIJA 2OUKA 2RGAA 4PYIA 1ZGCA 1OAKA 2C95A 1C3JA 3JRWA 3NHUA 3QVLA 1QP8A 3GLIE 3FF1A 5BRJA 4RC9A 4ZAGA 3UK1A 4AZSA 1FRVA 2XAUA 1BXGA 1ADJA 2DQKA 2ZYAA 2NXJA 2R00A 4LYGA 2Q7OE 3TSAA 4C88A 1T5HX 4RENA 2FTKE 4K9NA 3ENNA 4CF6A 1GCUA 2GEFA 1JEYA 3RVRA 2PZKA 1TB4A 3KR1A 4GRAA 3ZHOA 5BUSA 1HR0B 5EIHA 1WL8A 2OA0A 3GA7A 1I80A 2PPLA 2ZTMA 3L8GA 4IL5A 1FTNA 1CZUA 4UCWA 1UDAA 1M1UA 1CG6A 1Z7YA 2TMGA 4B81A 1K63A 4HNRA 4S1TA 4CM4B 1V5GA 2QW8A 3HYCA 3P9PA 4MVJA 4BTLA 3PHLA 3Q10A 3PPWA 3R0IA 5BO5A 3A9CA 3SBEA 3BCUA 2FHSA 4M22A 4CIDA 2YVUA 3FKSA 1B41A 2SKDA 1GTL1 3BWYA 4AKSA 1XL0A 3PFIA 4WL0A 2X77A 3FFXA 4YAWA 2PRSA 4N5DA 3UOAB 2DCUA 1BA2A 3SXJA 2HMSA 4YHBA 3TZCA 5A3JA 1ZXXA 4B9EA 2V4ZA 2ZWOA 1C41A 5F52A 3UUWA 3W5JA 2QUAA 3ZZUA 4C3OB 4EUSA 1CRZA 3SYLA 4Y2XA 1N2BA 1PD0A 3KE9A 1UMDA 4UVIA 3T61A 2D0OB 4DM7A 1EQ2A 5LPNA 3ER8A 3MCWA 2WF5A 4GRIA 2YJ4A 2H2HA 2JF0A 1IY9A 1G3IA 3I6QA 4TTPA 3BZBA 2IDKA 2JGKA 3IMEA 3PC4A 3T34A 3TW4A 1IWPB 1WW8A 2NXNA 4CTNA 4MB0A 2G0NA 2YQZA 1DUSA 4LDNA 4ENUA 3GLGA 3TZBA 1WJGA 4JY7A 4W5TA 1SXPA 1A2BA 2I55A 2D3WA 3I53A 3L79A 4FHEA 2JFYA 4XWYA 5B58C 2C82A 4DNQA 4LOJA 3HZRA 1I2CA 5CFZA 4HOYA 4HAIA 1I4OA 4GPBA 1K8YB 1IEQA 3CRRA 4P0TA 3LGXA 1BHQ1 1R0YA 5K0LA 1KVTA 4BCCA 3R75A 2IPXA 1G8FA 3RBXA 3ESDA 2VOEA 4RCYA 3YASA 1OB5A 3FCXA 1QHSA 4BZPA 1WE2A 3F6CA 4A8JB 5BXYA 1UOPA 2QQFA 2OHVA 2V7BA 1BEEA 3OKAA 1P62B 1YRHA 2QY6A 3AF4A 5KYVA 3FJOA 1R3UA 4KRGA 3GLFA 2E37A 3U4AA 3T5PA 1V4BA 2R00C 1XTJA 4KPEC 3PFCA 3RYFA 2QR5A 1HLPA 3CY6A 4PQRA 4DPMA 1NYRA 4R9UC 4JMLA 4GI5A 1KEWA 1PWZA 1R12A 1FSFA 4RD2A 4US0R 1SHKA 2FQ1A 4X8MA 3RBZA 2J6CA 3FF4A 