1JPVA

Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with so4
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
235
structure length
235
Chain Sequence
NPVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGFLVYTGKYNGETVSIATHGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSDNLAKGGIWITKEELEKSVMDGAKAVLDTLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-deoxy-5'-methylthioadenosine phosphorylase
publication title Three-dimensional structure of a hyperthermophilic 5'-deoxy-5'-methylthioadenosine phosphorylase from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 78
structure length 235
sequence length 235
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2001-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jpvA00
4JOSA 1TD1A 1V3QE 1PR2A 2RJ3A 1K3FA 1OTXA 1V48A 4DA8A 4R31A 3FB1A 4LNHA 2HWUA 1I80A 5F7ZA 4JWTA 4IP0A 1CG6A 1U1CA 1B8OA 3KHSA 3NM5A 1PR5A 5IU6A 1PW7A 3KVRA 4JP5A 1RCTE 3UAVA 1Y6QA 5CCEA 4F3CA 1RSZA 2I4TA 4BMZA 4WKOA 4L5AA 4UC0A 5B7NA 4R2XA 4F2WA 1QE5A 1YQQA 5F76A 1OTYA 1OU4A 4DAEA 2HSWA 3LBAA 3O6VA 4WKNA 1RXUA 4DAOA 2AI1A 2H8GA 1A9OA 3LA8A 4TXNA 3EUEA 5CCDA 4F3KA 4D8XA 1JPVA 3PNSA 1U1GA 4DA7A 1V45E 1OVGA 1Y1RA 4YNBA 2OC4A 3EMVA 4L6IA 1Z33A 1Z39A 4L0MA 3MB8A 3UT6A 1ZL2A 1Z37A 3ENZA 3SCZA 1Z36A 2Q7OE 1Z38A 1TGVA 3OF3A 1A9TA 3OPVA 3MMSA 1Y1SA 3K8QA 5F77A 4DABA 1XE3A 3GB9A 3FOWA 3UAWA 4PNPA 3C74A 1TCUA 3K8OE 4D8VA 4TXJA 2A0WA 1ECPA 1SD1A 5B7PA 1PWYE 5ETJA 5F7OA 4YO8A 1M73E 1JE0A 1OUMA 3O4VA 4QFBA 1JE1A 1OV6A 3EUFA 5F73A 1SJ9A 3PHBE 4D98A 1Z5NA 1K27A 5FAKA 3F8WA 3QPBA 5CXQA 1PK7A 5JPCA 4G89A 1Z34A 4H1TA 2QSUA 2XRFA 3OCCA 4G41A 4K6OA 2OC9A 4GLJA 4M1EA 1U1EA 1Z5PA 5CYGA 1Q1GA 4QASA 2I8AA 4R2WA 3NBQA 4DANA 1ULBA 1SD2A 1VHJA 3UAZA 5EPUA 5F7XA 3TL6A 3OZBA 1A69A 5CYFA 3UAXA 4ECEA 4DA6A 5K1ZA 1RXSA 5CXSA 3OZEA 5F78A 1V41E 4M7WA 3KU4A 4U2KA 3KUKA 4TXMA 4G8JA 1RXYA 1RYZA 2QPLA 5I3CA 4NSNA 1K9SA 4DA0A 3OOEA 4TS9A 3UAYA 1Y1TA 1T8RA 1SQ6A 1Y6RA 4NY1A 1ODLA 3FAZA 1JDVA 1RXCA 1YR3A 2A0XA 4WKCA 5B7GA 3NM6B 4GKAA 4E1VA 2ISCA 1TCVA 4TTJA 1VFNA 4P54A 1A9RA 4LKRA 1NC1A 5EUBA 4D8YA 1A9PA 3U40A 2HN9A 4QAQA 1N3IA 1T8SA 4QARA 2IQ5A 4PR3A 5F7JA 3BJEA 2A8YA 2QDKA 3BSFA 4KN5A 4MCIA 4OEHA 3IEXA 2GUWA 1U1FA 2HRDA 1JDUA 1Z5OA 1LVUA 4I2VA 1PKEA 1ODIA 3EEIA 3GGSA 4MARA 4QATA 2BSXA 5DK6A 3OZDA 1PR6A 1ULAA 4LDNA 1NW4A 4F2PA 3FUCA 5C80A 3ONVA 2AI3A 1JDSA 3OZCA 4TTIA 1A9SA 1JDZA 1LV8A 2PGAA 3DP9A 2QTTA 4D9HA 2AC7A 3DDOA 1A9QA 1PR0A 1JYSA 1VHWA 3LGSA 3E9ZA 4QEZA 5IFKA 1FXUA 1ZOSA 3KVYA 1PR1A 1V2HE 3T94A 4YMLA 1JP7A 1ODJA 1WTAA 4OY3A 3DF9A 1NC3A 1V4NA 2A0YA 1Z35A 1LX7A 4LNAA 3P0FA 3PNPA 5KB3A 1JDTA 4YJKA 1U1DA 1G2OA 4GLFA 1VMKA 3INYA 1T8YA 4EB8A 2OECA 3FNQA 4TTAA 4OF4A 4TS3A 4DARA 1B8NA 1PBNA 4EARA 1RT9A 3P0EA 5EFOA 1PF7E 5B7QA 4NS1A 4GMHA 4BMYA 2QTGA 3E9RA 4OJTA 3BL6A 3BGSA 4OGLA 4WKBA 4MCHA 4LZWA 2AI2A 4OGKA 1YBFA 4TYMA 4TXLA 1YRYE 4TXHA 4M3NA 1Y1QA 1YQUA 3DJFA 4X24A 1PR4A 3OOHA 4BMXA 4L5CA 4WKPA 1RFGE 3NM4A 4L5YA 1T8WA 1C3XA 3D1VA 3KVVA 3IOMA 2ON6A 4BN0A 4F1WA 4RJ2A 2P4SA 3FWPA 1ODKA 3E0QA 3PHCA 1CB0A 4FFSA 1PK9A 2OXFA 1T0UA 3DPSA 3ODGA 1RR6A 1TGYA 2B94A
chains in the Genus database with same CATH superfamily
2EEZA 4QRHA 1TD1A 4P7JA 2G5TA 4B2IA 1A98A 1JFFA 4QGAA 4A73A 2XE6A 1YS1X 5ICSA 4OM8A 1UXGA 1L3IA 4GPEA 5EOVA 4O5AA 3WXMA 3ZVRA 1CE8B 4EG3A 3ACCA 4W5TA 4C2UA 1JNXX 3W4IA 3AILA 4XASA 4AG6A 2NTVA 2IYYA 3SFZA 1Q7RA 4KQJA 5AK3A 3IVMA 4AX4A 3CXRA 4WNIA 1UODA 2O6HA 1HC7A 4XOUA 2QVCA 1FBNA 1JUDA 1K86A 1KO4A 1ORVA 2DBRA 1DFGA 3LUKA 3SM9A 3HABA 2FEMA 1R6DA 1N78A 4BP3A 2KM1A 1UPCA 2YHBA 5EFZA 4PEVA 2JASA 3F9RA 4EVQA 2BM9A 4TTPA 4BO4A 4GMFA 4DBLC 3ZE2B 4HWGA 5JAIA 3RVSA 4MV3A 4C0QC 4ODIA 5LFAA 4OIMA 5JI3E 4B4WA 2I33A 3ZJ5A 4ILKA 1RWKA 5HILA 2X3UA 2JGNA 2O2JA 5HGXA 4RXMA 3ZXUB 1JIVA 1VKOA 3PUJA 1M1NB 1NYRA 1VPDA 1OKKA 1YKGA 5E9AA 1JR3A 1XWFA 1X3SA 2J5RA 4RCYA 3T7CA 1QYDA 3VXKA 2A4KA 1GL9B 5JNVA 2QVLA 1NIJA 5ECDA 2AV6A 2G0AA 4RKFA 3PLNA 2NX2A 5A6SB 1XD8A 1M2JA 2F3UA 1A2QA 4Q1FA 1SQGA 4YP0A 2HWYA 2ENUA 3FY4A 5EUCA 4R81A 4GZ5A 5DISB 4D56A 1DKLA 5HUJA 1P0IA 4QYMA 4O4HB 3RV3A 3THXB 2Z4TA 1Q44A 1PZHA 1H22A 2NAFA 1AN9A 3GFSA 3I1IA 2DWCA 4UUMA 5DCUA 4XUGB 5EINA 5JARA 3IX7A 3ZD7A 2I54A 4F3TA 2GBFA 2XMRA 3MWDB 2VTDA 2XA9A 3NDBB 1XVLA 2VK8A 3O6VA 2JFOA 3QUCA 4IIBA 2JAWA 3QK7A 4WKNA 5DYNA 4ERXA 4GYYA 2FAXA 3F8TA 4PYQA 1OI4A 3UV3A 3EXEB 2XLBA 3AL2A 1TZJA 3PT5A 5KYYB 1LEHA 1GCIA 2Z09A 1TYZA 3ETJA 3ZDBA 3RC2A 1R8JA 3QFCA 3V8NA 4J0EA 4EB6A 1U1GA 2LZ0A 1DOAA 3KQLA 1JQ3A 3ANLA 4IHJB 1J2UA 4E33A 4YJDA 3KHTA 2ZU0C 1M1YE 3H3FA 3E23A 1NKSA 4R1PA 3VPGA 3C5WP 1K97A 4IGKA 4JB2A 1GDDA 5JZMA 3AEKA 3GT7A 3UY4A 2I2CA 4DA4A 1K5GA 1GUYA 1CNFA 3MJHA 3N76A 1TPZA 3DLPX 3LQQA 2FWRA 3R77A 2WZCA 2IS6A 2ZRGA 1P5RA 3KJFA 5CBPA 1W88B 3KQUA 2QMEA 4BMVA 4FX2A 4XVHA 5IKPA 3D7LA 2DXIA 2NSJA 3FOFC 3NFYA 3ZV5A 2CL6X 4CMCA 2IP4A 2OK8A 2HQSA 2WNIA 2C5AA 2FKNA 1WB5A 1GD1O 1NJGA 3C6KA 3FJ1A 3PNVA 3R5KA 4G24A 3OQHA 4EO7A 4YUWA 1KGSA 4F12A 5JYCA 2VQSA 4TKVB 3EQ6A 5E0KB 4C0KA 2QMZA 3MPUA 2BDTA 1Z5GA 3DFMA 4LQ4A 