1JPVA

Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with so4
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
235
structure length
235
Chain Sequence
NPVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGFLVYTGKYNGETVSIATHGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSDNLAKGGIWITKEELEKSVMDGAKAVLDTLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a hyperthermophilic 5'-deoxy-5'-methylthioadenosine phosphorylase from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords 5'-deoxy-5'-methylthioadenosine phosphorylase
total genus 78
structure length 235
sequence length 235
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2001-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jpvA00
2OC4A 2HN9A 4L6IA 1YR3A 5CXQA 1OVGA 2I8AA 1V48A 1JDTA 4D8VA 4DABA 5F7JA 3OCCA 4R31A 4OGLA 4OGKA 1Z34A 4MARA 1JE0A 1Y1RA 4YMLA 3IEXA 4LKRA 4TXJA 3PNPA 1ECPA 2Q7OE 5B7NA 3NM5A 4BMZA 1RXSA 1LV8A 4GLJA 5K1ZA 3UAXA 4TTAA 1Z36A 4X24A 4DA8A 1V3QE 3BGSA 3FUCA 4LNHA 5ETJA 4DANA 2QDKA 4YJKA 1G2OA 1ULBA 2ISCA 4UC0A 1RT9A 4IP0A 4D8YA 4YO8A 3SCZA 3E9RA 3ODGA 4TS3A 3OF3A 1T8RA 2AI3A 1JE1A 3LBAA 1Y1TA 1PK9A 3BL6A 2RJ3A 5B7QA 1JDSA 4L5YA 4E1VA 1N3IA 4OJTA 3UAWA 1PW7A 3KVRA 5F7ZA 3ONVA 1WTAA 1V2HE 4QARA 4DA6A 5JPCA 2GUWA 3GGSA 4ECEA 2P4SA 4F3CA 1JPVA 3NM4A 3IOMA 3DDOA 2H8GA 4PR3A 2B94A 4MCIA 4D9HA 1RR6A 3O6VA 4BMXA 3DF9A 1RXYA 3OZDA 1Q1GA 1A9SA 3ENZA 1CB0A 3QPBA 3P0EA 4WKNA 4NS1A 4EARA 4QAQA 1OU4A 2HWUA 3PHBE 4L5CA 1Z5NA 1OUMA 2QTGA 2OXFA 3NM6B 3U40A 1JYSA 4U2KA 3PHCA 5F76A 1T8YA 1JP7A 1Z5PA 1Y1SA 3KHSA 5EFOA 4F2WA 1V41E 4GMHA 3KUKA 4M7WA 1RFGE 4JP5A 1PR1A 5CYGA 1A9TA 4TTJA 3DPSA 4OEHA 3C74A 3EUEA 1ODJA 4KN5A 1A9PA 3NBQA 1Z38A 3UAZA 2BSXA 3FNQA 4F3KA 1RYZA 1NC1A 4F1WA 1T0UA 5F7XA 3OZBA 4H1TA 1OTXA 5F73A 1V4NA 1XE3A 4M3NA 1SD2A 3T94A 3EMVA 3EUFA 1K27A 3LA8A 4R2WA 1A9OA 3FB1A 1RXCA 5DK6A 1U1GA 1SD1A 2QSUA 2ON6A 2AI2A 4L0MA 4GKAA 4G89A 4LDNA 1PWYE 1B8NA 3MB8A 2A0WA 4EB8A 1U1DA 5CCDA 1OV6A 4GLFA 1U1FA 5B7GA 1I80A 1SQ6A 4DAEA 1C3XA 1Z39A 3O4VA 1PR0A 4G41A 4G8JA 5EUBA 3BSFA 4R2XA 1T8WA 2IQ5A 1RSZA 4RJ2A 4NSNA 1RXUA 2PGAA 3P0FA 4TS9A 5F78A 1Z37A 4LZWA 4FFSA 4TXMA 1JDUA 3FOWA 1U1CA 1PR2A 4QEZA 4OY3A 5CXSA 5KB3A 4BN0A 1Y6RA 3OPVA 4P54A 3UT6A 1A69A 1YBFA 1K3FA 3UAVA 5CYFA 1TCVA 3K8QA 1JDZA 1M73E 1QE5A 1VFNA 1NW4A 4WKOA 1TGYA 5B7PA 4K6OA 4DAOA 2AC7A 4PNPA 3KU4A 1VHJA 3KVVA 3BJEA 3OZEA 1LX7A 3PNSA 1K9SA 1Z5OA 1U1EA 1A9QA 4BMYA 1JDVA 4L5AA 4TXHA 1CG6A 3GB9A 1VMKA 3DP9A 3OOEA 4D8XA 1B8OA 4DA0A 1FXUA 4WKCA 3F8WA 1PR5A 4DA7A 1NC3A 1YQUA 2AI1A 1V45E 5F77A 1OTYA 5CCEA 3EEIA 1ODIA 4QFBA 2QTTA 1Y1QA 3E9ZA 5IU6A 4YNBA 4QATA 1T8SA 3FAZA 1YQQA 4WKPA 4QASA 3DJFA 4D98A 1SJ9A 1ODLA 1TCUA 2QPLA 3OZCA 1VHWA 5F7OA 4NY1A 5C80A 4WKBA 5FAKA 5I3CA 4JOSA 1ODKA 4LNAA 1A9RA 3OOHA 3KVYA 4F2PA 1RCTE 3TL6A 1TD1A 3UAYA 4MCHA 3LGSA 4TYMA 2A0YA 4TXNA 3E0QA 1PK7A 1PBNA 1PKEA 3MMSA 1LVUA 2OECA 1Y6QA 2HRDA 2XRFA 3K8OE 4M1EA 4I2VA 3INYA 3FWPA 5EPUA 1PR6A 1Z35A 4JWTA 1ZL2A 5IFKA 1PF7E 1ULAA 2A0XA 4OF4A 2HSWA 1Z33A 4TXLA 1TGVA 3D1VA 1YRYE 2A8YA 2I4TA 1PR4A 4DARA 2OC9A 4TTIA 1ZOSA
chains in the Genus database with same CATH superfamily
2J6BA 3FYDA 1K3TA 1VLMA 5AVUA 1X7WB 3CBGA 1HO3A 5KNDA 5JPIA 4YBZA 1MW9X 1VCMA 1I5EA 3L4SO 1QCYA 1S0UA 1XL0A 2ATXA 4W99A 5ALRA 1W5TA 1YA4A 2ALJA 2PXXA 5CR9A 2DPYA 3C41J 3PKJA 5KYYB 4KSCA 2OCIA 3MK31 1T6YA 2AJLI 4FKMA 1YWGO 2C4NA 1GPDG 1OH7A 3NHYA 5E9QA 5COBA 2D2IA 4HPWA 4ERNA 1U0EA 2W2MA 3QOWA 4FDLA 1G1MA 1ULSA 2F9MA 5G41A 1G41A 4RH0A 5JMOA 1F2TA 3D7KA 1HOTA 2ZJ2A 3LO8A 1VL1A 4RV9A 2NSJA 4DUGD 2A88A 2FWAA 4FYPA 1ECPA 2OQRA 2Q7OE 2M1ZA 1DAEA 1KY4A 2DQZA 4QBHA 4U7FA 1GITA 3M6VA 1VE5A 1V5EA 3REOA 4QOGA 2QTVB 3VTFA 4YYEA 3G2KA 5K1ZA 5TPZD 1XEFA 2DWPA 4XR9A 5AI6A 3PIIA 4A5SA 2B9EA 4YCSA 4QQKA 1IJKA 1J99A 3M7IA 5K0NA 4TZTA 4BO4A 1C7FA 3W1EA 5C34B 1GPLA 4IDGA 4IEFB 2ZT7A 3AVOA 2GILA 3NIBA 3V42A 2W6PA 2WF7A 2VHCA 3JVIA 4WLEA 2WD7A 5J5AA 1L1RA 2IDJA 4AG5A 1RBYA 4FM9A 2WSIA 4K81B 4DTCA 1KGSA 1FU4A 1XZJA 4HTFB 3LU1A 1XTKA 2D0IA 4ID3A 4DDVA 3LBFA 1KYTA 4BEWA 2H1CA 4CCSA 1NVWQ 5CLGA 3TPCA 3GH3A 5I7SA 2QM0A 4MZDA 2XH8A 2CYAA 4EHKA 1BU5A 5DMXA 1H2HA 4LQLA 4ESHA 1XDDA 3II6X 3ZZMA 3SCZA 1IUOA 2IEYA 3DYVA 4E2YA 1Z75A 4IKEA 3WYNA 3Q88A 3RRFA 5TX7A 2ESRA 2A5JA 4IICA 1C3LA 3B6KA 2OO3A 3CPHA 1C9JA 2G5CA 4DYHA 3D59A 3TOSA 2KSQA 2IYRA 4UBNA 3HRKA 1BAPA 2C9MA 3BD6A 1U0RA 3QK7A 5AM2A 1VBKA 2P41A 3C3EA 3DR5A 4LXGA 5EIWA 3V4VB 1H6DA 3SLGA 2Q2OA 3L7JA 3RVSA 2IVZA 4YJ2F 1UR5A 4F4DA 2IRWA 4LYDA 4QHYA 3VH2A 3PXXA 4BE9A 2HA3A 4A0RA 5LSAA 2PKRA 3T3MB 4LV5B 3FYTA 4JUDX 4IEIA 1Q1NA 5CA1A 4I1RA 3UJCA 1NUHA 5LU9A 2JIBA 3LP5A 3K20A 1NP7A 4ZI7B 3X2EA 3I9NA 4QDOA 1CEQA 5BV1A 4JZYA 2AFHE 4W9NA 3BD8A 5TQVA 1VPTA 3AWIA 3L7DA 3WGGA 2N42A 4P4UA 1RYMA 4EMTA 4PN3A 2B0JA 2G4CA 3GGSA 2I6SA 4MB6A 2NV6A 3AKEA 3KOXA 3LPMA 4U2EA 5A2GA 2VXCA 3VOAA 3ZW8A 4B3DA 3W34A 1SK8A 5AI8A 4GWKA 2YJ4A 1EVKA 3BD7A 1GAWA 1G7SA 1O54A 1SXGA 2WA2A 2J3KA 2WSSA 3JW8A 4HLQB 5TVKA 3CQ9A 4NYIQ 4E07A 4K26A 3HV0A 1OGJA 3NM4A 3CLUC 2AOUB 4BVGA 1A27A 