1JPVA

Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with so4
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
235
structure length
235
Chain Sequence
NPVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGFLVYTGKYNGETVSIATHGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSDNLAKGGIWITKEELEKSVMDGAKAVLDTLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5'-deoxy-5'-methylthioadenosine phosphorylase
publication title Three-dimensional structure of a hyperthermophilic 5'-deoxy-5'-methylthioadenosine phosphorylase from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 78
structure length 235
sequence length 235
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2001-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jpvA00
1TCUA 3TL6A 1TD1A 4P54A 1PR0A 1OV6A 1V3QE 2HN9A 3O6VA 3GGSA 1XE3A 3ONVA 1PR2A 1T8YA 4YJKA 1Z34A 4QAQA 3F8WA 3OZEA 4DABA 1SQ6A 4NS1A 1OU4A 1PF7E 1K3FA 4LKRA 4DA8A 3ENZA 4DARA 1OTYA 5DK6A 4OGKA 4M3NA 3PHBE 2OECA 1A9PA 2QDKA 1Y1QA 3FAZA 1YQQA 1FXUA 3EUFA 4E1VA 4WKPA 1ECPA 3GB9A 3KVYA 1V48A 1Z35A 5B7GA 3FUCA 4YO8A 1Y1TA 4YMLA 4IP0A 4DAEA 1NC1A 1Z33A 4KN5A 4D8VA 1VMKA 4PR3A 4L0MA 3BJEA 3DDOA 3OZCA 4QFBA 1JDUA 1Z5OA 1RCTE 1Z5NA 5EFOA 1V41E 4TYMA 4QEZA 1VHWA 5CYGA 1Y6QA 1QE5A 5ETJA 4F3KA 1N3IA 5FAKA 1RYZA 3KU4A 3SCZA 1SD2A 4D9HA 1YRYE 2OC4A 4F2PA 3KVVA 1OUMA 2PGAA 3IOMA 4G41A 1ODKA 1T8WA 3OCCA 2P4SA 1V4NA 1G2OA 4BMZA 4TXNA 4EARA 4RJ2A 4L5CA 4TS9A 4R2XA 4TXLA 4G8JA 2I4TA 4QATA 3PNSA 3UT6A 3UAXA 3DF9A 5F7ZA 1OTXA 4FFSA 5F77A 3FOWA 4F1WA 4NSNA 1PR6A 4L6IA 3LBAA 3BGSA 1VFNA 2QPLA 3C74A 4GLFA 4NY1A 3PHCA 4UC0A 1Q1GA 5K1ZA 1Z37A 4D8YA 4L5YA 3BL6A 4QARA 4OJTA 4R31A 5JPCA 4PNPA 4TTJA 1C3XA 3QPBA 4GKAA 1ZL2A 3D1VA 4U2KA 3NBQA 3DJFA 1U1GA 1YQUA 3K8OE 1PK9A 2BSXA 4F2WA 3UAYA 5CCEA 3KVRA 5F73A 1CB0A 1RR6A 4LNAA 5IFKA 2Q7OE 1LX7A 3EMVA 3K8QA 4JWTA 4M7WA 1JDZA 1B8NA 2HRDA 2OXFA 1PR1A 3P0FA 4DANA 4LNHA 1ODLA 1YR3A 4M1EA 4BN0A 4OGLA 4OEHA 3E0QA 4I2VA 3IEXA 2AC7A 2A8YA 1U1FA 5IU6A 2AI2A 5C80A 1SJ9A 3E9RA 4F3CA 1RSZA 1K27A 1PW7A 5CXQA 1U1CA 4MCIA 2AI3A 1T8SA 4LZWA 2RJ3A 1RFGE 1YBFA 1Z39A 3DP9A 1M73E 4TXJA 2I8AA 2H8GA 4GLJA 4GMHA 3OPVA 2HWUA 5KB3A 1LVUA 3LA8A 5F7XA 4WKBA 4DA7A 1PR5A 3EEIA 3FWPA 4L5AA 3O4VA 3OZBA 4TTIA 3E9ZA 4OY3A 4DA0A 3KHSA 3PNPA 1RXUA 1LV8A 1JE1A 4D98A 4QASA 4BMXA 4MCHA 1PR4A 1U1EA 4DA6A 3MMSA 1Y1RA 1VHJA 1CG6A 2QTTA 4ECEA 4EB8A 5I3CA 1RT9A 1ODIA 4TXHA 4YNBA 1TGYA 1U1DA 3EUEA 1JP7A 5B7PA 1JE0A 1SD1A 1NW4A 2OC9A 3DPSA 1T8RA 1JDTA 4WKNA 1ULBA 3OZDA 1K9SA 1RXYA 4TTAA 1B8OA 2QSUA 5F7OA 2GUWA 1ODJA 4WKOA 1A9TA 4DAOA 4D8XA 1A9QA 4JP5A 1A69A 2AI1A 4R2WA 1V45E 2IQ5A 3P0EA 1Y1SA 3T94A 1I80A 4G89A 4OF4A 2B94A 1PK7A 1RXCA 3NM4A 2A0XA 1TGVA 3OOHA 1Y6RA 1JPVA 1JDVA 1JYSA 5EPUA 1NC3A 3UAVA 1PBNA 3ODGA 1A9SA 3NM5A 3NM6B 3BSFA 3UAWA 1JDSA 3MB8A 4TXMA 4TS3A 1PWYE 1ZOSA 5F7JA 1V2HE 3OF3A 5CYFA 4LDNA 5CXSA 5B7NA 1Z5PA 4K6OA 4X24A 3FB1A 2A0WA 1PKEA 4MARA 2A0YA 1RXSA 1WTAA 3OOEA 3FNQA 1A9RA 3INYA 1T0UA 2HSWA 4H1TA 2QTGA 1Z38A 3KUKA 4JOSA 5CCDA 3UAZA 3LGSA 2ON6A 4BMYA 2XRFA 1OVGA 5F78A 4WKCA 1ULAA 5B7QA 1A9OA 1Z36A 1TCVA 5F76A 5EUBA 2ISCA 3U40A
chains in the Genus database with same CATH superfamily
4XSHA 1RCUA 1U8XX 3ABSB 1JIIA 1UFVA 3O0TA 1G66A 2CDAA 2DR2A 1V3QE 2ID4A 4PXSA 4RGBA 5FBLB 5K3SA 4DC9A 3FNBA 4MWOA 3W6UA 1NUSA 5ELLA 4B31A 1XZCA 1LBEA 1UKCA 3K9BA 4X00A 2FLKA 5DW0A 2DM6A 1F7VA 5JAPA 3F8WA 2BEUA 3DBHB 1GU0A 5ALHA 4HNHA 3DMHA 3IIKA 2V7PA 3I6YA 2NXWA 3QE3A 2BKUA 2WICA 3RVKA 1HMPA 3QQ5A 1SCUA 1MU0A 2CVPA 4IILA 4CMHA 3CBQA 4M99A 4WAUA 1QZZA 1V11A 3CW8X 1KQPA 3L7JA 5GINE 1J0BA 2YYSA 2CV0A 2LCIA 1IBSA 3CJRA 1R00A 1YR2A 2ERYA 2WD7A 3HUTA 4LECA 1ZCJA 1YQ9A 4Q3DA 1J56A 5AVJA 5DYIA 5TQ2A 4EYSA 4LFCB 2VNSA 3D5EA 1GGVA 1NAHA 1ODTC 3EFOA 4N7MA 1M54A 4BTVA 1L8LA 4JR2A 4ETMA 1RHQA 2AZMA 4QDKA 5JFGA 2PLWA 4PC3A 1CW2B 1P72A 1P8JA 1N8SA 1DKPA 1G38A 2PMBA 2IYOA 3UMBA 1XKQA 1ZC4A 4JY7A 1SOMA 3DNFA 3PPVA 1N2JA 3K05A 5JJLA 4I1OA 3VZRA 5KDDA 4BO0A 1IZ7A 1N57A 4TN1A 4XCXA 4YMUA 4Z4HA 2C4KA 1V43A 1Y5RA 4BWVA 3ORHA 1GLVA 1NXPA 2GBGA 3DBHA 1RJWA 2YVLA 3BFJA 1TJNA 1NSYA 5H80A 1K0FA 4G5FA 1UZMA 1IOLA 1T15A 1YZNA 4MVJH 2OSVA 1ZI6A 2WQZA 2C99A 3ZE7A 4M8KA 3NHYA 3EJ6A 2F3QA 3H86A 1EQAA 3W6PA 3ZV5A 1W8DA 4C0XA 1J49A 1VLLA 4UTRA 3R5KA 2Q0HA 4EY7A 5F4BA 5FBRB 2GZ1A 4FBLA 4XQEA 3CUVA 5FORA 2YJGA 1XEWY 3GELA 2CJYA 3RAEC 2JZNA 4KN5A 1G21E 4ZAZA 4LYDA 2X5JO 2Y76A 2H1VA 4FBGA 4FE4A 5A5DA 2P3LA 1W46A 3LUCA 2YWBA 3M6LA 3I4CA 3BEOA 4R16A 5I9SA 1AHHA 2BGTA 4ZYWA 1P0PA 4GX1A 1E79A 1SUPA 4M8SA 4F9EA 3OZGA 2B5VA 2IK8A 4PIPA 5EMNA 3QYAA 3VZQA 4LZPA 2EYUA 1F0NA 2CDBA 2J3HA 1EA5A 4L3OA 1MB2A 2WVHA 3LDHA 5IS2A 5LN1A 2VA8A 4FOPA 4NZYA 1HSOA 2DQKA 3QUQA 3QE0A 3AW9A 4QQFA 3TXAA 2J9ZB 4CMKA 3JRNA 1A5TA 3HYLA 4JVLA 3GJXC 3OKCA 4OU5A 2FSVC 1HT3A 2HPAA 1P7WA 1O8CA 1RWXA 2FP4B 2IXDA 2QUZA 3AG6A 3MJTA 3TMKA 2ZRBA 4YCLA 4NFLA 2N46A 5CM2Z 3MGAA 1U2ZA 1ZWKA 3C6YA 4RBNA 1JG3A 1Y7HA 5AHXA 4C6TB 5AFSA 3ZGZA 3UO8B 2MSNA 3C3DA 1G20B 2OO5A 3GLKA 1MVLA 1RWWA 2HQOA 4JKYA 3ZQUA 3K9LA 3Q3GE 4YMVA 1ZBQA 