2QR3A

Crystal structure of the n-terminal signal receiver domain of two-component system response regulator from bacteroides fragilis
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
126
structure length
121
Chain Sequence
SLGTIIIVDDNKGVLTAVQLLLKNHFSKVITLSSPVSLSTVLREENPEVVLLDMNFTSNEGLFWLHEIKRQYRDLPVVLFTAYADIDLAVRGIKEGASDFVVKPWDNQKLLETLLNAASQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Two-component system response regulator
publication title Crystal structure of the N-terminal signal receiver domain of two-component system response regulator from Bacteroides fragilis.
rcsb
source organism Bacteroides fragilis
molecule tags Transcription
total genus 48
structure length 121
sequence length 126
ec nomenclature
pdb deposition date 2007-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qr3A00
4YLEA 5TQ0B 3EGCA 4N47A 5JNWA 2ID7A 2ZAYA 5TQ2A 3ROTA 3OO1A 2L19A 1LJUA 2YHBA 2CD7A 3CFYA 3TO5A 4EYOA 1YVUA 3QLVC 1APBA 3N0XA 2O20A 3KJXA 1U8TA 1NXOA 5DGCA 1P6QA 4MS3B 3JVDA 4OTZA 3IP7A 3K9CA 3W9SA 4GNRA 1CEYA 2FLWA 1ZVVA 2A9OA 4W5RA 4WXMA 5BR1A 1DC8A 4FE7A 1ZHHA 1USKA 2NUBA 3SNKA 3HM9A 3LOPA 3HVRA 2IPMA 1YTUA 1E6MA 1HEYA 2JB9A 3C3KA 4NV3A 3HDGA 4O5AA 3OO0A 1Z25A 3O1IC 2HQOA 3QLUC 3O75A 4KQCA 4D6XA 4F12A 4P98A 3JPYA 2MYPA 3SG0A 5IULC 1J56A 2JK1A 1NXXA 2VYCA 3KSMA 4RV5A 4E7PA 3L49A 4QYWA 1QO0D 4ZMRA 2VUHB 1Z26A 1SXGA 2E4VA 4ML3A 4LE0A 3F6PA 3SQNA 2X7XA 4EGSA 2WJAA 2FMHA 5IEJA 2DRIA 4NQRA 4ZMSA 2NZUG 1EWTA 1LBHA 1T34A 1U0SY 4YP9A 3OLWA 2H3HA 1PHRA 2PL9A 2IOYA 1NTRA 1QO0A 1YIOA 4OBBA 4YR7A 1USGA 2GBPA 3RVPA 3M9WA 4MLDA 3URMA 2TMYA 3RVMA 4LX8A 1C0EA 4JB2A 1QQBA 2B1JA 3MM4A 3R0JA 3O21A 3E61A 3O74A 2E4XA 1YMVA 1ABEA 4L85A 1RXEA 2PUAA 4JA2A 2E4YA 5IUKC 1PUXA 3O2QB 4JB0A 3RVSA 1Z13A 3C6QA 3UUGA 4PICA 3QLTA 4ETIA 3DGFC 1FFSA 5ED4A 2MYTA 3NBMA 2MSKA 6ABPA 3G1WA 3T6KA 4Z4GA 5DCLA 2GKGA 1JWLA 5FWXA 1DRJA 1SRRA 1U2PA 4CBVA 5FWXB 4XAQA 3QLVA 4MLCA 4EYKA 4MRMA 4G0ZA 4MRMB 2FEPA 1JBEA 3CZCA 3MA0A 4TLMB 3OMXA 1LJLA 4MPTA 2P4UA 2L18A 6CHYA 5ABPA 1MB3A 4WT7A 2NZVG 2QVCA 3IPCA 4MR8A 3O2SB 1E6KA 7ABPA 3GT7A 1MVOA 4KQ9A 1JYFA 1ISSA 5E3JA 2LIVA 1QP0A 5JNTA 2HSGA 3RVQA 1YS6A 2QXYA 1DBPA 1P2FA 4KPYA 1DC7A 1DBWA 3BBLA 3JY6A 3KCNA 4XASA 1DG9A 1EFAA 1U04A 3H5IA 5C5CA 5C5EA 2FQWA 1MIHA 4YWHA 4B09A 3QLUA 4RSMA 5IBQA 2JVJA 3EULA 3MQ4A 4YS6A 1JH9A 3H5TA 4EVSA 4FE4A 4RU1A 4N76A 4Z9BA 3I5AA 3KYJB 3HK2A 3CKMA 1JFSA 3I42A 3LUFA 4MYRA 2PUBA 4G0XA 4KNYA 5GOTA 4RWEA 1QP4A 3B2NA 5TE9A 3C3WA 2WJWA 1PEYA 3NHMA 3H5LA 3F73A 3DZDA 1KMIY 4D6YA 4Z9AA 1BVHA 3IP9A 4FB4A 4TN5A 4LE2A 4MAAA 5EWMB 4N41A 3Q7RA 3HJFA 3NNNA 3CRNA 3MF4A 1FFWA 4RY9A 3E3MA 4WWHA 1E2BA 1ABFA 4MR7A 5JS2A 1NXWA 3JPWA 5DTEA 5IUJC 4XFKA 1Z2EA 2JBAA 5TQ2B 3RVNA 3Q9SA 2N9UA 4Y9TA 2IPLA 1Y1LA 3N0RA 4IF4A 2A9QA 4LRQA 4RS3A 2QZJA 4Z99A 5F64A 1M5UA 1XHFA 1E6LA 2R47A 2CHFA 2IDMA 4KFCA 1DZ3A 1JLKA 2VK2A 3HUTA 1I3CA 1FFGA 3HUUA 3MIZA 3F6CA 3CZ5A 1PNTA 3N0WA 2PE5A 4RK4A 2WMYA 4KK3A 5FWYA 3GBVA 3K4HA 2PJUA 3KLNA 4N03A 3H1FA 1D4ZA 4RXTA 3D02A 1FSPA 4IRXA 3C97A 1A04A 2HJ9A 4LDAA 4UHJA 2H0AA 3H75A 3BILA 4IILA 1D1PA 3EDCA 3LUAA 1QKKA 3DGEC 3OLVA 3T8YA 3ROFA 1Z16A 3G85A 1QMPA 1SXIA 3A10A 3I09A 4F3TA 1WETA 2FKAA 2FVYA 2LBPA 1EAYA 1DP4A 3OM0A 2RJNA 1QPZA 2PL1A 2PKXA 4RK6A 4Q6WA 2PUDA 2Q5CA 2LP4Y 3LFTA 3HSYA 1NXPA 3RVRA 2E4WA 3KYIB 5KQPA 1NXTA 4D74A 3LUJA 2FMKA 1JF8A 2A9RA 3H6GA 3OMWA 1NXSA 4LDZA 2FN8A 3CHYA 5CNMA 1GLGA 1BA2A 1JHZA 1NY5A 5PNTA 3QEKA 2KYRA 4EUKA 4W5OA 1OXKB 4RXMA 3TD9A 1DBQA 2FSPA 4YGXB 1QNLA 5CNIA 1ZH2A 3HS3A 2P9HA 4RK1A 3FFWA 3EAFA 3KS9A 5JS1A 3LKVA 4F8JA 4KRFA 1SXHA 1Z2DA 1K68A 1GUDA 2PUFA 3NHZA 1JYEA 1U2QA 1MB0A 5FBHA 3EJWA 2IPAB 4Z4CA 3EODA 4P1ZA 4S05A 1DCKA 3H1EA 2JVKA 3DLBA 1Z17A 3D8UA 3ILHA 2WWVD 3CNBA 3OLZA 2WB4A 2R4QA 3RH0A 9ABPA 1LK0A 1F4VA 4DQDA 1LBIA 2WRZA 3CTPA 3HO1A 4MQFA 4OLBA 1H9CA 4MR8B 4PEVA 5T7BA 2F8SA 2PMCA 1BAPA 2QW1A 2R25B 4WZZA 3MYYA 3CS3A 4EY3A 3RVKA 1BDJA 3O1HB 3Q15C 5DKFA 4ETMA 1D2AA 1JL3A 4L4UA 3L6UA 2FTKE 1UDRA 3OLXA 1TJYA 5EWJA 1L5YA 1M2FA 5EWJB 4MR9A 2JVIA 4MR9B 2E4UA 5EWLA 5EWLB 3CG0A 3JS5A 1VPWA 2PUCA 1OXBB 3F7NA 2XDYA 3QELA 3RVOA 4ETNA 4IMIB 1B00A 1TVMA 2OQRA 2BGGA 3IP5A 2JCGA 2RDMA 2ZWMA 3Q7SA 3FMVA 4EYGA 2RJOA 4HNQA 2QV0A 3H1GA 4MGEA 1Z18A 1S8NA 1QP7A 4QYMA 3QX9A 4RK0A 3H5VA 1F51E 1A2OA 2GX6A 1XWWA 2L2QA 4F06A 5BQ3A 3IDOA 3HZHA 4JOQA 3H6HA 2NT4A 1VKRA 3FFXA 3KG2A 3VNBA 4MR7B 4MS1A 3N75A 4PE5B 3JVIA 4N0PA 4MS4A 2JBAB 3IPAA 3T95A 2LUOA 4WUTA 4KV7A 4RK5A 3RVJA 2AYXA 4ZPJA 3NNDA 4EVRA 1M5TA 5TPWA 5I4CA 1EHCA 4YO7A 2FLKA 2FMIA 4M88A 5JNSA 2MYNA 2J48A 3SAJA 2IKSA 2FMFA 3UK0A 5KWSA 1ZAYA 1IIBA 5IUNC 2AYZA 3I45A 3EQ2A 2JRLA 3KLOA 3CU5A 3QEMA 1ZESA 1GCAA 4MQEA 4O1HA 1KRWA 4ZYLA 1JDPA 5FWYB 2QSJA 3HXMA 1YK0A 3TB6A 5JNVA 4Z4IA 3OQNA 5TQ0A 3T38A 1ZN2A 4RXUA 3HCWA 2L17A 1L5ZA 3ILYA 4HNRA 1ZDMA 3GRCA 4G97A 3M9XA 4XXHA 4W5QA 1QQAA 5HM6A 4N0QA 3O1JC 3SM9A 4H3KB 4DN6A 4KMRA 5GQSA 5CHYA 3S99A 4MS3A 4NICA 1CHNA 3LUHA 4KZKA 4OG2A 5T3YA 4YV7A 2A9PA 4XLTA 3DBIA 4RZSA 2V0NA 3GV0A 3LTEA 5IX8A 2OENG 4W5NA 1RZRD 4Z4EA 4KREA 3A0UA 5KQLA 