3HVHA 1HORA 4G2TA 3RREA 4G86A 1P4JA 5FUBA 1A04A 4NNJA 2DETA 2B94A 3TG8A 1JKMA 4KLRA 4D9HA 1JDJA 1ISGA 1L4KA 1TM5E 3B3GA 3CVYA 4UDNA 1LWNA 4ZMSA 2O8DB 3HVKA 1YZNA 3OTIA 4TLMB 4WT7A 2I5PO 4ZOBA 4KW7A 1LPAB 3KT3A 3NBMA 4GX0A 3CRQA 5ALVA 2X19A 3EFEA 4X92A 3U16A 1SU4A 2C29D 1QJ4A 2O2CA 3BWCA 4ROSA 2BP7B 1RQLA 3DHNA 5B3JC 2W2NA 5BP7A 5EZYF 1V7CA 2BKVA 2YXEA 1AQUA 3TGPA 2K87A 4JEUA 1ADBA 1W36D 1KH1A 4Y6SA 3HB1A 4OQEA 2P9BA 1E98A 1UMDB 5DGTA 1N5DA 3NWJA 2VBFA 5DTJA 4Y9DA 1KE2A 4Z9XA 4I1PA 2PVCA 2PXAA 3LWZA 1J33A 3RT1A 3OIYA 2RJOA 2UZ1A 2XEDA 4J8PA 1RTTA 2ZUUA 2O5EA 1IXKA 1DT3A 2RHLA 3DM5A 1FFSA 4NOKA 2MINB 4EYEA 1ZK0A 5E6SA 2LGJA 3OH8A 3Q11A 4LE2A 4AUMA 2AJDA 5B2FA 2WJIA 2XNSA 3HACA 1ZUNB 2ZB4A 4O1MA 2PA3A 4Y1RA 2TYSB 1TJYA 1XZCA 3CF4G 3UJNA 3JD4A 2H1LA 3CH4B 3F96A 1NSFA 1M2OB 3GGJA 1GKKA 1DQRA 5M34A 3IIKA 2JVKA 4RIHA 3WOVA 2JARA 1RC8A 2IHZA 2DZDA 4NLLA 2OYSA 4B2YA 4I14A 2XODA 1EFKA 5HE8A 3ZWYA 4BLPA 4RCZA 4YUYA 5L4SA 3SC4A 3T4UA 1JV2B 1XAGA 4X6YA 1UBMS 1LVHA 2KBEA 2CMHA 2Q5CA 2VPZA 4FYJA 4IIHA 1CRZA 1KA9H 3VC2A 4BS9A 2AV6A 1N5RA 4XWWA 1CF2O 1NXTA 3ABSB 1HC7A 1KR5A 1R0YA 3CUWA 4UUQA 4BVEA 1JI0A 2UVQA 5DCYA 2PXCA 2EBFX 3HPRA 1B41A 4DLTA 3HKDA 2I34A 2WUGA 1DOAA 2H1SA 1OTXA 2GBPA 2GA9A 2IGTA 2I1VB 4AZWA 3DP7A 1HK7A 2DP4E 3COVA 2C2ZA 1V16A 1XROA 3D8UA 2CMFA 1J9GA 3ZDDA 1T5HX 1XTRA 1AUQA 5GADl 3V1LA 5KNDH 1NPYA 2B30A 2GAOA 4LXIA 4NMXB 1K27A 1A50B 1P74A 1TK9A 3BWEA 5JAQA 5I4CA 1A9OA 1QRAA 5J2UF 1PV4A 3T95A 5FOTA 3VISA 3D0OA 3KSRA 4RCVA 2A9OA 5E6RB 2IPOA 3UJ9A 3P9CA 1CDOA 3WK7A 3PJEA 4RJLA 1MA3A 3HKBA 1IB0A 2Y2VA 4LJ7A 4NX2A 4B9EA 3SJCA 1H4QA 2DQSA 1Y81A 2NU9A 3EG9A 1TLTA 1M75A 2RD2A 3PPXA 2MSWA 3NHPA 3RRNA 1FJGB 1NRJB 1FX0B 3LVRE 5DW3A 5JTTA 2H4ZA 1KMHA 1E0JA 1G291 2JJMA 3C1OA 4WK0B 3FZQA 5J2TF 3U60B 1PJ4A 3SLRA 2ZIVB 1EVQA 2O8NA 3CRNA 3HY6A 5ITSA 1AHIA 3ROKA 3DMTC 4BEVA 4AJ9A 1MABB 3GH1A 3CWQA 1Y33E 3H2SA 3VM6A 3T3OA 1DRWA 2OBXA 1I80A 2GPBA 2WUWE 4NZNA 3TFQA 3ZGVA 1JHOA 4FI3C 2QORA 2OCYC 3QTBA 3NYIA 4BGVA 2AF4C 4MCAA 3HUDA 5EJ5A 4EJMA 4YMSA 5T5QA 2VP2A 3LUKA 1KK1A 4RTJA 4DCNA 1CZKA 3AX6A 1JHRA 3RAFC 2VSXA 3LC7O 4PFJA 3U7HB 3JQPA 4YEDA 5HFAA 4YA6A 5BQ3A 2JK1A 2IY7A 4IV8A 3ZWOA 2B3DA 1GL9B 2IBTA 4D8WA 2NU6A 4YLGA 1WB9A 1E2BA 4OXNA 5JASA 4JJ6A 4WV3A 4DGQA 2JNWA 3GGGA 1VE9A 4OQNA 2XLBA 4JLVA 1PS8A 2FB9A 2UZ0A 3R3HA 2XMGA 1OMOA 1XA0A 3G5TA 4X7PA 3IEMA 4FC7A 1SHKA 1O2DA 1XZBA 2R6R1 1PUXA 3TNDA 3TSYA 1VE7A 1X8JA 3I42A 3WLOA 4CCWA 1DV1A 3E0XA 3C43A 1OVMA 3GVHA 4B6GA 3JVVA 4F4JA 3ZXIA 2QQEA 3IKJA 2Z6QA 2BBWA 3R77A 3KZOA 1PL8A 5FJJA 3LXUX 3HJTA 4BN0A 2GD1O 1N2CA 1D03A 4U6SA 1BEUB 1KAEA 1WCV1 2SKCA 1F4PA 2QN8A 1TQ4A 4FZ3A 1W30A 4LYFA 1QR6A 1SUDA 1CFJA 4A6EA 4DR2B 3C6MA 4WTOA 1Q20A 1N57A 1FP4A 3IIMA 5TRTA 2NVUA 3D7RA 2M6SA 5EG5A 4PZDA 2YZNA 4K0RA 3ED5A 3M1YA 1GQOA 2Z2XA 3KSUA 3TDNA 3SSAA 2EHDA 3F3MA 5A4KA 3NAQA 2Z8ZA 3KELA 3W3AH 1QF7A 2RMKA 5M04A 1W5AA 1L7PA 1PTJA 4UHDA 1ZMTA 3SKVA 3ZQ6A 5AM4A 5K9ZA 3R1IA 2FZVA 1D8TA 2AG5A 4DAOA 3HXQA 1V25A 1OLXA 2O52A 3E1SA 3ODPA 5EZYB 5LKAA 2CNBA 3U1TA 6GPBA 4H27A 4BL5A 1TF2A 1PGNA 2Y1KA 2BGTA 3I8OA 2QW1A 1UDBA 3GLIA 4EF6A 1XMQB 5EE5B 3RW9A 3TN7A 1VL8A 2J0VA 1NVEA 1JH8A 4PIVA 3DAGA 2JH9A 4PLFA 5LBIA 2WUFA 1MMFB 3BRWD 3JPYA 1UL1X 3I72A 3GFSA 2BEWA 3KKLA 4Z4GA 2HRQA 3AMVA 2NZWA 5G4KA 1DRUA 3GB9A 3HJGA 1TOAA 2JJ2A 4IVPA 4YI5A 5KDLA 5ED4A 1E8DA 2AFIA 2EJBA 2C3MA 5DYYA 4LRXA 1J8FA 1NTOA 3ACCA 1YE8A 1RHUA 2ZTSA 2PVSA 3EW9A 3QPUA 4PGHA 5DFAA 5JH7F 1AT1A 2JA1A 2QG6A 1K75A 1M8FA 2G1KA 2NZ8A 2V5VA 4RZIA 3HVIA 3LVFO 3V7WA 4Q4HA 5E4YA 5J5CA 421PA 2W2LD 2JEZA 4MA5A 3BSYA 3A05A 2E6UX 3N2EA 2YHUA 3G7NA 4Q5IA 4XASA 4EJSB 5LOVA 1N5KA 2Y1XA 3NEJA 3EA4A 1TAQA 4A26A 1GNLA 1P1FA 1RJ9A 4Y1EA 3CUVA 1OWOA 5ICFA 3RHTA 2GVDC 5JAHA 4TV9B 3CY6A 4LTMA 2O9JA 3Q0TA 4FHEA 1M6WA 4MQ4A 4AMZA 4RTQA 5J4HA 4LF7B 1R8XA 3KQQA 3M4JA 4YROA 3SC3A 2PPLA 4BLOA 1Y1QA 1OZ0A 4MMYB 1BX3A 4BE7B 3U4MA 4KQ2A 3JVDA 3L8ZA 1YR7A 1O0CA 2GETA 5JDCA 1WXDA 3RUAA 1J8DA 1GYPA 2QR3A 2J46A 4BUCA 2IEGA 3R0JA 4PPFA 1UJNA 4YXWD 1V1JA 5BOSB 3P32A 4ZVOA 1KDZA 1YS9A 2GZ3A 3HWSA 4HSGA 4KH1A 1IM5A 4R4JA 1SM4A 2QMOA 3ANXA 4U7TB 4BBZA 1ESZA 3KBOA 2MSKA 2AZDA 4YDSA 2YCLA 3STHA 4A6DA 4M7PA 3FPHA 4OHXA 3ONEA 1G2PA 4K6GA 2FZLA 3HK2A 2CL6X 4RZ3A 2CLMB 5I9LA 4OKNA 1JQEA 3OFKA 1XNHA 3ABIA 4WN9A 3UJ3X 1J0BA 2BF4A 2XZDA 3PUXA 1Z22A 2X4DA 5T6MA 1T1GA 2AXNA 4DT1B 1E0KA 2VAXA 3NOXA 2HI0A 4TUYF 5D86A 3FTCA 1WZEA 4HXGA 5TS3A 4I8IA 4II2A 1QZ3A 3RBXA 3S2SA 3K0AA 3W6NA 4EGAA 3AONB 2FN4A 4FHGA 4X65B 5A04A 1D2AA 3CFYA 1POXA 2AKEA 4INZA 2HTFA 1AB5A 1TM2A 1OW3B 2A0YA 1RLUA 3PVZA 2POCA 4IHKA 4PO3X 1ZGBA 3K5PA 5IBPA 1Z2NX 1NOKA 3Q8XB 1HSZA 4FYVA 4HG2A 1UC4B 2RG7A 3QNWA 1AG9A 3K9BA 1KI3A 3U3OA 4WZBB 4I3HA 1DIOB 2X22A 2Y93A 2HRDA 4RD1A 2V9PA 2NU8A 2QTBA 3PQCA 2GF0A 1CVIA 3PYXA 5ILOA 1ONOA 4I9NA 3INYA 2PGNA 3FWPA 1O58A 2CHGA 5KOYA 3OJOA 2HHHB 4X84A 4CKWB 5FIUA 4YUXA 1WVMA 3I6BA 2QMEA 4MS3A 2O0HA 1RWBA 3KYBA 3QOYA 1UANA 3K70B 3AW8A 1R0KA 2ACKA 2KJQA 3LBYA 4M86A 1AZWA 3VPGA 4AYXA 4BNTA 1S2MA 4DC1A 4RA6B 4F2HA 2HUPA 4XGIA 4AL4A 4C89A 1OE0A 