4YECA 3I32A 4Y2HA 1Y1LA 1Y4UA 2H07A 3ISJA 4NZNA 5ALMA 5LA6B 1W36D 1GFIA 4L0DA 4Z9FA 4AF7A 2D7DA 5C1DA 4J76A 4ZAWA 1SXPA 2BMJA 1W49A 4MIKA 1UXOA 2OD2A 4D42A 2PA3A 1XWWA 2DQ4A 1ZISA 2H9YA 3TMAA 3QKSA 4GDMA 5TMBA 4QTYA 4Q4HA 3A1EA 3W8NA 1GKKA 1I5RA 1VMIA 2P5YA 5E1BA 3VR5A 4D4HA 5GJVC 4CKWA 2CWWA 2VPTA 1DJLA 1NQUA 1JDPA 3AEQB 3LXUX 4HG2A 4I3HA 5IBCA 3MXTA 2Z2KA 4HWKA 4IOKA 1DRWA 3TECE 3FI0A 5KX5B 3A6LA 2HCTA 3HN6A 3DZFA 1VJ5A 2HY7A 1KP3A 4RXTA 5E2AA 1MOQA 1KMHA 1RQ2A 2WAYA 1NJ5A 3GGCA 4LBWA 1RIIA 4YPFA 16PKA 1FJHA 5EMLA 4D98A 1N2EA 3EZ9A 3OOSA 5DHSA 4IDPA 2HHJA 1SUFA 3TQHA 5JR3A 1X42A 4YRKA 4ACBA 4DPLA 2OT3B 1KL7A 1V71A 3D6JA 2FHPA 4IIGA 4P9NA 2XNJA 4E46A 4YV7A 4IJVA 2JA1A 4W7IA 1H2EA 1IJFA 2H2IA 2Z2JA 3FHOA 4YP6A 4JBXA 3HUTA 5CFMA 1BSVA 1PYDA 3CF4A 3TW8A 4AS3A 4G41A 5LKRA 4EHFA 4O2AA 1N4AA 1P1JA 4P7KA 4JVMA 4QDUA 3TK1A 4Z54A 4O4IB 2VYCA 4OHPA 2O2GA 3GP3A 3QY9A 3L07A 4ZHQF 2I67A 3B6KA 4OU4A 4UBKA 5G2OA 5HCNA 2O0HA 4WD3A 4A2WA 3CPJB 1K3UB 5CLGA 3L6OO 2MINB 3FUWA 4OATA 2HI0A 3KPVA 1YA4A 5JC1A 1ONPA 2JFVA 3NB0A 1B73A 3HKEB 2NZUG 5B5SA 4O63O 2P5UA 4K7JA 4LBVA 5LXTA 4P98A 2X0JA 1TEHA 5CJPA 3BD8A 5AXDA 2XUKA 5HM8A 4QUBA 1KIFA 3CLRD 5DM60 1C3VA 2JIZD 1R8YA 1VG8A 2OZVA 3CLHA 2BDEA 3HBNA 3M5DA 1TXGA 5MN4A 3NW9A 3OZBA 3Q72A 5TMPA 2GM3A 1P2GA 2B0CA 3GLVA 3DE2X 3LCUA 1MAWA 5EWMB 3IE2A 1HYEA 4KI7A 3J80A 2V8BA 1W94A 1DC4A 2VHVA 2FK7A 4DCGA 4OD0A 3PF9A 5L3QB 4Q7LA 1EQ2A 3OCVA 1V5EA 2NSHA 3PQ6A 3G3EA 1MA0A 3KFVA 4TKMA 1T5IA 5JNRA 1FNBA 3A4YA 1L3BA 3B3FA 3H1PA 3ROGA 3LUGA 4Q24A 4EG1A 1S6YA 2W37A 3IXMA 2GH1A 3EQ9A 3U1TA 4NNPA 4OKSA 1L4MA 3DLCA 4TKZA 1YDGA 3RT7A 2VN8A 4Y3UA 5AJHA 1RXYA 2WP0A 4XQEA 4KXQA 2P5SA 3KVNA 2FH5B 2RGNA 4X63A 3PQ2A 3CUSA 3ZIDA 3MD0A 1VJ0A 2ZWIA 2NUTB 3DNPA 3O8OA 4MJ7A 4MPJA 2FP3A 2HDWA 2EBUA 3IL2A 2ZIEA 1KOGA 1MOZA 4JJ8A 2ZEJA 2VEDA 1HM5A 1OPRA 1XQWA 2GLUA 2IDMA 3A2KA 3L7BA 4N0DA 2NZYA 4KQ2A 2DULA 3W77A 5LB2A 1GP2A 3OT5A 5KOIA 2OSBA 5B53A 3VPCA 4KO2S 3D3WB 4IH1A 1DO0A 3M6UA 4MGZR 5JMTA 1NUPA 4LHYA 2UXBB 1P4GA 1YBVA 2O48X 4LY0A 1E1YA 3M83A 1F2TA 3SDBA 1J6UA 3UUGA 3NETA 1XL0A 2WFLA 1DB3A 1MVLA 3PHHA 1DHRA 2FFAA 4A6XA 1K7CA 5JHHB 2YV4A 1T9GS 3QELA 1XG5A 1XTVA 3MBIA 4NK5A 5C8YA 4ZYWA 1IBSA 5DB4A 1WULS 4V0SA 4NU0A 4X54A 5C18A 4PHCA 3L7DA 2GNAA 3NP9A 1ML3A 1F17A 1UPFA 2CWDA 3A6FA 4W1SA 2EZ8A 5IF9A 5I9TA 3FTQA 3R75A 1PZNA 2DCMA 3WMWA 1YMVA 3G6KA 3IAEA 1CBUA 5DYTA 4INJA 1NC1A 4N6GA 4HVAA 4UAVA 4YMHA 3GIWA 1I6WA 3L5KA 4Y6LA 4POOA 2YQ5A 3RFTA 1QVWA 4BVFA 1M5RA 4TL8A 2V7WA 4R1MA 3U3KA 3FYUA 5JSZA 2CYCA 4LWQA 4N7MA 5DWVA 5IH3A 1Q21A 1E3IA 3PCTA 3PP8A 4L57A 4ND8A 4ZI7A 1DBIA 1G21E 2D1TA 2VRWA 2W4IA 3EZGA 4H6VA 5EZYA 1MQAA 4JITA 4REOA 5ALVA 3ILSA 1SBZA 1E4YA 1TM3E 3IQZA 4HK4A 5ECWA 2Z3WA 1AOXA 5F12A 2XBUA 4UU1A 3VU8A 1IL0A 1UWVA 2OZLA 2Q6TA 3N6VA 5LQJA 1IPEA 4IF4A 1RMTA 1LFAA 1TFUA 4OJNA 4HNHA 4U2BA 3RABA 4XX1A 1WHSB 2A5DA 3JVUA 4HYEA 2GAIA 3C3WA 1AIPA 3PYXA 3NGXA 3EB9A 1CF4A 4QEKA 3TZ6A 1ZJ4A 1VIYA 1PLLA 1N6LA 1SIWA 2EIXA 2BF7A 2Y77A 2GLXA 3OJCA 4DLNA 1YQWA 1M0SA 1Z4QA 3C24A 3CGWA 3HSSA 4LC0A 5TS2A 4DT1B 3B20A 1ULAA 3E81A 4HN9A 2ADMA 4NLLA 3JD4A 5E7JA 5DP1A 2FOXA 2BFBA 1PWXA 1NJFA 3UWSA 1JG7A 4CMJA 1Z4MA 4LQCA 5DPMA 2WJYA 4AY5A 1SVNA 4OXQA 5KNCA 4FGJA 4X20A 2B6NA 2XH8A 1K3TA 4HDMA 4AN0A 2WSSA 1XHFA 4KO8A 4DWWA 4RTNA 5KSOA 3RANA 4QXOA 3EQ8A 1YFJA 5ECGC 4IGEA 3A06A 1DO8A 1VTKA 2VHZA 3JSAA 4IUCS 4J7XA 4WNAA 4JHLA 3PTAA 1CLUA 1E9DA 1M54A 1V9LA 1JTEA 2PUFA 4TTSA 5B4TA 1A8QA 5JXHA 2ZIWB 2EKPA 3Q15C 3ABQB 2QQEA 4FGKA 2QJRA 1E6LA 2ACKA 5LYYA 3I2YX 2AK3A 3ETGA 1WOYA 3HGMA 2H17A 3PHGA 4G97A 4JBWA 4X1OA 3V1UA 5FNVB 1IZ9A 3DF9A 2FPOA 4QEDA 2AHRA 4KVAA 1O94C 5EUMA 3A9VA 1N1EA 1D4OA 2FHSA 4X1YB 2H2HA 3MJRA 1IFXA 4G0YA 4KUHA 1KARA 3OQ1A 5FOSA 2HT6A 3AQIA 3PZBA 1OH5A 3QEMA 1FYWA 1PWZA 2WHPA 3BJIC 5KNDD 3SHOA 3N75A 4LSGA 3V7NA 1B43A 1B6TA 1Q3KA 2H11A 4WA7A 1QRUA 3ADBA 2I4NA 1ZCBA 3CLKA 1TM7E 1MJ5A 4X93A 2F8LA 4NHOA 3WDLA 4ZEOA 4MP3A 1IWOA 4Q3EA 4DLRA 5JDCC 1ZR4A 2HYDA 1E6WA 1K2VN 1S3SA 2ZSBA 3F8SA 3L8EA 3NHJA 4PQYA 4G23A 3KQOA 4UHKA 5F3DA 1DBSA 4HJXA 2EZUA 2I9KA 4L08A 1MC4A 1TC2A 2VJKA 2Z04A 3MCVA 3IMFA 1HQYE 1RLMA 2QZSA 3C16C 3P0RA 3V1LA 5FI5A 4YCCA 1QVAA 3LS2A 3GRZA 5KKCA 1WR8A 1T1SA 3KSZO 3L41A 4YROA 3TSCA 4EEZA 3GVXA 5DHPA 1RVV1 1C1DA 2BFEA 3I0MA 2GD6A 3AR9A 2I2FA 5HHTA 4RA6B 3L01A 4YQZA 2ZRQA 5EMNA 4ZYXA 1L6IA 1A8UA 2GETA 3GJXC 2QRVB 4DTCA 2C7VA 5DWQA 1AV6A 1VMEA 3WY9A 3M1YA 3WFJA 5BWBA 3CFYA 3O4GA 5AHRA 5LP6A 1T29A 4ZVTA 4LJRA 4CLDA 2HCJB 3VOSA 1G41A 2WR8A 2H8KA 3BL6A 1P7ZA 2P8JA 3UN1A 3DW1X 2VHCA 1WW8A 4QPCA 2PQ0A 4FYKA 3COPA 3H9JA 1GUFA 4PLCA 1V0JA 4B6SA 2ZJOA 3QEBZ 4I1PA 4HN2A 4G5FA 3SIRA 2CNWD 1X9HA 2G67A 1NLZA 4GWGA 2GPYA 2ODPA 3PQEA 4E32A 5AUOB 3PR1A 2RGWA 2QP3A 2CLFB 2J9RA 2E1RA 1I30A 4UMEA 3LT1A 2IWRA 4F71A 1SZPA 1BEUB 3F4BA 1EK6A 2FPGA 2D5LA 1WNFA 4UFNA 1XZHA 3ESCA 2DQKA 5CM9C 3EE6A 1YB5A 3G2NA 4R2IA 2ZSAA 2IZOA 3V9PA 5LZ2A 2GJKA 1XU9A 3FWKA 4ND7A 3W3AA 1QYVA 2YQZA 5EHGA 2QNRA 1VGVA 4MX8A 2ZBQA 3SZ3A 2Q99A 3K5IA 3LT4A 2VCEA 2QN7A 4ITUA 4WFQA 3P0HA 1P61B 3MS2A 3DBLA 