2PYZA

Crystal structure of the complex of proteinase k with auramine at 1.8a resolution
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title Crystal structure of the complex of Proteinase K with auramine at 1.8A resolution
rcsb
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2pyzA00
5I9SA 3EDYA 2W2MA 4NE9A 3DVQX 5FBZA 1LW6E 2ID8A 2W2OA 1T1IA 1Y1KE 2Z56A 5AQEA 1SUPA 1Y4AE 3WQBA 3F49S 4OMCA 1Y4DE 3QTLA 2P4EA 3H42B 4Z2AA 1GCIA 3GCWA 2PMWB 1PEKE 1CNMA 1TM1E 1C9NA 4JP8A 3BPSA 3HJRA 1SCAA 2G4VA 3BX1A 1GNVA 1ST3A 2X8JB 3GT4A 3VHQA 5JXHA 4OMDA 4C3VA 2ST1A 3A3PA 1S02A 1SCDA 1PTKA 1BFUA 1PJ8A 2DP4E 1R6VA 1SH7A 3L1KA 1BJRE 1NLUA 1AF4A 3AFGA 3DE5X 1Y33E 5FFNA 1GTJ1 3I30X 2Z2YA 3DE4X 4CG0A 1AU9A 1OT5A 2W2QA 1BE8A 3VSBA 2HPZA 5SICE 1IC6A 4NE7A 1BFKA 3DW3X 3F7OA 1C9JA 3LPDA 1Y3BE 3D9QX 3PRKE 1SVNA 1C3LA 1A2QA 2E1PA 3DE2X 1GTL1 4WOCA 3PTLA 2SBTA 1SPBS 1SCJA 2WV7A 1SIBE 5AMXA 1KDZA 3I37X 1EGQA 1SCNE 1YJAA 1TO2E 1Y3FE 1AVTA 1SBNE 4HX2A 1P7VA 3UNXA 1WMDA 2Z2ZA 1C9MA 1SELA 2ID4A 1SBHA 5JMOA 1NDUA 2XRMA 1TM3E 1MPTA 5AVJA 4RYDA 2DQKA 1MEEA 4NMXB 1AV7A 4AKSA 3QFHA 4J94A 5B1EA 1HT3A 1DBIA 1T1GA 3Q40A 3BGOS 4AKTA 2V8BA 5ARCA 3WHIA 1Y34E 4MZDA 1GA4A 4KB5A 5JXIA 1YU6A 3DW1X 4H6WA 5B1DA 4YN3A 3LXUX 2PKCA 1DUIA 4KG7A 3AJ9A 4CFYA 1EA7A 1Y48E 1CSEE 3I2YX 1WVMA 2Z58A 3D43A 3TI7A 2PWAA 3DYBA 3Q5GA 1S01A 2SNIE 2Z30A 4B5LA 1TM5E 3ZXXA 3TECE 1BE6A 1TM7E 3CNQS 3VTAA 3VV3A 1KE2A 3DWEX 1GA6A 2SICE 2PWBA 1NDQA 1SUBA 1OYOA 1TO1E 2PQ2A 3T41A 5JXGA 3VYVA 5JXJA 1SUEA 4KPGA 1JEAA 4H6XA 1ZVKA 4LVOA 1AH2A 1TM4E 1S2NA 3DVSX 1T1EA 3DVRX 3VV2A 4BWGA 1SIOA 2B6NA 1WMFA 1IAVA 3DE6X 5ARBA 3SICE 1VSBA 1Q5PA 3DE0X 2W2NA 2ZRQA 4FONA 2IXTA 1TMGE 1Y3DE 1AK9A 4I0WB 3F7MA 3AJ8A 5ARDA 1SBTA 1KDVA 2X8JA 2HD4A 4ZARA 2DUJA 3A3OA 3A3NA 3LPAA 3I34X 2PYZA 3QMPA 2ZWPA 3DDZX 3DE7X 2TECE 3GCXA 3LPCA 1YJBA 3GT3A 1R0RE 4WOBA 4DZTA 3WIUA 4OV6B 2XTJA 2WUVA 3OSZA 2ZWOA 3DE3X 4C3UA 2GKOA 1SUAA 1BH6A 1SUCA 4CFZA 4LVNA 2QTWB 1SN7A 4DJ5X 1THMA 5FAXA 1R64A 2Z2XA 1OYVA 1XF1A 1TECE 1ZVJA 3EE6A 2PRKA 3P5BA 1Y3CE 1SBCA 2Z57A 1PFGA 2SECE 1P8JA 1SCBA 4HVLA 1GTG1 1YJCA 1SUDA 1UBNA 1KE1A 4M1ZA 4H6VA 3CO0S 1SBIA 3WIVA 1P7WA 1KDYA 1GNSA 1V5IA 1GT91 4ZOQI 5AVKA 1WMEA 1WSDA 1Y9ZA 2W2PA 3SQOA 4K8RB 3ZXYA 1TK2A 3EIFA 1V6CA 5K7SA 3DE1X 3TI9A 4GI3A 4DWWA 1AQNA 5CW1A 2IY9A 1SIUA 1GA1A 2WWTA 2WUWE 1ST2A
chains in the Genus database with same CATH superfamily
3OOHA 4LJ9A 1ZI8A 4DCJA 3JYNA 3R5KA 3WISA 1Z6YA 3IHTA 2NPIA 3QHQA 3SZ3A 3PX7A 1Z35A 3NR2A 4ZT2A 3TEFA 3Q3GE 4MKZA 1QJ4A 1Q2UA 4A16A 4AO8A 1O5IA 1YCDA 3H5RA 3AEQA 2WKWA 3JAWB 5AXCA 2ID8A 4YJ2F 3WLTA 3FOZA 3RRXA 2WY2D 3N9IA 3PPVA 3B89A 4GOXA 2AFIE 4L2IB 2BE9A 2P2YA 4K6MA 2Q0SA 3OBIA 3U44B 1MOQA 2Z56A 2VK1A 2XA2A 4KUGA 3TQHA 3ZY6A 4NCJA 3ID6C 1SHZA 1SUPA 1E2IA 3LC0A 1X92A 1YB4A 1QOZA 3PICA 4EO4A 1RKUA 3SFTA 1KIAA 1S2GA 1KK2A 2CXXA 2GN0A 2YICA 3PFCA 4DNXA 3I8OA 4G1EB 2J0UA 4IJKA 3MTJA 5KQSA 1KZ4A 1OV6A 2R44A 4OLAA 4PYKA 3O1LA 5JFGA 5EOVA 3S2YA 2ZM6B 2CLKB 4FGJA 4TXJA 1Z8HA 1B76A 2IPAB 3L82B 4KNWA 4PE5B 4MUEA 3U9LA 3RSGA 5M2QA 4CM4A 3VTKA 1VL8A 3WTBA 1D1SA 1J8VA 4MDFA 2IKSA 4A36A 4WNCA 4XGIA 4OXRA 2R6GA 5DI9A 3WZ2A 4YCSA 2FLWA 3HZRA 4AYWA 5A3QA 3WGKA 2C5EA 3VC1A 5BWBA 3IE1A 2O4CA 3BX1A 3NM4A 4FGLA 4WXPA 5BOVA 4KIJA 3WBFA 1XPOA 4R9SA 2NZJA 3UV6A 2N9UA 1LFDB 4JI0B 3D1JA 4NBNA 4OKIA 4XOUA 3VVLA 4MROA 1B0PA 3AUTA 5JROA 1V11B 4PHFA 3CT4A 2R7KA 4RJ2A 4BQPA 4URXR 1KAGA 1LI7A 2YN4A 2JCSA 4N8EA 3G0GA 4B3XA 3TYXA 4DLWA 5CGZA 3K9QO 3OKAA 2IPLA 3F6SA 4OSOA 2J5KA 4QGSA 3ZNQA 4RD3A 2QI9F 2GEKA 2ZCUA 1LNSA 5EZ6B 3TKAA 5J2UF 4JFRA 1NUTA 1X7YB 2VHYA 4YHHB 2WAXA 1XQ1A 4Q3NA 1QH1B 1SH7A 3QLUA 2Q1SA 4HDQB 4XQGA 3RG8A 2OCAA 4J0DA 3TKLA 3ZUPA 4QC2A 2GSWA 2B1RA 2A88A 4HB4A 1T2CA 3BBLA 1G41A 5T64A 3BRQA 2HMVA 4ETMA 8ADHA 2UUBB 3KIPA 4GWGA 4DGQA 1CRWG 1LK0A 1T8WA 3CNOA 2GBFA 3IAXA 1Z73A 5K3FB 1AG9A 1XL0A 3KYIB 2PCJA 1I4LD 1OX4B 4C1BA 3DPSA 3GRFA 4UPEA 5MF6A 5LP1A 1Z34A 4IAOA 5G4LA 1QGAA 1YDHA 5K8CA 1RWKA 2XDWA 1IBSA 2AXPA 5BQFA 1NG9A 2NWQA 1G8HA 3ON5A 4Z9YA 1AMUA 1BXRA 1ZN8A 2WJHA 2XOXA 3W8RA 4W63A 4LWOA 1GKKA 2AH5A 1EBUA 2OT3B 2Y4OA 3G8YA 4GEKA 4NE7A 4YMLA 5KDOA 2FU5C 2QOEA 4TQGA 4JQSA 3IVRA 3K0AB 3NTRA 4JT2A 4R69A 3W8NA 1C9JA 2OZEA 3BJZA 1P0PA 3KTOA 1BEZA 2O3JA 4ZZ2A 4MUBA 2X0RA 3SJCA 1K5PA 2RHOA 5BUCA 3LRXA 1WRBA 3AP2A 1M6YA 2C4NA 2FOLA 4ZVSA 1VPWA 1FCJA 4EMUA 4NU6A 4CM9A 3W5AA 1RXVA 3ES9A 4Z4HA 1E9FA 4X00A 2XNJA 4HYTA 3RH0A 4AY6A 2EW1A 3GFTA 1E9DA 4OLJA 1AO0A 2ZPUA 3C3MA 3KJIA 2GQ0A 5CT5A 5BO5A 5I7UA 4ID9A 3AYXB 1NM5C 5IBRA 1EXVA 1LJUA 3IURA 4OK6A 5TGZA 3W2HA 3OCVA 1ESCA 1VE1A 3AGQA 4RLSA 4C07A 4KAAA 4B9EA 5DX1A 3VU3A 1A8PA 2WV7A 5B6JA 3OCWA 1A9ZA 2IWHA 2I91A 3MHTA 1TEHA 1V1MA 2ECKA 1CDDA 3EPRA 2F4NA 4Q1DA 1RADA 1Y3FE 3UJ9A 4IJVA 3GNTA 4HNQA 4R40A 3LRTA 3PHJA 4IZIA 4EJSC 5ECDA 3IMFA 5CITA 1ZNWA 1AGNA 2C84A 3K1AB 4YDRA 2Q07A 2HJGA 1LV7A 4PS0A 3SFVA 3L77A 4DRXA 5CD9A 1KY5A 2PCLA 1CIVA 3V00A 4NCAA 3AM4A 2VVTA 3WHLA 4EFLA 1TRKA 1QHHB 4HS4A 1EK0A 1SXHA 3C70A 2HF2A 