1JPVA

Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with so4
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
235
structure length
235
Chain Sequence
NPVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGFLVYTGKYNGETVSIATHGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSDNLAKGGIWITKEELEKSVMDGAKAVLDTLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-deoxy-5'-methylthioadenosine phosphorylase
publication title Three-dimensional structure of a hyperthermophilic 5'-deoxy-5'-methylthioadenosine phosphorylase from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 78
structure length 235
sequence length 235
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2001-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jpvA00
4TTIA 1U1GA 1N3IA 3KUKA 1JDSA 1SD1A 5B7PA 2AI3A 1JPVA 3LGSA 2IQ5A 3IEXA 1ODIA 4X24A 5F7OA 2P4SA 1LX7A 1YQUA 4UC0A 3P0FA 3BJEA 1A9SA 1PWYE 1JYSA 1WTAA 1Y1SA 4TXHA 1YQQA 2H8GA 5B7QA 3EMVA 4QARA 1I80A 3UAXA 1RXSA 1YR3A 1Z36A 4OEHA 3UAVA 4L6IA 3OOEA 4OF4A 1JP7A 2AI1A 3ENZA 3OPVA 1PK9A 4QEZA 5B7NA 4NSNA 1SD2A 5EUBA 1Z34A 1Z35A 4L0MA 4GLFA 4DANA 1JE1A 1PR0A 1RXYA 1A9QA 2HN9A 1Z37A 1PR2A 3KVVA 3KVYA 4TXLA 1RSZA 4YMLA 1A9TA 4OJTA 5CXSA 4BMZA 5F7ZA 5ETJA 2OC4A 4U2KA 4D98A 1RT9A 5JPCA 1PR4A 3IOMA 4K6OA 4PR3A 3NM5A 1JDTA 3PHCA 3E9RA 4D8YA 4L5YA 3MMSA 5IU6A 1LVUA 4R31A 2A8YA 4I2VA 2OXFA 3ODGA 3DP9A 5C80A 5CYFA 1RFGE 1YRYE 3BL6A 3DPSA 3FUCA 5B7GA 4GKAA 4LZWA 1VHJA 1Y6RA 1ZL2A 3OOHA 4GLJA 4PNPA 2PGAA 3D1VA 1PW7A 1ODKA 3F8WA 3PNSA 1SJ9A 5EFOA 3NM6B 4F1WA 3GB9A 3K8OE 1V45E 1V4NA 4P54A 4TS9A 4EARA 1Y1TA 2HRDA 2A0XA 1V41E 2QSUA 1ZOSA 1B8OA 4TS3A 1T8WA 1PR1A 3OZDA 2I4TA 4BN0A 3GGSA 1Q1GA 4D9HA 5F7XA 4L5CA 4NY1A 3UAZA 4TXMA 1PR6A 4TXNA 4L5AA 2XRFA 3UT6A 4BMXA 4IP0A 3SCZA 1FXUA 2GUWA 4D8XA 4DARA 4LDNA 1A9OA 3NM4A 1JDVA 1OUMA 4BMYA 3TL6A 1Y1QA 1NC1A 1QE5A 4D8VA 1A69A 1Z33A 3FAZA 2B94A 1TCUA 2RJ3A 1B8NA 3OF3A 1JDUA 4LNAA 4GMHA 4YNBA 1V48A 4JWTA 1CG6A 3UAYA 2A0WA 1Z5NA 3INYA 4WKNA 1T8SA 4WKOA 3KVRA 1XE3A 4YO8A 4DAOA 4FFSA 3T94A 4M3NA 1CB0A 1T8RA 5F77A 4M7WA 1M73E 3DDOA 1K3FA 1PKEA 2A0YA 4QAQA 3QPBA 4TXJA 1ODLA 3KHSA 3OZBA 1RYZA 1C3XA 1A9PA 5DK6A 1OTYA 2ISCA 1T8YA 4OGLA 1PF7E 3LBAA 3EEIA 2HSWA 3PNPA 1SQ6A 4NS1A 5F76A 1T0UA 4QASA 4H1TA 5CCEA 2BSXA 5CYGA 1V3QE 1K9SA 4WKPA 2ON6A 5F7JA 4G8JA 4DA8A 1V2HE 2OC9A 1TCVA 4G41A 5F78A 2Q7OE 1VMKA 3NBQA 2HWUA 3E0QA 1U1FA 4DA6A 1A9RA 1JDZA 5K1ZA 1NC3A 2AC7A 3KU4A 1VFNA 3O4VA 4DA7A 2OECA 1ODJA 4DA0A 4DAEA 1PR5A 1RXCA 1OV6A 4R2XA 4MCIA 4YJKA 3OZEA 4LKRA 3UAWA 3MB8A 3PHBE 4QFBA 1Z5PA 4R2WA 3OCCA 5F73A 4WKCA 1NW4A 1U1DA 1Y1RA 1OU4A 4OGKA 2I8AA 4F2WA 4TTJA 1RXUA 1ECPA 3O6VA 2QTGA 3BGSA 3FNQA 4DABA 3BSFA 5FAKA 2QTTA 1PBNA 2QPLA 1ULAA 4F2PA 1YBFA 4MCHA 3K8QA 1U1EA 4F3CA 4ECEA 1Z5OA 3FWPA 1U1CA 4MARA 1TGYA 1LV8A 5CCDA 3FOWA 3OZCA 3FB1A 4F3KA 2QDKA 4RJ2A 4JP5A 3E9ZA 3LA8A 4LNHA 1RCTE 1TD1A 4WKBA 2AI2A 4JOSA 3ONVA 4EB8A 4QATA 4G89A 4KN5A 1JE0A 5IFKA 1OTXA 1RR6A 3DJFA 3EUEA 5CXQA 1Y6QA 1VHWA 1G2OA 1Z39A 5KB3A 1TGVA 4OY3A 4TYMA 5EPUA 5I3CA 4TTAA 1OVGA 3EUFA 3DF9A 4E1VA 1PK7A 3C74A 1K27A 1ULBA 4M1EA 3P0EA 1Z38A 3U40A
chains in the Genus database with same CATH superfamily
4GLLA 4BC1A 3CH6A 1B74A 3I64A 1O4WA 2CYCA 4LV5B 4D41A 4EPTA 3U61B 4GOJA 4S1VA 4EMUA 3D7SA 1AX9A 3E5RA 1OAKA 2R44A 1GNLA 2Y1WA 3BA1A 1O95D 3GDOA 4OHVA 1ZI9A 1KEZA 2JIMA 2OO7A 2ZJFA 2BGUA 3PDUA 1DBPA 4UCFA 1YGYA 2UVDA 4X7RA 5HMMA 4OQQA 1AJEA 5G1PA 2WT9A 1KEWA 1XCJA 1ZZGA 2ZT6A 4PSDA 5TGTA 3RFUA 3ASUA 4QPZA 4D3SA 2JLYA 1DKPA 3EIFA 6YASA 1RAAA 1X13A 3H5VA 3O8NA 2P79A 4MEAA 3C5EA 1HTWA 1SB8A 3MCWA 3QE2A 3QYAA 4PO9A 5F1KA 3O95A 2HQOA 2A4KA 3LQYA 1M8GA 1OFUX 4KE8A 4Y7DA 4AUKA 3ZCVA 4R2JA 3FPKA 1VFPA 4MITA 4DNXA 2GI4A 3NJ8A 4TVSA 5JSZA 1U2TA 4O2BB 2RKBA 3CHYA 2WTMA 4PHFA 1P3Y1 1QVVA 4G5QA 1MVNA 5CDFA 621PA 1SG6A 3PQ4A 3P0FA 1E9SA 3OCWA 4EEXA 1F51E 1CS0A 5EQFA 1XCGB 4FDTA 4GMXA 1U02A 4Q3NA 4R84A 4LTNA 1KO4A 3V3TA 2ZDHA 5GM1A 2QUJA 1LX6A 4RIGA 2GWHA 3KPYA 1W2HA 1BA2A 1CY6A 4BAUA 1EESA 1IUNA 4OBXA 1JQKA 4TXHA 3WGOA 3W2FA 5KMGA 1CUGA 1IEVA 1XN4A 4F1KA 4Y0VA 1VIYA 4MKHA 3FYUB 2J9XB 3VPGA 1CFJA 3B2QA 4C4XA 5KKCA 1T9BA 3UGQA 4UMDA 1ULZA 4PZEA 4DRYA 2BEJA 1J0DA 5KNLA 4RY0A 1XD2A 3MGKA 4X1YA 1ILEA 1F4LA 2NT4A 1SWVA 3ORYA 2IUYA 4HYYA 4MSUA 5BN3B 5JC8A 5HRUA 1JR4A 3OOEA 3HRHA 3L7MA 1RZRD 1IDOA 3WRYA 1GN8A 2I8CA 5E6SB 3QE3A 4L76A 4KSBA 4EITA 2BSQA 3K0EA 4TMXA 3BILA 1RWPA 3SLGA 3U6KA 5DTIA 1WL8A 1VMIA 2W2LD 3ZGYA 2XUJA 2X5KO 2I9PA 4IIGA 1M74A 3E9YA 3SHTA 4AUEA 1MENA 3FDZA 1XK7A 2QD2A 3KRTA 3P27A 1GCOA 1SD2A 1QNLA 5EUBA 1U7XA 4MMZB 3HL4A 1PSDA 1HZZA 4Z3KA 4YCBA 1GDHA 3LHIA 3HA5A 3KJEA 1CJVC 1UH5A 1JILA 3K9HA 1ZD4A 3GARA 2XIJA 1B42A 1AY0A 2GJ8A 5JSKA 3K1TA 1G41A 2CNKA 2QTLA 2PZLA 1OHHA 1T91A 3EE6A 5KWEA 4RPLA 3DWEX 5G1OA 3DS8A 1SUSA 4J90A 4FWTA 2ZRQA 3WKEA 4R81A 2M98A 1JAXA 1N2CB 4OJTA 3LU1A 4WLOA 4RANA 4DCUA 2QMZA 5CXSA 4BVEA 3FW1A 2R11A 5FA8A 3AXTA 3RUFA 4WD3A 1HKUA 2IRWA 2OESA 3HVKA 4ZV7A 4QOIA 2BHNA 5DLEA 4CLEA 1YC2A 4NOMA 2QTCA 4B76A 5M34A 1MP0A 2O05A 2XE4A 4R1SA 