3FFTA 1D1QA 4PZ0A 4ZJPA 3O2JA 4PYRA 4G0PA 5IEBA 2QVGA 1FQWA 3GYBA 3BRSA 2FN9A 3A0RB 5HSGA 1RZRA 4G0OA 8ABPA 3LUGA 1MAVA 3KTOA 5KC9A 2IPNA 1DCMA 4Q6BA 4EYQA 2E4ZA 3EQZA 1EWKA 1P6UA 4JAVC 4RKQA 3TMYA 3C3MA 1USIA 4QPJC 1VLZA 4LE1A 4OLAA 2HQRA 3LUDA 2PAFA 2HQBA 2I6FA 2QU7A 3KHTA 2PLNA 4RDCA 5B3JA 3N53A 3NNSA 1A0OA 2M1ZA 3RQIA 3OLYA 3GWGA 3QX8A 1GCGA 4RY8A 5CNJA 3HEBA 5TPZD 1JFVA 1RXIA 3LUCA 4RK7A 4KVFA 3LKBA 3RVLA 4NCAA 2CHEA 2B4AA 3UKJA 3QK7A 4HNSA 1YMUA 5KQGA 3A3KA 1SD5A 4XARA 5TPZA 5KC8A 2GWRA 2VUIB 2M98A 2MSLA 2IYNA 3MMNA 1DCFA 3TX6A 1Z12A 4Z4HA 1M2EA 3GL9A 3H5OA 3LMKA 2GI4A 2LPMA 4MQFB 3OQMA 3GBPA 1P8AA 4F11A 1ZH4A 1AB5A 1BDHA 4YRZA 3HDVA 4G0QA 1TLFA 1ZY2A 4O1IA 4HYEA 4JP1A 1JX6A 1AB6A 2QR3A 4W5TA 1RNLA 4Z0NA 3IP6A 3H5WA 5BRAA 5HKOA 2HPHA 4Q7EA 4NCBA 3P9YA 4H60A 5DLEA 3QELB 5KQMA 1ZGGA 4IGAA 2FEKA 1JFTA 4GPAA 1DJMA 1EWVA 5TQJA 1C4WA 5IC5A 5JNRA 1RPJA 2PUEA 4G0YA 2FXIA 3OM1A 1GUBA 5D2CA 3FGZA 4Z4FA 2MYUA 2CWDA 4G86A 4EVQA 3GA5A 2NT3A 4RY0A 1KRXA 4QICA 1D5WA 4S04A 3KKEA 4WXEA 3OQOA 3CLKA 4E7OA 5B3JC 2MSWA 2R48A 1VRVA 3N8IA 3M6MD 4RKRA 2ID9A 2RGYA 1PNRA 1XHEA 5CNKA 2FQYA 1DRKA 4MS1B 3JTEA 4H3HB 2YHAA 4KK4A 1ZITA 5FBKA 4TLLB 4G0MA 4YCSA 2FW0A 2PUGA 3CG4A 3Q7TA 5HQJA 2F8TA 1R8JA 3N6VA 4MS4B 1NXVA 1YS7A 3SY8A 1TM2A 1K66A 3FDFA 1TMYA 4DADA 2FEWB 1JDNA 1Z15A 5TPWB 1BDIA 1URPA 2FQXA 5KI6A 1W9HA 1ZGZA 2WY2D 5EWMA 3HV2A 4TMYA 1ISRA 1YK1A 1NATA 4JASB 1CYEA 3DLHA 4OATA 3LUKA 3VNAA 3BREA 1PEAA 3BRQA 3QEMB 4MQEB 4LZLA 2W42A 1KGSA 1W25A 3Q41A 4IMJB 5BRJA 5JNUA 4UHKA
chains in the Genus database with same CATH superfamily
4YLEA 2YS7A 5TQ0B 2JG3A 3B1JA 2DHDA 4RTLA 2L19A 3A1CA 5J23A 1DJOA 2PKWA 4JLMA 3EGWA 3OE1A 1MA3A 3A8TA 1YKGA 5EP2A 5BV1A 1BEEA 4OQDA 2UVDA 1HQDA 1LVGA 3VHXB 1IZYA 4K81B 5DGCA 2NPFA 3ENWA 1ORWA 2I3BA 3DFIA 3RGWS 1DOHA 4JEHA 1E1QA 4UNQA 1QIKA 1XPOA 4KZPA 5F7JA 4ZRMA 4BVJA 1GL3A 3GRRA 1CUSA 1RDFA 1N2EA 1EZ1A 4LMAA 5IJAA 3UFXA 4B6QA 4DQXA 1W1UA 2HZBA 3IH5A 1ZOOA 3X1DA 3SNKA 1MUUA 2G88A 1J6UA 2O07A 3QKSB 4R51A 3WC4A 4BRWA 4CTMA 2JZCA 1RYFA 4L15A 1MW8X 2FMUA 2GM3A 4TS3A 1QHXA 2VCYA 2XQVA 1DBSA 1Q0PA 2ISQA 3PVCA 2ZKLA 3PK0A 3RT7A 1VIMA 4HEA6 4KXUA 3B1ZA 5E38A 4E7PA 2VYCA 3A4NA 4HZIA 1LBTA 4BNIA 1SXGA 2E4VA 3QLEA 1IZ8A 3OZUA 5AXBA 1FNSA 1OYYA 1N0WA 1P75A 1KY2A 2BEVA 1T34A 4FFOA 1G20A 1PZMA 1PHRA 4KLNA 1FP1D 1I2ZA 1MQ8B 1QO0A 2XQJA 4OGKA 2V45A 4WQMA 5K3FA 1L5MA 1PV2A 2X86A 3JATA 1UPTA 3TOVA 1GGEA 2V7GA 2FPSA 3OEYA 1Z8NA 3GUHA 2C9DA 1G5QA 1K7SN 1C0EA 1G21E 5CXQA 4PLHA 2QRZA 2E4XA 1HE3A 3LDGA 4BATA 2BFCA 4ERNA 4UAUA 1RM3A 3DEYX 3D7KA 4ZICA 2I2XB 1PR0A 2PH7A 3AR6A 4L74A 3TMKA 1Z8HA 4O5OA 3GEIA 4XWAA 1MRZA 1FYEA 1XVUA 4KSYA 1XNRB 1TDJA 4BN0A 1J90A 1WSDA 4UBKA 4YJKA 2WJ6A 4PTZA 1QPGA 1WXQA 1N2JA 3L8EA 5C52B 2VYVD 4XB2A 1W6RA 4A26A 1P44A 5LXTB 2RMKA 3IQDB 1R15A 1XOIA 2MYTA 3X1XA 3ZK8A 3DVAA 4HP8A 2JJ1D 5KZMB 2C8LA 4YR9A 3ZWWA 4KGDA 2H18A 1SKMA 1K1EA 5FWXA 3W2FA 3BDIA 2FEXA 1HYBA 3QLVA 3TJZA 4MRMA 4MIYA 1Y89A 3GJ6A 4L9RA 1ICIA 4BMPB 1CSEE 3MA0A 1ADBA 1LU9A 4RF5A 1GPWB 1OZFA 3G7SA 1JHAA 2GO7A 1MC1A 1RJGA 4RD2A 1SH7A 4NOJA 2PM8A 4WECA 2FZ5A 6CHYA 2IX3A 5FI1B 1NMEA 1OPRA 3JZAA 2EAUA 3LRTA 4MR8A 1N7IA 4ZT6A 1ML3A 2VDVE 3GT7A 2O2SA 4FC6A 1GSIA 2I3ZA 3TXYA 5MGBA 1R37A 3LQ1A 3RUFA 5ICMA 1UZLA 4YCJA 5LJLA 1YS6A 3EXHB 4EX6A 2XGGA 5TF0A 3EZ7A 5H0IA 1MVLA 2QJOA 2C2GA 1LTHR 1VKNA 1XZFA 3JY6A 1K4MA 1X1RA 5K03A 5C1PA 1JAXA 3JZFA 4HLCA 4MWTA 3OAAD 2NZYA 5AM2A 1H5NA 5L3QA 1R50A 3ICWA 4RSMA 1NUTA 3I2IA 2FPPA 1MB9A 3MQ4A 5JLJA 1OWPA 3HDYA 4GZ3A 1JH9A 3PNOA 1LNZA 1R0ZA 2HRDA 3GLHB 1IHXA 4IY1A 4Q7KA 1Y6JA 1QLWA 3EIQA 1BMDA 3HB9A 1X7GA 2X1HA 3S70A 4YRKA 4JVLA 4KRGA 4G0XA 4AO8A 3BRWA 2YW2A 5GM1A 5INTA 3LXXA 1XZIA 3OIWA 4TMVA 1E7MA 4OHFA 4AC9A 5EIAA 3DMTA 3E3OA 3K0KA 3IOBA 3GLQA 1G8GA 3I4FA 5CTJA 5KPJA 2V97A 3AHCA 5T57A 3EEBA 4Q19A 1FYVA 2HFKA 1NUUA 3ZQ6A 4BMDA 4ZKDA 4RCVA 3NNNA 3P94A 3PIIA 1JLRA 2J3EA 2XVZA 4CHTA 2A84A 1ABFA 1RRVA 3VZQA 3A6LA 5KYXB 2Q3FA 2VF5X 1Y3CE 5JMOA 1TM7E 5EMLA 1U1EA 3RRMA 3BAZA 4D96A 3ZCSA 4ZQBA 4D99A 2N9UA 3T7JA 4MUHA 4QEDA 3JU3A 4IF4A 3PE4A 4Q3OA 4RS3A 3WICA 4NBLA 1JEYA 2GPNA 2Q3EA 2OUIA 1YC2A 5FUBA 5KTSA 3IE1A 1GFSA 1M1XB 3DF7A 2C4TA 2QJWA 1CRPA 2PKEA 2Z3WA 3CZ5A 3EG5A 1UM9B 4M53A 2P4SA 4HDNB 2QBYB 1T0JB 3KPYA 3LJKA 4AY4A 1K2VN 1MPXA 3I0MA 4M8LA 4ZYUA 3SEZA 1UK7A 1V41E 1Y80A 1U7ZA 4HLUA 1WWKA 4Z2YA 1P4RA 3TW8B 3ZGXA 1NOKA 4CL0A 1R6BX 4L4XA 4TL6A 2AOUB 2GO1A 1NXQA 5LOVA 1V3QE 2TS1A 3EH1A 3RS9A 3ROFA 4MYHA 4F3TA 3WFIA 4TM8A 2LXNA 2A0UA 2Q62A 2YYSA 3BD9A 3IC5A 3R3HA 1X3LA 3S2SA 4UCFA 1E7RA 4AICA 3UPTA 1C3JA 3G2PA 3O4VA 5AKXA 4L8WB 1S8FA 3E05A 4HH4A 3X1YA 1PWYE 1U0EA 3IVAA 3NGXA 2ZR0A 3OJEA 3D7MA 4KW7A 2ATEA 5AHKA 4RK6A 2HJWA 3R23A 5HMMA 5CX1B 1SG6A 1XFAA 4EB3A 3CIOA 4EI9A 1FSFA 3FCOA 1R8SA 2GK7A 2XZOA 4DUZB 3EGXA 1ZM2A 5JMPA 3GRKA 4BAUA 3BB3A 5IAOA 2CXTA 1XN4A 1PGJA 2OILA 3VR5A 3E7DA 3CHYA 2ZQYA 2ZDGA 1JKJA 1S7GA 5K0BA 5CT5A 1DC3A 1ZCBA 2D3WA 3BTUA 4RAQA 5DIZA 5G0VA 4G07A 3INRA 2AXEA 2O19A 5KOHB 4NQZA 2IYVA 3FWPA 1A72A 2XD9A 4FS8A 3VR6D 1T9BA 3PUHA 3G8DA 1VE7A 1GARA 2C9BA 4UAVA 