2PYZA

Crystal structure of the complex of proteinase k with auramine at 1.8a resolution
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Crystal structure of the complex of Proteinase K with auramine at 1.8A resolution
rcsb
molecule tags Hydrolase
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2pyzA00
3DWEX 3TI9A 4AKSA 2Z2YA 1GA1A 2X8JA 1SUEA 1R0RE 3DW3X 2WWTA 1GNSA 3DE7X 1AH2A 1CSEE 1AQNA 1SBCA 3DE1X 3DE0X 1TM4E 1SBHA 1Y4AE 3QMPA 1XF1A 1KE1A 4K8RB 3GCXA 2E1PA 3DE5X 4M1ZA 4DWWA 1EA7A 1BJRE 1PTKA 2ZWPA 3F7OA 4YN3A 4C3UA 1UBNA 1Y48E 4OMDA 4AKTA 5FAXA 2W2OA 4HVLA 3D43A 4MZDA 3A3NA 3LXUX 3SICE 5ARDA 1V5IA 2G4VA 3EIFA 1BH6A 3T41A 2SBTA 1PFGA 1GA6A 1TM5E 5JXHA 2HD4A 2WV7A 3A3PA 1SCDA 3DE4X 3AJ9A 5CW1A 3PTLA 4I0WB 3BPSA 3VV3A 2SNIE 1GT91 2TECE 1SIBE 2V8BA 3ZXYA 1GTL1 4OV6B 3CNQS 2DP4E 1KDVA 1BE6A 2IXTA 3LPCA 4H6XA 2PMWB 4KG7A 5AVJA 1SCBA 1C9MA 2ST1A 1PJ8A 1SELA 1SUDA 1A2QA 3VSBA 1BE8A 3I30X 2WUVA 1SCAA 2PKCA 1SBNE 2WUWE 1SIUA 1CNMA 1TMGE 3PRKE 1S01A 1SCJA 2QTWB 1TM1E 1ST3A 3TI7A 3WQBA 2ID4A 4JP8A 3L1KA 1Y3FE 2P4EA 1Y9ZA 1V6CA 1GTJ1 3UNXA 3Q5GA 3VYVA 3AJ8A 4NE9A 1ST2A 1C9JA 4C3VA 1R64A 2Z2ZA 3DVQX 1MPTA 1KDZA 5FFNA 3DYBA 1T1IA 2W2NA 1SUAA 3I37X 3AFGA 2HPZA 1R6VA 1NDQA 3TECE 5B1EA 1C9NA 2PRKA 1NDUA 3DVRX 1LW6E 1WVMA 2B6NA 1P8JA 2XRMA 1TM7E 1PEKE 1GCIA 4WOBA 4KB5A 3GT4A 1EGQA 1YJBA 4WOCA 1TO2E 3DE2X 3EE6A 2X8JB 1Y4DE 2XTJA 1S2NA 2GKOA 1ZVKA 2IY9A 3VHQA 4NMXB 1AF4A 1Y3CE 3D9QX 5SICE 1C3LA 4BWGA 1WMEA 3OSZA 4ZOQI 3QTLA 5I9SA 2DUJA 1OT5A 3EDYA 1T1GA 3WHIA 5AQEA 1DBIA 4CFYA 1AVTA 2SICE 2W2QA 1TO1E 2Z58A 3VTAA 1MEEA 1YJAA 5FBZA 1TK2A 5ARBA 5AVKA 1AK9A 2PWBA 1IAVA 3BX1A 1SBIA 3I34X 4RYDA 1KDYA 1P7WA 5AMXA 2Z57A 1SCNE 4LVOA 2Z56A 4J94A 1SN7A 1OYVA 3DE6X 1WMFA 3H42B 3WIVA 1Y3DE 4HX2A 5K7SA 3Q40A 1OYOA 1HT3A 1AV7A 3LPAA 5JXGA 2DQKA 1BFUA 3VV2A 2PQ2A 1Q5PA 1WMDA 4DJ5X 3GCWA 3DVSX 3QFHA 4B5LA 1TM3E 1SPBS 4GI3A 4Z2AA 1Y1KE 1GNVA 1Y3BE 4CG0A 4NE7A 1SVNA 1SUCA 3ZXXA 3F7MA 1ZVJA 2W2PA 2Z2XA 2W2MA 1T1EA 4CFZA 3I2YX 2ZWOA 1YU6A 3HJRA 2PWAA 4H6VA 1YJCA 4DZTA 3SQOA 5ARCA 4H6WA 1S02A 2Z30A 3F49S 1WSDA 1AU9A 3CO0S 3DDZX 3GT3A 3BGOS 2SECE 5JMOA 4LVNA 5B1DA 1P7VA 5JXJA 1GA4A 1GTG1 1Y33E 3A3OA 3P5BA 1KE2A 2ZRQA 1SBTA 1TECE 3LPDA 3WIUA 4FONA 1DUIA 1NLUA 1SUBA 1SH7A 1SUPA 4OMCA 4KPGA 1Y34E 4ZARA 5JXIA 3DE3X 1IC6A 2PYZA 1JEAA 1BFKA 1VSBA 1THMA 1SIOA 2ID8A 3DW1X
chains in the Genus database with same CATH superfamily
4Q15A 4FR0A 1GADO 1PG5A 5CCDA 1HOTA 1MOPA 2AXNA 3TI9A 4ZZIA 4OLBA 1NVXQ 2P62A 4Y1GA 3RD5A 3DBHB 2FGJA 3RF6A 1V0JA 2EJBA 5CLJA 1GRNA 1M2VB 1ZCFA 2JLAA 4U7HA 1TKAA 3L7KA 3ZI7A 2W42A 4WINA 2P9YA 3CR7A 3LTEA 3LY8A 3A6EA 4YUYA 1XOIA 3HFRA 3GZNA 3QJGA 1GZ3A 2G17A 4IV5A 4KQ6A 2ODAA 3L02A 1FDUA 1YV9A 5KVSA 3KOUA 3IVCA 4RTQA 3ROPA 4EF6A 1I1NA 1R0SA 2R1UA 3DHNA 5EKDA 3EQ7A 3O83A 4PZAA 2WFLB 4H1WA 3QJYA 2YIDA 4CQLB 3P71T 2C7QA 4Q37A 2ZM6B 1DIGA 3PR3A 2BGKA 1WHSA 2XGGA 1RQ2A 1T91A 4O63O 4R6WA 3QEOA 4E51A 1CVRA 1U7OA 4LZZA 1Z5WA 1ZSVA 4L7QA 3B1YA 3KVOA 3SC2A 1N7GA 1SCUB 4WE3A 3KV1A 4X7PA 1HNWB 1EAYA 2H1WA 2E1PA 3QPWA 4XQCA 3G9UA 2CKMA 3F0TA 4HFRA 2WIFA 3VNAA 4JKYA 4BNNA 4UCWA 2YWBA 2IEGA 4LSMA 3GGJA 2J30A 3EIEA 1NLZA 4CXMA 1C7EA 1MO4A 4C4ZA 3B1WA 2BH2A 5JNTA 4TS3A 4G0ZA 4KP7A 4YCLA 4WPGA 3I4LA 4MMZB 4HR7A 4WDRA 5A2GA 2P77A 2ECOA 4Q6BA 3GIDA 2O0MA 4NOMA 5BQ3A 1RQPA 3OJCA 5DSXA 2NUPB 1ZONA 2UZ0A 4I9UA 5F7OA 1T5OA 3GLTA 4WEQA 1R0CA 4Y9TA 4F3RA 3FNFA 5KDDA 4PZLA 2W2OA 1P5JA 3BL6A 3NHSA 2JHPA 4RANA 2LP4Y 3FTCA 1PYDA 1ZY2A 2ZWIA 1XMVA 2NMVA 3RU2A 4EJSA 4TUYB 3UJBA 4LF5B 2QRZA 3Q8LA 3P9SA 2VJKA 3FDJA 2IUUA 3CH7A 4JUCA 2R84A 4PQFA 5FI1B 5F7JA 3GMSA 3B70A 4BN5A 2R5FA 2YXLA 1TJ5A 3CUUA 4WK2B 1CY2A 1NOKA 1JG3A 1B16A 4MUKA 2AA3A 4WK6A 3GH1A 3HU5A 5A6SB 1VL5A 2FZ5A 3D4PA 3BICA 2B1QA 2IEZA 1TUBA 4DHEA 3R41A 2C4KA 4DIFA 1G42A 1NOJA 4P0TA 5HKKD 5BNWA 3BDAA 3T7CA 2JAWA 1H0HA 2OENG 2B4KA 2A5JA 2IKQA 1GZ6A 1UJ5A 2YZNA 3IB3A 1P4GA 3UA4A 4E2XA 1GRVA 4EATA 2QYOA 2IFTA 3KFVA 3GCDA 2ENWA 4NQRA 1N75A 5JPDA 3TLAA 1JAXA 1TF5A 2O3SA 2YJ5A 2R6JA 4AZ0B 3RVKA 3FLBA 4Q4AB 3T5MA 2PGOA 4NNPA 3B9PA 5GOTA 3R7AA 2VYCA 2NUAA 4MQEB 5TPZA 3WGTA 5KQPA 2ZAYA 3EDOA 1BXRB 1WUTA 4N5NA 1MGPA 4EI9A 2C84A 3C6KA 4EHIA 1I6WA 3O73A 2WKRA 2WSSA 1GTL1 4X90A 1NQUA 3NWBA 4DA8A 1EWYA 2FZWA 1IPEA 2VWHA 1VHWA 2WOOA 3IJ5A 3OT1A 5EMJA 1GO2A 3CNQS 3E61A 2EJVA 2H29A 4KXQA 2Q3HA 4LYAA 4MINA 4KNVA 4FKBA 4QQ8A 5LP6A 3ANNA 1FFEA 1X7HA 2AG8A 3L0YA 3Q98A 1W76A 4JA2A 4TTIA 1LFDB 4RSHA 5HEKA 3ZWKA 2ZUFA 16PKA 3DLAA 1BQ4A 1E2GA 2BEVB 2QSZA 3SQMA 4Q1FA 3I01A 4X41A 3RS5A 3L41A 3PZBA 1M7HA 1CYDA 4MWCA 4QTXA 2UZ1A 4BWVA 5CFMA 1UJ6A 3ON5A 2XVXA 1GFIA 2BSXA 2EX1A 5DH9A 1ELOA 5TV2A 1UFQA 5AKHA 1W85B 3SDBA 5AM1A 4XQEA 5A4DA 4C3ZA 3WISA 2VT7A 3I0NA 1A2QA 2JAUA 4KIJA 2YUTA 2DHRA 4RCZA 5FT9A 3ZU6A 2FYTA 3ZOZA 4UU8A 3X1ZA 1VIVA 1H0SA 1PSDA 4H6PA 5DBGA 1RYEA 2Y0EA 2Q4TA 3ZKWA 2HRQA 4QOIA 9GPBA 3QXHA 2G5GX 3A9VA 3T0FA 1YQXA 2GZ1A 5AICA 3TOCA 2FKAA 4DPKA 3GNSA 4W7HA 3E9CA 3K4QA 2R1TA 3M1IA 3FPJA 1M34A 2YJNA 1J1IA 