2PYZA

Crystal structure of the complex of proteinase k with auramine at 1.8a resolution
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Crystal structure of the complex of Proteinase K with auramine at 1.8A resolution
rcsb
molecule tags Hydrolase
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2pyzA00
1YJCA 1CNMA 3QTLA 2P4EA 5AVKA 1MPTA 4C3VA 2WV7A 1OYVA 4OMCA 3CO0S 3LPCA 1C9MA 1P8JA 2PKCA 3EE6A 1AVTA 1BE6A 2ZWPA 5AVJA 3WIVA 3QMPA 3DE6X 3SQOA 1GTG1 4CFYA 1GTL1 1SUCA 2W2QA 3QFHA 5FBZA 2ID8A 4RYDA 1SBCA 1SBHA 5JXGA 4LVOA 1SCAA 1GCIA 1T1GA 1IC6A 1Q5PA 1SUDA 2ZRQA 5ARCA 2DUJA 3PRKE 1SIBE 4KG7A 3I37X 1C9NA 1PTKA 1GT91 1TM7E 4ZOQI 1C3LA 2PWAA 2ST1A 3BPSA 1KE2A 3HJRA 1WSDA 3A3PA 2DP4E 1SCJA 2GKOA 1SCBA 1S02A 4FONA 1TM5E 1WMEA 1Y3FE 3GT3A 4JP8A 3AFGA 3UNXA 2Z58A 1HT3A 4AKSA 3AJ9A 4NE9A 2PMWB 3TI9A 5SICE 2WWTA 3H42B 1T1IA 1V5IA 1LW6E 5K7SA 1Y4AE 4DJ5X 3D9QX 1WMFA 1AV7A 1R64A 2W2PA 1YJAA 1MEEA 2V8BA 3DE1X 5ARDA 1OT5A 1KDVA 4Z2AA 1SIUA 2X8JA 3GT4A 1BFUA 3WHIA 1XF1A 1S2NA 2HD4A 1BH6A 1TM3E 1AF4A 4H6WA 3DE4X 1A2QA 1DUIA 1JEAA 5B1EA 1NDQA 3EDYA 2Z57A 5CW1A 2Z2XA 1P7WA 2ID4A 2B6NA 3PTLA 1PEKE 3LPDA 2PYZA 4OMDA 4DZTA 5AMXA 3LXUX 2IY9A 2PRKA 1NDUA 1SH7A 2Z2YA 2PQ2A 1BE8A 1ST2A 2XRMA 1Y48E 4WOBA 1KE1A 1AH2A 5FAXA 3DVSX 2WUWE 1SELA 4NE7A 3DW1X 5ARBA 3F7OA 3F7MA 2W2OA 3LPAA 3DDZX 2IXTA 3CNQS 1R6VA 1TO1E 1KDYA 4J94A 4CG0A 2QTWB 1C9JA 3TI7A 2SNIE 3I2YX 3DE5X 2TECE 1PFGA 1SCNE 3Q5GA 5JMOA 1TK2A 3DE7X 3DWEX 3F49S 1GA6A 3GCXA 1YJBA 2G4VA 1CSEE 3VSBA 1Y33E 4H6XA 2SBTA 2HPZA 1GNSA 3A3OA 2DQKA 3DE3X 1Y3DE 3VHQA 3VV2A 1Y9ZA 2PWBA 4WOCA 4HVLA 3VTAA 3DW3X 3DVQX 3ZXXA 1OYOA 1V6CA 1TO2E 3VV3A 4MZDA 1SUEA 5JXJA 1TECE 4OV6B 5JXHA 1SUPA 2X8JB 3ZXYA 2W2NA 1SUBA 3EIFA 1GA1A 4LVNA 4KB5A 1SBIA 4CFZA 5AQEA 3GCWA 1AQNA 4NMXB 1SVNA 1NLUA 5FFNA 1GTJ1 3DE0X 3TECE 1TMGE 1S01A 3DYBA 2W2MA 2SICE 3L1KA 1TM4E 5I9SA 1VSBA 4GI3A 1AU9A 3Q40A 2ZWOA 3SICE 3WQBA 1T1EA 3WIUA 4B5LA 1TM1E 3BX1A 1Y3CE 1SBNE 1Y1KE 1SUAA 4M1ZA 1BJRE 1ZVJA 1WVMA 2Z56A 1P7VA 5JXIA 1SPBS 2E1PA 3D43A 1IAVA 3OSZA 2SECE 5B1DA 1SN7A 1R0RE 1SIOA 4K8RB 3I34X 1Y3BE 1SBTA 1PJ8A 3I30X 4BWGA 4I0WB 1WMDA 3AJ8A 1EGQA 1GNVA 3VYVA 1YU6A 4C3UA 3DVRX 1Y4DE 1ZVKA 4ZARA 1ST3A 4DWWA 1DBIA 1UBNA 4H6VA 2Z30A 1Y34E 1EA7A 4KPGA 1THMA 4YN3A 2WUVA 2XTJA 1SCDA 1AK9A 4HX2A 4AKTA 1BFKA 3BGOS 2Z2ZA 1GA4A 3A3NA 3P5BA 3DE2X 1KDZA 3T41A
chains in the Genus database with same CATH superfamily
1KI1A 4RHEA 1C1DB 2WF9A 2GOYA 6REQA 3C2QA 3FNHA 3K4QA 2WZQA 3BTVA 4G24A 2FZLA 3E15A 4I3GA 5DBGA 1TUIA 1WCWA 3BVPA 5AVKA 1EDBA 3A1DA 3EA0A 1E8NA 1GUZA 1T4CB 4QASA 1A4XA 3AZPA 2YVQA 2FRVA 4R1LA 2JCYA 4BEJA 4GC5A 1KQ3A 4UBNA 5BRJA 3SY8A 2AN5A 2CF5A 2GYUA 1ZSVA 1HTBA 3QFFA 4Y6PA 2GKSA 4BNUA 3F2IA 4F3TA 4UBOA 3I39X 1YVRA 4B47A 2TRSB 1XKTA 2ZWPA 4K46A 4KGVA 5IVIA 4YROA 4XLTA 3WIVA 4BUCA 2ODWA 5AXDA 4AS3A 3N0VA 3TFOA 1PR5A 2HUNA 4DY6A 1QZZA 3ZU5A 2WTEA 3BJIC 4W9NA 4CIXA 1PBTA 5G4LA 5FTLA 4M88A 3DM9B 4AYXA 1WSAA 1O95C 2AQIA 3GJRA 4Y2HA 2NP6A 5C53B 4P3OA 4PTYA 1CEYA 2YJNA 2IYXA 1BG6A 1YHZA 1YQTA 4Z1OA 3GQVA 3WIEA 3KHSA 4MQBA 4XXHA 4J16C 1WW3A 5BVHA 4OFWA 1E1RA 2PZEA 1G7CA 2P9TA 4B2IA 4UDNA 3I32A 4JR2A 1J20A 1KS9A 1RQ2A 4ASUA 4N3CA 3TJMA 3KYCB 2VK2A 4N12A 1QH9A 4K0KB 3LX8A 4PYNA 2PBLA 4QUDA 3REGA 3EG5A 5LD2B 3P8ZA 1WY7A 4RIFA 3AESA 1H5UA 1ZJZA 1UEJA 3PT5A 2LD4A 1VKZA 4CNBA 5JAHA 1JG3A 3PVZA 3EMBA 4GPAA 4HWGA 3IOEA 3PXGA 4FBMA 1E32A 2C42A 3EQ6A 3GMTA 3JAWA 4ED9A 4PFQA 2IPLA 3VFDA 4MW4A 2QNBA 2BF7A 3UMBA 4NIMA 3ZDBA 2QUHA 1Y37A 2PE5A 2I22A 2FW6A 3IUMA 5IJ9A 1KSGA 4EB6B 4W63A 1V11B 2ILVA 3CKKA 1NVGA 4MQEA 4DLLA 1ODIA 4PGMA 2DUUA 3DWGA 3ENZA 3CVVA 4FPXA 1WSDA 3FTDA 4KO2S 3TQSA 5EQDA 3VZDA 4Q4JA 3HNOA 4AZSA 3BH6A 2OZLA 5LP6C 2DT5A 4CKEB 1OLOA 3AEUB 3LWDA 1M2OB 2AZ4A 1ZXBA 3GQBA 3DFKA 1Q3TA 2GK6A 5H02A 4AU1A 3CZ4A 3NV7A 4KPFC 3UFBA 2H0RA 1ZCAA 1M8FA 2HXGA 3L0IB 3FNGA 4G9GA 2BUCA 2BPOA 2IYNA 1OAKA 3H2ZA 3OQ1A 4TN5A 4UQLA 2W6OA 1LVUA 3NORA 1J5XA 1V4NA 2DR3A 1L0BA 3C7CB 3IXMA 3QZUA 1KP3A 1XTIA 4EQ6B 5D85A 1E3SA 4YQEA 4HAVA 3HNPA 4MWCA 2PUEA 3TCKA 1G64A 4J07A 4BJ6A 4EO9A 5IJ0A 3GVCA 1Z06A 4BE7B 3KUXA 5KYVA 2R65A 4PAQA 1X19A 2QLBA 4JBWA 3F71A 3C8UA 4I4CA 1QAQA 1Q7GA 1OH6A 3Q9LA 2I91A 2GLXA 2EIHA 2LCIA 4ZZ3A 2X7XA 3NHAA 4CDRA 2BM8A 4P4UA 3FOZA 1CB7A 2HYDA 1J1IA 1HYEA 4TTRA 1FL9A 2B4TO 2WMOB 1J33A 4DJ5X 1J7JA 2JKVA 4L4SA 4Y2JA 3W3ZB 4DCCA 3CT4A 1ZIXA 1OUMA 5FLKA 3L1HA 3RQSA 4PC7A 4IKPA 5ERYA 5ALRA 5AJZA 4JN6B 1VYVA 4X8LA 3F7TA 3REQA 2VXYA 4QPDA 4XASA 3A2LA 2WYUA 2M6SA 2VQ3A 4TM8A 3RLIA 5BN3B 1QK4A 3HYSA 1KQNA 1NNEA 1SM4A 2ECQA 1JAXA 2R6GA 3BK1A 4O1MA 3UAZA 2RG7A 2W90A 5K4HA 2LW7A 1BFUA 2QM7A 3CURA 3UHJA 1PWHA 4EO7A 1O94D 1QRDA 1IY0A 2G67A 2HQ1A 3VU3A 3V8RA 1XDGA 4CMBA 4EFLA 2XB8A 4ND6A 4JLMA 4IS2A 1RPAA 1T8WA 2PA3A 2LR0A 5JCJA 3VR2A 1X42A 1ADJA 2KW5A 6GPBA 4Q3NA 4XJVA 5IUKC 4HDRB 5JSZB 4MUYA 1HI9A 4NYIQ 2FMFA 1DUIA 2WJZB 4WWHA 5DGDA 1Q3HA 1QKIA 4J3JA 3PDWA 3ZQKA 5B1EA 2PV0A 1V5GA 2UYOA 1E2NA 5B37A 5A04A 2VUSA 4B4KA 1A9RA 1UK7A 3Q8KA 2QU8A 