3C6BA 1WPQA 3G89A 4K9OA 2J5QA 1T3SA 2XRMA 3EG9A 2WTMA 1VKJA 3CLTD 4NESA 2IZ1A 3V7NA 4Q00A 3DCYA 3VPXA 3BFJA 3O8NA 5AOAA 4FQ7A 4PZUA 4Z7NB 1SXHA 3PX3A 3NV9A 4F4FA 1PVVA 4AK9A 1DMSA 1GCUA 1AE1A 1JHUA 1KJNA 1YUMA 1Z5GA 2QGZA 2WSLA 3GGCA 4J2TA 3AVPA 4QO8A 4OAOA 4MVJI 4Y1FA 4BGIA 1BGWA 5I8WA 2QA5A 4R41A 2WWXA 2JARA 2XCUA 4LYGA 3QEOA 2MSCB 4Q4LA 3ILHA 3HXPA 4KLRA 4QYTA 3CNBA 1I01A 4ILKA 3NXSA 4U8GA 5BN4A 4HEA1 2LCQA 1UBCA 2DFLA 3TPZA 1LK0A 3N2LA 5DWVA 3BQ9A 2IXDA 3FWZA 5L4LA 2JGJA 5LDHA 4C3VA 2A88A 1L5VA 3SMQA 5T7BA 5DLQC 3UNXA 4PSUA 2R25B 3D6HA 4H6XA 3I8OA 1MH9A 4GWLA 1EFVA 1TTHA 3O1HB 2F48A 1B14A 1LDNA 5AUPB 4GYKA 3ORSA 5BP7A 3OOHA 1CB7A 1QCCA 1TRHA 2G71A 2OV3A 2FK7A 4TWJA 4A1FA 2WF7A 1WO8A 5K3CA 2H4YA 2PR7A 3HBJA 4TL8A 5EWLB 2XSZA 3U39A 4BBPA 4QELA 5H59A 1CIPA 1Y9AA 2IF2A 2CNLA 1D9ZA 2PH3A 1S8OA 2WUEA 3F7NA 3R0ZA 2VL7A 3REGA 4YCLA 3KL2A 1LI5A 2HF9A 1VG8A 1B00A 4INJA 3WADA 5JIBA 4NCHA 1C41A 1DELA 2B92A 1ZI8A 2BMDA 4G67A 4PZZA 4U7WA 5DNYB 2DLNA 4TQ9A 4CQLA 2ZAMA 1V7CA 4EYGA 1U1GA 3DDWA 4H59A 3I8XA 2QMYA 2XE7A 4FOLA 1DLIA 1J0XO 2YJ5A 5E2BA 1YH3A 1N6OA 1QP7A 3O1LA 1RHQA 2H1CA 3W5IA 3PFGA 4BTVA 4ZGBA 5L95A 3GFTA 4XCVA 1L7MA 4Q7LA 2BKEA 3FMPB 3TAHA 5I3CA 4B4OA 3GJTA 3M6VA 3MGGA 3RSGA 4F1JA 1J5EB 1JI0A 2AHOA 1U2ZA 5A6SB 3VH4A 3GIWA 3K0SA 4EA8A 3D3NA 4MR7B 4RNDB 4TMFA 3H05A 1BMTA 4PG7A 5AICA 3HBMA 3K8ZA 2G0NA 2C04A 2QDXA 3JSAA 2M2IA 5KUTA 5ALQA 4KIFA 4OX9Y 3O9ZA 3VRHA 3V4PB 5JJBA 4L08A 1QF6A 3LG2A 1RZ3A 1YQTA 5TJ9A 5AUOB 4RF3A 4KI7A 1U90A 4QTUB 1UXKA 3B85A 4QUAA 5EJ8A 2IHNA 3CXRA 2FLKA 4QLAA 1KZ6A 3DL0A 4CQMB 4DWJA 4M88A 4V0MA 2MYNA 2ODWA 2VHUA 5JXIA 3E9DA 3B5IA 1YDEA 2GBLC 5CYOA 3TIVA 2FP4A 3I45A 1XEXB 3M2PA 2FJPA 2Q6LA 3T0GA 2ZRQA 5CYPA 3WGLA 2HK8A 3CEMA 4D4KA 1C0IA 5L8VA 4NVRA 1YTLA 3VC2A 2A92A 2ZM6B 2IU0A 4AAYA 3L1KA 3LSYA 1G21B 2A5DA 4NBWA 4QQRA 2HXYA 3VXKA 1ID8A 2RIPA 2C57A 3H1PA 4KDCA 1EVZA 1YZGA 1C81A 1ZA2A 2VRCD 3I83A 4G63A 4UKDA 3U1VA 4K88A 4U0KA 1KJIA 2WIKA 3PQCA 1X7YB 4LY3A 3UMFA 3VNSA 1FIUA 4YAUA 4H3KB 5HFAA 1U2GA 2IS4A 1RAEA 2YRWA 4PVCA 2Q2NA 4JKIA 3S99A 2FA9A 1ZR2A 2YJ3A 2C2WA 1YQQA 3KZCA 1R4NA 4OG2A 3THWB 2NYVA 2QVXX 3HU2A 1GCIA 5HGJA 2H1RA 4LGYA 5EEHA 2XB2A 1RLOA 3LDUA 1NNLA 1KS2A 4A27A 3OZRA 4H0CA 2HRZA 4QOHA 4MMZB 3A27A 3QOYA 4QUKA 3FZNA 3ZBQA 3TRDA 4JGIA 5IEBA 3DO8A 1HE8B 2WABA 3BRSA 2C20A 2X22A 2QTNA 2Q0XA 3PRJA 5B6PA 4MDHA 2R6R1 1SZPA 3AIIA 1MAVA 3FKQA 2KPOA 3V8RA 1CERA 3GBSA 1T4GA 1R1DA 5I7OA 5BN3B 1U0BB 3JRWA 1XRRA 1P7WA 1VPVA 2BE9A 2PKQP 2GILA 2W2MA 4NEHB 3ZDBA 1ISHA 2HCRA 1E7QA 4GH5A 1ZXXA 1E2JA 5BWCA 1CEEA 2FQQA 1OSNA 3DCJA 5AHWA 3ZWPA 1MP0A 2HXGA 2B9EA 3V4ZA 3HYNA 3UJ6A 1JDTA 1PVDA 4CMKA 5BT8A 2I6GA 4F56A 1KFKB 2ZRCA 2Y0EA 3PNKA 1N75A 2H17A 4CN8A 1IJKA 3BMQA 3KQMA 3QHPA 3DMHA 4ND8A 2Q7DA 1E7SA 2JK0A 3CNEA 2E82A 3PHCA 2QRUA 3U13A 2YXPX 2WJYA 5IF3A 1PLJA 1R0LA 4ZU6X 3HB1A 1ORRA 1ETUA 1YGYA 2IYYA 4GOOD 2JW5A 1AUOA 1CBUA 3H65A 4AXBA 4RTJA 3G2HA 1QRUA 1QFXA 1R0SA 2CW5A 2DT8A 3GD5A 4WNAB 3B9QA 2VQSA 1L8OA 1GTVA 2X5XA 3F8TA 5ALJA 4C0WA 1PRYA 4D4MA 3REQB 4DT1A 1C3OB 2A1UA 3WMXA 2WT4A 4RJ2A 1K5DA 5LXTF 5TPZA 1UMBB 3FLAA 1WPGA 1JAIA 3IBFA 1ZRMA 3BD8A 1IMOA 2ZRBA 3DTTA 2HMTA 3F3MA 1JTVA 1HTBA 2BYTA 1YWGO 2CVFA 4HAXA 4KMOA 3L82B 1P8AA 4Z4QA 1YZHA 1E62A 1K7FB 3OA2A 2XCTB 3TD2A 1GYRA 3SYKA 4I5EA 4O1IA 4XJSA 2OORC 1P1CA 4B4DA 2GZDA 4JI2B 3AJAA 1DTWA 1E9CA 5HZHA 4I4CA 4OAPA 4TLBA 4OOEA 1SO8A 2MINA 4PG4A 3HKEB 2C9MA 2OFFA 1F2UA 1CJUC 4TXMA 3K9QO 2RBGA 2AKYA 3ABQB 6ADHA 3ZLUA 3S8MA 4HT3B 2Q9BA 2RCNA 4I1RA 4IZHA 3KPWA 4P7GA 1Q0UA 2W2KB 2PSJA 1V16B 1XP8A 1RPJA 4REQB 4WBSA 2QJRA 2H1WA 4OHMA 5JNRA 4Y2GA 2D7JA 4FZVA 2G9ZA 4MCHA 2Q50A 1ELOA 4LYHA 1KE2A 4O4HB 2H57A 1KK2A 1MAAA 5D00A 4OH1A 3THSA 4E13A 1ULHA 4HAUA 2GPTA 3AQIA 2PWZA 2NO7A 2D4AA 2PZEA 1QZTA 2ZSDA 4YIKA 2Y27A 2UUCB 2WWRA 4J2HA 5AQEA 3TI9A 3QPVA 3IVGA 3UUEA 4NS1A 3ZZNA 3UKOA 1HEIA 4ENTA 3BT7A 2JHCA 2CVQA 2QHXA 4FCVA 3O95A 5CNKA 5FJIA 1CDDA 1NDQA 4URWR 5DLDA 3ROMA 5FBKA 5ADWA 2CUNA 3UYLA 4MVJF 2XNKA 2QT1A 4I0WB 2O1XA 3B6JA 2ZUDA 3SSMA 1X1BA 3R5FA 2ERCA 2VZ8A 1J33A 1RQNA 1JLHA 2PZBA 1IB0A 1YS9A 1MA0A 3FI0A 4YA6A 4BQFA 5D51S 3FOWA 1H5QA 1IULA 2XE4A 3LY9A 2PBFA 3PICA 4M0DA 3S2UA 3T7AA 3T7EA 2RGEA 3WLQA 1QVAA 2HGSA 2HUNA 2RGRA 2A0YA 1T4MA 4KC0A 3NGLA 4I5GA 3GFFA 4KRXA 4YRPA 3U3OA 3UJ8A 1MDFA 4MQEB 4OHVA 2PGDA 2BM1A 2W42A 1CETA 3D2CA 2PZKA 1TJ5A 3GCZA 2QAGB 4I66A 5LLDA 1J1ZA 1NWCA 2FOXA 4BX3A 3NC4A 3B6MA 2PS0A 1QORA 3QY0A 1JJ7A 4HDKB 2PH1A 1XD8A 1IUKA 4LJSA 4HNAB 3AL3A 3ZI7A 4O59O 4CCYA 4YJ2A 2PSHA 1X19A 4NIMA 1W75A 3F5QA 4E51A 4QNRA 2DSNA 3QXHA 1KZ4A 1DQRA 5FAKA 3IYLW 1WY7A 1EEXB 4RH0A 4MO2A 2HK9A 4B4VA 5JAOA 1XYVA 2ATIA 3HJNA 3DZGA 4P5EA 3ET4A 3HB5X 1NW9B 4JZYA 3RHSA 1PR9A 1XXLA 2DG2A 1UJBA 4W7IA 4UVDA 1Z45A 1GKLA 2XYPA 3PSAA 4GQBA 1G64A 1S02A 3SIRA 1BXZA 2NAPA 2QVZX 2GA9A 3HRHA 4LK2A 3LCJA 5C18A 1E6MA 1E2NA 2Q9UA 2V96A 3G9XA 5I9BA 1QPBA 2ZSHA 3PRYA 4YAWA 3SBDA 2XD4A 2NP6A 3PFNA 3FUWA 1LPSA 2Q3LA 3KVYA 1THTA 3O1IC 4XQCA 5KIAA 3KVOA 3EJ6A 2RHBA 4F12A 5FTJA 3JPYA 2XDQA 3SNHA 2REOA 3CWZA 4PC7A 3SYNA 1YCGA 2HU8A 3PFKA 1ZD9A 