1KY2A 2XWJI 5COBA 3FSGA 1GEEA 1KO5A 4BZZA 3HDYA 3DHYA 3R0VA 5JFTA 4K9SA 3HWRA 5KTYA 1NOJA 2PZFA 4YY3B 1NONA 2VLIA 4AKIA 3HNOA 4EPRA 4MKFA 2CHQA 2PMKA 2PKQO 2L42A 2QUAA 1ES9A 3UG6A 4CTOA 4NCBA 3NU1A 1R16A 2ZB2A 1FUYB 4G4SP 4DRXA 2PGOA 2BKXA 3L5OA 1IXSB 1SXJE 3U3JA 1F48A 3T3EA 1WBBA 2XWBF 1UPTA 4QXRA 1LPMA 2FWPA 4G9EA 1I3LA 2IEAA 1F06A 1H65A 1NQOA 2WF7A 3ELYA 4EJ0A 1CP2A 4LJKA 3SHVA 3KRTA 2I91A 1CZKA 3P0IA 4C0JA 2VZLA 4XUDA 4LXUA 1O9HA 5HJ7A 3TL2A 2BEWA 2NU9A 2IIPA 1UZLA 1ZD5A 2BMEA 3COWA 1H2HA 2EV9A 3QYFA 5DHUA 4R2MA 3VNQA 2YRFA 4FNMA 4FMBB 5E0OA 1MPTA 2H4WA 3KKMA 1W96A 2VTVA 2OILA 1KFJB 3D3NA 3ETHA 3GHHA 3K6RA 4HAWA 1YFZA 4MUYA 3W2TA 4BO1A 5CDYA 3OHMA 1VBKA 2DJIA 4PBTA 1V3QE 1C7FA 1VIMA 1Q16A 3CUKA 4RZHA 4XVQA 3VYWA 3LKVA 1WIWA 1PIWA 4NCIA 3DTTA 2C95A 1E1CB 2Y1EA 1Q22A 2M6RA 2V5VA 3R3WA 5JTTA 3TLKA 1QLHA 5D3ZA 4G1CA 5YASA 2IY7A 1HDEA 5HF8A 2R97A 3EF1A 4K28A 1I7NA 2PS0A 4PLYA 1RYNA 2ONCA 1JBEA 1TMGE 2HWUA 2C5GA 2II6A 5DIFA 4PN7A 2OP0A 1ZVKA 5CEEA 3DZGA 3OI7A 2IYTA 4QM6A 2A0KA 1PWEA 1G1AA 1UBSB 2P6UA 4HAYA 3H5NA 4C05A 4V0KA 1V7QA 1ZGZA 1XALA 3LUAA 2O0MA 3BCUA 3LZDA 4MV4A 4A0FA 4CWAA 1DUVG 1XZKA 4MKGA 5CDFE 1Q92A 2VXYA 2CF6A 5J40A 5CNKA 3ZJUA 4XWGA 2H7YA 1ZK3A 3CC8A 1V37A 4JP5A 5IH7A 1UKAA 1MXHA 1SKQA 2OORC 4IEIA 4IRXA 3GLGE 2IFTA 4N5HX 1PDOA 5IYZA 2R62A 4NV3A 4FKMA 1SUDA 3IDSA 3PTLA 3TO5A 3GJZA 2OGSA 3FLMA 3RIYA 3QLVA 2I7XA 2PKWA 4CLRB 1ZK0A 4LSZA 4ZVLA 3AIOA 3BGOS 1PJ4A 3LBIA 1ZIOA 2JZCA 3P94A 1FFCA 4X91A 3CSSA 4EGSA 5DBFA 2QI9C 2RGCA 2G1AA 2PZJA 1UKBA 3Q8XB 3VR2A 1C7QA 1NT4A 1WJGA 2C0PA 5HX7A 4DR3B 3PDIB 3DE7X 3TPZA 5E7QA 4M9UA 3L18A 1DKUA 4RF2A 3RSGA 2ZIXB 5BNZA 2Z5FA 4I6JA 4S1OA 2ECKA 3NWPA 3OZUA 4PBSA 3S2YA 2Q4EA 2EF0A 1M1YB 3BXHA 3E9NA 4NCXA 5I7RA 4XSHA 3PVSA 1BXGB 5E6RB 2AG5A 3DLBA 1DV2A 5KAMA 4O3MA 1FP2A 3L7IA 3KXLA 3LBAA 4JR0A 5DI3A 3T54A 2RAPA 1EZZA 5LOVA 3CN7A 1F51E 4CF3A 1Y7PA 1QQAA 4DOMA 1SUCA 1WLYA 2G6TA 4CKYA 5MDHA 5IM5A 4R40A 4EFDA 1A9OA 4E5VA 1DTWA 5FT9A 3ZN2A 5T41A 3U37A 4D8WA 4EI9A 3WAGA 4I8XA 3WGMA 5CXXA 2XD9A 1XX6A 2OV6A 4GOMD 1AGRA 5MN6A 2JGLA 3QVTA 4OP1A 4QUEA 2RGXA 3ZXXA 3N7AA 3MAGA 3LOPA 4YBZA 1N3BA 3SPXA 3GJ8A 4RSGA 4LE0A 1Q20A 2C83A 4BXOB 1X7XA 3X1XA 3GMTA 3QJGA 2FEXA 1PR9A 5EL0A 4EL5A 2ORVA 3HO6A 4ESOA 3IRVA 4EGAA 2JLVA 3RTEA 2PD3A 1NL3A 5BQOA 4AG3A 2NIPA 4FYHA 4YI3A 2QRLA 4YRAA 5ESWA 4RADA 2FR8C 3MIZA 5DZSA 1O5TA 1ZOOA 2DECA 1U3FA 4B33A 3QVJA 1PT7A 2VT2A 4G85A 2FEPA 5JCXA 3GZNB 3O8NA 4PYNA 2HSGA 2JHGA 2OHJA 2H0QA 2OV8A 3G9TA 4C21A 1UBLS 1WA5A 1R1DA 4L6AA 1H0HA 4UD6A 4HPWA 1KWGA 3RAFC 4B43A 3PNQA 3BVPA 1FTSA 1NJ1A 3K8QA 4KIJA 1PNRA 5EJEA 3UB2A 1GTMA 1Z25A 4BNNA 1QOQB 5IRCD 1U99A 4Z9XA 2Z2IA 5IBQA 1V95A 1Z0IA 3UTCA 821PA 3JAWA 1OT5A 2WYUA 4K03A 3MQ2A 3VV3A 1JBQA 3EGIA 5A4KA 1KEUA 1NU6A 2IE8A 3LU1A 1RXWA 5J2TB 5A4FS 5IM4F 4CLOB 4Y9RA 1KZ9A 2IOHA 3IAM1 3E8SA 2EXXA 1R5BA 4LTMA 2EDCA 2E4UA 2OY0A 3SLGA 1M73E 5DX1A 2XCUA 1SXGA 1OUMA 4KYUA 2CXNA 4H7EA 4MA4A 3RRYA 3TYXA 2UZIR 4D3ZA 4DQDA 1RABA 2F1HA 3B85A 5MGNA 4J0GA 1NHGA 4NFLA 4LOIA 1SJ9A 1NXWA 1RD4A 4FC7A 4RV9A 1Q1EA 4YRCA 1SCNE 3FJYA 1Q1BA 1U31A 3DFZA 4GLBA 3S2GA 3V8PA 4A27A 5ADHA 4ZQHA 2VJQA 4YJGA 3TLZA 3ASYA 4CCSA 1D2RA 1IZ0A 4XAQA 3R0ZA 1DXOA 3O4HA 3WDMA 3TL3A 3I5MA 4MAMA 1M7GA 3DLHA 2IUTA 3QBEA 4CNBA 4KQ9A 3EQ2A 2ZBFA 3TTTA 2PLNA 3E9DA 1I7DA 4HNSA 1GLNA 4MRAA 3CW9A 3CEMA 1U1EA 3L8FA 5HBGA 4BLPA 1ZIYA 1L5QA 2HXYA 4FS3A 1IN4A 2IZ0A 3CPSA 4GZMA 5CT6A 4Y1FA 3GNQA 3IVGA 1BVHA 4KXWA 3KEGA 3PXDA 2W8BA 4JDPA 1KZHA 2AWNA 1XMVA 2XWPA 3C2QA 4N5NA 2HYIC 2YZKA 3D2CA 2WDPA 3FPBA 3QYJA 3WIOA 1ZK2A 1VECA 4L5BA 4PO8A 3GLHE 4BV8A 4PC3A 4DUGD 5KJ1A 1QKIA 1ZXXA 1OQAA 1ZU4A 2A1UA 1DIGA 1U4NA 2GKSA 5E6UA 1FMTA 1QDEA 5FOWA 2FFHA 1NOKA 3H9UA 4NYMR 5FBLB 2NU6A 2X0DA 3SZUA 1KQFA 1R4NB 4UDOA 1RTKA 2CVHA 1B0AA 1XDBA 4R84A 5EIFA 5HFAA 4NXMB 1IJKA 2IDZA 3PGXA 5KSPA 5CXSA 1U8TA 1W4CA 4Q34A 2D3TA 4WEOA 4WHMA 2A86A 1FFXB 5CJ2A 4AJJA 3S2IA 4ZHQB 2ACEA 1O4WA 4KSYA 3KZVA 1NKTA 4XSVA 4UTRA 3C3EA 2BVNA 3ICWA 2G9RA 3L0CA 3C45A 1RHJA 4H17A 4JMPA 4ZVRA 4IIVA 2HJVA 1EFUA 1NYLA 1SUSA 1WM1A 5DXFA 4CDNA 4DZZA 1XQ9A 4K9KA 3T99A 1VJ1A 1YVEI 4KO3S 3K0AA 3UA3A 4I08A 4I4NA 3ZHCA 5KYWB 3W5CA 2GEVA 4M7OA 1Z2NX 2R1UA 4Z0HO 4Z2YA 1UBJS 4ZI5A 3RT1A 4WZZA 1P9NA 1UOQA 4CM4B 5GWXA 4DJDC 5DTJA 4TLLB 2YWHA 3QEJA 2A7QA 2YMQA 3QU7A 4NG4A 4ZICA 1SZCA 5F98A 3RRZA 4TV8F 1ELOA 1P2TA 3VI4B 1ODLA 5DXJA 3C3MA 1DMRA 1MF7A 5EIBD 3UMSA 4P81A 1JJAA 1GPAA 5K03A 1QR2A 1OH6A 1JZQA 1Q2UA 3FNIA 1QJ4A 1RMQA 2W90A 1G21B 2R2GA 3WWYA 1GAWA 3UXYA 2G40A 3GBSA 1G5IA 3QFRA 4J4HA 4HXFB 4X1IA 2X40A 2IW1A 2WQZA 4BGDA 2HK7A 3PUYA 4FJ0A 2P9GA 2UU9B 3OCUA 5K99A 1C30A 3ANNA 4I4IA 3O84A 2OO7A 4YAJA 5LU9A 1GQQA 4BB0A 4ZRDA 3ZHOA 3QX7A 2FKAA 3FD8A 4XIJA 3Q6IA 3ROPA 3AI7A 3UBTA 1W5EA 3IAUA 1JQ5A 1NJSA 2B9VA 3FPSA 5ISMA 1A2BA 1O2DA 3KOXA 3WQSB 4JLDA 1UEJA 3PNYA 1P1BA 3OLWA 1XCGB 5HF5A 2AOXA 4EJSB 1X1EA 5F7JA 4RW0A 2WICA 2G6BA 3W5IA 2LP4Y 1XYYA 3LTEA 4RKYA 3R41A 5BSMA 1KGDA 4MS3A 1U0LA 2C97A 4QDXA 5A2QA 1P4SA 3H1TA 4PF1A 4ISBA 4JY7A 4PAWA 4OHZA 2TMDA 4URUR 3DGEC 4IDAA 1YJXA 