4D41A 4EJSB 4B7ZA 5EJ5A 3B1XA 1C7ZA 2PD3A 5DSTA 2R86A 4KQEA 5CXQA 5MN4A 3PVSA 3LUJA 1SK9A 1EVIA 3EQZA 4TMKA 1UKEA 5KKNB 4NZPA 2C8VA 1BQ4A 4NPHA 1PDOA 4IH1A 1VG0B 4IS2A 1W44A 4WZAE 1CUSA 2I55A 2PMKA 4TVKA 3GA5A 4O0MA 5TQ2A 3UUGA 4A8HA 4CCYB 4AI6A 1QHFA 4P6VF 5DN6A 5FNVB 2E0IA 4IIJF 4JLJA 4N01A 1UBSB 1KK1A 2NXNA 1Y34E 4RZ2A 3O8QA 1MGPA 1YDGA 3ER6A 4KB5A 2DUWA 4W1QA 1KHHA 3BDAA 3K9CA 1R2QA 1RC1A 4GPBA 1ECCA 2J5BA 3FH0A 4ILEA 1CR4A 1JVBA 1XJQA 2RJ3A 1YZVA 5ALLA 2AN4A 1U8UA 2SKCA 3D5TA 3O1JC 4P7FA 4RMHA 3GJXC 4NVRA 3HKDB 1LY1A 3MUOA 4DDMA 2P2CA 2Y67A 3A4VA 3FCSB 3N39C 1G17A 3ST7A 2VPTA 4GMHA 2QGFA 2X5JO 3A1CA 4J49A 4CFYA 1E5DA 1PS0A 2QV0A 3HDJA 3QH4A 4K2AA 3SS7X 2QJRA 5J1TB 3ZHRA 1ADJA 4N0EA 4NYMR 5EHNA 1Y6QA 3B6IA 3CNHA 5JAIA 3HNPA 1N5LA 2I54A 1IN5A 2ZYRA 3M1LA 4ON9A 3P27A 4KPEC 2II6A 1E20A 2Z58A 2KQUA 2F3SA 1SVKA 4O4HB 5C9ZA 1OYWA 2F9LA 5AKGA 1FU4A 4JEIA 2BZSA 4LDAA 3M6UA 1BHQ1 4WRRA 5FORA 2UZ0A 4RWEA 4RM2A 2CKMA 3D5QA 1EZ4A 2Y1GA 3EXG2 5LKAA 2E49A 2IODA 3SYRA 3QU2A 2EJCA 4L74A 4E6PA 1BKYA 4HT3B 2PKRA 5CIYA 1Q15A 3BJIC 1ORDA 2ZI5A 3BH0A 1BU8A 2ORIA 4RFVA 5D6OA 1IXZA 3K9GA 4L75A 5JFOA 5C8XA 1ISRA 1AHNA 3V4VB 4ER3A 4QUBA 4FHGA 1SVUA 4PZPA 2OCYC 5TQ0B 5TVKA 2WQZA 3BTSA 3MMNA 1PG5A 4GEGA 1UIRA 2R3SA 4HNVA 5BXYA 4OREX 3R9WA 2YJTD 3NBZC 1J49A 4MVXA 3N2KA 1P1RA 1A4UA 4NZ9A 3W77A 2ORYA 3DMPA 1NYTA 1E7WA 1M33A 4UNQA 2GRAA 4PZUA 1P72A 1IH8A 1SNYA 1RHQA 1X3SA 3X1XA 3ZE9A 4G56A 2O1XA 3HVKA 1CF9A 4CLDA 3OAAA 5EKTA 1LVUA 2R5FA 4ZV4A 2O20A 3IOYA 521PA 2ILTA 4UTXA 4YX9A 1OXKB 1E3IA 2R2AA 3K6SA 3TEMA 4XYGA 1NDQA 3UV3A 4MVJH 2DQZA 1FYFA 1J70A 4NYJR 2OHOA 5A7FA 4R8LA 1MT0A 2GF9A 4AKIA 4MLPA 4PANA 1HWYA 5EWJA 2VSNA 4Z5XA 2IXFA 2QRQA 1A7AA 1H2RS 3M4XA 4CEHA 3LY9A 1G8YA 2QTVB 3N6VA 3BGDA 5HIKA 4N6OA 5C8YF 4KWTA 1XRQA 1JH8A 9LDBA 1B4DA 1E1CB 2QRJA 2QZZA 4MW5A 3WNDA 1T1EA 5IT4A 2X5XA 5DGIA 5LC1A 5IJZA 5DYWA 5BN3A 1M34B 4GI7A 4ZQCB 5K0SA 4AJKA 1MTZA 3IYLW 4HN9A 4LWQA 3ODGA 4H0NA 3QTBA 2YJ5A 4D45A 4E7OA 3VA7A 3ZDDA 3INYA 4NCHA 4F8EA 4ZIRB 7YASA 4E09A 2IA5A 1AM4D 4N12A 1DI0A 1QV9A 2JLSA 2FPXA 4CQJA 2ZJYA 3VR0A 3ASVA 2WNSA 1Z26A 2BW0A 1QDEA 4WPGA 5A2GA 2IYRA 3M2TA 3BTOA 3UEOA 3UJPA 1YR9A 2VXCA 4ALMA 2FUCA 4DKJA 5GM1A 2C9ZA 3DMDA 1FVHA 2JLYA 4P0TA 2XHZA 3ORFA 3TQQA 4AJPA 3IUEA 3VH1A 2BHTA 2R6AA 2E3JA 4MP6A 2FSSA 3BCUA 4C6TA 3V4OA 4ZQGA 1UJNA 1IN1A 2ZYAA 4HD8A 3IHKA 4JJIA 3D6VA 1CKEA 4KAXA 1HTWA 3SHWA 4RHFA 3CLHA 2H06A 4XW2A 4MHOA 3SYNA 4F5EA 4D2IA 3CZPA 3MQFA 3QMPA 1XZKA 3CPJB 4DIUA 4AJNA 3I9KA 4R5MA 3SVTA 4CKXA 1KRWA 1VL1A 4QOSA 4D1YA 3EG5A 3PJGA 1UFVA 1WEKA 1OY1A 2R6JA 2TECE 4UBNA 1KQPA 3NDJA 3X2FA 2XW6A 1UODA 3C3KA 3QPBA 4REQA 4C2UA 3DR5A 5EIBD 1UDWA 4WOBA 4A10A 4F04A 2W5UA 4LYAA 3ZWAA 1NOIA 1MPXA 1MQAA 1VCMA 2C2WA 4J3JA 2GN2A 4XR4A 3ESYA 3R7LA 4DDVA 1S6YA 4ZHQB 3LTNC 1GTSA 3FB1A 5ERGB 4LHVA 5LBIA 4B8YA 3A1DA 1OC4A 4TSRA 2WG2A 2EWWA 4IUBS 3ZDRA 1JPJA 4FIZA 1Q1BA 1JBEA 1IVSA 2QVCA 5L3SB 1SXJE 5LQAA 2QUZA 1QORA 1BKSB 1YC5A 2FG5A 5FBKA 2R8XA 3NWOA 4EY7A 2OC4A 1TF7A 1E58A 3ETJA 5A4FS 3DZHA 1E62A 3T3EA 2AI3A 1F2TA 4R0VA 4X1IA 4X3OA 5T67A 5BN4B 4QFMA 2RGEA 5DTEA 5FJJA 4OHFA 4F5YA 3W9UA 5HZHA 5I7SA 1QDLB 2YCLA 2ZQ5A 2QA5A 2ZIXA 3A04A 3C15C 1MOZA 3TZHA 3VR6A 1SMKA 2EV9A 2HKIA 1H2EA 3AETB 3LI2A 2FP3A 4LF9B 2KWIA 4XCXA 5C4GB 3GX1A 4CM8A 3EE6A 4Z0PA 4L0CA 1H4QA 1NV9A 3P0HA 4U7JA 3NOOA 1U11A 3T06B 4YO7A 3WNQA 3IODA 1LFAA 1WSAA 1LS6A 3E7PA 1MB0A 5EG5A 3NAGA 4WCFC 2XEXA 5EJMA 5FI0B 3CLRD 2KW5A 4ZI2A 1LSOA 2ID7A 3A26A 4YWJA 1YQQA 3F8TA 2BY4A 2ECPA 2VUUA 2WPDA 1K98A 2V97A 2N0SA 3LO8A 3MT8A 4J0GA 3U3MA 4E5SA 4MOWA 2CXQA 3CONA 4FWBA 2HV9A 4UM8B 2O2JA 6LDHA 1V2HE 4JL5A 5DHAA 1PSWA 3QX9A 1IBLB 2H4JA 2O8BB 3IVXA 4K9MA 4MIEA 2Y99A 2ZI7A 1KETA 4WCFB 5DRYA 2QRGA 3RWOA 1XVTA 4TKLA 1HQKA 4EPYA 1EX6A 3G5MA 5KTTA 1W88B 1SBZA 4JJ7A 2QR3A 3RIMA 4N48A 4LFBB 5EHIA 2GZMA 2A30A 2WJYA 5LBUA 3CUWA 1QDUA 3BK2A 3TN7A 1AKYA 3L0SA 3BXOA 2NU6B 5FTNA 3UT5B 2E4UA 3ORSA 4BV3A 1HQYE 2C5FA 4R0MA 4O3FA 3BH6A 1S89A 1NHWA 1RQXA 1FNBA 4PG8A 1EP2B 4S0XA 4DA9A 3JASB 3TPCA 3GLFA 1F6BA 3QY0A 1HSZA 3A6ZA 4HUQB 4K8RB 2FB9A 2OCKA 3DKPA 2ZSAA 2ZZKA 2PKQP 2VXBA 1F8XA 2OK8A 3DL2A 1C9EA 3IP9A 3L7YA 1WO8A 1GGKA 4X3CA 5ELLA 2XT9A 2ANCA 1POWA 3ND7A 5H0IA 1OGYA 4EW2A 3VR6D 1TGVA 3F46A 1I7SB 5E2AA 4A23A 4I66A 4E22A 5B5SA 5JEEA 1JP7A 3PE6A 1AX9A 4BKQA 3OQNA 3WGUA 1S2LA 3VHXB 1A9XB 1QRDA 4OIMA 1YTLA 4CU2A 5CA1F 2VJMA 4B3TB 4XJTA 1RWQA 5ALWA 1TD9A 2Y0EA 3A3KA 1NMSA 5FPSA 1JIQA 2X6QA 3IE2A 4IV8A 1KJYA 3IX7A 2XTNA 3QUBA 1YZLA 4ARIA 3SN6A 4NE9A 1TW3A 3GJRA 3RAGA 2HWUA 2VK2A 2W48A 1RFGE 2WPDD 1T3LA 3D3KA 3HFJA 3PGLA 3TLKA 3WGQA 4B4WA 1XTJA 3W1WA 2FDCA 4A8JA 4PF1A 4MEAA 1WZEA 1ZI9A 3U16A 1O9GA 2O2CA 3AJRA 4QUGA 3CW2A 3P9KA 1DWQA 3HCFA 3PU6A 1KTIA 4LJSA 3ZDQA 4AN4A 1L7XA 4BQFA 3RTGA 1YNSA 3BGWA 3QMVA 3UW3A 3VR1A 5JTTA 4BFXA 4G9BA 5FV4A 1VHDA 1VTKA 2QTGA 1B8PA 2DHRA 2WIDA 3K3PA 1A0OA 1EFVA 3CKLA 3CINA 3KUXA 5ECYA 5B7QA 5IXSA 2C7OA 5E6RB 4A0SA 2CKDA 1YZ3A 3VGPA 3QTLA 3FFWA 3ICCA 3N5CA 5H1YA 5CRIA 4D57A 