3ZV4A

Crystal structure of cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (bphb) from pandoraea pnomenusa strain b-356 in apo form at 1.8 angstrom
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
275
structure length
265
Chain Sequence
MKLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAHGGNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTALADLPEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAPHVRVNGVAPGGMNTRGPSSLGVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGDSLPATGALLNYDGGMGVRGFLTAAGGADLPEKLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical Studies and Ligand-Bound Structures of Biphenyl Dehydrogenase from Pandoraea Pnomenusa Strain B-356 Reveal a Basis for Broad Specificity of the Enzyme.
pubmed doi rcsb
source organism Pandoraea pnomenusa
molecule tags Oxidoreductase
molecule keywords CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
total genus 94
structure length 265
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.3.1.56: Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase.
pdb deposition date 2011-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zv4A00
4BKOA 1EK5A 2D59A 1HDCA 1UDBA 1K2WA 5TT1A 3VKUA 3A06A 4GVLA 4HFRA 5KJEA 1FF9A 4CMBA 2Y1GA 3DZHA 3ZGYA 4XYEA 3S55A 1E6EA 1NR7A 4HWKA 2CFCA 3FD8A 1YRLA 2G82A 3C3XA 2O3UA 3E5MA 3AWDA 2Q2WA 3CINA 3BMCA 1ADBA 2JL1A 5H83A 2G1UA 1GADO 1Y9AA 3WXBA 2W90A 4N5LA 3CMCO 3SVTA 3TZQA 1TLTA 3DBRA 3EUWA 3KSZO 5IN4A 3JD2A 4XDYA 1I5RA 3P7MA 3GRKA 2P5UA 3OJLA 5THKA 4JIGA 4EJMA 4C4OA 4ALMA 1S7CA 1Z6ZA 1D1TA 2YQ4A 4E32A 4Y6RA 3WICA 1K0UA 1P1FA 2HO5A 2XXJA 1RKXA 1CQJA 5G0VA 4R41A 5AXCA 4YDRA 3PGJA 4J7UA 1EBFA 3MJTA 3AM5A 5TQVA 3PTZA 4XR9A 2HU2A 1I8TA 4I8XA 3BMOA 5CDYA 1H0KA 4YJGA 4ZQEA 3PI7A 5JAIA 1WZEA 3TL3A 1OMOA 1ZNQO 2NSDA 3KUXA 3FSRA 1ULUA 1NQTA 1UZMA 2HUNA 2PZKA 3OA2A 4W9NC 2F00A 4WLOA 5CG1A 4PVDA 3DAGA 4R9RA 4E2XA 5L51A 1ENPA 1BRMA 3OQ6A 3MCVA 1NX6A 2EJVA 3OJEA 2YW9A 1LJ8A 1F8GA 1X0VA 3GHYA 3OP4A 2Y1FA 2HK9A 4RQUA 4E2ZA 1QKIA 4FSHA 4ZJUA 2HRZA 3FTPA 5DP1A 4MIYA 1NYTA 3NKLA 3AW9A 3ZHBA 4PLFA 3VKVA 4OOEA 2QYSA 2QZ9A 5F21A 3DBVO 1NPYA 1VRWA 3JYOA 1V3VA 3BMCB 4HBGA 2PNFA 1KETA 1VKNA 2HQ1A 3WQRA 5EQFA 5C5IA 1YJ8A 3F6YA 3HE3A 3DBRB 5COBA 4J1TA 2X0JA 3G17A 1VJ1A 3HDYA 1T2CA 2GDZA 2QRKA 3HJAA 3KEQA 3KYBA 4R4JA 1LDYA 2FR0A 4YT2A 2E48A 3A4VA 4BO7A 1JQBA 4MJLA 4KWHA 1PGQA 3LT4A 4DYVA 3I23A 1SB8A 5JNLA 2C82A 1C1XB 1RWBA 2EGGA 1H6CA 3QVSA 1SNYA 1PJ4A 4BO2A 4C7JA 4TVOA 1DRVA 5ITWA 2VT2A 1LEHA 1ZBQA 3AUTA 2BD0A 5DP2A 3MWDB 2EKPA 4W7HA 1OC2A 1VPDA 1NVTA 1R4NB 1V9LA 2BRUA 1GUYA 1V0JA 4AJOA 2O7QA 5ER9A 2VYVD 5I9LA 1QLJA 2X4GA 1OI7A 2JHGA 3ZDFA 3FWNA 1GCUA 3TOXA 3MTJA 4CM8A 5T57A 5F1PA 2R00C 5KVSA 2O3TA 1MX3A 3A1NA 3JQCA 2X5JO 4RL6A 2O3QA 5AXDA 3BMQA 1ORRA 4E21A 3UHAA 1BGVA 1GZ4A 2Q1UA 3LYLA 4J7CA 1RM5A 3UGKA 3B70A 3RC1A 2ZJ1A 1V3UA 2BI8A 3AY6A 1B8UA 1ZK1A 1XHLA 1DO8A 5I7VA 3LDHA 1ISFA 3NGXA 4FFNA 4JROA 3AFMA 4KQXA 4YWJA 1PJTA 5G0TA 3GGOA 3C8MA 5G4KB 3SC6A 2LDBA 1IYZA 1V3TA 2HLPA 4BNXA 2CSUA 3ZWPA 1P0CA 4J49A 4ZQHA 4BGIA 3I1JA 1SEPA 2GLXA 3I9KA 3OETA 4E2WA 2O3JA 3DFZA 1TB4A 2QIOA 3R6DA 3O4RA 1C3VA 4IIVA 1PZHA 3JQBC 4J9UE 4CV2A 4HFMA 3SJUA 3JYLA 3WGZA 2X6TA 4NBWA 5A9SA 1DIGA 4L73A 1Y7TA 4TSKA 4JNKA 5LDHA 2PKRA 3Q6IA 5CPBA 5C7OO 1BDBA 3RI3A 3JQEA 5CDGA 4GAEA 4FFMA 1B15A 2C59A 3WNVA 1I0ZA 2P4QA 4ZQGA 4AJPA 2NQ8A 1EDOA 2Q4BA 1JU9A 4E5KA 2PZLA 2VWGA 3PIIA 1H6DA 3KOUA 3U09A 1NR1A 3DOJA 1P0FA 4XDZA 1PS8A 4JGBA 1ULSA 3FF4A 3OBBA 2CDAA 2C0CA 1BMDA 3U62A 4P8RA 4QUKA 5IF3A 4OM8A 1XCBA 1OBFO 3NAQA 2BELA 3DOOA 4BO9A 4IMPA 3GEMA 3R3JA 3TZ6A 2DVMA 2Y66A 1GUZA 4QX6A 4LCJA 1HDYA 2VQ3A 1ONPA 5T64A 4CMKA 1E3JA 3TF5A 1R12A 4K9DA 4M87A 