5ERXA 1WKCA 2VT7A 3H3JA 2VXOA 4RYLA 3TNFA 1LNSA 2PFKA 3P9KA 4WKGA 1XPOA 1MG0A 1FLAA 1OIXA 1SZDA 2Q21A 2Q5IA 3MQ4A 4K9NA 1Z5OA 1YZKA 2ECFA 3OP4A 4JJAA 4RVHA 1OT3A 2EX4A 2VDJA 1IYZA 2K6GA 2AXEA 1OBFO 3VZCA 3ILYA 1P2DA 3PKJA 3DYVA 1UFQA 5G3YA 5EUQB 1MIHA 3MCTA 5E38A 2QBYA 2HF7A 2C94A 4QAJA 3BUSA 1ZZEA 1CRLA 3PJFA 2YJ3A 1TJPB 1CR2A 2IUFA 1BDHA 2VQ6A 1DWUA 2CJPA 2PWAA 3RYCA 2GN0A 4KX5A 4GICA 4D0GA 4EA7A 4BEBA 1XZAA 1R6TA 2BTOA 3TJZA 2RKBA 5PGMA 3EYAA 1D0VA 4RENA 3DP9A 3CT4A 1G3QA 2IPNA 3K4PA 5M2QA 1HI9A 1LNZA 1R8SA 2QTTA 2YYSA 5K8JB 1OA1A 3VR4D 5HPYB 2V58A 3MQFA 3EG5A 4Q19A 2PPVA 3OLQA 1S2DA 1WKVA 1VB5A 1BIFA 3MC1A 3ZWMA 5I51A 1U7XA 1UJCA 4HTFA 1XNQB 5FI3A 4ZJUA 2XGMA 2JIQA 1YRAA 4YCJA 1FX0A 3Q3GE 2AUTA 1ZOSA 4Y67A 4DJEC 1D8AA 1JPNA 1JXOA 1T0PA 2ZJZA 3GUYA 2GAOA 4HB3A 5ALUA 2NU8B 5JV5A 5M04A 3ZKWB 3GDOA 3ETNA 3N3BC 1ZLYA 3O26A 2GK3A 3GGJA 4UXJA 3RJZA 4C6TA 1V2HE 4XKJA 1J0CA 4X8LA 4BYGA 3DLTA 1U04A 1VL1A 3PS9A 1D7OA 1JP7A 1OY1A 1U3GA 2QVXX 3GARA 2C9YA 2KQUA 3RB8A 2VPQA 1QHFA 2HPAA 1UZAA 4JT8A 2Y99A 5DHAA 3IPXA 4BWGA 2FZVA 4PYIA 1U6KA 5D84A 2HXGA 4YV1A 4ZDIA 3QNWA 1Y3AA 4BP8A 3VYVA 1PNQA 4O1MA 5KWJA 3ESRA 3TINA 1MQSA 1JRLA 4JBIA 1E18A 1F3LA 2OK7A 3OKCA 4MEJA 4LVNA 5I8PA 1V8FA 1D1PA 3A6HA 4Q47A 1L4LA 1YFLA 3NCTA 4TYQA 2G9ZA 1QFMA 3ZCPA 3TNJA 1LNQA 2HIGA 4YUXA 1BKSB 2VJCA 5KJ6A 1VP9A 1YWGO 3FR8A 1AQUA 1KZYC 2A9QA 4CR8A 4DMGA 1F7VA 3GU3A 1NNUA 3HV2A 3OE7D 1XCOA 4Y6SA 5C31A 3HDGA 3C4VA 1BCSA 3M1LA 4A8JC 3AU9A 3ZVNA 5JATA 2BFAA 3AO0B 5P21A 4BTEA 3HB9A 3RFXA 1XZNA 1N2XA 4Z3OA 4CIXA 1YD7A 3KALA 1XZBA 3ZWBA 4JOCA 4D43A 5LLSA 3CLSC 1N9KA 2FW6A 4Q1BA 3S7TA 5F9HA 3GI1A 3SFVA 3UKOA 2BMDA 1OMOA 3H2HA 3KDPA 4JR2A 2ZJ2A 4BO7A 3CV3A 5GTDA 4DCMA 1IEQA 5EIWA 2GPTA 3RWMB 3JWIA 4N5IX 2DKFA 3WSWA 3BTVA 3T5GA 1WSWA 3ZWOA 3OQVA 4BMYA 2HJGA 2QG6A 3F6YA 2QXYA 3V4RA 4YVFA 1TMKA 2HLPA 5FP0A 1CB7A 5EKUA 3RSCA 3S4YA 2V3CC 4JI4B 2ZR0A 3DUFB 3PI7A 3FVTA 1C9JA 3D3EA 3QPWA 3ICOA 2WWTA 4H1VA 4NHEA 3C97A 2W6JA 5L6LB 1WAMA 4TXLA 1OZ0A 4GNRA 3ZLBA 5KDDA 4MEAA 3MTQA 5GM1A 1TZ2A 5JCZA 3C8HA 4GH5A 5D3QA 2GBPA 4A8PA 1ZA1A 1EGAA 4HDNB 2F1IA 2R8PA 4FD3A 1G98A 1PR4A 4Y9SA 1IM8A 3D6UA 4A5OA 2B4TO 4DCNA 1SXJB 3MJSA 4JLBA 2QZPA 1N2OA 2DLCX 2YWCA 1X15A 1XXLA 1YBMA 2P41A 3QFFA 3U9LA 2G04A 3IKLA 3PFIA 4PGMA 1BTOA 4HEQA 3JATA 5FJIA 4JL6A 1PEKE 2O3QA 3CKKA 1J2RA 1G6Q1 1PJ2A 1Y8CA 2AFHE 4OP3A 1MGOA 4XQ0A 1XEXB 1HT1E 2P4UA 3K7EA 3EAGA 1N6KA 4LXXA 4MUJA 2SKDA 4RA9A 4S1WA 4XGQA 4DTIA 2OKGA 5AW4A 3SYNA 2ZBEA 5IAOA 3GLFE 2R8YA 2XYHA 1N2CE 1H1DA 3GMIA 4ZTZB 1K8XB 4KWCA 2BELA 4BECA 1Z8DA 1MB2A 3JQBC 3ZHXA 1MEJA 4EOGA 2C5LA 3DV0B 1WXXA 1HMYA 1QIKA 2J0UA 1VL5A 2NVUA 2ZI6A 2DYKA 4K8OA 2XB4A 2P77A 3TTSA 3EHDA 4XJTA 2HSZA 1VPWA 3T5MA 1GRNA 3N8GA 3CZPA 1E3QA 4GE3A 3EPPA 3QOFA 3NKFA 2MU1A 1MDFA 3PNBA 4TLAA 3O38A 2Q6VA 2C42A 2ZVPX 2DGDA 1U8YA 1WXWA 3H5WA 5ALLA 3GBPA 3UOGA 3WIEA 1CETA 2VNSA 4IUDS 4Y9TA 3U9SA 5TY0A 1NI5A 4RGBA 1L8QA 2JBWA 3GZTB 4Q12A 1KYTA 2DM6A 1A5SB 2XBLA 2B69A 2ZYRA 4Q3LA 3U3XA 1WQ4A 2LTAA 1NW5A 4KPGA 1ZH4A 1UFKA 4RHCA 3R9KA 1ZN7A 1ZD2P 3L6RA 4RKEA 2HIMA 3S1AB 2J9FB 4C76A 4EABA 2FETA 1LS1A 4IJQA 4BNMA 4KQGA 3V4VB 3U5TA 3I2GA 1OREA 3FMFA 1T0HB 1D1TA 3HA3A 2RJ3A 3RC7A 3ASZA 3PLRA 2BFCB 3ZOZA 3GLGB 3K53A 1SOAA 2QQ5A 2FEAA 5KJCA 1MJNA 1N7JA 2JCXA 5LZ7A 1YE5A 3KELA 4LK3A 4OYYA 5SYMA 1WP9A 2FGKA 4DLUA 2AB0A 2EYUA 2BPOA 1XT6A 1RZ3A 1NX6A 3OUTA 1ZPDA 3UAGA 4DLZA 4IP0A 3O8QB 4MYRA 4WDRA 1AKVA 4CG2A 2X6TA 2CJWB 1UMCA 3L1IA 5JJIA 1M3SA 5BSTA 4E4RA 3SQNA 1SUAA 3BN3A 3ZWDA 4X61A 1HZZC 2CJXA 3NXKA 3WYCA 4GAEA 4AP6A 4I1OA 1L1RA 5CG2A 3N7TA 4O2LA 4ND4A 1HLFA 4D9BA 5BOSB 1ZRMA 4C87A 1QPBA 3UHAA 1YZHA 2O7VA 1A7KA 2FR1A 3OT4A 5E1DA 4D80A 2QVBA 1VCIA 1DAPA 3OCJA 4U0JA 2WWGA 3O73A 1JG4A 4H60A 4LOKA 3ZGYA 3N07A 2QI9F 2VBIA 1WUJS 4YUVA 1HFWA 2EFJA 5KDOA 2JKYA 5IBRA 3BT7A 1CS0B 4Q4JB 2FX2A 3ENNA 4Q39A 1GCOA 1NVKA 1U7ZA 2QF7A 5JSQA 1N6HA 2P6RA 1M0EA 3ZBPA 3UMMA 2H7CA 3LRTA 1RHMA 4TKLA 2H85A 1BYUA 3DTVB 1JLRA 4BBPA 4DKJA 4QGHA 3LLCA 1S3GA 4D9IA 4DRZA 1ACLA 3S3TA 1B1AA 3EXIB 4DFDA 4OSOA 1WQ1R 1UK8A 2HSWA 1NGSA 1D9ZA 2YW2A 3CJTA 4M1YA 1W87A 3IV9A 1RPTA 1YAJA 5C32A 2NNWB 2WU0A 4D6YA 3KIPA 4GLOA 5IKXA 3RHZA 4BP1A 3N2GB 4DCVA 4V1CA 4HNAB 4J0QA 4JQYA 2C8JA 4ARAA 2IX9A 4I50A 2PK3A 3RUAA 2E5LB 1MHTA 3M2PA 4OHKA 4LJ5A 1JFVA 2FZEA 1EGHA 3OLVA 3WGGA 4AZTA 4M86A 4WTOA 1KBOA 2PO7A 3NIDB 1MAUA 4CGYA 5KOYA 1ODSA 2P67A 3H2KA 3FETA 1SIBE 1UBOS 1ZUNB 5EJ5A 1TTPB 3BQMB 3K09A 3KYJB 4XARA 2EJUA 5D7BA 3AGPA 1KI9A 2QMYA 1DAOA 2IIBA 3B6JA 5FOUA 4XDYA 5JS1A 4MV7A 4KWHA 3JASB 5FNZA 4BVHA 3G5MA 3F5MA 1YUBA 1Z15A 3EDOA 4ZO8A 3OM1A 5HP4A 1E3EA 4KRXA 2AC2A 4AYXA 1S0UA 5J9FA 4L0MA 1C41A 1GZ5A 1W5TA 1F6BA 2MSEB 5JS2A 2D5BA 4LK2A 4FD2A 3CX3A 5CU7A 4BGUA 4WY8A 3GT3A 4UCQA 2EBWA 3AOEC 1OLXA 3NTLA 5DGTA 1L5SA 2ODTX 3MSCA 3LCRA 2Z5LA 5AYVA 1T1JA 5JY1A 3H5TA 3HG7A 4P35A 1TGVA 3I72A 1JF8A 1RHKA 4HI0E 4KU4A 1C3JA 1KXJA 1A9TA 1I4TD 2ISSD 2WAOA 4MVCA 4MVJI 5FD8A 4NV0A 1U5AA 4YMWA 4J1TC 2BGNA 3FCAA 3L8DA 1XLUA 2ECQA 2Z4SA 3RREA 3AT1A 2QL6A 3R7SA 1VYTA 1XD2B 2Y8EA 3DZDA 3HPRA 