4LMAA 1N2CE 3T5AA 1JHOA 1HYQA 4YLEA 4L5CA 3RARA 3EGVA 2OHFA 4J3FA 5DV9A 5LU9A 4H0CA 3EMDA 3ZV6A 2O2ZA 2Y0PA 3CWCA 1LRJA 1ZK2A 4FDTA 1EZZA 5B6IA 1XPRA 5JMPA 4ND6A 2R47A 3NHAA 3O8BA 3IBYA 3C4JA 1SG6A 4TLAA 1YB5A 3GZTB 3W6NA 1TEXA 1R18A 1Z4NA 3SWWA 3H0EA 2ASEA 5DN9A 1GN8A 1BXZA 3IMEA 4RJJA 3BPSA 1PZNA 1RC0A 3K9LA 4NATA 5DHRA 4D96A 3ZH9B 1XJ5A 1NIPA 4LPKA 3C3DA 2VDQB 5DBGA 4EECA 4ED9A 3L1IA 2CFIA 5A9SA 3E15A 4E5DA 2OR3A 4YHBA 2FDXA 4OJKA 4WNYA 4PNZA 2P79A 2XYQA 4KMRA 2B83A 2YV4A 5I7FA 4DABA 2QJFA 2HRZA 2YMMA 2ZSEA 1PQUA 2VJBA 3L7DA 5FULA 5HHTA 1HQCA 2JCYA 1XXLA 3FPKA 3HL0A 2Q5LA 3K8QA 1XXHA 3I6BA 4HQOA 4JLWA 4K9NA 4JI2B 5FXMA 2F43A 1HFKA 1G21E 3M2PA 1E6WA 5KJEA 3QXSA 1MV8A 1JLLA 2X23A 4ZAWA 4CTJA 4EB6A 5HWSA 1GZ4A 1WLYA 5KBYA 2FW0A 1PT9A 3TNJA 4QVKA 4UHHA 3B9QA 3R3VA 3JSAA 4MLZA 1MU0A 3SCZA 4AYXA 5KNDA 4ARZA 3K0EA 2ZAIA 2HF8A 3BMOA 3K35A 3TDKA 4C7KA 4F9GA 3FHTA 4N3GA 4LRXA 2PSHA 3WLIA 4BGVA 4JOBA 1BJRE 5BR7A 3UFXB 1EVYA 1Z38A 3ESDA 3FWPA 5H9VA 1T4CB 1U63A 2GCOB 3MSCA 1WHSA 2CHVA 5T8KC 4YQFA 1O97D 5LU8A 2DJIA 4ALNA 5ESXA 3KT3A 3ZYZA 2C77A 1E8MA 3L7LA 3MYYA 4M36A 2ZT7A 3Q6NA 1G5FA 4YONB 4I50B 2ZRIA 3AF4A 3G6KA 4LZZA 3I04M 3ZOKA 3PKZA 1PU2A 3WKCA 3CB4A 4PLWA 4YCBA 4DE5A 3ELDA 3V1KA 4I5EA 3DG9A 2G0AA 1AKRA 4I3GA 1Z39A 3H17A 4M49A 4R2MA 4WLOA 5DGCA 1C7IA 1H1TA 4WKGA 4X95A 3T3NA 3ZGZA 2CZCA 3LGSA 3PBKA 5K6TA 4G36A 2E4AA 1PR2A 2KSQA 4FXOA 2B6HA 2O8NA 3EEBA 4DG5A 4QYIB 2JIBA 3LZCA 3JAKA 3CXRA 3GPLA 2RBEA 3BZWA 5HBRA 1Z45A 3C2QA 1AN0A 2DR3A 3F4LA 2JBWA 2X1HA 2P78A 3EEYA 2APJA 4YUYA 4Z1OA 1Q50A 5EA2A 4FW8A 5JR3A 1H2ZA 3BFJA 4CVNA 2CCKA 2I7VA 3MHPA 4O4IB 4R8SA 2FUEA 4PSVA 1TPZA 1Y3BE 3C8HA 3FHJA 3TTTA 2JFZA 1N2IA 3TQTA 3V1LA 3A31A 1TJNA 3AINA 3C3PA 3HKEA 3K9HA 2Q4RA 3PR1A 4ZXFA 4P81A 3W7AA 1J2UA 2P2GA 2XDAA 3HQ4O 1XP5A 2QLBA 5CDUA 1PWZA 2RGXA 1RS0A 2XVZA 1LBIA 4WJZA 1UM9A 5FPHA 1NBOA 2AZTA 3ETNA 1RT9A 5LQRA 3RC2A 3EGIA 4IQ4A 4AJIA 1FFYA 4QPNA 2VWPA 1Z6ZA 1ZUWA 1E2QA 2X4GA 3X1JA 3ZCSA 2IL1A 4BBZA 4BLPA 1D4OA 3RBXA 2IZ1A 1O6CA 5HCNA 4RS4A 4K46A 2TS1A 1W5FA 2P90A 4YASA 2Q2VA 1ADYA 3DXYA 4KQHA 2ASVA 4NOKA 2ZROA 2LW7A 4QVGA 3KQUA 3VC7A 4P0QB 3STTA 1MAVA 1J6UA 1AQIA 2AXEA 3M6FA 1X1RA 1YJAA 4WBNB 1HFJA 1D2AA 2YYZA 2OO5A 1AVTA 5L4SA 2X6RA 4O4LA 3Q3JB 4R9VA 2DQ4A 4W8GA 4ES6A 5LZ4A 4PFSA 2BGTA 4UAUA 5F3DA 2XGJA 2I87A 5ESRA 2Q1TA 2V9ZA 3HJNA 3W8EA 3WKEA 1BWPA 5GJWC 3R8XA 4BEJA 4C14A 4DLAA 1AB6A 3LUBA 4MGKR 3NLLA 4KBFA 1E3EA 1FP6A 4YRTA 4M38A 3ZWNA 1NLMA 5AJWA 4AXXA 4AKHA 3TZEA 4IIUA 2X9VA 2IHYA 1M72A 5EJ7A 1RYMA 3EFHA 1NKVA 3QBTA 1T5DX 1QV7A 4UJ5A 4RY9A 3HFRA 2I3ZA 3EZLA 1QQ6A 1QYIA 1I2DA 4F1JA 1AV7A 4AKSA 5EIEA 4JL8A 4KJZA 1LLDA 1DRVA 1XCJA 4GX2A 4HAWA 1DUVG 1VOTA 1KJNA 4ZV7A 3GZJA 1E3LA 2ZBGA 4V24A 4B4DA 2NV6A 3I9JA 3ICQB 3ROXA 3VSDA 4V1CA 1SKAA 2CNOA 4GQBA 5E1BA 3FDZB 4BV2A 1SR8A 4WZZA 2PSSA 3V48A 4CKWA 3GMIA 2WJ4A 1YIDA 5SV2A 1JDBC 2V8BA 1XVAA 1EYZA 3OT1A 3BIFA 1FTGA 2VHCA 1O4VA 1ZA2A 2D0PB 2AMLA 3L3BA 1DJPA 1KBZA 3WYCA 2NPOA 1MZVA 1L6IA 3LE8A 1O1YA 3TSYA 2EX0A 1YWGO 3R5XA 3USES 1QRUA 2XGOA 4JXJA 1A5TA 3RUPA 1MG0A 3R0XA 2RGCA 3GGOA 4PAGA 5ALXA 1UOQA 4ZFNA 3LV8A 1RQNA 4EGQA 4F84A 1FC0A 1JDBB 2PL1A 1U7HA 4H27A 2QX6A 4JC4A 1ZA1A 1O77A 5DH9A 1D7OA 3ROQA 3OHSX 3WLOA 1X1CA 1L4YA 2PS9A 2XQIA 3D3QA 4FGWA 1IOZA 3OIGA 1E1NA 2R96A 4H08A 3CNLA 3B60A 3WB0A 1T29A 1TJPB 1D2NA 2B8WA 3CX4A 4W9MC 2GO1A 1Q3HA 1L5NA 3GEPA 1Z88A 2FFJA 1OAKA 2Q0XA 2WMYA 3UMBA 2HN9A 2A5YB 5JW6A 3NFYA 3ZKWB 1P2BA 3WGHA 2P4SA 2G25A 2WYVA 3DD5A 4WOKA 5JH7F 2HFKA 2HT6A 2JGDB 5SZIA 1P2FA 1JIIA 3ITKA 3WBKA 2BMDA 2GX6A 2HQBA 3IPLA 4UKDA 4JT8A 4J91A 2PEZA 1HE5A 3L7MA 3D4BA 4PRYA 5GAJA 2D5BA 3LFUA 3O84A 1OFTA 3ZGOA 4AAYA 2FKAA 4RY8A 4EX6A 1QP7A 2PXXA 3PB3A 4KUEA 1A9RA 1F20A 4BX0A 2JFPA 5L7YA 1XQ9A 5G1PA 3GEIA 4G2TA 5CB4B 4XPIA 1XUOA 5CT6A 3JWGA 1YUBA 3I83A 4IXDA 2X2EA 2AJLI 4JIGA 4Z7JA 4R83A 4UUPA 3BMNB 3NHLA 3ABIA 3DUWA 4W6ZA 5NULA 1H23A 2Z8XA 3E9YA 3IELA 3WQHA 4Y9UA 3V1TC 3HU3A 2Q8NA 5BT8A 1PK7A 2XNSA 3C7AA 2EP7A 3K0CC 1TT5A 2CD7A 3O2QB 1PJAA 3OD1A 3ZE1B 3ZK8A 4NL4H 2GF0A 1XZFA 1BYIA 1WPQA 4US1R 2C31A 1M8KA 1RWXA 1EINA 4HXYA 4Q9IA 5KI6A 3JZFA 3ZI7A 1SXPA 2A3NA 2WNHA 3DP9A 3WRVA 1KZ1A 4HYEA 4J1TA 3W5DA 1R00A 1E2GA 1Z7BA 2VSQA 4MJ7A 2IBSA 5ICCA 3WLNA 1OV4A 2A9VA 2ORED 2PWBA 3MWEA 4PONA 2B94A 4DIFA 2GVNA 2Q4OA 3BWYA 3QI2A 2FPMA 3IB6A 3OPVA 1XZGA 2B2XA 2VF2A 2GK6A 3QNWA 3EPPA 3RU9A 1A9PA 3HA3A 3HCBA 3HBMA 1RDFA 2INGX 1SKBA 3L0YA 1W4LA 4L3WA 5HJ5A 2V0GA 5IANA 1QB7A 5KINB 1XDSA 2D13A 1P4RA 3A25A 4L9AA 4BQSA 4C0KA 3PUVA 1JHVA 1PF7E 5KTYA 3JAWA 1TTTA 2VP2A 1BYUA 2D74A 3IUSA 1NRIA 2ZUVA 5EVJA 3AR4A 5L4NA 2VZEA 3LBHA 1B16A 3C6ZA 4L2IA 3DVSX 2EKBA 5DO9A 3MD9A 3CRNA 1IRIA 4X90A 4MUIA 5IM5A 4TYMA 1PUXA 1SIOA 2Y1FA 3GCDA 1PHRA 2VZ0A 5K9ZA 3Q10A 2AC2A 3CN7A 3NKVA 3SXUB 2VDPB 1S3SA 2CN1A 4CLOB 1JF8A 3B7PA 3HVUA 4MVCA 2DPYA 2ENWA 4QODA 3U4DA 1Y89A 4NBVA 2IQ5A 4RDXA 4PINA 2BRUC 1AHHA 3I8SA 5U4XA 1H2FA 2OCIA 4TM7A 1E0SA 4JA2A 5EPOA 4Y9DA 5IFLA 1DL5A 1OXMA 3JWJA 5AH0A 1DQSA 4IEFB 2AE1A 3M83A 