2ZKIA 2A86A 2PMDA 3KTDA 1AM4D 2R60A 3JQAD 4WWHA 2O20A 1C9MA 2JAXA 2XYPA 1HDZA 1GUZA 3NORA 4HEJA 4JEIA 5CLLA 5C7OO 1JAXA 3L6BA 3OT1B 2BGLA 1O08A 4ZAZA 2XY4A 1RM4A 2Z58A 5ARDA 3UC5A 4XWOA 2ZVJA 2F55A 4HRYA 3SU8A 4PHTA 4D46A 3NLLA 1GFIA 1NKVA 3OY7A 5IP5A 4CE6A 5ICGA 4I6GA 1NG1A 5K20A 5AOVA 1DTEA 5AJZA 2FZEA 2OCGA 4L6IA 4UE2A 4X0EA 5DH9A 4DMKA 2PWPA 1DXOA 2ZUSA 3FYSA 2WHXA 5CXQA 5K8CA 2WWRA 5H7XA 5AR1A 1F20A 1FJHA 2HDWA 1JSXA 4QTTB 3UKOA 1R0BA 2RBGA 4LCEA 2JB9A 4ZAVA 8OHMA 1QQ5A 3ICOA 3NHAA 3UJHA 4D0GA 2PX2A 1YUMA 4OGLA 1PFGA 3ZBQA 3QXGA 3KXLA 3NKVA 1W76A 3BGIA 3KKEA 3VU9A 4EQ6A 5BNWA 2EKZA 1A8IA 2A5FA 4OHKA 5AP9A 3W5JA 4MUBA 2QP9X 4LKRA 1WDLA 5KWJA 2FMFA 3IBFA 3N39C 1I1QB 3BTOA 2C2BA 2VIIA 1U8YA 2W2XA 1XSEA 2EKQA 3EGEA 3IHLA 5LB4A 3THSA 5JNLA 2QE6A 2QBYA 1TQ2A 2FWMX 5D3MB 5BQOA 4TLLB 4X00A 3R7BA 5BV8A 2HD4A 3GZNB 5AJWA 2IHVA 1QTRA 4PYNA 5LB2A 4JI4B 1FFAA 1JEOA 3EGVA 2WTMA 3OEWA 2ZUFA 3NVDA 3DFUA 3A06A 2QX9A 3JQRA 1W34A 1E4YA 4DG5A 2UVPA 1EVEA 3G9XA 5ISMA 4NECA 1GL3A 5JLJA 2E82A 1SCDA 2O3JA 3T3GA 5CA1F 3ZGXA 3GFVA 5F5LA 4XLTA 2OORC 2ORWA 3KD3A 4MUAA 5AI5A 4HDMB 3B9QA 1P0CA 5KAMA 2ZJ4A 2XD9A 5FULA 3KR1A 4HN4B 3TOZA 4B6EA 3CLRD 4LHYA 2TSYB 2MSLA 3GJXC 4UREA 1NASA 1DRVA 4UC0A 2O2IA 1SUPA 2X8AA 2HL6A 1YA8A 2WSYB 4DEXA 4CGZA 2AE2A 2FZ5A 5F4ZA 3EOAI 4LECA 4XOUA 1QIFA 5GTDA 2VDWB 1BDHA 4UFOA 4D6PA 2WPDA 1Q3TA 3SS8A 2VBIA 3E5NA 1T10A 3W3AA 3VH1A 2I3AA 3KSBC 1HR0B 3ZE9A 3LDFA 2FPSA 3DHWC 4HK4A 1N3YA 4OLBA 3GRYA 3L5OA 3TIFA 1QU2A 2R6AA 3MJSA 3LE8A 4RTRA 3ESDA 2WRZA 4MWBA 4ZT3A 1DEHA 3O8NA 1VYUA 4JIGA 3PLAE 2P77A 3A4VA 2OSVA 4QOEA 5EIHA 4HATA 4U7DA 1QVAA 2Y1FA 1HGXA 4EHLA 5CYOA 4I46A 1PTJC 1R0LA 1RLOA 1T5DX 1XLVA 1NDUA 2FWJA 2HQRA 2MT9A 3E81A 4JFRA 4PSKA 5H1YA 2PUWA 5TEWA 4TKVA 3VA7A 1OAAA 2Y0BA 1AHPA 5HZHA 5J2UB 4O6VA 2Z1DA 3SVZA 2CBZA 1FQKA 4CKYA 2OOKA 3AFOA 1WTAA 1KJIA 4Q21A 4EDFA 1W9HA 2LZ0A 5GINE 3QY9A 4BQPA 3I6YA 1HNWB 1N5OX 4KNYA 1Y1PA 4YQZA 4MW4A 3CRRA 3NUZA 2WAMA 4QRDA 1H5UA 3VYVA 2IYUA 3JS5A 5KWVA 1T2FA 3TWOA 1TFRA 5CEFA 4JLWA 3G82C 3G2JA 2QUAA 5BW8A 1XRQA 2WHPA 2JIOA 3GJ4A 4DXHA 5DRTA 4CL2A 2IC5A 2AVDA 1WXQA 4ZHQB 4RGQA 4CFSA 1EP9A 1QIJA 1KI8A 3GYGA 4QQRA 1TZCA 1M1UA 4OJQA 1ZMRA 5AK5A 2XMPA 3GBVA 5CT8A 3Q6IA 4U5QA 1Z15A 3LDHA 4CT5A 5A06A 3PD1A 3X1DA 3AB8A 4L4UA 5FR1A 2QTZA 3WNQA 2PJRA 5B58T 1SR8A 2PRKA 1H0KA 1OC4A 2ZYGA 1NF9A 3F4KA 4RY9A 3SF8A 3VMFA 1D6JA 3T7SA 3DZJA 5ALOA 5CXXA 3DOOA 3B13B 1L4FA 1XWIA 4IQ0A 3H4TA 2DWUA 1ZVJA 3QM1A 1I32A 1ZUWA 4PR3A 3B6EA 4ND8B 3WRYC 5FI5A 2QMUA 3RDPA 2Q1SA 4L8WB 5KTRA 1NBAA 1AQLA 3SFVA 4J4HA 4EG1A 3OICA 4W8GA 3O6VA 2R3SA 2BFDA 1YRBA 2GN1A 1EVZA 3QSGA 5EWLB 4BMXA 3L6CA 5KYXB 3S1SA 1NLZA 3QI2A 3TNJA 4CLHA 2X0JA 1RRCA 3CBQA 3UZUA 1A9SA 2IWHA 5JOQA 3MTGA 2Z6VA 4N49A 1TJ4A 4JQYA 1H1DA 5DLEA 2BDEA 5FQOA 3SQWA 3B1FA 1RPNA 4B35A 2VP0A 1FTYA 3G0HA 2O3QA 3K2EA 4RSMA 1FVXA 1WZUA 1PS9A 1KXZA 1J4AA 1ZWLA 2NXCA 3OWOA 3E7FA 4D26A 1NQOA 3PGA1 1NQUA 3EIFA 3HI6A 4FLFA 4FZJA 1TI7A 4MDHA 1ZOOA 1W2GA 4XSVA 4AJIA 3U40A 1RMYA 1KEWA 2TECE 4LOJA 4KQXA 2J5RA 3DUFA 1FFWA 1JYSA 1PVDA 3IOEA 4PRKA 4ZV4A 3D8TA 5T57A 4BN5A 3WYDA 3K1YA 3E5HA 4IDQA 3LHFA 4X1YB 1M2GA 5L8VA 5FOXA 1D4ZA 4HNGA 1TCBA 1LF0A 2XYGA 3F5FA 3GFFA 3FSJX 5JZMA 3KHSA 4R1QA 2OORA 4QDTA 2X5JO 3GQBB 5DKFA 5EKSA 3FPCA 3EGXA 3N53A 4ZC8A 2QEQA 1RFGE 2QPAA 1YIAA 2WZCA 5HGJA 2BGGA 4C07A 2AZ4A 4TLAA 3OQPA 4FT2A 1DHRA 4GGMX 2F4NA 4QGSA 3OD1A 4QJ5A 5BMVB 2P9CA 2HRCA 2QQ5A 1A9PA 2VUUA 2JEYA 1H8EA 2QVYX 1SKBA 3AUXA 3FNRA 3HUFA 4JVNA 4N40A 5EZSA 5FWAA 4D9BA 2QM3A 4YQEA 3KNZA 4JKIA 3T1TA 4KQIA 4P92A 3UGKA 3CUYA 1KAQA 4PGGA 1T9GR 4KHPB 1T0UA 4FFNA 5TT0A 5IM4F 1JFTA 2ZRKA 4M22A 4MRMB 1XEWY 9LDBA 4FN4A 2V6JA 2Q28A 3NTOA 5G0VA 5HOQA 1B8VA 2Y66A 1DWUA 1OXUA 4GT1A 1L4BA 2EATA 1T9AA 3LY8A 2GBFA 1FFXB 1P7PA 1YB5A 4H3VA 4QNMA 4ZCRA 5TR9A 1IZZA 2DY0A 4EIWA 4RPHA 2P3LA 1GCUA 2OFWA 2XJ4A 1PQ4A 3SF0A 5CB8A 4N5IX 2PYDA 1M72A 1UIMA 2C5GA 3RRBA 3SZMA 3D6AA 3GJZA 3Q8LA 4YO7A 3CSSA 2FPGB 3O3MB 3QEBZ 3Q7SA 3A58B 2ZJ6A 3KOYA 3YASA 4CTNA 2ZWMA 1ML3A 2JFOA 4QRHA 2ZCJA 4XJXA 3T7TA 1V6AA 4CCYA 3N0RA 2CUNA 1DUIA 4LK3A 3MB8A 4MPJA 3FW1A 1SHJA 3OPQA 2DJ5A 1XTIA 3HP4A 3IESA 1JHAA 4CU5A 3EYWA 3IKMB 4EA8A 1G6KA 5I7OA 1Q7GA 1XA3A 1Z2OX 3EVFA 4TWRA 4CBVA 4DV1B 3IURA 2QRKA 3W8FA 3IVAA 4BJ6A 4DQDA 1XU9A 3M4YA 4PNEA 5DEIA 2DECA 2Y3IA 5FI0B 1PJSA 1MA0A 2W6JA 2H2WA 4RFSA 1TAGA 3MAAC 4RVFA 1VZ2A 4B7XA 2AYZA 1WXXA 4NG4A 5JSKA 4MHSA 4I4LA 5L3QB 3ZH9B 10MHA 1PX0A 5KVCA 4FNGA 2ECOA 3WDKA 1UOEA 3WB1A 4C6RA 5DLYA 1SCQA 2EU8A 5BSRA 2EYUA 3E18A 4EW3A 3RGWS 4ENQA 3NVKI 2WYHA 521PA 5T67A 1XAIA 2AQ8A 1NBME 1YZHA 1I3KA 4QDZA 1SCJA 3F6EX 2CL0X 4QYWA 1CV2A 3I9JA 5CX4A 4B73A 2JJ2D 2XJ9A 3HV2A 1CUXA 2QAGC 1LI7A 2WFLA 3WHKA 4LK2A 1IHOA 4Z3OA 4JBWA 3BB1A 1YJ5A 1YZQA 3CG4A 3JD3A 4M89A 2ZFUA 2H1HA 1IZ0A 3FF1A 1LJLA 3LHKA 1YQGA 4MRAA 1X1EA 3FIJA 4HV4A 2IYEA 4GC9A 3DWGA 1E9SA 1NV9A 1SY7A 1XD2A 2VWQA 5DGXA 2I4LA 3C1AA 4LY9A 4G5GA 4O4HB 4E5MA 3L7OA 1RS0A 4EY3A 1AK1A 2J5XA 1PFKA 2EHJA 3BRWA 1Q92A 4CKXA 5DOZA 1YOVA 3DTTA 1S2DA 1XHEA 3NH9A 1BVUA 1ELOA 3UJPA 