2QR3A

Crystal structure of the n-terminal signal receiver domain of two-component system response regulator from bacteroides fragilis
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
126
structure length
121
Chain Sequence
SLGTIIIVDDNKGVLTAVQLLLKNHFSKVITLSSPVSLSTVLREENPEVVLLDMNFTSNEGLFWLHEIKRQYRDLPVVLFTAYADIDLAVRGIKEGASDFVVKPWDNQKLLETLLNAASQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal signal receiver domain of two-component system response regulator from Bacteroides fragilis.
rcsb
source organism Bacteroides fragilis
molecule tags Transcription
molecule keywords Two-component system response regulator
total genus 48
structure length 121
sequence length 126
ec nomenclature
pdb deposition date 2007-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qr3A00
2GX6A 1QQBA 3O75A 3HM9A 1GCGA 4HNRA 3KJXA 5TQ0B 1M5TA 2PMCA 1NXTA 4F12A 4YP9A 4XASA 4XARA 4CBVA 1ZHHA 2VYCA 1KRXA 4O1IA 4HNQA 5IBQA 3C97A 1D2AA 4PZ0A 3JY6A 4KK4A 3OO0A 4TLLB 1QO0D 4RXTA 4YR7A 5CNJA 2V0NA 3QLUA 5IUKC 4GNRA 1DBQA 3EAFA 3H75A 1KRWA 3H5LA 4W5NA 1EHCA 4WT7A 3A0RB 3KYJB 4KMRA 4YV7A 1Z2EA 3MF4A 3O2QB 5IUNC 3H5WA 4IMJB 1WETA 4H60A 4KFCA 5JNRA 1JYFA 1K68A 4YO7A 4RY8A 2M98A 5KQPA 4LE1A 5EWJA 3MYYA 4ETIA 4NV3A 1USIA 4UHJA 4MQEA 1EWKA 3Q7RA 2QU7A 2A9RA 4EVRA 4S05A 3LFTA 5TQ0A 3H5IA 4N41A 3HDVA 3RVPA 3HK2A 4G97A 2E4YA 3MIZA 1HEYA 4LZLA 1DC8A 3H5TA 4QICA 3CNBA 2VUHB 2WJWA 1JL3A 5D2CA 1NATA 3IPCA 3O21A 3HUTA 3CTPA 3KTOA 2A9PA 1XHFA 3TMYA 5BRJA 2QW1A 4GPAA 1APBA 4F3TA 3OQOA 3FDFA 5JNSA 4RSMA 3GT7A 5KC8A 4LRQA 4RY9A 9ABPA 2R4QA 3CLKA 2B4AA 2GBPA 3O1IC 4MS3A 3RVRA 4L4UA 3URMA 2JVKA 4RXUA 4NQRA 2E4WA 3RVOA 4ZMRA 1LK0A 1DG9A 5HM6A 5KC9A 2AYXA 2JRLA 2YHAA 3TD9A 3H5OA 2OQRA 3GA5A 2QR3A 4RWEA 4MPTA 1GUBA 3KKEA 3OM0A 1QO0A 3CRNA 3ROFA 3I45A 1NTRA 1QPZA 2QV0A 4N76A 2A9QA 2Q5CA 3RVLA 2MYPA 3HZHA 3C3WA 1GCAA 4DADA 1DBWA 4MR9B 1EFAA 3HUUA 5CHYA 1S8NA 2PUFA 4ZYLA 4W5RA 1PEAA 1NXOA 4WUTA 5DCLA 1VLZA 2FQYA 3JVIA 4QYMA 2B1JA 3QX8A 4KZKA 2NT3A 4EYGA 5TQ2B 3ILYA 1ZDMA 4XAQA 3A3KA 3GWGA 1JLKA 4OLBA 4JP1A 4Z4GA 3LUGA 2FEKA 1LBHA 2FXIA 4XFKA 3HXMA 4P98A 1ISRA 2FEPA 1DRKA 1ISSA 4ZJPA 1U8TA 2F8TA 1EWVA 4KQCA 2ZWMA 1PEYA 5B3JC 4OTZA 4RK6A 4JB2A 3G85A 4KRFA 2M1ZA 1FSPA 3GBVA 2MSKA 2FQWA 2PE5A 4WWHA 4EVSA 3KG2A 1F4VA 1NXSA 3EQZA 3D8UA 3GYBA 1BDHA 1VPWA 1PNTA 2F8SA 1TJYA 1JX6A 2MSWA 4F8JA 2RJOA 1ZESA 5EWLB 5F64A 1M2EA 4UHKA 1MB0A 1LJUA 3LOPA 3E61A 3LTEA 5CNKA 1YK0A 5B3JA 3RQIA 1OXKB 4PE5B 4O5AA 1DCMA 3CU5A 2IYNA 2BGGA 2WY2D 5JS2A 2IOYA 5DKFA 4MS4B 3G1WA 3NBMA 3OLWA 5JS1A 3JPYA 5EWMB 1E6KA 4G0YA 1A2OA 2FW0A 5PNTA 3LUJA 1SXHA 1IIBA 1DCKA 1RNLA 2X7XA 4NCBA 1PHRA 3BBLA 4KPYA 1QP7A 2RGYA 2J48A 4RU1A 3JTEA 3K4HA 3M9XA 3RVJA 1A0OA 1Z12A 2VUIB 4DN6A 3UKJA 5KQGA 2FVYA 2YHBA 4OATA 3SY8A 3EODA 3KLNA 4HYEA 3F6CA 1JBEA 1NXXA 1TLFA 5FWYB 4YCSA 1H9CA 3HV2A 3MM4A 4FB4A 1P6QA 1YTUA 2QSJA 4JA2A 2L17A 1NXVA 4Z0NA 4KK3A 3VNAA 3GBPA 2FTKE 2TMYA 4RDCA 3CZCA 3EULA 4MLCA 5FBKA 2PUCA 2MYUA 3OO1A 4MS4A 3DBIA 5IEJA 4Z9BA 1NY5A 1AB6A 3LUHA 7ABPA 4RS3A 2AYZA 3FGZA 3P9YA 2FMKA 3QLUC 3DGFC 2IPMA 3LKBA 3ILHA 3N53A 4IRXA 3TB6A 1ZVVA 3HO1A 3OQMA 4EVQA 1JF8A 1URPA 4ETMA 3GRCA 2QVCA 3Q41A 3Q7SA 4Z4EA 1P2FA 4PEVA 2HQOA 3LKVA 1SRRA 4RZSA 2L19A 5TQJA 3LUFA 3L6UA 1DZ3A 3SAJA 4EYOA 5TQ2A 1VKRA 4EYQA 2QXYA 3B2NA 4KREA 1FFGA 1NXPA 2FQXA 1GUDA 1ABFA 4MAAA 1SXGA 3O1HB 3M6MD 3A10A 3HCWA 5TPWA 2W42A 4JOQA 4E7OA 4Q6BA 3ROTA 1QNLA 3RVSA 4YWHA 5KQLA 5TPZA 1Z25A 3MA0A 1FFSA 1BDJA 2ID9A 1MAVA 5EWLA 2IDMA 3FFXA 1EWTA 1MB3A 2FKAA 2LBPA 3W9SA 5JNTA 3H5VA 1ZY2A 4W5QA 2DRIA 2MYTA 3T8YA 3FMVA 3MMNA 1DRJA 4NICA 1W25A 4Z4IA 3T95A 3E3MA 1KMIY 3EGCA 3C3KA 3QX9A 4MQFB 4RK4A 1Z2DA 5DLEA 4MR9A 3S99A 2PKXA 2NT4A 4D6XA 4MRMB 4TMYA 1K66A 1YS6A 3KLOA 1AB5A 3QELA 3F73A 3HDGA 2JBAB 3H1EA 1U04A 5KI6A 2GI4A 2CWDA 3OLYA 3RVKA 2JVIA 3O74A 1E2BA 2A9OA 1KGSA 2JB9A 4H3HB 2PUGA 3VNBA 4G0OA 2WWVD 3I42A 2ID7A 2JCGA 3R0JA 1JFSA 5EWJB 1PUXA 4EGSA 3OM1A 1JDPA 2HPHA 5BR1A 4G0XA 1DC7A 2PAFA 1TM2A 3I5AA 3C6QA 2P4UA 2WRZA 1YK1A 3EQ2A 4MQEB 4QYWA 3RVQA 3K9CA 2WB4A 3OLZA 4ZMSA 1JFTA 2HSGA 5HSGA 2QZJA 1XWWA 1Z13A 1QP0A 2JK1A 2GWRA 4JASB 1U2QA 4WXEA 1YS7A 1YMVA 1D1QA 4IGAA 1LJLA 3CHYA 3KS9A 3UK0A 4G0PA 3F7NA 1Z18A 4MRMA 3N0RA 3SG0A 5JNUA 1M5UA 3BRSA 2PL1A 2NZVG 4B09A 2PUEA 5ABPA 2JBAA 1QMPA 4Y9TA 1USGA 5T7BA 2FEWB 2PUAA 1GLGA 1ZITA 2FN8A 3DGEC 2MYNA 4MS3B 4G0MA 5BRAA 5C5CA 1PNRA 2E4UA 3BILA 4H3KB 4QPJC 5IUJC 4WXMA 2LPMA 1ZN2A 4KQ9A 3N0XA 5TPZD 4Z4HA 1BAPA 2L2QA 4FE4A 3OMWA 3F6PA 2H3HA 1JH9A 1DCFA 4MR8A 4HNSA 3DLHA 1E6MA 1T34A 5ED4A 2PJUA 4LX8A 2E4VA 2H0AA 1RXEA 5FWXB 3T6KA 4TLMB 4W5OA 3EDCA 1RPJA 4DQDA 1L5YA 4RK5A 3HS3A 2FLKA 4LE0A 1M2FA 4IILA 2R47A 3CFYA 3KCNA 4YLEA 4RKRA 2OENG 1YVUA 4F06A 4YRZA 3CS3A 1D1PA 1P8AA 3QLVC 4JAVC 5IULC 1U2PA 4XLTA 4L85A 3JVDA 5DTEA 3QELB 4N0QA 4MGEA 4IMIB 4OG2A 3DZDA 4JB0A 3KYIB 1DBPA 3O2SB 3C3MA 3EJWA 1DJMA 1Z17A 3A0UA 1J56A 4G0QA 5GOTA 4MR8B 5CNIA 3I09A 4S04A 3O1JC 2QVGA 1Z26A 3RVNA 3LUCA 4NCAA 2I6FA 3IPAA 4YGXB 2R25B 2GKGA 1JDNA 3LUKA 1TMYA 3MQ4A 2HQBA 4LDAA 1ABEA 1RXIA 1Z16A 