5BQOA 2CL5A 1G42A 3KPJA 1V48A 2YOFA 2Z04A 1Q77A 4J0FA 3IAUA 1HC7A 3TDMA 5HKKD 4DV5B 1EJBA 2AOUB 4J4HA 2FR8C 3FX2A 1AQ6A 2ORWA 3B1KA 4I1IA 2QJTA 5BW6B 3UHOA 4D81A 4EPRA 3BCHA 4ETNA 3I2JA 3AJ8A 1A98A 5EERA 4C5AA 1EI9A 2M6RA 3BXXA 4KDEA 3S40A 4M53A 1PDVA 4KQJA 1LCIA 2PHZA 1K2VN 1TZMA 5E8JA 1V11A 3AI7A 3TM4A 2PG3A 3TSAA 5C18A 4EG4A 2WKSA 4U8GA 2XTMA 3FGZA 1G4HA 1KNXA 3FMPB 2FN9A 2W4IA 1ZSNA 3M4NA 2H4HA 3MWKA 4LHSA 5DLEA 4YP9A 4OY3A 3KOUA 3DDZX 3GVCA 3CW9A 4U02A 2EFCB 3QVVA 4Z8XA 1W48A 1B2RA 1SQGA 2PQ6A 1XN4A 4TZ0A 4RL6A 3HN6A 3PQ2A 4B0OA 1X7YA 2C96A 3FJOA 3HLKA 4CF6A 4JNCA 3GT3A 2DETA 3NBMA 3FY4A 3RKSA 4E4YA 2A78A 4DZTA 1QH1A 3R0JA 4IDHA 4JAVC 4ARSA 1KHTA 1S2IA 1QJCA 4MUFA 5BQPA 4DHWA 2XZDA 1ILEA 4MLCA 3S1LA 4MEBA 4CMGA 4LHYA 1KERA 3VR2A 3KXLA 4ZKEA 2V7VA 1MKYA 4I55B 4RK0A 1MP0A 1NX9A 5JVDF 4L3OA 1NKTA 2GXSA 4D3YA 4F60A 4XQ9A 2O0LA 3BXGA 1DDIA 4RHEA 3WGLA 1VBMA 4KHZA 3RHTA 1NN1A 3P7MA 1E98A 2H1IA 3DCJA 4AJ2A 2ZIGA 4OL0A 3O38A 2YDYA 4ZEXA 5IXJA 1Z0IA 1ENPA 1US8B 1OPRA 2QM8A 3LYUA 4NY1A 5K3FA 1OX4A 4MDEA 4YDQA 3HM2A 3EXG1 3V8MA 1TKRA 1R3DA 4A0HA 4C4XA 3GXBA 5JCPA 2WILA 4IZHA 4UAVA 3LKBA 4FNOA 2HBZA 3DTTA 1R0XA 4L9WA 3DULA 5HJ2A 2JFOA 2ZYVX 3HR8A 2Z2XA 1VL2A 1Y1LA 4NARA 1BHJA 2YCBA 3M3HA 1JJIA 5DNWA 5TB5A 2BFWA 2DHCA 3GDFA 3OU6A 2VJOA 4KNYA 4BMXA 1CDZA 4I14A 1KKLA 3K0AA 2M6LA 3W06A 5G3YA 4PLYA 4C08A 2AOWA 1IMOA 1LGYA 1P9NA 3LLMA 4PFKA 2HCFA 3WK9A 4BUZA 2C4VA 1FFGA 5IP5A 3PVCA 4EMTA 1DNPA 3QWBA 1VHJA 2J5QA 1WSBA 1NOKA 3H4MA 1LBHA 4LYYA 3N86A 2ONJA 3B2EA 3G59A 3W1EA 2ZRKA 3GGCA 3HA2A 5ALOA 4B3IA 4YNBA 4O2AF 5FI3A 1BWQA 5BXQC 2ERYA 3CEHA 3C5HA 4HLCA 3UW1A 3QX3A 4NNPA 1FNMA 4FDAA 1DKLA 4UFPA 3U3DA 2WMOB 4BDTA 1YB1A 2QSJA 3H9JA 4KX3A 3AVPA 1E7MA 1E77A 4F93B 5KQPA 1Z6AA 3DT8A 2POQX 4DLSA 3D4LA 2NZ8A 1IHXA 1ZCAA 2I2BA 3VR2D 2HRRA 1Q1AA 3NBQA 1D1QA 1ESDA 1DAIA 1HF3A 5AVKA 1FFAA 3PF9A 4P5EA 2AG5A 2W93A 1Z8NA 4QUKA 3G5AA 1NM5A 4E0BA 3QKUA 1HYEA 1VPTA 4EGJA 5TQJA 1KJQA 4AICA 1WHTB 2EJUA 2I4IA 2W2KB 4X45A 4EUNA 1T9DA 1BEUB 1W9HA 3LL4A 5FUYA 2BUBA 2I5PO 3K1AA 1FFBA 4QT4A 1OXVA 4K9OA 4BKOA 2UYQA 3STUA 4L85A 1GFZA 1OI7A 4PWYA 3CX3A 1IE3A 2RK3A 4ESOA 3NOXA 1UDXA 3QVMA 4FS3A 5JARA 4PXYA 3VO8A 5M5BA 5AKHA 3IV9A 2B8EA 1QHHA 2XB8A 3AEYA 3DZJA 3O9MA 3OLYA 4YAWA 5TJ9A 1ULHA 5CW1A 2PIAA 3FAZA 4LZAA 2QTBA 2WTBA 5HF9A 4EJSA 1O6FA 1TYEB 2A6PA 3FRHA 4RA6B 1A7JA 5K4HA 2OZVA 3R23A 2OP0A 4JJKA 4J1NA 5EJ8A 1KWGA 2DBZA 1TCVA 3H1FA 4MCJA 1JHYA 4ZD6A 4RF5A 5ILOA 3PFFA 3SF0A 1KJJA 1NPDA 4UMFA 2DPLA 5HFJA 1VJRA 3TQIA 3ZVLA 5LWQA 4KPYA 2ZCJA 4IFBA 5GPBA 3DVQX 4CGYA 3DLHA 4PEVA 1BWRA 1M74A 2ZUBA 3CV3A 1RU3A 2EBWA 1T5OA 2W2OA 2Z5LA 3D6UA 4KQ1A 4N7BA 1EUQA 2C2XA 4B3JA 1JVSA 2JHPA 1N2OA 2XUOA 4FZVA 5E6SB 1DO8A 1F8UA 2OGUA 5FNVA 3SVZA 4F9EA 2BMEA 2GM4A 1P3Y1 1IZ8A 3NONA 4K87A 1S0UA 3QXJA 1Y8RB 3ZV5A 4BP3A 5AQEA 4F06A 1PR4A 3N07A 1SXIA 2C8JA 1INLA 3F6PA 3KSZO 2PKEA 3Q7EA 3QI7A 4L72A 2FXIA 3KB8A 3KJQA 1B15A 3AVVA 2IJGX 2JCXA 3ICEA 3H5TA 2VP0A 4CPDA 4MQ5A 3VZCA 2XADA 2HGZA 4RZHA 5BPHA 5IDXA 3RTDA 3HKDA 3LY8A 5LQNA 2FFHA 3KFVA 2GF2A 2CXNA 1NR7A 1PG0A 2OSBA 3C16C 3PDUA 2RG7A 4DBLC 3AIKA 1RM4A 1ZBDA 2Y1XA 4PGGA 1Q6YA 3PC6A 4PAWA 4BU0A 3LOUA 1T4BA 2B4TO 4BV8A 2Q5FA 4JUAA 1L5KA 3ZI4A 4MVJD 2JHAA 2CVFA 3X44A 4ZO8A 1FJGB 4O4HA 2DG2A 1TRHA 1ZR2A 1DX6A 4Q4AB 2I9KA 1MX3A 1TNDA 2HJSA 5FD8A 2CLIB 2IFTA 2X8JB 3HH8A 5TDHA 3D7MA 4RULA 3ET5A 3D0QA 3U49A 3INGA 4QUHA 4EMSA 4Q7KA 1BD3A 4JYZA 3Q8WA 4C0SA 1P29A 4DLVA 1MVOA 1TGYA 4FN4A 4DR3B 4BO2A 3VR3A 5DISB 1K06A 1Z2CA 2ZRDA 3BXHA 1SCDA 4ZT4A 1Q44A 3A11A 3PWKA 3OJWA 1BFUA 2VEDA 2XD9A 4GNRA 4DYVA 3OCUA 4Z7NB 5TQ0A 1YRQA 4UM5A 4ZOCA 1DMRA 4B2LA 4PQFA 4OI1A 4MYDA 3T35A 1QAMA 2WP8J 2RH4A 4KYTA 5IDYA 3VVMA 1NNUA 1S8OA 4M60A 4WVLA 1LS1A 3F2IA 2IXEA 1GGNA 5EZYF 3I9FA 3FOEC 1P33A 3BD9A 1NR1A 1LLQA 2QYOA 1ORHA 3NRJA 4H31A 4QOIA 1K66A 1G2IA 2W22A 4UEOA 5L45A 4EY8A 1RRKA 1S3IA 5ER9A 4WVFA 1PK8A 3RTCA 3GR6A 2ZR8A 1GTJ1 2H5JA 3OIVA 4BMCA 4UBMA 2RCNA 3JQFC 4B6QA 3STVA 3KBBA 3HUFA 2B7BA 3ETLA 1KYTA 1Z62A 2CNNA 5TT0A 4QASA 4PYRA 4Q6WA 2V7XA 4Y2QA 4CKCB 4Y6LA 3H84A 3WLPA 3ECAA 3DT6A 3ETEA 3H2BA 3ZJ5A 2W00A 1JTEA 3M82A 2HQSA 4IPTA 4OQXA 1OGJA 1RRGA 5FTJA 3L7CA 4X44A 3T94A 2QTVA 3ZQJA 5SICE 3I6ZA 3ZKAA 1BFKA 4GYYA 3WV4A 3DYVA 3DMYA 5KNCH 1CW2B 4TXHA 1E1CA 3RUCA 1XZIA 1M75A 1TUGA 2X5KO 2UUAB 4QE3A 1J5PA 2VA8A 3H8WA 1M34A 4CMEC 4AY4A 5FR2A 4AS3A 1U0FA 2H59A 2IHJA 2R7LA 3ZHTA 3GLFE 1PTJC 3GJ7A 3DAFA 2IHVA 1RP1A 2FRXA 2AFHE 1U81A 2BAGA 1A2QA 2GM9A 1CLEA 4JLVA 4PGAA 3U9TA 2XVXA 4JDPA 4A8PA 4BEVA 1L4KA 4MCIA 1IWBB 4ZIRA 3OZIA 2R8YA 4ER6A 1U2PA 1WKCA 1CG6A 3C4VA 3TXYA 1EUYA 1GFIA 4O8CA 3MILA 3JR3A 1UH5A 4F21A 1L4EA 1JHQA 2EQ5A 3LBFA 4RYLA 3MAJA 1RI4A 5CLJA 1QG2A 2QTMA 2HSGA 1JEQB 1NUHA 1YQXA 3T7TA 5AI4A 3KYDB 2GNPA 3AZOA 3F3SA 2DC1A 2ZS8A 1UJBA 5F3WB 1JFVA 1U5AA 1T1RA 2J5XA 4YGXB 1BGXT 1M1YE 1FMFA 3MGAA 4B71A 3Q9NA 1I36A 1O0CA 1V4VA 4BGUA 2R8RA 2J46A 4RVHA 2RGBA 2FJUA 2ZYDA 5EMHA 3E9NA 2NXJA 3U3JA 1NULA 4UREA 4AUNA 1SGWA 2R65A 4RGYA 5C0OE 4ARUA 1O96B 