5J1SB 1T1JA 4LQCA 2A94A 2B25A 5EZYF 1T9KA 1UPCA 3OICA 1Z16A 3H9BA 3CVWA 2H7XA 2ZS7A 4NBUA 4PYNA 4DYHA 1FDVA 2X13A 1XVLA 3JATB 1XDGA 4PR3A 3Q12A 1OA0A 1OAAA 1YZYA 3HL0A 2JGAA 1GL6A 1J07A 3NM5A 4MUFA 4CDNA 1VJCA 4F60A 4EVQA 4WACA 1TO1E 3TECE 3GLFA 4JWKA 1CR0A 2IU6A 4MR7B 1CVIA 3IP6A 1YDGA 1QYXA 5HHTA 1R0XA 2H0AA 1M34B 4MYRA 1YB4A 5J63A 3KQWA 4F3YA 1DP4A 3EF0A 1O3YA 3K73O 2Q2NA 1P2FA 1X1RA 1YDEA 3PHHA 3DTVA 2JRCA 4RK1A 4EKGA 2CUTA 2CJFA 3MC1A 4YJ2B 3NFYA 3B6ZA 4UOEA 1LBSA 3JQFC 3EG5A 5A2QA 1E7QA 3HHPA 1UDXA 1T2FA 4QODA 1NJ8A 3F67A 3PC2A 1DMRA 2B21A 3NKLA 4RQUA 4EDFA 3D8NA 2YX1A 3TH5A 4F5ZA 4Y6QA 1UDAA 1Y6RA 2RHMA 2VBCA 1BW9A 3A4NA 4MUKA 3GUYA 5DN6D 1UDCA 3HUDA 4DMRA 5E6UB 1OROA 3FZGA 1K06A 2AW3A 2I62A 1EHCA 1KJJA 1PW7A 1IZ0A 1JHXA 2F1IA 1Y5LA 3FBGA 3GXBA 3I5AA 3SYNA 4C4OA 1USGA 4PPNA 4L5BA 1NUHA 2IIPA 3K31A 2Z9CA 3PNSA 5KWIA 2IBSA 1HG0A 4M37A 1GT6A 3IBYA 4DRZA 3F46A 4UDOA 5LWHA 1LK7A 5IDYA 2MINB 3FLAA 1K6XA 2EJBA 2YQZA 3BGOS 3BREA 3KXPA 3OU6A 4F8YA 3FOEC 3CY6A 4BX3A 4E09A 3GEBA 4K9NA 3SE7A 2JATA 3R7LA 2QE7A 3WICA 4C4ZA 1Y1TA 4C30A 3OX2A 1CUIA 4BO8A 2XHEA 3GGGA 3QF4B 1KP3A 1UZMA 4GQAA 4Q1CA 4V0ME 3ND9A 4ARZA 1YI1A 5T64A 4JC4A 5H68A 3GJ4A 3RAPR 4AS1A 4OJQA 5AUPB 3B9QA 4JVSB 1AKVA 4RGBA 3WYFA 4YJFB 4RULA 1N36B 3QLJA 1LW6E 3R3YA 4KPUA 2CNBA 4A82A 4WLUA 4YMTA 1MIOB 1OI7A 1W5BA 2QN8A 2JAUA 5DGTA 1J42A 1FB5A 1PU2A 1V7PC 2GLTA 4MA5A 3ZDXB 4DGQA 1RXWA 2RGDA 3MN1A 1TJ4A 3W34A 3AY3A 1OYVA 3RUEA 2BKVA 1UJCA 5HKKD 4FYPA 4Q82A 3ND6A 3TOCA 1XFAA 5EEGA 3EG9A 4EB6B 4BVBA 5KPDA 2NO7A 3C39A 2CK3A 4WFQA 3T4PA 2BZSA 5KJEA 3TQFA 4MUXA 1KI1A 1XEXA 2VBGA 1N2CE 3IDAA 2XRFA 1GKKA 3M6MD 3B8EA 3NNDA 3PF9A 3CJQA 4UULA 2AJDA 4OGWA 1I2AA 3DTTA 1AH2A 5C53B 3EPJA 1EXDA 3R3HA 3I5UA 4QQKA 4I19A 4A91A 5TY0A 4HLNA 1ZJ4A 1JHQA 2QAGA 3ETJA 2XBUA 2Q28A 5FI1B 4EY6A 5BSFA 1JKFA 1SEPA 1J33A 2ZTLA 3I12A 4PW0A 5DK4A 5JFGA 4BEBA 4HRXA 2HJSA 1E89A 3G6WA 3I1YA 3DD1A 4LGCA 4GVPA 2SCUB 5TEVA 4C05A 3FTFA 1U8XX 2WT8A 2B99A 3ELYA 1P7VA 4RKRA 1F2TA 1VA5A 1RPAA 4TTVA 2P9HA 4NPAA 2AQ8A 1M9NA 3RARA 1Y8RB 4DUPA 1UPXA 3NP7A 4GMHA 1N9GB 1OLSA 5A3JA 3WWYA 3O03A 3SF0A 1EK6A 1M34E 2JBWA 3STTA 2I6QA 4IHJA 2P3SA 3RT7A 4DLSA 4O2AF 4WKOA 2MYUA 5BSVA 2IYVA 2YYZA 4JUBA 4EX6A 3EX7C 3IT0A 4MVJD 4AZ0B 2R97A 2QMHA 1J8FA 1X9GA 3LRTA 4KAFA 1XQ6A 3LLSA 2QM3A 3QUBA 3GJZA 421PA 4AWBA 4XDYA 3O47A 5K0CA 1A04A 4M3NA 2PLNA 3GT0A 4MQ6A 2XIQA 4YBRA 3VU9B 5JVDA 4OGGA 1Q2XA 4PXSA 2JHGA 4F11A 1B1AA 4KWCA 4YACA 3WOVA 3EQZA 3HYCA 2Q45A 1HTBA 5CUQA 3UXHA 3GJ7A 3SEFA 5ALEA 4HLDA 1YDMA 3KSRA 1B6SA 3VOTA 2EU8A 2BTEA 1MV8A 2REXB 3BJMA 2ZYVX 4WK4B 2CBGA 4BNDA 4Z3OA 2PVCA 3D8TA 2JI9A 2ORIA 2YMQA 2AFRA 3MT7A 3OJEA 4RJLA 2RH5A 5AM4A 2FUG1 4KR2A 3HJRA 1SCUB 2Z5GA 3ZLVA 3EF1A 4OBWA 1M3SA 1ODLA 1TAGA 3PEFA 2QTVB 1W76A 2QR5A 3KHSA 2JGNA 2QHXA 2ZW9A 3N28A 3DDHA 2XBMA 1CE8A 4WNCA 3NZEA 5F5LA 3KELA 4CMJA 4LJSA 4JSRA 4LC1A 1YRBA 1Y9JA 4OGLA 4A8TA 1E3DA 1T2EA 16PKA 2JAQA 3JQ8B 3SIWA 1W4RA 2D4AA 1VHLA 2MYNA 3HFGA 1NQOA 1E3JA 4QDUA 4UTOA 1L7MA 3DA8A 5FO0A 1A8PA 1Y37A 3BMXA 5GTDA 3U56A 4M1MA 1SKQA 1UC9A 3F6RA 4NS1A 4OJNA 4PAOA 4Q24A 4RE6A 3LUPA 3IAUA 2OKGA 3TTTA 4MRPA 3AHFA 4LW8A 2QUIA 4F9TA 1PNQA 3AJAA 4H1TA 1H42A 4N18A 3FXAA 1DC8A 4EG5A 5CCEA 1UUFA 2JA2A 3TAHA 3WE7A 3JS5A 1JTEA 2MMCA 1RQ7A 2NPIA 2XQFA 4WXRA 1W7AA 3VTZA 1XTUA 1K9SA 4WKPA 4BEJA 3QA9A 2WJAA 5K9ZA 1E3TA 5B1SA 4H1UA 3W2IA 1E2MA 3OH8A 2PEZA 1QO7A 1RQ2A 1V95A 2C0PA 3FPLA 4C01A 4YYZA 2YJ5A 1LNZA 1YCHA 4KSYA 1D4AA 3PHGA 2CFCA 1NN5A 1A5AB 2GO7A 2VQSA 4O4HA 1L5VA 3DXYA 2CNOA 4PE5B 4ZQFA 2EYUA 5CDGA 5J4KA 2AOTA 1H2YA 3WXMA 5ENDA 1NC3A 5K45A 2JLWA 1VFNA 4E4YA 4F4HA 2NTVA 4ZQBA 2CW5A 5DYYA 3U6BA 3P26A 3ZHQA 1Q12A 2ZBRA 2HOQA 4D6PA 4LMPA 1A7UA 2WU4A 2WTXA 4G3XA 4P4NA 3KJQA 1ZFNA 2V65A 5AOAA 2X0FA 4DTCA 5KYTA 4IDEA 2I7VA 3GAFA 2VRWA 4MVYA 9MHTA 2ETXA 3CCCA 1C8KA 3OCYA 1C1HA 4NF2A 3CG4A 2C9CA 5CYOA 4DBVO 1X86B 4ND2A 3KJGA 1KS2A 3AMVA 4HZIA 3UMJA 3OJCA 1AKNA 5GINE 3DJYA 1U6JA 1TZ2A 1U90A 1LWNA 5MHTA 4CKBA 2PFGA 1G3MA 2GFIA 1KEEA 4QUAA 1E58A 4C7MA 4PLTA 5TARA 1HI9A 3TTVA 3K0SA 4MV7A 2QROA 3UFXB 4C5AA 2JIQA 1NXWA 1DT3A 4HNVA 4X94A 1RIIA 2AMYA 2NAFA 2WYOA 4NFYA 2J41A 4OGKA 4ZCLA 3WK7A 1Q7CA 3GR6A 3TIVA 3LW8A 1ZHHA 2FF5A 3C5CA 1JMKC 3HDHA 3I73A 1KZ4A 4DJEC 2WY2D 4JXXA 5A3QA 5AXBA 1WM1A 3ZZMA 2Y6VA 1L7BA 3LQKA 2OGZA 1FRVA 4GOLD 5A1TA 1EGQA 2MWMA 4FUQA 1AU9A 2ZBDA 4NBRA 4BLUA 2K2WA 2ATCA 2VOEA 2ZWIA 3F7NA 4Z0TA 4FDLA 4GXQA 3SK0A 1NJFA 2QPLA 1J00A 1ZCAA 3UF0A 1RRVA 2QZPA 4JBHA 3AOEC 3MAGA 1GTL1 2I8LA 3VR5D 1TZMA 1L8XA 1MC8A 4HDOB 4RKFA 4EGSA 1MB0A 3KT0A 2JEOA 3TMKA 4LNUB 1A2OA 4QYIB 2FY8A 4ECEA 4RA9A 4YRFA 1WXQA 1UMCB 3P2YA 2LCQA 3TDNA 2O2EA 4Z54A 5FTMA 2C9DA 1TGYA 2QUKA 3I09A 4XE5A 1B16A 3KQOA 4G1FA 4G23A 2IE8A 4RIFA 5JWHA 2FLWA 3OETA 4Q7KA 4LYEA 5H3CA 2XVMA 1CRWG 4YGYA 2QZZA 5EXPA 3V8NA 1HNNA 2C58A 5DWQA 3OIDA 4RJ2A 1W2WB 2SICE 4MKXA 3SU8A 4ZDJA 2Y1GA 4WKBA 4ZI5A 1R9JA 1P6XA 4BB9A 1AQUA 4TYWA 3H5OA 4U3JB 1NXXA 3HP4A 3HVRA 2E4AA 2JG3A 1JS1X 1XDDA 3FX2A 5JNRA 5HPYB 3HZOA 5HCIA 3P9PA 3NDBB 2AZ4A 3AY0A 4P4LA 4Z9BA 4H7EA 