2NTNA 1UH5A 3VDQA 4L74A 3RBXA 4RORA 3RUDA 4IGFA 5DOZA 3QE3A 4M55A 4A7PA 4NG5A 5ES3A 5KJ1A 3RC9A 3FTNA 4PLCA 3L9XA 1UP6A 2X86A 4GKVA 5U1PA 3VPXA 3AUAA 4AJLA 5TC4A 5TSDA 3H5NA 3K9QO 4KQWA 4IPTA 4YRBA 3UUWA 1R4MA 3W8DA 2D4AA 4NJMA 4UVEA 3DONA 4LVUA 1RM0A 1JTVA 3VH2A 4A10A 3NJ8A 1I01A 5DT9A 5HS4A 4Q9NA 5GMOA 4FFRA 3EK2A 4TZKA 1F8FA 5AVOA 3U3XA 3DO5A 1TT7A 3E9NA 4I5GA 3WSVA 1ZK4A 2HK8A 3T7CA 1LUAA 4DQXA 1UZLA 4Q3NA 2D0IA 1JAYA 4CM1A 1IZ9A 4GX0A 3PYXA 5ENVA 5FI3A 5EESA 4PLWA 1YQGA 1E7MA 1RM4A 1SC6A 4Z0HO 3TDKA 4QFDA 2AE1A 1XU9A 2PFGA 4G5HA 3PHLA 1U2DA 2RBEA 4K6FA 3DL2A 4GX2A 2WE7A 3F5SA 2D5AA 3DZIA 2YYYA 4BNIA 4WOJA 1X15A 4GBJA 2X23A 3LLSA 4U6SA 1PJCA 4XD2A 3I6QA 3TFOA 5JC8A 3GEGA 1DIHA 1YO6A 3Q1LA 1GAEO 4IJKA 2CDBA 3K31A 3LC1O 4YJHA 4Z0PA 3ITDA 2W2LA 4CQLB 1MG5A 3BA1A 3K30A 4NFYA 3GFGA 3UFXA 4NFSA 3TPCA 2AG8A 1I24A 1I3KA 4DC1A 1YDWA 1ADCA 4PRKA 4W6ZA 5EIOA 3NTQA 2F1KA 4OO3A 1L7DA 2DUWA 3SLKA 5JO9A 4A5OA 1PR3A 3DMTC 3AI2A 1LLUA 1LLCA 1NQ5A 3G1TA 3ZNNA 1J49A 2BF7A 2ZCVA 4CL3A 3RU7A 1SMKA 4TROA 4URFA 4BKPA 1LRKA 3TQHA 3AU8A 2NLOA 1HDZA 1NWHA 1YBAA 3I9JA 1NFQA 4A03A 2YHIB 3IQDB 5I8ZA 1IL0A 4AJ2A 3JQFA 4N5NA 5CHEA 5AYVA 1A9ZA 1E5LA 1BDMA 1GYQA 1VSUA 5KWEA 4XWYA 4CV3A 2QX7A 2Y1DA 4Y98A 2AQIA 4N7RA 3WYBA 5C7IO 2YFHA 2Y67A 4IM7A 4U5QA 3ZHZA 4XX0A 2NVUA 1N8KA 3OIFA 1OC4A 3ONDA 1Y9EA 2WJPA 3GDFA 4JBHA 1EFLA 2PZMA 1U5CA 4PLGA 3ZWOA 3HQ4O 1P44A 3GHHA 4WLNA 1G1AA 1EBUA 1Q0LA 4FC6A 2GUGA 2GYYA 4GH5A 3IMFA 1Q7GA 4Z9XA 2PH5A 7MDHA 3GF4A 4IZIA 4ROSA 4BNMA 4JLWA 1KVQA 3DTYA 1OAAA 3E18A 2Y93A 1GPJA 3ZWNA 3SJ7A 2DKNA 4LSWA 4UAGA 5FWNA 3WYCA 1MGOA 3VTFA 1ZO8A 3QWHA 1AHHA 1O89A 3WQSB 1UXGA 4BMVA 2EERA 1IULA 4EUFA 1PQWA 3OFSA 4NJOA 1E6UA 1D1SA 3S2EA 4QEDA 3LU1A 4WLUA 4RF4A 1ZSNA 3UAGA 4B8WA 3B1KA 2E82A 2VCYA 1KC3A 4LISA 4R3NA 3JQAA 4BNVA 1YKFA 3OSUA 3E8XA 4I9UA 5JMWA 2EG9A 1CETA 5L7YA 4DREA 1NWCA 3RFXA 1NXQA 1TVEA 1P77A 2OORA 3ZI0A 4C7KA 4E5YA 3QRWA 4RV9A 1PZFA 5DNAA 1YVEI 2IEBA 4CPDA 4RPGA 1L1FA 3VH4A 2GPTA 3LT2A 3KYCB 3ORFA 1PWZA 4NJMB 4LSMA 4D3FA 4GWKA 4DTIA 2E37A 2ILTA 2XAAA 3JQGB 1JDJA 1Q1NA 3RFTA 4XGKA 1JW9B 1WXDA 2C20A 2WYVA 4MKXA 3NDRA 2A4KA 3LF1A 3ZNOA 1ZIDA 3QWIA 4RPLA 3CIFA 2PTGA 4UUPA 3GRPA 5ER6A 5I7FA 1A72A 1PJ2A 4LW8A 5DZSA 3JQDA 3VPSA 3KETA 4MPDA 1PWXA 1E3WB 3WTBA 1E7QA 1D4FA 1E7WA 3PFFA 2FY8A 2OBNA 1G6KA 3JQ7B 3STHA 1S6YA 2G5CA 2GZ3A 1VL0A 1E3IA 2D1YA 2X9VA 1MP0A 3KSDO 3WLEA 4DIFA 1P3DA 1BSVA 1LSUA 1X1EA 1AE1A 4CMAA 4FPXA 3PEFA 1ZKMA 4ND4A 1D7OA 3K73O 1C0KA 4QSMA 4F45A 3QSGA 3RBVA 2IZ1A 4M49A 3WNQA 5MGBA 3SLGA 1M6HA 2RCYA 4PZCA 2ZTVA 4OKNA 4OSPA 1I32A 2GD1O 2WWRA 3DTTA 4CMEA 4AJ4A 1ZVMA 3DBLA 1JWBB 4P4GA 4HNGA 4DVJA 2Y05A 4MVJH 3VH3A 3DAFA 1UAGA 4U7WA 4Y6SA 4J2OA 4ND3A 5F1KA 4W7IA 4CMIB 1ZXLA 2B37A 3PWZA 3BMOB 1ISIA 2HKIA 4JX8A 1ONNA 1NHWA 2P91A 4DMLA 1LDMA 4BO1A 4W4TA 1E7YA 3LVFO 3RJ5A 3MJEA 1GPDG 3FCOA 3OICA 4KUEA 4GKBA 3UKOA 4BNLA 2IZZA 3P5SA 4CJXA 5EJ2A 3CEAA 1T1SA 1E3SA 4R51A 3I83A 3GUCA 1NP3A 4IUYA 1HZJA 4YR9A 4EGFA 1U3VA 1N9GB 3FR8A 3IP1A 1OFGA 2W2LD 4II2A 2HJSA 5HS6A 3HUDA 2FOIA 3GG9A 3GVHA 4IGEA 3VOSA 4CR6A 2YQ5A 2GSDA 2IZ0A 4RLSA 2AEJA 4P38A 5JAQA 5H81A 3V1TC 5A3JA 2EKLA 3L4BA 4FJ2A 3UF0A 3DZKA 2VUSA 3ZWWA 2JHFA 1B8PA 3HN2A 4GMGA 4RVUA 2PKQP 3H4VA 2DM6A 2HAEA 3LC7O 3O03A 4IIUA 4A2CA 1U1IA 1KY4A 4OXYA 4MP8A 3PQEA 4GLOA 4YJFB 1N1EA 1LX6A 4J43A 4S3MA 4CLRB 5EN4A 3VHRA 2OHXA 3RKUA 1BW9B 4BL5A 1DSSG 3F4BA 5EMHA 4CLDA 4MP3A 4PFJA 5IXSA 3DZBA 1HDXA 5KIAA 1R4NA 4CMIA 1NASA 3WS7A 1DDOA 4L75A 5AQ1A 1PIWA 4BNJA 2EW2A 4M8SA 2DPHA 4Z9FA 1PJQA 3PZBA 2ZTUA 1Q0QA 2FP4A 5B4TA 2R2GA 1O95A 1I2ZA 4RJTA 5KJCA 1R66A 3ZU3A 3PPIA 1I36A 4BGEA 5HRUA 2GERA 1P1JA 4CMJA 2Q1SA 3UCXA 1W4ZA 2X5OA 4HADA 2H1SA 4R3WA 5BNIA 4LVCA 1CF2O 