1NNUA 4HH1A 2VFAA 2O48X 4I8DA 1EBUA 4FE7A 4HUJA 3JATB 4Q7KA 2OXTA 3SR3A 1L5VA 3F2IA 4RNDB 3WO0A 1ULSA 1EAMA 3KOWA 1DOZA 4CCAA 5FLXA 3DB1A 1JVBA 4HPJB 3W4IA 3OQOA 2RD2A 3L82B 1XA3A 4IINA 5I7HA 2YQ5A 4A23A 3ITEA 2GNOA 3KB2A 1U8YA 1P19A 3FSGA 3GI1A 2CXXA 3JQCA 1Q3KA 2OBMA 3AP3A 1XMOB 3VKHA 1KKUA 5EY5B 4RD6A 3PZBA 3BULA 4L5CA 3G88A 3R6LA 5CVJA 3FIJA 1O8BA 2AKYA 2C2ZA 5M04A 2AC4A 4KMMA 2ZWVA 1Y9EA 1WVMA 3AR4A 4OYYA 1H3FA 3ASYA 3SHVA 2IV7A 3AEZA 3INGA 1SG6A 2WJJA 1XRNA 3D6NB 4HDQB 1U0FA 4ZAYA 3TTWA 4C6TA 1JEEA 4B1FA 2XDQB 4TV9F 4YAIA 3DBLB 3WADA 3ESDA 1AUPA 2VUTA 1G20A 2WU1A 2ZQZA 4IJ5A 3UA4A 3RVMA 1W0KD 1NE7A 1J21A 1WXDA 1CLEA 4B6SA 1Z0AA 1TVEA 2P2SA 3OU6A 2RB4A 3JATA 1X74A 3QIAA 1V3UA 4GW3A 1AXEA 3N7UA 4HO1X 4JNCA 2FFBA 1Z0FA 1FFBA 3RYIB 5A5VA 2LV8A 2PWPA 4X7BA 4YQEA 2Z2YA 4WK2B 4DF3A 2C9BA 1Z37A 4D8YA 2CKMA 1VKZA 4FCTA 2AMLA 4M1WA 4ZJZA 3TNYA 1RP7A 2PEZA 4ZARA 3RJ9A 2Z5VA 1L4EA 1UJ4A 3R7WA 3AVQA 3MGBA 4UARA 1VRVA 2QU8A 2WTEA 5FAXA 4HFMA 2P9YA 4LJAA 2QUKA 3CLTC 5E2AA 1L1EA 4GNRA 2GBLA 2WQ6A 1A0OA 3COVA 3NIFB 1EK1A 5DE3A 1G5FA 3GRAA 4G5QA 1TUBB 1XZJA 5DNDA 1LRKA 4IX1A 1QTQA 2WV7A 1RLJA 4CDGA 2IV2X 4ZEVA 6CHYA 1QPZA 4JP2A 1L4LA 2D06A 1VMAA 1YQUA 2IHUA 3O83A 1KDOA 2A1TR 4FZ5A 5AJYA 1W1UA 2C83A 2BSXA 2XDQA 3DBLA 4IQ8A 2B35A 5FBQB 5T5QA 3SC3A 1MOSA 3MJVA 2BAGA 4NENB 2AKEA 2HZ7A 2AF3C 3LT0A 3P2KA 4NV0A 5LLSA 4A1FA 5JXJA 2FSSA 3PCXA 4X61A 5FWYB 1M66A 3IAM1 3A6PC 2Y27A 3LQ1A 1UOQA 4TQGA 1ICIA 3T6KA 3CU5A 4LBYA 1LI7A 1HDEA 3E1SA 4BQNA 5J47A 1S3SA 2H1CA 3TQRA 4TZTA 4ES6A 4PGAA 2Q7OE 4EYEA 1BVUA 3A6FA 4E2WA 4E94A 5JQGB 2OOSA 1R16A 2H08A 4RSGA 5A71A 4BBJA 5IABA 1UK8A 5FPKA 4I5GA 3PFHA 2RAUA 2QT1A 1OI3A 3LWDA 1GKIA 1FLDA 4BXOB 3MWJA 4M1EA 4URFA 1Z6GA 4JLBA 1KY2A 4HTAA 2OGSA 3RTDA 2KM1A 3TSZA 1W4BA 4LJ7A 1TUBA 3M1LA 2H11A 4FEEA 3U6BA 2A8YA 4Q0MA 4B6PA 1EHIA 4X54A 1N2GA 1XFAA 1OX4B 5IMBA 2IE8A 4KNVA 3WB2A 2OSBA 3BAZA 4TMZA 1C4KA 1M8GA 2EKPA 1YL7A 2G9QA 5DXFA 1T2AA 4NENA 2P0EA 5G3ZA 3IMCA 3CZRA 5ECYA 3U31A 5DLDA 2VPYA 4KLZA 2XCOA 3WGMA 5FWYA 2P79A 4AKHA 5AUOB 1W36D 1YU9A 3GCGA 2B0JA 4BEVA 3W9YA 4S1PA 2GF0A 1GQSA 4NV3A 4G81A 1DUSA 2QTWB 4KRXA 5GJVC 1NKVA 4KFUA 2JJYA 4LSZA 3EULA 1WETA 3IPRA 2ILVA 4JGBA 3GUHA 3KQYA 4BQRA 2OEPA 5I7WA 3C7DB 3DP9A 1GPNA 2F17A 1V9SA 4AULA 4YBZA 1UDXA 2NXNA 2XYHA 3FNFA 3FVTA 3HBAA 1OC2A 4M60A 4XDGA 5ARCA 1GJRA 2DUMA 3D4LA 3R3VA 2LD4A 4GE3A 5G1NA 1CE8A 1DRWA 1F4VA 4U7GA 1YZQA 4YP1A 1SBCA 5AI8A 5LUAA 1E9BA 3UTDA 1DMRA 3SE0A 3GK3A 1OX4A 3GDGA 4J2TA 4X3OA 5EVCA 3T4PA 3TE6A 1D2CA 3G89A 2EGGA 1E2UA 1YDGA 1VSUA 1KVTA 2YMPA 3EA5A 4UNQA 4M46A 4PHHA 3QUTA 2CB9A 3OIDA 2R6JA 2DEUA 4Q7JB 2V5UA 2PGNA 5BR4A 1NXTA 1J2YA 1JIUA 2AW3A 4IGKA 2C04A 2JJ2D 4ZZ2A 2VJLA 3T5GA 5HK9A 5IG2A 3AWIA 4DB2A 1QKJA 5CFZA 4QOIA 2WU3A 5C7IO 3PXDA 1USVA 1TKCA 3A9RA 4YK7A 3WSTA 3N70A 3N76A 4BHTA 5AM1A 5DHPA 1GPBA 1KBQA 3GAFA 4BNVA 2PVCA 1NDHA 3O90A 1RYYA 2QVZX 3L7BA 4TLAA 4PZLA 2I22A 1J1IA 1GR1A 2IE0A 2K7ZA 1ZCFA 2NIPA 1ZMOA 3IAHA 3LRTA 3PKIA 1Y7IA 2KBEA 2YFKA 3JQAD 3MT7A 4GYWA 5CTAA 2Q5EA 3H9CA 1H6CA 2RJNA 4RH1A 4EI8A 2UUCB 3SMQA 3SIPA 4FC6A 3RGWS 1CUCA 2A3NA 2C7OA 3VNUA 1EP2B 4C87A 3TN7A 2OG1A 5PGMA 1RAHA 4Z53A 3VNSA 4DA6A 2JGDB 2IZ0A 1H85A 2QTTA 3MBKA 4TTSA 4ZHQB 1GFSA 1NN3A 4IZOA 2X8BA 4D9CA 5LKRA 2ZRAA 1DFGA 3PC4A 2ZWMA 4W5TA 3ILHA 1THTA 3H8WA 4S35A 3JVDA 3CRVA 4LZOA 1LBQA 1TNDA 1WCYA 2W8ZA 3U3DA 3EASA 4OQEA 1AK9A 4E30A 1TGYA 2UUBB 4IEIA 1C0IA 4G0WA 3O84A 4L4ZA 3P9YA 4ODIA 2CK3A 1RJDA 5CK4A 1F0KA 4DXAA 3MZ0A 1ORVA 1LSOA 3AKEA 3K32A 3AVYA 2VZEA 3T5BA 2O07A 4PR0A 2HEGA 2PUVA 2M6SA 1XZBA 1FDRA 1WB5A 2JFWA 2X1VA 1C9NA 3C4VA 3R40A 4IIYA 4KO3S 4L1KA 1YD7A 1LKZA 4EDFA 2JVIA 1T8RA 1J42A 1P2UA 4BFXA 4ZAVA 5EOVA 2OK8A 1HZZC 1KPGA 3L7YA 5BWOA 1I7SB 1QQAA 3NVKI 1WCXA 2YOHA 3A6GA 3DH0A 1AKNA 4EGQA 2G5PA 2JGDA 3OZDA 4YCCA 2YVAA 1T9KA 4QDXA 1QH1A 1K9SA 3UVEA 5A5FA 1VE6A 2PA0A 3IKVA 2FY8A 2GDZA 1MCZA 2QLFA 3TTYA 4OQ4A 1S7GA 3A14A 4MR7B 5HF9A 4KYIB 1L4MA 4OU4A 2XLCA 5EIAA 5J59A 4GO1A 2E85A 5F7OA 2IXBA 2BEWB 5AKXA 4RD3A 4F45A 4I6EA 3LPLA 4H7JA 4B46A 5DU2A 1YVRA 2DGDA 2HMUA 1XAIA 4WX2B 3TPZA 5BNTA 2QN8A 2ZAMA 3TOZA 3SLKA 3ZZ1A 5DNYB 4FQ7A 3ZVLA 3L8CA 4IYJA 4QYSA 3HCNA 4LN1A 4RETA 3NC4A 1RMYA 3HXMA 2BM1A 2I7VA 1KC1A 2AI1A 2OCYC 2ZSBA 3JD4A 2VHEA 5B3JA 1Z22A 2BOVA 2H5LA 1GFIA 3FAKA 3GJZA 3O92A 3T34A 3J80A 1JWBB 3T94A 1MLDA 3KALA 2FZLA 5C7YA 5EIBD 3NNNA 1CCWA 2V6MA 5KTKA 2EF0A 1EP9A 1A7KA 4IIEA 2FW6A 3LKVA 3GU3A 2A0XA 4G1UC 4P3XA 4MYRA 4RD4A 1KOGA 4MR7A 1QBKC 2R6CA 3C15C 3EXHB 5K0NA 3RKSA 4B3JA 5BMVB 2RKBA 5AKGA 4GP7A 5D00A 1AKWA 4HGPA 3DBIA 4B3BA 3E82A 4F4IA 3ODGA 1SXPA 1XDUA 1MC4A 1NR1A 2PZMA 1DV1A 1LBSA 3K70D 1P7VA 9MHTA 3JR3A 3PXUA 1KSGA 1GRQA 3TGLA 1G3IA 2IITA 1YR8A 3NBXX 2GJSA 4HBZA 3VU1A 3ZH9B 4JMLA 1TVMA 2DMRA 1QU2A 1FP4A 4UNPA 5ITZB 1ND5A 1LWOA 3R7DA 1ZWLA 1IEVA 2QRMA 1OI2A 2B8JA 3GCXA 1KHHA 3HS3A 4BZZA 4D4KA 1WZIA 1WS6A 4QXRA 3EZFA 2BKLA 1Z5PA 5KSYA 4C0AC 1ECGA 1W8IA 5KC9A 2FNAA 1CVRA 2WM2A 2JCGA 3VR6A 5IH7A 1ZK2A 1PLKA 5H3CA 4Z4GA 3R7AA 3ZD8A 2NM0A 2WNHA 3KZMA 1GNLA 4NMHA 2ERCA 5CXUA 3QLVC 