4PR0A 1NP3A 1PV4A 2Z5FA 4NBSA 4C3UA 3B8HA 2G07A 1E2DA 4TMYA 1OSNA 2FK7A 4Q6BA 3ME5A 4W9NC 5K0GA 1G8YA 3DTVB 4MI9A 1WXHA 1P7PA 3WWOA 3UH0A 4E46A 1L5FA 3BGIA 2FMKA 3QKTA 3EUEA 1J22A 2PCJA 3C8HA 4JR0A 5IF3A 3WGQA 1VL0A 1K8XB 1BMQA 2VZ9A 2QBYA 5CDFE 3L1UA 3NT2A 1FX0A 3SWWA 1NBWB 2VF8A 5IAGA 2F64A 5BWOA 1YR7A 3BRQA 4RH0A 2HV8A 3MSCA 4R41A 5JW6A 3KKQA 1YJQA 2PD3A 3QE9Y 3EVBA 1E2GA 4WCFB 3GJQA 2C31A 4NEGA 4OQXA 4W5WA 1TJYA 3ZVKA 1P1IA 2R00A 3A58B 2Z2KA 4HLQB 1UDRA 1XZQA 3D5QA 3UVEA 1N8KA 4UVIA 1WG8A 3BT7A 3GEPA 4IDDA 5TPZD 2RAFA 1Q74A 3AT1A 3TD9A 2WIDA 3UAOA 1RQXA 1SC4A 4IWYA 4JOCA 3T3DA 4KFCA 1NSTA 1K8QA 1O95C 4IF4A 2PIAA 4KIGA 5EKDA 5FUVA 4MUNA 1JG1A 2ZXUA 4XIGS 1E2UA 4DLWA 1USUA 1F9AA 2QTRA 3P9SA 2R6FA 2XF8A 4FI3C 4U9IS 4ZZ2A 2HA0A 4I3GA 1I2MA 5C1BA 5I4KA 3RRMA 1MV5A 1PFVA 2PUBA 3E53A 2VF2A 1K7FB 4Q12A 4R2HA 2LGJA 1QCYA 2X7HA 4NL4H 4WN9A 4XUGB 4GUAA 1ZMTA 4I4TB 3QMWA 3JQAD 2G8LA 2O8NA 4CBVA 2VHCA 1MEOA 2CSUA 1S1MA 2IVZA 1VBKA 1ZUNB 4RQAA 3R75A 1G5TA 3L4BC 1DHTA 2XQKA 4YR9A 5FWNA 1NXPA 1JGTA 4X24A 1RWOA 4FVTA 4W7HA 1PJ8A 4KLAA 2H31A 4FS3A 2XZDA 4JFRA 4Y67A 4EHDA 2VPPA 2O57A 3GYBA 3SLRA 4U7DA 3KDAA 1EP2B 1QQ5A 1XOIA 2Q3LA 2Y2VA 2EHJA 2G25A 3DKVA 3C1TA 4P33A 5F4ZA 3T3HA 2AN3A 2I4RA 1RYMA 1YUNA 4XPIB 2CYAA 1LS6A 1SAYA 5A0FA 4NVRA 3RTEA 4DLRA 4BNFA 4OQLA 1ZK2A 1WTAA 5LZ2A 4GI5A 4QWMA 5CH8A 2F3RA 3GP5A 1ZGZA 3IKMB 3BFKA 3TG8A 1G66A 5AMXA 5JSYA 1KI7A 2GN9A 3QNUA 3HUFA 4JLWA 3O91A 1A0OA 4OXKA 1R4AA 3CURA 4KQWA 2AF4C 1N5JA 2XWJI 4RLFA 4YAUA 3CLSD 5LJIA 3N07A 3QU4A 4RY9A 4YECA 3RODA 1RXSA 2FFRA 4RGVA 2A0FA 4HVLA 3GAMA 1GVHA 4R71A 5ADUS 1D2CA 3WGUA 2R86A 3CSSA 3EWNA 3FUWA 1GTG1 2GD6A 2WPDA 3M6AA 3VHXB 3ZV7A 5KOJB 1QHHA 1DRKA 2W6QA 3E8MA 3QX9A 4S12A 1MC4A 1BKSB 4P2BA 1H4VB 4CLHA 4DCJA 1S8FA 2O4CA 2FQWA 2PV7A 5I7WA 3UMSA 2VXOA 1P5JA 1W59A 1SVLA 4P22A 5BOSB 2QUHA 2RGAA 2BEUB 4IWNA 4JU8A 4ID9A 3BMQB 3RC7A 1PT8A 3B51X 1ZNQO 3C1AA 2JCSA 4QDXA 4Q4AA 4F84A 1PQ4A 3BULA 3LD9A 1TMKA 4O5AA 4CF3A 2RHDA 2HJWA 1DBSA 2W5UA 5I7FA 3LP5A 1MAUA 4RS4A 1TTTA 1JI0A 2IF2A 3NDJA 3P9ZA 5A6VA 4C21A 1YV9A 3A0UA 3C6KA 2WB4A 3QENA 1X1AA 3LXMA 1HC7A 2ZAMA 1Z37A 3CF0A 2JAOA 3FDXA 3FCEA 2H57A 1YDFA 2IYZA 3H18A 1KYXA 3PUWA 3QY9A 3GL9A 3LY5A 4KQ6A 3N59A 5FHQA 4LHSA 1UBMS 2C7QA 1OBVA 2A4MA 1NUAA 2X6QA 5D3MB 3SP1A 3SICE 4CEHB 2DLCX 3QU2A 4KQEA 4ACAA 1WUHS 3IX7A 4E94A 4R68A 4X54A 3LQ2A 3WFIA 4BNIA 1GL9B 2R48A 2ZQZA 4RFSA 5HJ2A 3ZV6A 2TSYB 2O8FA 4EG8A 1BXRA 1OE0A 4M9XA 4QTTB 1Z7WA 3P0JA 4URVR 1Z0DA 2F59A 2NAPA 3FRJA 3OEHA 1E8MA 1ZOOA 2OVBA 3ABRB 4OMCA 2R6ZA 3OFJA 3U4QA 1J39A 3S68A 3NC0C 3FUUA 3FWNA 2FYTA 2Q0XA 4ZEWA 5FOVA 2EBHX 3ONFA 3ZE1B 2Q7XA 2QRZA 2ZJOA 3IDOA 3K72B 4ZTUB 1B7GO 2XTMA 1UDWA 1K63A 1ZJ5A 3WMXA 5AKXA 1H6CA 3AF3A 4EECA 2JJ1D 3Q2IA 4TM8A 5DSTA 2OA0A 3VAZA 5B5SA 1ZG3A 4Y1FA 4K9QA 3FBWA 4YRDA 3VR1A 5I45A 1K0FA 4AP5A 5FEMA 1N4DA 3K6RA 4OATA 3ZW8A 3SFZA 1N32B 3IUEA 2ZRFA 4CM6A 4Q3BA 2FDCA 1G8SA 4JD5A 4ZRMA 4QUIA 1FP6A 2QR3A 1B2LA 3LHSA 3TNDA 4HH3C 1ODSA 4NDZA 4X1IA 5CB4A 1LBHA 1J9ZA 1XGKA 2AUNA 2MSEB 4HQ0A 3AOGA 1DAMA 4IGIA 4UE2A 4EVIA 2V54A 2AMJA 3COSA 3VNQA 4EQZA 5A04A 1G9XA 1ZW1A 4Q4HA 5JZVA 1J24A 4GPAA 4I1SA 4GX5A 3CVVA 4UD6A 1P17A 3KVOA 3UMCA 1XJCA 3J7TA 4NENA 1NJ2A 1ZX1A 2FOIA 2F3QA 4DEYA 1DVRA 3MHPA 3DLBA 5DO9A 3AERA 2XGMA 1VSUA 5AO9A 2ZKIA 2HAEA 3RUDA 5K6TA 2ZJ0A 1ZAYA 4UOQA 5IXJA 4O4HB 4L8FA 1H23A 1FLAA 4OQNA 1Z7GA 5LNK1 3AR8A 3JAMA 3V4RA 3TLXA 2F1RA 4BTVA 3RSZA 2BR3A 2XDQA 5EFOA 3HGQA 2WAYA 1LKZA 5BWBA 4XOIA 3CZ9A 2HT6A 1E18A 1YZKA 3SMVA 2I3DA 4IH4A 1VL6A 2ZS9A 3VO2A 3IQWA 5L6LB 2IY9A 4G24A 4CQLB 2WWYA 3PQ2A 4AW9A 1DUIA 1Q22A 4MDYA 1KOGA 2DTXA 2QLFA 2IKQA 3E5NA 3VZBA 5CLFA 3BWMA 4J29A 4EVRA 3GJYA 1WA5A 3ZDQA 3MNFA 4L74A 1FYFA 3SJUA 2Y3IA 3NTVA 4KVGA 3VUFA 5P8WA 1GFIA 3VUEA 3P0IA 3AVPA 3HDJA 5H70A 1ZCBA 4Z8XA 1R6DA 4BPRA 1NGSA 4UHHA 3OZSA 1KEEB 1HH4A 1RZVA 4OB7A 3ZHZA 1DXQA 1KDPA 1XEWX 1T1EA 3WIEA 3QFTA 5FNVF 1HV8A 4EJSB 3V7UA 2WTBA 1GCGA 1V16B 1VDMA 4E08A 1ZY2A 3IKLA 4UXHA 1R6AA 2ONJA 4XWTA 4EY3A 3JZAA 1NULA 2HF9A 4P34A 3TOVA 2PS0A 1IUPA 4HWPA 2AXNA 1RRCA 1GNTA 3IVGA 3K70D 3ZWQA 3QVUA 4AX4A 1FXUA 3N3AC 4E3ZA 3N75A 1M6HA 4KGXA 5D5PA 4D8XA 5I7SA 1UT8A 1OUMA 3BJZA 3IOEA 4MIYA 1DTEA 1HOTA 2GKOA 4JKIA 4GVLA 3FVRA 2EFDB 3BFXA 3JYOA 3MRTA 3PFIA 1CZRA 1QE5A 3QKSB 1A76A 2CZCA 2HSGA 1DG3A 1EUDB 5BV8A 3R9KA 3OE5A 4S04A 3GPCA 3WGGA 5AW4A 3VI3B 4LE2A 4DLTA 1E0SA 4LNAA 3BHIA 2RDMA 1LI4A 2JLRA 3AO0B 2IVFA 3EIXA 4HEA6 3I2GA 3TJZA 3WLOA 1AMUA 3AKCA 1HSOA 1LCIA 2DUJA 2IPNA 5HGJA 1U6KA 1BCRB 2YJGA 3OUZA 2FEOA 1RLJA 1A7KA 2H29A 3A1DA 1JHRA 2DFTA 2FN9A 1DBQA 5D8DA 3T5CA 1RJEA 5ALJA 5EJAA 2WD9A 5EUCA 4D99A 5FNZA 5DVZA 2O5CA 1HR0B 1UPTA 4LRYA 4PO1A 1GN9A 4DAOA 5C8YF 2BFFA 2DKFA 2QMYA 5INTA 2D1QA 3LPAA 3MOGA 1Z75A 4Q1DA 3T94A 1QIDA 1E2FA 2HEIA 2IUSA 1DJNA 3N39C 3IUJA 3QWAA 1KRXA 1XKXA 3QGMA 5K3CA 5MFZA 4IRXA 1VYVA 4JQCA 1A71A 3BGWA 2WYUA 4MA4A 4ZVRA 5F2NA 3SGLA 1DAIA 3QBJA 5LA6A 3SD7A 4TRNA 1ECBA 2GB4A 2I65A 3QEKA 1SUPA 1YMQA 1UFQA 3UYLA 4FS8A 2CVFA 5I9BA 5TB5A 1XO1A 3R7DA 3U09A 3B1JA 3F1LA 1O94D 1OZ0A 1E6WA 