4KXLA 4LF6B 1C3VA 1MT3A 1UM9B 4EL5A 1CY8A 3O84A 2DUUA 1VJ1A 4RKFA 5EL0A 1HDZA 2GDJA 3HACA 3JVUA 2H0QA 2ONCA 4BMCA 3CKYA 1QHSA 1GTVA 4ZPJA 2VAWA 5LFAA 4R9NA 5KX5A 1E2QA 1YL5A 1FP6A 5JJBA 1A2BA 3FZNA 3ZIAD 3PD0A 2ATEA 1BHJA 2WF7A 3C3MA 3Q7EA 5IKOA 3ZCTA 3UC9A 2XIQA 4C05A 4E6PA 4POOA 3UJ3X 4NFYA 3QEMB 1F2TA 2KLBA 4YP1A 3WL8A 3GVCA 3U2QA 1JLLB 3A6LA 1BOFA 2QD3A 3LPLA 1VHDA 3V9PA 1NNSA 5C8XA 3TGLA 4NMMA 1W52X 4QJBA 4HAUA 4J6EA 1CY7A 3KLPX 3I5XA 2HRDA 1DMRA 4A82A 1CIPA 2D3WA 5EIXA 5BMOA 5K6TA 2FQYA 4FGWA 1CJUC 2IEAA 2MYPA 2HDOA 2PLAA 4HN2A 5CFZA 4XWWA 2B82A 3HKEA 3IPRA 3N8HA 2O1SA 4Q19A 1Z35A 4P3PA 1GCGA 4TS4A 2C5EA 3SDSA 4Q03A 1KYQA 2GN4A 2IUFA 3MEQA 2J1LA 3RFVA 1WU8A 4MULA 3Q11A 4ZO7A 2Q3CA 2JFZA 2Z1NA 1QFZA 4L6AA 1PZEA 3T0IA 4E5PA 4MW6A 5F2OA 1E79D 2O8CA 7MDHA 3C24A 3L7OA 5LQAA 4JUDX 5CBPA 4O5OA 1XALA 3ORFA 4OQXA 2OMEA 4JJAA 4Y2XA 1CUZA 3VJRA 3PRHA 1YR3A 3LH5A 1V47A 3N6RA 4WD3A 4F4HA 3VVMA 1P6XA 4DYVA 3HG7A 1P72A 4GSLA 4MV4A 3U7RA 4Q93A 3IURA 3NI2A 4LZLA 1M0TA 1KEZA 3Q3CA 4OMFG 4X97A 2WB4A 3TKYA 2OPBA 3OF3A 2ZS8A 4JODA 1MIOA 2ZFUA 1GQRA 2HDNB 1QGZA 4PEVA 1T26A 2VR1A 5EZSA 1SXIA 4LDRA 4JYAB 5DNYB 4IF4A 1KS2A 3HWWA 4LHWA 1L7RA 4MYUA 4G23A 5HCIA 1S4QA 4UHFA 2Y0PA 1HXHA 2I2CA 1EFPB 1UKEA 4WN9A 4RA6B 5JS1A 5EXDA 3EODA 2EKQA 4WZAA 5A4AA 1LW6E 3BCRA 2QJTA 3TRHA 2Q3BA 3F3MA 4YS6A 5KQLA 3IP7A 1E89A 4K8OA 4PONA 4UAJA 4E14A 1M2HA 1KJJA 3EZ2A 1GRCA 3KT8A 4QTYA 2Y05A 3AUFA 3GAMA 3LT1A 4K9DA 4XB6B 2RGWA 4O4IF 3U4DA 1ZL2A 5SY4A 4GH5A 3EDQA 3H65A 2J0UA 2YBDA 3WYFA 4TV9B 3U7QB 3KKMA 3BMCA 3VR4A 3A7DA 2PJRA 1BCRA 4LMBA 2PBFA 1YMQA 3DJYA 3P2IA 2DR0A 3HCBA 2ZZKA 4KODA 5CX4A 2O3QA 1Y4DE 1KFCB 1KI6B 2G1KA 3G8BA 3EMBA 2YICA 3QG5A 2PFSA 3TLCA 3ZHRA 1ZKMA 4MVYA 5ILQA 3WBFA 4IIBA 4HEA6 4CIDA 1P0CA 1R8JA 4RENA 3FCUB 1JHQA 5DWQA 1NKVA 5F2KA 2EC5A 3PWZA 2FFRA 3EEBA 3FBGA 3I83A 3HXOA 2AHRA 2Z9DA 4DDWA 1F4VA 2QPOA 1IOZA 1XWIA 4IZOA 4BP1A 4HX9A 2RGUA 4P4GA 4RV4A 1UPFA 4OGFA 4P4UA 2C8JA 4K9NA 4ZVQA 4URFA 3U5TA 3GJZA 4YRDA 2HK7A 2POQX 3LK7A 5LOVA 1NW7A 1AHHA 2GK7A 1GIAA 2XMRA 3AI3A 3PX3A 4FEYA 1YZNA 1CRQA 4OYHA 2H4FA 3GCZA 3NAQA 3VR5D 4B8WA 5LPNA 4HP8A 4CLOB 4TS1A 1GP2A 3PXUA 4LTMA 5AQEA 1QZTA 3OTGA 2XUHA 3ET5A 4WASA 4XCXA 4KO1S 3GEPA 4M1WA 2O3RA 3H0KA 4O1HA 2QMZA 3A1CA 3EGVA 4DLSA 1FC0A 3H1TA 3B3JA 2VN8A 4F92B 1GT6A 1E3MA 2BCGY 1D2NA 2O7VA 3QUSA 4M1QA 1LU9A 1MEEA 3RTCA 1QV9A 3WLIA 5AQ1A 1J9GA 1B2RA 4I5FA 3N2ZB 1I4DD 2R751 2XNSA 4N5HX 2PQMA 3O4JA 1UDCA 4I4TA 4EUKA 3CH6A 3U3JA 2WICA 1DRJA 5FHRA 4O08A 1T1RA 4UNPA 3I34X 5ERXA 4OM7A 4RYDA 3NAGA 4CN8A 4PXSA 1E9BA 2Q5FA 4KACA 3HGMA 2PBLA 1V1RA 2VHYA 3ILSA 1SC9A 1UZMA 3DB1A 2JGRA 4N3GA 4ZAWA 3U9SA 5IKEA 4DQVA 4RVSA 1Q91A 1C4WA 1W94A 2BL4A 2WF9A 4RTNA 1IVSA 2IYNA 3NAMA 2OR3A 2JCBA 4MQ4A 5C35A 1FNDA 4EQZA 3DP7A 3ZWWA 1PR2A 1Q0UA 1WJGA 2I3AA 2IDKA 2OT3B 3AKDA 3K0AB 3OFNA 1DXYA 2NQ8A 3PCRB 3RIYA 1EB8A 1X38A 4TMXA 5ISMA 2FI1A 5H5JA 3J81k 2A5FA 4MTLA 4M1OA 4EHHA 3NALA 1Z13A 2JJ2A 3GQVA 3HL4A 3O21A 3T7EA 2XUQA 4W63A 3KJGA 3IILA 2O06A 3FMIA 4IOJA 5DGTA 2Q1SA 3TGPA 2GYWA 1ODCA 4QBHA 5AXAA 2W37A 4I4LA 2WTUA 1JQAA 3QIAA 2QRGA 5AM4A 3OKCA 4CF6A 5NLLA 1X7XA 3MMZA 5B53A 1E7RA 7AT1A 3H75A 5DX8A 1WKVA 1TGVA 1UPUA 1J00A 2QJFA 4UZEA 1GL6A 4GLBA 4NKRA 2PYDA 3KTFA 2YUIA 1W47A 5DGXA 2V3WA 1J9ZA 2UVQA 3GCWA 4GWLA 4JX9A 3C3DA 1R9MA 4C43A 4C0HA 2QM0A 1OROA 4YJKA 5DNAA 4LMPA 5E3IA 5EESA 3IUEA 5JCOA 1NMSA 4NQZA 1YVUA 4DCSA 1UAAA 2CLHB 1E2MA 1RLTA 1QTIA 5B57C 1J1UA 1XYYA 2BHNA 1ZD1A 3DL4A 3EXIB 1MABB 5FPKA 2NSLA 4DREA 5JOQA 5K0GA 2B5VA 2DR3A 3F4LA 4FMDB 4H4CA 4KWCA 4UJ5A 5D5QA 1MHPA 3A06A 1E3SA 2EX0A 2R5WA 5G0WA 3UWOA 1P7YA 4BC0A 1UPXA 3U4HA 3GWZA 3AY6A 3WADA 2WVGA 5EKTA 4GRIA 2H2WA 4M8SA 3TOVA 1MZPA 4C4AA 2VG8A 4N65A 3W4JA 1U6JA 1NJSA 3PD1A 4PLYA 4XGKA 1KEUA 2YWGA 4IG9A 2BFEB 2MSDB 2UUBB 3R6TA 1QYIA 4LF7B 4HFNA 1H9CA 1G21E 2I2XB 1MXHA 4JGIA 4MR9A 1QQ5A 1VG9B 1ZMXA 5CG2A 1OZ0A 1DDGA 4TXMA 5C1BA 1EBBA 3L0DA 1KO4A 2EWWA 4PG7A 4TTAA 4MDHA 2P3LA 4UVGA 2PMEA 6REQA 1Z5ZA 3IQFA 2WZDA 4GF5A 4UARA 1PJRA 3F49S 3PT9A 1U6IA 4UMFA 4XUDA 2QSJA 2Q9AA 3GLSA 2N42A 2I1QA 5FF9A 2JEZA 3L01A 5BR7A 4MCJA 2ZIGA 4DMGA 3ZN2A 1RDFA 2B9EA 5T4EA 4BFTA 1JAIA 1Z37A 4D0SA 3OM1A 1GLNA 2Z0MA 1OREA 4HDQB 3CN9A 3QVSA 4YV1A 3JQGB 2A9JA 4NWIA 1WUIS 1ZNYA 2IXDA 3ABSB 2QDXA 3DOOA 3KL2A 3QKSA 1J49A 5FR1A 4ZQIA 2VF2A 5EIBD 5IFLA 1JI3A 3P20A 4CCYB 4MP8A 3IAUA 5HJEA 4KIFA 5HW0A 2PLWA 1T3SA 4UTXA 4PHHA 1NZFA 3LOQA 4HNQA 4RMIA 1DVRA 2MINA 4GGPA 1AHIA 2IDZA 3W8RA 4BY9E 1ONPA 3TAHA 2GJSA 4DIDA 4D0GA 3BC1A 3N0TA 3LT5A 3P9IA 3FH0A 1JALA 1JIXA 2RH4A 2XLCA 4ND2A 4AN1A 1AT1A 4XJVA 1JR2A 4MVJF 4DRXB 2DBRA 4EVQA 1R6AA 1EUCA 2GPJA 3VZRA 4C4PA 3RUDA 2ZI6A 1FXUA 1A3CA 2Q5OA 5CDHA 4R7ZA 2NXCA 3I45A 1Z5UA 4K0KB 4L6IA 2LD4A 3WLRA 1K92A 4TLLB 4TXHA 5E38A 5CB6A 3DCIA 1FRVA 1PQWA 2IH4A 1XVVA 1IQRA 3OT4A 3REQB 3VNBA 3HXKA 5ALZA 3JWIA 2AJDA 2VK4A 1SOMA 3DE3X 3ZX4A 3AFMA 1C0PA 3QVTA 4RH0A 1KI8A 4A1OA 4NAHA 3ZX5A 1OFUX 2NYAA 3DMHA 4UE2A 1E7MA 1ZH4A 4WNAB 4U2GA 3EZLA 5K0JA 4YGXB 4V3BA 4CMJA 