4BNMA 2G6BA 5KB3A 4WUVA 4F06A 1J70A 3KR9A 2R5NA 3P9KA 3C7TA 2YMMA 2LRHA 2Y68A 4OO3A 1GZSA 4F7WA 2AN1A 2IH5A 1GU0A 4QEKA 4J1SA 1CTQA 5TMBA 3UPTA 1O0SA 4G23A 4B31A 1C30B 3HG7A 2QTHA 3VOTA 4I5GA 2G80A 2J0UA 4MPDA 4CFYA 4ZCTA 1SUEA 3RRJA 4HDSA 4KTTE 3V34A 4JT8A 5AHRA 4AU1A 5EMMA 4YUZA 1TMGE 2NZYA 4O2BB 1YQXA 5IHXA 4AKHA 4MCJA 1J2JA 1Z4OA 1HNXB 1NJGA 1SCBA 1T5BA 3S4YA 3ZXXA 1E1LA 3KLBA 3B6JA 1NVBA 2R7NA 2CV1A 3KU4A 2Q07A 1PG0A 2NT3A 4LSMA 2NACA 2PA0A 1YSCA 4YI3A 3DBLB 2YMQA 2BE7A 4TGLA 3HB5X 4FOOA 3ZCUA 2WW8A 1DAKA 2OA0A 3U80A 4BKUA 2O5RA 3FDZA 3GLGE 2QRNA 4Q66C 2AUTA 1ZBQA 3EOBI 2XRZA 4AX4A 5FFMA 1A5SB 2A6PA 1U4SA 3K6SA 1TM1E 4C3ZA 4KHZA 4YRCA 5KJCA 2VCEA 5KVQA 4AJEA 4KIJA 1XGKA 3P4XA 5K6AA 1F8UA 1T43A 2YWGA 3NC4A 1XCGB 1P2GA 2IW3A 5KJ1A 5JD4A 4NXMB 2H5LA 3EXG1 5L7WA 4NV1A 2XDWA 4QTXA 1I5RA 4KFSA 3ZE7A 4TMZA 3RBAA 5EGNA 4BQFA 1MHTA 4A0HA 4DYDA 3QKSA 4OQZA 5D7NA 3DOIA 1EFRA 1CT9A 3MM4A 4NU6A 3NBAA 1JHQA 4JJFA 2GEKA 5DNDA 5E1MA 2O3UA 2ATIA 4IIVA 2GHQA 1JILA 4HS4A 3EEOA 1E3IA 3CM0A 3MOIA 4RHXA 2PKQO 2SHKA 1USVA 1WKVA 5T3YA 4EQZA 1EG2A 1IQUA 1AC5A 2FZKA 2W71A 5KOHA 4CG3A 4N5NA 3H9CA 4Y2JA 1SPXA 3TK1A 2R6JA 2RK4A 4HS9A 1Z4JA 3ZVMA 3N2KA 5G0UA 1PZFA 3GGPA 2CVFA 3HXLA 1XELA 3EJWA 5H8WA 2P3OA 4N65A 3V4FA 2W42A 2CHFA 4OX9Y 2HREA 5H81A 1YZUA 4PVDA 4G5YA 3WSVA 3QTTA 5B37A 3LLVA 5IKEA 2NMVA 1VP9A 3AUUA 4L95C 3O8QA 1DAFA 3AM5A 3ROTA 5D2CA 4AJ4A 5IJ0A 3W5IA 3EIUA 2P6UA 3WGJA 2KLBA 2DKOA 5IBCA 3KWJA 4ZK6A 1JF8A 1WCXA 3E8SA 3LUJA 1JSLA 3GHHA 3ZDXB 3OQMA 5LM3A 1DG9A 3DDNA 3B6ZA 1DX6A 5IM5A 3GMTA 3OCWA 2WMNB 1YL7A 1ZM9A 2A5GA 1QYRA 1E58A 1R4MA 4KPUB 4X1OA 1DTSA 5CLQA 3RJTA 5AVTA 1ODKA 5KYVA 5HRCA 4EHFA 4Q4AA 1S6YA 3W7BA 4UOZA 2I62A 2AQKA 4C4RA 3ELWA 1HOXA 3EJ6A 3HJNA 3QY0A 2H48A 4P7GA 4J90A 1FPMA 5I7AA 3RS4A 3SICE 3ZWNA 1CZLA 1AIPA 2M9MA 1Q7EA 3SHVA 2WP8J 5BUZA 4TYMA 1U94A 2C00A 4JB2A 3T7EA 4DA4A 4DR7B 1KORA 1KEEA 1L5MA 4BO5A 3OU7A 3MMSA 4XFJA 1XWWA 3CZMA 2PY6A 1RWPA 3JV7A 2HWYA 1PX2A 3ZWCA 3G0OA 3K5IA 4WFKA 1P5JA 1ZIOA 3GJ0A 2FW8A 4MINA 4O2AF 2Z2ZA 1L2TA 3K8OE 5L7YA 5C8YA 3S2FA 4CMIB 1OQAA 1U0FA 3O8DA 4ZVKA 3RVLA 3PA6A 1E3MA 1NKSA 1V0JA 4II3A 4X61A 5IK2A 3U9SA 4BNYA 4E6PA 4G5QA 2NTVA 4M8KA 4PYKA 5AXDA 4FCCA 4DQVA 1XXHE 3ABZA 3GEGA 2Z1NA 4IX1A 4LWPA 2PUJA 3W2TA 3VV3A 3BJMA 2FPXA 1P91A 3AUSA 3RANA 3W4KA 4DR1B 1I7NA 1H94A 1EUDA 2FR0A 4QXQA 1OU0A 1BQ3A 2FK8A 2OFPA 4NENB 3NTRA 4MEJA 4DLWA 2HOQA 1I1NA 2P11A 5FF9A 3NH6A 3UKJA 3WDSA 2P9QA 4XZ3A 2O7QA 3PZBA 1VYTA 2WILA 3ZLBA 2DQ4A 2ZIZA 1HFKA 5CVEA 5FPSA 1E94E 2C20A 3EXG2 5FOUA 1DDGA 2PKYX 5MN4A 2WU1A 1REQB 2NSYA 2A59A 4TTIA 5DWDA 5C4GB 4WBNF 1QYDA 5JXJA 4DLRA 4BXOB 2HN9A 3BWYA 2OXRA 1QHHB 4X71A 4YWJA 5KNCA 4G0YA 2G9ZA 1A3CA 1T8PA 4ISBA 5D84A 4AMUA 4EY4A 1WZNA 4G5OA 1XWFA 2ZIWB 3ADBA 1GPMA 3O4IA 4B7CA 4DIMA 1XDGA 3LFHA 1H0RA 3H18A 1NSTA 1QCCA 2OKCA 4OM7A 3N5CA 4C6TA 4OXKA 3OHMA 5F7JA 1VSVA 3CX6A 3IHWA 4AECA 4QU5A 2WHEA 3JWEA 3HO1A 5KKNB 3OX3A 4N3AA 5JS2A 2X9QA 3H05A 3IEXA 1DTWA 1FDSA 1NPTO 2FVYA 1RAIA 1GYQA 3C5VA 4IZOA 4OGWA 4DR3B 1WY5A 2BGMA 2RGDA 2VPXA 1Z4MA 4QL3A 3CS3A 3IPCA 1X7ZB 2BOVA 1PEDA 3WDLA 1FS5A 3RRZA 2JFGA 4XARA 3NBZC 1RYYA 4TV8B 1GA1A 3SQMA 3OBIA 1EWRA 3BORA 2AJCA 2EGHA 5DXFA 1IBKB 4W7HA 4TTAA 5FBZA 3K72B 3H2JA 1J90A 4B7ZA 3GLIE 1USWA 4ATNA 3V9AA 3M6WA 2FQWA 2QY6A 3CF4A 3KAJA 2GYYA 2ZUWA 4XWAA 3T3PB 4ARAA 5LJLA 1GTJ1 1EJ0A 3C5WP 3CURA 1V3QE 2XCUA 2QRUA 2QT9A 2J0QA 1RHQA 3JVEA 5FDFA 1ENOA 4NH0A 4UBKA 2C88A 3CUKA 5ECYA 2FPPB 5T4EA 2WIAA 1FYVA 2XE8A 1E9DA 3SE7A 621PA 1M2JA 1N2JA 2OM2A 1ULBA 4JUCA 1QKIA 2BEJA 3C6QA 4NRDA 2JJ8A 5HJ2A 4XPZA 1BE0A 4S05A 2W9XA 2V7VA 3PPWA 3ROMA 3SSOA 2REBA 5J63A 1G66A 3CEHA 2C1XA 7ABPA 3R7WA 4OD0A 3UOAB 3URMA 1BCSA 2GASA 4FWIB 2PUVA 1MNAA 4LVCA 4OUDB 4Q1EA 5IT0A 3CZ4A 3RVPA 1YRWA 2IPNA 2J41A 3MD0A 2ATCA 2CFOA 2CLCX 3IDZA 3TNFA 4QULA 3FVWA 3UB3A 4IKPA 4L78A 4OH7A 3I9KA 3IAUA 2WE8A 4WNIA 5LNK1 2IYXA 2WJPA 3RSSA 4H7FA 1ORHA 1UPAA 4NYIR 4QE3A 3TLAA 2RJ3A 1RYDA 4GMFA 4P33A 4WLOA 3DLPX 3DKRA 4WQMA 4ENRA 2CVOA 2R68A 1H1LB 1QLJA 2JIPA 2QTRA 3O1HB 4LHSA 4BNJA 2CDBA 2QROA 5DMHA 1B0ZA 1N7JA 2AOTB 4G8CA 2E1RA 3CUTA 3RD5A 3V4PB 4Q1DA 4JXZA 2C7QA 3NX4A 4JD5A 5DGDA 3K4PA 2E21A 1B43A 5BR4A 2IKSA 3ESXA 2P1DA 4DA6A 4FUTA 2GBCA 2ZQYA 1PGPA 4W1RA 1THGA 2AMVA 2WK1A 3X1ZA 2XD4A 5JSQA 1BDIA 2BUBA 3U7IA 2PK3A 1G5PA 2WKWA 4QUBA 2WINI 3P9QA 4GWGA 4J1NA 1GL7A 3LKDA 1OT5A 2YWXA 1L5HA 4DSOA 4HKTA 2FH5B 4QO8A 3TQOA 1T4CB 2F17A 3ZD8A 1UQRA 3NU1A 1ZIDA 2GPSA 4O2LA 3UUFA 2OHFA 4EB3A 3IDFA 4DYVA 3OO0A 4HX2A 2HLNA 1JR2A 4LV8B 3OZVA 2X1MA 3PJFA 1NYLA 2HMUA 4EM6A 2FP4A 2JJ1D 2XVYA 3QYAA 1G0NA 2QXUA 4MAAA 5COAA 5DSXA 4IDEA 2A0KA 2YNMA 5IMSA 4AFNA 2HSGA 2ZRIA 5J1SB 1UOPA 4UFNA 3C8MA 2UUAB 1U4OA 3D4OA 3CVWA 4DR6B 3CNOA 3PI6A 1MIOA 3TL2A 1J56A 4N3BA 4C0QC 2QP3A 1KEPA 3AP2A 4DUGA 4BFXA 1WO8A 2EG5A 2Q6KA 2UYOA 1RKVA 1RKQA 3BHMA 1FEZA 1E3JA 3LOQA 3ND7A 5A1JA 1CX9B 1P9WA 3GK3A 3NV7A 5LP6C 3RSHA 1MJGM 4NPCA 3U44A 3UAOA 1XV5A 1XX6A 3VNAA 3AL2A 4M1YA 4PBSA 2O2ZA 4H18A 3AKZA 2QRHA 3M89A 1T9HA 3MNFA 4EARA 4P8RA 3DE7X 2ZSHA 3UHFA 2Z3ZA 2BE9A 