4E51A 2Z2ZA 1O0BA 1VJTA 3EY9A 4MQBA 2G0TA 2QRPA 1NQXA 2IUFA 4B79A 2HJHA 3LYLA 4N03A 5T41A 3TTYA 1QRSA 4LF5B 2H2WA 2DY0A 3FN4A 1TAHA 3P0FA 4ZOBA 1N0IA 1CUWA 121PA 1QQ5A 2QRUA 3HU5A 1N6IA 4Q1AA 5DX8A 1E2MA 2DQKA 2YYYA 4RIEA 2EWMA 2AZXA 3U4MA 1J2RA 4FZJA 3WK8A 2CLHB 1LI5A 2XNKA 1VKHA 3D3WB 3NV9A 2XE6A 4XJSA 4BNNA 1EK5A 4EUSA 3NJ4A 4HNUA 1PNTA 4MI1A 4UHFA 4HVTA 4ZHQA 3JYOA 1COWA 2IU6A 3BWBA 2WJ3A 3FHCB 1U9JA 4IGEA 4WUTA 3P2IA 3GK3A 5U9CA 3VNSA 5JSZB 1I1QB 3A9CA 4UBJA 5L3SA 1RYBA 1TIKA 1A9QA 5JSHA 4FYPA 1E2EA 4X92A 3C7DB 5HF5A 1FRZA 4GRDA 2O06A 1UJCA 3DB1A 1CRQA 4RKQA 5FFMA 2YR0A 1SHUX 4TT3D 3RG2A 3VTFA 5BN4A 3BSSA 3DZGA 2I7CA 3LXXA 3CR7A 1HE8B 2Q1WA 5EKUA 3I32A 4OHBA 3ROPA 4E2YA 1C1HA 3EVTA 3KQVA 2ZJ5A 3AETA 2CHQA 3L9XA 3X0DA 1TKBA 3BCRA 1DFGA 2CDBA 2VATA 4KH0A 2JPDA 2L69A 5J3JA 1RRCA 5EMNA 3V4PB 2A92A 4CF4A 3FNFA 1U0RA 3I01M 1W8DA 4OVKA 3QELB 3I0MA 3NUQA 4MPDA 4C20A 2B8NA 1M6HA 2ZU6A 4ND1A 4C7MA 4PX3A 1SKYE 2Y1WA 1ORIA 2OAP1 5KUTA 2Q3BA 3VNRA 2IZZA 1LV8A 4Y7CA 1HDYA 1QYRA 3U17A 4B6PA 1DEXA 5TRTA 3UWKA 2D4HA 1ZIOA 2ONCA 4KWIA 3KBOA 5IG2A 4D26A 3F3YA 3A58B 4F4FA 4Z3KA 3DYBA 2O8BA 2V8OA 2WVJA 2Y6VA 1BS1A 1MGOA 2I03A 5L51A 2CMKA 4KVZA 2BDUA 2DH5A 4R84A 3UT6A 4B81A 4WCFA 2QLMA 3AMVA 1L9XA 2ZYGA 3OHPA 1LWOA 1P81A 4G89A 4YV0A 4G5FA 2RG1A 1W88A 1NT2A 2EKZA 2KM1A 3IHLA 1NX6A 1COWD 4JP2A 1P4SA 4CMCA 3T0FA 3LP8A 5CPFA 3S44A 1PFYA 2B9VA 2W6QA 4WN9B 4ZOLB 3V2UA 3G0OA 2NU6A 3UT5A 3FPLA 2RGNC 1CQWA 3IP3A 3NTQA 3OD5A 3Q9UA 4RVOA 4CFSA 1R9GA 1QYWA 2ECFA 2HMTA 2BDEA 2XIQA 4ZVRA 3SZRA 3PDCA 4H4DA 2EL9A 5ELMA 4AJ4A 1PBNA 4XUGB 3JASA 5G3ZA 3B9RA 4HUQA 5E9QA 1GV0A 2DSTA 3FTQA 2VJPA 1BKDR 2DKFA 4HL6A 4UPVA 4YDSA 5AK3A 3I28A 1ECFA 1RYEA 3QE3A 5TGTA 3CVJA 1HFEL 2V58A 4YRBA 3GXOA 4JGGA 1O3YA 2P9QA 4TRMA 2BFOA 4JEMA 1JHDA 3R3YA 2MCFA 1ISGA 1F8GA 4BE7B 1ZUHA 2FWJA 3ZIAD 5E95A 4W5HA 1P1CA 4H7IA 2XCRB 1O8BA 4ZU3A 4FQ5A 3MPOA 3D8RA 3IBCA 4Y2YA 3VHXA 1A9XA 3D6FA 5CFOA 3NXKA 4AJEA 3WA7A 1EBBA 1EWTA 2IEBA 1BS2A 1G3IA 1VG8A 1VYUA 2WZQA 3HCRA 4JVMA 4PU0A 2VOJA 4LJ8A 2WWGA 3UHJA 3LSYA 5JC8A 1CJKC 1OI2A 1AF7A 3UO8B 4C0JA 2HL6A 5BSMA 1VKRA 3W5CA 3W4IA 3ZHZA 5TPWB 4BMPB 3B12A 3MN1A 1SCKA 3ZDCA 2C2OA 2NO7A 4C7JA 4PHHA 3STXA 5IJWA 4KKXB 4L4YA 1B6GA 3BRWD 1JN0A 4H18A 4GZ5A 4F6RB 4E5UA 3T3MB 5B1YA 3JTMA 4GXTA 3SNHA 3DVRX 1ITZA 4PZEA 1SRRA 2JRLA 2Q3JA 3H9UA 2X7JA 1FP7A 2VT2A 1Z33A 2CC2A 5AHXA 4LY9A 5CYFA 5FYDA 3EWSA 4EKDA 2P5YA 1NPTO 3D8UA 1UC4B 4CV1A 4FE4A 3WDMA 5ARBA 1U7ZA 2JKVA 4EVQA 3SIXA 2GBGA 2VPZA 5FUBA 5E6RA 1TMOA 2F8MA 1JA1A 3K6JA 3H0KA 2C7PA 1XP8A 1FBNA 2NQTA 1WR8A 3ZD7A 3JWPA 2PGAA 4FPXA 4RXUA 5FOWA 4MV1A 3NBYC 3NHFA 4Q05A 5EXXA 1U04A 5EVCA 3SBEA 4QUIA 1W6RA 4LGYA 5CGQB 3LPMA 2QU8A 3CMMA 1OFGA 2REXB 4NOMA 1BX1A 1UQRA 4TKVB 2MR6A 4DTCA 2WYIA 2EXXA 2IRWA 3WLJA 4JB3A 2VSYA 4O63O 2P0AA 5L3RA 3F7MA 5BMVB 2GTIA 5KO2A 3KSMA 5EHZA 3WAJA 1WTCA 1DAHA 3PPWA 3EEQA 1B74A 1KC3A 3H3JA 3QOXA 1VE9A 1TLLA 4KLRA 1C0EA 4OK3A 1TT7A 1N1GA 4Y0NA 3A3NA 1C9KA 3GYBA 3COVA 2IYZA 1G5QA 4Q00A 1HYGA 3K1YA 1YXMA 4HMQA 1RBYA 2BN4A 1F2VA 1JJAA 2XMSA 4H1TA 3FMFA 1XKTA 1Z6XA 4OXNA 2VDJA 3NIBA 5GONF 1YBFA 5CDHA 4U2CA 2EBUA 4EG1A 4IOJA 1QK5A 2FUKA 1HG0A 4IQFA 1QAOA 2VF7A 3VOTA 1RIFA 4MIKA 2J08A 4F8JA 3NVKI 2XTJA 1CLUA 3OSZA 4JLDA 1FLVA 2Z2JA 3NO4A 3BIOA 4C3UA 3GJZA 4ZYTA 4UBLA 5HCIA 3TLCA 2IWRA 3ONNA 3OTQA 3UFXA 1NN3A 4RPIA 1T4CA 4HO1X 5G0UA 2GCOA 3TSCA 3ULKA 4R2WA 5AKXA 2J3IA 1W8IA 1BSVA 4FSDA 4M21A 1E9EA 1GPNA 3PWZA 3W3ZB 2FPPB 3PA6A 3V7UA 1KXZA 2PAFA 3NHRA 4I50A 4B3GA 5CJJA 2PUGA 4ZVQA 2YVLA 2CMGA 2R66A 1RJ9B 3UQYS 5BV7A 2IYXA 2Q3CA 4XVQA 4PHGA 3ZHXA 2X0FA 1ICEA 3S81A 5T8KA 3VNBA 2W58A 2WTMA 3DMGA 3USZA 3S8YA 5A0TA 4CQLB 1U8TA 2OYSA 4QYIA 3I09A 4AY5A 4DUZB 4LX0A 1XCOA 1ZN7A 3CF0A 4GQAA 3WI7A 3WQSB 3PWTA 2CE7A 4URVR 1YZHA 1GQFA 3GAMA 4HP8A 1RE1A 3SYLA 5CB4A 3PEWA 5EXPA 1KKUA 4HQRA 4AQ7A 1YDFA 2I6UA 4MMXB 1WXXA 3UXMA 1OCEA 1B42A 1NN0A 4O4IA 1B14A 1JU3A 3CRW1 4XVHA 4Q7EA 1XJ0A 3UPTA 3COSA 1UK9A 2VH5R 3IPAA 1P62B 2QM0A 5EIOA 3RU7A 1Z4KA 3KQPA 1XZDA 3U31A 4V0KA 4C89A 1XYYA 3HGQA 2O19A 3RROA 3KKZA 3RF6A 2E37A 5KVCA 2OP1A 1PR5A 2ZYIA 3CUEF 3KWLA 4JJFA 2GVZC 5ESDA 1XRJA 3HCOA 3P2EA 3TSZA 3WLRA 3WRXC 4B7UA 5KJCA 3K0BA 1KK0A 1GPYA 1RHUA 3HPRA 3GLRA 2PT7A 2HV8A 1GPBA 4AY3A 2IF2A 3PFNA 1ELOA 2IIVA 4IV5A 4DMFA 4B80A 1TUIA 4WY2A 2P3SA 4WBNA 4LY3A 1VG1A 2WTEA 3DOUA 4RV4A 4Z9FA 1UXHA 5G1NA 1Y9ZA 4PZAA 4HWPA 2WM9B 2I76A 2QD2A 2REOA 3A10A 4TXNA 1I1NA 1UQUA 1C1DB 1NJ6A 1RXYA 4M0UA 1RP7A 4QBIA 3SQOA 3EIFA 2VTVA 2G1UA 1F14A 4BB9A 4X6LA 1PEYA 1WDKA 3CJQA 2ZXFA 5IWCA 1AUQA 2DFPA 2Q1YA 4H7EA 3A6KA 1FS5A 4AWXA 5BV8A 4BRUA 3TJZA 1OAOC 3E7DA 3REOA 1N5RA 3SHOA 3BWMA 3BE6A 3S8EA 4AJLA 1K7CA 4K9QA 4L7VA 2GKGA 3V8VA 3Q2OA 3HACA 5I9IA 1IK6A 2A58A 2Z2IA 1JPUA 4YT5A 5JJLA 4E7PA 4EA8A 4P5DA 1Z63A 2XNCA 1CUXA 1T9KA 2FZ4A 3VOBA 2YY5A 3RVDA 2WHXA 1K97A 1N8TA 2Y8EA 2CBGA 2CDRA 3FDZA 3P20A 4Y98A 3SZGA 4CWAA 3WMEA 5K8IA 2P65A 1FUUA 5KVVA 4KQMA 3LQKA 4GX1A 1TYBE 1JHPA 2C98A 3BXZA 1T1SA 1O6ZA 3PENA 5TEVA 1EKXA 