1BOFA 3ZCPA 3VR4A 3HUEA 3OIDA 3VPAA 1JR3D 2Z1MA 3DULA 2X7XA 2YCLA 1MOSA 5FX2A 5FEUA 4HCJA 1L5NA 2M9MA 1AHIA 4V0ME 4HXFB 4AUKA 2A3NA 3MBOA 2BEVB 4Y0VA 3SKXA 2H4HA 4D43A 5H81A 1ZNYA 2B8EA 2J4DA 2WNIA 3LK6A 4GKVA 4PANA 2CB9A 5FNVA 4PONA 1HNNA 2YN4A 3I6MA 2Y6VA 2ZWOA 3FNQA 5AJHA 5FBLB 4LFCB 3T3IA 1ZGJA 1K08A 4XA8A 1P18A 4G81A 1UMCB 1RD4A 3GNQA 3O4FA 2Z6UA 4YPOA 3KB6A 2XBMA 1KXZA 1SXJD 2LWIA 4A36A 1E8MA 1QG6A 1CD5A 4B3CA 1EVYA 1PUXA 1KU0A 4I8XA 1SZCA 3HJRA 1XDZA 4YXWD 3V9PA 1P0QA 5H16A 1KYYA 5DM2A 1W1IA 4DABA 1S7CA 3CE9A 1I6MA 2E21A 2X1VA 4DRYA 3S2ZA 1Z4IA 4IIJA 1PVOA 4FGLA 4ACBA 4YAKA 4O4JF 3RYTC 3TE6A 4F0JA 3R7WA 5FWXB 1XZKA 1H1LA 1TO6A 1YC5A 3BWVA 4QGSA 4G0ZA 1S0UA 1SCUB 1TYEB 4MRMB 3MTDA 3ZY6A 5L45A 3H2BA 1KEEB 1YJXA 1Z7BA 2B1IA 1FYFA 2Y9PB 2QYOA 4WEOA 4EFNA 3H2ZA 2GOYA 1NRWA 1TTQB 1LPMA 1QX3A 1LD3A 1CV2A 4GLJA 4WT7A 2HA5A 5CURA 1JLLA 2HPAA 3DZHA 5E9QA 2HSWA 5G2OA 2R60A 4UOQA 5TMEA 4L22A 3OX4A 3UT5A 4BV8A 1XZDA 1TYAE 4KN9S 4GDMA 4TTAA 3HPQA 4FWTA 5IRCD 3WIOA 3AVVA 4NZPA 3AJ9A 5M7EA 3DBRA 1ODCA 3SN6A 4KPYA 2CT8A 1E5QA 2VPIA 4FFVA 2NLOA 4N3BA 4DA9A 3KEQA 3REOA 1VLQA 2JVJA 3X1MA 2A0WA 4BFYA 2FPPB 3LX4A 3O93A 4OMUA 3JX9A 3LPNA 4KMSA 4N76A 2PQ2A 1Q0QA 2V65A 5FA6A 2Z2JA 3EIFA 4EG3A 2Q3BA 2BH9A 3R3JA 2GZSA 2WKWA 5FWAA 5T4EA 3UF0A 5ESDA 4YYZA 4RD1A 5BOSB 4L9WA 4JA0A 4EGFA 1D04A 2CJWB 5ERGB 4O2LA 2WD7A 4HB0A 2M6LA 3BMNB 1N2XA 3B7WA 1MG5A 4M8KA 2QQFA 1CR0A 1G5HA 1VBMA 1MEEA 2WT9A 1F5NA 1Q1AA 2GEFA 4N1AA 4OO3A 4OEHA 1GU1A 2X4DA 3PJFA 1PWEA 2OXTA 1DPGA 2I8AA 3HU1A 3I05A 3IUBA 2FUKA 4Q1AA 1ESNA 4RENA 1CKEA 4B43A 4QPDA 3IJPA 2IQ5A 1SK8A 1SA0B 2J31A 1E2LA 4LJKA 2ZB8A 4PAWA 5HPYB 1G55A 2XNCA 3X1KA 4RYDA 4QEKA 4ZI7B 1T25A 4ONEA 4DBZA 3KZ1E 2FSIA 2YYYA 4WKBA 5FFFA 2CHFA 5DP1A 3HUTA 1A2KC 6AT1A 3KEMA 1PWHA 2ZSKA 3DF9A 4M3NA 1L8LA 4IGKA 2IYRA 1QU2A 2HU7A 5TB5A 3A2LA 4G4JA 3KLNA 5LLTA 4N03A 3DZJA 1WCYA 1XZJA 13PKA 1JXAA 4M49A 2P2LA 2FR8C 1E4YA 4S2EA 1OTXA 4EG8A 5I7EA 3CZ9A 2GF2A 2OOKA 5JNLA 5KYTA 2VBIA 1ZN9A 1L5LA 2FZLA 3BILA 5CB6A 3MUNA 4Z86A 3RRFA 1P91A 3DOFA 2A1TS 3EDOA 3KTAB 2CGEA 2FZEA 2FGJA 2J09A 3D8BA 4OQNA 3KPJA 5B4VA 4WUVA 4EAQA 3KV3O 2YWEA 2PQMA 1HBJA 1YULA 3CKLA 5LIRA 1Z73A 5KHAA 2PL1A 3KQPA 2NQ2C 3LL4A 3DWIA 2NVUA 4B35A 3FR7A 1X0XA 3PC2A 4LZWA 4XEHA 4EPWA 2Q5CA 4E5NA 1E3SA 1JRLA 4HX9A 1VE1A 2E7ZA 4BLPA 4F60A 1E2DA 1NW3A 4OYRA 3T7DA 4DPMA 1EMDA 2E4WA 4RH3A 1W4RA 5DNEA 1E0DA 1YA8A 2CXQA 2HNAA 1X6VA 2QTAA 1YONA 3FVTA 4GXNA 4X54A 4XIFA 1FJHA 2FK8A 3GPBA 2OUKA 3PGXA 3PRHA 4RIGA 3VZRA 4EKIA 2O6LA 2V9ZA 4HWTA 4YIHA 5KOIA 1P4SA 1RHRA 2I4MA 1JKJB 4FMCB 3UTDA 1IQPA 1ZJ6A 3FGOA 4ZO9A 4GX0A 4W5OA 3GAAA 1VCOA 5DOVA 3ENNA 4HQOA 2ZI6A 1PF7E 5TSDA 4QZVA 1WR8A 4G2TA 1WNTA 3KSBC 5ELXA 4LYJA 1XQ1A 5JV5A 1HT0A 2ZJ5A 3L0OA 4C01A 1X7DA 3R8CA 1XDSA 3ZX4A 2WJHA 3OESA 3K2BA 3TNFA 3UY4A 4DA0A 1XVLA 4KRFA 2Q1TA 2ZRHA 1JPUA 1UPBA 1GGHA 2KMLA 1GL6A 1PTKA 3KKOA 4ZV7A 3HBFA 4LJYA 1YD7A 4OJQA 3G6KA 4Z4CA 3I39X 5G0TA 1O95A 5IHXA 2IE0A 2D7DA 3D0QA 1NIPA 5HS6A 3IP1A 4NJMB 4AIRA 3DLBA 2DHQA 3WDMA 3HWRA 1O0CA 2WWVD 3RQSA 4P3XA 4PM4A 4YP1A 4NAUA 3AR8A 2DHRA 3UH0A 1L3BA 1XYGA 1VHTA 1OXVA 2ZJ0A 2OZLB 5FNZA 9ABPA 4G0VA 5F52A 2EVWX 3LOQA 3HO1A 1P5ZB 4Y2PA 5C8VA 4K6OA 3VVMA 4EB6B 3ZE6A 1QQ7A 2IL1A 4EY3A 2BHTA 1OR8A 2CMKA 2YWCA 1N2OA 4LMPA 3INNA 4ZQIA 1D2AA 1K0UA 4JQSA 5BQPA 1OLSA 1RKVA 3DLPX 3JQAD 1C30B 1M2FA 2WPNA 5E6UB 3T9EA 1AC5A 2P6MA 3DE3X 3JQCA 2HN9A 2ZIAA 3F5FA 2JANA 3P52A 4LNAA 4B6EA 3IA2A 1O5IA 4YMLA 4O4HF 2I8CA 1DI0A 1NWHA 4RVOA 1YNOA 2ZJ6A 1L7PA 4BP3A 2OHXA 3ZCVA 3NJ8A 2B4YA 3GUCA 1PBNA 3WHPA 2JIDA 2BGGA 5IKXA 2IV7A 4E2FA 3R9XA 2NVOA 1XZPA 3Q5EA 4RMIA 1OAAA 4MI3A 3A4YA 3PTZA 2DXIA 3IILA 3ASYA 3PEEA 3UMBA 3SLRA 2ZIVB 1XDWA 1T8SA 3DTVA 4XFDA 1SU4A 2PAAA 4M0EA 1A2OA 1U1FA 4DOMA 4DZTA 3H4IA 3GJ8A 3CVOA 4RYLA 1Z0KA 1NLMA 2WKRA 2J3DA 4EELA 4HF7A 4RGBA 5EIHA 1MOQA 1ULTA 2CJFA 5JD4A 5HKLA 3VNBA 1IY1A 1ZM3A 3IAFA 4KAAA 4JXJA 3N2ZB 4QJBA 4CRWB 5A4FS 3PC3A 3TRJA 4QUIA 1G19A 3UXEA 2JIQA 3DSRA 3PXCX 4GMXA 1LKZA 3TQOA 4OM7A 4D4LA 1UXOA 1PL6A 4U2GA 4QFDA 1IUNA 5F2OA 3RSLA 5J1SB 4GXRA 2ZATA 3LT0A 1ILEA 1Y4AE 1G8HA 3VNQA 2VHEA 2WAOA 1WRBA 4PFSA 3BSFA 3GXOA 1OT3A 4B2PA 2JRLA 1SRQA 2I7XA 1GPLA 1KO4A 1GCAA 1GSHA 1NFFA 1ZESA 3A9TA 4GIBA 4GKBA 1NDUA 3WQSB 5BPHA 4MDFA 1FZTA 3PUVA 1ACLA 1G8PA 1YK0A 2QQGA 4Z4IA 4TRRA 4FFSA 2NTNA 3CUWA 3F3SA 3E22A 2ZI4A 2GTIA 4JQCA 2W98A 4CUKA 4CQNA 1UBRS 1ZZGA 3K0BA 1FLDA 1MTZA 3H8JA 3UANA 1N9GB 2XX3A 3G2NA 1N36B 4L6IA 3ABOB 3N0TA 4MS3A 2OP0A 3KHUA 2VXOA 3G0DA 3E7WA 3LVQE 3MPUA 2V0NA 4OLJA 3IA7A 2X5NA 3HP4A 4Z4EA 2NXWA 3STUA 2VQ6A 1AD2A 1K7EB 3GB9A 1PJQA 1SHKA 3BB1A 4ARZA 4B6FA 2W70A 4BFWA 3N39C 3DM9B 3LWZA 1ISFA 5CA0B 5KYVA 4ZYYA 2XZLA 4GUAA 1ODSA 2Z83A 4MWZA 3WSWA 1HZZA 4GLLA 1C3EA 4B4UA 1OXTA 4DNFA 1J99A 2VK1A 3FTNA 1JEQA 3UTCA 4HQKA 2GCOB 1Y7HA 4A6DA 3WGUA 2F1OA 3RCBA 2WM3A 3OCYA 3GP5A 3K05A 2NTYC 1P6UA 3LK7A 1UADA 2VXBA 3TOSA 3VYUB 3FTEA 5DYYA 1PR5A 2JFQA 1EX6A 3Q12A 4LE1A 4Y18A 1ZAKA 3GT4A 5IK2A 2FDCA 2CBGA 1UMDB 3FPFA 2V03A 1R6DA 4ND8B 1CVLA 2WA2A 2JLZA 4FYWA 3ZH2A 4DC9A 2O8BA 3OE7A 4RPIA 