2PNJA 2OD9A 1WQ1R 2Y1CA 4K9RA 4UAUA 4PCLA 3HFJA 4Q01A 1TRKA 3HV2A 1UXIA 4K03A 3PSHA 3IGFA 4RLSA 1XL1A 4EZBA 1LI5A 3MWKA 2AR0A 3AHIA 5DLPA 1WHSB 3D6FA 3W9BA 4F4CA 4HX5A 5IABA 3HDVA 3FTCA 1V5FA 1CUEA 2W8BA 3ASVA 4KEAA 4EY5A 2LZ0A 4F85A 1AKEA 1B26A 4CTJA 5K0BA 4EJ0A 3EEIA 3G1UA 1CTQA 4HN4B 2AFIA 1Y7LA 3UMYA 1G9TA 2H4YA 1GGMA 4BPBA 4XQEA 2FN8A 2WPNA 1QDUA 2ZTUA 3CCFA 4B4WA 3RDPA 2FKNA 2ZWAA 1X39A 2V58A 4CQNA 1YRHA 3CH4B 1Y81A 4EB3A 1SCNE 5CURA 2F9LA 2ZSDA 3CF4G 3O9ZA 3DLIA 3ZD9A 1C9DB 3KV3O 3NPMA 3RAJA 1Y89A 3OJFA 5JO9A 4C0XA 2HDHA 4QQNA 3AUJB 1EUCA 4GYJA 1WPXA 1YE5A 4YB8A 2YZ2A 4BNMA 4DA8A 3DEJA 3JD2A 1V9LA 4PBTA 2I7CA 5JQGB 1MFZA 1UC4B 2R66A 3K2EA 2H2WA 4HAVA 3X2FA 1Y4AE 2VS1A 3PGLA 4IBOA 1BZYA 5DNUA 1EVYA 4OHOA 2ZYHA 3LY8A 3S70A 1XR3A 4G63A 4KGDA 4DA6A 5B6IA 3Q98A 1P4GA 5ALWA 3PGJA 1VGQA 4J2OA 3CH7A 3M1AA 5FPKA 2FH5B 4J07A 1NDUA 4QSHA 2OHGA 3G79A 1YS9A 3MJ4A 3EB9A 3MTQA 3AJ8A 1RYYA 4OQ4A 2AFVA 1KR2A 4MQFB 4NARA 3CX8A 4R0MA 3NBZC 1W1IA 3PDIA 1Z2AA 3B20A 4W4TA 4MJLA 3A6HA 3EPKA 4LF7B 2XCRB 2R8YA 4K28A 1ZLYA 1W96A 4V1CA 1POWA 1ADJA 4DCGA 3LIIA 3EDYA 4C1NA 5JH7F 1PUXA 3ZJTA 2VN8A 2IEAA 1TRHA 2HMWA 2PKYX 3GBVA 1MO5A 4NWIA 1L7XA 4KXFB 1GADO 4PRZA 1C8VB 3GFOA 4ALLA 4GYKA 3OZEA 2DCUA 3CVUA 1PX2A 5CJ2A 1UJNA 4IDQA 2GZAA 4LKRA 1EFCA 4PCVA 3RLIA 1FUUA 3RHZA 5BSHA 2QGFA 4KMOA 5KJ6A 3D8SA 1CK4A 2WWWA 3EOZA 3RJMA 1TCAA 5F73A 4Y2YA 1CZLA 1U7WA 4DBLE 1QOZA 3ABIA 3AZQA 3K16A 8AT1A 3MFYA 4DY4A 4NYMQ 1N3BA 1AK2A 1NP6A 1QO0A 4E31A 2K4MA 4GICA 1VHTA 2COKA 2KB0A 1OT5A 4YASA 1XTBA 3WXBA 4FLMA 2I0FA 3W5VA 1PIWA 4WW0A 2VHVA 2YZMA 2QV7A 1QAQA 1P0QA 2QTGA 4Z4GA 3FNQA 1Z12A 4P36A 5JPDA 2F8TA 4ZN6A 1DX9A 1NDHA 3R5XA 3EGVA 2X4LA 1NUTA 3CKMA 1R0LA 2IA5A 2WWRA 3SFVA 1TU4A 3BWEA 3PI7A 4K88A 1VG0B 2NX2A 2X5NA 1MA0A 2BBSA 2WTAA 4OHUA 1NW6A 4F2PA 2PWYA 5CEEA 1C2TA 1MG5A 2TRSB 3WRYC 1ZH4A 1JNXX 3NGXA 3N0TA 1F4PA 4IIFA 1NQUA 5K2OA 2GK6A 3MOSA 1NBME 3RYCA 4KKXB 5K8TA 2R1TA 4JKYA 1LBIA 4BYMA 4XIIA 5HCNA 4JJ8A 2P5UA 3VZPA 4BBJA 4CGYA 5IUNC 4J9UE 4X6XA 5A0TA 2CXPA 1RI2A 1RWMA 3UZUA 3A1VA 4RFSB 3TDMA 3ET4A 3HO6A 1HZZC 5I7VA 3QPDA 3RIMA 5BN4A 4DG5A 4V1CI 4QTXA 2ODBA 2QY6A 3H75A 3QFFA 1ZGAA 4FNOA 1RCTE 4JP5A 3K2BA 4UMFA 3OSUA 1P29A 2HMUA 1N7JA 3CNBA 5E4FA 1P7ZA 5KX5F 5FL3A 5EIBC 4NONA 3S27A 3G2HA 3WNCA 4NECA 4GM4A 2VP0A 4JYBA 4ZVNA 1AUOA 1UP4A 2PT7A 1L5RA 3A3PA 4J8PA 4XSHA 3HBJA 4XI9A 2PQ2A 3CFYA 4P83A 1AC5A 4GNKA 4HYQA 4L51A 4IOJA 2J3DA 3CVOA 1Q1NA 3NANA 5BWLA 5FBVB 3R2JA 4LDZA 4NYIQ 1HQCA 4OM7A 3STWA 1E5DA 5I9LA 1VE5A 2J09A 3FSGA 5IT9A 2QTBA 3DJFA 4OHWA 2ZI4A 1TMYA 1N75A 3SQMA 4IIJB 1PGNA 2BELA 2DTEA 3V4VB 2DP4E 4BZWA 4Q03A 5I9SA 2AE1A 1IB0A 1VMDA 2BEWA 4R9UC 3RUIA 3H11B 2ONKA 3RYFB 3SR4A 3ZJ5A 1E69A 5FI5A 2DRIA 1OVGA 2OV3A 4DCCA 1L1QA 1QKJA 2XXJA 3KCNA 4H0FA 4LY6A 3H16A 4ZXPA 1FW6A 5J4LA 2SKCA 3O4HA 1V8DA 2XOEA 1H4SA 1C3VA 4NCAA 3BF7A 3AHDA 3RTCA 3SLKA 2HREA 1R5BA 3DYVA 3BE6A 3UOAB 2OYRA 1U1GA 1TK9A 2CXSA 1BGVA 2W83A 4P3OA 3TEJA 1X9IA 1I5OA 1RJDA 1C7RA 1T8TA 1CV2A 5K6RA 4ZEXA 1QG0A 4I5GA 1NVFA 3SX2A 1AKTA 2OLKA 3UB3A 5L4LA 5B7PA 3QWIA 3E9QA 3Q3EA 1BHO1 4FZJA 2B9VA 1PYOA 2A1IA 3K1ZA 3HYRA 1GL7A 4D9BA 3LGSA 4ZT4A 1HDZA 2HR1A 2XCLA 3DHYA 1BOFA 4AJ9A 3R3WA 1MU0A 1S4QA 4WY8A 2YIDA 3CIFA 1N0VC 2IQ5A 2XECA 3H7AA 2GXUA 1EFVB 2D8AA 5AK5A 5KHLB 4IDPA 4WBNF 3O2JA 5KYUB 3QTBA 3GGJA 1K9VF 1IWPB 4HFMA 1ZJYA 5FH9A 4U7GA 3QRWA 1X70A 1QVRA 3QPCA 1JJFA 3W5BA 1MAAA 1TC2A 5FL7D 1SQSA 1CY8A 3FHOA 1TM1E 2P3QA 2LV8A 4G5SA 3OT5A 5IYZA 4LXIA 3O84A 1JV2B 2JCBA 2QU7A 1P0PA 1KEVA 3OKAA 2B8NA 2CLOB 3SQNA 2J9YB 2V7QA 1Y3BE 2ZP1A 4QA9A 1RQRA 3HCOA 4L08A 3P96A 1VIDA 3CXRA 4OXRA 4HDRB 1IBCA 4UBMA 5IJZA 4AY3A 3QOWA 1RHRA 3V34A 4RACA 1TQ6A 2ZUWA 2PMEA 4CN8A 4QD3A 5K0FA 1DO8A 3R44A 5EP1A 2ONZA 5KTOA 4S1OA 5JT1A 4XCVA 1Z2NX 2W6JA 1A95A 3DAPA 3CLSC 4KZKA 4YVFA 5GVRA 1U0TA 4LE0A 3ZV4A 4GSKA 4I1UA 4A6DA 2P77A 2C20A 4DZZA 2GTHA 4GDFA 2J9FB 4L6IA 1CUCA 2IW1A 4YIKA 4CM8B 4DV3B 1ZNXA 4OHMA 4JFAA 4LSZA 2XUIA 3H9QA 2PE5A 1A9YA 2C03A 2PX0A 4N7BA 1JEYA 5D3KA 3ST7A 3KB1A 4KNWA 1OVMA 3W78A 3KQTA 4EA8A 2EW2A 4I1IA 1TF2A 4XJXA 5BVHA 5I4IA 5JFOA 3VVLA 3FA2A 3X1ZA 1X7YA 2EZTA 4R1OA 1X15A 1C30A 4B7AA 3O21A 5NLLA 2CLSA 4O5OA 1YS4A 3H1BA 2AN1A 2NO5A 1T3SA 4LI3X 1R3DA 1ADBA 2LTAA 4S1PA 3UNXA 1ZGJA 1ACMA 1G7RA 2BL4A 2O52A 4P8RA 3OLYA 3PYLA 2LPMA 4HWTA 4LOAA 4INJA 4A6EA 3RSQA 3EZYA 4DEVA 4AFNA 4X8MA 5LYJF 4AMVA 5EHXA 1RXEA 4YEDA 1G8GA 1T2AA 2ZSJA 2AC2A 5CLQA 2ODWA 2QRQA 2PMKA 4LF6B 4EO4A 2XVZA 1XK6A 3GDFA 4O1HA 4UHDA 2DWQA 2ZIXB 4A4DA 1PSZA 1WD5A 1Q83A 1T2UA 5LP6F 3PQ3A 5AJHA 4AS3A 3I6ZA 1N4AA 4GD3Q 1QH1B 1OY1A 3AETA 5JRZA 3VJRA 2VYQA 1VG9B 4KI7A 5MN6A 3IHTA 5EIOA 2OK8A 3ZLJA 4G5YA 3E05A 3V1NA 5SY9A 4Z99A 5L53A 2O2YA 4FLFA 3R7SA 5A4JA 3UA4A 2SNIE 1CS4C 3ZGLA 1NQ5A 2B4RO 4UEJA 2JGMA 2JZCA 3VYSB 3IHLA 3QJ5A 1F38A 2FUEA 3AU8A 3PXUA 1CVRA 4IAOA 4WZ6A 3WWPA 4NAVA 3FOAA 4KNVA 3UPUA 4OLAA 5IU6A 4W5RA 1G55A 3CLKA 1FP4A 4AL4A 3PRYA 1FSGA 4MK4A 1LVUA 3ND8A 4QBKA 2H59A 4O4LF 4M53A 4GZ5A 2H92A 1N5LA 4WZBB 1WJGA 2TMDA 4NYJR 5A6SB 3FR7A 3L46A 4H7HA 4K9SA 3VV3A 4DV5B 