1QP8A 3F1LA 3WOHA 5TLSA 2WTBA 3SBOA 4YCAA 5JY1A 2Z95A 3WGIA 1H93A 4JBIA 4IBOA 2NV6A 1N2SA 2QRJA 4JBGA 4CM4A 5TGDA 4YVFA 3LSYA 2I76A 1ZEMA 3INRA 2RAFA 4DPKA 4HKTA 4LRSB 3OJOA 3C85A 3HNPA 4BQPA 4WPGA 4D79A 1AN9A 1LXCA 2H5LA 1GZ3A 3KTDA 1DEHA 1HTBA 2V6BA 1KBZA 4BVAA 2V6FA 3BMNB 3DDNA 4OQYA 4XYBA 1RYEA 5DCUA 2BLLA 4FFLA 1KVRA 4Q3AA 5LDGA 3DOCA 5JS6A 3LC2O 2X58A 4UVHA 1PL6A 1P9LA 4YJFA 5U9CA 1LQTA 3JQAD 3QWAA 1QLHA 5FEUA 1Z45A 3E9MA 4MVJG 4ALKA 2HSDA 1M67A 2NTVA 4RVFA 3VAZA 2UYYA 1TXGA 3RAJA 2OBYA 1PJLA 4J4TA 3W8FA 4BV9A 4R5HA 5GZ3A 1R6DA 3ICCA 4IDCA 4EW6A 3GMDA 5A5EA 2IDZA 3LK7A 4MOWA 1XGKA 3AY3A 3QY9A 3O8QB 4OIMA 1I33A 3ETGA 4PLHA 2JAHA 2R00A 3ROPA 5B37A 4JP2A 3QV1A 2WYWA 2IRWA 4YT4A 4TQGA 3DHEA 1U4OA 3FPCA 2AXQA 4PLVA 1U9JA 2B4TO 1YDEA 3T4XA 4AL4A 3ROKA 5G0SA 3GVIA 1ZSYA 1VKOA 2W2KB 1SB9A 4WKGA 3ZWYA 4AJJA 1EVJA 1Y8QB 2AQ8A 3L6OO 1I10A 4JN6B 4MVJI 4CM4B 4CMEC 3LT1A 4WK6A 1Y5MA 4B8ZA 2GO1A 4B4OA 3CH6A 3QA9A 4BUCA 3CSDA 3K8ZA 1R37A 2AEFA 4A27A 5TT0A 4UUMA 3AUUA 4KUGA 3JQBA 4NK4A 4FGSA 4ALIA 3VZRA 1KVTA 3V2UA 1ZK2A 4IMRA 3C7CB 4S1VA 2WD7B 1A7AA 4WCFB 1DHRA 1PGNA 4RZIA 4Z3DA 3UCFA 3INGA 1K6XA 3FNFA 3DZGA 5BQFA 3ENKA 4RPHA 5KTKA 4BQRA 2DU8A 4NNJA 3HZZA 4GGPA 1YOVB 3L6DA 4FW8A 3LLVA 3G49A 4WEOA 1KYQA 4HNHA 1KC1A 2BGMA 1Z74A 4ND5A 4BNYA 3DQPA 4NMHA 5G4KA 3C1AA 3VVCA 4D46A 4R54A 3OIDA 4PG8A 1SOWA 4YAKA 2JFHA 2HK7A 3R0IA 1P33A 3VZSA 3OIGA 1YJQA 2VYNA 1G0OA 3U4CA 3PIDA 4OH1A 1T2DA 4G81A 4EBFA 1BG6A 3D4OA 3FNEA 5A05A 3JSAA 3WTCA 4FOSA 2Q50A 4HXYA 1YXMA 3HG7A 4MVJD 1BVRA 3PLRA 4Q39A 3KB6A 4YAGA 4JJGA 1HT0A 3AU9A 3QP9A 1D3AA 2PD4A 1QYCA 4UVDA 1UXJA 3UXYA 1EFKA 2X22A 4ZRNA 4RPJA 5JPIA 3RUFA 2UAGA 3BHMA 4H7PA 1LSOA 3WFIA 1O0SA 4CM7A 1BHSA 1A7KA 3AM4A 2I6TA 4HFNA 1OOEA 1ONOA 1YONA 4CQLA 2ZYAA 5IDWA 4QECA 4OHUA 4BMSA 1O8CA 1EK6A 2FPGA 1MC4A 3JQ9C 1QSGA 4CM9D 4IJWA 1M75A 4WCFA 1HE3A 3KM0A 3DZJA 1QMGA 1ADFA 2P68A 4YQZA 5DBIA 3WGGA 1QV7A 2A35A 4BB6A 4Z3KA 3I52A 2J6IA 4YAEA 3GGPA 1WAMA 2AE2A 3GNTA 3K2EA 4HV4A 3GMSA 1FMCA 3QVTA 4ILKA 4RVDA 3ZH2A 4IJVA 3ANNA 4DRYA 3BMNA 2PD3A 1RJWA 1JAXA 2ZQZA 2VRBA 5EL0A 4FS3A 3D5TA 2EEZA 2IE0A 4GX1A 1X0XA 1GZ6A 4AJIA 1JVBA 4BNGA 2GGSA 3KSUA 1UDCA 1BXGA 3LQFA 5KJ6A 3KO8A 4XQEA 4CUJA 4DPMA 5CFZA 1PJBA 3OQ1A 3P19A 1MXFA 3GN1A 2O2YA 2BFOA 4XR4A 3WG9A 5DBGA 4TKMA 1X7HA 3D0OA 3S8MA 3DB2A 3RBZA 1ZJZA 3HADA 4NQZA 3H7AA 1DFGA 2Y99A 3N58A 1DJQA 3D7LA 3BTVA 4PLPA 3EMKA 2B4QA 3L0DA 4FFPA 5ADHA 4CM5A 3GFBA 2GN8A 3E03A 5IZCC 2W2KA 5L4LA 9LDBA 1U3WA 3H3JA 1UAYA 4L4SA 1NHGA 1JLLA 4KMSA 1PGPA 4HX5A 1YS4A 3RKRA 1LDGA 2D2IA 3PQDA 3TZCA 4M86A 4XB2A 3NGLA 4CR8A 3D1LA 3ZWCA 1TA4A 3IUSA 1VM6A 3DBHA 3WBFA 3GNQA 3FRJA 2CVOA 1UP7A 4K26A 4BO0A 2DAPA 4NBRA 2CVQA 4PLTA 1LA2A 1B26A 1XSEA 1J0XO 1KEVA 4CQMB 4RF5A 1Q0HA 4ZD6A 4ZQBA 2UV8A 1BXGB 1U4SA 3GOHA 3IC5A 4MVJP 4IDFA 3F3SA 3RSHA 4BNZA 1WVGA 2EHDA 4PG7A 4OL9A 2GRAA 5TF4A 2UDPA 5JAMA 2YHIA 1VJ0A 2JAPA 1YL7A 4MIEA 1CRWG 2NACA 4JCOA 3WYEA 1EVIA 1GUFA 3NT2A 3PYLA 1O9BA 2PGDA 1I2BA 1NQOA 1YB5A 1VL6A 3RD5A 3DFUA 5L4SA 2B5VA 4OKIA 1W0CA 1B16A 3WGYA 3NUGA 4L4RA 3ON5A 2NVUB 2I3AA 2Q46A 3EZLA 3GY0A 2FWMX 4BO5A 2O48X 4XQGA 5C7LO 3KLMX 3S2FA 1U8XX 1GQQA 1ZZEA 4ESOA 5JDCA 1IE3A 4DYDA 5HWSA 4DBZA 2H9IA 4YRDA 2FMUA 5CAEA 4CMGA 3OECA 1C0IA 3WIDA 3JQ7A 4OOFA 4AJNA 5JYDA 1LLDA 3G0OA 3BAZA 3WBBA 2Q2VA 1XQ1A 3FPLA 5T67A 2AA3A 3WWZA 2WEKA 1XEAA 1TT5A 3AOEA 2J5RA 3GN2A 4YAIA 2NU9A 3HDJA 4BNKA 1Y81A 3FI9A 3ZWBA 2CZCA 4E5NA 4WCDA 3MWEB 1XA0A 4R9SA 1F0YA 2EGHA 1PEDA 1C1DA 1AGNA 2YV2A 3BTUA 2X9NA 3ST7A 4DIOA 3ADOA 3KHUA 1WZIA 4D0SA 1KEWA 4U8GA 3RVDA 3AM3A 4BNFA 1Q2XA 3PJFA 1TI7A 1T24A 1YL5A 2FZEA 1MFPA 2O7SA 4E12A 4XIJA 2J5QA 4FIZA 3R1IA 5TRTA 3ZU5A 4KDEA 1U28A 3KYCA 4WNCA 4CQMD 1FDTA 4R1UA 1U5AA 