1PR3A 3CLUC 5IT9A 4YP6A 4DR1B 3S99A 2Q62A 2A9JA 2V9CA 3EXHA 1OZGA 4WLFA 5BMVA 1S9HA 2PMFA 4AG5A 1YQDA 3NATA 1HQCA 1VGVA 4C1NA 1I4OA 5AJUA 2JLZA 2QRLA 2AN1A 2W6JD 3GVXA 3JCZA 3OJLA 3OZVA 4U6NA 4A03A 1DJPA 1KVRA 5IWAB 1MJ5A 2G8NA 1T8TA 1JSXA 5NLLA 2C8JA 4EUHA 2RGGA 5DEOA 5TT1A 2AZ4A 1FS4A 1OVGA 4JVSB 5ITZA 1CZOA 3JD1A 3BGDA 1DE0A 2YY5A 2X0RA 4XOIA 1N0UA 1ZH6A 4Z2AA 3OPXA 3DZFA 2JZOA 4IGFA 2OFFA 2AFIB 2D5BA 2FN8A 2QS9A 2W4IA 2ZJ1A 5L45A 2FMTA 2YVUA 2QTAA 5FOXA 5E6SB 1QYDA 4H7IA 1G3MA 1IOVA 2XCSB 4RF4A 4B81A 2B36A 2B4KA 2D00A 1MH1A 4CFZA 3SWWA 5B6PA 3H84A 4WHMA 4B9AA 1KXJA 4JYMA 1N2IA 4YALA 2B83A 3GO4A 3ZLTA 1SKYB 2R44A 1PNOA 1FFSA 4INOA 4MTCA 4B3FX 4F7WA 3LA6A 4KIUA 5DSZA 3G2JA 2J0VA 3GGSA 3WDMA 4AROA 1GTJ1 1RD4A 3AR8A 3LPAA 5GPBA 3KSAC 5KNDD 2R7MA 1DS6A 1ZRNA 3QVSA 4RAOA 2QUBA 4FMBB 3ZQ6A 4MRNA 1N8TA 1VB5A 3U5ZB 2V0NA 3S8YA 1M5TA 1Z62A 2OAP1 3KTFA 4P33A 1ZU5A 3TBFA 1Z15A 4HXEB 3EQ9A 4J1NA 4IIFA 2OXRA 2VQSA 4OIFA 3GDWA 5K03A 3AI2A 3AJDA 4AMYA 4DPKA 5ITSA 2AFIA 2GD6A 5DK6A 6YASA 4AQDA 4MQEB 4H59A 1AHPA 4TMFA 5E6SA 1EVIA 1OQAA 3ONWA 1SO8A 9GPBA 4ND1A 4PFQA 4B3HA 1XCPA 4HR7A 2Q6TA 2VUIB 3KEOA 4QRHA 3HE3A 4UW9A 4RKEA 5FI3A 3A27A 4MQLA 1AV6A 1TLTA 4PIMA 2VYVA 5DXAA 2Z4SA 3CW9A 3RVBA 2Q2WA 4IFIA 3K0EA 5EE0A 5F3RA 1ZC3A 5CLQA 1KZHA 5JIBA 1JECA 1ZL0A 2PZEA 1XV5A 3UWSA 3VU0A 4ZN6A 2ZUEA 5KJ6A 2CD7A 1UANA 3RTAA 3ZHVA 2Z3WA 4TZKA 5K8CA 2HLPA 3G59A 2BR3A 1WW3A 2A0KA 3EZNA 3IIJA 5JTUA 4IW3B 4COOA 2IU6A 4FU0A 4ZHSA 4QU8A 3D64A 2OVFA 1TVKA 2XHEA 4KV7A 2DBRA 3RSHA 4CNQA 4DIFA 5F98A 3QBDA 3F5QA 4K6GA 4ZD6A 1FPMA 1T9GS 3OFND 1E4OA 3RVDA 3ZIAA 1OPRA 1MAHA 3QWAA 1WE2A 2Q07A 2H1IA 3D8NA 3WMRA 4B3MB 3K0FB 2EZ4A 4XQGA 1V26A 3RWBA 4D8VA 3BA6A 3M6UA 4JIMA 4P4NA 5KCZA 2IEIA 2X3YA 1QFSA 3HR7A 3L4EA 3OZCA 2JFBA 2XMPA 3D0OA 4QJ5A 5ESWA 3RNOA 4B40A 1DEXA 1E5QA 3AUXA 4N18A 3GJ4A 2QL9A 4LYYA 4UJ3A 4WA7A 5FOWA 3WTCA 2I34A 5TQVA 3ZDQA 4Z4EA 3ZWDA 1KQ3A 3A1UA 2C84A 2R751 5DGXA 4BC0A 1E6LA 2X0NA 3STYA 3H1GA 1FOEB 3GBSA 4TYMA 2MHCA 4NZOA 1GNPA 4WQMA 3SLRA 4B6OA 2DHDA 2Y1GA 1MPTA 2XZDA 3LXRA 3MFYA 1NLZA 1V7QA 1Y33E 1Y6QA 2IYUA 2X2FA 3D4NA 4HQOA 5FNVF 2QWXA 5K3AA 3S4YA 1XZLA 2VHTA 3BRCA 2CJXA 1RLMA 2GSWA 3V4VB 3VUFA 3GGPA 5JBNA 1JQ5A 1K6EA 4RA9A 4XD7D 4AN4A 3D0KA 1K7SN 5JAUA 4RF5A 5HQTA 2B5OA 3C3AA 3EIEA 4KW7A 1Q7BA 2QZPA 3R44A 5TY0A 1A2OA 1YRWA 3TH5A 3VSEA 3WLTA 4JQOA 2EIHA 1USUA 1WBJB 1WZCA 1Y3CE 1WF6A 2NTVA 4PLGA 5H9WA 5K2OA 1D9XA 3K0FA 4QJBA 4MO9A 1RBQA 4YJ3F 3RG8A 2J8ZA 3OQ1A 4Q9LA 4ZFNA 1T91A 5L7WA 4C7OA 1CUYA 1Z4KA 4K0KB 2VCYA 4UHCA 3OETA 3RAFC 1UK6A 4HXGA 4B45A 2NTEA 6REQB 3PR1A 3KVVA 1A27A 3W0LB 1NRWA 1SC9A 2H2DA 1X1TA 4PWZA 3TLCA 3QI7A 1LY1A 3GJYA 3IDZA 2PZBA 1VMEA 221PA 4H7DA 1E8NA 5F9FA 1D1TA 1YAHA 2CB0A 3QKSA 4Q9HA 4X41A 5CTJA 1Z4LA 1B23P 4Y2SA 5KWSA 1XQXA 4E08A 5FTLA 3FHTA 2IQIA 3NMUF 4CL3A 3K0CC 1FLNA 3IOYA 5BORA 3HWSA 2PUDA 1O9GA 2DR3A 3RSLA 4D9MA 5EHNA 3JALA 2RHGB 3WXMA 1NKTA 3FJ1A 4PRKA 4RMNA 3ZU3A 1EFCA 4EW3A 1TCBA 1TYBE 1SVOA 1MEEA 5EXDA 4KFCA 1IQ0A 3DO8A 4R8LA 4UVDA 4EYKA 1ODSA 3T5PA 5L6LB 1GNTA 2IYNA 5LA6F 3R6DA 2EJCA 4LYHA 3O0DA 4X1OA 3V32A 4NS4A 4A5OA 3EPKA 1R6TA 4BMOB 3UMSA 4QQKA 3X2FA 4LYGA 3X1KA 2CEKA 2G9VA 1ZRSA 3BB4A 1TM5E 3OT4A 6REQA 3ZEIA 3QPDA 2DSTA 3L7KA 2QPLA 5ALWA 1OROA 1X9IA 1E7WA 4U6QA 4PQFA 3ZE6A 2EP8A 1W36C 3F6YA 4K5QA 1TJPB 1P1RA 1SGWA 2RI1A 5LYYA 1H1DA 1Q1GA 1XCLA 2OO3A 4URYR 1T1EA 4R0VA 1PS8A 4A5SA 1L7AA 3LIPA 3G8DA 3W1EA 5KYUB 4WTOA 1KI8A 1Z4OA 2Q2OA 3PJEA 2C4UA 3GF4A 4QWWA 5A05A 1EFVB 3TEFA 1XNQB 1OGIA 1U4NA 5AVZA 2I66A 5JPCA 3TUZC 1OIWA 3I6ZA 3NYQA 3KS9A 1TA0A 3KSZO 1CUSA 3AZPA 2QXUA 5AKKA 4AMGA 2ZTLA 2O06A 2KYRA 5F51A 4GKAA 2NZVG 4KUHA 1R12A 2XVMA 4J7XA 5HK8A 4JDPA 1RQXA 1PX2A 2I7DA 4RL6A 5IDXA 5EXEA 2FRDC 4BGIA 7MHTA 1JLKA 5IASA 3TD9A 1E6KA 2O2ZA 4CLXA 2VBGA 2G1JA 1GITA 2BFBB 3DT9A 3KUCA 4JUBA 1RYFA 4MW5A 3CIOA 3PE3A 1JHUA 1HSZA 1ZNXA 2AX3A 2R2AA 1N7JA 3GXOA 2CZCA 3IUYA 3DQZA 1EGVB 4UFNA 5C32A 5KX5B 2PPLA 4QOHA 3F0TA 4JZKA 4ENQA 2QUHA 3DAPA 4XFJA 2EJBA 1NQTA 3ET5A 1JXAA 2ZSJA 4P4LA 4M7RA 5JC1A 2Q1TA 3SR0A 4MLZA 4MUXA 3WRXA 3BKWA 5KYUA 1AN9A 3C3XA 1NBEA 2BHLA 3LV8A 3PE6A 4DANA 4B7XA 3K5PA 1XJCA 1PWEA 1X7WB 2WOJA 4GQIA 1ODLA 3G49A 2YCBA 1OT3A 1EFVA 1JXOA 3BXOA 3DZJA 3FPLA 4JLVA 2C96A 4O5AA 1HE8B 2BF4A 4DCVA 2FZ4A 3RJTA 2BELA 2CZGA 3CZAA 2HT6A 1JB9A 1VBNA 1Y4ZA 1KJNA 4O2BB 3HU3A 1L5FA 5LSAA 2G08A 4XQ9A 3FX2A 4ZWNA 3OU7A 4DWJA 4EA9A 4XX1A 4MVXA 1KAEA 3IVAA 2LR0A 2NQ8A 4Y7DA 4CQLB 2O6LA 2AN5A 1E2EA 2HJ9A 3CE9A 4MUGA 2VHUA 1P3Y1 2ODNA 1DAHA 1NJ1A 1RHJA 1RZVA 2Q3MA 3CX8A 3LDFA 3SS9X 3T52A 3V1MA 2BFBA 3V42A 3VM6A 1Y6JA 4AMUA 4AWXA 5C80A 1GZ6A 2FLWA 2Q3JA 2VL7A 4OJQA 1D0IA 3PXEA 3ZHZA 5KREA 2IS4A 1RM5A 2XGGA 4G5XA 5KX5A 1FF9A 2BFAA 1BWQA 4DDUA 3H1FA 2RHJA 1RABA 4LRSB 4OO3A 4Y9RA 4PAGA 1XAHA 2OLKA 4R71A 3VHXB 1OXBB 1AKUA 1GGHA 3DOEA 1SZPA 3EZ9A 3KDPA 4IG9A 2YC2C 2Y1CA 3KDSE 3EXIA 4MB6A 5ECGC 3WFZA 4C4YA 4BEWA 1BDIA 3ENNA 4DUZB 1ZIYA 4A6PA 5P21A 2B34A 1X7WA 2XXBA 3OEHD 3THOA 2IUUA 1GKYA 1PL8A 2BI8A 2WSLA 2G25A 3OSZA 3VSDA 2UUAB 1XMSA 1YVDA 1NOJA 4KVAA 2R6AA 