4LZZA 3R5KA 2QTZA 2PCJA 1Z18A 2Z2XA 3ANNA 1TCAA 3IIJA 4OIMA 3V6MA 3MLAA 1K5GA 2W6NA 2B6NA 3AB3A 3BXOA 2PUGA 5CRIA 3B2NA 1JHAA 3WQQA 4XCVA 2B35A 4NONA 3UM9A 3WB1A 1HDXA 3WKEA 3DT9A 3BK2A 4REOA 3TNFA 3TSCA 3PC4A 2LNDA 2P5SA 2EHDA 4GAEA 4KC0A 2UZIR 1JRLA 3VNRA 4BNNA 3U40A 5ICEA 2EL9A 5HGJA 4ATNA 5FLXA 2HBZA 4V0KA 4PQGA 2RAFA 3S5UA 1LA2A 3CLRC 1FZQA 4DT1A 4IZIA 1MHTA 3EQ2A 1NBHA 1ODLA 1Y48E 2R86A 5ESWA 3E22B 1AKRA 1H65A 3IC5A 1LNZA 5KTMA 4ZCIA 1X15A 1ISMA 4DCMA 2ZPTX 5AW3A 3H1FA 1NBMD 5T4FA 5AKYA 2HJVA 4Z7OB 1RQPA 3IJRA 3O8NA 4P4TA 5ALZA 3SJZA 4JP3A 1OPXA 4H1WA 5LIPA 1X1BA 3HFJA 5SV2A 3PZRA 4LJ9A 5LBUA 1JKFA 1TUBA 4D3YA 3ESXA 3L01A 3U7RA 1EUZA 1QHSA 3R9IA 2HLDD 3OX1A 3RUEA 3EUFA 3VNSA 3CF4A 1M72A 4G01B 5AVQA 4D98A 4J4TA 2GAIA 1VYUA 4X0EA 4RVHA 2ZRDA 3NYIA 3WICA 4L5IA 1C7JA 4JUAA 3T3OA 5TF0A 3QEOA 4I3HA 3SDZA 3WOVA 3E9CA 4B4VA 5FOTA 4EYKA 1X80A 4WINA 2P9FA 4MKRA 3PFFA 5H3CA 4ZDWA 1HDEA 1YE8A 4JNKA 4JYBA 2I3DA 1RW4A 4MYCA 4Q1CA 4PVDA 1L5FA 4D44A 4ZA2A 1ID8A 2VYQA 1K89A 2VPIA 3G2OA 3VO9A 3LCUA 1L5VA 3N6XA 3ZCXA 4EY7A 4QOJA 5JS1A 5COBA 1CLEA 4HFRA 2DKOA 1U98A 2BUAA 2QF7A 5HFJA 4AZTA 2H07A 3I58A 3O1JC 2PO5A 3MYRA 4Q7LA 2AFIB 2BT4A 1F17A 1ZP6A 4MCJA 4D99A 4HDSA 3OQOA 1NWHA 2GN9A 2O0KA 1PR2A 1ZH8A 4EW3A 4M60A 1U9IA 5IFLA 2YZ2A 2R8OA 5MGBA 3QKWA 5BW4A 2F43B 3WLKX 1XEAA 4RQAA 4AUNA 3IX7A 4K28A 4C7OB 2ISCA 4ZO8A 5EWJA 1JFTA 3TQHA 2NNLD 3GCXA 5TX7A 1GARA 4KAFA 4UAGA 1G3MA 4F4UA 1CSEE 2QD5A 2A14A 2PL9A 5LLSA 4DSNA 4FFDA 5I7HA 1NOIA 5C1OA 2B9VA 1G291 1YDFA 2WSMA 5GMOA 1VZ2A 1D0VA 1QANA 5AKEA 3E61A 4DQLA 2I6UA 2P0YA 2QP3A 1VKRA 3NBXX 4UOZA 5BWNA 4TYYA 1CFZA 4X93A 1PJTA 1QCDA 4A26A 1SCKA 5FPTA 1MG5A 1T34A 1RLMA 5CM8B 5ES4B 2ZYRA 5EQTA 2IWRA 2NU8B 2CNNA 1HQCA 3I5AA 2G0NA 1TZMA 3C8ZA 3ZWDA 3H2YA 2QN6A 3PNOA 5DNVA 3HJNA 1S7GA 2B6HA 2Q4RA 1CCWA 1GTVA 2FOIA 4GYYA 4OB8A 4RK5A 5IK2A 3VBEA 5KVVA 5B1HA 3X2EA 3D8TA 2JGLA 2N3ZA 3K09C 2CDCA 4U6SA 1T2AA 4O4LB 3V4SA 1FX0A 1JR4A 5GWXA 2HA7A 5KYWB 1DCKA 1B4DA 1SU7A 4QATA 4UUMA 3O73A 3EGDB 4RF4A 2XYHA 1ZVVA 2ESRA 2VYFA 3DGEC 2VF8A 2XMCA 5FNVB 4WXPA 3MWDB 2RI0A 1G9TA 3E7WA 5BT9A 3BS4A 4Q7EA 1Z7WA 5DO9A 2QBYB 1JIJA 1Q50A 4FLEA 1G4HA 2HGZA 1YR6A 2CXQA 3L8GA 3RVSA 1FSGA 5CCXA 1KO4A 3BG5A 1I5RA 1MR3F 4JLPA 1KEWA 3FYCA 1G16A 3TWOA 3I9MA 2J3EA 1DBWA 1XTSA 4UCWA 1CIVA 2FEMA 2DPGA 5TPZA 2X8JB 3I73A 4HNSA 4V0MA 1BHQ1 2I2BA 4H59A 4O08A 3OSUA 2OMKA 1H8HA 3CWCA 3LDAA 4IOMA 3WS7A 6ADHA 2F3QA 2YIMA 4LJ6A 3OF5A 3A2NA 3DOEA 3RYFB 2Q45A 4OYLA 3Q3IA 3B51X 1HDRA 1R0BA 2FQYA 1B0UA 1N2SA 2O1EA 1QAMA 4A23A 2ZI4A 1Z0IA 3HJUA 5EIWA 3M3DA 3C8DA 3NNNA 3C24A 4YJ3F 2H11A 2B1QA 1DKRA 4JASB 4FLMA 4ARCA 1JJBA 1KARA 4I4TF 4D9CA 5CUQA 1J9GA 5JZBA 3PU6A 5BSEA 3FY4A 4BN0A 9ABPA 2PSFA 1SR8A 4GMGA 4HXGA 4AKGA 1VFNA 3CPJB 4HCJA 1QOZA 3BA1A 3EMDA 4NAHA 3INTA 2WTBA 4R41A 3KT0A 2O8NA 4OXNA 4PC1A 5KYKA 4N5DA 3JQAA 2RGNA 3OCYA 5EJ7A 1NW9B 1BHJA 1XKQA 1RS0A 4TKLA 1UFOA 3K9QO 2FLVA 5IT9A 4UFPA 2VEOA 1KYZA 1CUSA 4S1OA 2ZRJA 1SKAA 5FWXB 1GGMA 1UDXA 4HNHA 1YR3A 3B6ZA 3OUTA 1K92A 5F51A 3QX3A 1P7ZA 2R6CA 2XBLA 3UAGA 2ZWOA 2AN3A 1ZM3A 4FCCA 2IPMA 4G0ZA 5JYDA 2IEIA 3V8MA 4X95A 2OENG 4PZ0A 3V32A 5ADHA 1PAUA 1UC9A 3RSHA 4BTLA 5LNK1 1FU7A 1YVEI 2IJGX 4L73A 1P7PA 3O4VA 4HI0E 4LG1A 3GPBA 1PSZA 3LW7A 1SUSA 3WJAA 1WABA 3DXXA 3ND7A 4FYHA 3RI3A 3RSFA 2QRKA 4KQXA 2OL4A 3KFXA 1J0DA 3V8PA 2GM9A 3PKIA 3C74A 3IBYA 2GZ1A 3RFVA 2O8DB 4QE3A 3ROXA 3THXB 2WIAA 1HEUA 4FIZA 3SQXA 3D7SA 5KC9A 1T3LA 1HXHA 1BDHA 4RVCA 3WP1B 5DXJA 5CFMA 3TIXB 1EBFA 1ZRSA 1CY4A 5AK0A 2JFWA 3B1KA 4H31A 3U81A 1VSVA 3HCRA 4NY1A 2C7OA 3H9QA 3BN3A 1H4VB 3HCEA 1VBFA 1CHDA 4X00A 4XOUA 1ULAA 4UQPA 5G0WA 1PCXA 4I66A 1CUWA 2P9BA 3ZCVA 1ESEA 3EBPA 1IATA 3GIWA 5L9AA 3SSNA 2QKYA 4JUIA 3G5AA 3LBAA 3RANA 4M9RA 4OX9B 4OXXA 1T8YA 4NQZA 3C98A 3HNRA 3NUGA 2FJUA 5JADA 4LJYA 1RQRA 1VG1A 3OESA 2FDCA 1G9SA 1HPLA 4IGEA 3WDMA 4C3UA 4OYRA 5T3YA 5L3SB 3AYXB 2ZUFA 3IR5A 3A4TA 1E2MA 1SNYA 2FTKE 3NRJA 4WADA 4X6UA 1YZQA 2PX5A 1RMQA 3TLZA 1N8TA 3K9FC 5LQDA 5M34A 2BKXA 4OLBA 3WNVA 5EJAA 1N25A 3JVUA 3HXTA 3I5XA 5L3ZA 3FHJA 3GP5A 4IUCS 2WUDA 1P39A 1SHTX 3AQ4A 4FE7A 4MKIA 4OHMA 2WM8A 4OK5A 4LPKA 1LSOA 3VNVA 2DG2A 1NSTA 2JHGA 3UT5B 3SIRA 1EFVA 1WBDA 5B1SA 5B2FA 2C8KA 5G0SA 4BO7A 2P4QA 1RCFA 2MHCA 4KKVA 1EA7A 4XRGA 1YJ5A 1ODCA 1ZWLA 1W2HA 3LHDA 3HCOA 3PQFA 4V0NA 1HC7A 2J3MA 3AHJA 1MDBA 4B75A 1Z0JA 3AUAA 4C1BA 3WNCA 1W87A 2V7VA 5FPPA 3TL6A 3C3KA 3UENA 1KZGB 1N5DA 4II2A 3T5DA 2XQJA 3QKIA 1ORWA 1LKZA 2GCOA 5FOQA 3KT8A 4D3SA 1U04A 2WFLB 1DFGA 4DR2B 1XN4A 1FVXA 2EP7A 2GDJA 3OH8A 3T0GA 5KKCA 1NW7A 2FUCA 3RJ5A 3FX2A 4QUBA 1GGVA 3D2AA 3DE2X 1EQUA 2JJYA 2ZE8A 3WGZA 1WDWB 3E03A 3IOCA 4IYRA 4LDJA 5K9ZA 3U7FB 3I2IA 1XZAA 4Z4EA 2P6MA 2ZAGA 1P5JA 3ROKA 4PQRA 3NIWA 2JD0A 1YUBA 5KAPA 2QRMA 2DWPA 4KVGA 4HDNA 2R48A 3BEDA 4EJ0A 3GROA 4FSHA 4R3UC 2A5LA 4JSTA 5E4TA 5JI3E 2G9QA 3AERB 4CGYA 1H2ZA 4AKIA 3ZWBA 1MOQA 4WI1A 2ODPA 2M32A 3N2YA 4G67A 1SC1A 5E4FA 4DSOA 4O2RA 3L7MA 5HHTA 4BZPA 1J2EA 2HIMA 1XB2A 2WTUA 2AZDA 4JQYA 4J3NA 1T4DA 1EPUA 2C82A 