4PNPA 1UMBB 1WDTA 1XKLA 1N5LA 2FPKA 1H2RS 2PXXA 3NAQA 1EFDN 4URXR 1GVNB 4Y7DA 1C7IA 1DAFA 1USVA 2CXPA 3AGQA 1ADYA 1ADGA 2YYZA 4TKUA 2Y92A 4PS0A 3NRBA 2K7FA 1R5JA 3F5QA 1ZMOA 1L7EA 1I33A 1RE1A 1G9SA 2I1WA 2XGSA 4PAGA 4WZBE 1RVDA 3X44A 1XJWA 4EG4A 4DS3A 1S1MA 2VBGA 5FBHA 2X0RA 3WISA 2AFIA 2H1HA 3MWGA 1XZLA 1U4SA 2HU5A 2IEGA 1RRVA 2WKSA 1IOLA 3HNPA 1RHRA 2H59A 4GOXA 5IX8A 4E0BA 1GZ6A 1T10A 4HBZA 1PJ8A 5AXCA 1RC0A 4P3NA 5K0NA 3P52A 4FLFA 4HWSA 4BCDA 3FSJX 5AXBA 4MUGA 3ELUA 1Y5NA 1K7EB 1N1MA 2ZIGA 3QPBA 1HDXA 3H6GA 3BXPA 1ZP6A 1YHYA 3JQ8B 2FSUA 4OH1A 1QU2A 3M33A 2EAUA 4U8GA 4KBFA 3P9QA 4H9GA 4ZTBA 1U98A 4YP9A 5IVHA 1VPEA 3BICA 3I3SR 3W8DA 4DWJA 5LMUB 1I2DA 2W43A 4P7GA 1L5OA 3FOZA 1DLJA 4IOJA 4P53A 1W6UA 4M1EA 2H5IA 3MIIA 5CB0A 4P31A 1LB1B 1DCTA 2PZBA 1QAMA 5CYGA 4QASA 3TG8A 2AJTA 3ZW9A 1N5KA 2IEIA 1KU6A 1THMA 2O9JA 4FI3C 3ZY2A 4DR6B 4GYWA 4DSZA 3IAFA 1TIKA 3NBQA 5E8RA 2IHBA 1ZNYA 4TN1A 4BQNA 1VHJA 3N59A 3VUEA 4H0NA 3H7IA 4ALKA 3F96A 1Y5LA 4NIMA 1PJLA 2G83A 3VBCA 2RH8A 4Q7EA 4XWKA 5TARA 1NFRA 2ZRMA 2O4CA 4Q9LA 5CDGA 2VSQA 3ZGNA 2AJDA 1FTGA 3SR3A 1TUGA 1MD9A 3EFOA 5BQFA 3N2EA 3QVLA 4YGYA 3AG6A 3BF8A 5H16A 2O8EB 3GFQA 4O2BA 1U63A 4KCGA 2C92A 2IS1A 3C14C 3VR1A 4QBIA 5I9IA 4FLMA 2V9PA 4YX9A 3UMVA 2HSJA 2I76A 4NF2A 1LCIA 1BE8A 4HNVA 1UKCA 4JP3A 3AV3A 2OAP1 2ZFUA 1ZZGA 2OLEA 5L3ZA 1K08A 2H08A 2JAXA 1IY9A 3OG9A 1Z16A 2B35A 1SY7A 1SCBA 2YCLA 5ULLA 3SEZA 5LZ8A 3UJAA 3HKDA 5E6SA 2JDIA 3HV0A 2QPLA 4X8MA 1P77A 4EHNA 5I3CA 1T8PA 1SCAA 1ESNA 1T5SA 2NU7B 4WT7A 1N8KA 4NCAA 1Y1TA 1EFLA 3FIUA 4QXPA 3L6DA 3MT8A 3QENA 4HMQA 1XR3A 4EATA 3RS5A 4IMJB 4AS1A 1M6YA 3MLBA 4KPFC 3SJBA 2L18A 1MA3A 3V7FA 2EHJA 4G01B 5C1OA 3EG9B 2QG4A 3CR8A 4KLAA 3B7PA 3GX1A 1DRUA 4KOAA 3QHAA 3M6XA 3RU7A 2GCEA 1HWYA 3F1LA 3TOVA 5IAAA 3GJ6A 2CLEB 1GGNA 4WKCA 4QLBA 4JAVC 5I3ZA 1HYBA 4PQGA 4TV9B 4ZV7A 2X4GA 1KOFA 2C00A 1OE0A 4P22A 4YV0A 2JLWA 4MTCA 2FMFA 3NM6B 4KQIA 4C7OA 1ZICA 4ENPA 1PZEA 3YASA 3QEOA 2P2DA 3VDXA 5L7WA 3V2IA 2IYZA 4L27A 4LXYA 3W5AA 1TC1A 5F3RA 2DEUA 1NMQA 3WQHA 3NWJA 1YI1A 3QXHA 5FFMA 1ZSNA 3MTEA 3AUAA 1IZ8A 3SZGA 1TM4E 3K9QO 2IZ7A 3DT9A 4X64B 5HKKA 2SKCA 3SC2B 2IS2A 4HX5A 5FBWB 1RQPA 3H9CA 4AYTA 4TV8B 3R9XA 5J5VA 2H29A 4O02B 5BUZA 4LOJA 2C59A 3LK7A 4IV8A 4UNIA 3AQ4A 3ESDA 1NOIA 3MNFA 3KSAC 2JJ2A 2X1HA 2FFRA 1JHVA 3C15C 3K0BA 4D9GA 4NU6A 4QQNA 3TZCA 1EXNA 1NVVR 2EHDA 1NVGA 2ZE5A 1E2FA 3C48A 3MOIA 1KAGA 2BAGA 2C29D 2OM6A 2PU7A 4NCNA 1V7CA 5B4UA 3BE4A 2H16A 3O3OB 4P5EA 4B48A 1J2JA 3EK2A 2VQFB 1IWBB 3H0KA 1S2IA 2Q5CA 3BSSA 1U1FA 3MWJA 1JDUA 4CUKA 4PIPA 3PYLA 5ARCA 4YMUA 4YT5A 3RVDA 4UHBA 2XWSA 1JMVA 1KQNA 5IJWA 1EVIA 1NF8A 3RVMA 1UKYA 1I2BA 3EEIA 1II9A 4O59O 4IRMA 4RHXA 4BL5A 2O5RA 5KQRA 1PZGA 1UJ2A 3KD3A 2VJBA 2F62A 4Q1EA 1OBCA 1US8B 5F3WB 5ICMA 1JU4A 1T4CA 2SKEA 3JARA 2CDBA 1M2EA 2BJWA 4S1TA 1ZW6A 2PX8A 1I3NA 2BCEA 4M22A 4X7RA 1SMKA 2EGGA 4JC4A 4JV5B 5I4IA 4JNKA 3IE1A 2ZJ3A 4G1FA 1DXQA 4DXAA 3NTRA 5JCJD 5TV2A 5C34B 4QHSA 1YBAA 4UEWA 1J9ZA 4ZAFA 2NSLA 5ILQA 1CJVC 1YQTA 2OOKA 2FJPA 5JJLA 5AI5A 1YH3A 4CCYB 3K1AA 1RP1A 3IERA 1XP5A 3QJYA 2JLYA 3KYDA 1J33A 1F2VA 1KI3A 5ALFA 1BWSA 1HGXA 2FQQA 3WGLA 2IBSA 2DH5A 1CIVA 3REQB 4A9AA 1YS7A 1PR1A 4HZUB 4KXNA 5JS8A 2WTXA 4MS4A 1CUWA 5DH9A 3WWDA 2IXDA 4Q0MA 2Q5LA 1PV4A 1PVOA 1NC3A 4B6RA 3Q12A 1V4NA 1MH9A 2OO5C 1ZNWA 1LSSA 2A5FA 1Z35A 5BN5B 1ZVJA 1C0IA 3VPSA 3OBBA 5H9VA 4XYEA 1UK9A 1JILA 4WPGA 2UV8A 3QGMA 2FPPB 1TJ3A 2QV7A 2ZUSA 3PNPA 4CMEA 4BQSA 3ADDA 5JAQA 4TYNA 2PR2A 4I4TA 3U9TA 1L5HA 3QF4A 1PFVA 4DA9A 4BE9A 1NYQA 3LL4A 1GPLA 1GNPA 4KGDA 4MB2A 4L3WA 4KAFA 2L17A 4DG9A 2VDUE 3SY8A 4II7A 2AMJA 2JFHA 1R88A 3B7GA 5T4FA 4DLBA 4RS3A 1DRVA 1IB0A 4PSAA 2I8LA 4HB0A 4NYJQ 1JVNA 2IK8A 4FDLA 3STTA 3EVFA 5KYUB 3JX9A 5I48A 3OZFA 3EIEA 2QRNA 3VYRB 5K8CA 2GN4A 1BXZA 5ERYA 4Q9JA 3H84A 4LWPA 3OE4A 4DARA 3AIIA 1VA4A 1KZ7B 3AR5A 2X5JO 1NI4B 3FF1A 4LRTB 5AVWA 4UDXX 4X1KB 2P30A 1GM5A 5K3FA 2N75A 1JSXA 4KQWA 1GNQA 4U6SA 3N2NA 5F33A 2BCGY 2GBGA 2XY4A 2YS6A 3BDAA 2RCYA 2AOUA 1E98A 2W9XA 4HWTA 2R7MA 4NFYA 4NS1A 1M76A 1OROA 2TRSB 4OJMX 1RM0A 2GZ1A 3BJRA 2IXBA 5REQA 2IXAA 1MN6A 3H1FA 1NP3A 2E89A 3RYHA 3CZAA 1NXXA 2XUIA 4MPDA 4B35A 4UTPA 2C9MA 5C37A 4Z3DA 1IBMB 4IIJF 3I6ZA 1A50B 2AFHB 1SBIA 1VL6A 1CHDA 5KMGA 3W3ZB 3NBYC 1YBFA 1JGTA 1P6XA 2WVHA 3NNDA 3UW1A 4X3OA 3GLFB 3ZWNA 1N2CB 1SUEA 4MR8B 4EPYA 3A7EA 4Z4GA 4UM9B 1YQUA 3CVOA 3NC4A 4FIZA 4NPHA 1CXZA 1M6WA 1G59A 3DVRX 1T5LA 1Z0SA 1ZUIA 3X2SA 4BWVA 3JRNA 4Y2RA 2OR3A 3H11A 1UQTA 3FZYA 2DLDA 1GGVA 3QVOA 1RFGE 4EKGA 4Z4QA 1AZWA 3ZJ4A 4NCJA 5FFFA 2RGUA 4FJ2A 1DIAA 4G26A 2W6MA 5CT5A 3WRYC 4HUQA 3MEQA 2DUNA 1RZRA 1ODFA 4CMGA 3N8KA 1YE3A 2XODA 3IJ5A 3OIUA 3UHPA 1MC5A 1T6YA 1H85A 4F1WA 3D02A 3GC6A 1QG0A 1M0TA 5AW8A 5K3AA 1GU0A 5D2CA 5FUQA 1NLFA 2JLCA 4MVJF 1TUIA 2FR0A 3FGZA 3PF8A 2IP1A 1CF2O 2GEDA 2JZNA 4W6QA 3EWSA 4CT5A 3FLEA 3W7BA 1H2AS 1YNOA 3JR3A 1Z8FA 3KAJA 4HDRA 4JB8A 2WJ6A 3ASUA 5KYYA 3LBFA 1M2OA 2WG0A 2WTNA 2ZB4A 1IEWA 1EJBA 1BCRA 4H3HB 1MJHA 1UAGA 2QTLA 4QVKA 2I6UA 3EPLA 2XCOA 4AM8A 1BYIA 3K0HA 3TZLA 4LKOA 2Y1KA 3S1LA 2BY4A 1AMUA 5GJWC 