3F3SA 5L40A 4XUCA 4O2BA 3EZ6A 3Q9LA 4OQLA 3R9XB 2ECQA 1YB1A 2J4DA 2XGOA 3CF4A 3LK7A 1X42A 4CQLA 1L4NA 4QT4A 3QI2A 2CK3D 3A4TA 1LVUA 5ALOA 3SSAA 3V3KA 4YGYA 4BNKA 5DCWA 1Z18A 3SC2B 4XAQA 4IV8A 3NEYA 1X6VA 4HVCA 1OXVA 1A4XA 4FB5A 1N2ZA 1AK2A 4PANA 4Q1BA 2JHGA 3RJZA 5CA1B 1EYZA 2ATIA 1L7QA 4XM0A 3JQBA 3VHXA 4KODA 1A9YA 1S8FA 1T3SA 2YFHA 4KE7A 4HMPA 3V2IA 3AYXB 4KO8A 2CDRA 4P58A 2YYZA 3BWBA 5IXSA 2EQAA 4JUCA 4TLDA 3N8HA 3IEUA 1IOWA 4I8XA 2VSQA 1Z68A 3A6JA 3MUOA 3ZZ0A 3KQNA 1JTVA 4DQKA 1HX7A 5KCMA 2B1RA 4DIUA 5JALA 2JA1A 1DC7A 3DS8A 5A4MS 4BBAA 4B2PA 1O5OA 1Y37A 5BWLA 5MN6A 3R9XA 5B3AA 5D3KA 4HWTA 5I45A 4KR2A 2H1HA 3E23A 2RH9B 2Q3LA 1Z7GA 4ECEA 4URVR 3NW9A 2VP0A 3H97A 1XMJA 2DJIA 4RDHA 3SC2A 2A35A 2C1XA 3GP5A 2R48A 1EFTA 3MLAA 1B8VA 3K9WA 3W6NA 3C6XA 1BWPA 1NIJA 2JEYA 4NYIQ 1SCNE 1XD9A 5CA1A 2C2KA 1I8TA 4GS5A 3A11A 5J4LA 3OUTA 2QRVA 4CIBA 3B7PA 2WPDD 3ESYA 3C39A 1HOXA 3KR0A 4DCGA 1ZHOA 5FUMA 1TXGA 1ZJ5A 2D2VA 3VPHA 2F43B 1UQUA 1SD1A 3IQEA 3WP0A 1NW4A 4L28A 4H3VA 3DL4A 4KXXA 4NCXA 4OGWA 2X8LA 4WUVA 2O57A 4OTZA 3IAFA 1DZIA 2B6NA 2IU0A 2AFVA 2KLBA 3RUAA 4PAOA 2BH2A 1BHSA 2JFUA 5C7OO 1G5TA 1OY1A 2VHZA 2X7HA 1ML4A 5BUQA 4RO0A 5BVHB 1AQNA 1ULBA 1MFZA 2ZDQA 4B3IA 1DAEA 4K9NA 5LZ8A 2GH1A 1L5KA 1LNZA 2ZWIA 3QRWA 3T7IA 3Q98A 3F78A 4NBSA 2Y2VA 3L1VA 4O5OA 4FFDA 2H4HA 1QRUA 5EA2A 4Y30A 5JAOA 2Z09A 1VGRA 3E61A 4JOQA 1NRJB 4LZZA 5AVXA 3TD2A 1WLYA 3MJEA 4F85A 1F1BA 1VYVA 2XQVA 3N6RA 1YE8A 1Z7EA 2WWXA 1L7BA 3ELBA 1UFRA 2Z0MA 4TX1A 1IG0A 4KPFC 3FDJA 3AEQB 4Q9KA 3VR6D 4RHYA 2F43A 1IFXA 5KQLA 4AJHA 4KEAA 4ZI7B 3ZD9A 2YWXA 3NRCA 3IKLA 3KE9A 1T13A 5E4JA 3T1VA 3VR4H 2PYZA 1E63A 1XN1A 5BPHA 4WLNA 3WNBA 1JQKA 1OLXB 3NCTA 3P0EA 2POQX 3ZV3A 1S0UA 1BXKA 3CG0A 1YB6A 3CH7A 4J0FA 4LDJA 2QA5A 5CVTA 4M0PA 5BVHA 5L51A 1M72A 1E0DA 1AD2A 1R6AA 1G7CA 5EG5A 2QLTA 1N3YA 4X90A 4IF4A 4F97A 4WFQA 1EX6A 5IH3A 1PK7A 2EL9A 1OXSC 4P2GA 4I9UA 1D3AA 4UOEA 2Q99A 1CDZA 2AHRA 1YH3A 2H6EA 2BGNA 1U5AA 2XLBA 3E5HA 2WFMA 4N4AA 2I1VB 1NV9A 1U65A 3QG5A 4QOGA 5LUBA 4IX9A 2B8WA 4BJ5A 3A3PA 1KP9A 4CMGA 3TCNA 2QDXA 2QN6A 5TPZA 4EWLA 4NE9A 2X9NA 3ZU6A 5BNWA 2ORED 3WLAA 2IEDA 2PRKA 3BZWA 1EHYA 1ZUWA 3G6WA 4TWIA 3AEQA 1AGNA 1UDCA 1VKRA 4OHUA 2YHIB 3CISA 4IHJF 4ZI7A 1QCZA 4HRAA 1DX6A 2PS0A 3NJ8A 1GRNA 1MQSA 3EVFA 2QP3A 3MVEA 3M8KA 3G9XA 4K8OA 4MUBA 4XGRA 2VJYA 5CB4B 4CETA 4LDNA 1CY2A 2BM0A 1L3CA 2XQFA 3U6KA 3HGMA 4ZVKA 2Q2QA 1L1FA 4CT5A 3W2TA 4DR2B 2KSQA 2BDTA 2EBWA 3WYCA 2L82A 4NRDA 3ICQB 3JAWB 2Q5IA 1EBBA 1RM0A 4PO8A 3P2IA 2P5YA 3ZJTA 2R97A 2PH3A 3BHNA 4HXYA 4KL8S 5I9BA 1TQ6A 3RM3A 5KWEA 4BZXA 4UTVA 3B8HA 4TS4A 4OHOA 3EFEA 3CRNA 5KQMA 3IB3A 3FNQA 1TPYA 3GNTA 3PGMA 5AKIA 3KQLA 5CEEA 1UAAA 1N1GA 1DKUA 4AZWA 1XOIA 5H59A 4MVJE 2Z2KA 3NBFA 3AI3A 2LW7A 4WNYA 2JFXA 4ER7A 1LVHA 2YRXA 4FUTA 4OHYA 3ONFA 1HURA 1EKXA 2V4ZA 3LKZA 2YHIA 2X40A 3H42B 3ABQB 4PZAA 5DHRA 4BPBA 1QSGA 2YIMA 4X97A 5CB4A 3IERA 2OO5C 4GM0A 4R8KA 4RSRA 1AA6A 4JV5B 2PH7A 2APJA 2XWSA 4GKVA 2VYVD 3WBJA 4EGCB 4QUJA 1I14A 2KS6A 5EHQA 2G28A 2IBSA 1R4MB 8LDHA 1PEAA 1I3CA 1IBCA 2Q3DA 2FZCA 1P33A 1OFHA 2ZZMA 2DP4E 3JAWA 5G41A 3ML1A 1I51A 3WAGA 1NOKA 1QYRA 4ZQEA 3TEJA 4Q3BA 1NNLA 1T9BA 2ZE5A 4E1AA 4RU1A 1D0VA 2PJDA 1ZDMA 3I2KA 1U8AA 2W2XA 4WOCA 2D5IA 5B58T 4AX8A 1PL6A 3BTVA 1BU5A 3QV1A 1VSVA 1UT8A 3EF1A 1LNQA 1IVYA 2V4MA 4L3VA 4RJKA 3HL0A 4Q4CA 2HN9A 2O0MA 2OCIA 1Q91A 4NATA 3QTBA 2BGMA 2OCLA 1SUBA 2UDPA 1G16A 4J0JA 4QUBA 5CFOA 1XZKA 5KTTA 1TYAE 2AN4A 1L9KA 1NJFA 3ABIA 4FHGA 4U7TB 4DABA 5I48A 2GXSA 2Q1XA 3CNEA 3B38A 3EA4A 5E0KB 1BN6A 1OLSB 1NQXA 1QX4A 2QR2A 3BSWA 3ISJA 3M70A 1E92A 1CEXA 1USWA 3QBEA 2CUNA 2R00A 3I28A 4IS2A 4JLAA 2NW6A 3VR0A 2ZIUB 3SG0A 4A82A 2RGXA 1CJCA 1U99A 3EZGA 2VNAA 3ENZA 3D8BA 3GXBA 4UZEA 4DARA 1E5LA 5LPNA 1R4MA 3C16C 1NW7A 2FPGA 4C4ZA 5IUNC 3I8SA 3EMDA 1HDXA 1II8B 4MK4A 1V4BA 1HG1A 1N5OX 5MN5A 1JEYB 4A73A 2QD4A 2D2XA 1BMTA 3DMRA 4RDXA 4OL9A 3I9KA 1QMPA 1Y1QA 3ER6A 3UHPA 2DT8A 2OKGA 3NKFA 2B92A 1XJ0A 2R85A 1J5XA 2XD4A 4B85A 5GGXA 2C2XA 4DBZA 2GBLC 3UFXB 4J94A 1FXUA 2VHYA 1BD3A 1DCFA 3EUFA 4M0UA 4NOKA 1V6AA 1F8UA 1HRDA 1WMBA 3G02A 3SFZA 2A0UA 3H3FA 2V59A 1BGXT 3RUEA 2O1EA 4E2XA 3EIQA 4GVLA 4DUPA 4JGGA 2GEBA 3QBJA 1OLSA 3EVDA 1U9ZA 3I45A 4JB2A 3ZDCA 2RHRA 4LOAA 1Y7LA 1O3YA 2OWDA 4QFCA 2XYRA 5JWHA 1BXGA 3RSZA 4D45A 3SYNA 2A1UB 5EIHA 2HWXA 1D5WA 5DLEA 4KQGA 4EY8A 2UYYA 2FJPA 3HKCB 1OXXK 1DQYA 4W5NA 2IY8A 4TKZA 1JEYA 1JLMA 3VO8A 2WYOA 4CG0A 1PQPA 5HGJA 2RGNA 2VT2A 3PHHA 2BCJQ 1WBDA 1I7NA 4XDYA 3ZDFA 3SX0A 4N7JA 2J9XB 2B99A 3W4JA 3UFXA 1HT2E 4Q15A 1Z5OA 1CF2O 3M5DA 1O95A 3Q3EA 4X6XA 4TZ6A 2FPOA 4FC7A 4FZ3A 5BUZA 5KYWB 3ZIUA 2XIQA 4IQ0A 1BMQA 1X80B 3EQZA 4QRIA 1WQ1R 1P77A 1QE5A 1WO8A 1EDOA 521PA 1IZ0A 4TKUA 2R65A 4X8MA 3K35A 3T9EA 3WIEA 3LUDA 1WSAA 1YZGA 1YULA 1QHSA 3OZSA 4JXJA 4UM9B 1HNWB 2RHCA 3Q7PA 1WJGA 2A1UA 4G85A 4EGJA 3VZDA 4LVNA 1I2MA 5EQTA 2JB9A 4O63O 4E5NA 5IPFA 1IEXA 2IP1A 5T8KA 4HNQA 1P7ZA 1QYXA 4OJMX 1OYOA 1WW8A 3HKCA 2EC5A 1DAFA 3SNKA 4D9HA 4EO4A 3FF4A 1ODFA 2IL1A 4B2LA 5HW0A 4C21A 2GPWA 2OC4A 3GEPA 1USKA 3PGA1 4O25A 5LFAA 1CUZA 1YRAA 1Z83A 