2QT9A 4QBGB 3R9KA 3UAWA 4AD8A 1AVTA 3A37A 3NKFA 3URMA 3CLRD 1TFRA 1NXPA 3OZWA 1XDWA 1WCIA 4R6WA 2V4MA 4UNNA 5H16A 1ZWKA 1B0ZA 4HNAB 4UJ3A 1QO9A 2QVZX 4YJKA 3WWOA 1XALA 1E6UA 4P3KA 4I4TA 2VTBA 2F1KA 5FORA 5HZMA 2R0QC 4EUSA 1IWBB 1A88A 2EEPA 3TZLA 1RHJA 1GTL1 3VR6D 4BBZA 3IDSA 3QBTA 1G4AE 3ND6A 2BE9A 4F8EA 2WHEA 2IYZA 4GNKA 1IOZA 4IM7A 2WUFA 5AKLA 1QIGA 1Z5ZA 3I3OA 1RXEA 13PKA 2G83A 3HYCA 4W9NC 5BNWA 3D1LA 5J43A 3EH1A 1ETUA 1KSJA 2WC1A 1UT5A 2OGSA 1JFRA 2VWHA 2QPLA 1RYBA 1KYQA 2LKDA 2SHKA 2QLLA 3E3AA 4MUGA 1JBQA 1GL6A 4E2WA 1YSCA 3OOYA 3GLIE 3QELB 3OZBA 3KXIA 1T0HB 4FXPA 1Z6AA 3ZE8A 3FNIA 3QWBA 4JB0A 2E5LB 1AD2A 1R0LA 2CKMA 2RJ3A 4UHKA 4C4OA 4EFDA 1OU0A 1Y5RA 1KVSA 3UJAA 4CM1A 3WK8A 5M2QA 1LTHR 1OHHA 1K8ZB 1SCUB 4CV0A 4UOEA 9MHTA 1B3BA 1SG0A 5DX8A 4CXMA 1TZCA 1X77A 3E7XA 1E4VA 1Q0TA 1MAUA 2CUTA 2P3SA 1Q0LA 4KXXA 2QVGA 5JNLA 2WPDD 3HYLA 2XT9A 3WLEA 2VYCA 3AEQA 5AOVA 1M1YA 1ZD9A 4LX8A 1H1TA 4B82A 4QT0A 2BEKA 5AJXA 4V0QA 1QAOA 1U0JA 3BIJA 4I8DA 3X1KA 4DBVO 4ER7A 1I7LA 1J8MF 2JCSA 2HW8A 1UBOS 2FI1A 2OP1A 2QOEA 2YBEA 1VPVA 3A9CA 4ZRDA 5AT1A 5BR4A 3QG5A 4X8HA 1P80A 1N2XA 5EGSA 3DO6A 2Q9AA 4JX8A 4P4SA 1A5SB 4QXRA 2ERYA 1JG1A 3H2BA 2VRWA 4I8XA 1E7SA 2FY8A 1R6BX 4QJBA 4TV8A 3IDQA 2ZT6A 3BWXA 3RUIA 4O4HF 3TVTA 1VB5A 4S04A 5EKTA 5JPDA 3PXUA 1CDOA 1JQDA 4OO3A 3DBVO 4MWOA 3HXOA 2M2IA 3AQIA 3S55A 1GTRA 1L4YA 2PRZA 3EXFB 4FCWA 4MLDA 4XQ0A 1G20E 1JG4A 1EM6A 4CEHB 4F85A 4GC9A 1VRVA 1QG2A 2ZSFA 3HZOA 4MINA 5FBQB 2EZ8A 5M29A 5A4JA 2FN9A 2P6OA 2VHUA 4ZI7F 3D8BA 3VHXA 3N2IA 1LBQA 2Z2KA 5E3JA 1Z4LA 3LVBA 2N75A 3R5FA 1L6RA 4G4GA 3DC7A 1VRCA 2D3TA 4R1QA 4KUGA 2GO7A 5J4VA 1FRQA 3JPWA 1T1IA 4G65A 3HI6A 4V0SA 5SYMA 1IVSA 2DHDA 4RFVA 3X0DA 4FR0A 3W2IA 4C30A 1FMFA 1DIRA 1Q1EA 4PSVA 3R24A 4PR0A 5KUTA 5KTSA 6NULA 1ECCA 5KOJA 1AC5A 1T3TA 2RHLA 3JASA 5E7IA 2OYRA 1ZH2A 1XZGA 3F3KA 1K4MA 3GAMA 3D8RA 3NOOA 5GJCA 1HOTA 1VA4A 4A0HA 4AN0A 1G6OA 2QLJA 2RHRA 4QOHA 2OVBA 1CRPA 4JX9A 1Y8RB 3BILA 3GFRA 2Q3HA 4HPJB 1UEXC 2C2WA 2XHZA 3B7WA 2J3KA 3EPHA 2OY0A 1H42A 1QHNA 3HM2A 4MUMA 2ZUTA 3SHWA 1E2UA 4PPFA 3HZRA 1JQKA 1LXCA 3OQIB 5AKHA 5GAJA 1H2AS 1JMKC 1AF4A 1EP2B 4YFVA 4FGKA 1KGDA 4FHFA 3RASA 3OKFA 2NU9A 3C6KA 4UM8B 4BVBA 1KIAA 4BPBA 2C2MA 2R4TA 1CY8A 1DWUA 2H0AA 1F06A 2OBMA 3HUFA 4NULA 3EGEA 5HKAA 1GQRA 3IDFA 5EHZA 4BGDA 1P3JA 5KX5B 3Q7EA 3JQ8B 2P68A 4U8HA 1E6KA 2WMYA 1SXJA 4HGZA 2IEAA 4JJKA 5TQ0A 4D81A 2GEJA 2RGGA 2V1XA 2HUPA 3ICPA 4V03A 4ZQFA 4EOGA 4ENRA 1LCIA 2EZUA 1GP2A 2I33A 3GI1A 4OMDA 2Y6UA 2F2TA 3ULKA 1WCYA 1CQZA 1C41A 4DZTA 5IC5A 4R2XA 5BSWA 2CNWA 2H5JA 1QG0A 3P71T 1ABFA 4IUDS 2X2OA 3DLTA 3EGIA 1MT3A 3HCWA 2GXUA 3NASA 1IJBA 1MIOA 3RUDA 4A8JA 4YRQA 1S6YA 2H3HA 1VLHA 4JYPA 2C2GA 4PFSA 3DCYA 5CBPA 3FROA 1VKOA 1X3LA 3FGNA 3FGOA 1T2UA 3DFFA 4RZQA 4L28A 2WVGA 2B3DA 2QM0A 3PS9A 3W8EA 5IN4A 2A58A 1XJQA 2C83A 4EBBA 3HJHA 5A9SB 1PQUA 1FZTA 3BHIA 4UHJA 1RLUA 7AT1A 3JTMA 3M4ZA 4TYPA 1SVMA 3D4IA 1P0CA 4YRMA 4K6HA 4AXXA 3W2FA 1OLUB 2QY6A 4TTTS 5I48A 5KJ1A 3MAJA 1TA0A 2A9PA 2WIBA 4OQFA 3GVPA 1O9HA 3DW1X 3PPWA 4M3NA 3LVQE 5EJ2A 2XF2A 1DC7A 3LHFA 1V3UA 5H70A 4JFAA 4QQKA 3WIDA 5JDCC 5EKDA 4XH9B 3QG1A 1QHEA 1QR2A 3KOOA 2I2CA 1Z25A 4GPTA 2VP2A 1C7EA 3OETA 4EYGA 5HSGA 3DVAA 3PIDA 4WDRA 1D2EA 1T9KA 3GG9A 4EG3A 1AQUA 3BWDD 4MRRA 3WB2A 4OEHA 4MI6A 2BHTA 2JI6A 1W6UA 3V4PB 3USZA 3SF8B 5EFZA 2V9PA 4KFUA 4TWIA 1R4MA 3T1VA 2H9IA 4OLFA 2MSEB 1J21A 2CGEA 2MWMA 3V1LA 4GM4A 4WERA 2XYVA 1CRWG 2FSFA 2RGYA 1W30A 3NDIA 3CUTA 3NUZA 4M1QA 2QTWB 3RS8A 3RUAA 4XEHA 2X23A 5EHQA 1L5MA 2XBUA 1M2KA 3TZCA 2FEAA 3VVMA 2J9XB 4QM7A 4RHFA 4EGQA 3VNBA 3C6ZA 1AGRA 2O1WA 4RTPA 2A3RA 2NSDA 3ZTYA 5C81A 2HXSA 3SYNA 4EGJA 2EG5A 5DHUA 2PGXA 2PCLA 1NMQA 2BP7A 4D7AA 1ZOPA 4J1TA 4G1EB 2J30A 5F5XA 3VKUA 1FDVA 4H7DA 2Q3CA 3WYDA 1NZJA 2H57A 4JJIA 5T4EA 3DE7X 1TCBA 4B71A 5GZ1A 4WCFA 2D06A 3A1VA 1U02A 3HUTA 4IWYA 3TSAA 3EH2A 1U9IC 2X4DA 1K88A 1T6YA 2N47A 1LD3A 1PL6A 5KTPA 1Z7EA 4R2WA 2ZUVA 3B1YA 4O4HA 2O3QA 1VE9A 5T4HA 3WK7A 3IP9A 1HDYA 5T6MA 1D0IA 3JQGA 1IZZA 4D0SA 3CNHA 3H05A 1NLMA 2E4VA 2VDPB 3VO8A 4QDZA 4AURA 2WF8A 1JNXX 4E2ZA 2FSUA 1R37A 1J2TA 3ITEA 4FFMA 1W5EA 3O8DA 4WA8A 1N2BA 4OY3A 1RWNA 2EJTA 3TLXA 4ZI7A 1MQ8B 5IUNC 4ND2A 3AC0A 3OHSX 1TUGA 4TTPA 3VVCA 3ZWVA 2IU3A 1W93A 2A78A 5IS2A 1JQ5A 2Y4NA 4PQYA 5ALLA 3R5JA 2VSXA 4QHSA 4S1NA 1DAMA 3D0KA 2NO0A 5JSYA 4NMWA 4IIJF 3TGPA 2XMDA 2YW9A 4ML3A 4GNRA 5CVDA 5HF5A 2ZS8A 3ZPXA 1L5ZA 1A5AB 1N1DA 1V6CA 2O2SA 4EPYA 4LWQA 3OMWA 2ODAA 3ANYB 1IN6A 3HL4A 4LJ7A 1I4EB 4CL0A 4IZ6A 1XCGB 2GVDC 5E0OA 2X0NA 2H9YA 3DR3A 3HEAA 3TNYA 2WZBA 1I3MA 1RCUA 4C4XA 5JXJA 4QUJA 3RNOA 1UBTS 3I6YA 2IP1A 1S3GA 5HJ7A 1DJQA 2IY8A 3F9IA 4QNNA 5I9LA 4A15A 5J2TB 1GZVA 1O97D 3PXBA 4LCJA 4BNZA 1ZN9A 2N1MA 2XI4A 2XRFA 2FK8A 5DV9A 2Q62A 4S35A 2KJQA 6YASA 3ZW8A 3FDIA 4LRUA 3KQUA 5DM60 4C0SA 1JWLA 3MMPA 2DJIA 4MGIR 1WB9A 2HB6A 3OMXA 1OB5A 3GR6A 3I72A 3EVCA 1BJTA 3REFA 4BQIA 4X71A 2QDKA 1W581 2I8CA 4QU9A 1U3DA 4RY0A 5JS7A 2O8EB 2REQA 1D8TA 1LC0A 4LQDA 3N1UA 2NT4A 1ATIA 4WE3A 1ONNA 2BMDA 3PYMA 3OCCA 