4PXAA 1U5BB 4LWQA 1WO8A 4BCDA 2IT1A 4GYWA 4OAOA 1YRYE 4WUTA 2BFDA 5JXWA 3Q5GA 1BFKA 3PXXA 4G0VA 2PRJA 4KH0A 5BORA 3CW2A 3E6AA 4BFVA 3DOIA 2K5UA 3UGKA 1V9SA 2H4JA 4MUBA 3DWGA 4MUAA 3A25A 4KACA 4JC5A 4CKCA 5KSWB 3ZNNA 2J46A 1ZLXA 2EF1A 5JAHA 5ALKA 5KYYA 3RPEA 3V32A 2ZRMA 1B0ZA 3M0EA 1PD1A 3TI7A 5TQ0A 3DUFA 4E5KA 3B13B 3FI0A 3KALA 4ROSA 4S3MA 3CJTA 4FSHA 4GYYA 5HQ3A 1LH0A 4TMTA 3PP8A 5BRNA 3I9FA 2GJSA 1NVBA 2NV0A 3GROA 1RKVA 1UBTS 2VYCA 2XUZA 4OHFA 2HK9A 5DP2A 5CFNA 1QRDA 5TS3A 1HRKA 2DY0A 1QGED 2QMEA 5IAKA 1SGWA 4M0UA 2NW6A 5BQXA 2FW0A 4K9LA 5IKXA 1RLIA 2HIHA 4RKQA 2ZJ6A 3KFXA 3ONEA 1GAQA 1C50A 1UFOA 3K8OE 3EDQA 2QB5A 2QZJA 4AZSA 2IOYA 3U9SA 2LIPA 3I0MA 4I0WB 4ZALA 4TZ0A 5CGQB 4MVJG 2Q5OA 5GOTA 3E15A 3NTRA 4BFSA 2A59A 2BGIA 2I6UA 2Q3CA 2GDJA 3GDHA 3GV0A 4K86A 4BECA 3NBFA 3SS7X 4BXOB 5ILGA 2ZBFA 2EATA 3AEZA 4JEUA 4PZUA 3WDKA 3NWJA 4YV7A 3W9SA 1EDDA 1G21A 1ZOSA 3HA7A 4Y2SA 1GRVA 4QSMA 2ROQA 3COZA 2J6CA 1PFWA 2W6ID 1FIUA 4UQPA 2JJMA 3AUFA 1BH2A 4H27A 5ECDA 3AR7A 5A6SA 3BBLA 5DV9A 1E6UA 2DBYA 3G7NA 2ZKLA 3U2QA 2R5FA 4LEIA 5EJ7A 1CZUA 1N0WA 3GEEA 3J81k 1M67A 2RSLA 1Z26A 1TMOA 4GQBA 2GPWA 2H7CA 2AZXA 4D0SA 1I2CA 4Q9LA 3TX2A 4PVDA 2DECA 2JHCA 3KM0A 5JC1A 4IKOA 1LDEA 3KWLA 3NXKA 4WFJA 5GONB 4F21A 2ANCA 2VHEA 1DXOA 4Y1EA 4Z9XA 1MJGA 3PEEA 4CM7A 2QTHA 4RA6A 1XJQA 2XYGA 3NHUA 5H4HA 1DG9A 1OFUA 5NULA 4A26A 4EI8A 3K70C 3SEZA 3DLAA 2D13A 5LOVB 1B8PA 3OPMA 4F8JA 4FW9A 4HO1X 1RRMA 2YVUA 2ZYGA 4IEFB 3F90A 4J6FA 1XQWA 2O8CB 1A9OA 2V74B 3IQIX 3K8YA 4M36A 5ANRB 3ZEAA 4Q47A 2JI4A 4TV8B 5FFFA 1V2GA 2GZ3A 3OLWA 1KI9A 4L7VA 3LKVA 5DI3B 4X0EA 3D4IA 3BE5A 5AKYA 2C9OA 1AGNA 1JU4A 1XUOA 4HATA 4DQUA 1R5JA 2R65A 3BFPA 3F9RA 2J0SA 3N2IA 1Z8FA 4M2LA 3F7MA 1NY5A 2EERA 2X8JB 1H65A 4CL8A 4UOZA 4KVZA 5CEJA 1VTKA 4X95A 4PCAA 2IC5A 4CIDA 4YIHA 2XI4A 4G5GA 1FYWA 1HT2E 1OF1A 2Y0CA 1L5QA 2OBXA 3EAGA 3Q72A 5JQWA 3EWIA 2HCTA 2PBZA 3INYA 4ZGBA 3QZUA 2BD0A 1GWNA 3H2KA 3I9OA 3L77A 3GX1A 1SFRA 3DL0A 1P4HA 4B34A 4MHTA 4YT5A 1L5MA 4C4RA 4C2TA 2O8BB 1ZRNA 1FTYA 1EJ6A 1RJWA 1UAGA 4MW5A 4ZT2A 4AI6A 1KY2A 3RSCA 3RVPA 3CINA 5DOZA 4DCNA 2BFNA 1EXNA 4NZ9A 1KI6A 3WQSB 3ZZ0A 5J4HA 3ITKA 2O1EA 2Q4OA 4RZXA 1K3FA 1ENYA 4BQPA 1QPZA 3HWRA 4JI0B 2ZBUA 3OT1B 1CDEA 4F86A 3WNDA 2EBUA 4AM8A 2CLFB 2XWSA 2BR4A 3V8BA 3GRFA 4F5YA 2FMIA 2BKAA 2WOOA 3T5MA 4BYGA 1JNYA 3LP8A 2ZJ5A 1C1XA 2IZ0A 1XHEA 4QNNA 1NVDA 3RAGA 3GLHB 4B7UA 2D1FA 2B6NA 2ZANA 1UPFA 2X0RA 3U7GA 2BEVA 2QW0X 1C29B 3HH8A 3MTBA 4RZ2A 3KBOA 1RZ3A 4EPRA 4ZZ0A 1Y6GA 4LSWA 4JK3A 1AKMA 4MVJM 2GUGA 3IUQA 2WUWE 1AN0A 1QHNA 5HFNA 2A1TS 1IHXA 1I10A 3IXMA 1ZRSA 1JSZA 1T9AA 3I72A 3TAUA 4DLKA 4B3DA 4YCDA 1CRLA 2EKDA 2QX8A 3T1OA 3ZBUA 1D1SA 1PSWA 2JDID 4M88A 1U2GC 3BA6A 2IYSA 1QHFA 3D9QX 3PNOA 4RTQA 4PY2A 1T0UA 2HKIA 4BVFA 5GPBA 5AJYA 3TCKA 3Q6IA 2C3PA 3WWZA 1OZHA 4AYXA 3D5TA 3K8ZA 1NVVR 4C9BA 1QV7A 2HDNB 3JSXA 4HEJA 1PNRA 1LS1A 2WKSA 2GN4A 1YBHA 1MO2A 1MRSA 2Z8ZA 2LKDA 3PDJA 3SKXA 3NHYA 2OXEA 2MSNA 2F43A 4MKGA 3V2IA 4RDIA 4C0HA 5A4DA 3SC2B 1DWOA 2QQFA 5JCXA 1E6CA 1T3LA 4DHWA 2A35A 1F0KA 1ND5A 4HI0E 4I50F 1A5BB 2ODQA 3QVOA 3IKJA 1XIVA 3QTTA 5F52A 3WIUA 2V5VA 2R00C 3E3MA 3G68A 4CCYB 1PV1A 2NXJA 1LPMA 4ZHQB 4DM7A 3VHLB 2OUKA 2W2MA 3N53A 3PUHA 2CGEA 4JBGA 1J2RA 1XAHA 1Y3HA 4YCAA 2PEYA 4R3NA 2NM0A 3LT1A 3K9NA 3PIRA 4YFYA 3TQHA 5A4IS 1S2NA 4Q4DA 4MYTA 3TPCA 1F0NA 4EO9A 4X92A 1GZ7A 2ZATA 2VQFB 4WA8A 1USKA 1ZM3A 5AM0A 1SUEA 2YWGA 3MCVA 4LWOA 1PT6A 3M70A 1SUCA 1JZQA 3A6GA 2H4XA 3QVMA 5GV7A 2G5CA 4IM7A 4UDYX 3T3MB 4MWTA 2GRJA 3B48A 5DGXA 2X7XA 3THRA 4BO1A 1EX6A 4I4IA 1M2OB 2NZXA 4O8CA 3RYTC 4HDMB 2IYYA 3TZQA 2YJ6A 3U49A 3D6HA 2AYXA 2WLTA 3QTLA 3EGEA 4HQLA 3HBLA 2ZREA 3GG2A 1YD7A 1N1DA 4JYMA 1LXCA 1YZVA 5F33A 2HQSA 1XA4A 3ORRA 3WO0A 4EFNA 1PFGA 5FBLB 3SIPA 4X66B 2O1SA 4B5LA 3LX4A 5LMUB 3AY7A 3OCCA 1W47A 5K4GA 4YRLA 4BZQA 2HHAA 1CR2A 1RDFA 4R1MA 4GGMX 1KVUA 3LVRE 3RKRA 3NHPA 3JASA 3MHTA 1X1SA 2O2SA 3NALA 2EKPA 5FPTA 5H3LA 3CUWA 3O4IA 1I6KA 1QR2A 2P9TA 3KQVA 1FDTA 4JS0A 4LN1A 3D7KA 4UPEA 1ONNA 3NNSA 2IXDA 3DQPA 4PG4A 2VHUA 3RLFA 2YNMD 5IDXA 2VTBB 1SWWA 1SCQA 4HDCA 3CLRD 1GT91 1NXTA 2G09A 2R84A 5AQEA 5BW6B 4DC1A 2JLXA 3CPJB 3TFOA 3IEVA 3FYTA 1LVHA 1DRJA 3TEMA 2QJFA 3GT4A 3FSEA 1XDSA 1TFRA 2ORWA 3G9ZA 4NYIR 3E82A 2IH5A 2Q0SA 2ZRPA 5K3OA 4JL5A 1ZBDA 2PPLA 5EZYA 3TSYA 1TA0A 1REQA 1WSDA 4B74A 2YN4A 5I6DA 3PNQA 3T35A 5IM4F 1AKWA 2UUCB 5CLGA 4ER7A 2UUAB 2J5RA 3EH2A 4YMIA 4ZO7A 4H3VA 1ZMOA 3CV3A 1PLKA 1RRPA 3LDAA 4HNAB 1GA1A 3EZGA 4O3MA 2MDTA 3AVUA 1SZJG 2J59A 2VZ0A 3INNA 1GV0A 3FWKA 1HUQA 3QITA 4FM9A 2E5FA 3E7PA 2QDKA 1H05A 2C29D 3V9AA 3ICQB 1TYZA 2G28A 2PGXA 3MBIA 4FXPA 4RZUA 1CUYA 1NATA 3TTUA 4HEQA 1C3LA 1MVLA 5BNFA 4N76A 3KZMA 5LR6A 1FQKA 2ZDGA 1WDKA 1QFSA 4A0FA 2PUHA 3ISJA 4EB8A 3DE3X 1IY8A 4ZGWA 4YK7A 2XDWA 1GZSA 2A58A 3AG6A 2VUUA 3JQ7A 1I4TD 1NR7A 4X8LA 5EJMA 4C6RA 1JE0A 3QV2A 1UBCA 3TX6A 3DE7X 1TEZA 1PL0A 2GN2A 4IDOA 3V1YA 1JAHA 2IJGX 2FG5A 3RYIB 1R0WA 1V7QA 2NOAA 2YV4A 3IVCA 4Z9AA 5DNAA 3VOBA 4CQMA 1CKEA 4JGBA 4D81A 5C32A 1DKOA 3AK4A 4RH1A 2VAMA 5FPQA 5BUSA 2G04A 1QHIA 3WL5A 3T0GA 1H1DA 