3JYOA 4NZ9A 5F64A 5SY9A 3PT5A 2AVDA 2FWRA 3S27A 4I1UA 1TZKA 2XE8A 5KYWA 5C1OA 3MIZA 2WHXA 5JPDA 1IB0A 3EVNA 1BU8A 1SNYA 2AR7A 1JPNA 1X80A 2RHDA 4KB5A 4N0MA 5SZJA 4JODA 4QELA 1PGOA 5I9TA 4ENVA 1VZ3A 3QTLA 1I0LA 4TS9A 4TXLA 2QENA 3HA3A 4OBEA 2ZJYA 1FFCA 1MKYA 2D0IA 4EG3A 1VBFA 2P69A 3AIOA 4UPEA 3TUJC 5TMDA 5JSUA 4UBNA 1TK3A 2I7TA 1ABEA 4DCTA 3H8VA 4YCMA 5F7ZA 2M2IA 4BV9A 5JVDF 3TX6A 3A4LA 1ZOOA 5F77A 4DLPA 1K89A 5D5PA 2B82A 3AYZB 3HDGA 4JCOA 4PGHA 3VC2A 4YRZA 3GLGE 4BYMA 3A1VA 3FVRA 3RC3A 2O6HA 1Y6FA 4CODB 1ZGAA 1DUVG 1W5EA 3RS8A 4K8RB 5BSUA 2JGAA 4FGJA 2VH1A 5GAJA 1KEVA 3IMEA 4QTTB 2N1MA 3S28A 4HDNB 4NJMB 3BH7A 2VHXA 5CBPB 3PA6A 2D0DA 1UCFA 3BL6A 2HK6A 1JG2A 1HL7A 5DKFA 4CCYB 3TTSA 2DWOA 4PC6A 1TMOA 4HS4A 3WLLA 1Z12A 4WZ6A 1DC4A 4RPJA 1L4HA 1J99A 4FFRA 1IH8A 2AMVA 2ZZNA 1E1CB 4JJ8A 3WZLA 1X19A 3LDGA 2I3BA 4AU1A 1L4UA 1KZ1A 1X1AA 4KH0A 2CVQA 2LCFA 3AEKB 3NWOA 3KE8A 4ZO7A 4LWQA 3FDXA 3LECA 1LV7A 1YJ5A 3HXQA 1SEPA 2W2NA 3N2IA 3QVXA 5K4GA 2VOEA 1LTHR 1TM7E 3PUIA 3Q6IA 3F3YA 3KVRA 2O5RA 4O4LB 2EZTA 3OBIA 3OPQA 4DUYB 4Y0NA 3MYRA 1FMJA 2DUJA 2GKOA 2VSNA 4BFCA 1WAMA 3B85A 1LBHA 2ZYVX 4C14A 4IZIA 4BRUA 4ARIA 2JGIA 4HDNA 4NJMA 4CI0B 2EJWA 1BQ3A 4K2HA 2MTBA 2I6XA 4PU0A 2EP5A 1YZHA 4BU1A 2WIDA 2ACVA 4CCYA 5H7XA 3OJFA 2B7CA 2CFTA 2H4JA 2F3TA 4LHYA 3ERCA 4CW7A 1THGA 3RFTA 4BN0A 3HJRA 5LCXA 3NTUA 5CEFA 4UMFA 3C14C 4D96A 4OSOA 1T9DA 4BKPA 4J3NA 1DQRA 1E1CA 3H65A 4XSVA 3VR4A 4PG8A 2Q5QA 4ZICA 1HV8A 4ENTA 4N03A 1U28A 3AEKA 5J1SB 1S02A 2BI7A 2V98A 1JIJA 2ZRKA 1NXVA 2Y92A 3GIDA 3KB6A 4FD2A 1LW7A 1GAQA 2W6QA 1Q15A 2BGLA 2J45A 3FHJA 1TPZA 4DV7B 5JS8A 2DWCA 1SJ9A 3WMGA 1VJDA 3K1ZA 4W1QA 3E9RA 4IVNA 4WLVA 1WXXA 3T8YA 2BC9A 1GCIA 5HIMA 1K27A 3QPAA 4C4PA 5D86A 1TRKA 4F3NA 4D92A 2QW0X 1C9EA 4KN9S 2GZAA 2QVBA 2K87A 3H9GA 2HSEA 2CHVA 2O3TA 4X20B 4TRRA 2PZKA 4RKYA 1T8SA 1NWCA 1GPLA 2QQEA 1TFRA 3A6KA 3D3QA 3OQJA 1M8PA 3ORQA 3D59A 5B1HA 2GS9A 3ROMA 1AKRA 1MF7A 4CTKA 3OJWA 1NOIA 1JG7A 1ZMBA 1IMJA 2H51A 2JFQA 3VYVA 2CLHB 3VR2A 4KQEA 1PVDA 1ZISA 3B3JA 2OHVA 1BJKA 1WMEA 2VA9A 4WFJA 4AKGA 1EFLA 3MJ4A 3EIUA 4ARVA 4EKEA 1M1YB 1BA3A 4G0QA 4JVMA 3UOAB 1LK0A 2Y0BA 1C2TA 2V7EA 1B3RA 1Q77A 3BD7A 2D6FA 1P74A 4M0EA 3V7UA 1L5MA 1UJBA 1ZJZA 2B4TO 3BEDA 4L74A 3ZDBA 1TYZA 4FOSA 4ZAXA 3IJPA 2HXYA 4P83A 4JBXA 2Q5HA 1YB2A 4OP2A 1FQKA 2BHNA 2Q7DA 3UGTA 2LBPA 3FZQA 3MG9A 5KWIA 3LWBA 3ZXSA 1EQUA 1JVSA 1LLQA 3OLQA 4EY5A 1ZD4A 4L8WB 4X20A 5I9IA 3HY4A 1BVYF 4Y6LA 2G3YA 2YC4C 3F6RA 3OIWA 3MTIA 4Q82A 3OTQA 1T5BA 3LL7A 1OFVA 3N74A 4OQPA 3WQBA 4IGEA 3CTPA 2BLLA 2JS7A 4OPMA 2JLRA 3UJPA 5M2QA 4WNAA 3FGNA 1BN7A 5CX4A 3B3FA 3LLMA 4BMXA 2FZVA 1UT5A 2O23A 3DWIA 1AE1A 5JW6A 1M1YA 4KRGA 4YMIA 4DCCA 2PO5A 1GYQA 5DX1A 1F12A 4D6YA 4TL6A 1Z0KA 2MMGA 4MGIR 4OQNA 1P2TA 2QEQA 4Q1VA 2VT3A 3EVEA 3QVGB 1N2CB 4JH0A 1P1FA 2ZFUA 2O4UX 2YN0A 3RPEA 4CV1A 2EFEB 2AUNA 4NE7A 1YZVA 3PGXA 4AO7A 2VBIA 1R50A 1CP2A 1RXWA 3IAM6 1YC5A 1ZGHA 3S1AB 3UHAA 4U4AA 2NP7A 1U1DA 2HPVA 1MO3A 1AIPA 2G1KA 3R3YA 4NU8X 5A4FS 4BNTA 3TBKA 1HDYA 2QV0A 2QX6A 2C4VA 3WHIA 1FNNA 1JE0A 2GSDA 3IBFA 3LDAA 3BD9A 4FZVA 5I5GA 3RK0A 3AOEA 1NJ2A 2ZTUA 5EMHA 5ALZA 2QN2A 1Q83A 3WL3A 2Q41A 3KWFA 3PHJA 4K1LA 3MT0A 2EP7A 3FOZA 5G53C 4BVJA 3FY4A 1RQLA 1FP7A 2PMCA 4WKNA 5B3KA 1KEKA 3NHFA 3MMXA 3N6XA 5TPZD 5BN1A 1S2IA 4IQGA 1JBKA 2VAXA 5CD9A 1YR6A 5HS6A 2X4GA 3EEOA 3AJ9A 4AAYA 4TQUS 3IBCA 2Y0DA 2RIRA 1MQ8B 2J5QA 1ZSVA 3QVKA 4MZDA 3QVGA 4HMOA 4HX5A 4TTAA 1N2CA 1H3EA 4KX5A 2CHGA 4ARCA 1TUGA 1R7RA 2P2YA 2DFVA 4QTXA 2YIJA 3WK4A 4W1RA 1WEKA 1OZ0A 3BUSA 1OF1A 1T6NA 1ZKDA 4LFBB 3DTVB 1ECBA 1ZFNA 3E1GA 2HRCA 3GDHA 1VSTA 1D1PA 3D7LA 1Q16A 2PUJA 4FINA 4TPKA 3Q8XB 4RMJA 5JFTA 3KYIB 1QNFA 4QDTA 2C7GA 2CW5A 3C6ZA 2OD9A 3C6BA 2Z8YA 3ED1A 3PGKA 4UTPA 5B12A 4RHTA 1UL1X 1B26A 1U7DA 3GVCA 4K1XA 4RIIA 4TV8B 2FWMX 5CLLA 3WL6A 2Y6UA 5C81A 3LUJA 3MQ4A 3C48A 1YVPA 4OYLA 3L46A 2GPSA 3NP7A 5HEKA 3PC7A 3LZDA 2VTDA 4QNMA 3V3TA 1XPOA 4P7JA 1ZINA 4YRIA 4OF4A 2BBTA 2FWJA 4DLAA 5IAAA 4LXUA 5L3RA 1IIRA 1IU9A 3O5AA 5HILA 4ZMBA 1A7UA 5ADUS 4HI0E 3M1YA 4IIBA 4WZBA 1M1UA 4QUEA 2JL1A 1OE0A 3C3BA 5IKOA 3TI7A 1Y6RA 3UBTA 5DSTA 2XB8A 2BMDA 2IELA 1JYSA 2X13A 3CPHA 3HBFA 4FDMA 5JDIA 1YS9A 5F5LA 1Y3IA 3DTVA 4O6VA 1NVWQ 3F5DA 2QJWA 4FFLA 1JF8A 3OMLA 5JXIA 1PZXA 3GJRA 3E3AA 1RWVA 1HG0A 2OCKA 4XLLA 4PX3A 2YV1A 3NBYC 4YAEA 4TXMA 3VPGA 4LTMA 5JCPA 1C5KA 2DB3A 1VPTA 1JI0A 3S3TA 2Y1LA 4RELA 1UKVY 3NDIA 4QBTA 3VRHA 5K8JB 1A8PA 2HBRA 2VDWA 4TV8A 2XXAA 2ZKLA 2NU7B 1DCMA 3COWA 4KXFB 4R1PA 2WB4A 2WG2A 1KDZA 3T12A 2VOJA 2W2MA 3IUEA 3RFUA 2BCEA 1KH1A 4TWAA 1IN6A 1XXLA 4XVQA 5JSKA 5JS2A 4DV5B 3KQMA 1KF0A 3GLSA 4PHFA 4WXPA 1XRPA 2FUEA 4KJZA 3MMPA 3AESB 3KJXA 2LKCA 1WTAA 4I1IA 1QNLA 1SB9A 4RUKA 3GCWA 3V4OA 3WLNA 5BSKA 3I32A 4EF4A 2HL6A 3GT4A 4E88A 4OH1A 5FTKA 1U0TA 4PYLA 1FSPA 1T0UA 1W59A 2J09A 1MAVA 2PN1A 4EMBA 3WLMA 1ESNA 3D6MA 4KPUB 3FJOA 2J59A 2AW5A 4PYQA 4TVOA 2XWPA 2ENUA 4FCCA 4IF6A 3FZEA 1NBAA 5HRAA 2NSLA 5DCUA 3SF0A 1I0IA 4Q12A 1Q1QA 3LBHA 3PFIA 1XTIA 1Q1EA 3P27A 2W70A 3VR5H 1A5SB 4HGQA 1XLUA 4NMMA 1IONA 1ZQ1A 2UZ3A 1S2DA 3QPVA 4RTJA 