1XK7A 521PA 3TXAA 2XA9A 4PQYA 4M2LA 3O38A 3AWIA 4NJEA 3W77A 2CDNA 5TQ2B 4DQ0A 2O8EB 3UKOA 2P9BA 1UJCA 2XOKD 3GUUA 3PVCA 5K4AA 3INRA 5G1OA 3WGOA 4E13A 1RC1A 1FLDA 5GV8A 5IUKC 5JJCA 4LRYA 2PYIA 3CUVA 3L8CA 4IIEA 2F9FA 2YOGA 4IL5A 4FUTA 5EZQA 1IDN1 2J7PA 3I73A 2YOHA 3RTEA 3SLRA 3VC3A 2XITA 1PGPA 3S1SA 5IPFA 1XLVA 3UMJA 2X8JA 4M6WB 2RAUA 3NHFA 4PX2A 1XBTA 3GZ4A 4E2FA 2GO7A 3BTVA 4LJYA 1KU6A 4LUCA 4UM5A 1UPCA 5ITZB 2KQUA 1J2YA 3MPUA 5TS3A 3EB9A 4L9AA 2E9SA 2Z8YM 5FTJA 3ND5A 3D6NB 3NOVA 4DXAA 4R98A 3IKMB 1T1JA 1KR5A 2WSLA 3EMKA 3I5AA 3R6LA 4WIAA 3OX2A 4WZZA 4YJHA 4D9GA 1AQNA 4MWZA 1U0BB 1N5DA 5IAEA 2EXXA 5JAIA 3WB2A 3S68A 3MCWA 2D5IA 2PRJA 3K16A 3KSRA 1TM2A 5D6NA 4HVCA 4CV1A 3DTYA 1Y80A 2QV0A 4KXMA 4BU0A 1QLWA 3NIDB 1ZICA 3MM4A 4J7AA 1QHXA 4Z4EA 4OSPA 3I28A 1W0KA 4JJZA 1LK5A 1E5XA 2VUUA 3AF0A 3T4XA 5C5EA 1U8CB 3CCFA 4XYEA 2CSUA 2BAGA 2P40A 1E1NA 3O95A 2HFKA 4L4YA 4RWZA 2RK4A 4M1ZA 1ND5A 5DULA 3LHIA 3B1FA 5A7FA 4A36A 1NWHA 1PV2A 5FQOA 3WGQA 1GPUA 3CINA 2WSBA 4G0QA 2VJPA 3CX6A 4I55B 4W7SA 1FFSA 4DAOA 5FH9A 4PNPA 1YTUA 2P41A 1EA7A 5LUBA 8ATCA 2JFOA 5TLSA 2VNHA 2R8RA 2ZI7A 2NQ2C 4JQCA 4DIUA 4HK4A 2VHQA 4WADA 3K4HA 1FDVA 1H1LA 1SNYA 2ZRGA 5K3CA 2WWHA 3S5UA 2OO5A 2QAJA 2ZYDA 3R24A 1VLJA 2C4UA 4RS4A 1GAQA 3BGVA 1F2DA 1W36C 1CUSA 1GU7A 3UANA 3B6KA 3GDGA 8ADHA 4TYQA 4DARA 3G0HA 1CJTC 5LMUB 5FAXA 4QXMA 1OLSA 3QE4A 4MZDA 4RF2A 4FFOA 2I3GA 3DDHA 3GGPA 3NRJA 3G2OA 1XRLA 3PC4A 2Q1WA 4QUEA 1LSOA 1ZOLA 2VA9A 1DO0A 5KU1A 2UYYA 3E3AA 3LXUX 3EZYA 1HKUA 3H9EO 4OUDB 4AJ1A 4C4TA 3EIQA 4D46A 1F51E 1IEWA 2AW3A 1U4OA 2WV9A 4AXXA 1T5LA 2DEUA 5DB4A 5FTWA 1WIWA 3T34A 1X13A 1E6KA 3I39X 2GH1A 1ECBA 2O50A 4CLXA 4URXR 3DOFA 4X61A 3DAOA 1PS8A 3ZK7A 1VGRA 2GERA 3ESXA 2A4KA 4KZKA 4UUMA 3T41A 2R6AA 3UXYA 4G07A 4D3FA 3BZWA 1LQ2A 2R8BA 5T8KC 2FF7A 2FN3A 4MV8A 5EJ6A 2XXAA 2WTMA 4ZQFA 2YW9A 4ACAA 3CEAA 3PYMA 2WV7A 4XOUA 4GC9A 4CF7A 1E3WA 1ZOSA 3HM2A 2EQBA 1A76A 1YMVA 5E9QA 1LY1A 4RCYA 2WWVD 1TMYA 2OBFA 3PQ8A 4H7JA 3IQZA 3JQFA 4YV7A 1U0JA 5F9FA 1JXAA 2HH9A 3U1BA 2AFHA 1XTJA 1NI4B 1YRAA 3NGXA 1K7SN 2MT9A 1OXKB 5JJKA 2B25A 1P5RA 1WDKA 4IHJF 2H1IA 4HS9A 3LVBA 1II8B 4KI0A 2QIOA 3HR7A 4N0PA 4NJOA 2XSZD 1KIFA 1NRJB 2MR5A 1I80A 4J2OA 4OY3A 1OSNA 3L7AA 2VLBA 4DDMA 1HOXA 4M0DA 4P98A 4A73A 4WHMA 2VKQA 3EFBA 3N75A 3PFWO 2D4HA 3TAXA 2X42A 3A32A 3WSWA 3LQFA 5IF9A 2IHYA 2C2KA 1YDHA 2VEDA 4RZ2A 4DV4B 4K6FA 2FMUA 3TINA 1BDJA 5CUQA 3G13A 4JYCA 4CKYA 1FRNA 5CT4A 5DCLA 3OQJA 1FSPA 4LJRA 3UAYA 4F2HA 3R7DA 1LWNA 1TZMA 4LFBB 1A5BB 4AI6A 1GXSB 4I4NA 1IULA 2IYTA 3I8SA 3QG1A 3MK31 1B1AA 1L8XA 1YH3A 5FULA 4A27A 1H1TA 5JS8A 4MAAA 2WWYA 4XKJA 1ZA2A 5DVZA 5ENVA 3P9YA 1G59A 4LXYA 4J6FA 2I7TA 2V4ZA 4KQHA 4CRWB 2PKEA 4EQ6B 5FV4A 1RXCA 3KWJA 1A50B 1PE0A 4ZI7A 4CL0A 3C0KA 4JL6A 1UFOA 2G8LA 5E6UB 1COWA 1REQB 3CEJA 3K35A 3VM6A 1DHTA 1R00A 2O5RA 4BNDB 1EUZA 2MU1A 4HO1X 2HQ1A 3V8VA 5DXJA 1DIOB 3ABQB 5AXCA 4UZFA 1AQLA 2H06A 4IRMA 4YMUA 1O0BA 5CIWA 3FKJA 3TGWA 4S1NA 3KPVA 5SYAA 3HZZA 1YCFA 1IDOA 4WJKB 4P7JA 3FGZA 3AEUA 1H6AA 3M9XA 3AP1A 3JD2A 2YNMD 4QSHA 5DGHA 1PVVA 1EJ6A 1OXXK 1UMCB 4S1OA 4GBGA 3TTSA 5CAEA 4LJ5A 1BXGB 5G0VA 4AJHA 4X60A 4QDKA 3UGKA 3NM4A 3SVZA 1PZNA 3LF2A 4M8NE 3T15A 1FQJA 3RK0A 3OF5A 2BGRA 2B21A 1R5JA 4OHKA 4ZJPA 5IJ9B 5IJZA 1EFTA 3R5KA 2FZVA 1L5GB 5LA6B 2JH9A 1MPTA 2IS2A 1G3IA 5EP4A 2PGLA 2FXIA 2VDKB 2EYQA 2L18A 3VSEA 2H9YA 2XW6A 1H3NA 5EOVA 2LZ0A 3H2YA 4A8TA 4Y6OA 2VXBA 3NGMA 3WWDA 5JV5A 1EFVA 1W73A 5JTUA 1Z07A 3AL0C 4LBWA 2O6LA 1F8YA 4QECA 4XIIA 2GBLA 1OUMA 1Y7LA 1ISPA 4FT4A 1M2JA 2V6IA 4GL2A 1R0KA 2GZDA 1WZCA 4Y18A 3BWCA 4F5DA 1TKCA 4OSOA 1JZSA 3Q88A 3UN1A 5J2UF 1LBIA 5HS4A 4II3A 2YC4C 3SMVA 2VNKA 1YVRA 3QVGA 4HAIA 4DADA 3AVWA 4WY2A 3D4LA 3EG9A 1DTWB 1SVWA 2BEKA 3DDNA 2UDPA 3VO1A 1K86A 4BZPA 4EKNB 1EP9A 4EGFA 4P81A 2ZLBA 2CVZA 3F46A 4MGIR 2JBHA 2C95A 2AX4A 2EARA 2RHCA 3EY9A 4MVJD 1XQYA 4QXPA 1L5NA 5AM2A 1JR4A 1OD6A 3K1JA 3PFIA 4IJQA 4YR9A 3S8MA 2GCPA 2FN4A 3PNSA 1RXUA 4Y7DA 1VRVA 3DONA 2ZR9A 1BN6A 1EVQA 2QN1A 1L7BA 3H1FA 3JQBC 4IJ6A 5K8VA 1KWKA 1CEQA 3SQXA 3PKIA 4UMDA 1L5VA 3L2OB 2Y2UA 4Q21A 4DC9A 3UK2A 3C1UA 4X7MA 3H99A 1EDBA 1QHGA 4Q39A 5JAQA 4ZK6A 2QRHA 5IKXA 3RYIA 5I7SA 1W1UA 5E2AA 1RKVA 4OPMA 4RY0A 3N2LA 4FCWA 2ZYGA 3PA6A 4H7PA 1OZAA 3UXMA 2JGAA 1CY4A 1OF1A 1DFIA 1XDGA 3U1TA 1E1CA 2BFFB 5L4LA 3E2IA 3EPPA 5BVHA 3L7JA 1B00A 1DDIA 1T3GA 1UOQA 2XUKA 4CF4A 2VQFB 3IODA 4LE0A 3WB1A 1E6CA 3GLHE 2ZWAA 5GM1A 4ZDWA 5AT1A 2G04A 5TGDA 5SYNA 4GL4A 3KYIB 3KWLA 3LE8A 3UAZA 3W9YA 5LNK6 5DHSA 1XZNA 2EAUA 2IT1A 2QORA 1ZUHA 1RMYA 3NX4A 4X85A 3IT3A 3AUSA 3E8XA 5A9RA 5F98A 3ROFA 1T8SA 2W6NA 1FLNA 4FGLA 4D42A 3AU9A 1WXGA 1AQUA 4FYPA 4NV1A 4A92A 1JXOA 1RZRD 2AWOA 2Q41A 2AXEA 2VS1A 3RARA 3H3XA 1J2EA 4NESA 4ZU6X 1QP4A 1AKUA 1BGVA 3EVEA 3H97A 4GW3A 4V38A 2DGDA 1ORTA 1T9KA 1F0KA 2ODBA 4LNAA 2FPIA 2IHNA 3QELA 1E5DA 3IMEA 4GMHA 4RPCA 4B83A 3O75A 2IUTA 4QULA 3TOZA 4RD2A 5INTA 4YACA 3TLZA 1FMCA 1H22A 1W29A 2I7XA 3ECCA 2OKGA 1W0JA 3KPYA 4R84A 4ZT4A 3UHPA 5T6MA 5A03A 1NNI1 2BJWA 3HU2A 2HDHA 2DRIA 