5ADVA 3OQHA 5CNJA 4BCBA 4NARA 1Y34E 3H9CA 2G63A 5H7XA 2OPHA 2B7LA 1TGVA 1Y82A 1BCRB 4KR9A 3WL6A 4BX0A 5A5DA 4P3NA 3EX7C 2WKPA 1K86A 4NPAA 5IANA 3F78A 4CEIB 3A3KA 4LRUA 2QD5A 3G2MA 5AFSA 3OT1A 4DT1B 1N7HA 1LI7A 2A1UB 1B8PA 4YRTA 4CKBA 1R27A 1FNNA 3GARA 4U02A 4ARCA 1LLCA 1NV8A 2FF5A 4OQ4A 1R4MA 2FX3A 3CVXA 1NN3A 2C4HA 1NF3A 4ZCRA 3IEKA 4OXKA 4RV4A 2ICAA 1ZWLA 1KDVA 4W99A 3EK2A 3GPIA 4Q3CA 2QTTA 2XYGA 1ZJ4A 3DB1A 1MC5A 1TLFA 4E1BA 4S35A 3WKBA 2ENWA 3FF4A 3WOHA 1G41A 5KYGA 1G7RA 4CV2A 2ZUWA 1GEEA 4MCAA 1WEKA 2D1FA 4PLFA 5C0OE 4BMSA 4ZZ2A 5LJIA 3H5WA 3LT1A 4I2NA 4WCDA 1UK9A 1SOWA 3JQGB 3EE6A 2BMWA 2MINB 3NDJA 2NU6B 1GKIA 2OAP1 5AO9A 4JL8A 5J1TB 4O0MA 1F2UB 1F6WA 5KJEA 2PIAA 2O52A 2RFLA 5GJBA 1XKXA 1WMSA 4J6EA 2ECFA 3QJYA 2EARA 3RRYA 3A6DA 3DE6X 3FUCA 3KT0A 3QVGA 2CL7X 2O8NA 1C9YA 4G5FA 2VOJA 2BTOA 3HI6A 1E4EA 1KPGA 2RGCA 3JZIA 2VJMA 1SBYA 5B2ZA 5H1YA 5GIOE 4XM0A 5FBQB 4NCXA 2VDUE 1Y8AA 2CE2X 2CNNA 1H2WA 4JR1A 4OPMA 4CMBA 4EVQA 3M6XA 4RKFA 3MRSA 3BIWA 4AKHA 3DXZA 4IIVA 3UQZA 3B52X 2IS6A 4IXWA 2L82A 1JHXA 4C3OB 1KJWA 3V48A 2R68A 3D8RA 3B5JA 3MMZA 1ZD4A 1NASA 3N8IA 3ZQKA 4B45A 1ZW6A 2ID9A 3GJXC 3PE3A 1YRHA 3PT9A 5DSTA 3ISVA 4LDQA 3OWHA 3K0AB 4AJPA 1G7SA 4DYVA 3L43A 2W8BA 5JDCC 1PYGA 5HF6A 3W1WA 2X6RA 1AU9A 4RJKA 9ATCA 1FS6A 1QONA 5C1OA 2NTVA 1E4VA 2ATXA 3WLHA 1EUQA 2Q4DA 4G4GA 1XMIA 3EARA 1Q7RA 4P82A 3UUFA 1NW6A 2OHJA 3QPAA 2F64A 4PQEA 2J9GA 2IUEA 1G16A 2IEAA 3BMXA 4FT4A 3ES9A 4R5MA 4UVIA 5EIOA 5AVWA 3FYSA 5E3IA 3SFVA 4I1IA 2HCFA 1FFXA 3Q0IA 4HAVA 2QXTA 3N2EA 3FHCB 4B3FX 5BRJA 4BU1A 2FZGA 2IXFA 4BO4A 3SJ7A 4UHKA 3O8OB 3SK0A 2PX5A 4X6UA 1GAJA 1L7DA 4NCIA 2VRNA 2WF9A 3W5SA 1W87A 1JIJA 2V7XA 3CLTC 1OASA 3FLEA 3UMCA 4I9FA 1XJ0A 1PT5A 2O20A 4PZLA 3SMVA 1L4NA 2K2WA 2HMWA 4Q1EA 1P6QA 3ZGVA 1OYWA 1KKUA 4MOWA 3VR6H 5HUJA 1JSXA 4Q3DA 4PZEA 3VMMA 1ZLXA 1T9AA 2MR5A 1HE1C 1E5XA 4X8MA 1ZVVA 4R1QA 3HZRA 1K4YA 3C1UA 1V37A 2IDZA 2ZBFA 4NCJA 4TKUA 3SSOA 5A3VA 3Q3HA 1V1RA 1RP7A 1FTWA 3WI7A 4UZSA 2YXEA 2QN6A 2Z1NA 2IPMA 4I36A 3U1TA 4YT5A 1HEYA 5DI3B 4LTDA 3G0IA 4KXVA 1QYWA 2VJKA 4F2DA 1TVEA 3ORQA 3OO0A 4OLHA 1AGYA 1GTZA 1HPLA 2H31A 3CF4A 4KRYA 4EQ6B 2R6HA 4B6JA 1CQZA 8ATCA 3KXKA 5JQGA 5LZ2A 4OHRA 4DL9A 4L0CA 2R6FA 1FPMA 3MCVA 5H9WA 2ZJBA 4MJLA 3S55A 1DDIA 2WU0A 3KQLA 2QPTA 3L49A 4YMWA 3L0CA 1KH1A 5T3UA 1Y7PA 3BPSA 2BMFA 4G8CA 2P40A 1Q6ZA 2FYTA 3WE7A 4XGNA 4G5OA 4J90A 2E49A 4FMCF 3PC4A 4I1SA 4AMBA 1TYZA 1KAEA 2PUVA 521PA 3UAWA 2WUDA 2Q41A 2YC4C 3T5AA 4GG1A 2ZRIA 1EE2A 1L4FA 1B2LA 1Q7BA 1KAHA 2CFTA 4ZOBA 2I91A 1IH8A 2AOWA 1BYUA 4R69A 4G9GA 3GG9A 2VWPA 3ONNA 5CH3A 3HN7A 1KZGB 4CLHA 4EHBA 1QQBA 2JLRA 3LC1O 2WQZA 4DC1A 3KT3A 1L7VC 1SVMA 5FPYA 5EE1A 5DV9A 4W4TA 4AWXA 2ZJAA 5H4HA 4AZ3A 1ZH8A 3LW7A 4RIFA 3DEZA 5AW0A 5JALA 3MJDA 4TUYA 2D2EA 2GZ3A 2Y6UA 4ZO7A 1RPAA 3F4KA 3H11B 3JYPA 4OL9A 1EYZA 1T2NA 3I01M 4HOYA 4XWGA 5D7NA 3R7SA 3QYFA 5C4GB 2NYAA 2OXRA 3RAPR 3VJMA 5B2EA 3V1YA 4C6TB 1BXGA 2WQ7A 1U7WA 2QW8A 2ZBRA 1MDBA 1B43A 4ZVNA 3ZTWA 4MMYB 3DOJA 2MSKA 5CH8A 5G1PA 1JT2A 4KYUA 1JZTA 2JFBA 4PU0A 1YDHA 1IAVA 3WGGA 4CNBA 3KU1A 3NIFB 1W93A 3INYA 4M21A 3A25A 3F6BX 1LDBA 1WS6A 2XMGA 4H3VA 1K98A 1ZH6A 2XMRA 5T6BA 3HA7A 1N3BA 4A92A 1JBEA 2OB2A 3MRVA 5KCMA 3OMXA 4AJ2A 3NEPX 1KH3A 4KL8S 1E8NA 2L18A 4Y9SA 3V1TC 4BZWA 2ZS9A 1GZ6A 2O7VA 2PT5A 2WIBA 1BC5A 3CNHA 3IPCA 2CFCA 3K2QA 2PTGA 1TJPB 3OEWA 1JP7A 4GBGA 4MYSA 4D3ZA 2HQSA 2X4IA 1T2AA 3DFFA 3IODA 3BK2A 5KSPA 5DGTA 2AMJA 3NWBA 4MUMA 3DBRB 4K05A 1M75A 2ETVA 1GZ4A 5J5CA 3SDBA 4JBNA 2XA9A 4HTFB 4HFRA 3C0KA 1W47A 1T8UA 4NE2A 3WJ7A 2ZR8A 3RSFA 2J9FA 2GRAA 1T1SA 1XRJA 3AJ8A 4CI9A 3H5TA 4J0CA 3ZCQA 1P74A 3UC9A 4DQLA 3K6KA 3LM8A 3MTAA 5AK3A 5BORA 4G2NA 2O3QA 1UBOS 5ALWA 1W49A 3U1BA 4MVJD 4MH0R 4ROSA 4YO8A 4LNUB 4A23A 1PI3A 4F5EA 5TS2A 2UUOA 1POXA 3D4PA 2DULA 3U37A 1U7TA 4UOEA 3A2NA 4QM7A 3S0JA 5C1IA 1MAUA 4D6YA 3BMCB 1OLXA 3P0FA 5M2QA 1UKAA 1NX9A 4FHFA 2I9PA 4MV9A 5B1SA 4MAAA 3RYCB 2GPWA 2GHQA 3MF4A 1ITZA 3BRCA 4K9DA 3M3DA 1SUWA 4F71A 3TW4A 1PZXA 4L8GA 4YQZA 2OC4A 2I3DA 5KPDA 1X38A 1UCFA 1R6VA 4IMRA 3STVA 3PLAE 3DE2X 3RWOA 3IJRA 2AJ8A 3QA9A 1Z2EA 2Y2UA 4J9UE 1ZM4A 2RH4A 2AEMA 1EM8A 4GMDA 5A4JA 3EXG1 4CHGA 3RGGA 4ZQEA 2WA1A 2QR5A 3BXHA 2JLWA 1KETA 2XXAB 1RWKA 1VYHA 3TGWA 2IDMA 5BSGA 1U2TA 3EHEA 1DZ3A 3NVDA 5CGQB 1R18A 2H5EA 2DJIA 3HCOA 4L8VA 1C7JA 4BVHA 4IX9A 2AG6A 1F38A 4AS2A 3GBVA 3NTVA 1JQEA 4D41A 2JNWA 4WLEA 2NUTB 2F8MA 4MAMA 1JNYA 1O8CA 4JDPA 1QYCA 4LDAA 1Q7GA 1G6OA 1VJ0A 3DB2A 3IT1A 3LXUX 3PV0A 5EJMA 5B64A 2FW7A 1EFKA 4DLBA 5KB3A 1P4GA 1L7XA 3O73A 4ZRNA 1WUIS 2AWOA 3VHRA 5AJTA 5CA0F 5EJAA 4GRAA 1FDIA 1WZCA 3C5VA 1QK5A 2DFNA 4MW2A 1CCWA 4XM1A 3W6ZA 2J32A 1YI8A 4BZQA 4QBIA 2PKXA 4TT3D 2EDCA 4DREA 4EJSC 5MGNA 5GP1A 1JB9A 1OXSC 1WHTB 2H2GA 2M6SA 1FMLA 3DZKA 2PUDA 2EL7A 1ND6A 3KVRA 1YRQA 3EFHA 4ISBA 2YJNA 2PMBA 4M1MA 1VA5A 2P67A 1W94A 3E8MA 3FTDA 3KR1A 4HMPA 2AFIA 2UYQA 4AP5A 1YI0A 4D74A 4IL5A 1JA1A 1VLMA 4NV0A 5JTUA 1NR5A 2RHLA 2VHCA 1NOIA 4CWAA 5E0OA 1J0EA 4ND1A 3I76A 3QSYA 3H2YA 1IXKA 4PG8A 3CUUA 1GGVA 4TYNA 3QEKA 2BI4A 3AC0A 1N9KA 3FAKA 4ZVKA 4DEVA 2G04A 3PHHA 2VTBA 3FBWA 