2NU7A 2QVGA 4W6QA 4WECA 3KSDO 1F6WA 3PQEA 2DR0A 1X1RA 2FB9A 2HRRA 4DKJA 3FWYA 3TL3A 2XZOA 3IP8A 2EGHA 5DTEA 5BR8B 1G55A 1ZM2A 2H2FA 1NBHA 2FUKA 1ORDA 3IO3A 3PS9A 4UOQA 4EUEA 5KC8A 5KTPA 3UA3A 5MGBA 3VJRA 1L7DA 3PDIB 3IQWA 1E0AA 1SUDA 2GPTA 2IPOA 4W5QA 4YB8A 2XOXA 1EVEA 3AESA 4I08A 2W2TA 3PUJA 1BDBA 1ENPA 1FK8A 5H70A 1DG3A 3W5CA 3ANYB 3NHKA 2HW8A 4IFBA 1H1TA 3GWZA 1CUVA 5H02A 2DECA 1QP0A 1WM1A 1BGVA 3TRHA 4DLXA 3EVZA 4KFSA 5HCUA 4AS1A 2R8XA 1SUWA 2YRWA 2Q1UA 2GFHA 2YZGA 3TJMA 3FMOB 3K9CA 4RZIA 2EFGA 4P0PB 2D5CA 2WP8J 5EERA 4KQ1A 2UV8A 2JH3A 2UYGA 3AVTA 1CQZA 3VAZA 1A98A 4FIZA 2JFFA 2PQ0A 4IIVA 1W5BA 4EZEA 2D8AA 5LC1A 2GEVA 1O95D 2CCKA 1ESMA 4CF4A 3QU4A 3DT8A 3HA7A 3LFHA 1REQB 2P35A 3ITKA 3ABRB 3UJDA 2JCVA 2BMWA 3ABOB 4RHXA 1KJ8A 1M0WA 2PR2A 4MDEA 1YB7A 4D42A 3RYTC 5K05A 2WMNB 4C6HA 2EJVA 3WGIA 3ND9A 1NE2A 1UBCA 4DC1A 5JEDA 2PANA 1JJVA 4MVJF 1T3LA 2EVWX 3KBOA 1PIWA 3AJRA 1GFWA 2VK2A 1CJMA 1Q0LA 3IVGA 5HVNA 4E1VA 3KZVA 1Y0BA 3R3JA 5CGZA 3GB9A 2VSYA 5BN4B 4GZ6A 4N0QA 4DV1B 2ZGVA 2NZXA 4DLTA 4J1TA 1NBIA 5FUWA 3RO7A 2AWOA 4ER3A 2NSDA 5B7GA 4D5EA 1TDJA 1VRCA 4L0QA 5CA0B 4FWBA 1R0YA 4PTYA 4YO8A 1XF9A 2MSDB 3OA0A 4P7BA 3SJ7A 3N2GB 4O1IA 1CVLA 1B41A 2B25A 4MW9A 4C2UA 2EG9A 3MWGA 3RWMB 2REOA 3RADC 2VLIA 5BRAA 3VA7A 2G77B 1WV0A 1AZSC 1V7CA 3CLVA 4AYTA 4MCAA 4ZYYA 1REQA 4J91A 4N6OA 4MQUA 4N7RA 4D5GA 4NESA 1DC3A 4HOYA 5DFAA 3WRXC 3DDOA 1U3UA 4H77A 4HFJA 3J81A 1H2RS 4NZPA 4KVZA 3GVIA 4RS4A 1QGED 2HWKA 4NPCA 2JAWA 1MEJA 1ZGZA 1OH7A 4UM9D 2ZI9A 5G0UA 5I7FA 3HCAA 4C88A 4Y1RB 6NULA 1CJBA 2JAUA 4QYXA 2JGLA 3B5JA 5BN4A 1MB0A 4FD3A 3MTAA 1M5UA 1XTBA 3M5PA 3TPCA 5L4LA 1ND6A 1SVLA 2FP3A 4D9JA 5FBKA 5BMVF 3IV7A 3UMFA 4IHAA 4QM6A 3ETEA 1GPDG 4Q00A 3PX3A 3UXYA 4H7KA 3N2GA 2XVZA 8AT1A 1MGPA 1WDKA 2P8SA 4LWOA 4G5YA 1CEYA 2CXRA 1Y3AA 3N86A 5FAKA 5JMOA 5FEMA 4URZR 1XK6A 5MN4A 4NBLA 3GUCA 3NWJA 1QZUA 5A1JA 3C98A 4EP1A 1J2EA 1TU0A 1Z4IA 3SCZA 1IYZA 1T5TA 2DTEA 4RVSA 4GZLA 2O0LA 1NUHA 5CU7A 3RASA 1XELA 3ZLVA 2J9FB 3B2NA 3VR3A 3FPBA 5FYQA 2C94A 4H6XA 1PUJA 4N8EA 1Q44A 1FUIA 4DG9A 1TM1E 3FGPA 4I6GA 4RZXA 3FVWA 4LW8A 1ZESA 5FOUA 5C7LO 4CF3A 1XAGA 2HAEA 1N7IA 3C7AA 2HLNA 1EA7A 2O8NA 3FKQA 3K09C 3L8DA 4C0SA 4F56A 4NXNB 2PGAA 2B37A 2J31A 3NONA 1F38A 2W2VA 4Y0VA 3RUIA 3M89A 2JCYA 2SECE 5JBIA 4Y1RA 1T8WA 3DFFA 1FP6A 3OTWA 3UG7A 5FX2A 1OA0A 4JL6A 4M0KA 2HDNB 2Z04A 3U3MA 3N53A 5KS2A 3GGOA 1QYIA 1XZDA 2X15A 3R8XA 3FROA 3RKUA 5JD4A 2G5TA 2XKJE 1CY1A 4LZLA 5F1OA 4E51A 4YAJA 4YAUA 3KLBA 1S1CA 3NIGB 4FQ8A 2YKGA 4FX5A 1PFUA 4WNCA 3RU2A 1F1JA 1Q3HA 2EJUA 4P53A 2JHFA 3ZGNA 2G0TA 2CVFA 2ZDGA 4EG5A 3I9LA 3H1BA 3PNSA 4D4IA 3TQHA 1NJ6A 3EPRA 4QUKA 1QIKA 2CC2A 2R8ZA 2NU8B 2VQFB 3OPNA 3UB3A 1KBOA 3H0CA 3IOEA 1UODA 4UU8A 2J9FA 2Y9PB 2PUHA 1ZI8A 2WZDA 3R74A 3MILA 3ZXXA 2P0AA 4YX9A 3TLAA 1H0HA 3PL5A 4M89A 4P38A 5DHUA 3X44A 2R1VB 5JFOA 4KN6A 1A77A 1LSJA 4ND8A 5LP6B 4EECA 2E6UX 2P9CA 1KMCA 4Q66C 2Q27A 3VR4D 4XWOA 1LPBB 1P4GA 2BGWA 1X1BA 4QPDA 2R1TA 4XFDA 2OORA 1S7CA 4QXOA 5FUVA 4C7XA 4D0GA 1JHPA 1BE8A 1GAWA 2PSEA 4OLHA 2JIZD 5HNKA 2P9ZA 3K2EA 3L8YA 1JFTA 3CNOA 2BHRA 2PKWA 1GP2A 1QS0A 2AWNA 2FW8A 3GEEA 3TFOA 2R87A 3AW8A 3OQBA 2J1LA 3MGKA 5LD2C 1NX6A 2IZ5A 5AKLA 2CHFA 4U2KA 5DOZA 1T1GA 1EJ0A 1H2FA 1G42A 1G1MA 2NU8A 2X14A 4K26A 1CF4A 1RZRA 4E14A 3OQIB 4F6LA 1G7TA 4YREA 3UAYA 2ZB8A 3B78A 1L7EA 1XKXA 3SDBA 4XB1A 1IVNA 4QBIA 2R1VA 2BR5A 2HQRA 4OHCA 2B20A 3BWYA 1YJCA 3FETA 1VPDA 1ONOA 4NBNA 5LP6A 3I3SR 2GJ9A 1Q7RA 4HLCA 3FMFA 3LNTA 1LX7A 1B1AA 2JDID 2OB1A 4F06A 4YIHA 4QULA 5DNEA 5JQWA 2PKCA 1SH7A 2HM7A 4LWPA 5CR9A 2C9CA 4OMUA 1C7RA 3DDCA 4U7PB 1B8NA 1OI7A 5FOTA 721PA 3AETB 3AV3A 1OLUB 3SBEA 5BW4A 4A9AA 3ZI0A 3CWCA 4AP9A 2Z98A 1JKIA 2R11A 1WDMA 1HE2A 4PWYA 5KUTA 1A71A 2OHFA 5JI2E 3FFXA 3I4LA 4LE2A 4HPXB 1QGAA 4ACAA 4LXXA 1P6QA 1PP4A 3I2HA 2OZEA 4ZCLA 2AC7A 3TVDA 5KNDA 1NVEA 1RRGA 1LLDA 2P0YA 2MWMA 5TGZA 5TIIA 1R9GA 2LIVA 4PPFA 1ZIOA 4I4LA 2ONKA 2I5PO 3OQIA 4GKJB 1HQDA 4GOND 2AI2A 5FTMA 2H9YA 2NQTA 2QD2A 2OGTA 5CB0A 1WUTA 4D41A 4DDWA 4JVOA 1K06A 1MVOA 3K6RA 4LXGA 4O2AF 2H59A 3QQPA 1VKNA 3GJ8A 5KYNA 1A9ZA 1NI5A 4KMSA 4YVFA 1PW7A 1VKHA 1ADFA 3GCDA 3HFJA 1TW3A 4RLFA 3E81A 1I2ZA 2B5WA 3PIIA 3VVCA 4Z9XA 4CF7A 4LRTB 3QPWA 1M5RA 1HORA 2G9RA 2XODA 1M0EA 3ISVA 1SELA 2BLNA 3DHNA 2O8BB 2QI9C 3L40A 1Q0QA 1LQUA 2O8FB 1FEZA 2XVYA 3C6MA 3P9NA 3Q4GA 1KO4A 3AETA 2FSHA 1OLUA 2JCSA 5C3MA 6GPBA 3OH8A 3PFBA 4MV7A 5DIZA 1DEKA 3RVOA 3EOBI 3K16A 3DOOA 4TT8A 4TXJA 5DT9A 3CPSA 4K9DA 5AVKA 5J5AA 2K7FA 2IS1A 2LDBA 1BXRB 2PSSA 3EDCA 2JFHA 4GLJA 1ZK3A 5DHAA 2E18A 1EX1A 1N3LA 5AKZA 1Q11A 1SXJE 1EM6A 2DWQA 3M3HA 2A59A 2Q4TA 2IHNA 3NXKA 3SYMA 2R84A 2IXTA 3FNIA 3T1NA 2EW8A 3BL8A 3LPCA 4J0QA 5DM0A 2J41A 1GSHA 4GOMD 5LU8A 3UQYS 2ADMA 1FFGA 2UYHA 4EMTA 4HB2A 2P4QA 1XZEA 4M9ZA 5I47A 3MJCA 3K92A 1SG9A 4MYTA 5F5XA 1C7FA 1QLJA 2QMUA 1IBRA 4FLMA 4B48A 3PRJA 3NGXA 2FE4A 4EFLA 3KJNA 4CR6A 5FWNA 3VHRA 3IBYA 4YRLA 2VF8A 2O8BA 3F71A 2PKYX 4BMSA 3P9CA 3PNYA 2O8FA 3PC6A 3PB3A 3ETNA 4CLHA 1EXDA 2E2WA 4ZVSA 1UPFA 4Z9BA 1TZMA 3LLVA 2ZJ8A 4WPGA 2G09A 5TVGA 2WQ7A 3UICA 1J00A 