3LUAA 2PUDA 5JNVA 1ZGGA 5IEBA 3HJFA 4MR7B 4N0PA 4Z4FA 2LUOA 4MS1B 3LMKA 3NNNA 1NXWA 5KQMA 1CEYA 3NNSA 4IF4A 4E7PA 3CG0A 5EWMA 1W9HA 3KHTA 4RK7A 2NZUG 3CKMA 1JHZA 4EUKA 2CHEA 3HSYA 6CHYA 3HEBA 2P9HA 4OLAA 2E4XA 3BRQA 1FFWA 3IP5A 1R8JA 4ML3A 8ABPA 1ZAYA 1BDIA 4ZPJA 2ZAYA 2VK2A 4F11A 3DLBA 2WJAA 1YMUA 4WZZA 4XXHA 1JWLA 2KYRA 1QQAA 4G0ZA 1MVOA 3L49A 4RV5A 1F51E 4G86A 3NHMA 5C5EA 2IPAB 4LDZA 5DGCA 3SQNA 3GV0A 4M88A 5FWXA 3IP7A 3SNKA 3IP9A 1SD5A 4W5TA 2FN9A 1EAYA 3RVMA 3QEMA 3OQNA 2WMYA 4MS1A 3Q15C 3N8IA 1B00A 3M9WA 3N6VA 4PICA 5I4CA 5E3JA 2NUBA 1QKKA 3TX6A 2HJ9A 2IPLA 4P1ZA 1E6LA 1A04A 4Z99A 1ZGZA 4N03A 2PUBA 1ZH4A 3Q9SA 3LUDA 3QLVA 3CG4A 3RH0A 5HKOA 4KVFA 2CD7A 1I3CA 4Q6WA 2MSLA 1D4ZA 2LIVA 1RZRD 2FMHA 3IP6A 2FLWA 3GL9A 3QK7A 3JS5A 3T38A 1CYEA 3N75A 4KNYA 1Y1LA 1JYEA 3Q7TA 4FE7A 4KV7A 2E4ZA 1SXIA 5FBHA 3H6HA 3OLXA 1UDRA 3QEMB 4Z9AA 3UUGA 1XHEA 1Z15A 3BREA 5FWYA 6ABPA 5GQSA 3O2JA 1DP4A 3D02A 4MR7A 2JVJA 4D6YA 5IC5A 1JFVA 4N47A 4PYRA 1QP4A 2LP4Y 4ETNA 2N9UA 4EY3A 1C4WA 3IDOA 1BVHA 2FMIA 4D74A 2HQRA 1RZRA 4O1HA 2RDMA 3N0WA 4MQFA 5JNWA 2PLNA 5T3YA 3H6GA 5HQJA 2CHFA 3QEKA 4OBBA 4RK0A 4Z4CA 1D5WA 1P6UA 3HVRA 4RXMA 1TVMA 4TN5A 2FMFA 3OMXA 2FSPA 1MIHA 1YIOA 3NHZA 2L18A 3QLTA 2O20A 2RJNA 3FFWA 3H1GA 4RKQA 4EYKA 1C0EA 3H1FA 4MLDA 1U0SY 2IKSA 3NNDA 3JPWA 3OLVA 5BQ3A 3KSMA 5IX8A 1OXBB 1LBIA 5TPWB 2XDYA 2PL9A 1CHNA 1BA2A 1L5ZA 4RK1A 1USKA 4Q7EA 5CNMA 3TO5A 4MYRA 4LE2A 2IPNA 3FFTA 4YS6A 3SM9A 1FQWA 5TE9A 1ZH2A 1VRVA 3CZ5A 4RY0A 5KWSA 2R48A
chains in the Genus database with same CATH superfamily
3NEPX 4WOBA 4B71A 1SURA 3LO5A 4R3WA 4RF3A 3VU9B 1V7ZA 1M5TA 2GHTA 3RSOA 1Y48E 2JCYA 4UU7A 3M6XA 5HMLA 1JQDA 1CQIA 1RACA 3EWNA 1W87A 3IEMA 4WI1A 4ZVPA 7GPBA 2QAGC 3HFSA 1B7GO 3GO4A 3QUSA 4I7EA 1LSSA 3PIIA 1CB0A 4XYLA 1GGHA 2HQSA 2PWZA 3PD1A 1TTPB 1QO0D 3IIJA 4N7RA 4NYMQ 3ZHTA 1NLZA 2IEZA 5A4IS 2BZGA 1RJWA 4K05A 2Y1KA 5FPTA 2P67A 3MK31 2LCQA 3LZDA 3U0VA 3U9SA 5TMPA 1EGMB 3U19A 3A0RB 3HB7A 5FUBA 4B31A 3FN4A 2DT5A 4O4HA 5BV1A 4P0QB 4NYJR 2XA9A 3DXXA 2Z2JA 1UC4B 4LMBA 2NXJA 4ZQBA 3EZFA 1FTGA 3IVMA 1F6BA 2AFIE 1Y1RA 1MAAA 2GVDC 4EY4A 2JRCA 3UM9A 4K1XA 1JYSA 2OBBA 4KRXA 3JWPA 2Z8YA 2G4CA 5HF5A 4BP9A 2EJBA 1ZVJA 2A9RA 4KLNA 3DMNA 4M1KA 3BMQB 5D85A 4EHHA 3FWZA 3QYJA 5CLLA 5IAGA 3JQFC 4HYQA 4KGXA 1AUPA 4EYEA 1JAXA 3ZV6A 3TTYA 2C5BA 4ESOA 1ZCZA 1TT5B 4RW0A 2ZBEA 2VZ8A 4QXRA 1KDOA 1GWNA 3B7PA 4IF6A 2QTBA 4LTMA 4ACBA 5BW5A 3NO4A 4KN5A 1JHQA 3ZCSA 2OFFA 2H31A 4UM5A 4DPMA 3B8EA 4LCJA 1X0VA 3ZWKA 5LFAA 2YKGA 4KDRA 5A04A 2ZUBA 4MO9A 1C9MA 4DDMA 1C7FA 1KDTA 3FDFA 5WRFA 3WIOA 3G0CA 5C8DA 3AYZB 4C20A 1G5QA 3ZS8A 4DUPA 2YN0A 1VPLA 2B4AA 2ZVQX 3MJSA 4X91A 3BMCA 1CQZA 4E5KA 4L4UA 4HGOA 3HA7A 5J1SB 3VVMA 2IHKA 5AICA 4QUGA 3PGVA 1UJCA 1KP9A 1U1EA 3CNQS 2GBFA 2YIDA 2FP4B 4ZVLA 4OHZA 5ICGA 3BIOA 4X8OA 5IKMA 3BXXA 3PA8A 5F1PA 1O0CA 2I22A 4OQPA 1E4EB 4G9EA 2WF7A 3W90A 5BN4A 4XIJA 3AVXA 3EY4A 1NMYA 1ZP6A 2CFIA 5HNKA 2ID4A 2GZSA 3PC7A 4IIXA 1J8DA 3H5RA 4PZAA 3PGLA 5CHYA 1U4OA 1O6CA 2GYWA 3AQIA 3G88A 1MIOB 2NO4A 3M89A 4H7IA 1DKQA 3SLRA 1P45A 4M83A 4LYFA 1FTNA 2NT3A 1G2IA 3JQ6A 4HLQB 3MTEA 1W581 4HF7A 3T7RA 4PRZA 1II8B 2LR0A 1N3LA 1ISSA 1EX6A 3Q85A 5DHAA 1FXWA 1U8TA 5FI3A 2J7PA 5AXCA 3BWYA 1U1CA 3PCXA 1V8ZA 4PR3A 3M6FA 4UU0A 3IMFA 4GI3A 5ALLA 2BFMA 3QZUA 1KO1A 5AVYA 4CM6A 4GF5A 5DYNA 1VLLA 1POXA 2OAEA 3ZQ6A 4Z54A 1JWBB 2JIMA 4A27A 1OIVA 1Y6RA 2WM9B 1BWPA 1P7YA 4F4UA 1CVLA 4LQ4A 1WY5A 1FTYA 3KG2A 3ZU6A 1QX4A 3M1AA 4I5DA 5DW0A 4ATNA 2FDCA 2NUTB 2ZSEA 3P9NA 1Y37A 1R10A 1J24A 1J39A 1TZCA 4OKSA 3EUAA 4WNAB 1MABB 1UKYA 4GI5A 1R66A 2CDNA 4WERA 3MWYW 3R5SA 4O5AA 1J06A 1BROA 2O2SA 4FGUA 2VTKA 2QG9A 2XODA 5CGQB 5KJCA 1CUDA 1DSSG 1MOQA 1QCDA 4PX5A 4TM7A 1X7YA 1XCGB 3K73O 3NBMA 4TYPA 1SCUB 1E9EA 4GSYA 3WLLA 3ECAA 4BO2A 2XRMA 2YFQA 5F7ZA 1V26A 1GRVA 4MEJA 2HEGA 3MTJA 5PNTA 1PR6A 2C4UA 3PCRB 5FV4A 3IP1A 3TTUA 1YQ9A 3ZWOA 1EX9A 1NRJB 3L1HA 1PD0A 3FJYA 4JWTA 4ZVUA 2RGYA 1TEHA 3MGCA 4RDIA 4DLUA 4HKTA 1Z0UA 3TL6A 4GR4A 1KTVA 4PRYA 3K35A 5BORA 4UBLA 4ODIA 2PSFA 4PN7A 1WR8A 2IPXA 4L08A 4A8TA 4IQ0A 3SY8A 3BSWA 3T99A 1ZPDA 1LPSA 2P9CA 3A6LA 5E8RA 3OEYA 3AVYA 1FLDA 4CL0A 5FUMA 4S0XA 1JLLA 1T6NA 1NBMA 4QDJA 1UDXA 4PLVA 2HREA 4DKXA 3LY8A 2DLDA 3FPJA 3SC6A 3MJCA 4U9HS 3GGPA 4TZKA 1PR4A 1C4XA 3C8ZA 3ANNA 2MYUA 3WR5A 4FWIB 1DEKA 1ID1A 2NTYC 3UBTA 1J90A 2WF8A 1VSQA 4WZ6A 4LBYA 3CINA 2WUFA 1IEWA 3OE4A 5E0OA 4EJSA 1P9NA 4HT3B 4CEHA 1SY7A 4FHGA 2I3ZA 2O8CB 2C3OA 3ZQ4A 4OOFA 1DRWA 2JS7A 3ZHBA 3L82B 4LWZA 4G23A 2RH9B 5K0JA 2HQOA 3CF6R 1HSOA 1RQRA 2ACKA 1Z33A 2D2IA 5KCZA 4NPHA 3SZGA 3VHQA 3L6UA 5LU9A 1FNNA 3PC6A 1A76A 3GQVA 5K4HA 5DX8A 2Y99A 2JJ2D 1K4YA 4AN1A 1DC6A 3IIEA 4AKSA 5LA6A 3I04M 1FSGA 4QOJA 5BRNA 4NHOA 2VTDA 2F3QA 2GTHA 4WVFA 4L9SA 3N07A 1JHDA 4FFSA 1QBKC 4GICA 3D54D 3HCRA 3L04A 1RHMA 2I7DA 1IONA 4GECA 4KH0A 4EENA 5LZ2A 4ZA2A 1N0HA 1PFWA 1SIOA 2B8WA 1GUAA 3CJRA 4LK2A 3SJBA 1JAZA 4YUWA 3DBVO 4C4OA 4J6FA 5EPOA 1PKXA 1P29A 1XZGA 4ALNA 4N3NA 2VAXA 2VT6A 4BP3A 1A88A 2V4UA 1BO6A 4AJOA 3F8SA 3MXTA 2ZSBA 1N3BA 8GPBA 2O54A 3RUHA 1MX3A 3JYLA 3D0OA 4NJMB 3ZNPA 