1IONA 3WB2A 5DCWA 4EW2A 3WC4A 7AT1A 5JCPA 2XNHA 3I2HA 1G55A 3LUAA 2WHPB 4DSUA 5E0KB 3WG9A 3HB9A 2JFOA 1GG9A 2IHKA 1CUVA 3KCNA 3RYTC 2DBYA 4DHEA 1NUPA 1T3LA 2VJMA 1J7JA 3LSTA 3PQ4A 4YWJA 4R6XA 4W9RA 9MHTA 4IS3A 3OE5A 1IAVA 2Q50A 2H0QA 2IDJA 3DVRX 4WNIA 5KHLB 4MDEA 2XYPA 3PHIA 4DBLE 1DEXA 3FB4A 2ZBVA 4KBGA 4UAUA 4Y2UA 3CT6A 4LV5B 3C3JA 1JTVA 4QUDA 4XM2A 5C53B 1HWYA 3L7MA 4A10A 3ODGA 1IZ9A 1JILA 5JSUA 2ZUDA 3UJ9A 2X0KA 1AIPA 3WGOA 4EQZA 3LC1O 1A71A 2TSYB 3SICE 2VNSA 3TRFA 4P38A 1HT3A 1SU8A 3KOOA 1XFDA 3GAMA 1KQFA 3B1VA 4PS0A 4OQMA 1ZN7A 4NMHA 3UWDA 5DN9A 1PCXA 5BMOA 2PMDA 1GPJA 2O52A 3MCUA 2V97A 5DLYA 2BV3A 3DOCA 2XCRB 4FLFA 5JQGA 2P1DA 2EJCA 4RXUA 5ECDA 1SPBS 2O2SA 5BSUA 2JHPA 2IOFK 3VVLA 5KYKA 2O7QA 4BMNA 5CBPA 4BFTA 2RIRA 4DYVA 2I7CA 4GLBA 5HCNA 1N3IA 3GJSA 4CEJA 1WU8A 1VE1A 5IM4A 3LCVB 4GMDA 4NCIA 3IVRA 4CM6A 3MUNA 5LQKA 4DCJA 4LTNA 1VA5A 3TPZA 5JHGB 2QVLA 3ILSA 4ASUA 4Q1VA 2P0YA 2ONYA 3GLRA 2WA1A 1GQRA 4M0UA 4ACAA 4C78A 2VATA 2YINC 4D44A 1WVGA 1ZJZA 3BRWD 1UC8A 3FPEA 3PHHA 2BEUA 3K16A 4ZODA 5JVDB 4IH9A 3GUZA 3FOEC 1QH8A 2G1AA 2NNLD 3C70A 3PQ8A 5D1NA 3WKBA 3U17A 3H9CA 4NSNA 4DL9A 5H4GA 4CMIB 1UBOS 1Y8QB 3LQYA 1UBUS 1D4OA 4P7GA 5IU6A 2CWDA 2V7XA 3DP9A 3NTQA 4XTCS 5CPFA 2LNDA 5EWMA 3QFHA 1N5OX 3V3KA 421PA 4ZZIA 5IABA 3L6RA 4EW6A 1RMTA 2A35A 3ZHRA 3BWMA 1DC3A 3KEFA 1PUXA 1YK0A 5ITZA 2ZETA 3FPCA 3KDSE 1ZL2A 4CE6A 2OGUA 3KT6A 3TMKA 3G9QA 5C4MA 1D6NA 3I5XA 4XGQA 4NCAA 2GPJA 2O8DB 4KXYA 3SOPA 1DI0A 2JIZD 3OE7D 1YR6A 4KPUB 5AVVA 1FTQA 1YJXA 2GTHA 3LUPA 3OESA 2N46A 1BDMA 2SCUA 2P78A 2XT6A 4B09A 1JSZA 4ZO8A 5IARA 4J7XA 1X38A 2ZVQX 4LTDA 