5CNKA 3OQ6A 5E6UB 2QRHA 5SYAA 3PXDA 1KTVA 2V0GA 4DPMA 3TUIC 4BCCA 4LF5B 1WUTA 1Q2XA 1QH1B 1RRVA 4BQFA 3T99A 2H1VA 2WE8A 2FMHA 1YQGA 4FHCA 1RVV1 4FC6A 4J7AA 4FC7A 5ALKA 2A9RA 1F8FA 4JLKA 4NZ9A 1ONPA 3TYXA 1LPAB 4DIMA 2EGGA 4JJFA 3R3ZA 1E2KA 2O07A 4ZQBA 4AMVA 3M82A 2LP4Y 5DBHX 4LOHA 3HFSA 5H4HA 2GK3A 3ORFA 5B6PA 3ZLVA 4KQWA 1NBEA 1PLLA 1BZYA 1U4NA 3I04M 3EVGA 4CLOA 3JD2A 1E7RA 3PNMA 1JEYB 2N0SA 2Q0SA 4YP5A 4UVEA 2W2MA 4RPHA 2SICE 3L7KA 4DM3A 2QT1A 1IXRC 2R60A 1DLIA 1WVGA 3FCCA 3UH1A 3ZBTA 4DZRA 4JLUA 5CFNA 2Q2QA 1LU9A 1ULHA 4QM6A 1Y5LA 5C37A 1S3FA 2ZKIA 3P20A 2RGNC 3OZEA 3BDAA 1E1RD 1Z8FA 4QYXA 5AW0A 1BWQA 3K9BA 4EKIA 4F4HA 2YX1A 3BIFA 3COVA 5HX7A 3Q85A 4KIGA 3AYZB 4JU9A 4OJNA 1ISIA 1CDDA 1YAHA 3DZJA 2GYYA 2WRZA 3BRWD 4O4JB 4DLTA 1GXSB 4DLAA 3IQZA 5CVVA 1YIDA 2PQ0A 3UT0A 5FT9A 4OX9Y 5TT1A 2YMMA 1IEQA 4CCWA 2J33A 3P9ZA 4PHGA 3D4BA 2QRLA 3BAFA 4L3WA 4Z8XA 1SBNE 4E46A 1MQSA 1A50B 2B7CA 1M7GA 3AUSA 3K1AB 2NU7A 4BFUA 2H6EA 4F11A 1XU7A 5JRDS 1EE2A 1P0MA 3KPYA 4AJ1A 1XNJA 1TRHA 4GVPA 1O08A 1SPBS 1ZNZA 3GCGA 3B9QA 3QPUA 5MGNA 2WHYA 3BTOA 4RJLA 5KJ6A 2OK8A 2OM6A 3HA7A 4FM9A 1JZTA 5KSOA 3D6AA 3NFYA 4IWNA 3G5MA 2Z8XA 3PPVA 2WY2D 4URZR 1XZHA 2Q29A 3KNZA 1AKQA 2J85A 3V2HA 4DJDC 5KWJA 1TCVA 3OQBA 2W2TA 4E13A 1N77A 3SS9X 1X14A 1L7QA 2F8LA 2RBEA 3OM1A 1SQ0A 1XTRA 2H52A 4RE5A 2VZ9A 3HKDA 1D1PA 1VKNA 1W2GA 2WHQA 4N9QA 3RRFA 1UQTA 3HFRA 1TU0A 3G79A 3M4JA 4CU2A 4A2PA 1NI4A 2D4HA 1OLSA 1PFQA 3FUXA 4FSXA 3GRPA 1BVRA 2CYBA 3IRUA 4NLLA 1YRAA 2HDWA 2R1TA 3A9UA 3NDJA 3P2YA 3D3EA 2AQKA 2BWJA 5EVJA 3TTTA 3EFOA 1E6EA 4OJTA 4M8KA 1FB5A 2O2XA 4MQMA 4CF5A 2VRCA 5K45A 1H93A 1PKXA 3KR9A 4PIPA 4M9QA 4R68A 5KSWB 1BXKA 3HBJA 2DH5A 2Z3WA 3G5LA 2DFNA 4UM5A 3QA9A 2BGTA 5FWYB 3GRYA 4L8VA 3H18A 3A1FA 4QTXA 2ZVDA 1KBZA 3TX6A 4R8RA 3U49A 3BE5A 5C8YF 3ONFA 7ABPA 4QQFA 5B6JA 5DK6A 3K0CA 3P9NA 2KWIA 2QD1A 3M34A 4EX6A 4DL9A 3OCXA 4I7EA 1XCPA 1AUPA 1UXOA 2FPRA 2OHHA 2QSUA 1NAIA 3EHDA 3FCUB 3L79A 3MK31 4OQMA 3CKYA 1HYGA 4UBJA 4ZVQA 1CX9B 3DZBA 4YT2A 1YDWA 1YQDA 3O3CA 3GZNB 3SKYA 1NJGA 2FU5C 2XD4A 2M6LA 4BO2A 4EHFA 3TE6A 5A7FA 4LOLA 3V4LA 4NPHA 4TOIA 5FWNA 2F1JA 2XYGA 3BQMB 1TLTA 3O3NB 5IT5A 2JA2A 3ECSA 1JA0A 2D8AA 3GGOA 3NTOA 1V39A 4JS0A 1ECGA 3N5KA 5K8UA 4UXHA 2ZRFA 1M2VB 3AB7A 5AUNB 1G2QA 4ZWNA 4Z7QB 1RXVA 3K31A 4KTTE 3C5HA 5EIAA 2DBYA 5EMLA 1O4WA 2UYYA 6PFKA 4BO1A 2XZLA 2H51A 2W6JD 1EFPB 1FF9A 3BMNA 4NK4A 4REQA 4C4SA 3A9WA 3A1EA 4AG5A 3WFJA 3QEJA 3AM3A 2DQSA 4PTZA 3SIPA 4WBXC 1I1NA 4AJJA 4MHTA 1E2IA 4WCDA 3P5BA 3T1QA 1BC5A 3UJDA 3JVIA 4P38A 1N75A 4EWLA 3AI7A 1DL5A 1R9MA 5JCJD 1J9EA 1SWVA 3GEBA 1UPAA 2OB2A 5BUZA 4ZAVA 8GPBA 2E6UX 4JBNA 1AT1A 1V8ZA 3KOUA 5DTMA 1GM5A 4YIKA 3CIOA 2H1SA 5JY1A 4UASA 4D0LB 1MPTA 4EF4A 2P35A 2VHJA 3NAGA 3T3NA 1JKIA 4QXQA 1C3OA 3GLRA 3BAZA 4R8LA 4WUVA 5SZIA 1QRAA 1E9RA 2J0EA 3W9BA 2VCYA 3LCMA 1G1AA 2WUEA 3ZCUA 4CM3A 3L4EA 1ZUNB 2Y27A 2BHSA 2WJ6A 3BRSA 3GBSA 3WGIA 2XZOA 1GKIA 3UV3A 4MULA 2VF5X 2C4VA 4BP8A 5K6RA 3LQ4A 3RUFA 2FA9A 1MVLA 5IKEA 2PL3A 1HWYA 1BIFA 2X41A 2WKWA 4GZ5A 4RPGA 4QWMA 4D82A 4F3YA 4U3JB 5HMMA 2VRNA 4RS3A 3M9WA 3FVVA 3SQOA 4TRRA 1GNLA 3IKMB 1L5GB 1U7WA 1YRBA 2JAPA 5EZQA 3JZIA 4XGKA 4BYGA 4QUKA 3H4TA 1K5PA 1EA5A 1EP1B 4XSVA 3HRKA 4D6PA 1YJXA 4MWBA 2X0DA 2QZZA 1P9NA 1A7UA 4BUJA 5BMVB 1N5MA 4LDPA 3AB8A 1IBSA 3PDIA 2BFDA 2XITA 2HKIA 1WSBA 3O47A 3WGTA 1ZSYA 2QORA 4TUYF 1KPHA 4GUAA 4YRTA 4DQUA 1XRRA 4DYHA 3WMWA 4U2GA 3W4JA 3OPQA 1GZ6A 3A3KA 3UMRA 4NKRA 1TAQA 4K3UA 3IURA 4MRVA 4MHSA 3G8DA 1DVRA 3K2EA 2O8FA 1RQGA 5CT4A 3GA5A 3U9TA 1P2SA 2WWIA 1U1EA 4OGWA 4EZEA 5AJTA 1GR0A 4BUZA 1Q5PA 3OIVA 4C0AC 1PW5A 5GONF 4PRZA 5K05A 4H7PA 5FL7A 4ENWA 1FS5A 1A96A 3L46A 1U63A 1P1BA 4D41A 1U2PA 1C9NA 4ES6A 3RBAA 1FYWA 3CMMA 3F6CA 1EZZA 3D7RA 2YV3A 3HYRA 3LT2A 2VJYA 1PF7E 1KJWA 2XV1A 3ICOA 5GPBA 2LGJA 2O20A 3E2IA 2OV1A 3G85A 3IQHX 3AR2A 2JJMA 4D6YA 2ST1A 3CCCA 3FVTA 4O5AA 3QKSB 4L16A 2Y1WA 4W1SA 5K0GA 2I3ZA 4JHLA 2OTCA 4FK8A 5FI1B 3CRW1 1MT0A 1I9GA 5CEFA 3I9FA 4Q93A 2NZWA 3NAQA 1B7GO 1SJ9A 4D4IA 2O5CA 1DKPA 1I2MA 2AI1A 2G1KA 3O94A 1I4OA 3GWGA 4IV8A 1U1DA 4FONA 4C7MA 1R4NA 3MCWA 2ZG6A 4AJKA 2FXVA 2JLQA 3RC9A 1M34A 4HSEA 3VRHA 5C3MA 5F9FA 3VKHA 3RVRA 1H6CA 4FHZA 4DLRA 2QUBA 1IULA 2IHKA 2JI7A 3B2QA 3MBIA 4F21A 5IULC 2DHEA 4GGPA 5EQFA 1OBFO 3N8DA 4JB8A 4EVIA 1OFTA 1IJEA 3WSTA 1LSSA 4GBMA 3FSGD 4UUNA 2ZUEA 5KCZA 3CF6R 2X9VA 1YONA 4J7CA 3SG0A 2O1SA 1QS0A 4TZKA 3IA7A 3MRTA 2WWWA 4NBTA 1IOWA 1PD1A 4ER3A 4ZVPA 1E69A 1BRMA 3G2IA 1T3SA 5A2GA 5C8YA 1GAXA 2OBFA 3VA7A 4EJ2A 3C1OA 2WFZA 1BMQA 5I7OA 3WE7A 2IW3A 5IK2D 5JCOA 5J4HA 4F9EA 3TRKA 3VR4H 2AMFA 3NBZC 3PF9A 4TWJA 3DOFA 4D8TA 5F7OA 3VJMA 1PJZA 5AM4A 2ONZA 4HS9A 5JE8A 1IM5A 2OXTA 5JQGA 1UPXA 4RULA 1BE0A 2JDIA 1D5WA 2WW8A 4H77A 4DR4B 4MB0A 4PXSA 3H4MA 3R44A 4XW2A 3DL4A 1I1QB 4FGJA 2EARA 3SZGA 2ACKA 3JYOA 3R1IA 2QAJA 1EXMA 4EI7A 5FOXA 2P1ZA 4GYWA 4CQNA 3MLBA 2AFIE 4E1VA 2VA8A 1SIUA 4IX9A 4YRGA 3WAGA 1A4RA 2AXPA 2R79A 4OBBA 2Q5CA 3LC7O 1YS1X 2AN1A 4M54A 1A4IA 2WWGA 4WESB 4Q7KA 3DAOA 3DBOB 3EWAA 2IQIA 