2VN8A 1W2HA 3DLAA 3H5VA 3C6ZA 1IOZA 5ULLA 4JY7A 1KI9A 1Q0UA 4Q4JA 1FDUA 1JXMA 1Z5NA 2Q4TA 4BQSA 4EPYA 4FU0A 1UBNA 3ANSA 4R84A 2O48X 4JVMA 4U7GA 3I45A 4YRFA 5C31A 3RTAA 1OZHA 3BTUA 5CW2A 5FTMA 2NTJA 1S1MA 4Q47A 3PUJA 3UV3A 4XIFA 1QHYA 4RMHA 4ALLA 2GK3A 2BTQB 2XWQA 1YDFA 1O95A 1BEEA 3E8XA 4YAWA 2P2CA 1R9NA 3BZWA 4YLEA 3EPHA 2O8EB 3C5HA 3L4BA 1YRHA 4GMHA 3GP5A 4P98A 3OX1A 2HJ9A 1DIRA 1OXKB 4IIYA 4ZGGA 5CYGA 5DK4A 3ACBA 4TTJA 5IRCD 2I4OA 1UT5A 2GJAA 2YVKA 1ZN2A 3PNMA 5ALSA 3ZDQA 2P5UA 4BRUA 4KXWA 1JG2A 1NF8A 4AKGA 1J8YF 3OWHA 4W6ZA 1O3YA 4DMMA 4YPVA 4PBRA 2G8LA 2DHDA 3EFBA 1QIMA 3MA0A 5E2AA 5E4FA 1CIJA 1TCCA 3N0WA 1ZH8A 1ZY2A 3AV0B 4UD6A 4F3KA 3N2LA 1AQJA 5C52B 2XKJE 2VJMB 4P0TA 3ITKA 3TRFA 3V1UA 1IWBB 4FDMA 3K9LA 2MSDB 2B98A 2ERYA 4QYTA 1KDOA 3RS7A 2RHDA 1BGXT 3I2IA 3O4GA 3PCXA 4CM9D 4S24A 2RGAA 5EEGA 4LYHA 3OCZA 3AF3A 4OIMA 1ZLYA 4ANFA 4MMZB 3A2KA 1DQSA 2ZPUA 1Z63A 1FUIA 2ODPA 4B7AA 2HJRA 3HA5A 3KKPA 4LCBA 5IULC 3NQ41 1M0EA 2FWBA 5CNIA 4MXDA 3IUSA 4BDTA 3ITEA 3ADCA 2BN4A 2JIQA 5KTNA 5BN5B 3TOVA 1AV7A 4UNPA 2WU4A 3KK0A 4O4IA 4MIKA 1A88A 4J0QA 2OHXA 1I0LA 1XVUA 4AO8A 2ZTMA 1DEKA 4IOMA 4KXVA 4RF2A 1KQOA 1OXXK 3EZ6A 4LXQA 1SD1A 2DY1A 3IJEB 4HAOA 2QSUA 4OFBA 5IJZA 3V7YA 4B76A 4KLZA 1E1DA 4F0JA 4WCFA 3GP3A 2ONJA 3FMFA 1AS3A 4H0NA 1W85B 3HA3A 5EYPA 8AT1A 3BE6A 1I1OA 4IFBA 3L6EA 5ICCA 3KT6A 1BXRB 2GD0A 3CZ5A 4HYEA 4BO8A 3UA3A 2ODAA 4U3JB 5DZSA 3L0OA 4ZCMA 3W90A 2FPIB 1I51A 5IAAA 1Z0JA 2V7BA 3PRYA 1UPBA 4UVEA 1QGED 1TQHA 2QSJA 3ZOZA 4A6PA 1VGQA 4D9EA 4JA0A 4DT1A 1NR5A 2REQA 4XR4A 2I66A 3MWDA 4QVGA 4CMEC 5B4UA 1T1JA 4QXPA 3MB5A 1SVMA 4N39A 4UAJA 3RFTA 5JFGA 4HNAB 3SZ3A 3LS2A 3R5XA 3NJ8A 3VO8A 1FJ2A 2BFWA 1AV6A 3UMVA 1SIWA 2AL7A 4N47A 2QAGA 4O0MA 5D87A 1Y8RB 3KU1A 4ZAWA 7GPBA 3EZNA 1Z39A 3H9GA 4DADA 4JT9A 1SH7A 1PR0A 4JWKA 3S7TA 2GCOB 4XW2A 1GJRA 5FPTA 2CVZA 4FMPA 3OIDA 2V65A 1QFYA 4UBJA 1W46A 4IMRA 3VAAA 4ZZ3A 1YV9A 2UXDB 5JZBA 5FHRA 3OLVA 2H3EA 1FBTA 2B21A 1WA5A 2VQSA 3T3DA 1KHTA 6YASA 2J3MA 5AW1A 3DLBA 2FMHA 3CW9A 4AG3A 4B0PA 4QKQA 4ZZ1A 3CRW1 2QZ4A 4ACAA 5A5DA 4MKZA 1M67A 3C7CB 4MVYA 3MTQA 5GJBA 4J0CA 3LXRA 4UAVA 3HQ4O 4YJHA 5DDIP 1W73A 1QH1B 2ZIXB 4RS3A 5HILA 1LLDA 3VZCA 3SOZA 1H4SA 1HDRA 2YQ5A 5LYJA 2IWRA 2QD4A 4UTRA 5H68A 2X0EA 1GXSA 3QLTA 4BFTA 4UXJA 1DKNA 3F67A 3GT4A 4FFMA 2JGDA 1UBCA 3OD5A 4TL8A 2VF8A 1N0UA 3C3MA 3ZE0B 1WCWA 1WDKA 2GSWA 2Q8QA 2CD7A 3CWZA 4HB3A 3PHJA 4J3JA 4YP9A 1A69A 3UAVA 2IH2A 3DTVA 3BH0A 4HC4A 2JZNA 5J9FA 1M74A 1OLUB 2ILTA 2OCXA 4GS5A 4KR6A 4MB2A 1D09A 3T15A 5F1OA 4FTWA 4RK4A 1TRHA 3UH1A 1QU3A 3PBKA 3QVSA 4JLDA 3MSXA 3U3XA 3G1TA 4CHGA 1KY3A 3A70A 4FR2A 4WDRA 2YV1A 3MINB 3OQHA 2NYRA 5I6DA 5A71A 3FOEC 2XOKA 1XI2A 2H8KA 1BYIA 5H16A 2WQZA 1G18A 5F9MA 4V1CB 4QBGB 1M8JA 4QQNA 5DE3A 3TD9A 2VVTA 4JQOA 5CT4A 2ODQA 4PNPA 4ZICA 1AH2A 1JIQA 3VGPA 2IXGA 2GRAA 1NNSA 2B4AA 4RKEA 2C97A 1WCYA 4I5IA 1BH6A 2OWEA 1L0BA 3BRQA 4L4RA 5FPYA 4YCMA 3ZHXA 3IT3A 2G07A 2OGWA 5AK0A 3FDXA 1NVGA 2WJHA 2ZJ5A 4HDKA 2JGRA 2VSYA 4OG2A 1KS9A 4KR0A 4PU0A 1W36C 4AY6A 3T6KA 2YJTD 4ZOLB 1QTNA 3U19A 1JDVA 3NTQA 2VZEA 4FHCA 4E21A 5JJ5A 5KMGA 1GY8A 1Z62A 4REQA 3ZV5A 5MDHA 3BEOA 3UUGA 4CV1A 5EJ7A 2AFHB 1S01A 1KO4A 1DG3A 4JQCA 4QRIA 5T6BA 4YCCA 4RHUA 1AKRA 1ITZA 4KO1S 4RKWA 2KM1A 3VSDA 3PHLA 5BQPA 4F3RA 4LFBB 2GSDA 4QUJA 4XVHA 2UVDA 1RPJA 2C83A 4D97A 1Y7TA 3L02A 2AI1A 2R11A 3GXBA 4KV9A 5DX0A 4R68A 5KTYA 1V1MA 3OE4A 1LJ8A 1W88A 4M9RA 3L8DA 1GRQA 3R0ZA 5I9BA 4DCSA 3SNHA 1WVIA 2OTCA 4HMOA 4RTNA 3D8BA 4HGYA 3QRWA 5LQCA 3TXXA 4D4MA 4QUDA 3STVA 1ZEJA 2C04A 5TY0A 2JC3A 4HAVA 2OV8A 4PBTA 3P2EA 1LBSA 1VB5A 2WJAA 3PICA 1K4YA 4IFIA 4C43A 5JATA 2YZ7A 5KTPA 2ZU0C 3T9EA 1T8SA 2R79A 3ESQA 2A2ZA 3QJ5A 4JJGA 4JLBA 1N33B 2FRVA 3PQFA 4RVDA 4Y9TA 5T8KA 4CEJB 3Q7TA 1SXQA 2H1FA 2OQ2A 3MS4A 4IYJA 2ZBQA 4WKPA 2QVBA 3IVGA 3KTAB 3C39A 3W6UA 2BH9A 3HYTA 4BV3A 4IWXA 2NO4A 1N6HA 2FMIA 5IASA 1T1RA 2D59A 3V97A 3ROPA 3D1JA 4K2AA 4D44A 3GYBA 4BLVA 3PTLA 5DNAA 4DSTA 4Q7MB 4FC6A 1WW2A 1GGNA 3C5EA 1Y37A 5JSYA 3FRIA 1QHXA 2FOIA 1W35A 5FAKA 4D0SA 2ID8A 1F8FA 4FFLA 1A1SA 3IAAA 4CJXA 3ZZ1A 3M6MD 1Q74A 5AI4A 3U4HA 3ZIDA 1CUSA 1MVOA 3NWPA 2HDNB 5KQRA 5H70A 2YYSA 2ZJOA 3ZNQA 4TUYA 3MUNA 5CFLA 5I51A 5IARA 4Y3UA 3CVXA 4MCHA 4XD7D 3LGSA 4RW0A 4Q1AA 5AK6A 1K8QA 4OMDA 2WI8A 4G65A 3NAZA 4HLUA 3MCZA 4W5NA 1P0FA 4HAIA 3RVMA 4F8JA 4QOJA 1ZIYA 3EGDA 2QGZA 3MMPA 1HYQA 3C1UA 3DZFA 1G60A 2E87A 1NBMD 1PJCA 2HO4A 4RSHA 5E7IA 4PZUA 1ECCA 2V0GA 5K8UA 2ORED 5HP4A 4ZCSA 1KP2A 4CMAA 2HADA 1P9LA 2AN9A 4PZCA 1OI3A 4Y7CA 4J3NA 1V7QA 2Q9AA 3T3NA 3KQTA 5FL7D 3G2NA 2HKIA 4YHHB 2JLQA 2XMBA 5LP6B 1AQIA 5A4AA 4RM3A 3DJYA 4IIDA 2CCJA 1SRQA 1Z13A 2O8CB 1N6PA 3TXAA 5FPQA 2ETVA 2JFUA 4L16A 4WFQA 4INOA 5ADWA 1DHTA 4PX3A 3O4JA 4X93A 3BK7A 4MO9A 3E22A 2HSWA 4TXLA 5ITWA 4JVLA 3HGQA 3LIIA 1RXWA 4F5WA 2R8XA 2UXBB 3VTAA 1JKFA 3BJRA 5DBOA 5I9TA 4ZWNA 1JJ7A 4S2UA 3OUUA 5AKJA 2CBGA 2J0EA 2G1UA 1B73A 4XCXA 3K09C 4KITB 2NO6A 1S8OA 4MQEB 3RC8A 3OUTA 1ZNZA 3TD6A 3VO1A 3H11B 3KC2A 2CLHB 1W49A 2FWPA 4LYEA 2Y67A 3EQ8A 1RLTA 4DEVA 4I55A 5BUCA 3GUVA 3OEHD 4HQLA 5BYBA 