3FUVA 1WF6A 5EEHA 4RF5A 2R7AA 1G5RA 1E3DA 2VK8A 3G5TA 2Q5LA 2J3QA 1N5RA 1KK0A 1TFRA 1TK2A 4AG6A 4FHGA 1YRLA 4RTKA 1AA9A 1LJ8A 3BS4A 3JYHA 5KI6A 4FNAA 4R9RA 5ELXA 1E1KA 1C3OB 3DTTA 5DW3A 5AIBA 5F7XA 1P7WA 1OC2A 4C7MA 2DHDA 3BT7A 1JIVA 5ERGB 4XEHA 1L5WA 2C29D 3NBKA 2REXB 4HAZA 4OBWA 3TVDA 4AMYA 1Z3CA 5EHXA 3VU9A 1U2DC 3ANSA 3ZUPA 1JE1A 1Q0ZA 1ZPDA 4I50F 1QO0D 3KZXA 4EO4A 2ONZA 4HQ6A 4QFBA 2A1TR 1RQRA 2NU6B 1TL7C 2PH3A 3H8SA 4UEQA 5TR9A 1Y3DE 3KYJB 1IXZA 1GD1O 3FDZA 4JMPA 1GAEO 4RHEA 5I4BA 4DF3A 4UU1A 4ZOCA 1NVDA 4OVKA 1N6HA 4IHKA 4N3NA 3VR0A 1I0LA 4D81A 1WHTA 4XYMA 2GXSA 5D84A 5AKKA 2DSNA 5BXQC 5JRJA 1GSIA 1TCVA 2E4YA 3AIKA 3LPAA 4V0KA 1TQDA 2I71A 1QPGA 1U3DA 2DQKA 3FF4A 4G97A 1QFYA 2ERYA 4RF4A 1JLMA 5LP6F 3KKQA 2ZM5A 2ZIZA 1CX9B 3TZEA 4KWIA 1C1XB 3QEJA 3FZGA 4M8KA 2MJLA 3VDNB 2GYVA 3NBZC 3F6PA 3DTVD 3M4XA 4N5IX 2F48A 2QQ0A 4EWLA 4F4UA 4BXOB 3BH7A 4JT9A 1PFYA 1NXPA 1RWXA 2B37A 3LFTA 4BATA 4YONB 2E85A 4HYEA 5DI3A 3MWDA 2H1HA 2Y2VA 4E11A 1E6EA 4D9KA 2VH5R 3S3TA 3QKRA 3UMGA 4B47A 1Y1KE 3K09A 1PDVA 4GYWA 3GGOA 4PHGA 5EJGA 2AJCA 4GDMA 4CR8A 1GPDG 3EASA 1EEHA 3P45A 4OB8A 5EMKA 1AF7A 5BURA 4X66B 1SVNA 3OPXA 1SUCA 4Z3OA 1KAOA 3OZ7A 3BEOA 3H2ZA 2P27A 2Z2IA 1Y9JA 2YIJA 3QPCA 1YZGA 1M7BA 2AH5A 2XWBF 1Y37A 4U7DA 3PUVA 5G41A 3ZWVA 5KX5F 1RYDA 4TLAA 4CHGA 4A9AA 2I9KA 1UMBA 3HJRA 5LDDC 2ZRDA 4CUJA 2PWAA 4OK3A 4DGQA 1G8HA 2GWRA 4F6RB 1HNXB 4A8HA 3G17A 4WFIA 1P0IA 1UP6A 3NIFB 4KQXA 4BKUA 1E64A 5DIZA 1NVAA 1ORRA 1ZM9A 2ZQZA 3BAZA 3DDUA 3KV3O 2ONJA 1OA0A 3A37A 4KRGA 4MI3A 3K0SA 5GZ6A 3KVVA 2XWJI 3R09A 4J7XA 3W7VA 1IZ0A 3CPHA 4BTVA 2GPWA 2R00C 3OCJA 4JJ6A 2WQ7A 4R1NA 3ZJ5A 1A1SA 3D6TB 1U2ZA 4KX5A 4PRKA 3SS8A 1P4HA 2XCLA 1MIHA 3IV9A 4B87A 3LZDA 5B30A 5HUHA 3GAAA 1M33A 1X0XA 2FUG6 3MVEA 1ZGHA 4AUNA 1QH1B 3NJRA 4DNOA 2NTEA 3U3DA 1JMKC 1JZTA 2H4YA 3UKJA 1E59A 2IJGX 4TSKA 2Y1CA 3TEJA 3U7IA 3ZWXA 3U0BA 1D2MA 1LSUA 3OM8A 3N2KB 4HH1A 4QOJA 4YPFA 1DRVA 1HLPA 5BN4A 1PYOA 1SVKA 4LF4B 4LPSA 2COKA 1QQAA 4TMFA 2QZSA 3P2KA 4RY2A 3R3UA 3TRIA 4W5QA 1H5QA 3VVBA 2X9VA 5J2UA 2YL2A 2AYZA 4A2WA 1Y5MA 3VAZA 4MR7B 4RACA 4TWIA 3TIFA 4H7KA 4DLAA 1EUQA 4QNMA 4DANA 1M8JA 1UZUA 3E0XA 2J3DA 2OBXA 3COSA 3JD3A 1KQ3A 1PL7A 4RHYA 1L6RA 4YWHA 1ECLA 2HF2A 2IOHA 3T7IA 2JAQA 3GG2A 2VAPA 3NCTA 4H0CA 2FV8A 4AF8A 1TTHA 5HFAA 3U5ZB 1FDTA 1WKCA 1Z5VA 2HQRA 2Y8EA 3CKLA 4NS1A 1SD2A 1ODJA 1OWOA 2OCIA 2RI1A 4O2AB 4TL7A 3DSRA 4BO7A 2CLSA 5C80A 1FU4A 3NM6B 1YFLA 1RAGA 5K6AA 4UHJA 1HQCA 1RACA 2IKSA 3IMCA 3SFTA 4CKCA 3PJFA 3DMGA 3ITDA 1VSBA 4ZMSA 1THMA 1X8JA 3G6WA 1EWVA 2BI8A 4FWBA 2XDQA 1FFDA 2P7IA 4MRAA 2ZRLA 5FNVB 4D4MA 1TK3A 4BJ6A 3SYMA 2CHUA 5JD6A 2AKAB 1RLJA 2ZI5A 2ZJBA 5REQB 1FUKA 1FY2A 1SHLA 3N2GB 1CRPA 2YHAA 1P2GA 5K8UA 2G80A 3CNLA 3SSMA 3R44A 3PEFA 2X3YA 3EOZA 5GM2A 3D0KA 5F1YA 4FLEA 4JI6B 1VE7A 1QS0B 3WB9A 1P0MA 2FKNA 1XVTA 4YFYA 4Q82A 1LS1A 3DQZA 4URHA 5LWHA 1MB2A 5KNCA 2V1UA 5AH0A 5EP1A 1X7WA 2GZSA 3CRZA 4BNUA 1ISMA 4UE6A 2RG7A 3TIGA 1YBHA 3ND7A 4XQ0A 5ULLA 3GWGA 3PQ2A 3RS7A 1JXQA 2LNDA 4I5DA 1RAEA 3MJDA 5FUVA 4ANFA 4YJ3A 4K9KA 3MIZA 3Q9LA 4FD2A 2BIFA 4EW6A 2X5KO 2W4IA 1X2BA 1XKLA 3USCS 3ED1A 3OP1A 2FU5C 2KW5A 4LS3A 1TLLA 4G5SA 4NAUA 2NTJA 3T3NA 2HB6A 4N3AA 3BXOA 3QXCA 4BNJA 4Z0NA 5KWVA 1JS1X 1LKZA 2ORED 2OXFA 2GEDA 2VQ6A 1P0FA 1YKGA 4EG3A 1T4BA 4ZHQA 4GOOD 5LM3A 5JDCA 3P9ZA 4YDHB 3AM3A 4EITA 3B6IA 4YMWA 3C3KA 1JB9A 3WQRA 4WT7A 4C0JA 3KYBA 1Q92A 1SOUA 1EWRA 5CA0B 2C7GA 2ICAA 2A14A 4U6QA 3HJFA 4F7DA 2C59A 1VFNA 2ZR0A 5F12A 3ZWQA 4D8XA 5AVSA 3BDIA 3SMQA 1T2DA 1GVNB 2FWJA 3D3KA 4JC4A 4PAMA 4PO1A 3FZYA 3LF1A 5DM0A 4CM8A 2BW0A 2F9MA 4I4TF 1XPUA 1O6GA 3MUFA 2HHAA 3ADKA 4YMIA 1GL9B 2ZREA 1PDWA 1PLLA 2Q5CA 3IUPA 2ZG6A 3KXDA 4HDMA 4P33A 4F21A 4MVJM 3EK2A 2VDJA 4MHOA 4BNZA 2EP8A 3HJNA 3O74A 4S1WA 4BO8A 1M2KA 1VZ2A 2H7CA 3FYDA 5IXYA 3AILA 2VYFA 1CUXA 2JGDA 1YIDA 3IIMA 1L4FA 4R54A 2CV1A 1N6IA 5HHTA 3AEKB 2X4DA 1T0UA 2IELA 3NHLA 3RFUA 3S0JA 3T38A 3BE6A 1Y6JA 1UF9A 1A9TA 1A72A 4DB4A 1N1EA 2HA7A 1ULBA 3DBRA 4LJ6A 1GU0A 3PNOA 4B6OA 3V1LA 2N1MA 4AB1A 3A14A 5J5AA 3V7UA 1N0VC 1CETA 3ZY6A 3ZE6A 5BUQA 5C53B 3NHRA 4NDZA 3GLHB 1XQ9A 4XUEA 3SICE 4A8JB 3H5IA 2WI8A 1KO1A 1NJ8A 1PR6A 1TRKA 4KQMA 1DP4A 5AKEA 1X92A 5HDBB 1UXJA 4MS4A 1FRFS 5C8DA 4RK5A 4OI1A 3U60B 4ER3A 2HU7A 2Y6UA 1G41A 2GTPA 4G6ZA 7ABPA 2HV8A 4P7FA 3VYUB 2WPDA 2QW8A 5KOIA 2BONA 2VJMA 2SBTA 2ZVJA 4GX5A 2B9VA 5DNCA 4L27A 3V1YA 2P4SA 2W4QA 4LN1A 4OXIA 5HK9A 2D1RA 1QIDA 3F6BX 3PJEA 2V8OA 3E03A 3EWIA 4L5JA 5BSTA 4R1QA 4UHBA 1C8LA 421PA 2ZUUA 3UMSA 4E2ZA 5AK3A 4CI9A 2ZU6A 3CF0A 2P2GA 3EH1A 3THWB 1B43A 3K9NA 3WJ2A 1XRRA 3I09A 2FMTA 4QPNA 3Q87B 4AO8A 4Q3LA 4HNSA 3HR8A 2ETXA 3JRNA 3VFDA 1QIKA 1DC3A 2G70A 3FYHA 3KQTA 2P9JA 4RJKA 3DWFA 3VU1A 1Z4LA 5HE8A 4DLVA 3C70A 1PNRA 4BMXA 4Q7MB 2WNHA 1UBOS 3Q9NA 4B3FX 1L3IA 2PAAA 3MT8A 1CHNA 1BE6A 1HK7A 1QVRA 1XHEA 4HWPA 4C29A 5TE9A 1Y3HA 3CC8A 4PG5A 5TPZD 3SF8A 2PMWB 4QG7A 1VKZA 1VKOA 3LC1O 3RK1A 3TRKA 3R3JA 2IHUA 2WSSD 3EXFB 2YHUA 3BB1A 3EGCA 3FSGA 1RBYA 2OB1A 3G2QA 4RJTA 1S2OA 2BEUB 5B7GA 1EFHA 