1E7QA 1GKUB 1YZKA 4CODB 3BF7A 4L76A 2C7QA 3DBRA 1W59A 1IHOA 1XD2B 2A33A 2OFOA 3COSA 1IFXA 1VPDA 1G2PA 3SHVA 4YAOA 5TPZD 1U0RA 3Q4GA 3P45A 1N3IA 1X7YA 3EEFA 1H8HD 1QWOA 1EGMB 3KHKA 5F1OA 2X8LA 3ILYA 3LZCA 5I8ZA 1IZYA 2A9FA 5I7AA 4ZPXA 1LK7A 4PZLA 4M21A 4MNTA 1D8AA 3A31A 4XWWA 3UHPA 2ABWA 4FUTA 1X7WB 3M33A 4TV9B 2GN6A 1RAAA 3ASYA 1T5OA 4FN4A 1A2BA 1P2TA 2ZI5A 2BN4A 2FRDA 2WF6A 3PI7A 4G09A 4HRYA 4US1R 4B76A 2IT1A 4IJVA 4XVUA 1DBSA 2RONA 4KRYA 3HO1A 1KORA 2F9LA 1SXJC 2OT3B 3LPNA 1ULTA 5CAEA 1SXPA 4G8CA 4P58A 4RH0A 4MYRA 3BT7A 1TVKA 1MZVA 1FW8A 1Q7BA 1ST2A 1YFZA 4B3SB 1EWYA 1Y4ZA 3CVXA 4EG6A 3K2BA 3NTRA 4FEGA 4EKDA 1VG8A 1ZMOA 3A27A 2HRRA 4A9AA 3QKRA 4A8JC 2C29D 1KE1A 2OV6A 4GFDA 2IHVA 1MH9A 5L3RA 1A8SA 4JNCA 4M1YA 5KCMA 4TPKA 3EXHB 4U7WA 5EE3A 4MVJE 2BRUA 2ZWVA 1QV9A 1VE5A 2DBZA 4A2CA 2P75A 2OV4A 3FMFA 4H7KA 1NNSA 1U7HA 1UT8A 4KIJA 1KNQA 3IBGA 2PIAA 1MJNA 4I55F 3LX5A 2FZVA 1EVQA 3G0CA 1HFEL 2JGFA 1D1QA 5AW5A 4F7WA 3RHSA 4N03A 3VC2A 5H7XA 2DSNA 4DDMA 5JVDF 3OIWA 1KEKA 2PUBA 1RWQA 1UMCA 1Z8NA 1F4PA 1VC2A 2NU6A 3DCJA 4KRGA 3F73A 2CF6A 5KOHB 5FO1A 3I28A 3Q7TA 4JBHA 2BSAA 4HVAA 2ZGVA 1NXOA 1LDYA 2QLTA 4H4DA 1O7JA 2BBWA 1JQLB 3QF4A 1W5TA 1XOIA 3ROQA 1KK1A 3TMAA 1UK8A 4MKFA 1ZJ6A 3JRNA 1T5SA 1UPTA 2WSSA 2XNCA 2BHRA 2JH3A 5I7WA 4RM3A 5L3QB 3OJLA 1G8HA 1EWTA 5DBIA 1DKOA 3MRXA 5ADWA 1PNOA 1FNMA 1KZ1A 3DUFA 3NC1C 4UU1A 3W34A 1ZJ4A 1UMKA 2GPTA 4DILA 2XCLA 4Q4CA 3AM1A 2XD9A 3PSHA 4JEMA 1I2ZA 3B3QA 2G3YA 3ZIDA 4BMZA 1G6Q1 1B74A 1YRYE 4IJMA 4FGWA 3IVGA 3V6LA 4F12A 4R51A 3CUSA 3CT6A 2V6FA 3IA2A 4J1TC 1CJCA 4UVDA 3HVHA 3GLGB 1H2YA 3ED1A 3S2IA 1D2CA 2G9RA 3U7HB 4LNHA 2VJMA 3FKSD 4WCFC 3BWBA 3B85A 3UG6A 3L7AA 1U3GA 3UVEA 2VNAA 3C3XA 4IMIB 4NEHB 5DNDA 4QHYA 3ZK8A 2R66A 2XX3A 5FCDA 4UZSA 1UBEA 3U26A 5AVSA 3LUGA 3LVFO 2FZCA 3CLTC 1YNOA 5EJ5A 1U0LA 4FYJA 4PAMA 1P5FA 4Q3EA 7REQB 5IXYA 4B3MB 2HFJA 2R6AA 1OTHA 1B6SA 1H6AA 4HVLA 1R4ZA 5ALHA 3NP9A 2XVAA 1BXZA 2Q4TA 1P2DA 3EODA 4D3ZA 2COUA 1F3LA 3IMFA 3FCXA 1B42A 3G2MA 4R7GA 3NU1A 2EKPA 2B8EA 4UCXA 3CR8A 1C81A 2Q2VA 4OXRA 1E3IA 1Z5UA 1QIKA 2CNKA 3E0XA 2K5UA 1X2EA 3BK7A 3LXRA 4KXLA 4A2WA 1R9NA 4MSUA 5F1YA 1F51E 5B4UA 4DADA 2YWBA 3MAGA 1R66A 1G8SA 2ZRBA 3FDXA 3FFAA 4KQJA 3RU2A 4E30A 5LMCA 1ORTA 5E6SB 1D4FA 2CZGA 1QNFA 2J07A 2ZJZA 4JA0A 4DLUA 1RCTE 2QZSA 3C6XA 3AHGA 1H69A 1KP2A 3MSXA 3KQSA 1P60A 1QIEA 2NW6A 5E8JA 1ZD1A 1ISFA 2CVZA 2W2NA 3P9XA 5IEBA 5CYOA 1ADFA 1X8JA 4PE5B 3ZCRA 2VTKA 5FA5A 4CR7A 2QPOA 2ZAIA 3BJZA 5FUXA 1ESMA 5H82A 5KHAA 3Q88A 4OKNA 4X6YA 4DJAA 4CV3A 4QQ8A 3RSGA 1FFXB 4Y9UA 1INLA 4M99A 1VPLA 2O0JA 1XP8A 1NVFA 1VLMA 4R54A 3DLPX 3LOUA 1EP9A 2QD3A 4YNBA 2IZ5A 3NATA 2XQFA 3Q3CA 4PX3A 4I1IA 5ECDA 5K3FB 1M54A 4KQ1A 4GLBA 1HE2A 1SVNA 3K35A 1OYWA 1IXSB 3L43A 4G63A 2Q6IA 3UJPA 2NUPB 3GC6A 4HDKA 2IYQA 3EIEA 5IABA 1JG2A 2EIXA 3L1KA 2P7IA 1R2QA 4D6XA 5C35A 2VWQA 4JP2A 2H7YA 4HEJA 1IN7A 3DS8A 4K9OA 5EY5B 5ESXA 3UIEA 4ZYVA 4HZUA 4D25A 3JARB 2CWWA 3HCCA 2NPOA 1U2RA 1JHQA 1JIQA 3QVSA 4YDSA 2XAUA 3U6KA 3U17A 2LBPA 1UOEA 1BEZA 3RE1A 4XVCA 5CDGA 4CEJA 3UWKA 3GP3A 5BXQC 2R5WA 1M6WA 3PC2A 2AQHA 2JBAA 2KYRA 3JZMA 2FPWA 1E98A 2XODA 4JY7A 4OHVA 3VH1A 2B21A 4Y1GA 1CQWA 3TN7A 4G8DA 3ZNOA 2PUDA 1KK2A 1WPQA 1KJIA 3FFTA 2ZRCA 3R0QA 1YR2A 1UOQA 2IPAB 1WZNA 4GWLA 4HTFB 3SLRA 3E6AA 3L7OA 4I55A 4KJXA 3ZGYA 3EEYA 1VL5A 3WBFA 3AEZA 1XO1A 3MTBA 2EOAA 5KNBH 2WD7A 3RAFC 3M7IA 1NF8A 3N8HA 3DEHA 2O3UA 2HMTA 2JLRA 3IPXA 5JVDA 5J2TA 4DDKA 2UVPA 3SC3A 2EJUA 3JQQA 4ENQA 3O1IC 3D43A 4X1KA 3FXAA 4AYTA 2OQRA 1YO6A 1CJMA 4NZOA 1JEJA 5JHHB 2ATEA 1Z8HA 1SN7A 2ZRMA 3ZCPA 2A0YA 2I9PA 2F64A 3LHIA 1RLTA 1RJDA 2OAGA 3USES 3VTKA 4EELA 1IJFA 2JIQA 2YWDA 4CMKA 3DWFA 4RA9A 4IIYA 4JGGA 3WMGA 1GNRA 2G8NA 1K3UB 2FEWB 5CMLA 4AY4A 4ZHQA 1EDDA 1UXHA 2Y92A 4JL8A 3ZVRA 3HB5X 5K6AA 2FGKA 1NPTO 5D2CA 2P7HA 4UEKA 2JFFA 3RUPA 1ISSA 1UJCA 4B8WA 5IAEA 2NUAA 5HRAA 1IWPB 4DV0B 1JU3A 2H1OA 1T5BA 2PZLA 3UEOA 1R4AA 2GF0A 2JJ2A 2V7XA 4PPNA 5I7VA 2RB5A 1T4MA 2EZ4A 2COKA 2HL6A 4G5RA 4LOJA 4PX2A 4WOJA 4WY5A 5HF6A 5HEKA 3W2EA 5AHXA 5ADUS 2O2DA 5ICCA 1I2AA 3RCBA 1P81A 3I8OA 1P4SA 5KIAA 5EUCA 2EWMA 4OFXA 5FADA 1US8A 2JLYA 3FZNA 5JJIA 4PICA 4BLSA 2J0SA 3KX2A 1ZPDA 4RWZA 3NETA 1KZ6A 4KYVA 4BFLA 3AW9A 2V45A 3B8HA 3KXDA 4IIGA 1CYDA 3L04A 3KU1A 3ZJ5A 1EU1A 4J0QA 4JT9A 3K0CC 4QQRA 3A1UA 4OIFA 3OE7D 5EP3A 2Z30A 5C5IA 1OF1A 2JGAA 4JI8B 3OZUA 2AX4A 1CULC 1SD5A 1A1SA 3T9AA 4ZALA 1ZITA 3C87A 2XXAA 4DBLE 2OBLA 4IF4A 1RAHA 1VIDA 1VLQA 3H11B 1PE0A 2K7ZA 4R2JA 4TLLB 4JXJA 4I1UA 1BMTA 1JR3D 2FDRA 2OP0A 1NKSA 2YHIB 3OZAA 1OWOA 3QUQA 3ZS9A 4QUGA 4BNWA 3HN6A 2W5UA 3BGOS 4HLNA 1NQWA 3V2IA 2QX4A 4ZJPA 4UZEA 3KYIB 3LCRA 2DF8A 3LY7A 2FVXA 4LQCA 1AUXA 4DOMA 2W8BB 1GA4A 1S8AA 4C76A 4CM9A 3THWB 1KHHA 3ZUPA 5IAOA 4HGYA 3P26A 4FFLA 3OKCA 3L02A 2P3QA 1MABB 2H5EA 4URFA 3LP6A 4P22A 5ES3A 2OCYC 2VDRB 2FX3A 1JE1A 4KYUA 4DLYA 1YJCA 2BDUA 2E21A 3RSQA 4B0PA 1GPLA 1YL6A 1JGTA 3CRMA 3GBPA 3JYLA 4FMDB 2ADMA 1COZA 2E7ZA 2P4EA 2PUWA 3E9ZA 4RZ3A 5JAIA 1EUQA 4E14A 1XDSA 3SYKA 4C1NA 2GM4A 1M2FA 3RC3A 