2UVDA 3H9UA 3EDMA 4J1NA 5FF9A 1N9GA 1E7SA 2DTDA 5U4QA 4FN4A 1HSZA 4F6CA 1K5HA 3ANMA 1PZGA 4E5PA 3VPFA 5FFFA 3WB9A 3ZV6A 3K2BA 5CDTA 4K6CA 3EYWA 5JC1A 4A0SA 3BIOA 1X13A 4ALJA 4D45A 3PHIA 4DGSA 4XIYA 3PHJA 1SAYA 4E31A 3Q2KA 1NTOA 5IDXA 3GNSA 1DAPA 4E2YA 5DBFA 4FB5A 4OGWA 2ZKLA 1LU9A 3GC6A 4EITA 2RH8A 3H9EO 2WSBA 4GGOA 3ZV3A 1WPQA 2C5EA 2EV9A 1TT5B 5JLAA 5L7TA 4MVJE 2EW8A 2TMGA 5TX7A 4GMFA 4G65A 3IIEA 1E3WA 2X0RA 1BW9A 4MKRA 4KOAA 4R01A 4R1NA 3IAHA 1VE9A 1V35A 1WLYA 4CLRA 1GV0A 5B4UA 2YFQA 5A9SB 1LDNA 2VRCD 3GA0A 2W8ZA 1T2EA 5L95A 1DJNA 2GZ1A 1ZK0A 4HUJA 4NK5A 4YEDA 4Y9DA 4L9RA 4LGVA 3RUIA 4GSLA 4BNHA 4FCCA 3GQVA 4O59O 1YBMA 3MJSA 1NVGA 2P5YA 1VL8A 5G0UA 3WDSA 5K9ZA 1AHIA 1SBYA 2I3GA 3NRCA 4J0FA 3ZV5A 5KVVA 3FBGA 1VC2A 2CY0A 3DMTA 4XB1A 4RDHA 1E92A 1Z82A 4M1QA 4B4WA 4P4NA 3ZHYA 4E30A 1P1RA 1R15A 5B12A 3D5QA 2VRCA 4IZHA 3N7UA 4GQAA 4YXFA 3JD0A 3TL2A 4B7CA 3ZCXA 3GT0A 3FR7A 5T6BA 4NH4A 3ZWAA 2IODA 3G3EA 1MC5A 4TZTA 4BKUA 3WX0A 1U2GA 1XQ6A 3W8EA 2I67A 2NM0A 4I5DA 5I9MA 3FWZA 4X54A 1PS9A 1O5IA 1GL3A 1ENOA 4L0QA 3W4IA 4YQYA 5KKCA 2BI7A 1HDOA 1CWUA 2X0NA 3WJAA 3ULKA 3BTSA 3GZ4A 3KVOA 4MKZA 2VWPA 5BNFA 1HSOA 1UXHA 2O23A 1JN0A 3B1FA 3FN4A 3OH8A 4RF3A 3Q0EA 4BMNA 5BSFA 5MDHA 4WLVA 2EKQA 5KJFA 2G0TA 1F14A 5IZCA 2VYVA 3W4JA 4ZICA 4WNIA 2Y68A 1PX0A 4JJFA 2OFPA 3C7AA 3PFWO 3LF2A 2GASA 1B3RA 2V7PA 1U3UA 2RHRA 5JFOA 3E6AA 4OYRA 2AEMA 4Z9YA 3IS3A 3SEFA 2CF5A 4DLLA 2WM3A 3OA0A 1CJCA 3M2PA 1ZMOA 4FDAA 2JFFA 5JXWA 4PGFA 1K89A 3P2OA 1ZJYA 5CPFA 3H5AA 4MIOA 4II3A 4WECA 4IY1A 2VTEA 3PWSA 3TRIA 4FC7A 3M1LA 1Y8QA 1CEQA 1ZCJA 1JVSA 4JXKA 1SEVA 4Y8VA 3ICPA 2CF6A 1QXSA 1A5ZA 2I65A 3I9NA 3RJ9A 1X14A 4ITUA 4CM3A 1UDAA 1AUPA 1IPFA 1SCUA 4YBZA 4CMCA 4WE3A 4IS2A 4E13A 3V1YA 4QQRA 2X8LA 1Y5RA 4BNTA 3FBTA 2B36A 2C07A 4RZHA 5A04A 1ZEJA 2VHWA 5LCXA 4IXWA 4J16A 5DOVA 2OO5A 1A9YA 3ASUA 5COQA 4E5MA 4CLOA 3GDOA 3DR3A 3U4IA 4CUZA 3RIHA 2Z5LA 1GEGA 2YV3A 1HEUA 3UCEA 4ZGWA 2DBZA 1DIBA 3DEYX 3BHIA 1PL7A 2C29D 4KP7A 1GYRA 2DTXA 3OQBA 2Q1WA 4XYLA 1R0KA 1LQUA 5BSGA 1XR3A 2W98A 4R16A 4W82A 5HM8A 4CMHA 2B69A 1MV8A 1DFHA 1HZZA 2QG4A 1LDEA 5IJZA 3COSA 2IEDA 3E82A 1DC6A 4NHEA 3RU9A 3U4HA 2HRBA 5A4DA 1H5QA 2X1HA 3Q9NA 1DBVO 4E0BA 2GN4A 3TFQA 4XZ3A 1DIRA 5L40A 1J4AA 3OJ0A 5BT9A 4GVXA 3RUAA 5ILOA 4OSOA 1KEUA 4IXTA 1GD1O 1GYPA 4EJ6A 5CEJA 4I9HA 2AQHA 5JCJD 2NWQA 3NDJA 1LBEA 2VWHA 2NTJA 4Z0TA 4N5MA 4WLFA 4CLEA 4DPLA 4KDFA 3SXPA 3K92A 3W4KA 2OMEA 3I9OA 3H9QA 2EWMA 3W6ZA 4UULA 3I9MA 2QQ5A 1EEHA 3RC7A 3ROQA 1O6ZA 3JCZA 4ZQFA 2C2XA 2HJRA 4GPD1 4MDHA 3WMWA 1T26A 4ZU3A 4QT0A 4IINA 6ADHA 2YV1A 4YJGB 4A26A 3QVXA 4AFNA 4WJZA 1YB1A 1F12A 1P31A 2B35A 3QJ5A 1XU7A 4TVBA 1IHYA 2CUKA 3AJRA 1ZXBA 4FJ1A 5KVQA 2I99A 4PRLA 5BSHA 2NADA 5JCJA 3BXXA 3UVEA 5I9NA 4ID9A 3Q3CA 2V65A 3ONFA 3M1AA 3WWYA 4R1SA 1HYGA 4UEJA 1PQUA 2PGJA 3L9WA 3QWBA 5A06A 5KNLA 3PHHA 3PZRA 3GK3A 1J6UA 2I9PA 1FDVA 4IQ0A 2Y1CA 4K1LA 1M76A 4DLBA 4DLAA 2PKQO 3CE6A 3WIEA 1GQYA 4JP3A 1ZW1A 3HSKA 4XQ9A 5HA5A 1GY8A 3TSCA 1T4DA 4Y67A 4BOYA 5JO0A 4EEXA 2VHVA 2ET6A 2OZPA 2A94A 1WMBA 4BO8A 5EERA 2VZ9A 4BO6A 4DMMA 4G2NA 4PG5A 1HXHA 4NIMA 4LN1A 1E77A 2C7VA 4E33A 3DXFA 4QO8A 1GCOA 4Q3CA 4BB5A 1DXYA 2OXIA 3UW3A 1FDWA 7ADHA 2GNAA 5JMPA 2J8ZA 3E5RA 4I9NA 3WFJA 2HMVA 4D7AA 3NV9A 5AOVA 3RUEA 4DIBA 3WSWA 1CYDA 3JTMA 3A14A 1V6AA 3DC2A 2E49A 4NPCA 3MOGA 5JBIA 4LMPA 3NDIA 5CDSA 1KVSA 3F46A 3QQPA 3QIVA 4N18A 4XJSA 4O63O 2VZ8A 4WASA 3GVCA 1JA9A 2WDZA 2Q99A 2BH9A 4JQCA 2GF2A 2ZIZA 1I3NA 4PG6A 4DL9A 1ID1A 4CM8B 3ZHXA 2HMSA 5JDIA 4CLXA 3RUHA 2XOXA 2D8AA 3B1JA 4YAJA 2BMAA 2ZJ0A 1PJ3A 3GLQA 1FDUA 1SOVA 5HTOA 5IXYA 5ICMA 3TNLA 2X0IA 4I08A 2JFGA 4J9VA 2IXAA 5ILGA 1WDMA 4XJTA 4D3DA 1H94A 1ZH8A 4UEOA 4J4BA 4FBGA 3UN1A 3QWFA 4R68A 4J4HA 3WQQA 