4OI2A 3R74A 4R9NA 1ZD9A 4R5HA 2QP4A 4L28A 4DW8A 3ILHA 3JQ8A 3NPMA 3GUZA 4QJ3A 1E7MA 1QB7A 1JLMA 1SKYE 2HUNA 3FUTA 1L8AA 1HLPA 3KXPA 4XB6B 2DBZA 3C24A 3E4CA 4W8HA 1ZH6A 3GVCA 1XQ6A 3KR0A 4G56A 3UHJA 5EIXA 3TLCA 4CKBA 5TVGA 4G01B 4PFQA 4CMGA 3M3DA 3BGVA 2AC2A 3H9JA 3TZ6A 1NA5A 2BELA 4HTAA 3LECA 4RLSA 7ADHA 1UFOA 1U02A 1XXHB 2FEWB 2XGJA 1NX9A 1PWXA 1F3LA 2IDKA 1JWLA 1TJPB 3LQ1A 3B6MA 4G4JA 3LGXA 3CWCA 2IOFA 4FK8A 1A76A 4RE5A 2RGGA 1P3DA 3VZDA 2DHRA 4O4IF 2REOA 1MP0A 5IDXA 2WYIA 3PEFA 4L9AA 1SFRA 1Z26A 5ELLA 3HXOA 3H4MA 4JP1A 4LI0A 2MDTA 3GELA 1Z36A 3QTLA 5EN4A 1U04A 5EXSA 4Z0NA 3TAXA 1T3HA 2AZMA 3AHGA 4BQOA 3L7CA 1CBUA 1JA9A 1UJ5A 2ZIEA 3KX2A 3QLVC 3MLEA 4IMPA 3CB2A 3V2UA 2QAIA 3CH6A 3GQVA 1YS7A 2GBIA 3E9CA 3GVXA 3PRHA 1V2GA 4XUCA 4AY2A 5K45A 1Q2UA 2B4YA 4B43A 3JTMA 3OQVA 4J1QA 5CB4A 5LLTA 2QSZA 4IXWA 4HMPA 1W87A 1KZ4A 1G8AA 3LHDA 2ZRBA 4QU9A 3U4AA 1XTJA 1KK3A 1F1JA 5ITVA 1XTQA 4LC0A 2GNOA 2GESA 2O1XA 4M1OA 3RC1A 2X5KO 4HRXA 5ICSA 4GXTA 3ZD6A 4IM7A 3P45A 3OF3A 3P9ZA 2C7BA 3A6KA 3EE6A 5IMBA 5JS8A 5FWNA 1CSEE 1ATIA 1WM1A 3G0CA 3R20A 3RK4A 4IW3B 3X1YA 8ABPA 5LXTA 3CCCA 5PGMA 1Y8QA 3FOFC 1X87A 2PZFA 2A5YB 3JALB 2WWVD 3FDIA 3K05A 2AOVA 3BL6A 1GT91 3RS2A 4LE0A 1ZI9A 1N3LA 1M1YA 5KAPA 4AO7A 1G42A 4ENUA 3U81A 1M5RA 3WGZA 1L5FA 2ZDQA 3DEJA 3WKAA 3IRUA 1VP3A 4DDUA 3BWVA 3U1VA 2XB4A 5LUAA 4XSHA 3ZDEA 5FBLB 2I3ZA 2W6QA 2XYQA 3S3TA 2PANA 1VG1A 4TYYA 4IJQA 3THOA 3HKBB 5ADUS 3JQ7A 4KMSA 4P86A 2O57A 3HUEA 4I08A 2CXQA 3LG2A 4UDYX 2PLWA 4KPFC 1MGPA 5JSZA 2P8SA 4F86A 3EXEB 3KZXA 2JH8A 2RB5A 1DAIA 1E2LA 2QTAA 3UENA 1KQ3A 5HFNA 5ILGA 4E7OA 4UTNA 2RCYA 3HJRA 4R54A 1YZYA 4KFRA 4A8TA 4P0QB 4NCNA 2C3YA 1R5OA 3MPUA 1J0CA 1MO2A 1FYEA 3JYQA 5DTIA 5IAJA 1MABA 2E9SA 4PLPA 4G1CA 1XZPA 4Z4EA 2QYTA 4X1KB 1UKEA 2XDAA 3E35A 2QVZX 1NI4A 1SVSA 3KUCA 3NIGB 3RAEC 1H9AA 4JOBA 2UUPA 3A6EA 5GONB 5B58C 4PTYA 3UHAA 2JFZA 1VA4A 3P9YA 5FBRB 2BEVA 2FSUA 4IHJB 3OOYA 4IH1A 4G84A 4FYHA 3K71B 4EJSC 1FVOA 2FE4A 2VAVA 1QIDA 1I24A 5IAKA 1ZGZA 4WCDA 3I1IA 4OMCA 3R3VA 3L0ZA 1BFKA 2W6CX 4OFZA 4ER6A 5KNBH 2DFLA 5D6NA 1BD3A 1OLSA 2J3DA 1IULA 2P1ZA 3D3JA 3LNCA 1RXYA 2WUDA 3BMQA 3I62A 4YRDA 1RIFA 4GICA 2HDOA 5A7FA 1MF7A 1GSAA 1OYVA 2G5TA 4RHCA 3HCDA 2HW8A 4YONB 5B1IA 3I5UA 5IEBA 5C81A 2FEPA 5HQ3A 2FPUA 3ER6A 1N2IA 4X54A 2RGWA 4QWMA 4BLQA 5BQXA 1E92A 5BORA 3KZNA 2BI8A 3GF4A 5CUQA 4I6JA 3FI9A 4TYQA 2W4MA 4URHA 4O59O 5BW4A 4EG7A 2QYSA 3BKWA 4AVYA 2D4AA 3FMIA 4YALA 4DMHA 4EY5A 2I03A 3K4QA 2ZR0A 2WWHA 4HDQB 1RJGA 2FVXA 3LK7A 4L8GA 4U2KA 3VPHA 4YP5A 5F76A 4KNWA 1GV1A 2OAP1 4CQMA 4L02A 4N0DA 4C20A 4MW1A 1G4HA 2O0MA 1LCIA 4JR2A 1SCUB 5FNVB 3QXSA 4Q39A 1NULA 3RYIB 3QUSA 2VZ9A 4HFMA 3MWYW 4ZGBA 4O4HF 4BFWA 1V8FA 2JHPA 1KPGA 2ZTLA 4BZXA 5B30A 3F8TA 5C8ZA 5DM70 4O29A 3DDWA 1UINA 1ID1A 2OZVA 1IZYA 2PAAA 2W6MA 3I2KA 3RG8A 2PR2A 3UCFA 2NXEA 2Y1DA 3WYCA 1KL7A 1MG0A 1TX4B 2JK0A 4RORA 4E12A 1O6CA 1LDMA 2Q45A 3ZNPA 2IHUA 5EWMA 4Y2PA 1JJFA 1NYRA 2J59A 1KH2A 3V6LA 4RD6A 4OLJA 1FIUA 2PH3A 4A27A 4ETIA 1CC1S 4J7CA 4WZ6A 1X7YA 3BJIC 2XVMA 1M2HA 1GEEA 3PX3A 3T7RA 3K53A 1FFBA 1VBFA 2PGXA 3WWEA 1R4AA 1G9SA 4YDRA 5FBVB 3GCZA 3IKVA 1P0IA 2AS0A 1E2JA 4CM7A 1GLNA 4KR2A 4DM7A 1WMEA 2D4HA 1IJEA 1LDBA 4AQ7A 5JO9A 1VSUA 3VR3D 1SG0A 3LYHA 1U99A 1ZNYA 2ZREA 4BLUA 2C07A 1L3CA 3PWKA 4P08A 4EJSA 3M4ZA 1J8QA 1RAAA 2C84A 3PB3A 4FOLA 1CP3A 4GL4A 1WCIB 4JMPA 1PWEA 1RJ9B 4D5GA 2Z3WA 3C6XA 1XMXA 3MLAA 2GPTA 1UDAA 4JENA 1N6KA 3UMJA 1WHTA 3B3FA 4K9RA 2MTBA 1ENPA 1HDOA 1NR7A 4EMUA 1ZJ5A 1RQXA 1ZXXA 2JHCA 1K6IA 2YC4C 4NZPA 1E8MA 3E1GA 2GJKA 1KRXA 2PX5A 1WMAA 1EK2A 2GPWA 3CUSA 1NP6A 3L3BA 2XKAA 3EA0A 4GLFA 1M33A 4PSCA 3AB7A 3HB4X 3OZXA 2QTVA 3TZBA 4G0WA 5KNCD 1U98A 3THYB 1L4UA 2H18A 3E5MA 5B7GA 1J2TA 1LA2A 3N8DA 1GZ6A 1U3UA 1OFIA 4L0DA 1XLTA 3BA6A 3P9NA 5HW0A 1I2BA 3BQNB 5KU1A 4Q01A 1JLLA 3ADDA 3AFIA 1UBEA 2SICE 4DAEA 4OA5A 1C3XA 1AGRA 5DU2A 4UQLA 2CT8A 5CAEA 5GJWC 2O0KA 3V1MA 5KI6A 4TQ9A 3M6FA 1COZA 3KJXA 5JQGF 3MUOA 4Y6OA 2O3SA 3BAZA 3WGIA 2P5SA 1MW8X 1PT8A 2P78A 5ALWA 1P8AA 1QFXA 1P81A 2ZBGA 4PE5B 2W22A 4CODB 5JY1A 1J2RA 4L4XA 2PGAA 1AGYA 2J09A 3ZE8A 1QO7A 5L4LA 4P93A 3DC2A 3AVYA 2SCUB 4GKJB 3C6KA 4B4VA 5JPDA 2IGBA 5ERXA 5IAOA 4DUZB 4DL9A 3GFBA 4UCQA 4HUQB 3ZJ4A 3ZYCA 1YCFA 3UTCA 3EMKA 5C8YF 2FEKA 1HYGA 4WZZA 4OHCA 2B34A 5JDCC 3UT5B 2DUUA 2Q2VA 3LLCA 3QU5A 4LJYA 4GPAA 1P5RA 2HCTA 4R1LA 3UW1A 5IVKA 4AI6A 4QEZA 3S2GA 4JLMA 2B69A 4CMBA 1Y63A 1C3OB 2HHAA 1ZRSA 1YZTA 1Q84A 2OT3B 5AQEA 1KQPA 3DMNA 4ZOQI 3CTMA 3ADKA 1Z0ZA 4GD3Q 4PO1A 4C76A 4MDYA 4KVAA 1XN4A 4HEQA 2Q99A 1JBQA 2IVFA 1DLIA 1Z5WA 1Y80A 3AR2A 3GJRA 4UU8A 4LHEA 1GRVA 1X74A 3QWHA 2XCIA 1M6NA 3UWSA 4CKWA 1MJFA 3IXQA 3ZCRA 1CJBA 1XZ8A 3GRCA 3O9MA 4KMRA 3UMFA 2ZRMA 2QUHA 3LY5A 2P2DA 5EHNA 1XL1A 4AJLA 1KTIA 3PEVA 1RQ2A 2BKXA 3R4VA 3RV4A 2VTBA 5B7PA 3SI7A 3QKRA 2FQYA 4OHWA 3VJKA 4KREA 4DDWA 4FEAA 4NP6A 4J0KA 4NU8X 3VSBA 3Q5EA 4AWXA 1XZIA 2Q41A 1VC2A 3A1UA 1JZTA 3QH4A 4N48A 1SO8A 2GTPA 1AHNA 1E9FA 1O6ZA 2PUTA 2WYWA 2ZTHA 3OE5A 4MJXA 4ND6A 2FWNA 3FTEA 4KLNA 5C8VA 1DT5A 2DQYA 1Z4PX 1PWZA 2YXNA 2TMKA 5BN1A 4UBIA 1LX7A 