5CITA 4DYVA 3VR5A 1CQJB 1BXRA 2VH2A 3BK1A 3OIGA 4QASA 2OVBA 3F74A 2O7QA 4QVGA 2ZCUA 2C88A 1X7ZB 2MDTA 2XT6A 4UMDA 4CRWB 1DX4A 2YL2A 3HVJA 5C1PA 5K0JA 2IY9A 3REOA 5D01A 2C5LA 2R3SA 3G9ZA 1WKCA 1W4RA 3HZOA 4NCJA 2CYCA 4FHCA 4O4HB 1O2DA 2X5KO 2X6TA 4KNWA 5AIBA 5AUQA 2Z6AA 3NOQA 3ICEA 1K5HA 3DEJA 3RIYA 3V7NA 2C7RA 1ZJYA 1DWQA 2BVNA 1N5LA 3DWEX 5HRUA 3JAMA 1GRRA 2AXPA 2JANA 3CEPB 4JU8A 5LZ7A 1WSWA 5A7FA 1EAYA 1ZH2A 4PGFA 1VE9A 3Q8LA 3A10A 4HWPA 2P6RA 4J0CA 3CRMA 3ET4A 1KYTA 1NLUA 2I4NA 3LSYA 4CV3A 4RY8A 2G5CA 2CWDA 3JQ7B 1CQJA 4ZI5A 5IJ0B 1I5OA 3LG2A 1X7ZA 4BBPA 1PT9A 1YIDA 4Q39A 3W7BA 1FDIA 2QRJA 4BXOA 1V6SA 2QMYA 2VF7A 3BRWA 3LLUA 2OHOA 2ZDHA 3SX2A 1YASA 2VRCA 4MR9A 3M6XA 4M1MA 4ENRA 3GJ3A 3QV2A 3QEMB 4FGWA 1HNNA 1IJFA 1B8OA 4LDPA 4O4HA 3OHPA 5TPWA 2H7VA 1E3DA 2WKRA 3OCXA 4FQ5A 1RBZA 1MUUA 2H31A 2ORIA 3RSCA 3ZVRA 5FPPA 1TAGA 3TZBA 5BUSA 3MAAC 4HDMB 1G8KA 2WOOA 3KPVA 3W3ZB 4CV0A 1EDZA 1N4DA 2VDJA 4DRXA 1SIOA 2HXSA 2R00C 4TKVA 2VJBA 4N1AA 2J30A 3PWTA 4K9LA 4NAVA 3VJMA 3DMGA 1XIVA 1YBHA 2RHMA 5F3DA 4DMLA 3FOBA 3GFRA 5DULA 2ZR9A 2J4CA 1J8MF 2JKVA 3O8RA 3DR3A 5IF9A 3I9OA 3QMMA 4KKVA 5KX5F 2FN7A 3BFPA 3A06A 3TQSA 1EG7A 3K2BA 4IDOA 2IIQA 5H3LA 3G5AA 2WUGA 3LLSA 3JQ7A 1J8QA 3ASVA 4KLAA 3WL5A 5IJ0A 1XTSA 5JNLA 1RPTA 3KT6A 1Y3HA 2QXTA 1OAKA 1OWLA 3HLYA 2VTVA 1BWSA 4BNFA 2ADOA 3LQRA 4WJKB 2O8CB 2AG8A 4QOJA 1Q21A 2C9ZA 2QGNA 1Z9BA 4HJXA 3KOXA 5A0FA 1X7YA 1H94A 4HS9A 2P5TB 2ZIFA 2XUPA 3QEMA 5LVAA 3C6KA 1V8DA 1WUKS 5ANRB 2XJ4A 3HV2A 4X65B 1FSZA 4P93A 4V0NA 4NARA 3T54A 2DYKA 4O2BF 1NNEA 3TZ6A 2GZHA 1QE3A 4HDMA 3AF1A 1FFYA 2QXYA 3NJRA 3HH8A 4Q3OA 1FRQA 1K3TA 4CKBB 3CF2A 4RENA 4BP3A 1P9RA 3TECE 2XMGA 5BVGB 2QN7A 3RTEA 1FP2A 4LYAA 2Q1WA 1RM4A 3HU1A 4JLNA 4P5DA 5AUPB 3MTJA 5ER6A 2O54A 4CQMB 2FXIA 3ZWOA 2EWMA 4PYNA 3AGPA 1RWOA 2VPQA 3PR3A 3KWLA 1YOVB 1FTWA 4K9PA 5GGYA 5EJMA 2O8CA 3ZOZA 3FPJA 4ANFA 3JQDA 5KDOA 3COSA 3UV3A 4IO1A 3OZAA 3Q5EA 2ALJA 3AQIA 3VDQA 3BL5A 1JL3A 3GZJA 2J32A 5C3UA 4AJJA 2KB0A 1GR0A 1O95C 1QAQA 1C9DB 3H1PA 3RIXA 2A0YA 1F48A 1P60A 4TLEA 1NBME 5ALRA 5LLDA 3UTCA 1R37A 2WKSA 5CLFA 4BFLA 1KDTA 3KCQA 4DIEA 3SHOA 1N2SA 2XCIA 4RXMA 4NG4A 2H1FA 3URMA 3WBKA 4AF6A 1E64A 1NQWA 1XF1A 1NPTO 3HBNA 3O94A 3DHWC 1CUIA 3INYA 2HTFA 1T3ZA 4IXWA 1H0SA 3KTAA 3N2ZB 4Z2YA 2OAQ1 3V7FA 1Z38A 2GHQA 4CKBA 1ETHA 4RD2A 2FHPA 1PZMA 1AF7A 1CV2A 2P78A 2O5VA 3O73A 3OM0A 1JWLA 3UG6A 5BVGA 3DTTA 1V1RB 1U8CB 1X8JA 2D0PB 4CQJA 1N9KA 2RGAA 3TSOA 4ESHA 4PYOA 1GZ4A 1YA8A 1R0BA 3OC0A 5CA1F 4CQMA 1RMQA 1XTQA 4KGVA 1U3GA 3U60B 1X1CA 4BKMA 1PUXA 4GKBA 3B1WA 3E4CA 4K05A 1XMXA 4N3CA 4RE5A 4L57A 5B7QA 2MYPA 2A3RA 5MFZA 1KARA 4DM3A 5C1DA 3TJZA 4K6HA 2R1UA 3AR7A 3FR7A 1ADGA 1XAJA 3K9FC 1C8BA 2PS3A 4C2TA 5EUBA 1Y81A 1ZITA 2ACEA 4EQ6A 4Y2UA 4EEXA 3DFIA 4OL0A 3IEPA 1K7EB 4TMYA 4QZVA 1P2FA 4RA6B 3C5HA 5A5EA 3VC7A 2ZP1A 3WDLA 4FK8A 3F1LA 4NFYA 4S2UA 3WL7A 4ZI2A 1W94A 4UTOA 3NH6A 3WY9A 3ADOA 2I78A 1TD1A 3AI1A 4OKNA 1JHYA 4IOLA 4W9NA 4KNYA 2DULA 4YHHB 2W8BB 3PX7A 3IQFA 3AU9A 4HRXA 1XVVA 3IDAA 3EA0A 3MJDA 5IEBA 3ZVMA 1JNXX 2F2TA 3NTQA 3SI7A 3QA9A 2PPVA 4L4YA 3TSAA 3LQ4A 1V1RA 3NUQA 4NMXB 1P2VA 4EAAA 1YUBA 1UKAA 4OV6B 3CF6R 3LC1O 1YQTA 1R9NA 4JP8A 1KWKA 1H4TA 1K3FA 1OW3B 4LKRA 1XNRB 1M6HA 2FQQA 2CY0A 4IS3A 5FTWA 3OY2A 3B9RA 3GYBA 2FWIA 1MAUA 1XEWX 3VAYA 5TS2A 2X0FA 3L41A 4V0ME 1C2YA 4B7ZA 5I3ZA 1JXMA 1A9PA 2QIOA 2X6QA 2GZDA 1DDGA 2IF2A 4MIEA 2Y93A 4RA6A 5C4GB 4D43A 1H2HA 3ACCA 4OXIA 3A7EA 4C0LA 3PI7A 3WIVA 3SVLA 1V8BA 4QYMA 1JDPA 1RJEA 2QI9F 3V9AA 2E5LB 2IHVA 1MO5A 3DOIA 4LCEA 1AQUA 3WLRA 4B82A 2XUHA 2VDKB 2W8BA 3KZCA 1DADA 5HHTA 2FAXA 4R2MA 4OFBA 1R10A 1CRLA 1K5PA 4GZMA 4Z4IA 4FBMA 1KFCB 2WSSA 4OHWA 5DISB 1C30A 2HK7A 1XSEA 3ZX4A 2O2DA 3RBXA 4LOIA 4DDHA 1CB7A 4MA4A 3AINA 3ST7A 1BQEA 1OYWA 1CJSA 1PSDA 2FG5A 3KOMA 3GGJA 1DWPA 4C5CA 3HDTA 2HREA 1M0TA 1JEJA 2WK1A 4QHYA 4D99A 1RU3A 2C97A 2XQIA 1QYCA 2Z8XA 2X7JA 4UEJA 3SEZA 3THXB 2OB2A 4RNCA 4WN3A 3QKWA 1P9WA 3H8SA 4ZTUB 1SXJC 2VJAA 2Z3VA 4BGVA 4RJTA 4ZI7F 3SZUA 2GZMA 4Z7OB 1VMKA 5LQNA 3KQOA 1FXSA 2PJUA 2IZZA 3H7AA 5CT4A 2JJQA 2Z56A 1PTJC 1NT4A 3LLCA 2GCOB 3VZBA 3GG9A 3IBTA 4LGMA 4GL2A 1U0LA 4ZDWA 1KERA 1JR3D 1XO1A 1Z75A 3OLWA 4INZA 5DZSA 1J1ZA 3ZBUA 2RHBA 4N40A 5EJ9A 5CDUA 3MCVA 1QG4A 3UMRA 1CKEA 4BEBA 3DLPX 3V80A 4UVHA 5AW0A 2VK4A 3GD5A 3JQFA 1NDUA 2RI6A 4MV9A 4R5MA 1G4HA 1E89A 3UUFA 2FPLA 2CV1A 3A2MA 3FDZA 2R6R1 3VAAA 3TLMA 5KAPA 3W8RA 3VYRB 3ETCA 5EAIA 4LK2A 4NVRA 3IV9A 4KYUA 4HGNA 5LOVB 2VDOB 1ZD3A 3F96A 3R7FA 2P9GA 5BXYA 2D59A 4OOFA 1OX6A 2Z5LA 4OOEA 4DNXA 3THXA 4EG8A 4BO3A 3FW1A 2YYAA 3IKTA 1P5HA 3QEKA 3SLGA 4D74A 3OQVA 4F9FA 2PDAA 5FB3A 3OKFA 1SD2A 3H04A 4MUEA 1ELOA 1YS6A 3AFNA 3NC1C 5JCOA 5B6IA 3X2SA 3DL7A 1EVJA 3RFFA 4D9EA 5CB4F 4RCVA 1AUVA 3LY8A 3WTBA 2Q3EA 2XAAA 2HR1A 1HOTA 421PA 2HA7A 1F8YA 4ZK2A 1GSAA 2GCOA 2J46A 5K0TA 2VF2A 1UR5A 4OMCA 3NHRA 5TS3A 1JQJC 3D7RA 4LJYA 3G1WA 2R8EA 4MYHA 5CIWA 3W5VA 4DV0B 1URPA 2ORVA 3KU1A 3FG9A 4I2NA 2OR3A 3KAQA 3V4RA 1E66A 3WGGA 1RZRD 4PZZA 2GJKA 3L6DA 1W4AA 4UHDA 4RHEA 5FFFA 3SP1A 2IPXA 4MYDA 3GVPA 4OAQA 4UHFA 5JNWA 3HP1A 