2HSDA 4TZTA 3ZI7A 3DKKA 1UM8A 3VOBA 3A58B 1XLWA 3SJUA 3PUZA 3JYOA 5T3YA 2I2AA 1U4OA 3BE8A 4LE1A 2FSPA 4DV3B 4JOSA 4EW6A 1ZRHA 5FRDA 1E2MA 1IC6A 3JQPA 4MRSA 1DUIA 4MWBA 2YY6A 4YTEA 2V7XA 4NENA 3W5DA 5U4QA 2Z8YA 4LMRA 1DV1A 2FEWB 4X8HA 2YHIA 2RHTA 3A8TA 1F60A 2WWIA 2VC2B 1HE5A 2RJNA 3I42A 3LVFO 3MGBA 2X5NA 4G0QA 4OP2A 2H9IA 2Y4NA 4C3UA 5BV2P 1EB8A 2ZRLA 1P72A 2N9UA 1VCNA 1PGJA 2FWJA 3DOJA 3O8BA 3E61A 3HACA 3R5HA 7MHTA 1E6MA 2ODEA 5JYBA 1NW9B 1XQYA 2FX5A 2TYSB 2PGJA 4IUBS 1LQUA 1YOVB 2J9GA 2C5FA 3ZGXA 2BC9A 4KQ6A 4CIDA 4ZCMA 3IUYA 4MNTA 4MVJE 1G8KA 1KZGB 2WTAA 3D3KA 5A2GA 1MRSA 2OCKA 4DSNA 2JEYA 3PGMA 3ZVLA 5C81A 2JI7A 1E79A 2ZBRA 4PONA 4MW1A 1KDZA 1VCOA 5GZ3A 1XRNA 4RD1A 4RTQA 3B5JA 1T1IA 1E64A 3B5IA 3DAFA 4PCLA 1KKMA 1OFUX 2W48A 4PYOA 2OGUA 2GF9A 3A3KA 4U6NA 1OBVA 2J5KA 2TECE 3L1JA 3AY6A 3DQZA 1GZDA 2QPOA 1LTQA 1TA9A 2HOQA 2DBYA 1R10A 1Y33E 3D2LA 4PLTA 1KDTA 1QGZA 1S2OA 3P45A 3AFOA 3KLPX 2WA1A 5DLDA 3TNYA 3I61A 4BJ6A 2Z57A 5F76A 3LHIA 4JT4A 4UEOA 3AETB 1EVQA 5IAGA 1ORRA 3IBYA 2G72A 4P4TA 2XE7A 3U4HA 4AY4A 1NURA 3LVQE 3CNOA 4WXYB 4NDAA 3T7DA 2AT1A 1ITZA 1TIBA 2Q0QA 3AX6A 1T15A 5E4YA 3KKLA 1AMNA 2VQDA 2NTYC 1PL7A 3AHCA 1GPNA 4G8BA 4BMPB 5ELLA 3LX8A 4BRWA 1JA9A 2RGNC 3GCGA 1O6GA 4XM0A 3WSTA 3T41A 3RYFA 1NLYA 3E9MA 1JI0A 2BMWA 3LA8A 2AIRA 3P0JA 3ZWWA 4AK9A 1JQEA 4D81A 3SHQA 3M3PA 2W2LD 3NVMB 3M4YA 4UHCA 3H0CA 5IARA 4REMA 3TLGB 1QIDA 3FTCA 3K92A 4CTJA 6REQB 1DEHA 4L4XA 3RS9A 3D4LA 2WI8A 5TQ2B 1L3CA 2ZWPA 1KI6B 4XWYA 4EZBA 2J6IA 2Y4OA 4PU0A 4DUZB 4GGPA 3AXTA 4XQCA 9LDBA 2IBTA 1GSIA 1M1UA 1T2AA 2IPLA 4K2HA 1ZD3A 3CNQS 4G5HA 2RGRA 1A82A 2QLTA 3RH0A 3OM0A 2CLMB 1I0LA 1MFPA 1XRMA 1SBYA 1XZCA 1ZOIA 4AX8A 1P74A 1HDGO 3AF0A 3E8MA 3QJ5A 3R1IA 4M0PA 3STVA 2ZRKA 1B42A 2J4CA 2O2XA 2ZUUA 3Q9NA 2H2FA 4MLCA 1LZKA 2HA6A 5KKAA 4QU9A 1Q0ZA 2O2CA 1C29B 2RHLA 3BE6A 1DC8A 3N5CA 4OQ4A 4RXUA 1L8LA 4KFUA 4UM7A 2Q0SA 2NW6A 4I8IA 3V7YA 5SV2A 3OEEA 3EVEA 2RIRA 2CF5A 3Q87B 1LA2A 3VU9B 3GLSA 3JRWA 2GDJA 5CAEA 4WZBB 1S2MA 3DE4X 4E21A 1RC1A 1J23A 3MS4A 2CB0A 1O1YA 2OM2A 5TMEA 4AUEA 3L82B 4DDKA 5ELXA 1MW8X 2RAVA 2CUKA 1PQ4A 3UFXB 3B6ZA 4N8DA 5BNFA 5I7UA 1WUIS 3JVVA 3KO8A 5HS6A 1R0CA 2QHXA 1DG9A 2PYDA 3QMVA 3LCJA 3T52A 2XXJA 3IUBA 2RH5A 3GPDG 3GVHA 4FKZA 4US2R 1WL8A 2XE8A 3ND8A 4HGZA 4RHFA 1CFJA 4BNZA 4N7RA 2ETVA 5TGZA 3O3CA 1FS5A 4S1NA 3I05A 3JPWA 2R3SA 4R41A 1Z5ZA 3ROXA 4Y9UA 3ITDA 4IVRA 3CZ9A 3STUA 1N8TA 4EAQA 3AKDA 2YWBA 1T9BA 2PRKA 3CIOA 3IV6A 2XF8A 4LDJA 2B0JA 3VMFA 5F73A 1J0XO 1Z07A 2LXNA 2PX3A 3KDSE 2K2QB 1GTRA 1W76A 5C0OE 4FHCA 1NE2A 3I6YA 4KXFB 1I7SB 2J41A 4Q37A 2QA5A 4R7ZA 1M2HA 4MR7B 1NHWA 1F5SA 1ZCJA 2WIDA 5KBYA 3LPMA 4RL6A 3IKVA 4ABYA 3TJRA 3MUNA 2OV4A 1RJ9B 3HFSA 5DBHX 3AL0C 1O96B 1QANA 2IYVA 2J3IA 2Y3IA 1QFXA 4Q3OA 4U3JA 5EZSA 1BGVA 4E88A 3K70B 2OC9A 1TLLA 4PRYA 3JTEA 3EOAI 4KRGA 4V39A 3SG0A 5A9SA 4L22A 4IJKA 1KOLA 3K0FB 1B6GA 4MGEA 3ZW7A 3WYNA 3UPDA 1PUIA 3TFOA 1ODCA 4FI3F 3T9FA 1C9YA 1BS9A 2H1LA 2ZSFA 3CH4B 1GAJA 2E85A 4IXMA 1ORDA 2JI8A 3BSYA 2O1EA 3KJHA 1FUIA 5AJYA 2BHNA 2G07A 1CR0A 3PUKA 4YJ3A 3USES 3VU3A 4YAOA 3OD5A 4X90A 3OJFA 4YRLA 1ZA2A 3LUBA 1GGHA 4FMCF 2FJUA 5FWYA 2K7ZA 5KOJB 2CE7A 4DSTA 2F8SA 2JI4A 2UZ1A 2NO1A 4Y2TA 5EERA 1YVUA 3QX8A 4F45A 4W4TA 2OYSA 3ZDYB 2YDXA 3E35A 4R1NA 5IJ9B 3DDNA 3F49S 1P1HA 2A84A 2FWAA 2KHZA 2PMBA 4MO9A 5HF6A 3RAGA 4B4DA 2H2DA 3HBMA 4KIFA 5L3SA 1EVZA 3E3NA 1HT2E 4JYAB 3PUXA 1QRRA 2CLSA 3UJ6A 3AERB 1D04A 4LVUA 4RK4A 1S5PA 1ZGGA 4J91A 1RAEA 5K1ZA 4RQTA 2HQOA 1AKTA 3G8BA 1IH8A 2AG8A 2HHAA 3HJGA 5EQFA 5PNTA 1XNRB 1M2GA 2V45A 1AU9A 1JG1A 1TKBA 4HDSA 3LBNA 2R84A 3UPUA 4ZTUB 2PE5A 3N8HA 4JXJA 5FWXB 2KE5A 1GLGA 3TLCA 3HCAA 1QQ7A 1KRHA 2XYQA 3ZBUA 2E4AA 2AG0A 3D8BA 3FFTA 1TK9A 3T0IA 4FMPA 1PNOA 1ZX1A 3HY6A 1BVUA 3PJGA 4R8RA 3OQ6A 1CUBA 3HJTA 2ODNA 4NSNA 4RM2A 5EQJB 1KYXA 1MFZA 1YXMA 3ND5A 4ZZIA 1UAAA 2YIMA 2NTEA 1PSZA 3FWHA 1QF6A 2YIVX 3ZCTA 3PXEA 5GIOE 1BD4A 2EJCA 5HRCA 3RASA 1MO2A 1LRKA 4QPJC 1SQ6A 1Y7HA 4FBMA 4UEKA 2ZIUB 1QK5A 1JQBA 4WXHA 1J8VA 2A5JA 1SWVA 3BK1A 3ISVA 1C8LA 4KKXB 4C29A 2GEJA 1Y5IA 1Q11A 5LP6C 8ABPA 1DJPA 2VP4A 5JD3A 3H2GA 2ZBVA 4JUCA 3TW0A 4HFRA 2AOTB 3TI7A 2X8JA 5DHQA 1AGXA 4C4TA 1ND5A 2WVGA 3KXIA 1Z0AA 1JDVA 3VFDA 1Y5MA 4K6CA 2O0KA 4MRRA 3WOHA 1KYYA 1MX3A 1SD5A 1O57A 2B9EA 3I8OA 1X1QA 4DE5A 4DV1B 3OQOA 1B16A 1DNPA 1C0EA 2XCLA 3E7FA 1X38A 2W6OA 3EW9A 3KTAA 2FCAA 1KH1A 2F2TA 1EUQA 2JGKA 3BB1A 3WI7A 1TKAA 1I13A 1L7BA 2R60A 4XIFA 3HVKA 4PZ9A 3MXOA 3KB6A 4YRZA 2M6LA 3KKNA 3QWBA 1JALA 2X2EA 4HDKB 4ZOBA 4ZV9A 3V7WA 4CODB 4I3FA 1T2UA 4PICA 2FPWA 1B6SA 2RKOA 4WLFA 2HDNB 3ZU3A 3DOUA 4JBNA 4MZDA 3CB4A 4MUHA 3ZI4A 1M6NA 1GNSA 1T4DA 2JB9A 1VSUA 3H2BA 4FNAA 2XQJA 2Q3CA 4HATA 4OHUA 3WTBA 1Z7WA 1SVIA 1C0KA 2CY0A 2H1VA 2DPMA 3DOFA 4FDAA 4KLNA 4MKIA 2HPHA 5DK4A 4RABA 2QY6A 1EJ6A 5BY2A 1DT3A 2F1KA 2ZZNA 3OZ7A 4V2IA 3FCEA 5FH9A 1QTIA 3ZV4A 4BMSA 2FPRA 2E21A 3ER9A 1NPTO 2SICE 4GP9A 2QN6A 1CUDA 1TL7C 2HRDA 4WBNB 3D8UA 4X95A 2BOVA 1AUOA 4ICIA 2EFYA 4RETA 4ZAVA 1JN0A 5E3HA 2GEUA 3U4AA 3V42A 4JEHA 3TM5A 2HA3A 2JGJA 3QQPA 1X39A 4C6SA 2IELA 1KVSA 4CQLA 