2JLZA 3HDYA 1YS6A 2OFWA 5CM9C 4JYAB 1GPJA 3MVEA 1G2OA 1Z39A 1OFIA 4HZUB 4L73A 7YASA 1UFRA 1JQJC 3MJRA 5KB3A 1Y3DE 3NH6A 2J4FA 1UMDB 1T0JB 4XUEA 1KDOA 5CT6A 4OY3A 3WLRA 2AKEA 3THXB 2DFDA 3QOXA 3W6UA 2PBRA 3LHDA 1QQAA 2KPOA 1VKNA 4KPEC 1COZA 4LBVA 3KZXA 4XB6B 4QT4A 1Q91A 3BK2A 3HUUA 1XJWA 4TOIA 5TE9A 1ZPDA 3K7EA 1Z38A 1UZUA 1QCDA 3MUNA 4IHQA 5DIFA 1PQPA 1CQIA 2QIOA 2H3EA 2QRUA 1GOTA 3GELA 3D43A 1SUAA 4MVJH 5KC8A 1JHOA 2F9MA 3DBRA 4CCSA 1UKVY 2E82A 5JS7A 1QLHA 4BO7A 2GPAA 2NZYA 2QQGA 1T5TA 2GPYA 4GDMA 3QJGA 5L3SA 2GASA 4MQ4A 1H2BA 3G49A 1R74A 4ZAYA 1J6UA 3EY9A 3M4YA 3GEDA 3PDHA 2XQVA 3GN1A 4KTVE 5B2FA 4AMBA 3GZNB 3OF5A 2HMTA 4ODIA 4C08A 1OOEA 3CLTC 1JAIA 1ZUHA 3JYHA 3CZQA 1XMPA 3TCXB 5ALNA 3WADA 1Z13A 2DFLA 4XASA 3CBGA 4RF5A 2R6CA 3QHPA 1T9GR 2WP0A 1C7EA 2ZWMA 3KDSE 3HR4A 4G37A 5TV2A 3ZZUA 5F7OA 3HRIA 2OZPA 1T35A 3L1KA 3ZTTA 4N12A 1JLLA 1SUDA 2DPMA 1I4DD 2WHPB 3HB5X 1KAGA 1DOAA 1EG7A 3EVDA 4B85A 3CR3C 3KSDO 3O7WA 3VJKA 4GKKB 3H0EA 1YUMA 1BE1A 2VP3A 1KE1A 3VZCA 5A71A 3X3HA 1BVHA 1JEDA 1F8UA 1MNAA 4RX1A 1P31A 2X14A 3K9QO 5HJ5A 4UAJA 4I6EA 2GA8A 2X3YA 2CCGA 2CXUA 3NONA 4Q0MA 4Q02A 1LZLA 3ZCRA 3HO8A 1SIWA 1N5DA 2Q1XA 2BJVA 2I7DA 2XRYA 4ZVSA 1Q0RA 4KIFA 1SOAA 3ZCTA 3IR6A 2WYVA 1M2VB 1KK1A 2XAUA 2ZAOA 4R7GA 3FHTA 4KAXA 1ECGA 1OAOA 4KQXA 3ROGA 3R6DA 2W70A 2HSDA 1MJNA 1KVQA 2J6HA 4QX6A 4J7XA 3UAVA 3RYIA 4CKZA 5LPNA 1G18A 4BO2A 3ENQA 4OF4A 4AXBA 4LBYA 5HUJA 1NVAA 1FNNA 1XC7A 3ZWVA 2Q41A 3QKUA 5FX2A 3AR6A 1YB7A 2A3NA 4P86A 1RBMA 2Z1DA 4FHZA 4I1OA 4IEIA 3IR7A 3L7KA 3E9CA 5BN5B 3VDRA 1YC5A 4XFDA 3ZV5A 3STYA 5JNVA 2IU0A 1LBEA 1PG2A 4B2YA 4KWEA 4LVNA 1HEYA 1CPYA 4K1LA 3NTQA 2RHGB 3D3EA 3O1HB 1S2DA 1Z34A 2Y0PA 2V9PA 4OI4A 3UWSA 4LHEA 3AC0A 4H7KA 1CQXA 3MGGA 4FN4A 3KB6A 5GOZA 1Z0UA 2AKYA 5ILQA 4YXWD 1GQSA 2Y9PB 2R6R1 4LX0A 4ZICA 1W44A 5KJ1A 4MW9A 4AJNA 3PRJA 1ZVJA 4U8HA 4C0BA 2QYSA 5JY1A 1Z9BA 4L5IA 3LCJA 1V1MB 5EQDA 4HFNA 5GJCA 2FMXA 2BCGY 3DFFA 1JU3A 1ZR2A 1LTQA 3NHFA 2AQIA 2IPOA 1KI6B 3OM0A 1WOYA 4FCWA 4E21A 2C3OA 3NC4A 4K6MA 2R8EA 1PWXA 3EA0A 3P0HA 4AG3A 1DKLA 1DC6A 4L8WB 3LP6A 4P4SA 5DNWA 2BFAA 4EA6A 1V37A 4WGFA 3UENA 1NONA 2VTEA 4F56A 1UBSB 1J1IA 5I9MA 1EM6A 3CEHA 5K3FB 3RNLA 3E48A 1LK5A 1ZGHA 1ORVA 5FTWA 4YWHA 4BLWA 4HGZA 3SY8A 3ZLUA 3HCAA 2YQ5A 4NIMA 5T8KC 1QF7A 3TWOA 4M21A 2AC4A 2VDQB 2IXAA 4K6OA 3ZZ1A 5KNCA 4DR6B 4A2PA 5CBPA 3FCAA 3RS8A 3K0BA 1XKLA 1TUBA 4OHRA 4UPVA 3RANA 4JELA 3AFMA 4L5YA 5ISMA 4TYNA 1M7HA 2G08A 1NASA 2FWMX 1CNMA 2I2CA 1A8SA 4K46A 3H6HA 4WZAB 3L6RA 4FEAA 1NN0A 3TXYA 2EP8A 4REQA 2OXFA 2I2WA 2OTCA 3T4XA 4FYKA 4O1MA 1DOHA 4HV4A 1KZ9A 2HDOA 3CMCO 2YJZA 4L9WA 1N33B 5JASA 2YXDA 2R60A 1H4QA 2GESA 2RC5A 3INTA 5AOVA 4BATA 1WF6A 3HXPA 4MS1B 3D54D 1U31A 2UZ1A 4ESEA 4EI7A 1E4EA 1N5IA 4UXJA 4GKAA 2I3ZA 1IOLA 2ADOA 2H6EA 4W7IA 2APJA 2PH5A 5CMLA 3W06A 4UZSA 2A33A 3T7AA 3CNEA 3KZ1E 1RHKA 3G9XA 1A5SB 2AJTA 4LG1A 5IT4A 3PJRA 1ODKA 2INGX 2FUKA 2VK1A 3TUZC 1RM5A 1MX5A 2CD7A 1DWUA 4XPZA 2Y2UA 4FFNA 4D3YA 3TR6A 2A9PA 1TAUA 3GLUA 1TE2A 4DQDA 1K5HA 4MGZR 3A6PC 2CNWA 3FLEA 4G2TA 4NR0A 3SC6A 4KQ2A 2O7VA 4WVFA 2PZJA 4KCGA 2VRBA 3D31A 4PHTA 3ZU2A 1CEYA 5T6BA 3LZDA 1S3IA 4M1ZA 3IPAA 5DGHA 5AIAA 1MUUA 4C7VA 2VJAA 5A3VA 3X1DA 3EEYA 3ZHBA 5AD1A 5HJ7A 4DBZA 3NDIA 4BLPA 1E1QA 3EFHA 2QS9A 4RVGA 4BE9A 5B4VA 2Z2XA 4D7AA 3RHFA 5IXYA 3JQPA 1MTOA 2O3SA 4C7OB 1M6VB 3MXTA 4LRSB 4OVKA 2V3CC 5IJ9B 3GGSA 1YIAA 4Y6SA 4BTEA 2IP2A 1P75A 2W2KA 3H04A 3I2FA 3DEFA 2HWYA 1BYUA 1Y8QA 2E6UX 3ZY3A 3JD3A 4S24A 2XCTB 4AKHA 2Q3MA 4L5CA 4UEKA 5LBIA 5LDGA 3RB8A 4HDNA 2Z6QA 3DLTA 3EMBA 4Q18A 5FOTA 2BYTA 3AEKB 4A16A 1KWKA 4TXMA 3FD8A 3PXCX 4HTAA 1SXPA 2QWXA 1PR6A 2X0IA 3AEUA 3BKXA 4KLCA 3JASB 2V7GA 2WWGA 1L6RA 2RH9B 2X40A 1Y9AA 1E9DA 2FPGB 2JGJA 2HSZA 4QXQA 1NF9A 2E3JA 1Q2UA 2G5GX 3QNMA 4C2AA 1MRNA 1U2QA 3BRSA 4PO8A 2RI0A 3E22A 1OQAA 3KJIA 1FFEA 4INZA 3T0IA 3UG7A 5JDIA 4YRIA 2A5DA 1OYWA 2P4QA 3NM4A 4LDNA 2OG1A 2XD4A 3H1AA 3JAWB 2PXHA 1F06A 4R69A 4WNIA 4WXPA 1H22A 2XOKD 3R3SA 5JU6A 3QVXA 5AHRA 1A69A 1O0SA 2BP7A 5E38A 1JHUA 4EG6A 5J4YA 2HU2A 2CD9A 1NBAA 1YOVA 2ZSUA 1U3WA 3JQ9A 3T5AA 2BGGA 1WCIB 1GPMA 3TRJA 2RGEA 3GAZA 2BTQB 2GFHA 3OD5A 5JEEA 1REQB 4N65A 2G9RA 3TZLA 4BO0A 1Y98A 3UUFA 2YRXA 1JFFB 3ZDCA 3EWAA 4WZAE 1NPYA 1P8AA 1QTIA 4F3TA 4WWHA 1MTZA 2F00A 1XMVA 2XUKA 4U1RA 1TC1A 2PLRA 2BFOA 4G1VA 3S4YA 4D5GA 4KITB 5K99A 1MQAA 2YFYA 3IP8A 5FOUA 2B0JA 2YBDA 1QK3A 5D1NA 5AI6A 2LW7A 2WWTA 4DMKA 3S1SA 1FVOA 3R3ZA 1FJHA 2LXNA 3ZE9A 2PGIA 4BUZA 2IWHA 1P9NA 2FE1A 2P9EA 1XWFA 3PSAA 3T1VA 1ZCJA 5C37A 2GAFA 2QM0A 2AD5A 4DDUA 4YAIA 5ARBA 2I4MA 3IVMA 1J5XA 3KKKA 5H59A 5MFPA 2FTKE 4XWOA 1I94B 4JYPA 4KP7A 2OBBA 1G2QA 3UGJA 5FCDA 1F12A 2JLSA 1IPFA 1YONA 4DSTA 3R77A 4IDFA 3U0BA 2GF0A 2PMFA 1U4NA 3N2NA 2Q2WA 3OPYB 1GUBA 5AJUA 1M6WA 3WNZA 4EKNB 5TJ9A 5HQJA 1CJSA 2VCYA 3ZS9A 1EDEA 3NWPA 2FPPA 1C80A 4LYJA 3WBFA 4D80A 1KZ1A 1G4UR 1ZK0A 2QI9C 4FFRA 3HJAA 1HDOA 3DFMA 2RG1A 3DCYA 4JYCA 2GZ2A 1QK4A 1ONPA 1A9PA 1NUSA 3JQAB 3VPDA 4YQZA 4YO7A 1EBBA 3P5SA 4E7PA 1I7PA 3G8YA 1UEIA 1PF7E 4FFMA 4PBSA 1NI4B 1O9BA 2GYWA 4WNYA 1JVSA 4ZA2A 4J3NA 