4UEKA 2VNSA 4PLYA 5L3ZA 1M2WA 3C1OA 3G1UA 5THQA 1UXKA 3ITKA 1PU2A 2OP0A 5A02A 5JY6A 4AG3A 1GEEA 3H2ZA 1T25A 1EQUA 1Y8RB 4MVJM 2V6GA 2C7GA 4AICA 1RPNA 4RVHA 2BFPA 4D44A 5KVCA 4INAA 1Z7BA 3M6IA 4FD3A 4W9NA 4NU5A 2OOSA 2DC1A 2HCTA 4O1MA 1RYDA 2J5KA 4NDNE 3VZPA 4WCFC 1E0DA 1YQXA 3AFNA 3HHPA 2RHCA 1FDSA 3NYWA 4ZA2A 1Y6JA 4BV8A 4EUHA 5L45A 4W99A 3F5QA 3I6IA 1W6UA 3X2FA 3AOGA 4EI2A 2JD0A 2AQKA 1ISGA 1ML3A 2PGLA 2DFVA 2ZB4A 1QRRA 1J5PA 1HLDA 1DLJA 1A4IA 1MUUA 2Y0CA 1PJSA 4TWRA 2JD1A 5TIIA 1TEHA 3DZFA 1UZNA 3ROMA 1UUFA 2FZWA 3EZYA 3KEOA 4J90A 4PZDA 3K96A 3RWBA 4TMFA 4IQ8A 2GR9A 1BVUA 5BNTA 2YDXA 2VN8A 4NFHA 5TJ9A 3E1KA 1YH3A 1PTJA 1WDKA 4WGGA 1Q7CA 1YGYA 1X1TA 1DAOA 1X7DA 3RFVA 4I5FA 3AY7A 1IUKA 5ICSA 4Q3EA 1QYDA 2VZ0A 5T5QA 3U5TA 3JD1A 3JYQA 4AJHA 5A3VA 4UUNA 4XYMA 3GZNA 3KXDA 3KYDB 4BNUA 1DRUA 2PH3A 5CG2A 3GVPA 3JYNA 1I2CA 4MVJF 3F47A 1ARZA 4UUOA 3VH1A 3H2SA 1DC3A 4AJ1A 4FQ8A 2PV7A 1HWYA 5HBRA 4BGUA 2Q49A 1U7TA 4EDFA 4NR0A 5JYEA 2WMDA 1VI2A 4IS3A 4ZVVA 4RVSA 4DQVA 3MTGA 4P22A 3MZ0A 3G79A 3W6UA 4CLHA 2YJZA 2NU8A 4ALLA 1BWSA 4WUVA 4AJKA 2DPGA 3LZ6A 3H5RA 5FYDA 1O94A 1MB4A 4YT8A 1E1LA 1FXSA 5GY7A 4HY3A 4RDIA 3V2GA 4RF2A 3VPHA 5DF1A 2VOEA 2OL4A 4GI2A 1NPDA 3JYPA 1DHTA 1UJMA 3KLPX 3IOYA 3NEPX 1GFSA 3KZVA 4OJNA 5L53A 4M89A 2WD8A 5CEEA 4MO2A 1ADGA 4YRAA 4JK3A 4J2HA 2DQ4A 3L07A 3JV7A 3H9JA 3TJRA 4GSKA 4NBTA 4J6FA 3AI3A 5I8WA 4YTEA 3E9QA 1XG5A 1BXKA 5F5NA 4OQZA 2J3IA 4J1SA 1F17A 2Z1NA 4RLHA 2D5CA 2QYTA 5JSFA 3ADPA 3PJGA 3F1KA 4Y6PA 5I7EA 4BHTA 2I5PO 1B0AA 3TZKA 1OZAA 3JQAB 5B1YA 1PGJA 2NU7A 1K6IA 5A03A 1QYVA 2UUPA 5KOIA 3GG2A 4HFJA 4BIIA 4E3ZA 1NQAO 1ENZA 5B4VA 1LC3A 2D3TA 5K6AA 1F06A 4KTVE 2O4UX 1P1IA 3U0BA 1DIAA 1DB3A 2FPIA 2JJYA 1ZSVA 4GWGA 1U7HA 1G0NA 4WLEA 2CNBA 4U0JA 2BFMA 2VHYA 5G2OA 1VLLA 5C3MA 2CDCA 1DOHA 3ETEA 4PVCA 4Q3DA 2JKVA 1NAIA 4U0KA 3I3OA 3JQ8B 2CVZA 4M54A 5LC1A 1WMAA 4CV1A 2FR1A 5CP8A 3AOEC 2J3KA 2OP1A 4MINA 5C37A 4P4LA 2DBQA 2RH4A 1AXGA 4DXHA 1E3EA 1LSJA 2VNAA 1N5DA 3H65A 5DDIP 4WOKA 3OEYA 1R0SA 1WNTA 2R6JA 4F3YA 4B7XA 1ENYA 5IDYA 1MG0A 1NAHA 3Q11A 3ZW8A 1E6WA 1EUCA 4FJ0A 2IXBA 3PGXA 1EQ2A 3QW2A 1M66A 3FHLA 5F5LA 2VHXA 3SX2A 3HFGA 2Y0EA 4EZBA 3EVNA 1SPXA 2QZZA 3ZNPA 1YOVA 1WWKA 3Q2IA 3GVXA 1EVYA 1WP4A 4CM9A 1A27A 2ZQYA 3S2GA 4RO0A 4EUEA 3MJVA 2CD9A 4PG4A 5L4NA 3I4CA 3D3WB 2VWQA 4CODB 1PL8A 2OUIA 2RIRA 3CZMA 5L9AA 1I3MA 3D4NA 4J91A 4B3IA 4LRTB 5BR7A 1IB6A 1IHXA 2HMWA 3L6EA 1QV6A 2JCYA 1HLPA 4XA8A 2Q3EA 4AJEA 2O3SA 4DBVO 3PRJA 1A71A 1C1XA 1KY5A 1NFFA 3EHEA 3DHYA 3GZNB 3KYDA 3VZQA 3P2YA 3ZNQA 3ETDA 5KCZA 1T1RA 1YE3A 4PIVA 2PWZA 1EZ4A 3JD4A 2QHXA 3O38A 4CUKA 3NX4A 1HRDA 4B7UA 1PR9A 1DPGA 1Z75A 2NQTA 2DLDA 1V8BA 5IAAA 1HE5A 3K6JA 2O50A 4ND1A 1IOLA 3EGOA 1KVUA 3IJRA 3JQGA 3KV3O 3QHAA 4O0LA 3ZWVA 3OHSX 4O5OA 4CLOB 2VOJA 4OXKA 3RUCA 3PP8A 3BMQB 1U8FO 1PQPA 5TJHA 3L4SO 3IKVA 2IYPA 3RCBA 4L4XA 1B7GO 3CKYA 2DTEA 3U49A 5I7SA 1QYWA 2LDXA 4I5EA 4I1IA 2B5WA 2FRDA 1MLDA 2B0JA 3OJFA 1Z7EA 3I4FA 2EF1A 3I5MA 4CM6A 2ZYDA 3IDSA 2Q2QA 2Q1TA 4OXNA 3ZWXA 2ZCUA 3L77A 3BHJA 1E3LA 4LCEA 4B4VA 3PXXA 4RVGA 1GU7A 2JCVA 4XQCA 4XYGA 2AMFA 4OMUA 3MEQA 3H8VA 1ISHA 1UP4A 1XKQA 1Z73A 2I66A 2P9GA 4TRNA 3PJDA 5IG2A 3BTOA 5COAA 3RROA 1LTHR 1ZFNA 5ENDA 1K3TA 2YUTA 2AW5A 3NTRA 3OEWA 2FSVA 8ADHA 2PZJA 1B14A 1KS9A 3WR5A 1BXZA 2WYUA 4DQUA 5J23A 4O6VA 2FR8A 4UREA 1QG6A 4QO7A 3EY4A 5K0ZA 3VVBA 1RM3A 1U3TA 2NNLD 1HETA 4F6LA 1C0PA 1NNUA 3C7DB 2XXBA 3RASA 3TWOA 2G17A 3AK4A 3INTA 5JAZA 3GEDA 1EUZA 1E1KA 3VC7A 1EVZA 1WDLA 2EIHA 2Y1OA 4LK3A 3NJ4A 2GN9A 2ZTLA 1BTOA 1P45A 2XPCA 3A28A 3O26A 3CTMA 1N92A 2O3RA 4XGIA 3JQ8A 4XRGA 5EQDA 5FI5A 4BO4A 1T4BA 1XDWA 8LDHA 5K6AC 1LRLA 2P9CA 1UXIA 1X7GA 2FN7A 4E6PA 5EPOA 5EINA 3H6KA 1K6JA 3CUKA 4CV0A 2ZYGA 4R1TA 