3OCVA 1QYCA 1V35A 3EZGA 3ZHXA 1UMKA 4MRMB 5IDYA 4MITA 4EP1A 3AQ4A 3PUWA 2YXPX 1AF7A 1DIAA 3C8DA 4QO7A 4OXNA 3WYEA 3VRHA 1HNZB 3QTBA 4E88A 3B3AA 2VZEA 4ZAWA 2CWDA 4H4DA 2RG1A 3NU1A 1DQPA 1GHTA 3KAQA 1SXJA 2Q5IA 1AUXA 3ESXA 4P2GA 3Q8MA 1JFSA 3QU9A 2LXNA 3ULKA 5H02A 4Q3KA 2RGAA 2Y2UA 4G0XA 2AE1A 3IKJA 2D1YA 5DTMA 3OCJA 4AUKA 3RAFC 1Y9EA 4W6QA 2LDBA 1XPUA 5CM9C 3A2MA 3H97A 2H6EA 3AW9A 4NZZA 1U0OC 4GL4A 1N7HA 1Y3IA 3GRZA 1JFTA 3DTNA 2WAMA 1Z13A 2WHQA 4CMCA 4F38A 1VL8A 4LECA 1M2JA 4DZZA 4PSDA 3KRTA 3IJ5A 3AVWA 1PGPA 1XQVA 4IGAA 2DFKB 4A23A 1EX1A 3WGGA 1XTQA 5EE3A 2FRXA 3N8DA 3PQ4A 4ARSA 2FR8A 1SC3A 3HVJA 1XEWX 2WPNA 4E1VA 3MMPA 4CODB 2HFJA 2WZCA 4RBNA 3C1OA 5H1YA 4BGUA 4C7XA 1V2GA 1VHQA 3GOHA 3UPUA 3JASA 1MOSA 1FB5A 3AINA 4N0DA 4CMAA 3U80A 2ICAA 2FN8A 2HT6A 3QFHA 4D99A 2EDCA 5B7QA 3I64A 3OIUA 3DF9A 4GPIB 1GDDA 2GLXA 2VWQA 3TZKA 3IPLA 2CMKA 3RBXA 1WW8A 2FE4A 1T25A 1UBUS 2GN6A 1GG8A 1IVYA 3ER6A 3B20A 1FXUA 4KXXA 1EE1A 4ZVVA 1KDYA 4DARA 1CQWA 2EYQA 1U8UA 1QK4A 2MINA 3LCCA 1HX7A 2CLEB 3W6NA 2I2XB 1ZMTA 4M76B 1G5FA 3V8BA 2XDQA 3C4QA 3U62A 3J7AC 4TSRA 1CFZA 1X38A 1Y81A 1KI6A 1HLDA 2BPOA 3P4YA 1RXEA 2XNJA 4K28A 2YWCA 3K05A 4NG5A 2K4MA 3WZLA 3DV2A 4TLMB 4AQDA 2YJ5A 3M5CA 4AS2A 4W5OA 4JC5A 1E77A 1RABA 3DZCA 1CQJA 1NL3A 1YVRA 1BE6A 1QNFA 3TRHA 5IF3A 4A2PA 2DTXA 1Z62A 1REQB 1UZUA 3HS3A 2QX7A 5IANA 4IBOA 1SK8A 5G41A 1UMDB 1QRRA 1E2GA 4R5HA 3B89A 1BHJA 3FFAA 3KR0A 1Y89A 2GARA 4MKHA 1COWA 4HJRA 4O4JF 4DC9A 4Q1DA 4XLTA 1FF9A 2Q4RA 2JGDA 3BCSA 4BCCA 3VOSA 1XVUA 1U0GA 4JB0A 1DT5A 5EE0A 4ZEWA 4XTRA 3WLNA 3IMGA 3ZWBA 2XGSA 4LOJA 4BS9A 3QX3A 4M38A 3DONA 2JD1A 4R1PA 2V9PA 1Z17A 3U3KA 4G84A 3BB1A 1M7GA 1Y5MA 1N3YA 3A3NA 3K2QA 5JD3A 4OXRA 4PYNA 4XFJA 3QKTA 2V4MA 1XLVA 4R8MA 1HQKA 1HT1E 2VZLA 2E18A 5FTLA 3ASYA 4BO9A 2BKVA 4IOLA 3R0IA 4TKUA 1MJ5A 4CV2A 2XRZA 3I2JA 1HDZA 2ZFUA 1OV4A 4OA5A 5F9MA 5TIIA 2OXRA 4P3KA 2PVSA 5K2OA 4N5MA 2R7MA 3CWQA 1YAJA 2C42A 2IVZA 3MCWA 3NH9A 4ND8A 3SBDA 2Z9DA 3GDWA 5IYZB 1U65A 2XYGA 3UKOA 5DXJA 3K0AB 1V7QA 2V6IA 4MCAA 2Q99A 2GVNA 1OTXA 3QSYA 5KJFA 3TAXA 1CEYA 2UUAB 2A9VA 4GWKA 4E7PA 4LYEA 3Q3GE 3MPOA 2JCXA 1E1CB 1GILA 4G24A 3O38A 1Q7EA 2FUCA 2NZUG 4DSNA 2JD2A 3GDOA 3UGKA 3AEQA 3DWGA 3R3XA 4LDNA 5CLFA 2O0LA 2YJNA 4BC0A 2OV6A 1NDUA 4Q1VA 4DQUA 3AO0B 1H2HA 1NNLA 3D3JA 2UXCB 4Q00A 4ZPJA 3TQTA 2A33A 3LP6A 2VTBA 4B3BA 3FUVA 1A95A 3ZJ5A 2W2QA 4U3JA 5EQTA 4DCGA 2ZQYA 1CY2A 5AUPB 2OP1A 3PQ8A 3TOCA 4LRWA 4IJWA 2VI5A 5LQNA 6PFKA 4MWSA 4FNMA 1US8A 4ZHSA 1UR5A 3TOZA 3IP9A 1ML4A 3GGDA 2CE7A 3GPCA 2GEFA 3HLYA 4OMFG 2B5WA 4Y2YA 4KR9A 1WVMA 2WHYA 4KQIA 4KMMA 5EMMA 5FR2A 2JLZA 3NDBB 1HNXB 1I14A 4ON9A 1LNSA 4PGHA 4ND2A 2NXNA 2ZCUA 3KJZA 3RS7A 2CNNA 3DFKA 4OUKX 4EI7A 3D6MA 1ADJA 1FLNA 4PG4A 5CBPB 4G8CA 4R9RA 3AYXB 4Z99A 2ZT6A 1N6IA 4IJQA 4DF3A 4BBJA 1ZH4A 3G9QA 3SXUB 4FKMA 2TRSB 4HDSA 2UXBB 4O4HF 1P0FA 2OV2A 4RZHA 1KARA 3HZZA 2CD7A 3FNEA 4MK4A 5CAEB 4YAIA 2R66A 2XMQA 3QWIA 1CP3A 2OGTA 4XWGA 3DL7A 1JPVA 3F46A 4MVJF 5GWXA 1P0MA 1DXQA 1G0OA 4YFYA 3M6LA 4JIMA 3OQIA 5J2UA 2PKCA 5B4VA 4L8GA 2VTEA 4HWRA 1NN0A 3ZIAD 3PWKA 3STYA 4E15A 2YVLA 3LFUA 4QVIA 2Q6KA 4U2BA 1UDBA 3TM4A 1V25A 3U7QB 5JS6A 2A9FA 5IC5A 5BWBA 3GEMA 3WGNA 3CSSA 1U0LA 4PLZA 2V96A 1YZTA 3ASVA 2OBXA 1GUZA 4L8LA 2VHTA 1ETUA 3DE2X 1E1YA 2NUPA 4BMCA 5DN6D 3RVDA 5KOYA 1I24A 3B5JA 3DBRA 1Q11A 4B83A 4DIBA 4I50F 1U8YA 1PL0A 3KOZA 2PLNA 3TDNA 2JLYA 2XE8A 3GD5A 4EY6A 4Q15A 4RK0A 1ORWA 4DQXA 4EKDA 4X1YA 2ISQA 3WK6A 4DOMA 4G41A 1OFUA 2EJVA 3C8MA 2QYHA 3CH6A 3FW1A 4YBRA 4DIFA 5JXGA 4X95A 1C81A 3HHPA 3FVWA 2UUCB 4C0BA 3QLTA 5M7EA 1GO2A 3RRBA 1BTOA 3NYIA 5EGNA 1FFHA 3W5UA 2HJGA 3IPXA 4FSDA 3LLCA 4M37A 1OXBB 2GZHA 1JH8A 1CHNA 1R6VA 1U5AA 2PL9A 3HE3A 3LE8A 4HR7A 4N8SA 4UEWA 2J31A 3A1DA 4RVNA 3LPMA 5FOVA 3VR6H 3NT5A 4C0LA 2ECFA 4BMPB 2QRVB 3SQXA 2ZE6A 2VQFB 2P35A 3AL0C 1NVTA 3IHKA 1DXHA 2IU6A 4HUQA 2GPYA 2BSXA 1EHIA 3E48A 1N9KA 4I4LA 1BXRB 3OIWA 3F9CA 5BVGB 5K8LA 1NF9A 1JIKA 1YZHA 5T8KC 4XWAA 2PMCA 4HB0A 1JEQB 2GBCA 3IAAA 4XASA 4H3VA 1ZH6A 4XARA 1J5EB 5A7FA 3UNXA 5EMNA 4PBRA 4GYKA 3ZZ0A 4KSBA 4FX5A 2HX1A 2G9NA 2ZUTA 4DQLA 2GPAA 1Z5OA 1D2AA 2SICE 4TMXA 4AJIA 2YY5A 2A5LA 4RZ2A 1XU9A 4W7HA 1WPXA 1FPMA 1ZM7A 4S1VA 4DJFC 3T41A 4FZJA 5JD4A 3AB7A 3QNWA 1GA6A 1PV1A 4KMRA 2C1XA 1DUVG 2V4ZA 3PTLA 3SX2A 3VH2A 4B32A 4U7GA 5HGXA 4YO7A 2C5FA 2PGIA 4FFPA 3MJRA 3TSAA 1BU8A 4D9EA 1NIJA 1EP2B 4LE1A 1GAQA 2HLPA 3GP8A 4UVHA 1EE2A 1VKZA 4AJ9A 3C3CA 2PT9A 1KE2A 3S1AA 2HD4A 2W8BA 1Z8FA 4PFQA 1XO1A 5TQ0A 2D0IA 2IS2A 5CTAA 5LMZA 3RVPA 4BYMA 1AQYA 2OCAA 2X6TA 4M21A 3OZGA 2XKKA 2CZGA 5EKDA 1TECE 1GG2A 4DEYA 3KVYA 3Q2KA 2O3RA 4HD8A 4Y2GA 5IDVA 2ZIWB 4UPEA 4JI6B 3WHPA 1UK6A 4HS4A 1HL7A 4XIYA 4U1RA 3HUTA 4E3ZA 4UHDA 1JNYA 5JXHA 1VMKA 4TN1A 4WBXC 1EUYA 1H2BA 1TK2A 1NW3A 3LYAA 4GMKA 4I2NA 2R65A 4R83A 5ALNA 4ZI7A 3R7AA 3AU9A 1Y33E 1DELA 1K2WA 3NDJA 4CM8B 3AK4A 4J0EA 4O2RA 1SBHA 3RYCB 3KQUA 3RVRA 4KN9S 3RYTC 3HP4A 3L6RA 2FAXA 1D2RA 2DUMA 3B1KA 1D7AA 1QCZA 1XTBA 1QG6A 3PR2B 4IVNA 2VJKA 4J3JA 1QTRA 1SD1A 4JHXA 5J23A 4J29A 1FW8A 1N2CA 3KKEA 1XJ0A 4DYDA 1BEZA 2W8BB 2C92A 3BE6A 