1T1IA 4BKUA 2A0XA 1G6OA 4H7KA 3VNAA 1FU7A 3MRTA 4MR8B 4OFZA 2PRZA 3TIFA 1R5OA 4YJ3B 4XX0B 4BNDB 4QA9A 2X2FA 2P2LA 5KTOA 1ICIA 1PW7A 1UKZA 4KO8A 4FKZA 3T6KA 3CW8X 2OB1A 4PR0A 1TOAA 3IUBA 3C8UA 4TLBA 1DAPA 2OOSA 1TC2A 3UENA 4CDNA 4D5EA 2G3YA 4LYEA 1FQKA 1LPMA 2BI7A 3PV0A 4IIDA 3UXHA 3LU1A 8LDHA 3MQ4A 1D5CA 3ECCA 3AKZA 1JQDA 2QX8A 2FEMA 4RC9A 4O5OA 5HUQA 2BFNA 3PRJA 4TLDA 1CNFA 1MQSA 3BFKA 3RV3A 4MJ3A 4F9TA 4ZJPA 3IQDB 2B35A 1UDAA 1WQ4A 4KK3A 3ZJYA 1T13A 2RI6A 1QGUB 3JZIA 4FD2A 5I4BA 3FIUA 1XDZA 4X1YB 2WD9A 5CCBA 4D8UA 5AW3A 2J45A 1ML4A 3VKWA 1SCAA 3ZKWA 4B3MB 1Y6ZA 3PITA 1WE2A 4FFVA 4HBGA 3I58A 1P91A 2JGDA 1R4NB 5JBNA 1QIJA 4D25A 4TMWA 5JG7A 3GT4A 1D6NA 2OYRA 1D8TA 1TI7A 2C5GA 2IDJA 2IU3A 2LV8A 2P5UA 4Q9AA 5JXHA 2F2TA 7MDHA 2ST1A 1BN6A 3IUQA 3YASA 2FFQA 4JI7B 8OHMA 3P2KA 3ZI0A 1RKXA 3LT2A 2O0HA 3RUIA 5J59A 2JVKA 4BN0A 3AK4A 2O0KA 3ED1A 4RF4A 3A36A 5DLDA 4C4RA 3A1VA 3NAQA 1L0BA 2B5OA 1NTOA 4FQ8A 4UEQA 1NF9A 1Z2AA 2AUNA 1HH4A 2RARA 4REMA 3LUCA 4MKRA 4XX1A 3EIHA 4D82A 1NYRA 2V0NA 3CH4B 4NTZA 4B74A 2W2TA 4QDOA 2DP4E 2OILA 3ABSB 1EZ1A 3BMNA 1Q19A 4WEOA 1U7DA 2W6MA 4CM3A 3QUAA 5CLLA 2CYCA 1C9DB 1X94A 4B2IA 5C5IA 4EW3A 4XPZA 1DJNA 2YVKA 5JCXA 3R9XB 1R9NA 3E8XA 3U6KA 4WXYB 2OVFA 1K27A 1XK7A 3RAEC 4ZT6A 3CCBA 1CZHA 3QHAA 4FCTA 3GJ4A 2R6FA 3K5WA 1USVA 3UOWA 3OZVA 4X7BA 4HX9A 4EQ6B 1XALA 4N3NA 4XZ3A 2TYSB 1W52X 2EBFX 3MFYA 1DOAA 1RXCA 2JGLA 2QE6A 3K0CA 5IAGA 4DFDA 2NT3A 1NBMD 2W0SA 4MW2A 2YJ6A 4URYR 2W2QA 2OBFA 3MJDA 4G24A 4R6WA 4EITA 4D4JA 4BJHB 3HFGA 3DLTA 2KYRA 3O03A 4BFWA 1Q17A 2AT1A 2ZSKA 3WLLA 4Z4CA 2AJTA 2GYWA 3I1YA 4M87A 1ZJ5A 3OTHA 7AT1A 5FHRA 4XQEA 3ELUA 4TTAA 4GL4A 1DINA 1N3BA 1THTA 2R7NA 4MB0A 4W82A 4X8LA 3HXQA 1I7PA 5I7HA 1NY5A 3KELA 3SXUA 2QDKA 3Q8XB 3UWOA 3STWA 1G8MA 2FVXA 1R8YA 4CLOA 4OHKA 4NENB 2B1JA 4C4TA 3F5DA 1Z08A 4MGEA 1XELA 5G02A 3ZBPA 3HE3A 3WLKX 2B20A 4OHUA 1SVMA 4JEUA 1U8YA 2VNIA 1TU3A 2EW2A 3PNSA 4WOCA 3V1YA 4MMYB 1PR0A 3VYRB 1T9GR 1R0SA 4BX2A 2FVYA 2ZJ6A 3GEDA 4B9AA 4PVDA 5ALZA 5IDQA 1DX9A 1NNI1 2AHOA 2I67A 3NKLA 4K9DA 4RHUA 4YWHA 1TQHA 1SCJA 1YZGA 3MQ2A 3JVVA 3QX8A 2GN9A 3EDOA 4YRJA 1DFIA 1P0MA 2AOUA 5AMXA 4WMLA 1TCBA 2BRUA 2AOVA 5D8DA 1UBTS 4Q24A 5LXTB 3OWHA 5AOCA 3OIUA 1DDOA 4P7KA 5KNBH 1X74A 5IWAB 4XGKA 1MJGA 1BAPA 2ACKA 4OHRA 3CWZA 5JUWA 5C35A 3G79A 3MT9A 1QRTA 3ROMA 4FFPA 1VG9B 1XCPA 3DMTC 2HEIA 1PYDA 1GSIA 3UOGA 2P8JA 4HMPA 3UAXA 2FR8A 4B1FA 2YWXA 3Q88A 4KXWA 3AL3A 5D85A 3AY7A 5B37A 1ZINA 2QMYA 2QUJA 2AW3A 3NOQA 2AJDA 1ODIA 1RHRA 1AKMA 2A33A 2LP4Y 4UQLA 1KQGA 1ZM7A 2WJJA 3IDAA 3ZWDA 4AP5A 4HADA 1DTSA 4K6OA 4N3BA 2DHDA 3KZOA 1I8TA 1P19A 2QQFA 3IB3A 1AKEA 1J06A 1JXAA 2QS9A 1Y5IA 2NO1A 1K6MA 2QV7A 2NZUG 3A1NA 3GN1A 3HI6A 3MTGA 4FFSA 4MV0A 1P9OA 2XUAA 5K8UA 4IDQA 2YJGA 1V3VA 1W87A 4FU0A 4CL3A 1NQOA 1B8VA 1F38A 2LDBA 4I55A 1M2NA 4GM1A 4LI3X 3U3KA 4NCKA 3ZZTA 5JWOA 1IHYA 1U31A 2PRSA 3B2QA 5H70A 1OXSC 2C2YA 3CZ4A 3EXIB 5DBHX 2FLVA 2A1UB 3P71T 1DVRA 2XKAA 4K6HA 2QN1A 1US8A 2AB0A 4K86A 4G1VA 3TLYA 2QUKA 2R9VA 1CIPA 5EGSA 1U8ZA 1U1CA 4WX2B 3E70C 3LLVA 3IALA 4F7WA 3JQAB 2I1LA 3DTVB 3RUHA 3HBFA 1E59A 1YB6A 4KO3S 3SNKA 4DJJA 2FWBA 1JDUA 3NAMA 4MUAA 1TM2A 5IH3A 2AKEA 3LDAA 1QGYA 3K31A 5ESWA 3QZUA 4PYLA 3HDYA 1K0UA 3KUDA 4PW0A 2IYUA 1OR8A 2P1ZA 1MEOA 4B17A 2BE7A 2HBQA 1RM0A 3DEIA 1QZXA 1PYOA 1V45E 3AU8A 3R7WB 4AO7A 4INJA 1CSEE 1PD0A 3VPDA 4BC1A 2DT5A 2G1PA 4CZ2A 3RANA 2EATA 3GRUA 1AKQA 1GAJA 2BV3A 3NU1A 1C41A 2PPLA 4B34A 4EI9A 4PZCA 3L4JA 5HXAA 1S01A 4MWGA 4NFLA 4R2JA 4HEA1 1USKA 5FF9A 4DREA 2VKQA 4PCAA 1GGEA 4TLEA 2KS6A 2Z8YM 2I65A 3WIOA 1QG0A 4D4HA 4U7DA 3ERCA 2VRNA 4RNDB 3PXAA 4KGZA 1CJSA 5JHGB 4EKNB 4DV6B 2XF2A 3FWHA 2HK6A 3MPUA 1YR3A 3RJ9A 4QQRA 3PFGA 1JWBB 3IIMA 1Q1EA 1XJCA 1TA9A 1FTNA 1D6SA 1OZAA 3JARB 2PANA 1U6KA 3R76A 2ZSUA 4RH3A 3PNKA 4N5LA 1UADA 3JVUA 2NSDA 4LBYA 1O94C 5JPIA 1WHTA 2W2KA 1EWYA 2C07A 3RUDA 3LBIA 4IL5A 1X77A 4L8FA 3KG2A 1U5BB 3PQCA 5LA6B 1I6KA 4JZKA 2V3CC 1Z7GA 1PZMA 4QULA 2EGHA 3ZZMA 4P8RA 4QRHA 4YROA 3CEJA 3GZNB 3TKYA 2WP0A 4XIYA 5M3BA 3HVRA 1IY8A 5AI5A 3FTEA 1JPVA 4WH0A 1D2MA 3VYSB 4YEDA 1TO1E 1GZDA 2P68A 4RA6A 1OXTA 2VBFA 3KO8A 1GZUA 5KNCA 3OZGA 3UAOA 5JXJA 1QTIA 3OZCA 2WDZA 4K6KA 3OUZA 4OXIA 5ALYA 1D0IA 1U0OC 3IFSA 4QWMA 1LDMA 3BULA 5CVTA 4TZ6A 4IHQA 1NMXA 4L0DA 3ZLUA 4JT4A 3WXBA 3E22B 3VO2A 1G19A 4G0WA 4W5TA 5IRCD 1Q0LA 2Z98A 5AUNB 1Z6TA 5E6SA 3FWKA 4B44A 1UOOA 2Y1CA 3QMWA 1Y8RA 1ZKDA 2AQIA 2F8SA 3P9QA 2H0RA 2VNKA 1SC4A 5E4YA 5I8ZA 5JNWA 3DE6X 4BGEA 4YQZA 4GUAA 3IMGA 1M5UA 4BQNA 4AX8A 5KHLB 2VJQA 3BTUA 1EVKA 4C9BA 3GFRA 4HQNA 4I08A 3VFDA 5K09A 2D1SA 4A4DA 4MJXA 4ACBA 3FKJA 3HUEA 4G8BA 3ZWCA 4INOA 4TTSA 2C9CA 4E94A 1RRFA 3OX3A 1H8EA 1U0TA 4R1TA 4ZK2A 4JUFA 1NVFA 3LVQE 1R3UA 2Q5JA 2XCLA 3LC7O 3MB5A 1ABBA 1H94A 1LI4A 4PS1A 3PFHA 1MB2A 2YXEA 3PC7A 4UU7A 3MMPA 4Y67A 3SLGA 2BMVA 4YRQA 2GEDA 4DA6A 4NAVA 4ZKDA 5BWOA 3TLJA 5FBVB 2WU4A 3ANMA 1OH8A 3N6XA 4Q4AA 2GT1A 1GPH1 3T9EA 1D9XA 3A6DA 4UOQA 1FUIA 1MX5A 2V3WA 2X8JA 4ONEA 4TLCA 2UXCB 2DUJA 3GDHA 3MOIA 3QOFA 2GK4A 1EP1B 1BCRB 