3UWMA 3WIOA 4PIVA 2GYWA 4I46A 1SVSA 4ZANA 4BAZA 4Y6LA 1UPUA 3H8SA 1LDGA 2KBFA 3VXKA 4IVNA 4BE7B 1I7LA 2UKDA 1I1HA 1AQIA 3PTZA 5K8TA 3I1FA 1ILEA 1P1IA 3QEMA 4WCFB 2JASA 2A5LA 2W6MA 2H2WA 1GG8A 1XA0A 3N76A 2IBMA 4Q82A 4A9AA 1QKKA 2Q3JA 4CM8B 1I4EB 4UNRA 1L5GB 3FE2A 3WGJA 3IJ5A 5I7AA 3VDXA 4AKGA 1BU8A 1OIVA 2O48X 2HTFA 4BGVA 1XU7A 1ESDA 4KXNA 5EVCA 3QF4A 1E1CA 1WEHA 3O3MB 1O7JA 2P40A 1JZTA 1YRYE 4OHRA 4K3VA 3LDUA 3ADBA 4RYLA 2WA2A 5K8VA 3AGQA 1DMRA 3ST7A 5J43A 3THYB 3G2IA 3BOSA 2B6HA 3OP1A 1C0KA 3EMKA 1OAAA 4I2VA 3M6LA 4H7EA 3MPUA 4C0HA 1EE1A 4UC0A 2CXNA 3VO8A 3LQ4A 3ADKA 3GFQA 1Y63A 3OLZA 3IAM1 3CUWA 2JAWA 4LY9A 4Q9DA 4R69A 2XGJA 3F6PA 2QAGB 4HP8A 3B48A 3CO5A 1JDBC 1SB9A 2F59A 2EP8A 5TT0A 5I51A 3M81A 4BS9A 1L1RA 4GDMA 3HKBB 1WMAA 5C1DA 3ZGLA 3QVXA 5KIAA 1GTRA 3FD8A 2HC9A 3L8EA 2G08A 1YQEA 3EGOA 4FOLA 3T5GA 4YAEA 3U44B 2ZTVA 3OFSA 1GPNA 1TAGA 1GP2A 1WCIA 3KP1A 4MEJA 4N0DA 4DLSA 1MO2A 3H2YA 3S2GA 2R65A 5HIKA 2DSTA 2WKSA 3C97A 3TFOA 3OT1A 1PNRA 1NXOA 2FZKA 3AONB 3F1KA 3HRKA 3PHCA 1QHYA 2VPYA 5A03A 4HWGA 3IEKA 3LQRA 1E9AA 4DF3A 4NKRA 3X44A 4LRYA 1C3VA 4AY5A 4HNHA 1Y8CA 3THWA 1T1SA 3R7AA 2V65A 1G9SA 1QF9A 2PN1A 2XV1A 3NV7A 3VHQA 3K9HA 5A3QA 5K45A 2HADA 3L0PA 5FJJA 2VT6A 1GG5A 5AHOA 4EA7A 5DM70 2EG9A 1W94A 5JJLA 1TM3E 2I6UA 2VP2A 4KMMA 4EFKA 1ZK0A 2JFWA 1KJNA 1ACJA 3EXHA 3JWGA 4GS5A 4MDHA 4MIOA 4X90A 1FJGB 2BFEA 4P33A 4NBLA 2JFBA 3OICA 2NSHA 2AI3A 3LIPA 1MJHA 3NCTA 1LTQA 1R6UA 5A0FA 1VHQA 5KJCA 1LX6A 4OBEA 1E9FA 4H35A 4AROA 3ONVA 2CNNA 1JHRA 1TM2A 1U9IA 1V37A 4I08A 2D6FA 3DMHA 2ZE8A 1OLXB 2UYHA 1N9KA 1RAAA 1ZNZA 1A9ZA 4W5WA 1D2GA 1E2QA 