3UF0A 1S3FA 1XYVA 2C5GA 3BHNA 3VR4D 2EP7A 3UW3A 1T4MA 4PV7A 4OHRA 4IFIA 5H3HA 4OUDB 3HUUA 2DBVO 3AF3A 1N8SA 2FPLA 2GCGA 2C0CA 5EIXA 1SVKA 2XTAA 2QZSA 2PUFA 4HH0A 5IU6A 2XUJA 4KLAA 3AR3A 4QYMA 3JVIA 3CC8A 4AO7A 4V0QA 2B1JA 2I0FA 2Y8EA 5F3RA 4RM3A 4AMYA 2OCPA 5CVVA 1RJFA 5LB4A 5I9NA 4OI0A 1E5QA 4IGIA 1MNAA 2AZDA 4QXPA 2VEDA 5THQA 3NX4A 1YJBA 4MWTA 2D2VA 2IYLD 3T4PA 4DXDA 4BE9A 3ESQA 4HBGA 3COWA 1E2UA 2H5EA 2VDMB 4A0SA 3NHLA 2BJWA 4LOLA 4LHEA 1LPMA 1XCLA 4YC7A 1XN1A 4DY6A 1M74A 2D00A 3DT6A 2OKGA 1OD6A 4NF2A 4TV9A 2HIGA 3L02A 2MSKA 1VMDA 5C5DA 2ZS8A 2WMDA 3GZ4A 2XPCA 3QY9A 3T54A 1F4VA 5J2TA 4YJ2B 1YS1X 3BWDD 1ODCA 1YB4A 1D2NA 3VMFA 1PI3A 4UAJA 1QO7A 1Y8RB 5F2KA 3ZDXB 4DABA 1WD5A 2CLSA 1N2EA 1NVVR 1QAMA 4PNEA 3VZPA 2PFGA 3L0BA 2WUVA 4RF4A 5AOCA 5EZQA 3V33A 1TU0A 2AFIB 3CU5A 4OAQA 3IXMA 4IG9A 2WY2D 2A5GA 4P5DA 2H48A 1YGPA 5DKFA 1YGYA 4C88A 3E35A 3D6VA 4JLVA 1E1CA 3JPYA 3ZDEA 3AFGA 1F48A 1ACMA 1DUIA 5B2ZA 1SXHA 5EVCA 1IIBA 3LA8A 1E7RA 3LOQA 2LNDA 2GXAA 1GQ2A 3QTTA 4KPYA 5BNWA 1NLYA 3T7CA 5B2EA 3ADKA 1U9JA 4L1KA 4LCBA 4LOIA 4BNWA 1C3XA 3B85A 2P3LA 3DVRX 3NYRA 2GRUA 3ZV5A 1KF0A 1X13A 5B7NA 5ITSA 1KPIA 1IBKB 4JLOA 1DIOB 1JEOA 2JFZA 3AFMA 3WLEA 2A4KA 3RSFA 1MABA 1RYZA 1MN6A 2OCXA 4C7JA 5AVJA 4YCSA 3M6VA 2XF2A 4O3FA 4MCIA 4YJGA 3PKJA 1IPEA 9GPBA 1FYWA 1F7UA 1QYVA 2H4JA 4I50B 2B20A 1PFQA 1S3SA 2O7RA 4WECA 5FBVB 5BSEA 2WSMA 3EISA 5HCNA 4NU5A 5CEJA 3AJDA 3R6DA 2JGMA 3A1TA 4AG3A 1DXOA 2H5LA 4RMNA 4AS3A 4E09A 1L4BA 3LUHA 1UFOA 2DTDA 1I7LA 2IL1A 1PJAA 2JFXA 4ZEVA 2GPBA 1NW8A 1FNCA 2ET6A 2VIIA 1CZKA 1DQRA 4WINA 1O4VA 4U2KA 1EP3B 2BHTA 4LY3A 2DR2A 2QRMA 3D1JA 3L41A 1T3HA 4JL5A 3AC0A 5CDTA 5EXPA 2HCFA 1PQPA 3SVZA 1UEIA 2L19A 4F6RB 4GYJA 3BICA 2C4VA 4UU1A 2XQFA 1VJ0A 3E3NA 3OCXA 1JECA 5HKKD 1AGPA 4LJYA 3UWPA 3QOYA 3CEAA 1X3SA 5ALKA 2V55B 1MQ9A 1AM4D 1UKEA 2NSHA 3A4VA 4R8SA 4URWR 4XYGA 5JDIA 3GFVA 1S5PA 4HXEB 1Q14A 1G5IA 4NBTA 3N05A 3ROTA 2UKDA 4N3CA 4A73A 1QNLA 3RVSA 2ZSHA 4G0NA 2FNAA 3EDRA 4HUQB 3NLLA 4LDQA 2UVPB 4O2BF 4DEVA 2WG1A 5HOEA 1W9MA 5SICE 2FOLA 4PO3X 1B2RA 5E38A 3OM8A 4J49A 4A16A 5BR7A 1M73E 4U7WA 5L9AA 2BY4A 2FSGA 4HNGA 2X15A 1AKVA 4DILA 4ESEA 5HZGA 1NNI1 3FPAA 1I5EA 2Q1UA 3B5IA 3ED1A 4U9IS 3GLIA 3GF4A 2UZ1B 5AW9A 2YV3A 3OOEA 1AUQA 4ZEMA 3CKLA 3ZHZA 4NOLA 1GGJA 4V03A 2WJ6A 2PA3A 2NT4A 5FHQA 3BJMA 4LBWA 4IQGA 5HJEA 3QKRB 4QTYA 3W9BA 5KJ1A 3H2IA 5AKXA 3RV3A 4HZIA 3OBBA 1FP2A 5B3KA 1XMOB 1I01A 1T5LA 2VHJA 2O1XA 4JK3A 3IQZA 2I6GA 3P7MA 1UMBA 4QUEA 4QUKA 4DSTA 4B40A 4DLBA 3AI1A 4G4SO 3DDOA 4YUXA 5JUWA 2Z1DA 3CEJA 4RLQA 1XAIA 2QF7A 1X9HA 4AF8A 3WA7A 1RQGA 2IDZA 5BP7A 4PF1A 4XVCA 2PAFA 1Z22A 4ND1A 1QGOA 4RANA 4C7MA 1UOQA 4DTIA 3DLAA 2HWYA 2XKBA 2X8LA 4WLNA 1K97A 4LHVA 4RMHA 2HSGA 5LBTA 4U63A 5CUQA 1KEVA 3RTGA 3HPQA 3K9LA 4RMIA 4E5PA 5IC6A 1Q7RA 3R8FA 1YMVA 1V8OA 1XVAA 4ZN6A 3B2QA 1LSOA 1V6AA 4MWGA 1I51A 4ZRMA 5EP4A 1ZICA 3AFNA 3FDZA 3HRHA 3DT9A 1GNQA 4G4JA 1Y5RA 2PUWA 3QVTA 3A04A 4HQRA 4HZUB 4DA7A 4MRAA 2PL1A 3IIIA 4E22A 5NULA 3VPDA 3V9AA 3OE5A 4JUBA 4N54A 2JAQA 2B83A 5JXJA 4Y6LA 3TLCA 2PUAA 4D8VA 1N5MA 1ZITA 1POWA 3I83A 2VDVE 2PX5A 3QF4A 4GMFA 3N59A 3N7UA 4AF6A 4PSUA 5JC1A 2O52A 3H7AA 2P30A 1GZ4A 3BILA 4QPJC 5AHRA 5E4FA 3ZX4A 3ORRA 4O6VA 4F92B 4WN9A 4D4KA 1JGTA 1V1RB 4N8DA 3EPLA 1JSZA 4UBOA 3ERCA 1BYIA 5DGTA 3ML1A 4L4RA 4F86A 2JFHA 3L8CA 4MR8A 3VNRA 5DT9A 1YD7A 2BMFA 2ASEA 3W3AD 1S8FA 1T8RA 4ER0A 4RTSA 4ZT3A 2QW8A 4OHMA 1JE1A 5L6MB 3WI7A 2MT9A 5K2MA 2XNSA 4R2LA 1RP1A 2QJFA 1MC5A 4IY1A 3T6KA 1WXQA 1C8VB 1QONA 4XQEA 1Y7HA 3JQRA 3ONDA 1FX0B 2VJLA 2VJMA 3VC7A 1QFZA 2AT1A 5DGXA 2BKEA 2FLKA 4LE0A 3PB3A 5FCDA 2D5IA 1D3AA 6REQB 2GK6A 3SE7A 4O3MA 3JASB 3BDIA 4ZOLF 2EFDB 2JI9A 3QVWA 3D7LA 3QXXA 4C6SA 4CMEA 3G1UA 1AKWA 5MN5A 2BFNA 1YA4A 4MOWA 3LL7A 6YASA 2PPLA 3L8ZA 4K6OA 1LRLA 2XWPA 3KYIB 3HBFA 5J2UF 1XIVA 3IDQA 2KMLA 2O8DA 3ZNOA 4XWYA 3P4XA 4C08A 1KVSA 2FMUA 3K09A 3T15A 4BRZA 5KYGA 4W9NC 3D4LA 5GOTA 1MC1A 1MPTA 2D1TA 3DAYA 4G4GA 5HIJA 4CPDA 1M34A 3WDLA 1CUJA 3WTCA 3Q11A 4FQ5A 1AT1A 2PV7A 1OXMA 4N1AA 3JQGB 4PO9A 2JK0A 5KYWA 2A86A 4DHEA 4I9HA 2C8JA 3CNHA 4OB6A 4QLAA 1H3NA 4Q02A 3L8HA 1GFIA 4DEXA 4PLFA 3LL4A 1UWCA 1ABEA 3LUAA 4JROA 1ISIA 1HDRA 1MH9A 1SC9A 4YCLA 1YRBA 2QNRA 1IE3A 1JQAA 2Q3FA 1UMDA 2OHOA 1JZQA 1NT2A 3IAFA 1O5OA 1QFYA 3TG2A 3USES 1XKQA 3SOPA 5AESA 3EWSA 5JHGB 5K0EA 1VDMA 2EJUA 2REQB 3NNSA 5KTSA 2ZJ3A 4CT4B 3LHSA 1W9HA 1Z5WA 4LI0A 4X60A 3RRFA 5I8PA 1E1RA 2WDZA 4XWTA 1KPHA 4NULA 2H1FA 3WJ1A 5CITA 2V1XA 1RTKA 1UBLS 1MO5A 4IXDA 4B8ZA 1O9GA 1ZAYA 2WW8A 3O9ZA 3E70C 5JFOA 1R50A 4D8WA 1L4GA 4L9AA 3WNDA 2VJPA 5GGXA 3RJTA 3WKCA 3K9NA 5EHGA 5LDHA 1XU7A 3I1IA 1JQJC 4KLZA 5KYUB 1N5DA 4AURA 4CMIB 2Y93A 4RPLA 1SHKA 2B5OA 2DFTA 4WK2B 1UFKA 2FG6C 3GN2A 1R8SA 3IVXA 4Q12A 3SQNA 1CRWG 2ST1A 1C8LA 3ENZA 4OM7A 2ZBRA 4P22A 1GZDA 1T15A 4EGJA 4XCVA 5T8KA 3UH1A 4BX2A 3IO5A 4NMXB 3CGWA 3HA2A 4XX1A 5EUMA 3TGWA 3AVUA 5DTQA 3FPGA 3DYVA 4TWIA 2OSVA 1IB0A 1V37A 4LX0A 1ZOOA 2HIMA 3PPXA 4OPMA 4EL0A 3TBFA 1BGWA 2IUFA 1OMOA 1R9JA 1CQIB 1FP4A 1M76A 2YXLA 3HB5X 1KMMA 4IV8A 4PPFA 1BMFD 2REOA 4XD2A 4Y9SA 3T5DA 3IQFA 