3VOBA 4JITA 4KPYA 5FLYA 1PT8A 3IUYA 4GMGA 4URYR 2TMGA 1AO0A 4QPZA 3NUQA 3H87A 4IILA 1UIMA 2JJQA 3HO6A 2V5UA 3JRWA 3NFRA 1N2CA 3PB3A 4HEHA 5IT9A 1XLUA 1VI2A 3BRWA 3UC5A 4TKVA 1E4EB 3RPEA 1NXOA 2QRVA 3RBXA 3SX4A 2AC4A 1YXMA 4OI4A 3TSZA 2AFIE 1NM5A 3WLKX 1OGJA 1QH8B 3GFVA 3FSJX 1EUDA 3IBSA 4CJXA 3DBVO 5H68A 4FKZA 2YINC 5ANRB 4QVGA 4JLPA 1Q0SA 2JASA 5AKLA 4JI3B 5JAHA 2NYRA 1KO5A 1NMYA 1OW3B 2I34A 4I66A 1M1NA 4KOAA 1EHCA 1DCTA 1VCHA 3U3MA 3UICA 4FVTA 2YWFA 5L3RA 3WRXC 3GLGA 3L84A 5TC4A 1FNBA 1VI6A 2ZB4A 1DWPA 1YRHA 1Z4NA 1E66A 1B74A 3NVMB 5J5VA 5I47A 1YS6A 1YR2A 1GL3A 4JYMA 4XCQA 3SQLA 3K6SA 4I14A 5C5DA 3QBJA 2ATCA 5IK2A 1FNNA 3JRXA 5DE3A 4GPAA 1V16A 1MFZA 3KQUA 4EOGA 4MLCA 4WCFC 1N1MA 2O1XA 2QN3A 4LWQA 5CB4B 2AOXA 1LZKA 2AEFA 1THZA 3P0IA 4IM7A 4LXIA 3CMCO 3TG2A 1ZHOA 1BHO1 3K1TA 1HT0A 4CEIA 3CM0A 3K6RA 2PZGA 2RGDA 1E2NA 1DEOA 2GBFA 3HHPA 5K0FA 1CIVA 1DQYA 3CFYA 2C82A 3EDMA 3EGOA 2J4FA 4OIFA 4EB3A 4RTOA 3HDJA 5T4BA 2H0RA 3ZE1B 2YRXA 1PR9A 3MOSA 3GHYA 1XTPA 2GZ2A 3NT5A 1MFPA 1MCZA 2X5XA 5KNDA 5L4SA 2YRFA 2HXGA 2NZYA 2MWMA 2Q6LA 4C07A 2CV2A 1V4NA 5EUBA 3DKVA 5H9WA 3AO0B 4B3CA 3L49A 4KDFA 5BYAA 2P0AA 1AHNA 1QYXA 2BVNA 1BYUA 2OYCA 1C4OA 5LQRA 1CUIA 4KN6A 4LRWA 4MKXA 3SBEA 2A30A 4MUJA 2B69A 2R86A 2VATA 3IBTA 4PGMA 3TL3A 5GVRA 1ML4A 1RLMA 3DLCA 4HFMA 4P1ZA 2BFMA 1QHIA 3DBHA 4E15A 1KEVA 2FMIA 5JRDS 1Q1ZA 3HCOA 3OCUA 1K08A 4LQDA 1M2VA 4LRQA 1EQ2A 3PEYA 1XXLA 3U6BA 2NTNA 2JVKA 2K87A 4QAJA 3H16A 4QRDA 4ES6A 4R1MA 2G71A 3VRHA 3RJ5A 1AKQA 2OCKA 3UZUA 3ZJ4A 5HBGA 4AX4A 5B1EA 2PUEA 5IN5A 2QUKA 4XAQA 4QEKA 4WXYB 3W9UA 2MSKA 1ENZA 5ALOA 3L77A 2O5VA 1FQKA 2D0DA 5FOXA 4ER6A 2WFLA 3PFCA 2EYUA 3AR8A 1PR0A 2RCYA 4CQLA 5KJFA 5DM4A 2W71A 1LPAB 4JZYA 3U3OA 2OCGA 4R05A 2QJRA 3MJHA 5AVOA 5C8YB 4CIYA 1KOGA 4B35A 5EGSA 1GZDA 3EF0A 4PFKA 2X8AA 3C7DB 5AESA 5JYEA 4GSYA 4D4HA 2J6HA 13PKA 3WKEA 3TZ6A 2VHUA 1SCUA 3R77A 3S70A 4J76A 3B6EA 5DNVA 4WOCA 4XOIA 5IDYA 1CDDA 3KVNA 4RLFA 5IWAB 2UV8A 1UWLA 1ZR2A 4QGFA 3PXAA 4AWXA 3LTNC 1E8NA 2XXBA 1IATA 1YZKA 3DPIA 4YDQA 3MJSA 2JFPA 2PSDA 3JWEA 1ZVKA 2ZRIA 4E12A 3O4VA 4XM1A 3VR4D 1TRHA 1NUHA 3GJ7A 4X45A 1VCNA 1HFJA 1G6OA 2XCQA 4LXHA 4NYMR 1M2OB 4M76B 3DFMA 5AW1A 1O87A 4FGJA 2NUPA 4P84A 1PK7A 5HNKA 1MG5A 2PKQP 1USIA 2IW3A 2VI5A 2Q8PA 1Q7GA 1WMEA 1U9ZA 2I7CA 2UZ3A 1TFUA 3WTCA 4CDNA 2P5UA 4G0PA 2BFCB 2XQJA 5AW6A 2IGTA 1Y7TA 1NX6A 2II6A 1N5OX 2BGMA 3KJHA 5IBQA 2AL7A 4LKOA 3ANMA 2PEYA 4UAUA 4GD3Q 4F91B 4R69A 2PPLA 2EJTA 1DG9A 2VQSA 4B46A 1XV5A 3I2JA 5IHXA 3JASB 3NETA 4TWJA 2OYSA 3REGA 3GVXA 3UUWA 1ML3A 5A6SA 4BASA 4JI1B 4OGWA 3ZHXA 4EY3A 2IF2A 5BW5A 1QTQA 2IP1A 2D00A 3BGSA 5K0TA 4PO9A 2ZGVA 1OH6A 3CCCA 4Q3CA 4UVDA 3T5CA 1C9YA 1JHRA 1KJWA 2H8KA 4R41A 4CCWA 3OQOA 5H80A 2WVJA 3UJHA 3G49A 4M87A 2A2ZA 3L7MA 1SB9A 1PL8A 2HU5A 5E95A 2W6MA 4PR0A 1DX4A 3OX3A 4B6GA 4BV8A 1U0SY 3IULA 4YA6A 5FOWA 1WCYA 3KQWA 5I7AA 3TDMA 4E4TA 3U1VA 4ME6A 5CITA 2GB4A 2XE8A 1TA9A 3B52X 2CLCX 4KQCA 1I30A 4G1MB 4O4LB 4PIVA 5L3VA 3DKIA 4H1VA 4KK3A 2LDBA 3T1VA 1KBQA 1M1UA 4MQEA 3SK0A 1KMMA 2DHEA 3AU8A 1SRQA 4YAEA 1PWXA 2FE1A 4QAQA 1JIIA 1BDHA 4NARA 5F77A 5A4JA 3FGNA 3NPMA 1VC2A 1F1BA 3WYEA 2JJMA 4I2VA 5TPWB 3LUAA 1N0HA 3OFND 5EG5A 4DLYA 1Z0ZA 3OQ1A 4PC2A 2C5GA 1KY4A 2YN4A 2ZJFA 1T5SA 2PQ2A 3EUEA 2BEVA 4J07A 2JJ2D 3KZNA 2J9RA 3SZRA 1L7DA 4I1PA 3F3SA 4FDLA 4AFNA 2XVZA 2WWWA 2PL3A 4B73A 3THYA 1KTVA 3LNCA 1NONA 3U26A 4CF3A 2DBQA 2ZOSA 5KVVA 1M6WA 4N0EA 5FBWB 1GSOA 3WWYA 3V4VB 3EEFA 2HJVA 3ZYZA 5K0CA 1DKQA 1MC1A 3BL8A 1KMNA 5GTDA 5CNMA 2A1UA 4QU0A 3O1LA 3VYRB 2GBPA 2V45A 4CG0A 2LW7A 5HKBA 2I55A 1QZ3A 4XWGA 4V03A 2Q3JA 1UM9A 4OX9B 3I2GA 2Y67A 3AQIA 4JVNA 2YMPA 2C7BA 1OBFO 2RHRA 5KSZA 5BV2P 4ZI7F 2OHXA 2PG3A 3OZBA 3RHSA 1OJ7A 3FNHA 1E0SA 2H54A 3UJAA 3HSKA 3KKKA 5EA2A 1CUDA 3ZE8A 5BWOA 4HF7A 5LZ4A 4EEKA 1SD5A 4FFNA 4NULA 4NZYA 3OC6A 4ND3A 1WB9A 2O8BA 3EQ8A 4MHSA 1AKEA 1C1DA 2FTKE 2YYYA 1DCKA 5K3EA 5KTRA 4JVOA 3RSHA 4BCCA 1OB5A 3W5IA 3OEEA 3Q7PA 2BFAA 3ZQ4A 1ESMA 1WB6A 3JD4A 3PHIA 1S3IA 2CT8A 3C5CA 1GDDA 5K3BA 3DD5A 5DNEA 2WD7B 2RARA 4IDDA 4UM7A 1SQ6A 3TQOA 2XH8A 5B6PA 2HJ9A 4MW5A 1Y33E 5KYWB 1M66A 1QVAA 4C89A 2AFRA 5C1PA 4KIUA 1KY2A 5SZHB 1L5SA 3SQNA 1ZK3A 1V7PC 1TXGA 1GKLA 2JH3A 2RGEA 2O8FB 5IMBA 2DVMA 1RC0A 3TTYA 5LLSA 3IAFA 4BQRA 1PQPA 2DWQA 4PBRA 3F2VA 5DXAA 3ZDEA 5KJ6A 2A33A 2JBAA 1UBMS 2OM6A 4GYJA 3ONWA 4B4KA 4C7OA 2XY4A 2NNWB 4DYHA 2HY7A 2D6FA 1WZ2A 1ZNXA 4UQPA 3VPFA 3W79A 4OAPA 3G89A 1G8FA 4DBLE 2Q50A 2RI0A 1Z62A 4E88A 3AH8A 1DJQA 5GONF 1T9GS 2J48A 1RWNA 2J9ZB 1D8AA 5TVGA 3GYGA 5ECWA 3ZHSA 4KPGA 4V0LA 1C5KA 1HEIA 2ZSBA 1K7CA 1L4KA 1W5SA 3E48A 3KR0A 1E9EA 1R50A 1YCDA 4DCUA 3PFNA 3DV2A 4PRZA 1IM8A 2AJBA 3QE2A 5G3ZA 2J6CA 4D2IA 4ETIA 1L0BA 1CS4C 1Y81A 1B76A 1JEAA 4PY2A 1SEVA 1LLFA 2CL7X 4GX2A 4CKWA 1IHPA 3T3PB 1MO6A 1XFDA 1HQYE 2HSEA 2Q27A 1BMQA 4YJ2A 2IHJA 3QP9A 2B3DA 2D1YA 3WBBA 1OXUA 2GZ3A 2WPNA 1U94A 3ROKA 4CIBA 1K63A 3QF7A 5TVKA 3IV7A 1U63A 3OU7A 1RM4A 3GP3A 2FPRA 2H11A 4TV9A 1YRYE 3I6IA 5EWLB 4OQQA 3G0GA 4G0MA 1RRKA 4HHEA 2PSHA 2NPFA 3JALB 