1ODFA 4PZYA 2ETVA 2GLTA 3WNCA 4AP9A 3UPUA 2O14A 4M55A 1CW2B 4QC2A 3G0HA 5AUQA 1AQUA 5F7XA 3JAMA 4DV7B 2HMUA 5ALPA 3FFTA 2IHUA 1KOLA 1EDEA 1Y8AA 3GIWA 1KORA 1FYEA 3IEPA 4RFVA 3TECE 2ZE5A 4D9FA 2I29A 2C03A 4QAQA 3DUFB 3H86A 1L8QA 3OJLA 3WKEA 1PJAA 3MWKA 3EGXA 1G19A 2IF2A 3AFGA 4OI2A 2TMDA 2QGNA 2X40A 1PG5A 5F12A 5JSQA 2Z1NA 1V26A 1K5PA 4LSWA 1X1BA 2JJ1D 1J00A 1R6XA 3GOHA 1T5OA 5J5VA 5BQ5A 4FE3A 2AKEA 2HLDD 1LTHR 2GNOA 4RH1A 2ZS9A 2DPYA 3EVNA 2YBDA 3UOWA 1CJVC 4DV0B 1VIYA 1W5BA 3OY2A 4JZKA 2NO1A 5JLAA 3U9SA 4BZZA 1CU1A 2YN4A 3FZYA 2ZJ7A 4JLWA 4YMSA 3ZWCA 3QE2A 2OXIA 3W0LB 1SH7A 4KN8A 2IWHA 2ZVJA 3AT1A 3B3QA 1D5CA 1JAZA 3PVZA 4UZSA 4GSKA 3ZHUA 1Z5UA 5FPHA 2J5QA 1HFJA 2QR2A 2GCOA 2QE6A 2RI1A 3P9YA 2J3HA 4XQEA 3LSYA 4QE3A 3U26A 4LOLA 1XZ8A 5ALVA 4BX9A 1M6WA 3E7DA 3VTKA 1KI6B 1XUOA 2OV3A 4HO1X 4Z4EA 5ER9A 4PZDA 2W6NA 3SS8A 2VNKA 1EFPA 1JNYA 4R98A 4AF6A 1OFIA 1YD7A 5TLSA 3JARA 4DARA 3RVSA 5FYQA 4MHSA 2C7RA 2HQSA 3PEEA 4OJQA 1E6UA 1P3Y1 4C2UA 1SUFA 2PL5A 3S1AA 1QGYA 3ZTYA 4G41A 1YQ9A 4FGLA 3JQPA 3RC9A 3CQ9A 4KO4S 4OYLA 3EXHC 4QVIA 4FFRA 1QH9A 1XTIA 821PA 1VHDA 4IOMA 4A2CA 1P1BA 2O3TA 4HWKA 3VNBA 3HBNA 3I04M 4DCMA 2ZCUA 4TKUB 4G0QA 4P32A 5CBKA 4C22A 1KC1A 4REQB 1U9IC 4QUIA 3CYFA 2F1IA 4ABYA 2ISSD 2Z2JA 4OQ4A 2DM6A 1MRNA 3SDSA 1XRNA 3H1EA 2XQJA 3LUHA 1AJEA 4EMTA 2JFGA 1XXLA 3K6KA 3LDHA 3C4VA 4Z0HO 5HDBB 4YRIA 3SPXA 4F2WA 5K09A 3B9PA 2V6GA 1S2GA 2B7BA 4EH1A 1CRPA 1GDDA 1CB0A 3OZIA 4JVOA 3C7DB 1E8NA 4UUQA 1Y7LA 1KI2A 3LUFA 3MW8A 3IURA 3LGSA 4V24A 3MHTA 4NEQA 3PRKE 1K9VF 1QK5A 2JK0A 1H42A 1IWOA 1UOEA 5F73A 1WO8A 3CS3A 5IFLA 1IPEA 3R5JA 3RK0A 