3PI7A 1X14A 4KQGA 1NAIA 1M6WA 4MAMA 3KQMA 4PRKA 4HVAA 2WUEA 1MGOA 5JE8A 3A3PA 1YC2A 3KBOA 4LFBB 5HKOA 1WB4A 4HRAA 1GVHA 4B7UA 4JR2A 4F4IA 3EEYA 4OIMA 1Y6QA 3DDNA 3X3HA 2R8RA 2EW2A 3H2BA 5A5GA 4CMIA 4JT9A 3I5XA 2K87A 3DCIA 4KV7A 1ISPA 4JNKA 1HDXA 1TU3A 3V1LA 5H16A 4DJEC 1XHEA 3CF4G 3QTLA 4UZSA 1WX1A 2CZQA 4KAFA 2J6CA 1E0JA 2FWJA 1HLFA 1WMDA 2R87A 4DMLA 1KH2A 1VP9A 1H1LB 4LI3X 4WN3A 5C7YA 621PA 1QP4A 1R88A 1TFUA 2EGUA 1QYDA 1BKYA 4QE3A 2VQSA 3OH8A 1GAEO 1UBEA 1JXMA 1BD4A 1ULTA 2IY9A 2Z57A 4XRGA 5G53C 1TMGE 2G06A 4LXYA 1JW9B 3V1TC 4EZEA 3KLBA 4TS3A 4WBNF 4E32A 1UM9A 4QYTA 4GBGA 3CLTD 3TVTA 4EPWA 5I5GA 4ZV9A 3PJDA 1DEXA 3AHEA 1GCUA 3KYBA 3WL6A 2A0WA 3TK1A 2A0YA 5IMSA 2JIPA 1XJ5A 5JMWA 1U1DA 1X1BA 1B8VA 3IBYA 3M7IA 3PVZA 2GJKA 2XMZA 5JSZA 3R20A 1B0ZA 3R41A 5C80A 1H5UA 2HA0A 3GR6A 5TMBA 5KQSA 1KIAA 1PK7A 1UPAA 2IYWA 1BEUB 3EXEB 1KXJA 2XW6A 5A1JA 1O6ZA 5IAEA 2K7FA 1DCTA 1MXHA 1DPGA 3LD9A 3DLIA 5D84A 4DYVA 1Z6PA 5F2EA 4KU4A 4AWAA 2IK8A 2QORA 1Y4UA 1XMPA 2HMWA 5TT1A 4BLPA 1U5BB 5K4GA 2F1KA 1QQBA 3FTEA 5EP2A 4GI2A 3N8GA 4HC4A 1O58A 4HL6A 4M0KA 2QJWA 5TGZA 2I91A 1KQPA 2H4FA 2YIJA 3P1JA 5CRIA 2ZSUA 1ZHHA 4N01A 4OUDA 5FRDA 5FPKA 1JQBA 3LNTA 1J25A 2HSJA 2B1IA 1K5DA 4EI2A 3V1UA 2WIGA 5K0NA 1H4TA 3I5YA 1E6EA 4IYJA 2Q3CA 3U7EB 2IYVA 2PYIA 3PPWA 4WZBB 1EVYA 2FK8A 1DBQA 1K4MA 1U7DA 3EAFA 3NGXA 3A58B 4NL4H 5BWNA 4ALLA 5B2FA 2N47A 3CPHA 1Q2XA 1Z2EA 3O2QB 4Q4CA 2GPSA 3IBTA 1E7QA 2R6R1 4DCTA 3QWHA 4EVIA 3WNVA 3VTAA 1K6IA 5AW3A 4K9DA 5I48A 2ZR9A 1PG5A 4D92A 2P2DA 2VYVA 2HU8A 3L7DA 3MYYA 4AW9A 1CE8A 2N0SA 2QROA 2VK4A 3H1BA 2VDOB 4H1TA 2QBYA 2ACEA 4L15A 1ZK3A 1GQOA 1QDEA 1DAPA 3HKDA 1HZZC 4N18A 4BO0A 2N1MA 1J2TA 1H23A 1U7PA 2VJMB 1D07A 3WLHA 5JDCA 1JR3A 1C8KA 1Y8RA 1CK4A 4MLPA 4FFNA 2VT7A 4P4SA 4DQ0A 4KR7A 1AKEA 1OXXK 2J9XB 2MSEB 2NV2B 3F6EX 2GJSA 2CJFA 3N86A 2JAPA 2Y6UA 3FPFA 2POCA 3HLTA 4NESA 5FLKA 3MW8A 2CHQA 4E03A 2E7ZA 1GQRA 2XJ9A 3AM1A 4QVKA 6ADHA 3PUJA 4RY9A 3ZE8A 2R4QA 2IHJA 1VIDA 2QMEA 5IN4A 4H16A 3L7MA 1OCEA 1J23A 4KE7A 3L4BC 3A9VA 4K1LA 1YE3A 1X1AA 1GV1A 5BSUA 3DCJA 1K8QA 3ILVA 3CW9A 3QHAA 4KGZA 1ZXBA 3GA5A 4AD8A 5AKGA 1B1AA 2P4EA 1F0YA 3K0SA 1U8CB 2QRGA 4WZAB 1ZLYA 5JWHA 1YS4A 4F2HA 4KXNA 2GVZC 4NDAA 3O4HA 4ZQFA 1UMCB 3S7ZA 3AUKA 3TRKA 5I47A 3BQMB 3U1TA 8ADHA 1FYXA 5BYBA 1W5SA 4UUNA 1KC3A 2YINC 3TJZA 1X7WB 1I9CA 1R9MA 2JIDA 3TRDA 3C7KA 3ZWDA 4YJGB 3TTWA 2ZR7A 4CM4B 1IY2A 1NXOA 1IZ9A 1KOFA 2D1SA 3EC1A 2VWGA 1L1EA 2PQMA 1G3RA 3R6GA 4G5SA 5TQ2B 2F59A 5KBYA 1GV0A 2ZT5A 1NGSA 4E4YA 4QX6A 2C1ZA 2BLLA 4KNWA 3S1LA 1SIBE 1U02A 5JO9A 2B69A 4L8FA 1FMFA 1C9EA 4UOZA 5HDBB 3M33A 4BN0A 5B3JC 1G8HA 1UM9B 4I99A 4GX2A 5DP2A 1SCNE 1NQAO 3ZCQA 1XX6A 1ZD2P 3ROEA 3JQ8A 3CIOA 3S1SA 4OI2A 3OOWA 4EVSA 1AA9A 3WGZA 4BB5A 2YHSA 5LA6F 4WY2A 4X66B 2B98A 3AEUA 4X1OA 1I3NA 3SYKA 1G20A 4R2IA 1L5QA 3UV3A 2WIKA 4XCXA 1BXZA 3ABIA 3M1YA 1OI7A 2GDJA 1HZZA 2CXUA 1BVYF 3IQIX 1IXRC 3VYTB 1GUYA 1UT8A 3GGGA 2BGGA 4HAUA 2V1UA 1GPJA 4L4XA 3P9XA 2VCYA 3ME5A 3MVEA 1XHLA 4E31A 2CE2X 2HA6A 2JAHA 1GTL1 1MT0A 1UOPA 2JGEA 3ZQKA 1UIMA 2RHJA 1B14A 1CDZA 5JQGF 2PCLA 4MKZA 4BPBA 4KQXA 1RVDA 2JDID 3W5JA 3BZWA 1B1CA 3DA8A 3DEFA 2C54A 2CL7X 5D6NA 4HOYA 3BD6A 3LH5A 2FPSA 4O2LA 3OU2A 4YXWD 5KWIA 2X1LA 4MV1A 3TI7A 1DFIA 2F4NA 3C5EA 3G49A 1NC1A 4EB0A 1G7CA 1QH0A 1R6AA 3K4HA 2VAWA 1VIVA 4WJKB 3VO1A 3A4IA 3MINB 1CDOA 2PZKA 3JD4A 4NE2A 4WRRA 3RSZA 2CCGA 3S8MA 1MHTA 2UYOA 3R4CA 3EODA 2GXSA 1L4NA 2WWWA 2QUBA 5ALTA 3L4KA 1EINA 4AX8A 3MM4A 1HR0B 2HW8A 4DG9A 3SJAA 4ZOBA 3R0XA 4E51A 2OBLA 3I28A 1E5VA 1W35A 2GFHA 1THMA 3GJ7A 2KBFA 2B4RO 3A4LA 2Y1DA 3CZCA 2BR3A 4S3MA 1U9YA 2R1TB 3FBGA 1Q1BA 4XB2A 4DMUB 2HTEA 3C74A 4AXBA 2Y1EA 1Z4MA 3FGZA 2GRAA 2XUZA 5GZ6A 2X1VA 4BQPA 3ROKA 5DIFA 3T1QA 4D56A 5BYKA 2QJRA 1TZBA 3DS8A 2VC2B 3V4PB 5C37A 4ZHQB 2D4HA 3P0IA 3WMXA 2AF3C 5BQOA 3FDZB 4FIZA 2C7GA 2KLHA 4MNTA 5DNEA 3TEFA 2GLTA 4BIIA 2H59A 1Z37A 2W6CX 3UH0A 2Q0SA 2IRWA 5K03A 2ZVDA 3UHPA 3VZCA 4J0FA 3I04A 2IYPA 4J2TA 3UAWA 4C4SA 2KPOA 1ABFA 2PUVA 4WESB 3BFVA 1SJ9A 2RGRA 4NNJA 2RHBA 1VJCA 3RS5A 5TPWA 3HY3A 4D4MA 3MNFA 2WFLB 3O4JA 4DIDA 5HXAA 2ZJ1A 4EHDA 5IJXA 5SYAA 2ZKLA 4PGGA 2AFHB 1ZCJA 1KI4A 1TEXA 4NDZA 5EP3A 5AM1A 5TPZA 1MORA 4RH1A 2C7OA 3ORSA 3A4NA 1NW7A 4L2IB 4L6IA 3TNJA 3H5VA 4PYQA 4RZUA 3G0HA 3UG6A 3LCUA 4J3FA 3U49A 1VE6A 4V0MA 2KB0A 5JS7A 1JHUA 1E3QA 2VHVA 2C58A 1DHRA 4HX2A 4R0NA 4TT3A 2RJ3A 2NTVA 4Y6PA 3HJAA 3MWKA 4G1FA 2GPNA 2NMVA 1QIEA 4CUZA 5EJMA 3RE1A 2XCSB 2YDYA 3PT9A 3H4VA 3UBMA 1JAHA 2D5AA 2BZSA 3HCEA 5A9RA 3EDQA 1TCVA 3EXIA 3LK6A 4I1IA 3V3KA 2XCIA 1QTIA 3HWSA 3NXKA 4TUYA 2ILVA 2V7PA 2FN7A 1XVIA 2O6LA 3INRA 4V3CA 3AUUA 3UT6A 5IJ0A 3L92A 5DT2A 3LXUX 4R2HA 4JBXA 1PFVA 1U3CA 2X0DA 1C3JA 1R5JA 2ZRNA 4YFVA 4OAOA 3RODA 3GA0A 3AMVA 2PZEA 2HDWA 3MTIA 1SCJA 2QR2A 1GUFA 5JTTA 3OKAA 4G0OA 821PA 3SQDA 3HVIA 5DHTA 4CCYB 1UBFA 3H0EA 3OPYA 1PUXA 5HQ3A 4LEIA 5LZ4A 1PW5A 3B2EA 4MW9A 3USCS 2HHJA 2R8XA 4BNYA 4I55B 1FIUA 5BSWA 2Q1WA 4TOIA 5E6RB 2WV9A 4DIUA 1SM4A 3GGOA 3TG8A 3DO8A 2P4UA 1JMVA 1GGVA 3BIXA 4QYWA 3DNFA 2JW5A 5SZJA 3R74A 3L6CA 4JBIA 2X5XA 4I9GA 4KQMA 5HKBA 