1O5IA 4MVJH 2FCRA 2XWJI 3B52X 3ENNA 1EXNA 2NV6A 1SKYB 2V0NA 4TQGA 3IEUA 4CHGA 2DU8A 3LUPA 5ECWA 5EP4A 3S2FA 1D04A 3LDHA 4KUHA 5ENZA 1KQPA 2WMNB 3HA3A 4KL8S 1G8MA 2HBRA 3KJXA 5LVAA 1VA5A 3TOSA 1N0WA 3X1JA 1Z5GA 3MM4A 3AHCA 1UIRA 1T5DX 3MZ0A 5JG7A 2B4KA 4GOLD 3UB2A 3ZCQA 2FOLA 4DMCA 1M67A 2WHXA 1E5TA 1BRTA 3KC2A 4MW7A 4OYHA 2X0EA 3UXYA 3CN7A 3TW8B 2CUZA 3AU9A 3QPCA 5C8VA 5CFQA 2O19A 3AETA 3FPLA 5BSUA 1L5LA 2BGIA 3M83A 4M86A 4E2XA 2ZJ2A 3VU8A 3QUAA 5JZ9A 1HRKA 2I4IA 2ZWMA 3FETA 4FZ3A 3FPJA 3E18A 4NNOA 4G2TA 1ENYA 3DHVA 3N8GA 3E35A 3LHKA 3CRVA 2OFWA 3SNKA 4XLLA 3U62A 4ETMA 4RWEA 4Z4GA 1WA5A 5U1PA 4HBZA 3VZBA 3O4IA 3O8BA 5TV2A 3GH1A 2G7ZA 1NE7A 4UE2A 2C97A 1OKKA 2ECPA 4LVOA 5CLFA 1CU1A 1B41A 1HT1E 3OJWA 4QBFA 3VOBA 1BHSA 2YNMD 5KWSA 2FLKA 4AS2A 4M2LA 2Q6VA 5ADVA 4QFMA 5CDFE 5JCPA 1JSXA 3M6LA 4GH5A 3QUCA 3G9UA 2XDQA 3LUCA 2CL0X 3EW7A 3ASUA 4HJXA 2C4NA 3G8BA 3IAUA 4E31A 4EG0A 1NXWA 2AX3A 3QVGB 2GAAA 4U7PB 3I8XA 5ENDA 3HN7A 4TXLA 3DJFA 3F5FA 1TM7E 2FMIA 5EXEA 5KU7A 2B8WA 2BF4A 1L7NA 3GY0A 3L49A 5CP8A 5K51A 4XB6B 1UDAA 5I9IA 3MILA 3MYYA 3WYNA 4YRKA 2HSEA 4RMIA 2PWAA 4QU5A 2J9YB 4MITA 3ESRA 3AILA 2DEUA 3UW1A 1TA4A 5IDQA 4KTVE 1U99A 1WEHA 3KOMA 4R0VA 5DTIA 5CLJA 1PJ3A 4ZVLA 5A71A 3CZAA 2RC5A 2PGDA 2I34A 2XGGA 5I4CA 4UDXX 1LSJA 4LJ5A 5ABPA 3AKCA 5H9WA 2FETA 1E0SA 5K0NA 1K68A 2ZJ6A 2UZ0A 5CB4F 5JYBA 1RI4A 5TGTA 1R8YA 2Q6OA 2REBA 2AEEA 2CXRA 1W0CA 1R6AA 4QGGA 3SX2A 3IERA 2QX6A 5DFAA 2BFBB 2QD2A 4BX9A 4JR1A 1CBUA 1WMEA 2HV8A 3FTCA 2GHTA 4KPYA 1JFFA 2FQQA 1M7HA 3FZGA 2CVOA 6Q21A 5G0TA 3EG9A 3MJFA 4L02A 5K0ZA 3G68A 1U7TA 4Z49A 3DEAA 5CVTA 5CG2A 1P9LA 4H7IA 3TG2A 1ZR4A 3AJ9A 1SURA 5TY0A 5HG0A 3H3JA 1ZL2A 1Z37A 1QR6A 1W8IA 2WFAA 1AS0A 3ZDCA 4J6FA 2PH5A 2ZTHA 3AL3A 5F7JA 2D6FA 4HGOA 1DXQA 4PLVA 1C9YA 3F9RA 1CY0A 2BBSA 4NBUA 4M7PA 5K8TA 1EJ6A 2V58A 3OUZA 2I8LA 2KHZA 4F93B 4XWTA 5KWEA 4KE7A 1EEXB 3FTPA 4MUFA 3K92A 4B85A 5KYUB 3LWZA 1PO7A 3HDYA 1IG0A 1RWVA 1B15A 2H29A 4GS5A 4ZEVA 1QWSA 2XSZA 1IDOA 5KNDH 2HEGA 3GEDA 4KU4A 5FWDA 2W6CX 3BL5A 3U3XA 5JAMA 3OJEA 4MV8A 1R64A 4J0IA 3DNPA 4C04A 4BO0A 2RCNA 2Y0CA 1XEWX 5JCOC 5LKRA 1KJZA 3E3MA 3GNTA 4F3RA 3S44A 2GVNA 2HSGA 2UZ4A 1OT5A 1FLNA 1NLFA 2E55A 2HIGA 3HYNA 2B98A 4QDOA 4HGRA 3ZDRA 2AR9A 5FTNA 2HIAA 1A9YA 1S2GA 4C4PA 5JY6A 1QORA 3EFEA 2GFQA 1E1QA 3B1VA 2PFSA 1OT3A 3FZQA 2OESA 3NHRA 4A4DA 4L51A 2WUGA 1JALA 2RHGB 3TW0A 2XE7A 3AT1A 1M6HA 3AF0A 4MR7A 3V9PA 3PKZA 2O8CB 4KGZA 4ZVSA 2WE7A 3B1ZA 4F4JA 1TT5B 4PY2A 4MDFA 1Y1TA 2R62A 1EVJA 1A2QA 4MPTA 4QGAA 4KO3S 5KYYB 3HP7A 1Z15A 3NO4A 4S1VA 4HTAA 3GEPA 2JEYA 4GP6A 5AD1A 4AO7A 3ZXUB 2EZ9A 1CRQA 4KE8A 1XVIA 1HLFA 3OPXA 4JMLA 4FU0A 1JSRA 2SKEA 3ANLA 4R1TA 4PRKA 3K9CA 2BI8A 2W2KB 2PUJA 2OD9A 2X5XA 3E3NA 3P9YA 5AO9A 4HV4A 4HQOA 1GU1A 1MB3A 2WVHA 2DFKB 1LK0A 1NNUA 1OAAA 3CLUD 4IXTA 3A6GA 3EJWA 3LC1O 2F9MA 5FTKA 2EWVA 4F1KA 1OFUA 2VATA 4ER0A 3LXUX 4IXDA 3U4IA 3WGKA 4V1CI 5AW7A 3DNMA 2HA2A 4Z86A 1NDUA 4RXMA 5JYCA 3IT2A 1NT4A 3FUCA 3NGMA 3LQKA 2RGCA 2FRDC 3T3EA 1LLQA 1K0UA 1R27A 3VPBA 1RIIA 4D8VA 1ZJYA 4EATA 1KRWA 3UG7A 1VRWA 2OPHA 4KQKA 1CE8B 2VQSA 3MWYW 3OPYB 3VPXA 4HS4A 1Y6JA 4EP1A 5BXYA 4ZTBA 4GZLA 4XDHA 2Q1SA 1GUYA 1WETA 2VWGA 4KITB 2ZZMA 5IEJA 4BAGA 2HCRA 2G63A 1TIPA 1HE4A 4HH4A 5IJZA 3DVSX 5FYQA 1JSCA 3VJLA 1P33A 1BQEA 1EAYA 3FPCA 4NE7A 4B6OA 3ON5A 1HKUA 3IMCA 2FN8A 4G0UA 3GOQA 1WB6A 2Z8YA 4WTOA 1RMTA 5B1YA 1UEIA 2R4QA 2CJYA 3MMXA 2NNWB 3HVJA 4P0PB 3RT7A 4ETNA 2BRUC 1BW9B 4H0NA 4JLSA 3SXUA 1RM5A 1VKHA 4B81A 1TW2A 3F6PA 3GJZA 5U4XA 3KQTA 3CX8A 4WXRA 2GZ3A 1E1KA 1U6JA 2PLNA 4RGYA 1YRLA 4WOKA 4KQFA 2PN1A 2MJLA 4ODIA 1KDYA 4WXHA 5JZMA 2UUOA 4CG0A 1Y9AA 4NV0A 4KREA 5K3OA 4ZCTA 1YHNA 1WXEA 4DV6B 2ZRKA 5A02A 3I6IA 1LZKA 3GPIA 2GNPA 3RHFA 5BNTA 3AIMA 4TMFA 5EVCA 3OLYA 4F2GA 1ADYA 4XWGA 1XA4A 2R2GA 3KLNA 5HTKA 2JANA 2H1HA 4NYMQ 4QRHA 3W2HA 4FDTA 1ZJWA 1H9BA 3TQTA 2Y71A 2LIPA 1PFGA 1XEXB 2A3NA 1N0IA 2QVLA 2QMQA 2W4IA 2FW0A 2AOUB 1XQVA 1PEYA 1T0BA 3KHUA 3OJXA 4GSYA 4WFQA 2QTCA 5EC8A 3R7WB 5HBGA 3DYVA 4X84A 2CJWA 5F35A 2GN2A 1J5PA 3FYUA 4YJ2A 5LZ4A 2G4VA 5JBQA 4DMUB 1F2TA 3OO0A 2VRCD 2OBBA 1RBMA 1JHYA 1C29B 1C80A 1VE7A 1X3SA 2QJTA 3TE7A 4KNYA 2IUYA 1P4JA 2WILA 4BGIA 1DIBA 1YMUA 3K05A 1A8HA 5DI9A 1AKTA 2GBLA 4JLWA 1NWCA 3KYDB 4MKHA 4PLZA 4CLXA 1JHRA 4RHTA 1QUEA 1DRWA 2J0UA 3Q7RA 4EHBA 2IP4A 4HQ0A 3JX9A 4DRYA 1QFZA 1V43A 2X8BA 2XWBF 1M5TA 4NX2A 3NHWA 1D4ZA 2PGAA 4UCFA 3CBQA 3QVOA 5EZSA 3BIOA 1XRLA 4LGVA 4XFJA 1TAUA 4UD6A 4E03A 4GMDA 3I83A 3QQPA 1NX6A 4XQ9A 5BQFA 2H4JA 2I7DA 5HNKA 4MQ6A 3L2OB 1MG0A 5FBWB 5IBCA 4LFAB 1KI6A 3PRHA 4P83A 1U2ZA 3U4DA 3ZXXA 3FDZA 1SHZA 1W96A 2BBOA 3DPUA 4B4UA 4COKA 1PJSA 1D09A 1YIAA 1CQIB 2DQ4A 2HRCA 1JTEA 1QLJA 4MV3A 4QU0A 1N8SA 4RV9A 1F2VA 4X7MA 4UVIA 2XBMA 2A30A 2C94A 1GITA 2EC5A 1K98A 4L9RA 2PT6A 1BE1A 4RVSA 4HQNA 1XL0A 2YYYA 5AJYA 1AOXA 2PS0A 5A1TA 1WL8A 1OB2A 2YHSA 2BFNA 2QTVB 3OU7A 4LN1A 5AJHA 4F5YA 5CIWA 4PG4A 1QB8A 1QGUB 3A4IA 3CX4A 4YCLA 1OILA 2I4NA 3M6WA 5EKUA 2P6PA 4NXNB 4BNIA 1EB8A 2D4AA 3PQ5A 1XQWA 3CBGA 3OFKA 4FBGA 