4K6OA 4HQLA 1E2IA 3MWJA 2BGUA 3SLKA 3VZCA 1LPBB 1G5FA 2XOEA 1U3TA 4R3WA 1AKRA 2P6PA 5E4YA 3V8RA 1KI6A 2R4TA 5E7JA 2H85A 3FYTA 3LDFA 3WGJA 3PQEA 3H11B 3PF9A 3TRDA 3JX9A 1NW3A 4K9OA 4R2LA 3ENKA 3M6XA 3RIGA 3NDRA 3UAWA 1LSSA 1R6DA 2J7PD 3FPKA 3AM5A 5FYDA 3WMEA 4LXTA 1CSEE 3FCCA 4G5QA 3ECAA 5FUXA 1OXSC 4O4HF 2JLVA 1TCBA 1UXOA 1SBCA 4IDGA 1CE8A 2ZATA 4J91A 4TXJA 1J23A 5B1YA 2C31A 1WPRA 4CLOA 1M1ZA 1ZBQA 3DNMA 5KWEA 2I2BA 1E6UA 3ZQ6A 2P78A 4HQOA 4WN3A 5JAMA 1OKKA 3CZ4A 2XODA 4HDKB 3EZFA 1SULA 4BKPA 2JC3A 4KVZA 1GGHA 3R3HA 1MC8A 3WIBA 3WO0A 3MD0A 2GCOB 2PXAA 1Q57A 3LUPA 4HB0A 5BNIA 2X2EA 5D85A 1QBGA 3DEFA 1PTJC 4Z8YA 1Q7TA 2R7LA 3PDHA 1ES9A 3L6EA 1ZEMA 2RK3A 2JVIA 2W6IA 4JJIA 3ZNPA 1Z6XA 3FUWA 3HQ4O 1IZ7A 1CZNA 1W0KD 4HRXA 2JFHA 4RGQA 4TOIA 4AYTA 3G9XA 1DUVG 3A2MA 2G67A 1SXHA 2WFZA 1HMPA 3FR8A 1J0CA 2NO0A 4X3PA 2V59A 1KVUA 4A26A 3PDIA 2RHDA 3SEQA 5CBKA 4HNTA 3ACBA 3OTQA 4M89A 3KBBA 4UCQA 4AU1A 4YJGB 3LP5A 1PFKA 3KLBA 4JSYA 1JSCA 4Y2VA 1QONA 5E4TA 1NN1A 5T67A 4HVLA 4MYCA 2BTQB 1GCUA 2BSQA 2AE2A 4EENA 4U0KA 2OHFA 4DV5B 1AB5A 1QAQA 3LXRA 4NCNA 1KHTA 3BEDA 4FN5A 5D86A 3VGJA 4EX7A 5IC6A 1IZYA 1L7MA 1USGA 4PNEA 3JARA 1RT9A 4F6LA 1T8RA 1ISSA 2C7RA 1ZH6A 3D7RA 4IJMA 4LHVA 1Q7BA 5AI8A 4ZZ2A 4QXQA 5ALEA 4ZXPA 2GHTA 5L7YA 2ZAGA 4A1FA 3FVWA 3LCRA 3R6DA 2PDAA 3OLVA 221PA 3CKMA 3HXQA 1ZJ6A 3KX2A 3A8TA 3TSYA 1GFZA 2HC9A 1RXWA 1XU9A 3HNRA 2BDEA 5CM2Z 2FXVA 5ALTA 3I52A 4S04A 4M1SA 3A7EA 5JAOA 4IY1A 4TZ6A 3V48A 3NYIA 3JVDA 4I9NA 1GQYA 4LOJA 1GEEA 4ZCTA 3T5AA 5IVIA 2FG6C 1NVBA 3BXEA 3X1DA 1E2FA 1MR3F 4J16C 3KXKA 1O96B 2YYZA 1R16A 3D3JA 3IDFA 3IDSA 2CE2X 2G63A 2IY8A 4G41A 4RBNA 4C6TA 1YQDA 2IYLD 3T7RA 2Q7DA 2KX7A 2PEZA 3H1GA 3HYLA 4Z9BA 3VDXA 4DIEA 2ZDGA 3L0BA 2PMFA 5FOVA 4C20A 4E08A 3I5YA 4PAWA 5AOVA 4JI4B 1CYEA 2IEBA 2CDRA 2IVZA 4BGIA 1SCIA 3HL0A 1T1SA 4ZZ1A 3MRTA 2BGTA 2W8BB 3WAKA 1U9IA 2NIPA 5TMEA 1E20A 4D79A 1P6QA 3EA4A 1Y89A 2WE8A 2QVLA 3FETA 1LDEA 1Q0LA 2C3OA 2JEYA 1TCAA 4MUIA 2FPUA 3MNFA 3L92A 5BSFA 3ZDFA 3CONA 2BFEA 4IFBA 4MS1B 1MQAA 3RROA 3OLXA 4Q4CA 4OQDA 4CR7A 1EXDA 2ZB3A 4Q00A 3VVCA 3MRXA 4DLRA 1Z39A 2DWUA 3T9EA 1JVNA 2EBUA 5BORA 2P6UA 1YRQA 4TM7A 1GQQA 4LY0A 1M7GA 3EFHA 3PUWA 4B6SA 4UMVA 3FB4A 1H93A 4DQUA 5MN6A 4UHEA 2ZITA 1I5OA 1FSGA 4ZVVA 2YZKA 3X2FA 3BWXA 2J4DA 4RY8A 3UHJA 5JS2A 4AIIA 1PR5A 4UHCA 3LK6A 1WDLA 4UVHA 4C0WA 2I1VB 2WUWE 3DB2A 5J4LA 3MG9A 4UFNA 3V4FA 2RKOA 3BJZA 3JQGA 3N6VA 4W6ZA 1JJBA 2C57A 4G5GA 1D0VA 1L7OA 2CXQA 2VP9A 2ZRPA 3GEGA 5DP2A 4Z0PA 3OPYB 1KSJA 3PFHA 4CETA 4CCYA 3EPKA 2QE6A 2WIBA 2YJTD 1JF8A 5JZMA 1DJPA 5FX2A 1RBQA 3RQSA 4WESB 2Y3IA 2VZ8A 3LPMA 3T7TA 4DEXA 5JUWA 1FJXA 1I24A 3EXEB 1I0IA 1SUIA 2C4WA 2J9FB 3CURA 3FR7A 1JQJC 1LDGA 1OT3A 1R0XA 4LYHA 2B0CA 3CMMA 2ZI9A 4M54A 3T9BA 3A1SA 3WL5A 4UM9B 1JHOA 4QQRA 4EI7A 2XA2A 2ZTHA 3L4SO 2NZ8A 3LY5A 2WZCA 1ULHA 2ENUA 4RGBA 5I7RA 4HCJA 1ZITA 1COWD 1MRZA 2JFYA 2P9ZA 1DAPA 2Z43A 4GPZA 4X64B 2YFQA 3LLVA 3AWDA 2G9RA 3KZOA 1GTJ1 3V4OA 4DTCA 4LX0A 2WF8A 4JBGA 5IJAA 3EGIA 5FWYA 3QWHA 3Q5GA 5J43A 4Z7OB 1CDOA 3HSSA 3I76A 2BGNA 3RREA 3KQKA 4HBGA 2FEMA 1C9JA 1I5EA 2ILVA 3F4BA 2ODPA 4NK5A 4WNAA 3TNYA 4AJ9A 3OJEA 5CA1B 3AB3A 4X1YB 2YXNA 2AOVA 2J6IA 3DZHA 2FLWA 3ZZUA 3RB8A 2UVDA 1DRKA 4WY5A 3OMLA 2O8EA 1WR8A 2GN6A 4FGSA 3K1AB 5TEVA 3TFQA 2GCIA 2J5BA 3RUEA 4JKIA 3NKLA 5L95A 1DSSG 2HA5A 2O2IA 3RSSA 4ALKA 2F4VB 1ISGA 1VJ0A 1IXYA 1BEUB 3ROQA 3UMVA 1OXTA 1HT1E 3V2GA 5JU6A 2I65A 5JVDB 1E96A 1QHFA 2PWPA 2MSLA 5BRAA 1AE1A 1NQWA 1B23P 4A91A 4YXWA 3DMDA 1R6VA 4OSEA 4OI0A 3DZFA 4LK3A 2PRKA 3PYLA 1YR1A 3T6KA 1NDUA 1IPHA 4C6RA 2BUBA 2PIAA 5FPQA 1HQKA 2OGZA 1C2YA 3EFEA 4IO1A 4EJSC 1Q0TA 1C30B 3WIDA 1AHPA 3UUGA 1RYZA 2YZMA 3Q7IA 5ESWA 5HIMA 4MDYA 5JRZA 3ADPA 1OYWA 3DC7A 3L8YA 4XWTA 5F64A 4LJSA 1MO5A 3RF7A 2GETA 3AERB 2OHJA 4JLUA 3B2NA 5BUCA 1WZNA 1YQWA 1FP4B 4NFHA 4RAQA 5D7BA 3QF4B 4US2R 3ZI4A 5KNBD 1W88B 3ROXA 4D8WA 3K6JA 5CFQA 1N9GB 4KTTE 4R2WA 3KNZA 1TJNA 4YGYA 3WGLA 2G36A 2XGSA 2Q2NA 3NTLA 3R0VA 1XDWA 1MB4A 2W2KB 3CEHA 3DE2X 3MTGA 3O82A 3PXXA 3R0JA 1YE3A 3AUUA 3M5DA 1AOXA 3CZCA 3RS4A 1G20A 4ZT2A 4EHKA 3SHQA 4NF2A 4JXXA 2OTCA 2IE0A 3MXTA 5D87A 3EBLA 2NT4A 1DEXA 4DV0B 2FZKA 3FBWA 3K9FC 1OI2A 3FYUC 4LF8B 2BFDB 1XTTA 2PMCA 3QU7A 1TEVA 1U8TA 3NANA 2QYSA 4UW9A 1RW4A 2YDYA 4PTLA 3HK2A 4B3XA 4G2NA 5FOUA 1A97A 3FKQA 4CMKA 4XXHA 1ZUD1 1D9XA 4NXNB 4B2IA 3WWPA 3G2PA 1OT5A 1AG9A 2IQ5A 3MGCA 4QFMA 5EPUA 4F72A 5H4HA 5EVCA 2GK3A 3G8YA 3FDFA 3DYIA 2GD1O 1WVGA 1LXCA 1AVTA 1P7CA 1Y6FA 1UBEA 1ECGA 4UDOA 4OUDA 2JD1A 5M29A 4KYVA 2A59A 1H3FA 1T5BA 2AZMA 1GCAA 2EQ5A 2XE7A 1PYGA 2V7XA 2ZIXB 3IBYA 1AQIA 2FCRA 2VDWB 3N2NA 3Q1LA 3E9QA 4PCLA 5AI9A 4NONA 1F4PA 5C9ZA 1I2AA 2IYSA 1ACJA 2YFHA 2D0PB 2HN9A 1BWPA 4HN4B 1W0JD 4I1OA 2FQWA 5DLYA 3IHWA 2UXDB 4P3KA 2PZMA 1NFFA 2QF7A 2IEDA 3M3PA 1LA2A 1NURA 1Y42X 3TTVA 1NJ2A 3I9OA 2OZKA 3GY0A 3GI1A 3TK1A 2Q46A 4D57A 3TLGB 2VZEA 3ABZA 4C3OB 1PF7E 4B4WA 5CVDA 3AR3A 4OGKA 3C4VA 2PZ8A 5K4GA 3UYKA 3LFHA 3O4HA 4BMOB 3NS7A 4P3NA 3OG9A 4CIVA 4LISA 2GN1A 2DHQA 4EW1A 1P62B 2PUWA 