2WB4A 4RNDB 3VOAA 1XRSB 3ED5A 3PFHA 4YUVA 1YU6A 1BKDR 1OBVA 2JK1A 4JASB 2JG3A 4O2AA 2ZXEA 4M7WA 4PHHA 2NYAA 5K3EA 2WT8A 1PGOA 4AZTA 2JAOA 1SCBA 2BC9A 2JLSA 3FMPB 4Y2TA 3UOWA 3KEGA 1YI0A 1E1QA 1RRFA 3GDHA 5JAIA 4UARA 3OESA 1BKSB 4IX1A 3I6ZA 2OLEA 1VPDA 1JEJA 2VF5X 3IE1A 4MUNA 4EJSC 4ZT5A 2GN4A 3RYIB 2XYHA 2I5PO 3HP7A 2P5YA 1GLGA 2LTAA 4TTIA 3F97A 3PQ2A 1ITZA 1L7NA 1L5OA 1NRXA 4OMUA 1CIJA 4Q7LA 2GCOA 2H2GA 4A8HA 4EGAA 2XB6A 1CQPA 2VL7A 4WY5A 5B1SA 5IVDA 5IUJC 3EF3A 2ZU6A 4NYIQ 4WXMA 1DQSA 1RZVA 3GH1A 4MV0A 5TPZD 5F3DA 2AQ8A 5C34B 1CJBA 4D25A 3CH7A 1EEHA 2HRQA 3OMWA 4IYRA 4LY9A 3F6PA 3RGGA 1RRCA 3MERA 1KYTA 3BWMA 2C9DA 3ZWQA 4HDNA 4U5QA 2XWSA 3W2EA 4X90A 4GOXA 4NECA 4EY5A 4P3PA 2C7BA 4Y1RA 3UKDA 3CIFA 2H1SA 2H0AA 2IZZA 3H16A 1T9ZA 4UHEA 5ENZA 4JXZA 3KSUA 5D5PA 1P17A 1YFKA 3AZOA 3BH0A 2RCNA 1X7XA 5LWHA 2X2OA 4PSCA 1I7DA 1Z6XA 3HY4A 2XXAB 1GPYA 1OX4A 2JHFA 3AR7A 3ENQA 1D0VA 2OBNA 3QLVC 3K31A 4INOA 5EERA 4I14A 3KJHA 1XZKA 5KREA 5GTDA 4KX5A 4K9OA 1FP4B 1G6Q1 4OLHA 3UAOA 2ZZMA 2J0EA 3IODA 1NV9A 4EEZA 4P58A 5AVZA 1DBPA 2CUKA 1UBOS 4FFWA 4P08A 1CZNA 1XG5A 3FCCA 4FCVA 4UATA 1ABBA 1I1NA 2GAFA 2JGRA 1P1KA 1J56A 3A0UA 1ZK4A 3R6TA 2NU6A 3HGMA 3MLAA 4HQFA 1QF7A 3LQFA 3O1JC 4IIDA 4MR8B 4U7PB 4YO8A 3K1ZA 5DWVA 5LCXA 2VKQA 1OH8A 2QA5A 5CXXA 2X41A 2X77A 1ZWKA 2TYSB 5L3QB 1QANA 4UJ5A 1G291 4PLYA 1FDIA 4AN0A 1U7XA 3GDFA 1ESCA 2HQBA 4NAVA 2OCDA 3DG9A 3AIMA 1U7OA 3O8NA 4DZTA 3DDZX 5F4ZA 4FN5A 5HRUA 4AUEA 4Q3DA 5IEBA 3N2IA 4LKOA 3VR4H 3MLBA 1DWPA 2WJZB 1B73A 4IXNA 5D5HA 2WFLA 2CBXA 3FMFA 1P81A 1RCTE 4C0HA 2IBSA 3CQ9A 2IYFA 3L0PA 4WHMA 2P2LA 2WINI 3MQ2A 4G8BA 1EQAA 1KGDA 4RHUA 4YONB 4DC1A 2IUYA 5F9HA 4DIMA 4RK7A 1R0SA 3FGNA 2QY9A 5IMBA 4ENTA 2C7QA 721PA 4ENPA 2H1WA 2CN1A 3EXAA 3FZEA 2BRUC 5E2BA 4Y3UA 1I30A 2HK9A 2QWXA 4R54A 2PL3A 3HLKA 3MS2A 2PJRA 1NSYA 1VLHA 1QIJA 2GKSA 5GAJA 4ZYYA 3U44B 2QR5A 3A6KA 5AHKA 4ND7A 3R7DA 4OHYA 1FY2A 3GC6A 1ESNA 3HCFA 4C22A 3KFVA 1FTSA 4QFCA 4QKQA 5DM4A 4C4AA 2ZK7A 4WMLA 1A8SA 3UAZA 1IOVA 1G7RA 3IVAA 3M70A 5AKHA 4JT4A 5BWMA 2C5SA 2V6MA 2QD4A 3LHFA 3QGMA 4NBWA 5FEUA 1GRNA 1VPTA 4R6XA 5JH7F 2QZ4A 3GVXA 3HFRA 1VZ3A 4WK0B 4Y9DA 3EFEA 5CFPA 2ANCA 4BWFB 4YIHA 2HO4A 2WMYA 3CW2A 4B3IA 1MOZA 4Q4HA 3Q15C 5F73A 1SKYB 3UICA 2GWHA 3NV9A 1SU4A 2G07A 5JAUA 1IY0A 3NT2A 3O1LA 4IOMA 2Q0HA 4Y6RA 3EIUA 2BM9A 1QKKA 1DL5A 2VJCA 1QGUB 4G01B 4YP0A 4WCFB 1WP4A 3AR2A 4CV1A 3VKHA 3VHRA 1Q0RA 4N8EA 2A35A 1SOUA 3IAS1 2P9FA 5DLDA 2PN1A 1L3IA 1SZJG 1KWGA 1M2OB 1HFJA 1AV7A 5JAPA 1FBTA 4F6LA 2R751 3QVJA 5JYCA 2PU7A 4GMGA 3N76A 3IP6A 2XUHA 3UA3A 1BMQA 3WE7A 4B8YA 4B2YA 4ENUA 4C4ZA 5BMVB 1A4XA 3TM5A 1L8XA 3OPVA 1LS1A 1CR4A 2OHGA 4IWNA 4YJHA 2Y4NA 5LB2A 1L4EA 5H59A 3T3MB 3KUKA 3WG9A 1GZ5A 2FCRA 2GF9A 3WIDA 4Q47A 5FWYA 1N57A 2Z3ZA 2GSWA 1TA9A 4PLHA 3U3RA 3C41J 4ZQCB 1BSVA 4AJJA 3K9HA 2JVJA 1LBSA 3THWB 4BZXA 2GA8A 1T4DA 4O2AF 2QN8A 4JQOA 4DC0A 2REXB 4ID9A 2PKWA 4DLVA 1WU7A 3MWFA 4L7VA 4YMVA 2BGMA 4BUJA 1CEQA 2QXUA 4FSHA 3B7WA 4GLBA 4U8GA 3EA5A 3VSEA 1K88A 4NZ9A 1T5HX 2BF4A 4K2HA 2C94A 1Y4DE 2NVUA 1JG6A 2CHFA 2XVYA 3PHGA 3FOWA 3QEKA 3JTMA 4FW9A 2Z04A 1IHUA 2QQFA 1VL6A 4RFSB 3VU3A 4CDGA 5C8ZA 3IAUA 1CLUA 2XX3A 3BE5A 3HJBA 4J76A 4JCOA 3VHXB 2ZLBA 5KTPA 3QQ5A 3SD7A 3H9CA 1I2AA 4CQMB 2Z83A 1MX1A 2WJYA 5AKYA 5ALRA 4HMPA 3GLRA 4HQ6A 5P21A 3IUJA 3S2UA 2EHDA 3W6ZA 2RG7A 5BT9A 5HF6A 3AGQA 2W5UA 3KXPA 4PYOA 1PJ3A 4E6PA 1P1CA 5LA6B 2BFBB 3OEED 2OQIA 4ZAFA 2YJ6A 3RM3A 2C03A 3TO5A 3LAWA 5EZSA 3VKUA 4QWWA 1NFQA 1RJEA 1KJZA 1ZN8A 1RYHA 3ESRA 4W63A 3SMVA 2V3WA 3OZXA 3SQOA 3ZWAA 1K7YA 1UWLA 4NU0A 2VP6A 5K8TA 3EUEA 3QFRA 2HBZA 3GFPA 3NT4A 3AF6A 1T13A 3IUMA 4F46A 2FF5A 4HNRA 4CG2A 4D0GA 2OYSA 1FUEA 3ITEA 2YWXA 3K4PA 1HE3A 1KJJA 4YTEA 3QBTA 2BFDB 4KW7A 1I6WA 1SELA 3B6KA 1ODKA 2NU7B 4I3HA 3RHZA 4QVGA 1ZAKA 2VDWA 1RE0A 3L4EA 1YJQA 4L8VA 5EJ2A 3EGVA 1N2CE 2YHIB 4D4HA 5LL6P 4TLLB 1EVJA 3OO0A 3F7MA 5HRAA 5AHWA 3UT5B 2Y66A 2P91A 3MC1A 5KSWB 3DFUA 1MNQA 4DS3A 3RYFB 1CZHA 2PJDA 3NG1A 3A4YA 4C01A 4W5NA 4RC9A 2QN6A 3GFBA 4WCVA 5H80A 5HW0A 1W49A 2CWWA 5HZHA 1RPZA 2AZXA 3PD7A 4JR0A 2BMDA 2P4SA 3KZVA 4N7MA 2D13A 1RRMA 5IPFA 2Q4BA 2ZRPA 4S12A 4CL3A 1KC1A 2NTJA 5FEMA 1NRIA 3KKQA 3R7SA 3V8RA 3A27A 2FDXA 3ZVKA 1J1UA 1GPLA 4Y1RB 3UOGA 3Q7RA 3ZLBA 1FFEA 5LLTA 2WJ4A 1YJCA 1Y1TA 4KE6A 4IH9A 2FU5C 5JWRA 3D4IA 4LPKA 3CZ4A 5A6SA 5JAZA 3RIYA 3SF0A 4RTQA 3SQWA 1Y3BE 1YRQA 3A2NA 1K5HA 5L3RA 4A0FA 1YR6A 2VDUE 4ACAA 1PWHA 1S8OA 2R6DA 2XUOA 3AFIA 1MQSA 1KAHA 3IKMB 3PEEA 4U2CA 1NATA 1E3WB 2P77A 4UAVA 2JLVA 3LCVB 2W90A 4Q18A 2QW1A 4GUAA 2H11A 5JBNA 1TVEA 1APBA 5HKAA 2RE8A 1TVKB 5AJVB 3U4QA 3HXTA 1T9CA 3JWHA 3EVZA 3NYWA 4L3VA 1N33B 3L07A 2WI8A 1M1XB 4JFRA 4CHTA 1Y3FE 4MS3A 2I76A 1OT3A 4O4HB 3RUCA 3GLFA 4Q9JA 3OEEA 3C87A 2DCMA 1LZLA 3ZLUA 3DLCA 3WK7A 1TJ3A 1UL1X 4DDKA 1TUEA 3ZUPA 2EGGA 4JLSA 2G76A 3AJAA 3H7IA 1EUQA 2PTHA 4KN8A 1TC1A 3EHEA 2V7XA 5F77A 4CM3A 2A9QA 1WAMA 2YN2A 2BKXA 1GSHA 2FSVC 3UUFA 3NBAA 4EW6A 1L7VC 1OSNA 1XQXA 4LGYA 3SEQA 2O23A 4FC6A 2FPUA 2FUG6 4UAUA 3ANLA 1JA1A 2PLWA 2CHUA 1VJ5A 1NTOA 2WSLA 5KKNB 1RIIA 1X1DA 1MDBA 1Z0AA 4WUTA 