3L8HA 2GRAA 1XFDA 2WA1A 4JHXA 4YBRA 5BO5A 5TEVA 2I4LA 3QVLA 6REQB 3LAWA 3S29A 3S8YA 4WKGA 1FP6A 4P8RA 4OK6A 4DNQA 5CFPA 4CETA 4BFZA 2GASA 3BUSA 1SB9A 3W3AA 4Z9XA 4JSRA 2Q28A 1NF9A 3HBMA 1W4CA 4EZBA 1QF6A 2EBUA 5KHOC 2D1QA 3CH6A 1Q44A 2TYSB 2VZ0A 4CFZA 1UKZA 2RHOA 1AQYA 3LDFA 4BZWA 4EY8A 4UM7A 5DBFA 1DOAA 2WKPA 2HJSA 3DLCA 4ESHA 5EWLB 3K96A 3BFVA 3K5WA 1SD1A 3L84A 4MZXA 4A5SA 3JQRA 1LPSA 2W6PA 3PFWO 1MAHA 2E4YA 3VH3A 4DBZA 4QBHA 1FYDA 1C3VA 3BXFA 2FSIA 3BWYA 1X8XA 5EJ8A 3PA6A 5ALWA 1Z17A 2DETA 2UXDB 4P84A 4O4IB 1DBPA 1NQUA 1EWKA 2A92A 3NAMA 3HGMA 1R0SA 2ZUUA 1O6BA 2Z09A 2VYVA 2ZBDA 2OHJA 2P5YA 2R4UA 3HVIA 3I2HA 5D86A 4E07A 3SSMA 1R0YA 3UFXB 3F4LA 1IY9A 1Q74A 1J0EA 1QFYA 3ICVA 3IKVA 4IX1A 2C5GA 4M0KA 2YHUA 2Z1DA 2ORED 3H8WA 2FG6C 2P5UA 3WQBA 4EHIA 4J0JA 2IA5A 3K0BA 3K71B 3DTVA 4LNAA 3NIFB 3UGJA 2ORVA 2R9VA 5G3ZA 4LBZA 1Z62A 4DCSA 4ZXFA 2OGTA 4TQ9A 4YUVA 3AH8A 4KDEA 4PLHA 2ZTVA 3FNQA 3AVOA 1PFVA 3BX1A 1X0VA 1CVRA 1Y3CE 2HMWA 3JQPA 3L1VA 2BTQA 3IUJA 4N6NA 1JH9A 3HDHA 2D7DA 1KETA 1ZC4A 4HFMA 2NZVG 5AK5A 3AESB 3T7TA 1VMIA 3IMEA 3HKBA 3DPSA 3EOZA 4CRWB 3MTIA 1C7ZA 4F38A 2VH5R 5JSHA 1EB9A 1EVYA 1KH3A 2C84A 4J9VA 1QTQA 1V8OA 1DARA 2JI4A 2HTEA 2QL6A 3H0KA 1OJLA 5FBHA 4PIVA 1SBYA 4E3WA 4D4MA 4BNDA 3DULA 2Z5LA 1A8IA 4AJPA 2SECE 4AULA 1ZGAA 1ZIPA 4KXFB 5IJ9B 5IM4F 4F2HA 3I34X 3OLZA 4I36A 4YJGA 3TF5A 4MQEB 2CK3A 2PV7A 4MR9B 3KQKA 1NMYA 5AM3A 1PBNA 1XZKA 2MYUA 4FVTA 1OX4A 3I30X 5CB6A 3R5SA 1U0BB 1GYQA 1D2HA 1NUPA 4AF8A 1ZBDA 1J2UA 1GSHA 2OQIA 4OKIA 3FRIA 3FAKA 4CN8A 2O2GA 4RGQA 4E88A 2C3PA 1QDEA 3PJEA 4JB3A 3GPLA 4TWRA 5K6AC 4OQDA 2REOA 3FDFA 4JKOA 1G3QA 1L4BA 3FB4A 3KR1A 1GZHB 1W44A 3VPAA 3S8EA 2KMLA 1CNFA 2FSSA 1OX5A 1ZM9A 4PINA 2CKDA 3M1YA 3C1AA 4PM4A 2ZBFA 2C98A 3KZ1E 2V7QD 2ROQA 4KNVA 4MR8A 5DLPA 3VTZA 3KKMA 4ZV4A 1COWD 3K70C 2J4CA 5DOVA 3ELUA 3U7QA 4JBYA 4OGGA 5FBRB 4WLOA 4NOMA 5C31A 4C6HA 3HABA 4DANA 3JWGA 4HB3A 1WCXA 4JP5A 2FFQA 1NGSA 4QL3A 5EN4A 2A86A 3TB4A 4I4LA 3IB3A 3BM5A 4O29A 4EY5A 5FUVA 4YV0A 1W34A 4RTOA 4JI2B 4Q3DA 4QPJC 1E3JA 2JDID 1YCGA 3IOYA 3UC9A 1D6MA 1SB8A 2ODTX 4YGXB 3ZIUA 3GFTA 3LFUA 1RC8A 4WBNA 2HU7A 1C2TA 3OT1B 5B36A 3EPJA 4I1RA 3JQDA 4NCIA 3JYQA 2A88A 3FLEA 5CH5A 2BGLA 2BFEA 4BQEA 2GEVA 2GJAA 3HDQA 4M0FA 1Y9JA 2I4RA 2ANBA 3DD5A 5IVHA 5DCUA 4C29A 1XT6A 3VO2A 4R1MA 1KAEA 1SU6A 4DVGA 5AESA 1O77A 2RGDA 3DM5A 2AJLI 3GA0A 3RB8A 2Q6LA 1AS3A 1DRVA 4GMHA 3U4CA 1TB4A 3UKDA 5KQMA 3KWJA 3FFBA 2BMVA 2UYHA 2JI8A 1BCSA 3L8YA 3P96A 4EG1A 2QQ0A 4NZMA 4XKJA 3WDKA 1OFGA 1ZK0A 3SCZA 3HTXA 4ZZ0A 5KTOA 1T1SA 1ZXLA 5LA6A 1RI1A 1WB5A 2RHJA 1ANKA 1OYVA 1JIKA 3CN9A 1ECFA 2Y76A 3TM5A 1RXIA 2VPXA 2QTFA 3CO0S 1CUVA 1TZBA 4LXXA 3QMMA 1M66A 3HWWA 3OZRA 1OASA 3MD9A 3UHFA 3VC3A 4P3NA 1U65A 1BE6A 2YWXA 1H0SA 3RARA 1N5OX 4FYWA 4XE5A 5IUJC 2JLZA 3ORYA 1MMFB 1LI5A 3ZW7A 4ISBA 5FUBA 1Z4KA 1N6KA 4G0QA 3SYRA 4CQMA 1S8OA 3QBJA 1QSGA 4DLWA 4G5QA 4MAFA 1GTG1 4XFKA 1LB1B 5AKZA 3S4YA 3LP8A 4BECA 3I9V1 2P9YA 3R5HA 4QT4A 1L7XA 3ADKA 1FU8A 4M0MA 2ID8A 5B55A 4EL0A 3SS8A 3DAHA 1IZ8A 2O2JA 4G41A 3AVTA 4J7XA 4DT1B 1KMHB 4RKQA 4MP6A 1GG8A 1JVNA 4NF2A 4EG5A 3BMQA 3TFQA 2CT8A 1GQ2A 2WU3A 4LNUB 1J0BA 2YV2A 4TLDA 1Z3CA 1LNQA 4HX5A 4QOSA 3EIQA 4DMFA 2HA0A 2KM1A 2RIPA 1H6DA 2I3AA 1LVHA 2JH9A 3HI4A 4KI7A 4MQFA 3KETA 3N58A 5IWAB 1LDNA 3CVUA 2PSSA 2GILA 1N92A 2Q6KA 4U0KA 1QIFA 4D4HA 4YUXA 5SY4A 1TI7A 3FPGA 3H1TA 3S8MA 4R1NA 3RU3A 2OD7A 1IC6A 3C4VA 3KBBA 3U3DA 1EX6A 4V1CA 2XXJA 5IMBA 2BY4A 2R1VA 4QBKA 1VI5A 4MRNA 4PQFA 4YJFA 2W6IA 4YP0A 2GD0A 5HDBB 1J24A 3C97A 3ZKWA 4RJTA 2II6A 3U3JA 1W1IA 2WJ3A 1JXQA 3V55A 4CF7A 2XVZA 1Y5NA 1ZONA 5EMKA 3ROTA 5JDCA 1WOMA 3KE9A 1Z6XA 4BNGA 2WSSD 4N82A 3NBAA 3PRJA 2F1HA 1WW2A 1OLXB 3I23A 4P5DA 5A9RA 5TQJA 2GESA 1ZI8A 2CFRA 1VL8A 5C8ZA 1HMPA 1EVZA 2RFLA 3A3PA 3HCAA 1SCJA 2GKOA 2H85A 1DI0A 2PRJA 2JVKA 3IUQA 3DAFA 4BNFA 2Y6VA 4BRZA 1AGYA 5LU8A 2BMEA 1V2HE 2M1ZA 3WV5A 2Q1TA 5H4GA 3NBMA 2ASEA 4A03A 4UQOA 4Q9LA 3VSDA 3T1TA 4JXZA 3ICWA 4A27A 1QIIA 2PMDA 4R7TA 3F96A 2VOEA 1KYYA 1X38A 2JCVA 2MINA 3VR3A 4DDWA 5L7WA 1WMAA 2JFVA 5EPOA 3T0FA 1Y6ZA 3GFGA 4EPVA 2OV3A 3W4IA 3C43A 3KPVA 1IYZA 3BL8A 3D7NA 3PZBA 1VHWA 4G5FA 3SEZA 1L7DA 3G2JA 4JA2A 5F73A 5K0LA 4L0DA 4EW6A 1IQ0A 1O8BA 1Q15A 4J9UE 1NIJA 4NENA 4CDNA 2APJA 1W88A 4HMQA 4PF1A 3ZWQA 4F60A 1RWPA 2V3VA 2AZTA 2CZQA 3VQTA 1NNLA 3PVCA 2C96A 2FEKA 3GFBA 1RBQA 1YS9A 1KRXA 3ROFA 4YJHA 3R5TA 2V6MA 3T38A 3DGFC 3G2PA 2JRLA 2HLNA 1FDOA 5BUQA 4CPDA 3D3NA 1U8YA 1UZUA 2ZROA 4JWKA 3UAXA 3IDZA 4D9GA 1FFDA 3OHPA 4YYZA 1P5RA 3EUAA 3VR0A 4POAA 1E92A 1L5WA 2AG0A 3GEEA 4YCSA 3AIKA 4HWKA 1FDRA 3SHQA 3WAKA 4NYMR 4AW9A 4HUTA 1KA9H 4KFRA 1B8VA 4COOA 1E62A 1JDNA 1K6EA 3A9TA 1SVUA 4FFBB 2Z0MA 4JL6A 3SZLA 4X90A 3LF2A 4B6PA 1KEUA 4YO8A 4MDYA 3VH2A 2G76A 4CM4A 2A1TS 3NVDA 4WLFA 4RD0A 5KSYA 2ZULA 3HU3A 4JQSA 5EWMA 1EDEA 3U44A 2BR5A 4Y2SA 1J07A 2HGSA 2R8PA 1ADGA 1BYIA 2WZCA 1SVIA 2IUFA 5K03A 1ZHFA 3DMPA 5B7GA 4KLRA 3B3FA 3DZIA 3L5OA 1H0HA 4BKQA 1JG7A 4DZZA 2GFIA 1OIWA 1TTPB 2ZI7A 3CGGA 3ZE1B 2I3GA 4D57A 3DE4X 3D81A 