3SC4A 3UH1A 3ZV4A 2A92A 1T2FA 3HN7A 3PYMA 2ZB3A 3NTOA 3OMLA 4J0EA 4TRMA 3CZRA 1PS0A 1JKFA 2FHSA 3JQFC 1LI4A 4FR5A 1NVMB 3V1UA 3IKTA 4H3VA 3A9WA 1GQ2A 5A5FA 4RQTA 2QRLA 4ALNA 4XKJA 3ZZNA 4B3HA 1DC4A 4GX5A 2QW8A 3D3WA 1LDBA 1I3LA 5DN9A 1Y1PA 1I30A 3ENNA 1DFIA 3IJPA 4PCVA 3JQ9A 1E5QA 1H2HA 1LC0A 2C5AA 2FPPA 4DA9A 2EP7A 5T8KA 3R3SA 1H6BA 3OF2A 1LNQA 1LRJA 5BSEA 1N7HA 1CQIA 4D41A 3GH3A 4IDEA 2AHRA 1H9BA 4KWIA 1GTMA 1P74A 3DAPA 3PDUA 4L8VA 2HDHA 1KERA 2E4AA 1PGOA 2V6MA 2ZATA 3KBOA 3PDJA 4H16A 4PZEA 1E1MA 5DCYA 3HB4X 3KRTA 2O4CA 4EYEA 3S1LA 1W8DA 3RQSA 3M2TA 4FOOA 3IL2A 1C14A 5AXBA 5CEFA 2J3JA 1CDOA 3ZW9A 1SO8A 2BGKA 4QFCA 3WLFA 2PLAA 3HFSA 3WGTA 2WD7A 4CL8A 3GAFA 4MVJA 2ZTMA 2GZ2A 3AI1A 6LDHA 5DULA 2W4QA 3EAGA 4U6QA 9LDTA 4BKQA 3ZU2A 3GPIA 4FFOA 4Z6KA 4R69A 4ZRMA 1M6WA 3U9LA 1DRWA 2PR2A 3MJCA 4IDAA 2VTDA 1KOLA 1W73A 3ASVA 5GZ1A 4YYZA 2X7HA 2Q45A 4R5MA 1IY8A 2OGUA 2X5KO 1DLIA 2POQX 5F3RA 3AUSA 4KZPA 4RCVA 1AXEA 4BNNA 3T4EA 3VPGA 3MJ4A 1B3BA 3EC7A 1R4MB 1CERA 2G76A 4UVIA 1GDHA 4TRRA 1HKUA 3U4DA 3VDRA 5IDQA 1YWGO 1EDZA 4HP8A 4ND2A 5IFLA 1ZK3A 3V8BA 2Z1MA 2CMDA 3ZWMA 3WGQA 3W1VA 1N7GA 5ITVA 1E7RA 3O8QA 5JDIC 1XWFA 1EE2A 2GN6A 4L76A 3O9ZA 2GCGA 5G0WA 2ZB8A 4YJDA 4YA6A 3V5NA 3PWKA 3GDGA 1XIVA 4IDBA 2C2YA 1VSVA 4ZN6A 3PJEA 2Q4EA 4ZHSA 3CPSA 4B79A 4YACA 4D0RA 4GLLA 2E6UX 3F9IA 2JCXA 3FNHA 2HMUA 3HDQA 3E48A 5A9RA 2VT3A 1NBOA 3PHGA 3JQ6A 2DBVO 2HMTA 4YT5A 4B3JA 3DMYA 4K28A 4CR7A 2H6EA 4YJHB 3DHNA 1HL3A 4D43A 2BGLA 3ABIA 4BS9A 4D42A 3WJ7A 4NI5A 3ANLA 2B83A 3QLJA 5IN5A 4BO3A 3N74A 3WGOA 2NVWA 5DCWA 1JKIA 1GR0A 2IYOA 3H3FA 3QVWA 4XCVA 4NZ9A 1IZ0A 1MFZA 2PA3A 4DUPA 4EJ0A 5T8KC 4PN3A 4FGWA 2YHUA 2PY6A 4KTTE 1NM5A 1YBVA 2BKAA 1HDRA 3GGGA 1CIVA 3C1TA 4LMRA 3TZHA 1B8VA 2BFAA 5KKAA 3PK0A 3TN7A 3GAZA 1C1DB 4AVYA 2DT5A 5L7WA 4JJIA 3PLNA 4TKLA 3T7EA 1C0LA 3EVTA 4J7XA 4Q3BA 2FSSA 1FK8A 4N54A 4PLZA 2P9EA 3B6ZA 1QYXA 3UICA 1A4UA 5TS3A 1LLQA 1HYEA 4XEHA 3CXRA 1XELA 3LT0A 1Y8RA 1JKJA 4B4UA 4MP6A 4NU6A 3HDHA 4J3FA 5TNXA 1IPEA 3Q9UA 3D3EA 4GL4A 3WGHA 4F46A 4BNWA 3L4BC 2P2SA 3TOZA 1H9AA 1UR5A 4KUHA 2VUTA 3OM9A 5CDUA 1R16A 3GR6A 2EP5A 3GUYA 5JE8A 4UVGA 4DWVA 3ZN2A 3PQFA 4BGVA 1NPTO 3HWRA 1T2AA 1QR6A 1HE2A 5F1OA 4DC0A 1R0LA 2DBRA 1WW8A 1DC5A 5A9TA 3QVOA 2VUUA 1KIFA 3D64A 4QTZA 2SCUA 1P1HA 4E4YA 4RGBA 2TMDA 1ISMA 4ONEA 2NU6A 1XYGA 2DUUA 1PSDA 3DBHB 3DWFA 1FJHA 2B4RO 4A73A 3NT4A 2YY7A 3B20A 1XLTA 1H2BA 3X2EA 1L7EA 5IZ4A 3I9LA 1Q7BA 2J3HA 3VTZA 2EXXA 2WE8A 3MOIA 2YZ7A 1E1NA 1MA0A 1P1KA 4CQMA 2YDYA 3PVZA 2XF8A 1GV1A 3S2IA 1EE9A 5JCXA 1D8AA 2VYND 3DBLB 1VJTA 1B2LA 3D4PA 3C24A 1YL6A 5JDCC 3WMXA 1N1GA 5AXAA 1SZJG 4IJUA 2C54A 2P4HX 1PZEA 1YB4A 1HF3A 2Y1EA 4XRRA 1EMDA 2EJWA 3CMMA 4IDDA 2ZK7A 3JD3A 4H15A 3BZUA 4OAQA 4NBVA 2ZB7A 5A1TA 1HDGO 3EW7A 1H6AA 1YQDA 3ZU4A 4YPOA 2X9GA 2JD2A 3IP3A 4TRJA 2PK3A 2UUOA 2A9FA 4IDGA 4IQGA 5GZ6A 5G4LA 4EEZA 2DFDA 3K5PA 3F4LA 1LSSA 4BKRA 1KEPA 1QORA 3H9GA 4J1QA 2Y0DA 2NVBA 4NBUA 1ZUD1 3FNGA 2VHZA 3UOGA 1HE4A 1ZMTA 4RPKA 5H82A 4QXMA 2AG5A 2O2SA 3GPDG 3NT5A 3HB5X 1HYHA 3V2HA 3RC2A 4WEQA 4D3SA 1JWAB 4XGNA 2PD6A 1MXHA 3BYZA 2H63A 3ONEA 5JW6A 1NFRA 3IUPA 1ISJA 2NUAA 4YB8A 1EUDA 2BHLA
chains in the Genus database with same CATH superfamily