1RRKA 3DBRA 2RH5A 3H6GA 5CHEA 1MV5A 2QNIA 3NVAA 3FAKA 4J43A 5FBWB 4KQFA 1IN5A 3JQFC 4AM8A 5J4YA 3I0ZA 2OCLA 1A9QA 3MJDA 4QM7A 1BH2A 1PD0A 5HCNA 3GVIA 1Z4KA 3F9CA 3MT8A 1ISIA 3NXSA 5JCJD 1AKEA 1JAZA 3OOEA 4R1NA 4UQOA 5GIPE 1GLVA 4LXYA 2DPXA 2J5KA 5JNWA 3ZWWA 3VU9B 5F2NA 4UVGA 1QGYA 3D2AA 3V8EA 3B85A 3E9MA 1FXUA 2VUTA 3PVCA 1E2PA 3RUHA 3ZEIA 2JPDA 3ZHUA 1SOWA 2O4UX 2VDQB 3DEFA 1ACMA 3GUCA 3IOBA 1UFVA 3F8WA 4HYQA 4F97A 5C8DA 1FNBA 5IKMA 3ND9A 3VJRA 4UARA 4DA7A 1JQAA 1SKAA 3MTBA 1WXFA 3QFCA 3ROFA 3IBTA 4M8IA 1VHLA 3M2TA 4MGHA 1NUUA 1U2RA 3MRXA 4IQGA 4TQGA 3VTZA 2QB5A 1FQOA 3A1WA 1VMAA 1PJQA 2IU4A 4YP6A 4EPXA 2I80A 3HDQA 5INTA 3GZNA 4P83A 3ISJA 4FFPA 3AEKB 5AKXA 4IQFA 1B7GO 2X1VA 3SJBA 4CM9A 3ZVLA 2QG9A 1JWBB 2C1ZA 3WSWA 4LOIA 4ZI7F 1QWOA 3VDRA 1A5BB 2GTHA 3QVGA 5CVUA 3ETNA 2D8MA 3EXIB 4LCJA 4LVUA 1GG9A 1ZD4A 3WMGA 1CZRA 2CNOA 3BWDD 2R8YA 3KZ1E 4IGFA 4MGYR 3GDOA 3OFSA 5E6SB 1VSTA 2JHFA 3SHFA 5GP1A 4YUVA 2QMQA 3KKZA 1S8FA 2HR1A 1ODLA 1TCUA 4D9GA 4LZOA 2BFFB 2ZBDA 1U31A 4HAYA 4X44A 4OP1A 4Y1RB 4G1UC 4OHZA 5IT9A 5C80A 4XTCS 5I7VA 1L3IA 1LJUA 2ZWOA 4I4NA 4RGVA 3FPSA 4DCMA 3BDIA 4QYSA 4Z2AA 1E3LA 1MB3A 1RAFA 2EBUA 4E4YA 1DDOA 2EZUA 4WY2A 1NW9B 2NZJA 3TINA 1LK7A 3Q6MA 4G4GA 4UHHA 4F56A 3B5EA 3HZRA 2VJPA 1YT5A 5HKKA 4B45A 2QR5A 1DC7A 1NBOA 4M83A 2W8ZA 4D9MA 2R1TB 3F46A 2XMRA 1NM5C 4CIAA 1QHGA 3M3PA 3W4IA 1SELA 2PBLA 4FINA 1D2CA 4YRRA 4L4YA 3CNEA 2XRYA 3UWDA 4C7VA 3AF5A 3QFFA 4FBLA 4HWGA 5HQJA 3WYFA 5K3AA 4XVRA 5LQNA 5J2UA 3G1WA 2PT6A 3RTGA 2FRDA 2RARA 1AKWA 3AEQA 1QQTA 5KTOA 2VQ6A 3ER8A 1SVNA 3EA5A 5H59A 1JTVA 2RBEA 4B9AA 5EOVA 3IUBA 1D1QA 3UJ7A 1NI3A 3G49A 2VPWA 2ZB8A 4EHBA 2VSNA 5BR7A 1UFQA 2A4KA 3DCNA 4PLYA 5H3CA 2PNJA 4EI9A 4O1IA 3RIMA 1DEOA 3IQEA 3SG0A 4U4AA 1Y34E 3S5UA 1EFCA 3DAFA 4U8GA 3F7TA 4QU8A 3R8XA 1QTQA 1B00A 1I14A 4R7ZA 3A9VA 5E6RA 2W2QA 4M9CA 3VPFA 4B8ZA 4ND1A 5IWCA 1MT0A 3ZDZB 2ST1A 2ZAYA 3O21A 5K51A 1HT3A 3EG5A 2EWWA 3P9SA 2Z95A 4PLTA 3VDMA 1MKYA 4AXBA 2OCAA 2ODEA 3UICA 1TGVA 1QZUA 2ZT6A 3WJ7A 3OUZA 5I9IA 2Y0EA 2R7MA 3WB0A 1Q0ZA 3TTVA 2LCIA 4GP9A 3LAWA 2XVXA 3SF8B 4EFKA 3U5TA 2AOWA 1D3AA 1TTHA 2Z2YA 3C70A 4OHUA 3TQFA 4B8YA 4KYVA 3DPIA 3EIQA 3LYUA 1ZITA 1IIBA 1N2OA 3LA6A 1TYDE 2J9GA 2PMKA 3DCJA 3EW7A 4HGOA 3P94A 5AVXA 2V0CA 1JFFB 1ENYA 1O4VA 3KHKA 4R9RA 1IXSB 1VOTA 1GQRA 2ZCVA 4LHZA 4NULA 3DBVO 3IBSA 4WGGA 2ZUTA 4GPD1 2O3RA 3Q0EA 3PR3A 5LZ5A 3OIFA 1E2UA 4H7KA 3G2QA 5EWLA 4R6WA 3SIWA 4GMKA 4MKIA 1V48A 5BN4B 3PGJA 4NVRA 3FGNA 1DV2A 5JRDS 1DNPA 3OCCA 1V3VA 1BIFA 1FVHA 2F1OA 4FN5A 4K9LA 3F2IA 1T8UA 3NHMA 4JYZA 2PV7A 3ORRA 4P3KA 2EWVA 1Z4NA 1KF0A 3UUWA 3OHSX 4FD2A 1Z6GA 3DAHA 1Q0LA 4GGOA 5CBKA 1ECJA 4Q3DA 2ZXUA 1QUEA 5D01A 5C1BA 4UM7A 5LDHA 4JBYA 3CX3A 3E4DA 4TZ6A 2Z83A 3CZRA 4YHBA 1QWSA 4M8SA 4ALNA 1UXHA 2ZITA 4D3XA 3BRCA 2BHLA 3ETLA 4O25A 5I01A 1XRNA 1WMBA 4R2HA 4R81A 3DUFB 1L3BA 2A57A 3IAM1 1VI5A 3DE6X 3T12A 5JNRA 5FUWA 3TM5A 5GMOA 1YH3A 4V0NA 1HDCA 4RYDA 4E4RA 3OZFA 3UO8B 5G0TA 2H0QA 2C58A 1MRNA 4EMBA 1DBRA 3CUEF 3Q7IA 3OM9A 4ZIRA 1KERA 4WXHA 1V4VA 1QHNA 1RZRD 4XVUA 1CR4A 2PG3A 2DVMA 4B75A 4GUDA 5FYQA 1N2CB 1KEUA 4LFAB 1X94A 5G4LA 1PJRA 2UYGA 1HLDA 1ZG3A 4MJLA 2CFTA 3DHVA 3LXMA 3LZ6A 2WF9A 1C9EA 3CLUD 4QOFA 1NONA 1ZISA 2Q1WA 4M9SA 4MV5A 1EEXB 2XBLA 1VG0B 3QKUA 1CYEA 1AHHA 5FL3A 3AU8A 1E64A 1Q16A 2VYFA 5JI3E 2FGKA 1Z29A 2JFWA 2XYRA 3JAKB 3PC8C 3W9UA 1G59A 3CR3C 4G0OA 2IA5A 1DJNA 2C2HA 2JVIA 4W5OA 5EMJA 5FFNA 1HL7A 2HPZA 3BFKA 4NHOA 3A6HA 4OXRA 4PAGA 1P7ZA 1RVDA 3CLVA 4GI5A 1EK0A 1OLXB 4YP7A 5EKUA 4EWLA 3D0KA 4KU4A 4KR9A 1H0SA 4LZLA 4XWKA 1YQ9A 3O74A 2V96A 5FTKA 4BX0A 5FA6A 2V97A 3S2IA 1YGPA 4CIWA 4C2TA 2LBPA 3B20A 4DLZA 3QVJA 4DBZA 3CUUA 4YIHA 3OE1A 2YS7A 2AZXA 3RTBA 1P19A 3B2EA 4LOHA 3W77A 1DMSA 3LM8A 2V74B 3ZIUA 4LJ5A 2RG1A 2VDRB 1OFVA 2FK7A 2XUPA 4F3NA 3ONNA 3IVCA 2RAVA 1XTBA 2WTNA 3MS7A 5HYVA 4O4JF 1CNFA 2GAFA 3F7NA 3MVEA 2NSLA 3GJ6A 3NOQA 3TYXA 4EW1A 4O4LA 1SUSA 1NN1A 2CLLB 5JAZA 1TTTA 4M1MA 1R0XA 4RQAA 3P2OA 4UTOA 3GARA 2Y99A 4OAPA 3T9FA 2PJUA 4E08A 2YHSA 4IIXA 3LQ4A 2PUEA 1E3DA 2YBEA 3DDCA 4TSFD 1CVRA 3K4HA 4EYQA 2ZR9A 1ZNQO 1JHZA 1DQNA 1BJKA 2NOAA 4ZDIA 5LIPA 3L9WA 2Y9MB 5LQMA 2DB3A 1NT4A 2JRLA 1FCJA 4DMGA 5DM2A 2INGX 3IDQA 5E2BA 1FSGA 3JASB 3RIGA 1DLJA 1XKXA 2BH2A 2DYKA 4N5HX 2ZJ1A 2DLNA 1AURA 3LYLA 4RTKA 5JZVA 2PX6A 2O8BB 1M6YA 1LLFA 1N5LA 2EGUA 1YVRA 2R97A 2VA9A 3L8FA 4NZYA 4ZOEA 3GMSA 4EPTA 2BI7A 5EFZA 3I04M 3UFXB 4CI9A 3B7PA 5L3QA 4GDFA 1YZLA 3CGGA 2J07A 3ILSA 2ZUVA 3KSDO 3O8OB 1J42A 3BXEA 4KC0A 2H9YA 2RC5A 2AE1A 2YH2A 3K96A 4NS4A 3SVLA 1EHCA 3TR0A 2PLNA 5HBGA 3P1JA 4R2LA 4EECA 1WHSA 1G7RA 3A2MA 3NGMA 1UPUA 3QELA 4HAXA 2PNFA 4WJKB 3HN2A 2CFCA 2XNCA 4D3ZA 1OFUX 3G1UA 3PF8A 4MI9A 2QG4A 3ZU2A 3LZCA 4P1ZA 3KPWA 2H51A 3DQZA 4PANA 3ZPXA 4AZ0A 1V26A 3LRXA 4O02B 1T8TA 3ZK7A 4RL6A 3CPEA 4ALMA 3AVTA 2PSDA 3A1VA 1B0UA 5JISA 1PTKA 1V11B 4R9SA 2YJZA 4YB8A 3ZNOA 4F72A 3FTDA 5D3ZA 3WWZA 1DBPA 1DI0A 2ACEA 1OI2A 3DXXA 4GI1A 4FW8A 1W19A 1BHSA 1ZXLA 2WG0A 3AERB 3JQBA 4UM9D 3TZQA 3HB0A 3X2FA 4H1UA 2JF0A 5JFTA 3WI7A 1GEGA 1A9ZA 1N9GA 1TVCA 1SC3A 1SC4A 