1W581 2XUKA 3AVVA 3ESAA 2RAVA 3R74A 2O2HA 2ERCA 3MOSA 4JNKA 3TB6A 4YJHB 1PJBA 4Z9BA 4F84A 2XA1A 2Q5LA 2QRKA 2Y1WA 3N07A 4OQEA 7YASA 3D0OA 1VM6A 2OD7A 4Y0AA 5H1YA 4O3MA 4NVRA 3S29A 2GBLA 3PJRA 2WUVA 2Y1EA 4NHEA 4U3JA 2RFLA 1SCIA 4NBUA 5E95A 1ZCJA 1T1EA 4XX0A 4P58A 3R0XA 4P4GA 3D9QX 3ICQB 4TT3D 1QHEA 3F97A 4AZ3A 3M34A 1B26A 3ZJTA 1PSWA 1D3AA 3U7FB 1Y8RA 4WK2B 2GZ3A 1ND6A 1OILA 2A6PA 4FGZA 1YA4A 3RVKA 3SJBA 2C4UA 1NP3A 1VLVA 4FQ5A 4WTOA 5DX0A 4AJLA 1EVZA 1QTQA 5HQ3B 2VYNA 4WBSA 5E9WA 4V1CI 3PXGA 2YS6A 1RXWA 4IIVA 3B5JA 1SQGA 2PX4A 4H4EA 2AVNA 4IDCA 2HSDA 4HGZA 1YO6A 1Y42X 2FG5A 3B78A 3CRMA 4Q4LA 3QOXA 5CX4A 3A0UA 3G6KA 4CG3A 2JD0A 1IHXA 2QTNA 3C3KA 4HNVA 3C39A 3H11A 4G97A 2GFQA 3KKOA 3IS3A 4QXAA 4EATA 2HCBA 5TIIA 4ZI7A 2ZRDA 3O74A 3RG8A 1T9GS 4O1HA 5LYJA 1EVQA 3PCTA 1NN0A 1WTCA 3F90A 4O25A 3TJZA 4DIUA 4FMDF 1HORA 1ZICA 5KNDD 5DNUA 3D81A 2AGVA 1A4RA 1QDEA 3NBFA 1IMJA 3C74A 3C8HA 1DEAA 5C3UA 4JV5B 3EULA 3NWJA 5EA2A 5EQDA 4Y9RA 2IH2A 1QV6A 2OD2A 3NUZA 2QRGA 4LJRA 4NK4A 1AUVA 4G1VA 4EUNA 1JB9A 2Q5IA 2VK8A 1SXIA 1ZGJA 2ZI6A 3FYCA 4EY6A 4BFSA 2F2TA 3QY0A 5AI4A 4QOEA 4U2BA 2RI6A 5EZQA 4S0XA 2VDWA 5TS3A 4JASB 3LU1A 3LT5A 4E07A 2JFVA 4CL8A 5A62A 1WS6A 1P75A 3ACCA 4ZYLA 1Z6AA 4TM7A 5CLGA 1RACA 2G9NA 3RT1A 3F4KA 3UF0A 1ACMA 5JAOA 3HJUA 1IUKA 4MP6A 4R2XA 2IHZA 1DIBA 5K0NA 1PWYE 4AP6A 1AK9A 4PX5A 2JIOA 4TSRA 4D9CA 2R2GA 3FXAA 5ECGC 2K7FA 2QUIA 1WG8A 4B6RA 1G8AA 5JC8A 1VG1A 4J7AA 4QGFA 5DI3B 4FMDB 4OQYA 5IH3A 2DEUA 3A10A 4EHLA 3GNSA 3KTFA 4MKIA 2I4TA 1JEQA 4G0VA 4ZJYA 2A3RA 1U28A 2FB9A 3R8FA 1J6UA 3O8DA 3RAJA 4V0NA 4TQAA 5DYNA 1XMXA 1U8FO 2QD5A 