4M37A 2O48X 4EAAA 4LECA 3OQIA 4ZCIA 2BKVA 2PCLA 4WADA 2FDRA 3S2GA 4GOND 5LQNA 3FFWA 1H4SA 2V0GA 3MJTA 2IFTA 5KU7A 1DDGA 1K8ZB 3M33A 4F8JA 1HDGO 1N6NA 5AW4A 1U9IC 1DIOB 1IEQA 3F9RA 4GPZA 3LUPA 4FEEA 4LHWA 4G09A 1MFPA 3EJWA 3PXGA 2XMPA 3AFIA 3C87A 3OOSA 4P1ZA 4EW1A 4LJRA 1SNYA 1MX5A 2Q7OE 3SKYA 4M38A 4ECEA 2CKDA 3TQSA 1QYRA 3D8UA 1NRXA 2OAGA 2QSYA 1EHIA 1XCBA 1JR4A 2ZBQA 3IVRA 4PFQA 5HF8A 2Q1YA 3KT8A 4GUDA 1W0JA 2WHYA 1W4CA 4AP6A 3L1VA 1CUZA 4DLLA 2A5FA 2EEPA 3WBFA 1EGHA 1TPZA 2QP3A 4FYYA 5DB4A 3OKCA 3TLXA 1FDVA 4CTOA 1R4AA 1Y7TA 3O9MA 5CB4B 3D59A 4BPRA 3KL4A 2VI5A 1NNEA 3TDNA 1PLKA 2VR1A 3NTLA 4NWIA 1VPLA 2EFDB 3GFRA 1A9XB 1PR6A 3K7EA 2X7JA 1VL8A 3LCCA 2K7FA 3M0EA 5DDIP 2IYXA 2V7QD 3MOGA 3C6MA 3IMGA 4PG6A 1VPWA 3H19A 3FSRA 1VDZA 2ERXA 3HZZA 3L84A 2I22A 4DRZA 3BIXA 3DR5A 2R6ZA 3H5RA 3K35A 3M9LA 1SG9A 3AEUA 3HU5A 3ZBTA 4BNYA 3CZQA 4XX1A 2HO4A 1G38A 3LF1A 2ZWMA 4CVNA 3JYLA 1TX4B 3AI7A 4RPHA 1GQSA 4LRYA 3ZWBA 2ZUEA 3Q88A 2ZB3A 3MTIA 5FOVA 4KXFB 4K8RB 3IVCA 4RETA 1KDTA 4G01B 1RJEA 4I55A 2IVFA 1FFCA 4YAEA 5KKNB 1SCDA 2O8CB 3LSTA 1KJQA 1X2BA 3O84A 5JSKA 2VBCA 2H2HA 4UBOA 1DEKA 4JMLA 2EW1A 1N5JA 1YHNA 2O2IA 3NJ4A 1WTCA 4FFDA 3FFXA 4JYBA 4TMWA 2M6KA 3VHLB 5BSKA 3IJEB 2HA2A 4TVOA 5KDOA 3S1SA 1MABA 4QBKA 3RR2A 2FPMA 4CQMD 3JVIA 4WJKB 2COUA 3QUSA 5I9NA 4KPGA 2AYXA 2W0MA 2Y1OA 3NNDA 1KY5A 3RFVA 2B20A 1MJNA 5DYWA 3IQGX 2OCXA 2ZBGA 1JKMA 1RI3A 4C7MA 4NOLA 1CY8A 4J3NA 4CLOB 1UDWA 3BXPA 3ZQ4A 2DPHA 2GYWA 4CLDA 4TS1A 3I04M 3W2IA 4B82A 4XFJA 4YJ2F 3V46A 1YB4A 2CJXA 2OZKA 4ZYLA 3UMJA 3MN1A 4BO6A 3ZN2A 4OUDA 2CKMA 2ZPAA 3FNEA 4M54A 4NI5A 4RD3A 2HHLA 4RPGA 1SXJC 4D9NA 2A30A 3O26A 4B0OA 4N12A 2JIMA 3E84A 2FX5A 3RBZA 1MD9A 1QQAA 5ISMA 3NAZA 1PE0A 5H3HA 3O1JC 3RUCA 1H2YA 2W2OA 3IEIA 3DE7X 1K88A 3FCXA 4GL4A 4I8IA 4IH4A 4ZC8A 3M6UA 4NICA 2AZTA 1GPAA 1KGDA 4TSFA 2E48A 5CXXA 3A9CA 3E8SA 3EOAI 4JC0A 4DE5A 1HFEL 2FSVC 3EVDA 3UUWA 5FL7A 1P81A 2WVGA 3HKBB 3QBJA 1NQ5A 5IDVA 3GY0A 2GYVA 1VC2A 2QN1A 3QBDA 3VI4B 1ZO8A 4B5LA 4C1BA 1TKBA 4E5KA 3EF1A 2X15A 6LDHA 3DH0A 3UV6A 1SOVA 4Y2VA 3NCHA 4EOGA 3NOOA 5CHEA 1NF2A 2QLLA 1ECCA 5YASA 1AS3A 2YVQA 1GRNA 2YOHA 2FW8A 3MK31 2FF7A 2QRQA 2AI2A 5HKAA 2YJGA 4Z6KA 3CX6A 2ZJFA 2ZUCA 2ACVA 4FWIB 3KQNA 2XUGA 4LG1A 3KWLA 3WWDA 3HGQA 3H97A 1KRHA 4FSDA 2GASA 2BZ1A 4GWGA 4ZQGA 5C8YA 3NVAA 4EATA 1U3DA 2OMKA 4J07A 4UVHA 4LKRA 5CTAA 1LZLA 1M34A 5FNVF 1G8MA 1LDGA 2GCNA 2QR2A 2C0PA 4B81A 1M6HA 3WJ1A 2BELA 2G28A 1RAIA 2HGZA 3FRJA 3K6SA 1S9HA 1U8CB 1VSVA 3NHYA 1ZD3A 2CVZA 3DXFA 2ZRNA 1OXUA 2WTUA 4GNKA 2BF7A 1JJVA 2WIJA 2XYRA 3EA4A 4IHAA 4F1WA 2O8BB 5A0FA 3ZXIA 4CF5A 3HEBA 5C1BA 3E70C 4RVSA 5B3AA 1CUVA 5A9TA 1C9JA 3NVMB 2Z58A 1GZSA 1D6MA 3T3EA 5AVSA 3ZJ4A 2X3YA 5DN6D 4LHXA 5I47A 2QY9A 3DM5A 2Q5FA 1D3AA 1EJ0A 1LPPA 2GH1A 3P9NA 3QK7A 1P2GA 4P3OA 2ZT5A 1GPKA 3X2EA 1ULSA 2HNBA 3WOVA 2WSSA 1WHSA 2EYUA 5E1MA 5EUMA 4C7BA 2FZVA 2GBLA 3GVHA 3MYRA 3OPYB 4IIJF 2A0XA 4JQYA 1T0PA 4BXOB 1G2IA 3LDHA 3UCEA 3ZKWB 2E3JA 3H5OA 5CB8A 4A10A 1F8FA 1RWQA 2YTZA 1W5TA 4RELA 5JCJA 3EUAA 4LXQA 4C7JA 3NXKA 3ICOA 5IM4F 3JWEA 1NW7A 1YVEI 3S2FA 2FPWA 4MQ5A 2JIBA 3KDPA 3Q8WA 3R2JA 1UFQA 1QE0A 1XRNA 2P3LA 5GWXA 2QD3A 3TTYA 5GONA 4Z0NA 1X13A 1SPXA 1Y3FE 2BMEA 1E1NA 1NF9A 1U3GA 3A26A 3GFOA 1WW2A 4DUGA 5DRYA 1DQPA 2AFIE 4UUAA 1JG2A 2P9ZA 3D2AA 4HQ0A 4WTOA 5LLSA 4R9VA 4R6XA 1U9CA 1V5GA 4Q3EA 3VU9A 1QV9A 1CZOA 2AXNA 3OD5A 2OBYA 4DA7A 1ES9A 1B0AA 3ONEA 1XK6A 4M7WA 1G60A 2ECKA 3T9CA 2BGKA 2UVPB 3GFGA 1V9SA 3DDHA 3JQRA 3K1AA 4U2CA 3WIDA 2Y1WA 3HVIA 4QWWA 3L4BC 3C16C 4DV6B 1Q1EA 3TL6A 1X0VA 1JJIA 2OHHA 4YMIA 1PDOA 4I4LA 3W3ZB 4URXR 1TJ4A 3MC1A 4QDTA 2W83A 3R3SA 4XPIA 5IVPA 3M6MD 5I6DA 3MJFA 1OAKA 3ZDAA 3L0BA 2HH9A 3F4LA 1HSOA 3TZKA 3OEHA 4MW9A 5DBOA 1ZITA 4PCVA 1M6WA 4GLOA 4XQ0A 4IJUA 2C2XA 1MCZA 2AN9A 4JR0A 1S3GA 1RE0A 1NBHA 2DSTA 4KWIA 1UL1X 4JP8A 1ENPA 4W63A 4BQQA 2EWWA 4D9JA 1P2BA 1B6RA 3GZ4A 5D6NA 1PV1A 2GBGA 2QG9A 3PHIA 4G9EA 2R4TA 1RSZA 4IFIA 2GM5A 2ATCA 3FDZA 3NTXA 4AVYA 4BP1A 3BXFA 3L4EA 2OFWA 5AW8A 2BMJA 4PY2A 5BR8B 3OZAA 1DQNA 3H42B 3FOBA 4Z54A 4LXTA 4GMFA 1QYIA 4TYPA 5IDWA 1RQ7A 2R5FA 4D79A 3LLMA 1Z4MA 3H4TA 4OHBA 4RGQA 4IKOA 1N4AA 1E1QD 3A2KA 2O2DA 4QG7A 1KKMA 3RYFA 2H07A 3VSBA 4GX1A 4QUBA 2Q6KA 1Y5IA 3Q3VA 2QV7A 3T99A 1IHPA 2ORVA 2J6HA 3D4NA 2HK7A 1E3WB 5KSOA 2C7VA 3IR5A 2LVBA 2OORA 3A1UA 5HQ3B 2GD0A 1SVOA 1C1HA 3QXSA 3OT4A 4RV9A 3ZV6A 1P5FA 1OBVA 2IDKA 3OBIA 4W5RA 3F5DA 5BR1A 3OPYI 1LFAA 1TA0A 4JLKA 2I4LA 4UMVA 3WKDA 4DILA 4OX9B 3LOPA 3BD7A 1Q5PA 2MWMA 1QANA 1X1QA 2D0OB 4TXNA 1PJCA 4HB4A 4YT4A 3A70A 4KXLA 1U6KA 3G13A 3PD0A 4GM4A 2BGRA 5FTWA 3SYRA 1MC8A 2K6GA 1E9BA 3PG5A 2OV2A 4LHVA 1KJ9A 2AQHA 1P1IA 1RBMA 1MQAA 1VJTA 3K92A 3D3JA 3R8FA 1AKUA 2C5BA 4J0QA 4BFUA 2MYPA 3UJPA 1J56A 1G1MA 3OJ0A 4D25A 1CTQA 1X1CA 1CY7A 1QO0D 1TJ3A 2UZ1A 2ZG6A 3R7AA 4K0KB 2WJAA 3V4LA 4AB1A 3QW2A 1W76A 2YASA 4RL4A 3UM9A 3ADPA 1CNEA 1XKLA 2AOTB 4O3FA 5HWSA 2OBXA 4YP6A 2BMVA 1A98A 2QVBA 5B58C 5GZ3A 2FMTA 4LXYA 2J3KA 3KPUA 3M4NA 3FUUA 2ZGVA 2EC5A 2HWKA 1CJBA 2AUTA 4LX8A 1ZINA 4L1KA 1FEZA 2J6IA 1DT3A 2AQKA 3E5NA 4ISCA 3PITA 4LSMA 1B26A 