5A0FA 5KNCD 1QCYA 1PAUA 1XZNA 2BHNA 4GGOA 1ZMRA 2YOGA 4RM3A 5C2JB 1TC1A 1ONOA 1WEHA 2ZUCA 1XZQA 1ZKMA 3N76A 4DNQA 4KR7A 5CW2A 2JLRA 5DP1A 3W04A 4DMMA 4Z7QB 2VXOA 3RK4A 2Y4NA 3M6AA 2EZUA 2AYYA 4D6XA 5HKAA 4TTIA 5KMGB 1C1XB 1FUKA 4JLUA 4RPHA 4AT1A 5L3ZA 1VI5A 1W94A 1CHNA 1AN9A 1M2KA 1T91A 5E7IA 3U80A 3WYEA 5GZ3A 4MWSA 1HOXA 4N3CA 1N6KA 1JMVA 3FYUC 2O48X 3FF4A 5LMNB 3FNHA 2A9QA 3UCXA 4O2BB 5ALPA 5HYVA 5CT9A 4G6ZA 3AP3A 2JEYA 2CL7X 4F46A 3KQSA 1KY3A 2KB0A 1QVZA 1O08A 3OCCA 2ZQZA 5AW7A 2QE7D 3NCHA 5HF6A 3DS8A 5T4BA 3VPXA 4RGBA 4MWBA 4LJ5A 4Q1EA 2ZR0A 2PMCA 3ZV4A 3ZD9A 3NHBA 3VAYA 5IVIA 4URZR 4QBKA 3FYUB 1NP3A 4OYRA 1TADA 4J76A 4M1OA 3EXHC 2GXAA 5HZMA 2G36A 3CNNA 4KN8A 4U7PB 3ZH2A 1H8ED 1QHSA 1I0IA 2WHPB 2Y71A 3SBOA 1XOIA 2XITA 4Z2YA 1TEZA 1THMA 2X7HA 3K2BA 4CKCA 2Q6TA 2ZXUA 5JD4A 2Q6LA 3LDHA 1XWFA 1Q7BA 3V97A 4RKWA 3KLOA 3B6MA 1PNQA 1CE8B 1ZN9A 1OYYA 3IE0A 2J7PA 3SJ7A 1PD1A 2DKNA 3N8DA 3EXHB 5EKXA 4A5OA 2BL4A 1ACMA 4EKEA 1NXQA 5DULA 2G9NA 3R40A 3RU2A 3ZCVA 1SKMA 2ZEJA 4CNBA 1BC5A 2PUAA 4M1MA 3AIIA 2O3QA 1DO0A 4MP3A 2FEAA 2ZPTX 1O6GA 1KR2A 2NU7B 1GNPA 2P8SA 3DH0A 3GP3A 4KQKA 1YJCA 4CETA 1CUJA 3ZU5A 5KWJA 4YV2A 2BFAA 4BNZA 3QLJA 2H57A 2JJ1A 2KBFA 3G02A 3LK6A 4UEKA 1YE3A 2ZYSA 3WGMA 3DHEA 1IEWA 4FMCB 2GJAA 4D8XA 4IGFA 4Z8YA 2OO7A 4GOJA 4G0OA 4CMEA 2GILA 2HDNB 1DC7A 3NTUA 4PXSA 4KH1A 3U26A 1UUFA 3WGGA 4U6SA 4GOMD 4NZOA 3EJ6A 1PK9A 1JEQA 1PTJA 4C4YA 3LCJA 3JYHA 1PL6A 1AXRA 2C4MA 3G5LA 3KYDA 3RPEA 4EKYA 1PWXA 2JF0A 2XY4A 3MTQA 4KFSA 1J9EA 4LA4A 1T5IA 2YL2A 1RI2A 3VH3A 4D43A 4II2A 2NQ8A 4PTLA 3TLGB 4M0CA 1H5UA 5TQVA 2B0CA 4F5WA 1C30B 3RR2A 3EVBA 4JN6B 5CM9C 2ZTMA 4CCAA 1E9SA 1OTXA 1SCQA 3MBIA 3R44A 1A8UA 2QEQA 1YHNA 3NGLA 3DPIA 5ALNA 5DTQA 3H5IA 5IYZF 2VHTA 3HU1A 3QEMB 2FMHA 4GM0A 5D1NA 3UK0A 1G8SA 4E14A 1FDTA 1II9A 1O96A 2FTKE 1GL6A 4G84A 2PL9A 3VR5A 4TTQA 1AMOA 3KYCB 1A7KA 1MDFA 2PGLA 4M3NA 4DEXA 3TI9A 2H85A 4BNMA 3MUEA 2QRVB 2YXNA 2X41A 4JVSB 3G2HA 4K9KA 4TTPA 1G4AE 5AO9A 2PE5A 3VMMA 4EOGA 1RPNA 3M5DA 2DFVA 2FN4A 3S3TA 5FFFA 3AVQA 4EWLA 1XROA 4GKVA 1XTVA 1HMYA 3D3WA 3KOWA 3TAUA 3ANTA 5GY7A 5JYBA 3S55A 4FYMA 3KWFA 3LC1O 2A0YA 2G83A 2EYUA 3OWOA 3Q0IA 2XR1A 3OPNA 1RQPA 4TSFD 4BDSA 5C37A 4J0QA 5JMWA 1XZCA 2WU0A 5DLYA 2ONYA 4LDZA 5DXAA 4RPKA 3L8HA 4C05A 3G2NA 4TYYA 3LMKA 2Q2QA 4N9WA 2ZK7A 3OM9A 4JZYA 4XIIA 2IUEA 2IUYA 2XCQA 4QJ4A 2H65A 4TN1A 1QVRA 5DI3B 3SLKA 2JJ1D 2E9SA 3TR5A 2A86A 4INPA 1KAOA 3UJHA 4JP1A 3CPHA 3MJEA 1DS6A 1UKVY 1IBRA 2A2ZA 2ZUTA 3HJHA 2H4FA 4C7VA 4K0RA 4GYWA 2VH2A 1V8ZA 2CXUA 1FA9A 3EFBA 2OLJA 1W76A 3BDIA 4KGDA 4KN9S 3UAZA 3REFA 3UFBA 1SG0A 2JW5A 1F4PA 5AI6A 3V7FA 4MKHA 3HRIA 5EJGA 4JLOA 3TIGA 3AXTA 5E6UB 3A4LA 4IIVA 2CV1A 4TL9A 3G2IA 1USGA 3HHEA 2WTAA 1RNLA 1R5NA 3H42B 3HYSA 4GMKA 2UYHA 4UQOA 4F3YA 3I92A 1QFSA 2EX4A 2J31A 3T7DA 1WAMA 3DNFA 1M2GA 3PPYA 3HYTA 4JWTA 2VDMB 3ESQA 3QELA 3OJXA 1YGYA 1XFDA 2HCTA 2GI4A 4O29A 4BC0A 1TM1E 1N6OA 4MVJM 2WWYA 4OAOA 2WG0A 5F5LA 4XB6B 1LJ8A 5FPYA 3VR5D 4ZGGA 2CB9A 5JYCA 1T1JA 1WV1A 3HU2A 4OYYA 2M6KA 4D9CA 1E1RA 2IZ7A 2YVUA 3ZU6A 3IP7A 3Q9SA 3K32A 5KSZA 1I5RA 1V96A 1TIPA 4HDMB 2VTBB 2ZI4A 3I9NA 3L4SO 4WY8A 2VUHB 2FUNB 1MZPA 1ACLA 3FMOB 2QSUA 3GUHA 1ZN2A 5B53A 3QVJA 4NDNE 1ISPA 1S02A 3I6QA 2JK1A 3IKJA 4KKVA 1RJWA 3GLQA 4IMIB 3MUFA 4NBLA 3R7BA 2ZYTX 3W9SA 5JC1A 4N9QA 4WOPA 4WN9A 4ZOLA 1UBHS 2P35A 2BFFB 1U8AA 1PJ8A 3KVNA 4KN5A 4MCAA 2C20A 1HTBA 3ZDXB 2BKVA 4BE9A 2IEDA 1OXBB 3QEAZ 2I1QA 1ARZA 1DDGA 1L5YA 1ZLXA 3KR2A 3NEJA 3Q7RA 4ILKA 2EFGA 4BECA 5L3QB 3AWIA 2VT6A 3KAKA 1P2GA 3SKVA 1HO3A 5C32A 1IHOA 2AEFA 2ZIAA 2ZETA 3IP5A 5IJAA 1GVHA 1GG2A 3IV6A 2RGNA 4AD8A 1ZOOA 4PTZA 4N7JA 3TTSA 1JT9A 1TCCA 3LO5A 3WZLA 5AVVA 1XVLA 1IXRC 4OL9A 2ZVPX 4Y6SA 4JJEA 2OUIA 2Z2YA 4E2FA 2FAXA 4CG0A 1ULSA 4NOLA 4Z0NA 3EF3A 1C0IA 3WKDA 2HFJA 3DD1A 2RC6A 1CD5A 1NJFA 4G07A 5FIUA 1NW9B 2ERXA 4NNOA 5FNVF 5TMBA 4L50A 1RZRD 3ROGA 1Y7HA 3RRYA 5A4IS 2PGDA 2Q3EA 1U7WA 3FDFA 3JRWA 3S7ZA 2NXWA 1Q0UA 3M6VA 1P8AA 2HT1A 3I5XA 4ZODA 5TPWA 4RELA 1JIUA 1JDJA 1VPVA 2ZBRA 5C51B 1E1RD 1R4MB 4F6RA 3DL4A 4GPTA 4TV9B 1MVLA 3F7OA 2Z3VA 3P9SA 1YC2A 5ADWA 1C7EA 1UQTA 3QJYA 4HWOA 3A37A 4X93A 1TTPB 3D9QX 2JIRA 3CBGA 1G18A 3CLUC 3QU7A 1C3LA 3BJRA 3IAM6 2GWHA 2Q41A 3BWCA 4CM5A 3TPFA 3R0ZA 3FYDA 2HMAA 2JNWA 1HLGA 2Q62A 3EOBI 3WYNA 2IOHA 1QIFA 3GV0A 3PC3A 4BAUA 2QN2A 1T43A 4HXEB 1CT9A 5BVHB 2BH2A 5G0WA 3F9RA 3C85A 3V8NA 3TOXA 3KQWA 1RVV1 5FNZA 5SY9A 2JK0A 5E3IA 3SX4A 4YMUA 4UXIA 1WA5A 5FI1B 4DARA 1M6WA 1OIWA 1ZM2A 1HZJA 3HCCA 5JDIC 2DB3A 1SOVA 4GW3A 1IQ0A 4YS6A 2X42A 1CRZA 3JYQA 1AIPA 1CRLA 1X0VA 4O2RA 4TKVA 5JALA 4XWWA 1KC1A 5FUQA 2OCLA 5KDLA 3WADA 5L40A 4CMIB 3I37X 4G8CA 1R0BA 2VPQA 4CM1A 1L4NA 5COBA 2BGRA 3DZ8A 3P4UA 4AK9A 5BMVA 1OWMA 3PUZA 3T3PB 1NP6A 1EG2A 1G5TA 2CK3A 2CLEB 4YRCA 2BGUA 1DV1A 5SZJA 4LZJA 2C7QA 1PZHA 4KP7A 4KGVA 2WM3A 1FS6A 3NUZA 3GW8A 2J3QA 2GCNA 3BOSA 3OCXA 1J2JA 2FPWA 4FKMA 4G01B 4XAQA 3WVNA 1SEVA 2WE7A 2QAGC 2VA9A 5D6NA 2XV1A 1HL3A 2JC3A 2ZDQA 1MNAA 1RXEA 5F76A 3KQHA 3CT6A 3VKFA 4KXFB 4BPBA 2R5NA 