1FNSA 4KLAA 3RU3A 2I54A 4LQ4A 3OJXA 5BNIA 1YS2X 1CUDA 2CB0A 2PFSA 2VNJA 4MOWA 3TIIA 1CJSA 2BHTA 2IYFA 5AOBA 1KO1A 1GHTA 2CW5A 4KQ9A 3TQCA 2PSSA 3UGQA 1IU9A 5G0SA 1HT0A 4ITRC 3KUKA 1C30A 1TYCA 3TVTA 1JLSA 1VMDA 4UATA 5HCUA 5CNJA 3V4OA 3UG7A 4AMGA 3TX2A 2VXBA 1TRKA 2R1UA 3AFMA 4KIUA 5ARCA 5KYWA 1HY3A 3UNXA 1VRCA 2QS9A 3EAQA 5CDHA 2JAPA 3RHFA 5KYNA 2IT1A 4IV5A 1H6CA 2P9JA 4NKRA 2VHVA 4AZSA 3F78A 5FLEX 4XCVA 3SWWA 1F8XA 2JKYA 3E2MA 5D3QA 2WB2A 3DFIA 2CLEB 3JZIA 2RGNA 5IANA 2I8CA 1LKZA 2RGYA 3RU9A 3MILA 1N77A 4D9IA 2ZJBA 4OJKA 2JGJA 4RA6A 2XUGA 2HAEA 4IF6A 2I3GA 5EVJA 1M5UA 5A9RA 1LV7A 3WLTA 1AMOA 3OLZA 1C9YA 1EVIA 2G25A 2OMEA 3OQBA 4F4IA 3OT1A 1KYWA 5F12A 5G3ZA 1KWKA 1EXDA 5DYGA 1ZD2P 2QHXA 1LNSA 3QHQA 4HGZA 3GAFA 2ZUEA 1LLUA 1CEEA 4M3NA 1G8HA 1E5DA 1X92A 4RMIA 3RAPR 3UY4A 1BG6A 2QJTA 1WS6A 2BM0A 5DV9A 3KETA 5F98A 1IHXA 2C61A 3IMEA 4RLQA 4H4EA 4HWTA 2IBSA 1YJAA 2CV2A 4RHEA 2QRVA 1FFDA 3I1YA 3EZLA 1CD5A 2VDPB 3I0MA 3LA8A 2Z98A 3R5KA 4ZV9A 4BC0A 3F6CA 3E3MA 2IELA 2CVPA 2Q5QA 3O4HA 5DK6A 1N7IA 2XT9A 1EXWA 3JXEA 4MWCA 2ZBRA 1EP1B 1UJ2A 3HMKA 4IBOA 4L0MA 3UXMA 4JJ7A 2GJSA 4MULA 1N5JA 3DMTA 3R7FA 1JSRA 2CGEA 5HF9A 1WKBA 1S9DA 5EVCA 3PLRA 1NVVQ 5AUOB 4OQMA 2CHEA 2IDZA 3ORSA 1XPJA 1UP4A 4JJAA 4MP6A 4BNDA 5KOHB 5ALUA 3ROEA 1I01A 1XTVA 4N6OA 4MRSA 3HWX1 3GZTB 3W9BA 3H7IA 3N2KB 4JLUA 4MEBA 4UNSA 3NHWA 4Z54A 1QBKC 3M6UA 2GFQA 1K6MA 4BATA 1KJZA 1YNOA 2HWXA 1UP7A 1OFTA 4HN9A 4XX0B 5GQSA 3RYTC 3GCXA 3X1KA 4EFLA 3THWA 4C7OA 1IY1A 5K5EA 3VKGA 1MHPA 1SHZA 4B6RA 1ISMA 1E2EA 4GRAA 3HM2A 5DHRA 3HCWA 1JA1A 2IBMA 1PZEA 4LQDA 1ZM7A 2EW8A 4QLOA 3CRMA 4BVFA 3P2JA 4WZAA 3R7DA 2GKOA 1I6KA 2HBZA 2HMYB 3I8XA 1UOQA 1NDQA 1UIRA 2GT1A 2JI8A 4KRGA 4P5EA 5T64A 3TKYA 4EUKA 1EDOA 3FBTA 5I45A 5K99A 1L9KA 5HFJA 1QKJA 3HJUA 5EUBA 3L6RA 4I8DA 2IE0A 1HNZB 1ZC3A 3PDCA 5A05A 4KPUA 4I9HA 3ZVRA 2YUTA 3MTIA 1XRSB 5I4IA 1QP0A 2XI4A 1CQIA 5CURA 4H31A 1QDEA 2RFLA 2WT8A 4JLKA 2CUTA 4WI1A 4XPIA 4CKEA 4YRZA 3VKHA 3TAHA 1X7DA 3WLLA 4Q93A 2C4TA 2HSDA 1TVKA 1Y0BA 3SX0A 1P2TA 1UXKA 3LC1O 3PSAA 3ZDBA 4JLSA 1KIAA 3NETA 2XMZA 1OX6A 2PYZA 3HSYA 3PNYA 2IUFA 2GK7A 1V43A 3I9OA 3GDWA 4KXFB 3N2YA 1VI6A 4WLFA 3ZKWB 4E5PA 5AVSA 2X0IA 1ORWA 2PUDA 1F7UA 2XHZA 3ZX5A 3PX7A 2JEOA 4CTKA 4IG4A 1TQ6A 3VPAA 3G5AA 4HTFA 1GPBA 4OQLA 1AA9A 2WA1A 4EG6A 4FGUA 3OFND 4MGEA 2YWEA 3KJFA 4HNQA 4J75A 5IG2A 3SZOA 1ARZA 1UZMA 1L7RA 4KRFA 3ZGNA 1CY2A 1CF4A 4PINA 1RBQA 3IR5A 1DO0A 5TT1A 3H65A 3NEAA 4M0KA 4MQBA 1CYDA 4MRVA 1JDZA 4DDHA 1TECE 1YI0A 3K0FA 1VQ1A 3L7KA 4MR8B 5GWXA 4J0GA 1YS4A 1FXSA 3HNRA 4TWZA 4TLEA 1XN1A 1M0TA 1EUDB 3LWBA 1JJAA 1HM5A 4KVZA 1JH9A 1MJHA 1C8VB 2I6XA 5KYKA 4OP3A 2B8JA 3Q3JB 4FILA 4US0R 5CW1A 5D51S 3S8MA 4CLOA 3K1TA 2C7VA 4NBNA 1P2UA 3W2HA 5BXQC 3ER9A 2JLZA 3KVVA 1DCMA 5AM0A 4KQWA 4AW9A 2RB4A 5BVHA 3HP7A 5FADA 3CNQS 5MFZA 3IE2A 3OAAD 3WZ2A 4UHBA 2BGNA 4Q9AA 1JX6A 4YAOA 1LPOA 3NHJA 5F64A 4CLDA 5HXAA 2R0QC 4R01A 4UMEA 2MYTA 3GZ4A 3ZTTA 5JQGB 2AG0A 4AF6A 1DELA 1EM6A 1TE2A 2RH9B 5EHIA 4ZI7A 5EUCA 1R18A 3EZ7A 4IDDA 4B40A 1ESCA 2NUTA 4IJKA 3ZKAA 1SXIA 3S7ZA 4BFUA 3ZY6A 1Z08A 2HT1A 2I91A 2JIZA 2XB8A 3H0KA 4JI3B 3F6BX 4P3XA 1VBNA 4P53A 4BTLA 3Q2IA 4J16A 3LF1A 1R7RA 1QQ7A 2G0TA 2I71A 2YY5A 3N7TA 4KMMA 4TL6A 5CT6A 1VCOA 4OREX 3VOBA 4CHTA 5A3JA 5HNKA 2PUBA 1GD1O 2EZ9A 5E7MA 4GECA 3HN6A 3T5DA 2JGLA 2CZGA 4LWOA 3GPCA 4JXXA 1P1IA 3QHAA 5ESWA 1KFBB 4IPTA 2GDJA 1BXGB 5CD9A 3THXA 1DKPA 4K8RB 2II6A 3DFKA 4QDUA 1LZLA 4KYIB 4I2NA 3TZCA 3CE6A 4EGQA 1ZH4A 2X0KA 3HCCA 5FAXA 2COEA 2G5PA 5HA5A 2I67A 2QTTA 4GAEA 2P6RA 2BZSA 2FG7C 2ABWA 4BECA 4KDFA 3MW8A 4P4LA 3E9ZA 4BGDA 1VMIA 2O50A 1TZBA 3TOCA 3T54A 4P9NA 1SXJB 1YHNA 1NWCA 3R41A 4QATA 3DWEX 4NE9A 4YNBA 2QKYA 2PU5A 4G9BA 1JAIA 2FN3A 4K9NA 4YCJA 5T4FA 5JSFA 1JNXX 5IAGA 4D4JA 1PBTA 2I6TA 4Y2GA 3TW8B 4BUJA 1OI4A 4WXYB 5JC1A 1XYVA 4KJZA 2CXRA 1E32A 3FWNA 5L40A 3PG5A 4LHWA 3DJFA 1E6WA 1QZZA 3MIZA 4PM4A 4CLRA 3GQBA 4GVXA 4DZTA 2QPLA 4EHJA 3DZHA 3ZCQA 1F38A 4Q4DA 2V59A 1TO2E 3AO0B 3SDSA 221PA 3HL0A 3ZZUA 5E3HA 2UZIR 4PS1A 4LZNA 4LYGA 3FXAA 4LAFA 4LYAA 4KXXA 4N9QA 1ZR4A 2HV9A 4UBOA 4CV0A 4G8BA 3N8KA 2FTKE 4PGFA 4FBMA 4E5SA 3H4VA 1RPAA 4LEIA 3SC6A 3INRA 2UZ1B 4HRAA 1ZH2A 1W5SA 4Q7QA 1WNTA 4Q6BA 3RBZA 3RVJA 3GLQA 4FGJA 4AYTA 3WGYA 4DV2B 1HDGO 1E6CA 3GCGA 4ZT5A 2OD7A 4GRDA 4E30A 2P9EA 4UHKA 5L3RA 3RUFA 4PCUA 5G53C 4X66B 1RZUA 121PA 4WJZA 1EWYA 1PBNA 1KVTA 3F90A 2RGNC 4A91A 4AP9A 1O5TA 4MSUA 2IYWA 4GXRA 2UYHA 1OA0A 4WNAB 2XDQA 3O75A 4RIGA 2MCFA 3ROGA 5CJ2A 4QFCA 1ZLXA 4Q3AA 1H8HA 3HCFA 4LKOA 3QKWA 3EXHA 1FFXA 1WSBA 3E1KA 4I2VA 4N7BA 3UANA 2XOKD 3FPJA 2DR2A 2IIPA 1GZVA 1P1HA 1VMEA 2HLHA 3GLSA 2PMCA 3RABA 4C78A 1E7SA 1R0SA 2H06A 1XEWX 2R4QA 4H77A 4TTTS 4DMFA 5LLSA 2WHRA 3PQ3A 1UMBA 2R9VA 4JJIA 4PLCA 1FFCA 3UBTA 4CG1A 3M5DA 2HA2A 4A2PA 1T2CA 1KDYA 5JI2E 2OAQ1 2FPGA 2HSEA 3Q9LA 2EV9A 1DIAA 4CMHA 3PDWA 1QG2A 1ZJYA 5IDQA 2UAGA 3RIHA 3WV5A 2GZMA 1U5AA 3SHWA 2Z30A 4CG0A 3BCHA 4FMCB 1Y5RA 3PDJA 2CLOB 3WSTA 1LPMA 2VJOA 2QF7A 1NF3A 3PJDA 2ZATA 3VZBA 2HSZA 4QIHA 2CMKA 2J7KA 1COWD 3UB2A 2X7XA 3FZEA 2I2FA 3C4JA 1MC5A 1LQT<