4BKOA 1EK5A 2OMKA 1HDCA 3CRZA 1GT6A 5BWOA 2Z98A 5E6SA 3LUGA 2I1VB 1QNFA 4HFRA 1P8AA 4C05A 1OLXA 3ZYCA 2BGIA 3DZHA 4F93B 2W5UA 1REQB 5JCPA 2EARA 3TQRA 3WL5A 3UK0A 2FFBA 3E7WA 1Y8AA 3KELA 3FD8A 4X7PA 1IVYA 1L1EA 1W94A 2WAYA 1OYVA 1V11A 2H16A 2V9PA 2ZTHA 3FUUA 3SGLA 1ZJWA 3A9RA 1BKDR 1GADO 1Y9AA 1DBPA 1R50A 3SVTA 2ZOSA 1IWPB 2RJNA 5EKDA 3Q0TA 3MAJA 5DTRA 5C2JB 1W49A 2FK7A 2HIMA 1LD3A 1NRWA 2IVFA 4PONA 2XWPA 2V59A 5AVVA 3PCRB 4ALMA 2HA5A 1E94E 2PG3A 5D3ZA 5DNVA 4J0HA 1S7CA 1RKQA 1Z6ZA 2AN3A 5AKXA 3KWLA 4Y6RA 3H1GA 3Q88A 1L4BA 1P1FA 2XXJA 1RKXA 1JDPA 1JIVA 2WKWA 3HJRA 1SKYE 3MT8A 1WW3A 6PFKA 4LZZA 4NOKA 5AXCA 1Y3HA 3PGJA 4J7UA 4A6EA 1G5PA 3HO8A 2XA9A 1K0FA 3MJTA 3PI6A 2OHHA 3PDWA 2HU2A 4I8XA 2DQYA 1MX5A 4Q1EA 1WJGA 3AKEA 3BMOA 1Z2EA 5TPWB 3ZDXB 5CDYA 4MWCA 5GIPE 4K9QA 5JAIA 5ARCA 4P4TA 2W93A 2G5TA 2JH9A 4MYHA 4DANA 1NQTA 2PZKA 1M2OB 1US8B 1O0BA 1YBFA 3T5TA 3HY3A 1Z6GA 5L3QB 1JG7A 4KO1S 3JWGA 2BM1A 3LYUA 1L5FA 3ZW7A 1G60A 4R9RA 1Q12A 5L51A 1BRMA 5KNDA 1WHSA 4UNIA 3QFFA 1U9YA 3PU6A 1LBTA 4S1OA 2YW9A 3T3DA 1LJ8A 1LPSA 2OGWA 1ES9A 1X0VA 3IUYA 4UJ5A 1U90A 2ZRNA 5FOSA 4OQLA 3FPKA 4X24A 1QV9A 2Y1FA 4QC2A 3LUDA 5A0TA 3VC3A 4Y2TA 4NYJR 4ZJUA 5C1BA 1PT9A 4MIYA 4L5IA 3LZDA 3D8SA 4KCGA 2P75A 3WC4A 2O0KA 2H4XA 2VBCA 4QGGA 4F8EA 3DBVO 2CUTA 1ADJA 4YMLA 1X1QA 3KXPA 1KETA 2HQ1A 2BEWB 2PGOA 4Q21A 5FA5A 1YJ8A 4LQLA 2V4MA 1QFXA 1AUXA 3CNHA 1MNQA 3HGQA 2UZ1B 5COBA 1XDUA 4CTKA 5DNYB 4J1TA 3FSGD 1T2CA 2GDZA 3FX2A 3PUYA 4YT2A 2WIJA 3ERCA 1JQBA 1XQYA 1YACA 4TV9B 1PGQA 2C8KA 2DHEA 2OO5C 5JNLA 1YK1A 3FCCA 4F5YA 1L5ZA 4YX9A 3LG2A 1C1XB 2EGGA 3IP7A 2XMDA 3Q4GA 1SNYA 1PJ4A 3L8GA 4OGKA 1Z17A 4TVOA 4V0QA 3C15C 5GOZA 4C7JA 2VT2A 3AUTA 3RYHB 3MWDB 5ANRB 1FZQA 2R68A 3I42A 1VB5A 3B89A 3BWDD 3L6UA 3P45A 1EPUA 5EIHA 5J4KA 5JNVA 1VHDA 2QR3A 1R4NB 1V9LA 1BJKA 5ER9A 3V9PA 2V0NA 3NO4A 1B1CA 4B3SB 3KYIB 3WDKA 1PJRA 1TJ4A 5H16A 1GJRA 3ZY3A 3FWNA 1ZJ4A 3TOXA 4YJKA 1P7VA 1WE2A 3B1YA 5CH3A 2O3TA 3A1NA 4UM9D 4GGMX 4RL6A 3X1KA 1WX1A 3IE1A 2O3QA 3KE8A 5BRAA 4ZVPA 1WSAA 3IXMA 2QGNA 3D7NA 4NBKA 3UHAA 1GZ4A 1G9XA 2J5XA 3HH8A 2X5XA 1ULBA 4UTZA 2OXFA 1D5CA 3R3VA 1RD4A 5DXAA 4YR7A 1P7WA 2ZJ1A 2BI8A 4IIJF 1KEEA 3RK4A 2OC4A 4FFNA 2B6HA 3NGXA 1YZQA 4J6EA 4KQXA 4YWJA 1DXQA 3C8MA 2O8EB 1OX6A 3AZOA 4C87A 4D98A 3BPSA 3D6MA 2HLPA 5LKAA 4BNXA 4CIYA 1X3SA 4BASA 3VNSA 1ZOIA 2UZ1A 2LD4A 2M98A 2R8OA 1N6IA 1AZTA 1NT4A 1I51A 1ZPDA 1E9EA 3N7TA 3JQBC 4I6JA 1A98A 2EJUA 3V00A 3D9QX 4HFMA 3VU9B 4YPFA 1C30A 3DMNA 1JGTA 1SC9A 3O8NA 3QTTA 1KAQA 5F7ZA 1JQEA 1P72A 1V11B 1L7VC 1QH8B 4NBWA 1Z7YA 3GP5A 1DIGA 1MAAA 3LQ2A 2GPBA 3R7WB 2GEFA 1MO5A 4TSKA 4JNKA 3RYHA 3K6KA 5LDHA 2ZUUA 2Y0BA 3A1UA 1UQUA 3JRXA 3UWMA 2I91A 2QRNA 3R3ZA 3ZKWB 5ALFA 3RI3A 4HDKA 2QQEA 1NYQA 1RT9A 3L0SA 1U7WA 2ZI9A 4LC0A 5JWHA 4YMGA 2GCIA 4JC5A 3WNVA 1CFZA 2BHNA 5E0OA 1A8PA 2ZJZA 4AJPA 1RYBA 2Q4BA 1PX2A 3AEQB 4KWEA 4CKYA 4E5KA 2MSNA 4MQEA 2PZLA 3A6FA 4B2PA 2VWGA 1H6DA 2JH3A 3PT5A 5BRNA 2XNKA 4Y2HA 3TVDA 1P0FA 2P4SA 1WZ2A 1M2NA 2Q2OA 1PS8A 3CRVA 4M8LA 4PHCA 4XDZA 4DRXB 1WKVA 4ZFNA 4MCJA 4N03A 4YAWA 5EWMB 4CXMA 1GKKA 1ZI6A 4B4KA 4AW9A 4Z0NA 1TFUA 1K9VF 4F38A 3EC1A 2R7NA 3L7BA 1RZVA 3BFXA 4FYHA 1HNZB 2GCOA 2DVMA 2Y66A 4MUIA 1PLLA 1N0WA 1HDYA 2FPOA 2VQ3A 4Q1BA 4Y1RB 3WRXC 4F4HA 5CFLA 1K7EB 5EMLA 1YKSA 5JNWA 3Q12A 5T64A 3EPKA 1RLTA 4M9ZA 4GQBA 3OZVA 1U31A 3EDOA 1W93A 3GCGA 4M87A 1X6VA 4RQBA 4DUGA 1TF7A 1YNSA 3H13A 2ZGVA 5D6NA 3N2NA 4Y30A 4B4DA 3NC1C 5AVTA 5CFOA 1M2KA 3BXZA 2A0FA 1QLWA 3VDQA 3VI4B 1XTZA 3BK2A 3RBXA 3TW4A 3WP0A 2HW8A 2BMFA 4RORA 2W70A 3RUDA 4H1UA 3MMNA 1JJAA 4RY8A 2QJRA 5DOZA 4D8UA 1CLUA 4DLXA 4LKOA 3BJZA 1SIOA 5KJ1A 3RC9A 4EA6A 2NZ2A 1DEAA 1L8XA 1UP6A 1XQXA 1THGA 2REOA 3OPYI 1KI3A 4MUMA 2E3JA 4U7FA 5BNWA 3V6MA 2H2FA 3K9QO 4KQWA 3V8NA 5CFPA 2IH5A 1YUMA 2D4AA 4UVEA 4I3HA 4JYMA 2ETVA 1WU7A 3DONA 1IUNA 4P34A 3LKDA 4CE6A 2WLSA 4EFKA 3VH2A 5JH7F 1NBIA 1MIHA 3A10A 4FFRA 2BL4A 3EK2A 4G0WA 4KXLA 2HD4A 4HDKB 2PDAA 1DXOA 2J7PA 4TZKA 4BAUA 5LKRA 3K2QA 1QFMA 2JGIA 4FNMA 1LBIA 3WSVA 3VR4D 2XGJA 1P75A 4DM4A 4DQXA 2AUNA 2ZRKA 2ZU0C 3OJWA 4JT9A 5IANA 1EFVB 3OX2A 2OY0A 4KW7A 4MDYA 4MW2A 3UC9A 5EHXA 1JYSA 3EGEA 3FGPA 5KX5B 1YQGA 1NVBA 3K4PA 4FQ7A 4OK3A 4DIKA 4DRXA 1NNLA 2J9ZB 4INPA 3SIXA 3BXHA 4DWJA 2AE1A 