4J6EA 2JFZA 2BZGA 3LNTA 3RC1A 5BQ3A 5BUSA 3PL5A 1NDQA 1A9SA 3LXMA 1G19A 3MA0A 5FWAA 4JBGA 5DRYA 2O2ZA 5WRFA 4LEIA 4X97A 4EYEA 1TK3A 1Y81A 3IESA 1QONA 2JIMA 4R9VA 4RQUA 3OX2A 1M0EA 2G1PA 2PUCA 3KJFA 1E9VA 1I6MA 1XR3A 3DTYA 4OQNA 5FV7A 1B0AA 3LM8A 1FSPA 2KB0A 4RPLA 4EHHA 1MQAA 4IHJF 2OK7A 5F52A 2G71A 3UWMA 1IZ7A 2K6GA 4XVQA 1HE8B 3W6NA 5BNIA 5JCZA 2VNIA 2OG2A 4CU5A 2Z2YA 3QLTA 4ACAA 4QUAA 1AF7A 1P18A 3K20A 4L4ZA 2BFFA 1R3DA 1KBQA 3KYJB 4WJZA 3RKSA 2A1UB 3O3OB 3UWPA 2D1RA 5NLLA 3OFVA 2B1RA 2IYEA 4WOBA 2A4MA 3GLQA 4PYMA 4FZJA 3TTWA 2VHQA 4D42A 2PQ6A 1MGOA 5J2UA 3LTEA 5LXTF 3UQYS 3MCVA 2W2VA 3Q3HA 3EDQA 4M8NE 3T35A 2ATCA 3H9EO 1J8FA 3CVOA 3CRQA 1VP3A 2AGVA 2WUWE 3AZQA 4PLPA 3BERA 4DW8A 1QQAA 2NP7A 2E0IA 3BMOA 5I4KA 4ZDKA 3PXXA 1Z2PX 1VL0A 2F3SA 2R25B 4P3XA 3WHPA 3KQWA 4UHDA 1U0EA 2X58A 5CFZA 5ARBA 5LJLA 2D3WA 3FA2A 1ZD8A 3HP1A 4BLTA 2JJQA 3AY7A 3K0EA 3PE3A 3OFNA 4IDGA 1APBA 1ZL0A 2V97A 2E4WA 5DLDA 3SEFA 3A6JA 1QQ7A 1K7CA 2NTVA 2OKCA 1A9PA 1EWVA 1NASA 3ZZ1A 3HCFA 2YMQA 5IU6A 4JBLA 3KQOA 2ZBPA 4OUDA 1L6IA 1RYNA 3AP3A 2P8SA 4JKYA 1GZ4A 2IF0A 2FSPA 5J5VA 5EKXA 4B45A 4RA6A 3V1TC 2P3OA 3SAJA 5LZ2A 2XR1A 1KAQA 4LZNA 3VI3B 4ABTA 2TECE 3O2NA 1D2NA 3QFCA 4IRUB 4P7GA 3T4PA 1MGPA 2IRWA 2ZYTX 1FYFA 1G41A 3HBAA 3ID6C 2PJDA 4D8XA 5DGIA 3F6SA 1IH8A 4U9IS 3LKVA 3FPSA 5CXQA 4EW2A 3ZTTA 3UMVA 5BV1A 2VTEA 5HTOA 3TS1A 2ZBVA 1EFRA 4IVRA 1RBZA 1QYDA 1RADA 3OC6A 3FVWA 3F49S 3DWEX 2X3FA 4EGCB 1ZZGA 3GHYA 3KM0A 4JEUA 3OT5A 1C14A 1PJRA 3AR5A 4LA4A 3W7AA 2A9QA 2F3RA 2WU4A 3HDTA 4YCDA 2JJ2D 3I05A 3IQDB 4B2YA 5JFTA 3MWLA 3SFZA 4A3SA 4Y9TA 4YS6A 5A5DA 1BGXT 4DKJA 4CF6A 2I99A 3KLOA 3OQHA 1NR5A 1YBFA 4WKPA 3FYUC 3WYFA 2F8TA 2ODNA 2WAAA 4D4GA 5A9TA 1SEVA 5JAUA 1DEHA 1QP4A 3IELA 3P2OA 1TEXA 3K72B 4ARIA 1MENA 3IHKA 4JLNA 4GPEA 3A9VA 5KJCA 1CDZA 4N0MA 1ORHA 1Z12A 1UM9B 3EGXB 2GBLC 4YMSA 1NYTA 2WIFA 5H5JA 1JEQB 2EQBA 3DCNA 3FSEA 4XGRA 5ALFA 3AR6A 4ZVRA 2WYWA 4F96A 1E5XA 4I5EA 1NQOA 5JS8A 4RJIA 5F4ZA 3VUEA 3VGJA 5D6OA 2QVYX 5F2EA 3WWPA 4H3HB 3STTA 5GGYA 4AXBA 4HAOA 4KAJA 2G77B 1QFMA 2QP9X 2RGBA 2ZRLA 3UT6A 1JXMA 4F3KA 4A36A 2GAOA 1V71A 4EDHA 3EF0A 1JYFA 2A0FA 3W8DA 2AKEA 1KFEB 3OF2A 2E2WA 4HC4A 4MZDA 1R8SA 4RVUA 4A92A 1BS1A 4CM9D 4O2BF 2HT6A 4TN1A 5F64A 3CLSC 1TVCA 1KOLA 1ZGCA 2DSTA 2NIPA 1WZUA 3QE4A 4KSCA 1G5FA 2RJOA 2X42A 4TKVB 5LCXA 2PTHA 2UDPA 4MB2A 4JGIA 3TVDA 4EFNA 1KZ7B 1Y6FA 5EPUA 2IIQA 4MUXA 3DT6A 3AEKA 1IPEA 3ZXYA 3VZPA 3LCJA 3B36A 3LZ6A 3BBPA 3MMSA 2O2HA 4P3YA 1Q11A 3SVLA 4GKKB 1OGYA 1A9OA 1N1MA 3FYSA 4C78A 2PGJA 1KYWA 1D0SA 1KAGA 1N8NA 2CFTA 3FR7A 3QSGA 4G5OA 4G1FA 4HOYA 3I3SR 4IBOA 5EIBD 5IYZF 4B3RB 3GELA 3EIFA 4BBAA 5G40A 2PXAA 3AUUA 2AJBA 2JK1A 2VDKB 4LXQA 5K3SA 2G36A 3BB3A 4X1IA 3RS4A 4KQCA 1QJCA 3MJSA 2YQ4A 1H23A 3EARA 3I2JA 4RV4A 4E70A 2HO5A 2PH7A 3N6RA 5ECYA 4OHZA 2HJRA 1XDZA 2Y8EA 5I4BA 2ZYAA 3RAJA 4NHOA 2CL6X 4HY3A 1NF2A 1NUUA 1WCIB 2EKZA 4FIDA 4PSUA 3WRWA 2Q3EA 4Q9DA 4ER5A 1RZRD 4YJ3B 2X7JA 5YASA 3T3PB 1UM8A 3BMCB 5BT8A 1X9GA 2VTBB 2EX1A 5I9SA 2VQDA 3O03A 3PD1A 3OZSA 1PWEA 2P8JA 2QYSA 1VCMA 3WB0A 5T4BA 5KEIA 3HU5A 3ZDXB 2GBCA 4LIPD 3N6VA 4LWPA 1WZCA 4F91B 5AUPB 3SYTA 2IXBA 4RZHA 4F2WA 4JROA 2VP4A 4JK3A 2P1RA 1UINA 4Q1DA 5DCLA 5LXTA 1WTCA 1S2OA 5JD6A 5JI2E 1OKKD 1NULA 5TE9A 2GMWA 1T1EA 3U56A 5G1OA 1WG8A 5H9VA 4RQTA 4OQQA 1NUTA 1I33A 1KVQA 1DJOA 3KK0A 4RIEA 4QOFA 5CR9A 3SQDA 1NJ6A 1QVWA 1TGYA 1YA8A 3IAM1 4RKRA 5A3SA 3C5VA 1V4VA 4G1VA 4TMWA 3PGKA 3GVXA 4FMCF 5BOSA 1P1FA 1VLVA 2AJCA 1BJRE 4PIMA 1QH8B 2WVAA 4HZGA 4DARA 1U0SY 1Z0AA 1DMSA 3GGJA 1SKYE 1XYVA 4FGLA 1G8GA 3V7UA 3VZSA 2YMPA 3FCSB 3NBYC 1QF9A 3VUFA 1UR5A 4B3HA 2XQIA 5TNXA 1EFTA 1RLJA 2Z5GA 3D2BA 3N7AA 1RI3A 4FI3C 4ICIA 3AEQB 4PFKA 3OEEA 3OZTA 2PLFA 5B1DA 1WP4A 2IU0A 3LQYA 3TSOA 1SIOA 1I32A 1YASA 2H59A 2BLNA 2XUIA 3PQCA 1QRUA 4K9RA 4EHKA 4YY3B 3QXCA 2J4FA 4E5DA 2GKGA 1LF5A 2ZQZA 4INPA 3SOZA 1FNNA 3A70A 2NV2B 2ID9A 4OLAA 1V4BA 4P4SB 4ZGGA 3D4OA 1A9ZA 2OHOA 3T15A 5CURA 5LWHA 2CWDA 3TZEA 3JALA 5JFOA 5CJPA 1ACMA 4YMWA 3JVVA 4JJ4A 2C5SA 2FE4A 5ALTA 4Q4AB 3ZCTA 4C06A 4ZJYA 2QN1A 4Z4IA 3C7TA 1Z8DA 2XUJA 3MTJA 1AMNA 1G6HA 1YKFA 5BPHA 5FOWA 1KMIY 3O93A 3FG9A 4KH1A 1DQRA 3V4RA 4BWFB 2WOJA 4RDIA 1MAWA 1KI9A 2GDZA 2JGRA 2Q2NA 3R5XA 1RYZA 5U9CA 2ATXA 4UOQA 3UBTA 3EAFA 1YFLA 1UKYA 2A0KA 4BNMA 2DZDA 4X45A 3U16A 1F2UB 2VKTA 2HNKA 1BOOA 4MPJA 4QXPA 3M6AA 2VVTA 3PGJA 3K15A 4IUYA 4RXUA 1UBNA 4KV7A 4QSMA 4HGQA 2Q5LA 3K94A 4CMIA 5M3BA 4E1BA 1GCUA 4IVPA 3DBIA 3VPHA 3IAXA 1Y34E 4BLQA 1SUIA 5KVQA 3WKAA 4BNKA 4U4AA 2VJKA 4RIHA 4ZD6A 1Y3AA 3PNYA 5A5GA 4QG3A 2IHNA 1WX1A 1V6AA 1W85B 1WULS 4WXYB 5CFOA 2KSQA 1DC3A 3GLIA 1G59A 2GTPA 3LX6A 4OAPA 1Y63A 1P0QA 3A58B 1REQB 4UJ5A 5KOJB 1HDCA 1IAQA 2C4KA 1IY8A 3JASB 5EZYF 4EMBA 3FIJA 5K0EA 4I1PA 1SZCA 5BR1A 3ZD9A 2IS4A 5ICGA 3ZXIA 1AG9A 3AJEA 2OG1A 5ETJA 4V39A 4D9EA 5T7BA 3EEBA 3L6EA 3UOGA 2Z4SA 1PZFA 2Z2ZA 1E1QD 3VNQA 3RYCA 4B6JA 5JRJA 1HBJA 1XDUA 2OAQ1 4FNOA 1Q0PA 1DHTA 2MIIA 2PS9A 4P7FA 3Q7IA 4GPZA 3DG9A 4JYCA 4ABYA 4OCZA 2IH4A 4YV2A 4JJZA 1E79A 2DPHA 3B78A