3T7DA 3V8BA 3H7AA 4TSFA 2EW8A 4FB4A 3COJA 3LBHA 1L9KA 3ZDYB 3P45A 3BMOA 4BWGA 1JGTA 2VZLA 2QVZX 4BNHA 2HRQA 2OUIA 5KPJA 5HPYB 4YRSA 1U98A 2XSZD 2F48A 3E3NA 4JI3B 1PJ2A 4EB3A 4AM8A 1TUEA 5IEJA 5FBLB 2BFMA 2JRCA 1DJOA 3SNHA 1GNLA 1SUAA 4JK3A 4OHWA 5EGNA 3IODA 2AZDA 3RARA 1KETA 4IEEA 2DT8A 5KNCH 1LEHA 1Y9AA 2JI7A 2R84A 4AUEA 1KJQA 3K35A 4CRWB 5A5VA 5I45A 3IC5A 3GZJA 4XZ3A 3B1FA 3S2ZA 1D2HA 4BQRA 4DSOA 3EGVA 1E3TA 4PF1A 4MP3A 5G3YA 2NU6A 1XTBA 3UC9A 4FZ5A 4V2IA 5HX7A 3GCDA 3C2QA 1SXJE 1EFRA 5JSZA 3ZY4A 5FNVF 3OZGA 1KYYA 3RS2A 4D81A 4BVLA 1BXKA 4CL2A 1SZDA 4NZYA 3LC2O 2C07A 2MT9A 1O5OA 1OX6A 3FCCA 3CGGA 4QHYA 1W6RA 1V1RA 1P2VA 2NP7A 2XE7A 3KJFA 4M8LA 2B4QA 2D1TA 2C4WA 2FFRA 1XGKA 3PEWA 1M72A 5JATA 3SZMA 3ETCA 2FPKA 1ULAA 2KYRA 1RBQA 1G98A 1NVBA 1H3NA 3M3DA 1TEXA 5JFOA 3KLOA 3E84A 3QA9A 1QIIA 1FXWA 1N5JA 2GN4A 2MSWA 2NZ2A 3ZHYA 5L9AA 1K5GA 5HTOA 1QP4A 1H9AA 3PTLA 5EWJB 1VCMA 3CF4G 3DVLA 4F8YA 2OFOA 3MJCA 4MW5A 1G8JA 3AVYA 2WJ4A 4LUCA 3ZUGA 2XKAA 4IY1A 4Z9AA 4JBGA 3CEHA 2A0YA 2P9CA 4YJFA 2UVPA 4KMOA 5H7XA 2QN2A 3LWZA 5AKLA 3RYIA 3V4VB 3FDIA 4D3DA 1ZD8A 1W9HA 1P3DA 1T1RA 1BHJA 1CJSA 1PT5A 2GN6A 3LI2A 3M82A 3OZFA 2V8BA 2WYHA 4PR3A 1OUMA 5FV7A 2WAXA 1J22A 1NY5A 1UKBA 1J0BA 2JCYA 3ECAA 3HB7A 4MPRA 1VBKA 4Z4IA 1SBQA 2IGBA 4JIMA 2XY4A 2BR4A 2ZB3A 3G23A 4DWOA 5EHQA 2PXCA 1PDOA 3DBRB 3MHPA 2K6GA 4ZEXA 4F85A 2J1LA 2HCJB 4H3SA 3IMKA 4HLCA 1EZ1A 1FPMA 2HWWA 4NCNA 3FFWA 1CUEA 3KKNA 4MGZR 3UAWA 1Q0UA 2C9DA 2E82A 1DKOA 2CVOA 1KK0A 2NTYC 3C7TA 3EF0A 2Y1XA 3HVUA 4P4SA 3RHSA 3T15A 5AW4A 4KJZA 4CMCA 2YWBA 3HM9A 2X5NA 3A04A 3H4MA 5IHXA 4F8JA 4EX6A 2GR9A