3IV6A 3PQCA 4HB0A 1G8AA 2VG8A 2GN6A 3LO8A 2ZI3A 2Z4TA 5AXCA 1DX9A 3ZU5A 4EHDA 5LOVA 5K4HA 2PT7A 3WC4A 3ZHTA 4GEKA 2SKCA 2PYDA 5JMPA 4M98A 5JZ9A 2RI0A 3PSAA 1C7IA 4GHWA 5IAKA 5ITVA 3BK2A 2WFLA 4HG2A 1FBNA 4G0MA 1T1RA 2FSIA 1UK9A 4F1WA 3IRVA 2PMKA 2X5NA 3NKVA 4L6IA 2UVQA 2PXCA 3CJQA 4Q1CA 1I5EA 2A9QA 5JYCA 4LA4A 3MTDA 4B6EA 4AICA 4HAIA 2HMYB 2DPLA 1ST3A 4G8BA 2QYHA 2VO1A 1XDSA 4KR0A 4E12A 3KL4A 3PZRA 5ALJA 3RBVA 1KI9A 4DHWA 2C4TA 4GG1A 3ZHQA 4WIAA 1NMZA 1JJAA 3UN1A 5AVRA 1VE1A 1Q6ZA 4KXVA 2DY0A 3ANXA 5B1SA 4GU5A 2QZSA 3F6CA 4Z49A 2VJCA 3A05A 3F46A 4MJ7A 4D4HA 5ENVA 1XCGB 1LEHA 1M1XB 2PD3A 5JZOA 2YTZA 2IPNA 5EJ7A 3PFGA 2IYWA 3OEED 4AP6A 2FUCA 1W5TA 4LXHA 4F2WA 1IY2A 1TO6A 13PKA 5WRFA 4PQGA 2WU0A 1P4SA 1UBHS 3E8MA 5EKTA 3VJLA 1FFWA 4ZOEA 1RI1A 1RWMA 1I4LD 1K4MA 1UBRS 1RYNA 2B4AA 5SYAA 3UY4A 1JHZA 2IYLD 2PRSA 3OD5A 4HDCA 3AOEC 4ZDIA 2GZ2A 5LZ2A 2BH9A 1BS2A 1XRRA 3DGEC 1BCRB 1UBKS 5CT6A 2BUAA 2FCRA 2GILA 3DBVO 4NIMA 2PAFA 1TYCA 1FPQA 4YA6A 3YASA 4DMCA 3TR0A 1DIGA 3OTGA 3T7CA 1NJ8A 4Q5IA 2JGRA 4JWTA 5CH3A 2Y6VA 2ZTHA 3KQPA 1Y4DE 2EBHX 1P9OA 3VXKA 5LQSA 1SG0A 1OREA 2JLQA 3LPMA 2B98A 3AQ4A 5DCLA 1WU7A 1J20A 2YXNA 1A3CA 3P0JA 1WDLA 5KMGA 4WADA 1RYBA 4E5SA 4TL7A 1G291 4BX3A 1JJFA 4ZT7A 1OXKB 2BZ1A 4HD8A 5JLAA 2Q5CA 4JMPA 1TA4A 2X8WA 4KXNA 4Y6GB 2P2LA 2XVAA 4RS3A 1J2TA 2EARA 3KO8A 5B55A 1A8IA 1X1QA 1W7AA 5FWXB 4CM5A 4F3CA 3ZCPA 4HDOB 1PDOA 3N0WA 1SC3A 3IC5A 2D7DA 1AJEA 1ADBA 1BCRA 3DZHA 1MFPA 1Z5ZA 3C3CA 4OLFA 1KYXA 2GZ3A 3EJWA 4KQWA 2GRJA 4G0PA 4KJXA 1KHTA 1NASA 5IBRA 1A04A 5CXQA 5JD6A 3I2FA 5IJ9A 5KPJA 5FPTA 3G68A 3OT5A 3PUXA 4IDHA 4IL5A 3CVOA 4X95A 3GLIB 3FR8A 3KKZA 5B2EA 3HUDA 1MIHA 4TL8A 4X94A 4U3JB 5IVHA 1U6JA 4CR8A 4FGUA 1N9ZA 4Q4HB 1YKGA 2CL0X 4D9GA 4E5KA 1GG2A 3C87A 3KQWA 1CZKA 4TT3D 1DPGA 1CHNA 3U0VA 5K0LA 1WHSB 2NUAB 1KYYA 3DDHA 1T9ZA 4L9SA 4AG6A 2HMAA 3DD5A 2DETA 4NBKA 5FWXA 2ZITA 2HO5A 3CUSA 3HO6A 1XHFA 2C95A 1NY6A 3MTGA 1U2SA 1IJEA 4A8HA 1QZTA 4ZOBA 3IP3A 3AUAA 1XCJA 1USGA 2PRJA 2L0XA 3GAZA 4A6DA 3LY9A 4M53A 4C05A 2XUQA 3E3LA 2IUEA 4AKSA 3R3HA 3WNDA 2Z4RA 5JARA 4I1RA 5IF3A 1U3TA 3T1YB 5CB8A 4F8JA 5HQJA 1POWA 3E9ZA 3VVMA 1XTJA 4GQAA 3CONA 4A0RA 1XZHA 1GM5A 4U3JA 2C07A 4EKNB 1NRXA 1PUIA 2HMTA 4OFXA 4DBLE 3RRJA 4JI4B 2Y1DA 5TARA 3SM3A 4S05A 1XALA 3CN7A 3PDWA 4Q4HA 4TV9B 2YWEA 2BE7A 5C37A 4TQAA 4IRUB 4K46A 2REXB 4ZI3A 1HKHA 3WBFA 1T25A 2JFYA 4PS0A 4PVDA 1WHSA 2NUAA 5AVUA 3MMNA 2QR3A 4FYPA 2AEMA 3QJ5A 4WSOA 3W2HA 1I10A 4LDQA 1OOEA 4IDNA 821PA 1UP7A 1K6MA 2B4QA 4Q34A 2REBA 2Q9CA 3FRHA 2X3FA 1XTTA 3QX7A 5FA8A 3BWVA 1WKBA 4MUIA 5B7PA 2WNIA 3L02A 5K99A 5I4IA 3LKDA 3LS2A 4KAAA 4RVDA 1JFSA 5AJVB 2TMKA 2DQ4A 2W90A 1F7UA 2J6CA 2KLHA 2PLAA 5C8XA 4JXKA 3H83A 4F91B 2W93A 3ZDDA 2A7XA 2WWYA 2XJ9A 1TAQA 1V39A 1WG8A 2JRCA 2VXBA 3R5HA 4K6KA 3COZA 4MW2A 1QOZA 2BEKA 3E70C 3G82C 3KR9A 4FP9A 1W85B 1HMYA 3R6TA 2ZJ3A 4BLSA 4D6PA 3LW7A 3RUPA 4OX9Y 1KL7A 1UBUS 4TWRA 4CMIB 2IYFA 3ROEA 3OLXA 2QX8A 1FQWA 4HQFA 2TYSB 4UREA 3RT7A 3R2JA 2I2FA 4R6WA 5FADA 3UF0A 4MRPA 4FDVA 4PYIA 4BNNA 3O95A 4DV4B 3RVSA 2X19A 3ON5A 4NOJA 3X1DA 2HLDA 4YRKA 3Q7SA 2SKDA 1C0KA 1JHDA 1JZQA 3CM0A 3GA5A 2X8JB 2LKDA 2PFKA 3U9SA 4BTEA 5J40A 3O93A 1GG9A 4E6PA 2ZTVA 2QQ0A 1VCHA 2MT9A 2J0EA 1IHDA 1WWKA 4YS6A 3RIEA 2IHBA 1T2NA 3OIUA 2QV7A 2XNKA 1DXHA 5C2JB 2I2WA 3V7YA 2FE1A 3DWGA 1U3WA 4L7QA 2ONJA 3ROPA 2YJ3A 3V9PA 3S2SA 1YKSA 1MZVA 4BO1A 1PL0A 1R5OA 3KZOA 5KVAA 4BAGA 3G23A 2WWRA 5EL0A 1KO5A 3PC3A 4JD5A 1W85A 4LTDA 3VKWA 1Y3FE 3ESCA 4YN3A 3U9TA 5LLTA 1B0AA 3NM4A 4CMIA 3T9BA 3RRMA 1GXSB 3UAGA 4ZKEA 4A6EA 4F6RB 1JMYA 4BY9E 4B80A 4RABA 1CC1S 3UB4A 2ZPAA 1LB1B 3EEBA 4CCSA 1T9AA 4J1TC 3CKKA 1HT0A 3I83A 4EJ0A 1J8FA 1A95A 1EXVA 4CQMD 4G3XA 3T9DA 2XNJA 3IVMA 3HCCA 4R9NA 1QANA 1IC6A 1PQUA 2O2EA 3IO5A 3PQ7A 2DPGA 3DVRX 3ZLUA 5ILOA 1HRKA 3RS9A 4DM4A 2GF2A 1RACA 1XMVA 5KTMA 2UZ0A 4AIRA 1Q74A 1UADA 2VWGA 1PWYE 1HUQA 2JI7A 3NAGA 2C7PA 3COYA 2CT8A 5A0VA 3FBWA 4V0LA 1JQLB 1U7XA 2YWRA 4GWKA 3DXZA 4O4JF 5A3SA 3SOZA 4DS3A 3BE8A 1KZ4A 1DTWB 4H6VA 3BG5A 3PPXA 2NXJA 2I6UA 1FRVA 4H4DA 3U7QB 1GUAA 2YWJA 3BXPA 4J07A 3CMCO 4MARA 5A5GA 1GXSA 4RQBA 4F6RA 3BWDD 3R5XA 1CFZA 4UU0A 2G7ZA 3I53A 4ZRNA 2JVJA 2FSGA 3M3PA 1U7HA 5CHEA 4ZZ0A 3UT0A 1KQOA 3P9KA 3AJAA 4L8FA 1E0SA 3H87A 3OMXA 3ZE8A 1DRUA 2ZBRA 4R1SA 4W6ZA 4BDTA 1U2GA 3JRWA 4KIJA 4E4YA 1RJGA 5JSFA 2PL5A 1UBGA 1IWBB 2K6GA 2XMSA 1BDMA 1SBHA 3D7SA 5DM2A 1TJ3A 3UAZA 2GERA 3A4IA 2GN8A 3ZIDA 3OJCA 1E6MA 2VUHB 4PRYA 5LMNB 4AECA 1JKJB 1SXIA 4ESOA 3WRYA 4TTTS 3EQ7A 2IZ1A 4HVTA 5COQA 3GN2A 4ED9A 4WA8A 1SHTX 2AYYA 4MGYR 1KA9H 2C5BA 5EFZA 4BN5A 1RE1A 4YV2A 2YZNA 2CMFA 1MJGA 1RP1A 4PZEA 4QUDA 2QRHA 3HFSA 1DTWA 3ZS8A 3TOCA 3TRFA 3U7QA 4EL0A 3QEBZ 1B4DA 1WKVA 3VO2A 2JIDA 4LZJA 1AMUA 4AN1A 5DTJA 2WMDA 3NXSA 2WSSD 4I4TF 5IDYA 3UOWA 4QSHA 3C43A 3NVAA 3WLSA 1U2PA 4BAZA 4R1LA 5MGNA 3WXBA 3SICE 3GFOA 1R2QA 3D7MA 3TL6A 2DLCX 3WL8A 2VRBA 1SVSA 2PSJA 1KH2A 3A3KA 5AH0A 5TX7A 5K0ZA 3UMJA 2BUCA 3GLFE 4K9RA 4Z1MA 1PFYA 1X1EA 2I6TA 3CN9A 4QD3A 4QEDA 2YNMC 1H4SA 1QO0A 1UPBA 1S4QA 3AUKA 2OKCA 3ZHUA 1SQSA 4MVYA 3OHSX 1NLYA