4PV7A 4DRXB 4M1ZA 2QS9A 3BDAA 2PJDA 2GEUA 3BWDD 3PPVA 3QVSA 1QG0A 5GVRA 5MN4A 4DVJA 1YVDA 4N5IX 4OD0A 4PG5A 3WLEA 3B7PA 4L4RA 4IZOA 3S4YA 4FDUA 4B85A 4XUEA 3FVRA 4KX3A 4Y7DA 3VKFA 1Z13A 3TOXA 4N8SA 2OZPA 2RKOA 4HFNA 1D6NA 3UHAA 2BR4A 1OBOA 4NAHA 2OE2A 4OA8A 3QLTA 3KAPA 3AO0B 4K9NA 3WGZA 1NKTA 1VIDA 5ED4A 4UFNA 4IQGA 2CLIB 5BSWA 2DFVA 3ANSA 5K0SA 1FSGA 5AI0A 2PA0A 4XDGA 5FYDA 2E87A 1RADA 2C03A 4X24A 4XB1A 5EQTA 5KWJA 2V5VA 5HJEA 2EU8A 4P4LA 1IQUA 3UMMA 3FOFC 4LDNA 5KTKA 3E9ZA 1ORVA 1BWRA 5AW7A 2IY7A 4UVGA 1GUFA 2ZE8A 5A05A 5KVQA 4FR0A 1ISMA 1U02A 5BMVB 4NBUA 1GP2A 3KD2A 3RV3A 1JW9B 1JYFA 5DULA 1II8A 4C2AA 4QG3A 1M34E 3KTDA 1KEPA 4KQHA 1YMQA 3DUFA 4EKDA 10MHA 1QHSA 3ELYA 1FP4A 2AS0A 1DBPA 2ZJOA 3OBBA 2IS1A 1NSYA 4IIGA 1DG9A 3AERB 3OOEA 3SEFA 3N8DA 4P4TA 4M46A 2I2AA 2PWYA 1QG2A 2ZFUA 2VRBA 3BRWD 1AZWA 3DBLB 2G08A 4PIVA 4RDHA 3B1WA 1DAGA 5CBKA 3GWZA 2P9QA 2JHFA 1L5SA 1GSAA 1XTBA 2OCKA 3MT9A 2YN2A 5BW8A 1SCNE 2XT9A 2Q29A 1E66A 1Q7TA 4G1BA 2JH8A 4MGYR 3B2NA 3C1OA 1IY0A 1HUQA 1SU6A 1ULBA 2WJWA 3LPDA 4BNGA 4FX5A 4RJLA 2UZ0A 2GJ4A 2FPKA 4GR9A 4DJDC 1E2QA 4L9SA 4WE3A 2GETA 4KU4A 4MVWA 1UZMA 3QUCA 5EZQA 3UHOA 4N41A 3OJWA 5TIIA 1XAJA 2YUTA 4QIHA 3HHPA 2AA3A 3JYNA 1E2BA 3A36A 5C46F 4ZAVA 3SPXA 4D0RA 3OQ6A 3KFXA 1YBVA 3BXZA 3AOGA 4RF2A 1NXWA 3ENKA 3KELA 1D4AA 4LV6A 1PGPA 3MT0A 1G9TA 4Q9HA 1MVNA 4AO6A 4E70A 2XVXA 3ETJA 4FM9A 4CDRA 4B7AA 1GZUA 4YC7A 4ESHA 2IPLA 4RAOA 3CGGA 2CNBA 3AKDA 5TLSA 3E9MA 3D1JA 5CCXA 3I4CA 3PZRA 3ST7A 4HR7A 4Q3KA 1T2CA 1EX9A 1U5AA 1DWPA 4K6KA 1A9ZA 3RHFA 2YZNA 5LOVB 1G6Q1 1TJNA 3CZPA 5HS4A 5F64A 1E1CA 4G25A 3FYHA 2VK2A 4H16A 4QXOA 1S4QA 3HUUA 1QVRA 4IFEA 4ERXA 2IXBA 2O6HA 3W5BA 1K6IA 3JQBC 1EFUA 1QM5A 3KKLA 3JQ7A 3C39A 5EP1A 1Z8FA 3BE8A 1CLEA 4FZ3A 4FDAA 2MR6A 4LC9A 4Y2QA 5F77A 1WPXA 3NASA 3R0QA 4YDSA 2H0AA 4K1LA 5EI5A 4HPXB 1KI4A 3HB7A 1VKHA 1XD2A 2F1IA 4Y98A 1QV6A 3DGEC 4IBOA 4PZCA 3A3PA 2O2EA 4Z1MA 4YECA 3A10A 3THYB 1E9VA 3QBEA 1T1IA 2DWPA 2VT7A 3B82A 4S2UA 5KSWB 4DIMA 1Z39A 5I4CA 4IJQA 4COKA 5ARDA 2WI8A 1ZKDA 4CFYA 5J5AA 4EMTA 2WIAA 3VR5D 2JAWA 3WG9A 3R76A 1XK7A 2J0VA 4MV7A 4DIBA 4XWKA 5JI2E 3DTYA 3EXAA 1W5FA 5LQAA 1QCYA 3AYXB 1YE3A 3NBYC 2AFIB 3G8CA 1PFGA 1J5PA 5EMHA 1K4KA 1Q16A 3IV9A 3JAKB 4C4XA 4ZZ1A 1J8MF 3QXGA 1ARZA 2X1MA 2YC2C 5KTNA 1ONNA 4LQ4A 2G07A 2I4TA 1RPTA 2QPLA 4DBVO 7MDHA 3AUUA 1YRBA 2HMSA 2F00A 2WWFA 3DZ8A 2H29A 3IPRA 4X1YA 3RLIA 4JI4B 1W29A 2QZSA 3KHKA 1KBQA 3ROZA 3I1IA 2WVAA 2VTBB 1UDCA 3L7IA 4DLPA 3THRA 4KG7A 2IOQA 3PA6A 1ESEA 2P1RA 4LISA 3RSCA 4Q9KA 5ALTA 1PTJC 2GXQA 3JYOA 4J3JA 1FMFA 4I5IA 1T2VA 1NL3A 1AHHA 1AZSC 1IZZA 2EBFX 2OCBA 3DKVA 4F72A 1N7JA 721PA 4DWOA 4GEKA 4HD8A 4FMDF 1T91A 5FBHA 2IPAB 1C3VA 2Y0CA 1OYVA 1Q7EA 1XJWA 4XVQA 5FTKA 4D9FA 1EEHA 1O9HA 1DV2A 4DKJA 4A15A 4KR0A 4S05A 3LT4A 3ZGLA 4WDRA 1P29A 1Z17A 2TSYB 2QW0X 1VJ1A 3KQTA 3PQ2A 2O8EA 2EW8A 1OX6A 2E5FA 3CZ4A 3HKDA 3MAJA 3OLCX 1F4VA 3H1BA 1SUBA 3JAWA 3N2YA 4HDRA 4M87A 4F96A 3IEXA 4CT4B 3EH2A 3RJZA 5JH7B 1QIIA 1TKRA 4PEVA 1FTNA 1J20A 1GZ7A 3KAQA 1ZIPA 2XSZD 3BXXA 2FR8A 4O2BA 2C00A 1NNSA 3AOEC 4MJ3A 4TTPA 5CM2Z 1Y4ZA 2OLJA 3D9QX 4PQFA 5B4UA 2FTKE 1P2UA 3CUKA 3OLXA 5IP5A 1L5YA 3N87A 5K01A 1TKCA 2JD2A 1IY8A 1QHYA 2VSFA 4EKEA 2VQFB 1BGXT 2A59A 1YO6A 1OLUA 2QTBA 2ZCJA 3KB8A 2O0MA 1CY6A 4WCFC 4C0LA 5IZ4A 5LQDA 1XV5A 1IEXA 1IOVA 1IHUA 1I1OA 1IPHA 2FWRA 3SP1A 4DSAA 3DE4X 1QZUA 4R3UC 1NONA 3ELDA 2AN1A 1YF3A 1MO4A 1N0VC 3DMGA 1BXKA 4FEYA 2QV0A 4MSUA 3OJXA 2HC9A 2JGFA 4OXNA 4BBZA 4WN9A 2FH5B 3DV2A 1IG0A 1KA9H 2APJA 2P3OA 2RAPA 1XU4A 3IDOA 2P9FA 3CR8A 5COQA 3H6HA 4V24A 4X41A 2WD8A 5IVDA 5EHGA 2I2CA 4EJMA 1VSUA 1K75A 3B20A 3IRVA 5A4DA 3N2KB 2FCAA 4MVJP 1MABB 4C6RA 1EP2B 5GJVC 1XTQA 2I54A 2DU8A 3GJ3A 5G1NA 1CR1A 1MC4A 1V6CA 3C3YA 4MDYA 5FR1A 3WLLA 2WLTA 1Y9JA 2QTHA 3OSZA 1GKUB 3QITA 5EQFA 1O96A 2X6QA 2I33A 4FHGA 5TPWA 4ZALA 4BNWA 1KI6A 3WLPA 3VNUA 2HU5A 1QIMA 1R10A 2XCSB 2C7BA 3UK0A 1O9GA 2B5VA 5AM5A 2AYZA 1KEWA 4C0SA 3IAM6 5CB0A 3ZV4A 3BZWA 3QEMA 4JI1B 1OUMA 1MF7A 3HXMA 3TNJA 3WTCA 3F46A 3ZZUA 3TB6A 1PJZA 4D5EA 1YJBA 5CA1B 1U31A 2PRZA 2OGUA 4RW0A 2NZJA 2FPRA 1L5ZA 5DM0A 3AKYA 5E9JA 4Q18A 2JRCA 4S3MA 4NMWA 5E9WA 1KOLA 3EZYA 5ITSA 1I1HA 1PUIA 4HRAA 4CM4A 4CKCA 3WXBA 4GOMD 4R3WA 1XELA 1R00A 1TCBA 4UBMA 1TLLA 3VNRA 4F93B 1UK8A 3RREA 4FCWA 4PC2A 4IGEA 3IUYA 1M66A 1Y9ZA 4BFCA 3WYAA 3A28A 4CG1A 3T3DA 1CJKC 4LZAA 3OQVA 5HYVA 5IX8A 2HEGA 5HIKA 4B6OA 3NWPA 4P22A 1MW9X 2PV7A 1NVAA 2OG2A 3IVXA 3N2NA 3PHLA 4F86A 1E32A 4TQGA 5E6RA 1X70A 5HMLA 3B51X 1T1JA 2IYUA 4OHWA 7REQA 5KNBH 1OX4B 2Q46A 2Q4OA 5JQGF 1ZYUA 2QVGA 3DYIA 3REFA 2CLLB 1CUYA 5K20A 2X7HA 2NMVA 1ESCA 3A0RB 4P80A 1DARA 3SX0A 2FI1A 1ILWA 1CUEA 3CQ9A 1E3QA 2QRGA 2G4CA 4M99A 1KS9A 3WGMA 2ORED 4KMMA 3TQQA 1N1DA 2EEZA 2XLBA 2YYZA 3EQZA 4KAFA 2OFPA 1FU4A 2EFHB 4I9NA 1JHOA 3EXFB 3JWHA 3ER8A 1M34B 3LNTA 4O29A 1NKSA 4X5OA 3LUDA 1LBQA 4QOGA 2ZBUA 3VPHA 1X9GA 1Z2CA 4BB9A 4ZZIA 5K6AC 2HQBA 5B3JA 2D6FA 3UJ7A 4RM2A 2I7CA 5GINE 4TS9A 4DY6A 1RYDA 3LLUA 4IKPA 2R8RA 2X3FA 4B7ZA 1H9BA 1EA7A 1BD4A 3CISA 3CPHA 5MFPA 4CF3A 2IBTA 4IJKA 2IHJA 5TPZD 1XTRA 1MO6A 