3KDSE 1CB0A 3AILA 4HEQA 1NDUA 1XWWA 2MWMA 2G7MC 1TM3E 5JSKA 1L1FA 1WXEA 1CHDA 1Z75A 4S1WA 2BKEA 3W2FA 3ZZUA 3VSAA 2PUCA 4GZ6A 6AT1A 2Q9BA 1G9SA 1Y4ZA 3OZBA 2GZHA 2QYSA 1HDEA 1ATIA 5IJ9B 1J8FA 2PZ8A 3LUFA 2QAGB 4DJAA 2PLWA 2W90A 2RHGB 4YLGA 2A5LA 3W5JA 1HT3A 5ENZA 4OHMA 1ABEA 3CPEA 4BTEA 2CF6A 2CLMB 3RFCA 2RKWA 2E7ZA 3Q87B 1L8OA 1H2BA 1CDEA 4CG1A 1P77A 2FPPA 4YJHB 5ENDA 2O8VA 1QVWA 2IC5A 4TTJA 4JBIA 5DNVA 1O87A 1JG6A 2KJQA 4AZSA 2GETA 5C1IA 1JG1A 1QM5A 1RJ9A 3EZ7A 2H07A 3HYCA 2E1RA 3DBOB 1RRMA 5IKOA 4EH1A 3AR6A 1P73A 1QFYA 3JR7A 1CQIB 2JFNA 4C4PA 4CIXA 2K7FA 1W1UA 5DHFA 1YKSA 4YN3A 4MGZR 4E3WA 3C43A 4HRXA 4CQLA 5ITWA 2WTNA 4UTPA 2GD6A 2G8LA 2AMJA 1YQ9A 2CVZA 1ISHA 3NHKA 2R87A 1QZ3A 5A4DA 4LZNA 3I2KA 2CK3D 1XTRA 5CNKA 3LF1A 1JI0A 1N6HA 2D7CA 2CXTA 2HA6A 1TKAA 2ZE7A 3LXMA 4LV6A 3P5SA 2I2AA 5DRTA 3B13B 1MB9A 2OO3A 3NYWA 3T4UA 2VN8A 1A27A 1K9SA 3NT4A 4FEYA 3UK7A 1KEVA 4COOA 5CFLA 1UCFA 3NH9A 5MFPA 4M6WB 3LBAA 1JKJB 3SM9A 2ZUFA 5ITVA 2F17A 2IH4A 1D9ZA 2QT0A 4RTKA 4BX3A 2XWJI 1JLSA 1FS4A 4IDEA 1DG9A 2VP5A 2CVQA 4FILA 4MTLA 2HJRA 1E94E 1H69A 3SKYA 4B5LA 1K7EB 1J1ZA 1MA0A 3O2NA 4Q3AA 2X8AA 2H31A 4QREA 3MMXA 1WSWA 3JVIA 4BLWA 4KNVA 4F4HA 1S2MA 3CM0A 3DHYA 3WX0A 2BSAA 4L4XA 3REGA 4WZBE 4P4LA 4C6SA 4B3SB 3E9DA 1HNXB 1D03A 2PU7A 1TM5E 1CJCA 2ZT6A 4HQFA 4RO0A 2VJKA 3ZDBA 2VHWA 1ADGA 4PLPA 4LE2A 5D00A 1ZU4A 4PXAA 3TECE 1XAIA 3EULA 2NO0A 4BMYA 4HI0E 4XR9A 1FPMA 1TM7E 4G9GA 5ALQA 3CNQS 2IHUA 1M0EA 3WRXA 4YCDA 1Y7IA 4Q9LA 1MO4A 1C1DA 1DOZA 1P9RA 2LD4A 3PDIB 3PUWA 3VV3A 3ZXIA 4DF3A 4F3RA 3RHZA 3SY8A 1DE0A 1MBZA 3BWXA 4WACA 4GH5A 3UB2A 4WDQA 1JWLA 1Z82A 2GNOA 4U5XA 1JS1X 1L1RA 1KVTA 4QYXA 4QYSA 2F55A 2X2PA 5DYIA 1JSXA 1RLTA 3ET4A 1XHFA 2GVDC 3CRQA 5F4ZA 5KEIA 1S7CA 1OBFO 1FYVA 3SZLA 1Z5PA 5JAZA 4KITB 2P6NA 3O0TA 1DTWB 1BQ3A 2YV3A 1GQYA 1T3GA 4P86A 1G16A 3VVBA 3FGNA 3ZZ1A 2XUPA 3EMVA 4AP9A 3ZWXA 4IBOA 4M1SA 4CM6A 9LDTA 3BXPA 1OVMA 4U6NA 3VJKA 3T7IA 3RJMA 2Q7XA 3QKSB 3FCEA 4PBSA 1IHDA 1OAOA 2G6TA 3IVAA 4BBAA 2Y1LA 3M6WA 5ETJA 4UUBA 2VRWA 2BR4A 4R1LA 3WSWA 3I39X 3Q6IA 2WWRA 4HLNA 3O7MA 2BFBB 3ITDA 4B43A 3H3XA 3BQNB 5K4AA 4MR8A 1KJ9A 5HNKA 3PS9A 4V0QA 4MRAA 4RCVA 3PIIA 1BW9B 2P3OA 2YC2C 4YJ3A 4XX0A 5DNDA 1GADO 1WMFA 2J30A 4UU0A 3TB4A 3U9SA 2PV0A 4BNDA 4ZICA 1NNEA 3KTAB 4LNAA 1FEZA 1EXMA 2VBIA 1ZFNA 2F4VB 3JPYA 2CLLB 2QL7A 3UGQA 1X1DA 4OX9Y 1E0DA 4X91A 4CF5A 4HQKA 5D5PA 3KTFA 2NXCA 2NIPA 1VYHA 2F67A 5H59A 4EIWA 2CB0A 3DMRA 5LLSA 1BMDA 3LHIA 2P9BA 4EVRA 5FDFA 5IJ0B 5F7ZA 3P9RA 2AUMA 3LC2O 5KNBA 1JZTA 3HXTA 4X0EA 1QGUA 5AHOA 1G3QA 2RHJA 1QHGA 3ZCXA 1S8NA 3URMA 3FVWA 4X1YA 3S1SA 1SOUA 1DEOA 2XOKD 4Q1BA 2Q2NA 1E5LA 4XA8A 2YASA 1N1MA 4F9FA 1A7UA 3Q5EA 5CJPA 3EYAA 3MWJA 1R4NA 1X7ZB 3TMYA 3HUDA 1KSJA 4GHWA 4JOCA 3SR3A 1QMGA 1BXGB 2E89A 2REQB 3TUJC 3VBCA 1N0UA 4F6LA 4HH1A 3A3OA 4E5PA 4OUKX 3M9WA 3C14C 4C5CA 2QP4A 3L0DA 2R6CA 3ZTWA 1VA5A 3FTNA 3JQRA 3P96A 4JI5B 3GC6A 3F74A 4YR7A 4NICA 2V7QA 5CYOA 3H99A 3TINA 3K16A 2XNDA 4LKRA 1ZUD1 2BFPA 1J21A 3PEUA 1WUHS 2HA2A 3QNUA 3SG0A 4BFCA 1C50A 1VE5A 1X8XA 1YJBA 4JEHA 4ESVA 4XDZA 4JH0A 3I8XA 3MWGA 1TMYA 4F91B 4DV1B 2CDCA 4FJ1A 1RBZA 3OIYA 5DNCA 1Z12A 3DTYA 4OV6B 1SB9A 4PQGA 3ZVMA 1ZL0A 3HABA 4XSVA 3DE3X 3EFEA 3ZOZA 2OM6A 3HYLA 4WBSA 3GPIA 2HCBA 2Q1UA 1VECA 3EBPA 4H7DA 2J9RA 5TVGA 3RHFA 4C01A 1V37A 1X2BA 2J0QA 3PFBA 2IUTA 1FJHA 4FWTA 5A03A 1LWNA 3QYJA 3IEPA 3UYLA 4Y6GB 1Y5RA 4TRNA 4D8TA 4M83A 2VTKA 3JQEA 1B6TA 1VMDA 5F52A 3VMFA 1Q22A 3ONFA 1VCIA 4AMBA 4WFQA 2YXPX 1G6Q1 3IJ5A 2J85A 4EQ6A 4KSCA 4V3CA 4OX9B 2HLHA 5BYAA 1JR3A 3KJZA 4V02A 5C1PA 1C8BA 4WXHA 5JEDA 2PTHA 3A9UA 5KNBD 1N9ZA 1FBTA 1T2UA 2H5EA 3OU2A 1ZESA 1R64A 4HAZA 4IO1A 1J90A 2P9YA 3LT0A 3K2QA 3OEHA 1CUYA 1L4BA 4MRNA 5EE3A 2GO7A 4JV5B 2DSNA 1USIA 3F97A 4IKEA 3NIDB 4XSGA 3BAZA 3WBJA 4ZYLA 3PXUA 2QUAA 4RAOA 4G0UA 1QH0A 3S28A 1BDIA 1H0KA 1VM6A 2W70A 5F78A 1IZ7A 1WZCA 2VC2B 3TB6A 4U5QA 3ZK9A 1NXXA 4GG1A 2V6MA 1M7GA 2PEYA 2PPVA 2B3TA 3WKAA 5I3ZA 2SHKA 1FDOA 2FEOA 1ULBA 2GYUA 3LQFA 4YIHA 4GDMA 2C57A 5JBIA 2QORA 4NENA 4ZCQA 1KE1A 2DCMA 1C4WA 1O9HA 2FEKA 1TJ4A 4KU4A 4BVBA 2XNDD 4GSYA 3R9KA 4FIDA 2VWQA 2CHUA 4MUGA 3WDSA 1YRHA 1NYLA 1R8XA 1RR6A 1NYQA 1S4MA 2RH5A 2WAYA 4H6VA 3OY7A 5KQLA 1E1LA 1YA4A 2AV6A 2RHHA 4IJ6A 2DPHA 3CLKA 1OROA 3E58A 3HCWA 3CF4A 1MFZA 1QWSA 3RBZA 5BR1A 3R7NA 5DZSA 1RWBA 1QE0A 4F4DA 4L08A 1EXWA 4UDYX 5F7OA 2QJWA 4L5JA 3FOWA 2O8CB 4WWHA 3BSFA 2YQZA 5C8VA 2QT1A 3DB2A 3CZMA 1UJ6A 3QWAA 3MNFA 4RIGA 3ZHYA 5LXTA 5BPFA 2ZP1A 2YIDA 4NFSA 2B1QA 1JAHA 1E5TA 4ZQHA 2AQKA 1Z8FA 2GUWA 1TZKA 5F5XA 5IFKA 4MUXA 1JR3D 2OBBA 4DQVA 2IIQA 4M88A 3R5FA 3FPFA 4BQOA 2C8KA 2HREA 4KX5A 4LW8A 4R1SA 1NL3A 1AOXA 3CF6R 4RD4A 5DNEA 5EJFA 2ZBFA 1CBUA 5TF4A 2G9RA 1OASA 2V7UA 3B38A 1GR0A 1L2TA 5CB6A 3NWPA 2BGGA 3SQLA 4FCCA 1EVJA 4KLZA 2E18A 4L5AA 2DJ5A 1H2YA 2IPMA 4LJYA 2SCUB 4WV3A 4RABA 2ISSD 2NNWB 1WW3A 3DMTA 4FZRA 5IMSA 3BT7A 4JENA 3K0KA 2IHZA 5I9SA 3K94A 1YQDA 1YUNA 1KFBB 1YCGA 2ALJA 4NU8X 3QE2A 3QVXA 2OFFA 3TSWA 3QMMA 1EE2A 5FBZA 2I29A 2WFAA 1JALA 5A05A 2WBLC