4B82A 5JCJD 1XQ1A 1ZITA 3IIJA 4CV0A 1HFWA 1MCZA 5KS2A 3TKAA 3MLAA 3MYRA 2BF4A 2ZJ7A 4RXMA 5F76A 1CQIB 3KE9A 4ALMA 5G41A 2HRQA 3CGWA 1E64A 4BZPA 3NYIA 4C6TA 4BN5A 4BVGA 4QXOA 3ZIDA 4JLBA 4DHEA 2NXEA 4GPEA 4GLBA 3CCBA 1NNI1 5CM8B 4XUDA 4EF6A 2GPBA 1S0UA 2EX1A 5FWXA 5A03A 3ZWMA 3F96A 1PGJA 1J70A 4EMTA 4RCYA 3ZY4A 3O90A 4YS6A 4LPKA 3PNBA 2QT0A 1U1FA 2DR2A 1SULA 2P6PA 4JLVA 5CNKA 2ZJ8A 2FSVC 3DO6A 3TZKA 1EX1A 3AQIA 5G53C 3GLKA 3HFSA 3OWOA 1AB6A 3BXXA 5CT9A 3ZNQA 4KG7A 1YQ9A 1VJDA 4V2IA 3W4JA 4M8SA 1WHTA 4DV4B 1AUVA 3B78A 1O58A 1GD1O 1PJAA 1SXJD 1R0CA 3BRWA 3FPGA 3LC0A 3M3HA 4F6CA 5FUQA 4XGQA 4L85A 5G2OA 2KYRA 3FHLA 5D3QA 4JT8A 4QTUB 2JGFA 2PZBA 3L0DA 3QYFA 4R2XA 4R6WA 4D74A 3V48A 4IXNA 1LRJA 4KSCA 3L8ZA 3N5KA 4YC7A 2AFHA 4I55B 3HEMA 2B4AA 1S3SA 3K09A 5JZ9A 4JVNA 3RRJA 1LB1B 3W5SA 3RIYA 3BB1A 3H5IA 4LDJA 4MPDA 3ES9A 1T4BA 4RY2A 5JJCA 3EXHA 4AF7A 2G1PA 1RKQA 3V8QA 4DLAA 1RPTA 4HSEA 1YE3A 3VSBA 4O2AB 4LBWA 4B3SB 3QPAA 5ELXA 1QJ4A 4IILA 4XFJA 2JF0A 1SVKA 3TFWA 1XX6A 3V1TC 4F4FA 3S44A 3GK3A 3C1UA 1CP2A 3I5XA 4OIMA 1WE2A 5ALFA 3VR2A 3F73A 1XTTA 1M1XB 4Z7OB 2CL0X 2R2AA 5JZOA 1GKIA 1RYFA 4PTZA 4QLAA 4ZCSA 1I0LA 1X1CA 2YV3A 2HYDA 2PGJA 4H7JA 3DAYA 2UZ4A 4C0AC 3UN1A 1R4NB 3JVEA 2CHQA 3SVTA 5FAKA 3CLRC 4QPPA 2YJ3A 1PQWA 4WKGA 3O2QB 4YUVA 4X71A 5EVCA 2FVXA 6AT1A 1GR0A 1GTJ1 2RHTA 3G5UA 3FMVA 1D1QA 5EE0A 1RS0A 3I04A 4AN0A 5FWAA 3TLZA 1KQGA 3O26A 3NHAA 2JJYA 2X1MA 1M1NA 4B6PA 4FGLA 3P20A 4R3WA 5AVTA 2ZG6A 5EHQA 2IUEA 3U1VA 3VHQA 2H5LA 4D3DA 3NYRA 4IYJA 4PVCA 3AEQA 4LRTB 1W9MA 3GEGA 4Y0AA 3ADOA 4KR3A 5AVVA 2HTEA 2JEYA 3OG9A 5ALSA 3HYTA 1CHNA 4OQFA 1UP6A 3FOWA 3K5HA 1JQ5A 3CNQS 1IU9A 2OCYC 3N58A 1E2KA 4KTTE 4M6WB 3JD4A 3Q10A 2OBFA 3W2GA 2ZCVA 4D3XA 3B7PA 4WKCA 4IXWA 3KOYA 3G0DA 2JBAB 2O7NA 4CIXA 1YQXA 2F8LA 1VLJA 4AYTA 2PFSA 4OOEA 4RVSA 5D84A 2FFQA 3EVCA 4AF8A 3HCEA 4LK2A 3M4NA 2Q6IA 4P5PA 2H51A 3WWDA 2QL6A 1MDBA 3IQFA 3IEIA 4KQFA 4NV3A 4TMKA 4TKUB 2X0EA 4F93B 3RVRA 4AN1A 1V25A 2Q8NA 2WJWA 1N6RA 2X58A 4N03A 5C8ZA 2FW6A 1XRSB 4HDKB 1FVXA 2NN3C 5CM2Z 1Y1LA 3F0TA 1KY4A 2C78A 3LXRA 3D3NA 2QENA 4EG7A 1GARA 3KOWA 2HFJA 2YIMA 3EMDA 4KGVA 1E9AA 4JL6A 4P98A 3TNYA 1GCIA 4N5IX 2KM1A 2MIIA 2G83A 4DJFC 3NT4A 5LMCA 1I01A 1KDVA 2MR5A 2ZI9A 2Q07A 4W8GA 1SG9A 3ZD6A 1SVNA 1K7EB 3UFBA 1E4EB 2D4HA 1Q0HA 4QU5A 4ZWNA 4KRFA 1RWKA 2JFWA 3LKZA 3QEJA 3IJEB 3V46A 3IBSA 1TGVA 2IYEA 4TYMA 5DMXA 1NM5A 1MAHA 3I4CA 1XAJA 3GFFA 5I3CA 2CNLA 2E87A 1JH8A 1N6PA 1UBLS 4DQLA 1IXSB 2FPWA 6LDHA 2ZXEA 3UV6A 2GM4A 1CIPA 4EPVA 2PKQP 1IUKA 2BHLA 3PWKA 4ZANA 1XPRA 3H2SA 4EUSA 1M2KA 2HPZA 4K9DA 3A1FA 4JI7B 5ITWA 3QVJA 4QM7A 1N3IA 2GETA 2GDZA 2WD7B 2XWQA 3HV0A 4DV6B 1JN0A 1NSYA 2I4NA 2O3JA 2REOA 3CH5A 4K6CA 3F97A 5IJWA 2RAUA 4EYEA 4F06A 4R9SA 3KUCA 4TRRA 4C7OA 2B5VA 3HR8A 4YRSA 2CJWB 3IDQA 3K70B 4GH5A 4MRVA 1JT9A 2FSIA 4GI7A 3SZOA 3UA3A 1UMBB 2PMDA 1YZ3A 1K4KA 1M0SA 2GCPA 1EGHA 1L7DA 3FF4A 5AI8A 4OHYA 3HNPA 1V39A 3N74A 4K0RA 1U28A 1YFJA 1LTHR 3GA0A 5FNVA 2QLLA 3ZHXA 2QU8A 2HX1A 2VDWA 5ITZA 3L4KA 3F3SA 3H5RA 4FKMA 4ISBA 2VYVD 4QGAA 4Y30A 1B0AA 2RBKA 1EVQA 2QRNA 2RAVA 5FV4A 3UBTA 3AL0C 2NUBA 3L8CA 5IG2A 4UBLA 4EMSA 1YOBA 3UK7A 3FH0A 3BDVA 4OI2A 4J03A 1UJ6A 4CM9A 3JV7A 1O96B 5I3ZA 3HN7A 2BLNA 5BW4A 5IMSA 3ZCXA 4GO1A 3D4BA 4IUBS 1ML4A 1ECFA 4C0KA 1K4MA 2R79A 1N92A 4IV0A 1ISIA 1PJSA 3V4SA 5MGNA 2D2FA 1NWHA 1FFXB 1SNYA 1JYSA 5KOHA 1W4LA 3F3YA 3AHJA 1CRZA 3NEAA 1L5HB 1EXWA 2VNIA 3LUFA 1RBQA 4NHOA 1DELA 3D4NA 1B76A 2PUWA 5BMVF 2VUSA 4US1R 1T2CA 3GJRA 3MOIA 5JRJA 2B83A 1R66A 3U16A 3UTDA 4JI2B 4UUOA 4IMJB 4ZVPA 3WNBA 1VKOA 3ZDFA 1QC5B 4BY9E 3UT0A 1EGAA 1L9XA 2VHYA 1JDBC 3JZDA 5EFZA 1QIIA 1QQ7A 2CXNA 2XADA 2J3EA 3C3MA 3D0OA 4C03A 2QTFA 1T24A 3DAOA 4PPFA 1XRQA 1YOVB 4DL9A 5KSYA 1USWA 2OLEA 3F71A 1JG4A 3D6NB 4B87A 5EINA 4R2IA 2RD2A 3EAQA 1WCYA 3KLMX 4JB3A 2XJ9A 3RO7A 4BO9A 1LPAB 3ZXXA 4V0SA 3TS1A 3PQDA 4F4DA 3EH1A 3DKPA 1NE7A 4YAWA 1B15A 2P0YA 3TKYA 2V7WA 2B3DA 2P0AA 2HI0A 2ZYRA 1X7ZA 2EP7A 2WHYA 2JH8A 4M0KA 3CKLA 5CFOA 3N6VA 4FC7A 3LGXA 4PC1A 1QZTA 2Q4RA 10MHA 3IUBA 5GV8A 4RHFA 2QK4A 2NO6A 3OZXA 1P1RA 4ESOA 4TWZA 1SIUA 3OIVA 4FN5A 5HXAA 2FX3A 1XAIA 4ID3A 4JIGA 3U7QB 4H1VA 2P3LA 4MMYB 5ILOA 4CFYA 1YJXA 2QD1A 1MR3F 1MAVA 3KVYA 3HXKA 4TXLA 5ERXA 2HSJA 1H85A 5IWCA 5DHQA 3GLGB 1XZLA 2XUFA 1U7DA 2IYOA 3T6KA 4I9FA 2PHZA 2VA8A 4MV8A 5KYNA 3CZ5A 4JKOA 2AHRA 1DQZA 4D9GA 3WLLA 3ADPA 1ISHA 3G7UA 2VNJA 1GQFA 3IYLW 4PN3A 4YRGA 3E1SA 4RTLA 1I5RA 1YVEI 1ZSNA 3GPDG 2DERA 5JNSA 5THXA 4DZTA 3C48A 1TT5B 4FFPA 5JV5A 4G0MA 1W0KA 1J23A 3IOMA 4YP7A 4Y9SA 2BI8A 4CTOA 4R5MA 3HTXA 3U13A 4F6RB 2FN7A 4TT3D 1H8HA 4D8YA 3H84A 1W5AA 4LXHA 1AGXA 4Q1AA 5EGSA 3RASA 4AC9A 3M6XA 4QOJA 2JPDA 4WXYB 2E55A 3NAMA 3TINA 1OB5A 1J8VA 2NYAA 1ZUIA 4KXUA 4P93A 1BKYA 2BE7A 2VJCA 3JQ6A 1ULUA 1ZN9A 3RVMA 1A5ZA 2GCEA 2R4TA 3MINA 4FYXA 4N0DA 3CZRA 3WLQA 4PIMA 1IM2A 1Q7RA 2C83A 1JX6A 2VSYA 4FB4A 4OL0A 3SQWA 4ONEA 2BMEA 5JCOC 2EFEB 5KTTA 5CYFA 4MQBA 5KAMA 4CPDA 2NUAB 3BL6A 4FYYA 7GPBA 1JH9A 2DR0A 2PUGA 3WDLA 3ZNPA 5ITSA 4ZYXA 1ZDMA 3LWBA 4GIBA 4M9QA 3GRAA 5LQDA 2ZAGA 1BH6A 2HA5A 4X1KB 