4ZCRA 1N6PA 4HLUA 3VSDA 4C2BA 3S2GA 1O94A 3KUKA 2Y0BA 4PN3A 1H2ZA 3L0OA 4NRDA 1AQ6A 2C9MA 2HRBA 2Q8QA 2IITA 2YHIB 3P0RA 4IGAA 4HG2A 4HC4A 3CPEA 2C2XA 4HRAA 1VE5A 5GY7A 5DMXA 3IDOA 4PV7A 3HEAA 3PQ4A 1VOTA 3A3YA 4INOA 1KAMA 3M4YA 4O6VA 4EUNA 1JH9A 5EEGA 3F97A 1UT8A 2H48A 2XTMA 4AY4A 5A9TA 2ZSEA 3QIVA 3GFFA 3GRRA 1KYYA 1A69A 1S8OA 3DT6A 4BE9A 1ODIA 2QQ5A 1Q15A 5C37A 5CLFA 4FQ8A 4HGNA 3PQ7A 1GXSA 4LDQA 2Q0XA 1R15A 5BYJA 1AMNA 3BMQA 1V5FA 1SM4A 3C8UA 4L22A 3T3HA 2EL9A 2ZVQX 3EQ2A 1L5HB 3C3YA 4IS3A 4TGLA 1XPOA 1F8GA 3LXXA 4RKYA 1PU2A 2IEIA 5EHQA 3S44A 1YA4A 1JDUA 3QPVA 4XR9A 2YDXA 3MMPA 5CVVA 3VZQA 3IT1A 2W2MA 1RFLA 4EQ6A 1T1EA 6Q21A 1BO6A 1NT2A 4RHFA 3R7FA 3PEEA 5A02A 3W0LB 2G25A 1GZ5A 3EQ6A 2WYIA 3F6EX 1REQA 1G5TA 3CJRA 1D6JA 3I2FA 3ORSA 3TD2A 5E4FA 3ESBA 3TPZA 4BNDA 3BZUA 2OHGA 5KIAA 3B7WA 2CYCA 3EN0A 3QOYA 5LBUA 4RMGA 4MIEA 1K6IA 3HU1A 3DA8A 1O2DA 3CLUD 5CVEA 5IJXA 4C7KA 4ED9A 2BEJA 3SQOA 2VWQA 5CEEA 2NLOA 5FUYA 4BEJA 4J1TC 4CIWA 3S28A 3WVNA 3H1EA 2B4YA 2OPHA 4P54A 4DCVA 5IMSA 1KARA 3EVZA 3PJDA 3V80A 3GLFE 1UMCA 1ZA1A 3L0ZA 5FI3A 3PE6A 4ZRMA 3NWEA 1CY6A 4KDEA 2YXDA 3NBYC 3QFFA 4Y6LA 1XQ6A 4RDXA 4TYYA 2WD9A 4X91A 4ZEWA 4WXMA 1THTA 1OYYA 1XCLA 5JI2E 2O8VA 3AOEC 3OZVA 3NUGA 1A96A 4TVKA 1PV4A 3K0CC 1MAHA 1FTYA 1K75A 1NLMA 2HUNA 2ADOA 4BNFA 5J23A 4DMCA 2KI5A 4GXRA 1YI8A 3PHGA 1TYBE 2NYVA 4PNZA 1XR3A 4O2RA 1K7YA 2K2QB 3G2NA 4EYQA 4NZZA 4JSRA 1G21A 5TRTA 3FCYA 3K1YA 5B3KA 4PZ0A 3VX3A 1USWA 4BNLA 2RDMA 3GN2A 1WXQA 2YY7A 4NEHB 4FOOA 1J20A 3ZY3A 5JAPA 2DUMA 4P5EA 2ZRAA 3ZDRA 3WAGA 3L6BA 2ZYAA 5F9HA 3A6DA 4EL0A 1UODA 1JDSA 1Q2UA 1H4SA 1BKDR 1R9GA 1P5HA 2E5WA 3DJFA 1PJ4A 1PQUA 3FVTA 4M1KA 3LP8A 1IVNA 4YK7A 1DPFA 1DAFA 2WIKA 1V41E 3THRA 3P4YA 4C7JA 3CHYA 5D3MA 1XJCA 2PKRA 2VKTA 5CR9A 3CBGA 3D1LA 5KHLB 1E9SA 4TRMA 1EFCA 5F5NA 5G2OA 1QV7A 1AGRA 1VL1A 1DTWA 4LI3X 2IHTA 2X13A 2JLRA 2XJ4A 3A25A 3E9RA 3QKUA 2PYZA 1V43A 4JU9A 3ZGXA 4I8IA 5KYUB 2O54A 2DQ4A 3NTQA 1RHRA 2IZ7A 4MRPA 4DR6B 1E4YA 1RBZA 1QG2A 1P2SA 1CZKA 4TLDA 3JYQA 1R7RA 5IX8A 2GEVA 3PGVA 3VYSB 4L9WA 4B82A 5K2OA 2RGAA 2ACVA 3AG5A 4GLJA 5FO1A 1P3JA 2JLSA 3UB3A 1U90A 1LPSA 1DJOA 4FHZA 1DAOA 4NCAA 3E0QA 5TGTA 3DXFA 3TE6A 1KEEB 2QG9A 3AEQB 4QFDA 4AKHA 1CUFA 4DT1B 1HV8A 2QRMA 2OV2A 2ZUCA 4TX1A 1H8EA 1KFJB 1JW9B 1QYRA 5A62A 3P1JA 3G8DA 1S96A 1PWZA 3N9IA 3RVQA 1ZMOA 2FSSA 3ZV4A 4BNYA 4CKXA 1Q12A 2AF4C 4YASA 1GPNA 1UAYA 3W5VA 1PD0A 1RD4A 3C6XA 4Q48A 5FR2A 1JDTA 3QKTA 2Z4RA 3QU5A 2P2NA 1U3UA 1ZM2A 3T06B 3PC8A 4C0BA 1Y7IA 2FSIA 2D5AA 2IPMA 1C50A 2I33A 2NO5A 2UUOA 1JDVA 3CN7A 3HLYA 3ZTYA 5EJAA 3NWPA 4ICIA 1PFWA 4CLDA 1HBJA 1WPXA 3FJ1A 3FPBA 5BXYA 4X6LA 5KNCD 2I6GA 3OQ6A 5GVSA 2V55B 4C0LA 3R5XA 4KAXA 1BQ3A 1Y4AE 2FMHA 4MS3B 1VHLA 5I9MA 5K1ZA 1D6NA 2XIJA 1VECA 4EY8A 2C78A 1E7QA 2QP4A 4RFSB 4TUYF 1XF1A 2ZQYA 2W2XA 4YAIA 1U65A 3S2EA 3BG5A 1TUEA 2PXCA 3N5CA 2PGNA 3T12A 5JZVA 3EXHA 1H23A 1ZM7A 4H0NA 4KO4S 4QBKA 4RORA 4P32A 3FI0A 4RK0A 5EJMA 3C3BA 3ST7A 2XF8A 2IYPA 3EC1A 2F55A 1CQXA 4PZUA 2I2AA 5JALA 2ZROA 3EAGA 1P4AA 4L02A 1OAOA 2X9GA 4RCVA 4DSUA 4UFPA 4PFSA 2D8MA 3BQMB 3L1JA 4MPJA 2RIPA 1L8QA 3CVOA 5ALWA 4Q7KA 1C9EA 4DPLA 2BLLA 5DHFA 2FP4B 3A1EA 2H1LA 1K0UA 3O8NA 4PSKA 5JCOC 2BM9A 3BDVA 1DRWA 1UOOA 3F7OA 1EM6A 1DBQA 1AUPA 1HF3A 1WDMA 2HTFA 1K4MA 3DMNA 3H2BA 3FROA 4FYKA 4YCDA 4YP9A 1TW2A 2Q5JA 4ZT6A 5FWAA 2IX9A 3P0HA 2OZPA 4AO6A 1L5YA 5BQ5A 2NADA 4BX0A 1R6XA 1V96A 5DN6A 5GV7A 2W6ZA 4ID3A 5TSDA 4WSOA 5IT5A 1DKUA 3I9V1 2ACEA 3W3AA 4IVQA 4ZXFA 5JWRA 2BP7B 5F3RA 5A4MS 1FIUA 2CLFB 1GWNA 4HZUB 2GTHA 1LFAA 2VXYA 1JG1A 1RLIA 4CEJB 1UL1X 4QDUA 3R7NA 5A1JA 4H3HB 1OASA 1XNJA 2JZNA 3PDUA 4KV9A 1G7SA 1ZSYA 1HO3A 2FZ4A 1IMJA 2IF0A 3LFUA 4L0QA 4C78A 4X62B 3OKFA 1FU7A 1G8JA 3D8UA 3DCYA 1IL0A 1PJLA 4BQIA 4PRYA 4C1NA 1N5LA 4U9HS 3JAKB 5LLDA 4AKGA 1ORHA 3LUGA 1CFJA 4YUVA 4OHCA 4KFRA 3AW9A 1RQXA 4FSXA 3VYTB 3PKJA 4H7EA 3CJQA 5KQGA 1J0EA 4ZO6A 4CLHA 2WDZA 2MDTA 3LD9A 1WM1A 4X95A 3O47A 3JWJA 3R7WA 5E1DA 1OXMA 3GPCA 4F9FA 5C8ZA 2XCRB 4RTJA 1MKYA 2PT9A 3MTDA 1RMQA 3K9GA 5B2FA 3OQPA 1JMVA 2PANA 3P2MA 2OK7A 3OSUA 4FE4A 5HGJA 2BC9A 4IS2A 1O7JA 4NTZA 3ZBUA 3OCWA 3W5BA 4KREA 2WILA 3K6KA 3DE4X 4BC1A 3V46A 4B4UA 3F1LA 4KXVA 3ZLBA 4LOLA 2WPDD 3TE7A 3LKBA 5B37A 3S81A 3EEOA 3AVTA 1P6UA 3OZSA 3AVVA 3IUQA 2O05A 5IFKA 4HVTA 2G88A 1UUFA 1DIRA 4NHEA 1XAGA 1ZZGA 4QUBA 1AZSC 3DMTA 4HLQB 3ZD9A 2OBYA 1L8OA 4KGVA 5FXMA 1UCFA 4XIFA 1PUXA 4FOPA 2CLIB 3INYA 3PI7A 1TIBA 2QG6A 3IAS1 4G1VA 5CJPA 3CW9A 3BHNA 2F1KA 3EARA 5DYIA 1IN5A 1IUOA 5A5GA 3CO5A 3HCEA 3QMMA 3PQDA 1K88A 2DP4E 1NQVA 3DOIA 3NAZA 4D3YA 4IIVA 3NDBB 1AK1A 1ONOA 2DMRA 2X0KA 4L8YA 4W8GA 2YY6A 3HPRA 4TKZA 2A9FA 2IXEA 2ZYIA 3HV2A 3V2IA 1E2LA 1M72A 1LDMA 1YNOA 1Y8CA 2OC4A 3N2YA 4NPHA 5DHPA 3WGUA 5HQ3B 1YQ9A 2GR9A 4K3VA 5B7PA 1OTYA 4LHXA 4K6KA 4J03A 4Q7LA 1YQQA 4Q05A 1FDOA 2HRZA 1SUDA 3QNMA 5DK4A 3V8QA 3OLZA 1O9HA 2Y0DA 3UEOA 1L7NA 2DHCA 1CZHA 1UMDB 5CEJA 5DXFA 1G8AA 4B7AA 3SC6A 4A2QA 1NGSA 3KAKA 3JQ9A 3IAEA 2MYNA 2QRLA 4JWKA 1EIZA 1F17A 2PS3A 2CZGA 3GP5A 3RC3A 1P39A 4D5GA 