1YZYA 5DK6A 2WDZA 4DJTA 4JYZA 1M6EX 1NY6A 1QF9A 2BKAA 4C89A 3HU2A 1WUKS 1X1RA 2C0QA 3CZMA 2CN1A 4FOSA 1QCDA 4GC5A 4DJFC 2HTFA 1LVGA 3DB2A 1HEYA 5K8LA 3DHVA 2FSIA 3PC4A 1FTNA 3D2AA 2EWWA 4RHTA 4MMZB 2BM0A 3WE7A 5EKDA 4QRDA 4BX8A 2BMVA 2ODWA 4JX8A 2JBAA 5C4MA 3LYAA 3S40A 2WKWA 3W8RA 2VNAA 3CNEA 1AA9A 1F8XA 3KJQA 5BSRA 3ZX4A 3FDJA 5FL7A 4LZNA 4U2CA 3ER6A 2AN3A 2WFMA 4OBBA 3GAAA 5EVCA 4AJ2A 3CRNA 1R0WA 1X8LA 2CD7A 4D0NA 3L2OB 3B9QA 4XLTA 4AECA 4UNQA 5IZCA 1YHNA 1DUSA 1Q6YA 1S89A 2VEOA 1GRQA 1P1IA 3S70A 3C70A 2R7NA 3DHNA 4KACA 1WTAA 5DU2A 3T94A 1YDFA 2HCFA 4N7BA 1UKZA 7REQA 1YC5A 2JNWA 1JXAA 1KYVA 2A0YA 4FDVA 1XB2A 4WUTA 1YZFA 2AZDA 4CT4B 3FN4A 2NZXA 5SY4A 3KTFA 2XRZA 5IKMA 1IMOA 1KHHA 5IDVA 4CM6A 4O29A 1A5ZA 2OENG 4EGQA 2OG2A 1COWA 2YNMA 3V1TC 1PLJA 3GEHA 4XRRA 1T6ZA 3MVEA 2OVBA 2WG1A 3QLVC 3WK7A 2PL9A 3DLIA 4PCVA 2D1QA 4QTTB 1T6NA 1WD5A 1YS4A 3KT3A 2C9DA 1P2UA 5EE5B 4ZCPA 1N8NA 2OUIA 4XGRA 4KRFA 3DOCA 1CZRA 2V7PA 4PW0A 3TPCA 5JZVA 1JEYA 5LBTA 3RBZA 3NHPA 3WQQA 4GBED 4MVJH 3QI2A 3TLXA 1T5HX 2LDXA 5I5GA 1K6XA 1CZOA 4JJ7A 2ZUTA 3VMMA 3UNXA 3K20A 5JY6A 1A7AA 1IUOA 1RWWA 4MJ3A 1TW3A 4QO8A 4OAQA 4EZIA 1QP4A 1U9CA 2VZ9A 5JWHA 3BWXA 2CMKA 4BNIA 4ZPJA 3IUNA 4EARA 1DC6A 1KIMA 4YLEA 5AR1A 3BTOA 1P1CA 4MZXA 5AOAA 4Y1EA 4WL0A 3LKZA 1AMOA 5JADA 2BBWA 4V0MA 4CG1A 4N01A 5B7QA 3OP1A 2ZRJA 4AZ3B 3TGLA 3NAZA 1T91A 2YOHA 2UYOA 3P32A 5F5XA 3TRDA 3ZYZA 1FPQA 3K5PA 4MS1B 2QSZA 3AF5A 3WGUA 4X60A 1KEWA 2FUNB 2QN9A 3ED1A 2Q8PA 2CUNA 1Z08A 2QW1A 1NY5A 2VG8A 2CW5A 2YQ4A 3R7WB 3GEIA 1UJ6A 4WMLA 5BWCA 5HQ3A 1E9SA 1T25A 4OHFA 4MUXA 4ZZ0A 1QGUA 3VPBA 4EB0A 4DG8A 1N25A 3WFZA 1Z18A 4G5XA 4C4SA 5HIIA 1NSYA 1PV1A 3Q9SA 3WLSA 1WQ3A 5IASA 5AOBA 5H70A 4D6PA 5GPBA 1SXJD 1PEAA 5CIWA 1P3Y1 3FOAA 3L77A 4LHSA 3A4VA 2CLKB 2VDPB 2Y9MB 2GGSA 3N53A 3EBPA 3K1JA 4X24A 3BWVA 1KK1A 3NNNA 3V1KA 3WP0A 4A7PA 521PA 2ZIVB 2RDMA 1T2EA 2FQ1A 4HQOA 4KGXA 4ONEA 1IXYA 3TCXB 1T9AA 3R7NA 4C3VA 2A67A 2YDYA 3E8XA 1N92A 1LVHA 3F1KA 4FCCA 4KDFA 3NBXX 1DKPA 5EJ9A 1D6NA 4JI1B 1EE9A 3VHXA 1NAIA 1VCHA 2G71A 4QYXA 4PNZA 3I1FA 3HRHA 2FE4A 4IIJB 3S6JA 3H7AA 3ROEA 1GPWB 3DNMA 3KLBA 3QTTA 2ON6A 3IT2A 4LFCB 3UMGA 4MW2A 2VYQA 2RI0A 3IVXA 1K8RA 1NTRA 3GRKA 1X86B 2VWHA 5FWDA 3RSOA 4D0LB 1H93A 4G0WA 4G4GA 4HQ6A 3TVYA 2WIKA 5F23A 3IEMA 1DKQA 3OEHD 4IYRA 5HVNA 1KFCB 2ZP1A 1ENYA 5KC8A 3RBAA 2ZJ7A 2GJ4A 3X1MA 3PU6A 1YB7A 4BTVA 4E5NA 5HZKA 3PPVA 3KP1A 3WK5A 3QV2A 3W2HA 4ARZA 2RHHA 4PO9A 1DFIA 4MWCA 5GMOA 1HX7A 2I8CA 3IQXA 4J4BA 1RLUA 4ZVNA 2Y67A 1EYZA 4MVWA 2Q3LA 3COYA 2VBCA 3UK6A 4AS2A 4BJ1A 4EO4A 5DNAA 1F14A 4CIWA 5DI9A 1ISHA 1BMFA 2OB2A 1YGPA 1G66A 3HL0A 3KEFA 2F59A 1WD7A 5DCWA 3S2ZA 5FBQB 1G17A 2CZGA 3V1MA 5TIIA 4BMNA 4UCWA 2BTEA 3WL3A 1ONSA 1NKVA 1YI0A 1LK0A 1JZSA 1E2QA 1VLLA 3GDHA 5IN5A 3SYLA 4HT3B 2QOEA 3SS9X 4AJ9A 2XTJA 2C5EA 4M21A 3LLSA 4KBYA 4O2AF 2HMAA 4B46A 3PICA 3ZEAA 4Z51A 4M7RA 2YH2A 4RK0A 4CF5A 4YCDA 3NEYA 3MWEA 2X2FA 3K15A 3KL4A 2CVPA 1EVLA 2VDWB 3W9UA 4DXHA 1DL5A 4MQBA 1CTQA 1XFDA 4DYHA 4U2DA 4F4JA 3LUFA 2V03A 1VE5A 2VRCD 4ZXFA 5K3SA 1GN9A 1ZFNA 2WWRA 3MD9A 3QM1A 2ORED 4QSHA 1OR8A 5JAPA 1GL7A 2PRJA 3OKPA 4J3NA 1QWSA 2NZ2A 1GEGA 2HMSA 1FDRA 5L7TA 3B6MA 2IZ5A 1IY8A 1F0KA 3WBKA 1RCTE 3OTOB 1LC0A 2C4UA 1JKXA 1TUBB 1ZN9A 3K35A 2HAEA 4HLNA 3H9BA 5DX8A 5LXTF 3SSMA 3W4KA 1EK5A 3I23A 1Z88A 3MERA 2WJ4A 1XZPA 3HQ4O 2WSLA 5I7FA 4XDHA 5AESA 2RHGB 5HDBB 2I4TA 4OQLA 3OFVA 1L4YA 1NRIA 1PGQA 2GBIA 2FDRA 3DTVD 4Q02A 5CVTA 3FWNA 1AUQA 3FMGA 1VMAA 3BWYA 1NPDA 2NACA 3H4TA 3M0EA 3OT1B 4MOWA 2CFIA 4KH0A 3DQPA 1IE3A 1FDIA 2OQRA 4WVLA 1ADCA 4X6UA 3HHEA 4A4DA 1NN5A 2JW5A 2PUJA 3D6NB 3MOSA 2Q1UA 2QRUA 3LHFA 3NJRA 1UXKA 4ZJPA 4YAGA 1QFSA 1X2EA 3R5SA 4IDOA 3VSAA 1W0KA 2WTEA 4EK9A 3CRMA 3HCFA 5JJCA 4JI2B 1Z2AA 2Q8QA 3WQRA 5CLFA 2Z83A 3GJQA 3FG9A 4GPBA 3ZZUA 2IHNA 2P62A 1SGWA 1B3RA 1R5NA 2HWWA 4QRIA 5IG2A 1BDMA 1VIVA 2A92A 2R1TB 3R0QA 4NBRA 4UU8A 2Q7DA 3RDPA 4D3XA 4E6PA 5CVCA 1TO1E 1RZVA 5TVKA 5IEJA 3EUEA 2IPOA 3GIDA 3H86A 3KR0A 5TQVA 5B3JC 3OAAD 1U2QA 1DE0A 1SG0A 2CFRA 2DBZA 1C1XA 2HK9A 3AC0A 3IUPA 1T24A 4GI2A 4C4XA 1ZESA 3CX4A 2YOFA 4CKEA 2O8CA 5GAJA 1CQJA 3RU9A 1OVGA 3AI3A 1G1MA 2Q9BA 3PCRB 2AEFA 5KJEA 5EIBC 4BQIA 3HWSA 1KSFX 3NBZC 5AVKA 3A6GA 4UNRA 1WB9A 1G2PA 3F7TA 5C8YF 1OZAA 2N46A 3NHZA 4KL8S 3IT0A 1T5DX 1JLLB 2VZ0A 1CIJA 2W4QA 4MWOA 1YO6A 3I01A 1V9SA 5KVAA 3NXSA 5EY5B 3QBVA 2NYUA 5JNWA 4IGFA 1BA3A 3NJ4A 1MCZA 2XKAA 3HM2A 3CPHA 3Q85A 2FLKA 2V1XA 3OCWA 3IP7A 3O95A 4MVJP 3X1WA 3S2EA 3L4KA 5AKEA 4UUAA 1TD9A 3V6LA 1ZCAA 1Y48E 5DJ5A 5JQGA 5FYQA 2F00A 4E2ZA 1VOTA 3H5LA 3TUIC 3WNBA 2A9FA 2J3EA 4CT0A 3NS7A 4XVRA 5CH8A 4D9CA 4ZEMA 3H19A 5BN4A 4ZI7F 3HU5A 5A7FA 2HWXA 4PYLA 1JHYA 3TOSA 3KKEA 1A95A 2IU3A 3LDUA 4EHBA 2CXTA 4MYUA 2JVJA 2VL7A 3KVOA 4ZCSA 4BX2A 3PC8A 2HJ9A 1JXMA 5TQ0B 1PJSA 4XTRA 5K0BA 3VJRA 4CMIB 2M6SA 2VA9A 1QFJA 3DC7A 2LIPA 1GQSA 3WA7A 2YUIA 4XE5A 2HIAA 1X7YA 2X9QA 4IM7A 2GAJA 3GROA 4M6WA 4W82A 3X1JA 4BJ5A 4ES6A 4KR7A 1OXTA 4GF5A 3IO3A 3MMXA 3PWTA 1PWYE 3ZWYA 1P60A 4PSVA 1DCMA 4BV9A 2WPDD 1CPYA 2H48A 1EP3B 4CR6A 1M9NA 3O75A 3HR8A 2BUAA 3V9AA 