3KWJA 2PS3A 3I9V6 2ZSIA 1O5OA 1AGYA 3PD0A 1X74A 3TLGA 2EDCA 4MR9A 1F1JA 1MGOA 2VDNB 4E5DA 4CL2A 4XYBA 4U5XA 3TUIC 1YTUA 3U1TA 4JITA 1J56A 3LTNC 3M3PA 1FF9A 5FPSA 5I8WA 1WXIA 3BCSA 3VR3A 4HQRA 4MB0A 5HW0A 4QFMA 5IUJC 5JH7A 4MWGA 1IQUA 3PJFA 3SNKA 1LGYA 1LRLA 1US8B 3VR0A 1EUQA 5KINB 3EPHA 1N5OX 4JXKA 4UBIA 1V4NA 5A9TA 2JB9A 1NF8A 3A6JA 3LFTA 1U3GA 3VU0A 3T3GA 3DCIA 2PX5A 3V6MA 2ZT7A 1C9NA 3AFGA 4M98A 2ZCJA 5C5DA 1TZBA 5ALIA 1AKQA 1N5KA 2FOLA 2QSUA 4JEIA 4BQSA 4D0RA 5TQ2A 6ADHA 2QGZA 1U0RA 2BHRA 1Y5RA 3H9CA 4IY1A 2J0EA 2VJBA 5HZMA 1GPH1 1D2RA 5F23A 4ZQHA 1NFRA 2XTAA 4WNAB 5DTEA 2V7BA 1AUPA 3G2IA 4ATNA 4J7UA 4BLQA 1TUIA 5COAA 3EVTA 1VXRA 1WS6A 2QLBA 5CGZA 1YDWA 3M6UA 3PGVA 1ZEMA 4LYGA 2AZDA 3W3AA 4HHEA 1ECLA 4QOHA 1Z6XA 2C59A 3MMXA 4WE3A 5IARA 2OY0A 1Y63A 1MJFA 1WF3A 2WSSD 4N0MA 4YALA 3C7AA 3L9WA 5EWJB 4X6LA 3W5CA 1NUPA 1E3EA 5CB6A 1MXHA 2YW2A 4JSYA 5CDHA 1UEJA 2PZGA 5AVJA 3GLGE 2J08A 3WBKA 3IULA 3BSSA 3UT6A 3A36A 1WMDA 1SN7A 1YH3A 2B5OA 4RNCA 2HA3A 2AH5A 4M87A 2CUNA 3D0RA 5E9WA 2RONA 2GQ0A 2O0HA 5AIBA 1G8AA 3ENWA 3T0FA 3PCXA 4LDAA 3PICA 4CIBA 5FOSA 5KEIA 2VA9A 5ALTA 2UVPB 3NEPX 5I9IA 3E81A 1KFBB 4CCWA 1YIOA 3R41A 4AZ3A 3SHOA 2L82A 3IXLA 1ISPA 4WL0A 4EGJA 1TCUA 3T1YB 3D1JA 2OO5A 1W85B 2AZTA 3O82A 3HMQA 5C7YA 2HCBA 5ESRA 3LWZA 2F1OA 2ZJ2A 3ANLA 4LYDA 4RK0A 1NF3A 2HA6A 3DV0B 2DF8A 4QGFA 2GZHA 5KX5A 1I7LA 4QXMA 2IS1A 5TMPA 3MAJA 1IHPA 2P6MA 1ZI6A 3FRHA 1Z6YA 4KUHA 4M1WA 1B6GA 3QEMA 4YGXB 4EHJA 1OH6A 3VKUA 1V3TA 3QVLA 1L4FA 5JARA 1EG2A 1EQUA 3TPZA 3SZMA 3EGIA 1KMCA 1YR9A 2D2EA 1C1DB 2VT6A 3W5IA 3I9NA 4MP8A 2VL7A 4O4IF 3OE7A 4MRRA 5I9TA 3OJWA 4HNGA 2DBVO 1AUXA 1O6BA 4ADSG 2WOJA 2C7RA 1ZNYA 2L17A 1VE6A 1I7QB 2ECPA 3CNOA 3UUEA 5AW3A 1UC5B 4YQYA 1B93A 2JI7A 4AQ7A 3AVTA 4C89A 1W30A 1T5SA 4OQPA 5HF5A 4V0OA 3R8CA 3ZV3A 4NJEA 4JIMA 5E1OA 3T7CA 2LE0A 3FWZA 4NOKA 1YZNA 3BXEA 3GVHA 4PZDA 4BE4A 3M81A 1X6VA 3ZCUA 2W6NA 1PVVA 2RH4A 3HZRA 4DDHA 2OQIA 3WGTA 4BOYA 1GG2A 3D3WB 1J0EA 2XA1A 4FZ3A 3UOWA 3H1FA 2P4UA 2C3YA 2ORED 1BRTA 4WADA 1FLDA 1FL9A 2R8OA 1DTWB 4Y1RA 1LDYA 5DHTA 2QUZA 2Z2ZA 2QV0A 3TCNA 2Q21A 3NWOA 1WTCA 5DHAA 3R7WA 4HAYA 4EA7A 3TW8A 2ZPTX 1AD2A 3QEBZ 1I2ZA 1ZVVA 1IG0A 4BNKA 1PLJA 2V0NA 1W4CA 2ISCA 1T8YA 1RWNA 1JBEA 1T13A 4GVXA 1ITZA 2CV2A 3MMZA 4GPZA 1II8A 2CFSA 1UM9B 1C2YA 2BMJA 2C3UA 2PNFA 2XZPA 4ND5A 4WLFA 3OQHA 5HFAA 2ZYDA 4DIBA 1VPVA 1P1HA 1U81A 3DF7A 1MJ5A 3STHA 1JR3A 1FDOA 2NXWA 4ETWA 4M9ZA 4QC2A 5J47A 3B6KA 5CB0A 1H5UA 4JOQA 4OK3A 4D82A 5DHRA 1GKYA 3KYCB 1FUKA 3UC5A 4BN4A 3P9RA 2CMFA 4LS3A 1Y3AA 4BNGA 4B47A 2WF7A 1F2UA 2ZI5A 2POCA 3A6FA 4O0MA 4IDGA 5F7JA 2OXRA 1K5DA 2R4UA 2I4OA 3B1FA 4IGEA 2QPAA 2XCUA 4RK6A 2P6OA 3JQGB 2NSYA 4DADA 3OEWA 3AIIA 2BFEA 1D8TA 2VJQA 1VSTA 3H42B 1KYYA 4G01B 5EJIA 5FNVB 2BW0A 4C7BA 3QEAZ 5CNIA 1INLA 1W5EA 1GTSA 5SYMA 2AN9A 4DFDA 2F9FA 1VDZA 3VVCA 2DGDA 2O4UX 3ETGA 3THYA 4TZTA 4RKYA 2H17A 3GMIA 3P4UA 1ZISA 2HD4A 1NNUA 1XP8A 4AWAA 2WJGA 2DHRA 2EZUA 2VLBA 3CUVA 3FKSA 4UTXA 4PYMA 1V4VA 3B53X 2YWDA 4GMDA 3I3OA 5TMEA 5C5CA 1SXJC 4I08A 4I1PA 3WB1A 4KJZA 3H2HA 3JRXA 1EUZA 4DMMA 4OPMA 4FD3A 5LQAA 4AT1A 4QUDA 4EF4A 5AK0A 2FV8A 1PS0A 4JQZA 3V5NA 2IYPA 2PV0A 1OFVA 1M1UA 1SBYA 2VH5R 4GF5A 4NCJA 3Q7RA 1KSJA 3M7IA 1V7ZA 2FSPA 3H2GA 4NV0A 5EXDA 3PUKA 3L7JA 4P38A 4URFA 5BSRA 4RMJA 4MVCA 4LF4B 3A9WA 3QXGA 1BMFA 1W8IA 1K08A 1Z3CA 2BKEA 1TQ2A 3LKBA 3QXJA 1KARA 1TA9A 1X9HA 3F49S 3H0KA 5FBKA 3RF6A 2AJLI 3NO4A 3D6UA 4LKOA 3N8GA 4EAAA 2QSJA 2RH8A 3IV9A 2NO9A 5C8YB 4BQQA 1TPZA 4KO3S 2UXDB 4EHAA 1EE9A 4JASB 4OI0A 4N54A 3RFFA 3RWOA 5KQPA 5E4YA 3KQQA 1ZRHA 4QG7A 1RXUA 2EAUA 1ECPA 3OC0A 3ILVA 1EX9A 3KL4A 2IYLD 1K6EA 2J48A 3WOHA 5I5EA 5KVAA 2PUCA 4O4JF 5KZMB 4MRMA 4KBYA 5LP6A 2XB4A 2AG0A 1R64A 1A7AA 3CWQA 4ZO8A 1QNFA 2DVMA 2J4DA 3QELB 1A8UA 1D2MA 1THMA 3QUAA 1T6NA 3ESZA 1FXWF 3RTBA 4MQ5A 2JJ8A 2WMDA 3QP9A 1ZXLA 4QREA 2DM6A 1VHQA 2OWDA 4FFBA 4WI1A 4ZC1A 5DYTA 1BEUB 4DNOA 4Z2AA 2V6JA 3N2KB 3KKMA 1OFHA 3QMPA 1X7XA 1C7JA 1ICIA 1E2EA 1UBJS 2M6SA 3ESBA 1YBAA 2Y1LA 2XZLA 5B3AA 1OXBB 1UEXC 5U9CA 3K0FB 3R0XA 3RTGA 2EZ8A 3UB4A 5JUWA 4C0SA 3FWPA 4IJUA 5IT0A 2I67A 4I7EA 4HLUC 4FW8A 1CY0A 1Z06A 1QG4A 3A2NA 4YHHB 3P45A 3WGMA 3DHVA 4NS4A 3Q7TA 3RI3A 5CCDA 4CKEA 3N86A 1EM8A 1RAFA 3BSYA 4OTZA 1BD3A 1RAGA 5AHWA 4Z4IA 1UKAA 4IUYA 4F3KA 4HUTA 5JJBA 4Z51A 1Q0UA 4C6HA 1LZKA 5T4EA 4LMRA 5HKAA 4RMIA 1VCMA 3TB6A 4Z9YA 1AZSC 4GM0A 3U19A 2IDJA 1WCWA 3I5YA 1PZGA 1AMNA 4PLWA 4QPCA 3KT3A 3QVTA 4JLKA 2O8DB 2EJCA 2V7XA 3EYAA 2YOHA 3KBBA 4TTPA 1VSVA 4BQNA 1IN6A 1U4SA 1G42A 2H52A 3ZW9A 1KKMA 1NW5A 2HXYA 3S2EA 2GZ1A 3WAKA 4BLVA 4H4EA 4FHCA 4XB2A 3T9CA 3HJHA 4CU5A 1WETA 4ZDKA 4LGMA 3UWOA 4UUQA 4MAMA 3KEQA 4J16C 2ZYSA 2BCJQ 2AHOA 2GM5A 5DT9A 5FWYB 5BRAA 3MINB 3NU1A 4BMSA 3K0HA 5J59A 3CRNA 4XQCA 5TVKA 3ZWBA 4B5KA 5AOBA 3IDZA 3V8RA 4L57A 4B1FA 4DT1B 2O7RA 2QVGA 2BM8A 5E6RB 1I3LA 5CCXA 4KBFA 4KQMA 4UEWA 1Y6QA 8GPBA 2FI1A 3HS3A 2EKZA 5K8JB 2BFCA 4G1BA 2PUDA 2GAOA 2VQEB 2PSHA 4CMEC 2WV9A 1AURA 1E5TA 3B9PA 2ODTX 3C87A 3EC1A 1IBSA 1X1QA 1YXMA 4CR6A 1C7QA 2X22A 3TUJC 3S81A 4JB8A 4G9BA 1K27A 3MT9A 3RV3A