1Y4ZA 3TD6A 4JLDA 1Q0QA 1T2NA 5E9JA 3WGLA 4BGDA 1DKNA 3SC2B 3OPXA 4GDMA 3CE6A 3T7DA 4YN3A 3VH4A 4OHVA 4V0NA 1EUDB 2QSYA 4M8SA 3RUIA 2ZJBA 1OE0A 3TTVA 1W4RA 3GFRA 3C45A 3H2ZA 5IHPA 2V7WA 2ZU0C 4JQSA 4M89A 1XVLA 3A6JA 4WDRA 2V0GA 4GQBA 4QLBA 3UV7A 1MEJA 3PFWO 3FCYA 1RXYA 1JI3A 3DOEA 4P7KA 3U48A 1M1NB 2Y71A 4PW0A 5AVVA 3THXB 4YRTA 5C0OE 4BNDB 1DADA 1FTWA 1ECGA 3GBVA 1WXGA 2FQWA 3KALA 3LIPA 3UJ9A 3UYKA 2O2IA 3IAM1 2PE5A 4FYWA 3RC3A 1Z0SA 1BHQ1 2Y0BA 4CQMA 3M6AA 2YRFA 3O8QA 2YS7A 1EWQA 4X71A 4RTMA 3BG5A 2GERA 3R9IA 3T34A 4HWSA 5H7XA 1ISJA 2AFHA 1OA0A 1T1JA 3DOHA 1HFEL 4GPBA 4MAFA 4KO8A 1F8FA 3ENVA 4D42A 3H8WA 2W6PA 4R7ZA 4A0GA 1AUVA 3LC0A 4DGQA 3G1WA 1A9YA 1YIDA 1V9SA 2QE7D 4QLOA 3DDHA 4EI8A 5CDFE 2O8BA 4Q9KA 4BGVA 3VZBA 1WO8A 2B34A 2OO3A 3BWEA 1QF9A 2J3KA 3EFOA 4UXHA 1SIUA 4QEKA 1GD1O 1EU1A 1RDFA 2X4LA 2C2GA 1A77A 1IN6A 4CL2A 4XIIA 1CULC 2WUGA 1CF2O 3H4MA 3I12A 2VPXA 2CMFA 2AFRA 3Q6MA 4JQCA 4NG4A 1A0OA 2VUIB 3L9WA 3WDMA 1ZI6A 4U3JB 4NP6A 3H2HA 2FVYA 3D0KA 4M1ZA 4MA4A 5JSYA 4HYEA 3CYFA 4L73A 4OHUA 4LFCB 2L69A 2OD7A 3P5SA 2G25A 2AQIA 4RGYA 5AUOB 3GJ6A 2C4MA 3EYWA 4JYCA 1TIPA 1P6XA 2GZ1A 2QSJA 3RB8A 4MW7A 4YMHA 5ALIA 4FYYA 3EXG2 2D1RA 3VNAA 3EDMA 2H1LA 2RAVA 3Q8KA 4CM5A 4BE7B 1IN5A 3SEAA 1FVHA 1VCHA 2BW0A 3D8BA 1Z47A 3LOUA 5J59A 2YVKA 3HO6A 4BFWA 4CM1A 3DAHA 2VYFA 3OZAA 3SE0A 4JGGA 2QPOA 1MAWA 1G2QA 4P6VF 5AXDA 5KS2A 3QU4A 4S0ZA 2IEAA 4JJFA 1V41E 1LC3A 2V97A 5EE9A 3LBFA 2UV8A 1RS0A 3F47A 4CGYA 1HUQA 1ONOA 1KI7A 1QB7A 1QH1B 2R9VA 2X0IA 2ISSD 1XZIA 3PFNA 2GEVA 1LU9A 3BF8A 3PUYA 1DZ3A 5F1YA 2NO5A 3DM9B 5TQJA 3MSXA 3WJ7A 4YP6A 1TUBA 1DNPA 2FPWA 2FV8A 2QXYA 2W9XA 3PGXA 5K99A 1S1CA 4MAAA 1GUDA 2LIPA 3B36A 3Q5DA 4P53A 3VPSA 4R69A 2JH9A 1CC1S 3E23A 1EGHA 2Z6UA 5SZIA 3JAWA 2C2OA 3WOVA 3O0TA 2ZRCA 1FFSA 1RWVA 3VPAA 1HQYE 3RFTA 1P75A 3K0BA 1AXGA 2EVWX 3W9SA 3DWFA 4MYHA 1JG7A 1QDLB 5LMCA 1E79A 3UCFA 1FDUA 4CEJB 2XE7A 4GLFA 2CKMA 2JFGA 1OASA 3HKEA 4TWZA 4TQUS 4MVWA 3DVLA 1I4DD 4QDZA 4MUMA 1LBEA 2XTJA 2WDPA 5KHAA 4PHFA 5IVPA 1YACA 1IUOA 2EERA 2I4OA 2NPIA 3GAMA 2YYZA 4TMYA 5EHNA 3VFDA 4KMSA 4ZI3A 1NBWB 3CPJB 4ARZA 3UMGA 4NS4A 2UVDA 3LY5A 1MG0A 1JJBA 3UHAA 2GYYA 4XWWA 1YQEA 2JFVA 4BEJA 1C3EA 1D2EA 4FR5A 2ZYAA 3PNMA 5E1DA 5BUZA 1YCDA 3A1NA 1H69A 1ODIA 1QHYA 2CHGA 2GJ8A 1N5RA 1ZRMA 2NQ8A 2PQ2A 3EWIA 3PXXA 2C4WA 4FQ7A 4KRGA 4TLEA 3QJGA 3B5EA 3Q5EA 1K0UA 3E9EA 4H4EA 3B12A 3F71A 3GRUA 5TMEA 3RBZA 2D6FA 3R9XB 1UXHA 3HJCA 3TWOA 1NQTA 5AUQA 2VK8A 3SJUA 4D8UA 3EQ2A 3LYUA 4DM4A 1D2GA 1FS5A 4MI6A 4D4IA 2F8LA 2H4YA 1ZINA 2H1HA 3RROA 3RAJA 3HMKA 1JKIA 3ZWVA 1YS7A 2XY4A 1ZGAA 1F0PA 1EFHA 2VDWB 1NX6A 3BIFA 1AS2A 4QSHA 4H08A 2Y2VA 1L5MA 3DVQX 2JEZA 1FP7A 1AKNA 1FJ2A 4L27A 4M7RA 3TLYA 4Z7JA 3WP1B 1H4SA 3OD1A 4O02B 3U4QB 1P60A 1FDTA 2PUEA 3T5MA 3IUEA 3ZTWA 4PAOA 1A7JA 2JLUA 4II2A 3AJEA 3KWMA 5T7BA 3KO8A 2Q0QA 2IV7A 1DOHA 4JX8A 3R75A 2NX2A 1C1XB 1NQVA 3M49A 2HWKA 4Y2QA 1KYQA 1N0UA 2YN4A 3JALB 5BNZA 2Q9UA 2TS1A 3BBPA 2YZMA 5ES4B 2E89A 5JT1A 4JBLA 3UC9A 3KDAA 2RGUA 4GI1A 4BRUA 1BAPA 1G2OA 1NRWA 1T8WA 4MUYA 4Q0MA 3MTQA 2H3HA 5K6AA 2XZTA 1E1QD 1KK3A 1ZGCA 3PQEA 4ZCLA 2EQAA 3O8LA 1Z4OA 2X6QA 2O3TA 2PR7A 1Z4JA 2IV3A 4DZRA 4GGPA 2E48A 1TYAE 3PGKA 2FUG1 4QUAA 4PXYA 3HXOA 3QIVA 1E2FA 3ZD8A 4H15A 4COKA 5BR4A 5L4NA 3IV7A 1DAGA 3DMDA 1V45E 2PXAA 1KTIA 2P6MA 3L8YA 3SM3A 2A7XA 3PZBA 4JJKA 3GXBA 3RARA 3EBPA 4YRPA 1I4TD 1VB3A 4JAVC 2VDLB 3MMZA 3EG5A 4K9NA 1SR8A 4L57A 2EKLA 1Q12A 3CKYA 1ZCFA 2J4FA 1ZU4A 2VWPA 3GAAA 4MGEA 1YQQA 4N0QA 5AVRA 1N2BA 5DYTA 3DZDA 4MHSA 3AW8A 5EMHA 1SMKA 2O2XA 3VKVA 1H42A 4LVNA 1E5DA 4HFNA 5P8WA 3ENKA 3IJEB 5E7JA 3TDKA 4CM8A 5DULA 4AB1A 4BB0A 4DLKA 4FYKA 1QIIA 2ZM5A 4FGSA 1EFDN 1F0KA 1GLVA 1WHSA 1A98A 1YO6A 1Z26A 1IRIA 1RPAA 2HMVA 3DPIA 3W7VA 1L1RA 5KSYA 1PVDA 4LJ7A 3SMQA 3ON5A 3ZDCA 1KZYC 2AN9A 2JGAA 2AKYA 3IPAA 1AZSC 4Z86A 3H5NA 1NW6A 1W5TA 1KI6B 2H2WA 1PT9A 3RHTA 1GAWA 3WBFA 3EIHA 1G4HA 3QYPA 4LDAA 1SVSA 2H1RA 3R5JA 4R68A 2CHVA 3FLAA 3ZHUA 3TZCA 3QNUA 3QE3A 3BJIC 1YA6A 1CYDA 1HWYA 2GM9A 3QUCA 4N0PA 5DO9A 4HAYA 3BQ9A 5HFAA 2DWPA 3SSOA 4JA0A 3KKZA 4KL8S 3UK7A 3BWCA 1H5QA 4DNOA 2IYTA 3INTA 2OR3A 3MJHA 4YBZA 1QV6A 1WM1A 3IOBA 2HU7A 5IJ9B 1XEXA 2FR8C 3QE4A 1PO7A 4A1OA 4B6JA 3IULA 4M1YA 1WLYA 2ROQA 1TX4B 3JARB 4NONA 5TEVA 4HQOA 2OXIA 5GIPE 2F4VB 1I0ZA 3PSHA 1YVEI 1U6KA 1WKVA 4URHA 3WBBA 5K8VA 3WIEA 1BDIA 2PNFA 3THXA 2R60A 1L7EA 1E9DA 3T1NA 1HE1C 2PS0A 2G17A 1C0LA 4ZJUA 1XGKA 1C3OB 1DJNA 1NYRA 3E4DA 4R84A 3GELA 2B1GA 2W71A 2IYQA 5MGNA 1ZD8A 2B3TA 3WL5A 3O03A 5FWXA 2VF7A 3GJYA 5KKAA 1RZUA 1IJKA 5CB4A 4AMBA 1T1IA 1SCAA 2Q4TA 1OFVA 3O3OB 3EXHA 2ECPA 1I7NA 3GFTA 2C4TA 3LLUA 4M7PA 2A3NA 2CVPA 4QTUB 2B99A 2DXIA 1B00A 2H8KA 2QQ5A 4CMJA 3WX0A 3ROMA 3HN2A 1XMSA 1TM1E 5E95A 4LWOA 2DPGA 3R9XA 3DBOB 2FPKA 3TL3A 4JMPA 3KYCA 3EPRA 1IJBA 1LZKA 2X4GA 2ASVA 4K2AA 5JDIC 2BEVB 3B3GA 3KM0A 1T2VA 2AZ4A 4G85A 3V5NA 4N03A 2IXDA 1SRQA 1W1IA 5JQGA 2QRPA 1JQKA 1DEOA 1WSDA 2WF9A 3DOIA 1VKNA 3F2IA 4W1PA 2XD9A 4WVLA 5U1PA 2ZBQA 3RH0A 3K6SA 2RAUA 1OKKA 4WACA 2Z4SA 5CW2A 1GU1A 3LT5A 2P68A 4EGFA 3UT5A 2RHHA 3N2YA 5IFLA 4HTFA 4U2DA 