1QZZA 1V4VA 3T1VA 3ZVNA 5DPMA 3A1VA 4RK7A 2Z3VA 1IEWA 3OCXA 1Q17A 4TUYF 421PA 3NUQA 2ZWIA 3WKCA 4E5VA 3VH2A 1YMUA 2GEKA 1RIFA 3Q3GE 3NT5A 1UBKS 5F23A 3ZVLA 1N8SA 3CEHA 5HRAA 5DYGA 1P7CA 4PPFA 5TMDA 4NG5A 2CLSA 2IHBA 2EJTA 3IPLA 3TCKA 4D9KA 4MVJH 4OHOA 2N42A 4MV3A 5FQNA 2P6PA 3ZYZA 4Z4HA 2QWXA 2HJSA 4MQFB 2O9JA 1UIMA 4FHCA 4DCTA 1UPAA 2PPVA 3DTNA 4LXIA 1DKQA 2F59A 3LBHA 3AK4A 2BSXA 5BSEA 1O77A 5EE9A 1NTOA 2NZ8A 3N59A 4B79A 4ETWA 5J4LA 5LKRA 4GAEA 4LBZA 4UEQA 1JX6A 1AB6A 2A5YB 3TEJA 4AN4A 4EEZA 4W5TA 1KYIA 1Z6YA 1J49A 5J9FA 3ZKAA 4K03A 5HKOA 5KMGA 4HGYA 3L1HA 1BG6A 1NDHA 1EE9A 2B6HA 5LPNA 2EBUA 2H48A 1R88A 1PFUA 3GDWA 4FPXA 4INZA 4Y3UA 3PPWA 3DAYA 4F7DA 1G5RA 3A7EA 1ECJA 1ZGGA 4PR0A 4C30A 3LXMA 1LPNA 5JD3A 2DR0A 3VU9B 2DBRA 4JROA 1XRMA 4WFQA 2XKJE 5ES4B 1BN6A 3B9BA 3A1FA 1GUBA 3GLIE 2Q8NA 2ZTUA 4N54A 1NVVQ 3ZVKA 3DMRA 4RPKA 4QKQA 1IXSB 2FV8A 2WJGA 3VV3A 4ODIA 5SY6A 4FEGA 4TL7A 4BFVA 5K8IA 4PW0A 1NR7A 1PZHA 4P6VF 3HB4X 2CUKA 4E7OA 3ED5A 1A5TA 4JJ4A 1M2VA 3W3AA 1F1JA 1RACA 1Z7EA 2OM2A 4XPIB 5AVVA 3H8SA 1FRZA 1VBNA 2NXCA 3FNBA 1Z2OX 4YVFA 1KY3A 3Q3JB 1MT0A 3CYFA 3I6IA 3L7BA 4HSGA 4KO8A 4LRXA 4YCSA 2FW0A 5EJGA 5HQJA 5B6IA 1RKQA 3PQEA 2BIFA 1NXVA 1AGPA 4M0MA 2EGHA 2IEDA 3SY8A 4OFZA 3WYNA 2R6GA 5F1KA 3EUEA 4EA6A 2X8AA 3I37X 1OZAA 2YN0A 4ZOAA 1TT5A 1URPA 3H9EO 1D2GA 4BKMA 4M89A 4Q1CA 3HV2A 4LOJA 4TMYA 4BLOA 4JASB 3MQ2A 2GXSA 3DFUA 3D6JA 3A4TA 2POQX 2WHPA 2XUAA 4P7BA 1FVXA 2Z9CA 3U0VA 5BN5A 2TYSB 4CT5A 4YJ3B 5CDUA 2XE8A 5DNVA 1VL6A 3IXLA 1F8XA 2A78A 2ID7A 4TOIA 2FHPA 3E1KA 2C54A 3ETLA 1HYGA 3RD5A 3G0GA 1GZDA 2CHVA 2GB4A 5D3MA 2J7PA 5AVKA 1I33A 2DPYA 1NZJA 1XL1A 4HGNA 2RHHA 5AVJA 2DFTA 1V8BA 4U6QA 1NXOA 1VKZA 3I2KA 4RPLA 1NP6A 1GZVA 4AL4A 1Q1BA 2JF0A 4Y1EA 1FA9A 2Z56A 1ZHFA 1XZMA 1PG5A 3ITKA 4BQNA 2A9OA 3GZNB 4FFBB 4X7MA 4ARUA 2BM9A 4BB6A 4AY3A 4CG3A 1AQJA 4FE7A 2HL6A 2A67A 4X84A 3UGKA 3M1LA 1JQAA 4CKEA 4F6RB 5AHRA 1IHYA 2C4MA 3TZBA 4U7HA 1FMTA 1I3OA 1P4AA 2WV9A 3D4IA 1C4OA 2ZRJA 3G8YA 5DSXA 3VBCA 4DAOA 1HR0B 1T3TA 1R9MA 4AZSA 4BZPA 3F2VA 3VR4D 1DQZA 1RJWA 1ST2A 1V7ZA 1RE1A 1SQFA 2Z9BA 5IH3A 4FOTA 3TSZA 1A2BA 2BKUA 1AQUA 3ILSA 4IYRA 4K2AA 1QDEA 3PF9A 3EVGA 4S1TA 4HWPA 3CJTA 1FVOA 1GLNA 3LYHA 3L7AA 3MOIA 4ZTZB 2BF4A 1HMPA 2X0FA 3TX2A 3CVYA 2IYPA 2W2NA 2VNKA 3B9PA 4ZVQA 3FOZA 2AVDA 3F7OA 2R9VA 3P2YA 4BMNA 3IAM1 3T1TA 3G3EA 3ONVA 4OBBA 4RD4A 3F9CA 4C6HA 2CXNA 1OGJA 2VYQA 4XKJA 4MLDA 3ZH9B 4BEJA 5JDCA 1H6CA 2JGLA 3OLQA 4BMOB 1EUYA 1PJ2A 4RFVA 1CDZA 4Q9IA 4MA4A 3WYDA 2E1PA 3NT2A 4KYIB 1NI4A 5LYJA 2D1RA 1YRLA 4BLTA 3H2JA 5BSFA 4J1TC 4REMA 1RXEA 1KIMA 4OI1A 2WUVA 2PZJA 3EGEA 5TVKA 4JWTA 5MN5A 1SBHA 3P9PA 1ZGBA 2V1UA 1FDUA 2R6JA 1E1MA 4IRUB 2XLCA 1YL5A 4JKOA 3U31A 4C7KA 1YJCA 4LOAA 2GEDA 4Q47A 9GPBA 4F6CA 1NV9A 3QE2A 3UHFA 5EG5A 2P0YA 3S5UA 5JH7F 3HYRA 1T0IA 2VJAA 3NI2A 1ATZA 3GDOA 3KJHA 4NOKA 3USZA 3M5DA 3ICPA 3P7MA 4M6WB 2DAPA 1U8UA 3TQCA 4H7KA 3F90A 3OOJA 2NSHA 1YE8A 3SDSA 1HLFA 2BTQA 3UKDA 5D5PA 1GAWA 1VQ1A 5AVYA 3NBUA 1WBBA 5D5HA 2V4UA 3PP8A 1H8HD 1QFJA 3L7MA 4Z7JA 1SAYA 2FRXA 3DUFB 3IMEA 1WXFA 5ESXA 4CL2A 1FZQA 4HRYA 3QOWA 4RHFA 1XMPA 1H8EA 3FCUB 4QARA 4BWGA 1R8YA 1CQJA 4MB6A 1YACA 4QFCA 1QDUA 2JD0A 3DVQX 4NYMR 5SZJA 4MEBA 1Z0UA 4GXQA 1Q3TA 3LRPA 4B09A 4DV3B 3EFOB 1LK5A 3HN2A 1I13A 1B8UA 3Q7IA 2JCXA 1DE0A 1Y6ZA 3BQMB 4OQMA 4FYPA 1RYNA 4JN6B 4XTCS 1R5OA 5CVEA 3WHLA 1PK9A 1UT5A 2CLHB 4KPUB 1Y8QA 4M1EA 3OTIA 4I55F 2CFIA 5C31A 4K9RA 5ED0A 2KLHA 3ED1A 5BOVA 1XZQA 4ZAFA 3T5MA 2MMGA 1NN5A 4XUDA 4BFLA 5A7GA 1SHJA 3N58A 4RLSA 3FDJA 1EKXA 2J0EA 2X8JA 1HG1A 3DQQA 2CDAA 3HCCA 1RLUA 5FTMA 4RPCA 1MFZA 3R9KA 5IZCC 3O8BA 5MFZA 2FR0A 1CZKA 1DUVG 2Q0QA 2AE2A 2CUZA 2XDAA 4IAOA 4B6SA 4QPCA 1JR6A 5C34B 3HJFA 2BKAA 1XZBA 4Z3DA 1FFWA 2TRSB 1EINA 1QS0A 4FSHA 1GHTA 4DLTA 2B4QA 2O7QA 3CKKA 3TN7A 4DCGA 1I2MA 2IHKA 1LLQA 1MN6A 1VGVA 2ZUBA 3DPUA 3I23A 2FEMA 3LX6A 3OQPA 4Q4HA 5CYFA 5HIMA 1XT6A 3MFQA 3O94A 1EUDA 5LUAA 2QG4A 1Y1LA 5CFPA 3IIJA 5G4KB 1PT8A 1PZNA 1KMCA 1DRUA 2P9GA 2QZJA 2XUPA 1A7AA 4G5SA 3TRHA 3GDGA 5KHOC 4BWFB 2Z5VA 2OVFA 4UBNA 3ZE8A 7MHTA 1Y1TA 3NX4A 1E6LA 4RQAA 6Q21A 4CMEC 2WSBA 3F6CA 5DXAA 2XF8A 2C4WA 4FZRA 2C4UA 3TOCA 4CL8A 2O5RA 2WIDA 3FSGA 5D85A 4DHEA 1AV7A 4U7JA 4RHTA 2Z2XA 5F3DA 3JQ7B 5FWYA 5LZ4A 1Q7CA 5E95A 2BGNA 3QYJA 1YZUA 2ZRMA 2L69A 4MVXA 3CUTA 2NXNA 4R1OA 2YINC 4RXTA 4Q7QA 2VBFA 1UQTA 3VQTA 2NUPA 1DRVA 1E58A 1PFYA 2JLVA 2R7MA 1V26A 4Z5XA 5BQ5A 5TDHA 1ID1A 3NONA 4PTLA 1XD2B 2D2FA 3D54D 1AF4A 1NPDA 5AHXA 3KB2A 1XZHA 4YCBA 2PFSA 4J8PA 2EJWA 3T5CA 4H4CA 2I1LA 3FGNA 3MPOA 3SXJA 2X0KA 4BGUA 6PFKA 1M1NB 1Z7GA 3RAFC 1B23P 4NP6A 5U4QA 3VAAA 2Q45A 1DMRA 1JG1A 1QKJA 1TZJA 2JAPA 2Q1SA 3AW9A 3PUJA 4FLMA 3H0CA 4AJKA 4EFKA 5K0CA 1ZA1A 3OJCA 2OGWA 4LGCA 4MPPA 4HN2A 3ENZA 2C5HA 3UAGA 4Q9DA 1OIWA 1LZKA 2YWXA 1MXFA 4CMHA 5C8YF 5HE8A 3L77A 2BFOA 2XMSA 5EOVA 3B7GA 5CLQA 3GQBA 3QQ5A 1C4KA 3KOYA 2IV2X 2W0SA 1B1AA 1YL7A 3DMYA 5CNMA 4E33A 1U3CA 1FVFA 3E2PA 1OTYA 3KXIA 1I5EA 4J49A 5FLKA 4X1YB 2PQ0A 1EVIA 2FE1A 3P9RA 3MT8A 1Y8ZA 3GLIB 3K2IA 1R0YA 1KHHA 1PW5A 2P3SA 2VHVA 5EVCA 2JJ8A 3KZVA 9LDBA 1J9EA 3Q9UA 4QPN<