2PKCA 2ZAIA 2QTTA 3W7BA 3FSGD 1M75A 2PO5A 1X80B 2XMZA 4FTWA 4IRUB 5JC8A 5TMPA 2VPYA 2GBGA 4QHSA 3T4PA 4ZP1A 2O20A 1EK5A 3EXG1 5J63A 4FHFA 3PNMA 5ENZA 2P0YA 1ABFA 1KI3A 2ALJA 4E94A 2HL6A 1GLVA 2WKSA 3M33A 4GKBA 4V1CI 3BRWD 1H69A 4Y1RB 4GVLA 1EGAA 3G9QA 1DIHA 4H7HA 3V1UA 3CSUA 3LQQA 2JARA 2IZOA 4S3MA 4BLUA 4BVJA 4CE6A 5HJ2A 2X1MA 1RPNA 3KUCA 1E9FA 4IH4A 1XMQB 2JAXA 1DDOA 3TI7A 2ID4A 2IGBA 2XWPA 4MR7A 4D92A 1JDJA 1ESDA 3H84A 4OB7A 4IYRA 1ZD4A 2I54A 1EHIA 4MKRA 1M67A 2V6MA 2VSFA 4K9SA 1XMOB 4P8RA 2GKSA 3BXGA 1ZN7A 3LT2A 1QQ7A 3A0UA 3QUQA 1U9YA 4MSUA 3NEJA 2EHJA 3LM8A 2EERA 3OC0A 4S0ZA 5THKA 3T5PA 3PUIA 4AS3A 3FE2A 4CMBA 1T8YA 2QLMA 1XGKA 1EESA 5GZ1A 1IWOA 4O2AA 2C5HA 3A9SA 4OFWA 1ST2A 1ZXXA 4UJ3A 3A36A 2X40A 4C3VA 5AKXA 3KWFA 1QF7A 1AMOA 2QVGA 4L8VA 1XHFA 1Y3AA 3CF4A 1YR6A 3DVQX 1GYPA 4UHDA 4DLZA 2CWWA 4YJ2F 2TRSB 3KHTA 4I4CA 2OLKA 4MW7A 4OKIA 3EMVA 4Z4GA 3CS3A 4GZLA 4RY9A 3OKPA 5AM0A 4NBSA 2IODA 5FNVA 4AVYA 1M5TA 4UATA 5LP1A 4TV9F 3P0FA 1L4LA 4NOJA 1YUNA 4UPVA 3RRFA 4X84A 3MWEB 2RSLA 4H3SA 1L1RA 4C1BA 5KNDD 1JH8A 2I4LA 2BFBA 3JQEA 3VH3A 1FU8A 3U4QA 2GNOA 4QYWA 5CT6A 4DY4A 2WWIA 3FNBA 1QP0A 5LN1A 1QS0A 5MN5A 1TU4A 4EW3A 3H9CA 3QTTA 1RP7A 1GTMA 4QTTB 2QA5A 4JYPA 3M6WA 4AZ3A 4Q9DA 1L4HA 1QYVA 2FWIA 2N75A 1AY0A 3AF5A 1C80A 1MJHA 2GM3A 4KOEC 4OHWA 4F4DA 1G1AA 1G98A 4L4SA 2BTEA 3CLRD 4HSGA 4QNNA 1J2TA 4I81A 3HXMA 1MAWA 3RABA 3O0DA 2OY0A 3NHPA 4NZNA 2EJCA 4OHBA 2PKYX 3PHJA 3TNDA 4JEMA 3AM1A 4RM3A 2QW0X 3COYA 1U5BA 5HX7A 3IBFA 1XCOA 3FIJA 1CB0A 3DXXA 3DO5A 3LBFA 2QW1A 3GFOA 3R1IA 1I6LA 3AOGA 1J09A 2HU2A 2B34A 2Q2QA 3AM4A 3L7YA 5EE9A 2VRNA 4CDGA 5JSFA 5AW4A 2EW1A 1P2TA 3D81A 3U16A 1NXWA 3LHDA 3ZK8A 1NHGA 2O0LA 1DPGA 2AOUB 1UJ4A 4HDRB 2X2FA 4I3GA 5CA0A 1XYVA 3IC5A 4K28A 3DMPA 4DBZA 4XX0A 2E0IA 3ELWA 3KLNA 3BWMA 1K2VN 4ZAZA 2VH1A 3WNQA 4EA9A 1KY3A 1ZNZA 4EUSA 2V3VA 3CXUA 4ZDJA 3SIXA 4PS0A 4LFCB 3UQZA 1FYXA 3AF1A 2QMHA 3BGWA 5EY5B 4DABA 3F74A 1PGJA 3TW8A 2CMKA 1XEWX 3FGPA 1Y9DA 3JQFC 5KQMA 2G08A 4PTYA 3TTUA 3RUHA 3TSCA 3PHBE 1Z6ZA 4KI7A 1TNDA 3H5NA 4HNRA 1GR1A 3D1VA 4TM8A 4YDSA 5DZSA 3TLBA 3FMVA 1W59A 3JCZA 5JARA 4KRFA 3U4IA 3SHTA 2EKLA 5BOVA 1XZGA 3RTGA 4D6PA 2BGGA 2BBOA 3EIWA 2CNBA 1NXTA 4TMVA 3VPAA 5JAUA 3WKDA 2GRUA 4D3ZA 5IZ4A 4G4SO 1N3BA 5GINE 1Y1RA 1W1IA 3WHKA 1P2BA 2XF2A 4XLLA 3FTDA 4YRFA 3F9IA 1X7ZA 1PS0A 2F8LA 1EDEA 4G5HA 3O2SB 4UDYX 1KJNA 1JEYB 1V71A 1XU4A 2FH5B 4BLWA 1W36B 4RXUA 3GJ0A 5FL7A 2CK3A 5CT8A 1TE2A 3KB6A 3NVKI 3BE8A 1KP9A 1SCQA 1XZJA 4JB3A 4GEKA 4OQMA 4JC0A 4L95C 3BX1A 2VBIA 3MTQA 4KR9A 4HAYA 5LXTA 4GKVA 1FFBA 4EVIA 1U8YA 3SZLA 5F21A 3OT5A 2Z57A 2RIRA 4FEEA 4Z9XA 5JG7A 1SCNE 4LVOA 1Y5IA 4JH0A 1VL8A 2VBGA 2Z56A 4R3NA 1HE2A 3AB7A 5JCPA 4QRHA 5ILOA 3UENA 2WAMA 1YOBA 2FFBA 3RGGA 2WG0A 2C2MA 4RLQA 3L79A 3W5SA 1D2GA 2F8TA 4YDRA 1JE0A 3EYAA 2ZT7A 3NHZA 2V7GA 2ZBEA 4Y2UA 4F5WA 4AQ7A 4DYDA 1NW5A 2AUNA 4WXEA 3PRJA 1PK8A 5HUQA 1VRCA 2I3ZA 4W99A 4L78A 2LR0A 1OYOA 1N3IA 1PHPA 4TSFA 2XKBA 1UJBA 1NW8A 2PUFA 3NHBA 3MJCA 4Q1EA 1SXJE 2J5QA 2UVPA 3RWBA 4PU0A 4QDZA 2PVPA 5H3CA 1JSLA 3JQRA 1FTSA 2YHBA 1YULA 3ONDA 3MN1A 3GRCA 3OFVA 1NBMA 2HMUA 1S8NA 1V37A 3MMSA 3O3MB 4N7RA 1L1FA 2C8KA 3R76A 3TQHA 4YRSA 2I87A 4A6EA 3BK2A 4UULA 1JHZA 1NQOA 4B8ZA 3L1UA 1KAQA 3AHHA 5H8WA 1H3EA 3QSYA 2ZIUB 4IDPA 2G0AA 2XQFA 3JAWA 4TYNA 1SPBS 2HCFA 3S55A 1QCCA 2RKBA 4K2HA 3W5CA 2DFLA 3C5HA 5FPPA 3DV0B 3PWSA 5BT8A 4NE7A 1E7WA 2P75A 3AEXA 1IHOA 2QN6A 1L4YA 3GQBB 2O1EA 5JMTA 4W9NA 3MBKA 2A78A 3IDZA 3DNPA 1CUVA 1GGFA 4QU9A 1HH4A 4XGRA 5IYZA 1LSJA 1T4DA 3SXUB 4N18A 4XPZA 4EFMA 4BLRA 2H59A 2IZ5A 3CPSA 1V3QE 4D9CA 1C7IA 2C4VA 2PXXA 1HDEA 3QA9A 2WF6A 4H6VA 3X1WA 4Y67A 1LW7A 1K4KA 4FBLA 2WJ3A 1XKTA 4JGBA 1D7AA 2JHCA 1V9SA 2X58A 3HDVA 4ZHSA 1ARZA 6ADHA 4X6YA 3WK7A 2BUAA 4BOYA 1MRNA 4MGKR 4MA4A 5CLLA 1JEEA 4ZI2A 1ZUIA 1YDGA 4UXJA 4GR9A 5CB4A 4Y9SA 4EVRA 4GOMD 4HRVA 1VLQA 3N59A 3U7GA 3VKHA 3KBOA 3MWYW 2G1JA 4LVNA 2CYBA 2PL9A 3ANLA 3R0XA 2D2XA 2Q5EA 4TL9A 2NUTB 2ZUSA 3A3OA 1I7DA 3BSSA 4BV9A 1PKXA 4WZBE 4U2FA 5CB8A 1Z29A 4W8HA 2QT9A 3SE0A 5BN3B 1H0KA 3N8DA 2R6FA 3N87A 3ZJVA 4WVLA 1PWEA 1C0KA 3LOUA 3QVOA 1BEEA 1XJ5A 2OYRA 4DW8A 4K05A 5U4XA 3V7YA 2Z8ZA 2C9ZA 4IJ5A 4MKIA 4AKEA 2Q0HA 4FONA 1UPTA 2FF5A 3OZIA 5AHKA 1NLUA 4DLPA 1JYEA 1TB4A 4TRJA 3UT6A 2GILA 2I2FA 2VDPB 3G8CA 4MUXA 3RYTC 5E7QA 5I4KA 4BWYA 1FMFA 3ACDA 1A82A 4OMCA 3T1NA 3IR5A 4I1VA 4D9FA 1NV9A 3B3GA 3VR3A 4DLNA 1JU3A 5JXIA 2PRSA 1U28C 2BFNA 4Z4FA 1XWFA 2FLKA 2E6KA 4BLTA 2CDAA 5IC5A 3QVMA 1JHAA 4KKXB 4PANA 2HA2A 2WYWA 2L82A 2IBTA 1COZA 2XUDA 1BD4A 4IMIB 1S3FA 4BZQA 4Z49A 4EVSA 3CZ9A 2WJJA 4NNJA 4YRQA 3LUFA 4X92A 1PJTA 2QE7A 3BD7A 5FPTA 4NYMQ 5C8YA 4ZTZB 4ZVLA 2RGRA 2EW2A 5DTQA 1HYEA 1BJTA 3W7AA 2CCKA 4FWIB 2A57A 3WL7A 1XTKA 3EPHA 3GOHA 3DWEX 2ZS9A 4KHZA 2FOIA 2QZPA 4YX9A 2OLJA 2IQIA 1XP8A 4DC0A 4UQLA 1I7QB 1TJ3A 1R0YA 5CDYA 2YXBA 4GBMA 4Y9DA 1A8SA 3A26A 2I6UA 3NNDA 2FW6A 1J21A 4PTZA 4FX2A 1GGKA 5GP1A 1PVOA 3V32A 2OO7A 1PW7A 1Y6RA 3LVRE 4I55F 1FA9A 3AHIA 5BN5A 4UBJA 1GKUB 1P2FA 2WWTA 1SXQA 1XN1A 1DAMA