1CYEA 4R31A 1JKFA 1AN9A 1XB2A 3IH5A 3H9GA 1TJPB 3PCTA 2AEFA 3PRYA 3C7DB 4FLEA 1SKQA 1HY3A 3H6HA 5FBHA 5KVQA 3ZU4A 2BZ1A 1ESDA 3LQRA 2I6TA 3EFHA 4DV5B 3GCGA 4C2TA 3ZGNA 2QTZA 3E3OA 3M81A 3OWOA 4PCAA 2AXPA 5LLDA 2P2NA 4P36A 3UXYA 1RC1A 1WXXA 1EQ2A 3JYNA 1RWMA 3F2VA 1Q1NA 4V0ME 2W6NA 3NHSA 2P9TA 4I50A 1BVHA 4XYBA 3WLTA 3KZMA 2IVFA 4EX6A 4K9RA 1VLVA 1NKVA 1OHHD 4LRXA 2P9GA 1NURA 2EU8A 3JSAA 3R3ZA 3N0WA 3Q8LA 5LKRA 3HM2A 2OCYC 5HQJA 3DOCA 2HBQA 1G66A 3UQYS 1XYGA 3EPHA 3F4LA 3NVAA 4N5NA 4RXMA 4XLLA 3FG9A 3SR3A 3ZEAA 4FWTA 5FPPA 1NG1A 1M1YA 2FHSA 2BM8A 2EBHX 2ZSDA 2ZUVA 3CUSA 2N1BA 5K1ZA 4EQ6A 3A6GA 2RJNA 1MA3A 3TCKA 4TLCA 1XZBA 1PZMA 2NADA 4KQ2A 2A0KA 1JDBB 1I36A 4FDUA 4S35A 5IX8A 2GBIA 3C85A 3OT4A 5FTNA 2C8KA 1YDEA 2OTCA 4IQ4A 5HUJA 5K0LA 1USKA 2RHTA 4Q7EA 1FBNA 3HYSA 2J3DA 3W2TA 3FFTA 2V54A 4X8HA 2NN3C 4TWJA 3RTCA 4WH0A 3QI7A 1NJ6A 4H18A 4ZAZA 1ZH2A 4M6WB 1EXNA 1L3CA 1SC4A 4ZU3A 1E99A 2C04A 2B4YA 1LPBB 3F6SA 3P9SA 5H82A 2ADOA 5I3CA 4F5YA 1GNSA 3L6EA 5FOTA 3FWHA 4G67A 4LTNA 4JI2B 1XA0A 4DMKA 2ZITA 2D8AA 5JVDF 4Z8YA 4Y1EA 4RJLA 1NP7A 2AB0A 4QDUA 3ZDAA 1Q16A 5BSTA 4KFRA 1Z5GA 1J5XA 4RIFA 4D9FA 1A5TA 2PS3A 2IF2A 2X1HA 4UM8B 1DAKA 3QXJA 4ZYZA 2PMDA 1ENOA 4INJA 5ALQA 1TT5A 3U7HB 2P69A 4RXTA 3AUYA 4ARBA 4D0SA 3PS9A 4KRYA 4HDSB 4KQWA 1LRKA 2RC5A 3BN3A 3QLUA 4HLCA 4II3A 4DVGA 3ESDA 1QZUA 3AL3A 1P2DA 1Z4QA 2EZ8A 3PX2A 5IBRA 4J91A 2ZSJA 1O9HA 3HFGA 3FA2A 2PUTA 4UD6A 3S68A 5CDYA 5K8IA 3N58A 3KYJB 4YV7A 3ECSA 3KQHA 2ABWA 1XEWY 3O9VA 3PXDA 2WA2A 4C3VA 3HDJA 1U7TA 3C3YA 4O0LA 3WMFA 1NYQA 2UZAA 4BC1A 4RD0A 1PT7A 1T5DX 1F2UB 2BGIA 1QG4A 2UAGA 2ZIGA 4CTNA 4D9MA 5KIAA 2BFDA 5HIMA 2H29A 3PPVA 5BVGA 4P7JA 2A9JA 3AR5A 5DHQA 3DKVA 4LSGA 1WUIS 3I2FA 2CJPA 1X8XA 2A0XA 2NV0A 2Q2WA 4QG3A 1CKEA 1SC6A 4LJAA 2BH2A 2EIHA 1JR4A 1MJHA 3MIZA 2XQVA 1D2CA 1LQTA 2R62A 2I4MA 3PE6A 2GA9A 1EFPB 1AC5A 1G5PA 1JXOA 5FV7A 3CCFA 1YZNA 4RSRA 1XHFA 3I9FA 1RU3A 1ILWA 3JQFA 5KHOC 3UGTA 1KS9A 1N4DA 3NI2A 5EIFA 5T4BA 3FOAA 5JNSA 4RSMA 1MBZA 3U4GA 1EK2A 2O5VA 3U4CA 2JI4A 2I6SA 4DAEA 2Y9MB 4E5UA 2O59A 3PFBA 1GTSA 5LYYA 3QMPA 4KE9A 4QARA 4UDXX 3D4PA 2Q2QA 4JBYA 4WXHA 3VI3B 4ZZ2A 2O7NA 4OHCA 2QD3A 2AKEA 1SB9A 1LK0A 1E2LA 4KI7A 3SGLA 4DR7B 1CETA 4YH1A 1Z9BA 1N0VC 2H2DA 1UJ6A 3R0ZA 4L0DA 4HYYA 1PL8A 1RCFA 1HTBA 2W6ID 3ROFA 1QPZA 1Q5PA 1FNDA 2E1RA 2XRFA 1XQ1A 4OYYA 4WBSA 3WYGA 4B6EA 2H92A 2JJ8A 3B51X 3H1PA 3HZHA 1YZ3A 4D0LB 3FUXA 4ISCA 2C57A 2ZYRA 4B48A 1W94A 3VPXA 1BN7A 1JDVA 3QVLA 4IVRA 3WJ2A 4ALMA 4URZR 3EZXA 1VA5A 2H1VA 4GP6A 4TL8A 3IKLA 2Q3HA 2VJNA 1PEAA 2VATA 4I4TF 4PGAA 3LGAA 2IXGA 1C7EA 1EUZA 3H19A 3H1TA 2WTXA 3UB2A 1N77A 4RD4A 2OZVA 2FSUA 3CUKA 3G2IA 1SCUA 3H87A 3ORQA 3AI7A 3EXFA 1HYEA 2JFNA 3L6BA 5A5VA 2ZWMA 1PEYA 2IU4A 1OV6A 2WOJA 3H1AA 3MJEA 1BFDA 3DFIA 4FC7A 5G4KA 4B73A 3OAAA 5AK3A 3AEXA 2KSQA 3GUUA 3UJ3X 4DA4A 4H0FA 5IM5A 2CT8A 1TUBB 2O5CA 3QKUA 3IT2A 3AUAA 4KWTA 5BQFA 3D8UA 2QL7A 1RWBA 3K8QA 4YLYA 1GITA 3S5UA 4ETMA 1XNJA 3QE2A 2WPDA 1VG1A 4YYEA 2LKCA 3SDZA 1BJRE 4ZYXA 5K8CA 3NIDB 2Z4RA 2P3SA 2W6JA 3ZCXA 4B3FX 3LTEA 3RUEA 1YK0A 3BL8A 4N3AA 1OXKB 5DF1A 4P83A 3PNVA 4BNGA 3LNCA 1L3BA 2LD4A 1Z68A 4FEAA 3IMCA 2WSBA 4NCNA 2JIZA 3VYRB 4EA8A 2HSWA 1RRGA 2DR3A 3UB3A 1E6KA 1RM4A 3OCYA 5FXMA 3STVA 3GLGB 3TF5A 1JJAA 3X44A 1HYGA 4X00A 3WGOA 1NLMA 3M5DA 4FYHA 3OX3A 3L8GA 3CGGA 2K5UA 4HSEA 4FILA 3OVMA 4ZARA 4YRLA 5EQDA 3GPIA 4EJSB 4CEHB 4F1WA 2G4LA 3LWDA 4WKNA 3KFXA 3OJ0A 4OL0A 1UXIA 3ICPA 1GRRA 4MRRA 4R1QA 3JTEA 1YKFA 2FHPA 1L5KA 2HJWA 1XQ9A 1CY7A 2ZRIA 3LX8A 5CFRA 3LA6A 4DL9A 1A9SA 1ZGJA 3C7AA 5EI5A 2EWVA 2F62A 1QGDA 1YZLA 2C5HA 2DT8A 1SHUX 3BE8A 5BN4B 5J2TB 4KH1A 3DDWA 4IDNA 1QWOA 4EAAA 4ZJYA 3E84A 3JYQA 4D9HA 2O8EB 3T5CA 4FB4A 1Q1AA 2GF0A 5LQMA 1N5LA 4C4YA 3CVVA 2L17A 4M9QA 4KQJA 2FFAA 4OBEA 2ODNA 2QZZA 4EARA 4GMXA 4YRMA 2BDTA 2DF8A 1QPGA 1LEHA 3OURA 1A1VA 2I2BA 4YMGA 4H7JA 2O48X 3I0NA 4HXFB 1VJTA 5IJZA 3S27A 1AB6A 1TTQB 2Z58A 5FHRA 2GM3A 2ZDQA 1G8MA 1CPYA 3C3DA 4U7TB 4L0QA 2NZ2A 5DBHX 1OUMA 3DOOA 2JATA 4NJEB 3LPNA 1XZQA 5CFLA 4RX1A 2NXEA 2G0NA 1MW8X 1SOVA 4Z4EA 4N6OA 1JALA 3CLUC 3RJ5A 5FT9A 5A4JA 4WUVA 5KNBD 4RPKA 1NBMD 4HEJA 2P6RA 4OQDA 3V80A 4M0DA 4QFBA 5JZ9A 3LC7O 3QG5A 1FUKA 4I5GA 1J4AA 1DAFA 1DMRA 3F1LA 2W42A 4KTTE 4BPRA 1I2ZA 4FWBA 4M6WA 3GVHA 1ZUHA 4OU5A 3MA0A 3NR2A 4DBZA 3D3WB 3ABOB 1KOGA 3O47A 3UQZA 4WFJA 4CLRB 4Z3OA 1KQOA 4Y0AA 1YOBA 5FWAA 4N3BA 3R7NA 1KH1A 1SXJD 4UJ3A 1JQ3A 1NSFA 3FB1A 2Z3WA 4WV3A 2QY6A 5HJ7A 2PVCA 1PE0A 1X7XB 3HCBA 4ZQHA 4YRGA 1P0QA 2J9ZB 2PX3A 3JQEA 4MQFB 2X22A 5B58C 3L43A 5K0FA 2FOXA 2ZWVA 2F55A 2W93A 3MOSA 4J0JA 3WVNA 4OGWA 2GRJA 1N1GA 3CUUA 1OFTA 4X1IA 5ISMA 2BHRA 1O96A 5AVTA 4GKBA 2G0TA 2HXSA 1J8VA 5IKOA 3IAHA 3W8FA 1KHTA 2AZTA 2JB9A 3IEUA 3Q3JB 1D2MA 1ZSVA 4BKRA 5COBA 3I42A 3U3XA 5TV2A 1EJ2A 4BLQA 4AIIA 3E27A 5EWJB 2IS1A 3T7KA 3HQ4O 3Q1KA 4CIWA 1DC7A 2OA0A 2OSBA 3H6KA 1RJ9B 3I5AA 4CG0A 2WKQA 4Z7NB 1U8AA 3RFUA 2LRHA 1HKUA 3A31A 5KKCA 1LW7A 1UP4A 1QRTA 5T57A 1EESA 4JX9A 1SG9A 3DXFA 4MVJH 2F43A 4FMBB 3RVQA 3W5AA 2PXCA 2XLCA 3MJ4A 1ONNA 3VO8A 521PA 5ARBA 2FI1A 4QWMA 3UFXA 3K8OE 2OK8A 4FDAA