1NP6A 2DT5A 5G4LA 1XZGA 2IZZA 3MTIA 1KZ6A 2G5PA 4JB0A 4ME6A 4CF7A 3EEYA 4Y6QA 3CSUA 1F1BA 4B4UA 1GNVA 3HNRA 4F46A 1IG3A 4K46A 3VO2A 1XPRA 1VE1A 1DINA 3WYDA 3G2KA 4TGLA 3CXUA 3P9NA 1T0JB 4G89A 5JPCA 3THWB 4R68A 4ND5A 3HB1A 1G6OA 1ZUWA 3KTOA 1NUHA 3STWA 121PA 2AD1A 2OV1A 4BAGA 4LJ9A 4ZAYA 4PQFA 4RU1A 5BNWA 3SBOA 4PANA 3NHKA 5K4HA 4UUOA 5C53B 5DLPA 1M8JA 2B3TA 2OLJA 3P9SA 2AZ4A 4P92A 4EPXA 4IIYA 1UDXA 1D2CA 1QS0A 1GG5A 3SR0A 1VHDA 1SHKA 3OFKA 2Q3FA 2XUOA 1O6CA 3LGXA 4UMFA 2NT4A 5FPTA 3RIEA 2YWXA 1JR4A 1M8GA 1TYEB 3QVKA 5BMVA 2NV0A 4QDJA 3R5TA 2NG1A 1TAGA 1FSZA 5E9QA 5FA8A 1GXSB 1TVKB 3HCEA 4BNKA 2Q07A 1FYFA 1KA9H 2IF0A 4INOA 1TVMA 2DT8A 4P93A 3JZAA 3SD7A 1NSFA 3JY6A 1LDMA 1Y1PA 4UARA 3TVDA 4C06A 4G6ZA 1H1TA 2PKCA 3NOQA 5KJFA 4QQKA 1DBVO 3E9QA 4N3CA 3VAAA 5FPPA 2R00A 3NAMA 1CQIB 1T3LA 4PAQA 5H4GA 3BHIA 1QKKA 3PXXA 4RY0A 5BR8B 5BN3A 1HTTA 5C46F 3FWZA 3RUHA 4NFHA 2AMFA 2CVQA 2XYGA 2HWKA 4AKGA 2Z2YA 5A5FA 1P44A 1E66A 2PBZA 1AS0A 5IVPA 3AVYA 5H02A 2GPWA 4FMCB 3RNLA 4BNDA 4GOOD 3QA9A 1FP7A 1SQ0A 2BSAA 3DE0X 4XR9A 4M1SA 5DDIP 5FPQA 1JAZA 5DNDA 4GW3A 1TVCA 1GAQA 1MAHA 1UT5A 1H69A 2ILTA 3LOUA 5CVUA 4AZWA 3ZV7A 5AW6A 1AUXA 2Z8YM 5K8UA 2BHSA 2W6CX 2WAMA 1EX9A 3B7WA 3HJCA 3LNTA 3QWHA 3SC3A 3ZNPA 4Z4FA 3UAYA 4AROA 4RDIA 4FT4A 3HC7A 3NIWA 3RSFA 5LP6F 4DV4B 1HNWB 5HK8A 1WOMA 2RB4A 3E1GA 2C1XA 2P9ZA 2VZ8A 3FAKA 4K1LA 2E18A 4QOJA 4AXXA 3JCZA 1OIVA 4MW0A 4W8HA 1NRXA 3CLTC 4IS3A 4MIOA 1QE3A 2VHJA 3DBRB 4GPZA 3WJ7A 2FN7A 3ETLA 1AG9A 2NYVA 2VSXA 4ZPXA 5SYAA 5BYBA 1LWNA 3DFKA 2AEJA 2XHZA 3UK7A 3C6QA 3TD9A 2BONA 2I2BA 3EMBA 2BWJA 4ZC8A 2WC1A 3CLVA 1QTQA 4GM4A 3WLTA 2QM3A 2AX3A 1K06A 3BBPA 4B09A 1DKOA 4DIOA 3OPYA 1FMFA 3V00A 4BNYA 4I99A 4IL5A 5FA5A 1VE9A 3MGAA 4IZ6A 4U7GA 3NWOA 1SVSA 2EQBA 4QE3A 1ZM7A 4RTOA 1HLDA 2DVMA 3R3JA 2JGIA 2VAWA 2D1FA 2Q3HA 4TMYA 3L6BA 4JIGA 3WMXA 1A71A 4LNUA 3C3YA 1RU3A 1HL3A 2CXXA 2Z3VA 2BBTA 5K8TA 1LK5A 5JCOC 2UZAA 1E2HA 4H3KB 1GYRA 1Z06A 2GARA 5TPWA 3T7TA 4FEEA 1DVRA 1RJEA 1XRQA 1AK9A 2CNBA 4BVAA 4QARA 2EERA 2IQ5A 1JFRA 3PUHA 4BIMA 4M9QA 1XCJA 4UUPA 4X6XA 4AF6A 3B9BA 3JD3A 2WILA 2G0TA 1O89A 1OCEA 1RAHA 2PX5A 3M6AA 5T7BA 4H1UA 4BFXA 3TFWA 3KEQA 1CE8A 3ADOA 3UTDA 5IDYA 1CQZA 3A11A 4HGOA 2EJWA 3NIGB 1UWLA 4MKZA 3G5LA 4DV6B 3WB0A 4OA8A 3B2QA 1LVUA 1XEWX 4BO3A 3KE8A 1S3FA 3UHFA 3B1JA 4ZQBA 4ZARA 2R6ZA 1JI3A 1NXVA 3T7IA 4ARIA 1JKFA 4X3PA 1TAQA 2F8MA 4WZ6A 2PS9A 1Q0UA 2A4MA 2PLAA 2YJGA 2DBQA 3HVRA 1JSLA 2OWDA 4X7BA 1R2QA 1YB2A 4D4KA 1AKEA 3ORFA 3J7AC 1K6MA 1W59A 4UM8B 4ENQA 5AVXA 3TQTA 2XQVA 4RE6A 4HFMA 2NZ8A 4FZRA 2ZCJA 2Z9DA 4XX0B 1M1NA 5FI1B 3K4QA 1S8AA 5FOXA 5B37A 2Z1DA 4E09A 2AN4A 2ZBGA 4WK4B 5HIAA 3ZQJA 1Y7LA 1NA5A 1NNSA 2AC7A 2O2HA 3CB2A 3DDOA 2X0IA 2EC5A 4Z1MA 1XRSB 4Q1CA 3AB8A 1Y9ZA 1Y4DE 2J7PA 1NVBA 2H7VA 3FRIA 5GVRA 4O33A 4WK2B 1FQOA 1KI1A 4UVEA 2YS7A 5JZSA 5ALTA 3Q7TA 4D4JA 1A76A 2HU8A 2M9MA 3THXA 3D0QA 4TYPA 2RJOA 5EMHA 1KY5A 3AP1A 3WLNA 2KJQA 3DXZA 1E7SA 1IZYA 3TW4A 2Z5GA 1VZ2A 1IMJA 1JFFB 4JR1A 2J1LA 4PTZA 4J1SA 5IYZF 3RQIA 3S68A 1WU8A 3MWDA 3PEYA 3TOZA 2B8NA 5A05A 1P3DA 1Y4SA 2J5XA 3UGKA 3THYB 1Y9AA 2WSIA 2R7LA 3KM0A 2YWJA 2HHHB 5FJJA 5A03A 2QZ9A 4Y2XA 4RHUA 2JIPA 2O5CA 1N5IA 2I3DA 4NJMA 3AW8A 2PLWA 4DV2B 3FE2A 2X4DA 1JQLB 4NCKA 1TYDE 4EHIA 3RADC 1O94D 2QD5A 1N5JA 5DP2A 1VFPA 4LRWA 2FUG6 2QROA 1M6VA 2PU5A 2RH4A 3CX7A 1X74A 3K9CA 2PUVA 4C1BA 2XT6A 2AA3A 1XTJA 2QE7D 3HLYA 3OTWA 2X2OA 4LZOA 2EEPA 4BMDA 3DGFC 5FUBA 5CGQB 4PC6A 5DKFA 2MMGA 2XVXA 3I8SA 3BFVA 1CY2A 3I09A 5LOVF 2RAUA 1GTVA 4MVJG 4L7VA 1D2AA 4RDCA 5CNMA 2PO5A 2XADA 2ZYDA 3AKCA 2OXRA 4I14A 4EY4A 1H23A 1W44A 3G0OA 4JEMA 4L3VA 4YRRA 2J45A 3FPCA 1Y7TA 1EMDA 2ONJA 4B4OA 3GFVA 2XTMA 1UJNA 1FFDA 1BMQA 2R6GA 2XGGA 1HEIA 1HO3A 1M83A 1XZQA 3K6JA 4GRDA 4LBZA 3QW2A 3HI4A 4QJIA 1TJNA 4RANA 3WBFA 5IHXA 4OL0A 1ZK1A 2EGUA 2O05A 3B78A 3LWZA 4H7PA 4XVCA 2BGIA 3OCXA 1DAMA 4CIYA 3GMDA 3K09C 5LA6A 4EJ2A 4UM9D 5K01A 3VNUA 3OOWA 3N28A 4HGYA 4LZPA 3QE3A 1E7QA 3K8YA 4EP1A 5F35A 3BQ9A 2HK8A 4ZQFA 1CUCA 2OCBA 4FIDA 4I4LA 2XUHA 4K26A 5LR6A 3VX4A 1X8XA 3EA0A 4XDZA 3HCBA 3OEWA 2IYQA 2ZUCA 2P6OA 3J81k 4MCAA 3JQFC 2VUHB 4N5DA 5B3AA 3H1BA 3AEQA 1E0JA 3CNBA 4EB6B 5BVHA 4IO1A 1Z74A 2PPLA 3ICCA 3NBMA 4TVOA 5KU1A 5JCOA 4L02A 2J3LA 5B6PA 4PHTA 3I64A 2ZYGA 3O8DA 4PRZA 4KC0A 4MGIR 2Z5VA 3GJ4A 1B6RA 2HD4A 2MSCB 2J3JA 4OVKA 5DW0A 2CLCX 1QC5B 5E3IA 4OYHA 3WRXA 3ZJTA 1YQGA 1K89A 2BM8A 3AEKB 3D1VA 4YBRA 1ZI6A 4A03A 4DMRA 1T5OA 2ZANA 4J2OA 1FSFA 4BGVA 4Z0PA 4E5YA 4JODA 5MN5A 1MEEA 5BQPA 3B1WA 5F2KA 5CBPB 2CDCA 4YJFB 2ZJAA 2Q50A 4CU2A 2CLOB 2D2IA 2IUYA 4PPNA 1IPHA 2B4YA 2X6RA 2V97A 4I5GA 2CHVA 3L3BA 4OHRA 2RD2A 2F1JA 3MGCA 1FP4B 3ITNA 3B36A 4GEKA 4F8JA 4LJYA 1MU0A 4JD5A 1UBHS 2BP7B 3ZD8A 1CUVA 2JIDA 2HIHA 5ADUS 5C52B 4KSCA 1ST2A 2XVMA 4R6XA 3UM9A 1CW2B 3GPBA 5KWIA 3M5CA 3ENWA 3I39X 1IBKB 4TYYA 2OXFA 4G86A 4EF4A 2ZBUA 5LBIA 1RMYA 3D7SA 3VOAA 1UC5B 3F6RA 3EVGA 1YCGA 2PWBA 1L5RA 4W5QA 5A0TA 5EZQA 1MV5A 3SBXA 4PN3A 3H87A 2VA8A 4I1SA 3H99A 4KDRA 1U65A 4L0CA 1BA2A 2MINA 4UUBA 5H3LA 3UT0A 3NTOA 1NAHA 2PGNA 3QKSB 5FTWA 3T9DA 4Q4HB 2G63A