4NL4H 4ABTA 2PFGA 4G5HA 3HUEA 1A8QA 1Y6ZA 1Z6YA 4IW3B 1FJXA 3STXA 2PMBA 1AHPA 3PD0A 4JX9A 4K6FA 4GX2A 4MS1B 4D9JA 3T7SA 1BDJA 2PFKA 2Y4OA 1W29A 3DZIA 3GYGA 2P7HA 5J59A 4UOEA 4K9SA 6AT1A 5I4KA 2C7BA 1WY7A 1X15A 4QIHA 4U6SA 3TIXB 3GEGA 4D8YA 3NV7A 3Q1LA 4HDRA 4OQXA 2VXCA 4YJHA 5KVAA 2Q4OA 2QN9A 3B2NA 1XNJA 1DCTA 2C9CA 3ITDA 3OZWA 4DEYA 1L0BA 1MX1A 2DR0A 4GPTA 4LQCA 5CT8A 5EYPB 5AUNB 2JJMA 1BNCA 1JP7A 3K30A 1Z06A 4QHTA 4C08A 4ZOLF 5DU2A 2VATA 3FPFA 3CS3A 1I24A 1DCMA 1JMKC 1FUIA 2GVNA 1P6UA 3BREA 4W6ZA 1M34A 3AUKA 5EFZA 4RACA 4ZO6A 5EIOA 2F1KA 4OUKX 1IBLB 4KFCA 1GTZA 4ZARA 3RLFA 2CKMA 4FR0A 3EODA 2H1WA 3M3PA 4A5OA 3DMTC 2IITA 3GV0A 4HB0A 4N41A 2O8EA 5IAOA 4EA7A 2VNHA 3MWGA 4KBGA 1J49A 2BF7A 2ZCVA 1R6XA 2PT5A 4JBWA 4BU1A 4CCAA 1Y1QA 1S8AA 3TRDA 4IR7A 3RQIA 5FL7D 1LRKA 4ARAA 3CO0S 2NLOA 4AZ3A 1KAHA 2NXCA 4KIWA 3C3BA 4BRUA 4RELA 4W9RA 3R5JA 1EFHA 4KVAA 1CNFA 2JJQA 1NFQA 1X80A 2MYNA 3NNNA 1Q84A 4A03A 1TAQA 4AJ2A 2J46A 2P9YA 3W6OA 3FOFC 2CB0A 2B8TA 5AYVA 2WWHA 2FEKA 4EGAA 1HFEL 3U9TA 2WJZB 1JKJB 3DE6X 1G98A 3QKRB 4HS4A 4QYXA 5CB0A 2HWYA 3QUBA 2YFYA 2ASEA 1GGHA 3FDFA 1T9BA 4IIJB 4L57A 2QVXX 4X1KB 1PW7A 5CXSA 5IARA 3SAJA 3N3AC 3VAYA 1P5JA 2NU8B 5T4EA 4M1TA 4C3OB 5IXJA 1ZIXA 3L6CA 4U5QA 1GXSB 3KHSA 3LRPA 4ZCMA 3PV0A 2OVBA 3ET5A 3WK9A 3U3OA 2WJPA 5F4ZA 2GJ9A 2PZMA 1U5CA 4F9FA 2A0KA 4LHWA 2H7VA 3ODPA 3EDYA 4FDVA 1BQ3A 1EBUA 1X1BA 3KQNA 4EEKA 4BMCA 4NECA 4GH5A 2O0JA 3IMFA 4HNQA 3T12A 4Z9XA 4OQFA 4IFIA 2OGTA 4UBKA 1DQSA 1ABEA 1QK4A 3QUTA 5HE9A 2A57A 2QAIA 1KA9H 2ZI6A 1D1QA 3DTYA 3E18A 1LCIA 1GPJA 1CY4A 1X1CA 1XLWA 1Y9DA 2GCEA 2OSVA 2WUDA 5E6RB 3SJ7A 3WL4A 5EYPA 4CTOA 2WUWE 6CHYA 1MGOA 2WV7A 4TLAA 1ZO8A 1NA5A 3S2ZA 2FKAA 1T8YA 1ZGBA 3QWHA 3IBGA 1GQRA 2ZUFA 1AHHA 3PHCA 1UXGA 3IFSA 2HU8A 4BMVA 5HP4A 2J3QA 1QHEA 3NEAA 3G7UA 1G55A 3KR9A 1KYWA 4QNMA 4DQ0A 2UZ3A 3NBXX 1TQ4A 2YYZA 4R98A 4QEDA 1DARA 2CUZA 2J7KA 1KP9A 4HPJB 3SHTA 3PRHA 3TXAA 2EDCA 1M2EA 3L01A 2O2ZA 4A92A 1A9XB 4O4LB 3PVSA 3FWPA 3R3XA 5GPBA 5H1YA 5LYYA 4MR7A 1L5KA 3VPCA 2VCYA 1YKGA 3TGWA 1YKFA 2FWPA 3DL7A 1T8RA 4I9UA 2GFHA 2H4FA 1WSDA 3Q7SA 5ALPA 1NXQA 4KK4A 1P77A 3E84A 4P83A 5DJ5A 3BSFA 2VEOA 5BW4A 5DNAA 3AKCA 3BH7A 4F3RA 4G8JA 4MW4A 3U44A 4FYVA 4W5RA 2GEBA 2HADA 4DV2B 2GPTA 1AKNA 1XF1A 2PX0A 2R96A 1SQ5A 5NLLA 4B35A 3OT4A 2KE5A 1NC1A 3LGAA 2V1UA 2QN3A 1VKJA 3GW8A 4G0ZA 4M8KA 4KNVA 3JQGB 1W8IA 4BMOB 1J1IA 3MBKA 4C4SA 1MO4A 2V7VA 2CBZA 4JVSB 2Q8NA 1FEZA 3LF1A 1N6NA 3QWIA 2OC9A 3AJ9A 4FILA 3KUDA 2WFAA 4HMQA 1HDIA 1FS4A 3M7IA 2H17A 5I7FA 1J56A 1A72A 1PJ2A 2ONKA 2C0PA 2VP4A 3N0XA 3VPSA 2PU5A 1Y33E 1XVLA 4RHTA 3BGWA 3M1YA 2OK7A 1VJGA 2FCRA 3GT7A 2OBNA 1FTWA 1WUJS 5LP1A 3STHA 1XTPA 1S6YA 2G5CA 2GZ3A 1VMIA 1W52X 2QAGB 4YRMA 3QJYA 4LHZA 3HXMA 4O8ZA 2X9VA 1MP0A 2QTRA 2QROA 5LU9A 3L1UA 4DIFA 1P3DA 1JDZA 3DT9A 4JZYA 2FOLA 5FV7A 3STYA 2V9CA 5HKKA 4TZ0A 1AB6A 2YTZA 5JSUA 3WNBA 1EJ6A 1T0PA 4PNZA 1TZMA 3KVNA 3EPHA 1PKEA 1JQDA 5C4MA 4AKHA 1T15A 4GI5A 4DGQA 4F45A 1M1YE 2IXGA 1YQWA 2G07A 5AVUA 2JK1A 3HEMA 4BWVA 2BMWA 1M6HA 4X45A 4PZCA 5SZKB 2ZTVA 4OSPA 3VSBA 1I32A 2GD1O 3I53A 3PGMA 3TLCA 5JI2E 4CMEA 4AJ4A 1ZVMA 2RJ3A 2VC2B 3IVAA 4EIWA 3BJMA 3OT1B 3VYRB 4HNGA 4KX5A 5CDFE 5JYCA 4B3XA 4DVJA 1FU8A 1FNCA 3HXOA 3OKFA 4J0CA 4JKOA 1TPZA 1DWUA 2CL5A 5FTNA 5DNEA 4IIXA 2IXEA 2BUAA 4U7WA 5F1KA 4J2OA 5ADWA 1G6OA 1NU8A 2C8VA 1ZQ9A 4D9IA 2OHVA 5AM2A 1XV5A 4QVIA 3R7BA 4EFLA 3H42B 1BROA 4B3RB 1NHWA 4B09A 5ALQA 4QDKA 3TQTA 5BOVA 4BO1A 1F3LA 2QX4A 3ESBA 4W4TA 1M34E 3ROEA 3L84A 3LVFO 4HPXB 4X41A 1TA0A 3MJEA 1GPDG 1AQUA 5HZMA 4A6DA 4PQEA 5KQGA 4TMKA 1NG9A 1WV1A 4YP5A 3LQYA 4I50A 1QHYA 3CSSA 4MR8B 1GTG1 3HP4A 1GGMA 5DFAA 3NM4A 4M1OA 1E8NA 1RAGA 4PX3A 4IXDA 1XRQA 4IIJA 4R51A 1WCIB 1YZYA 1GRVA 3AKYA 1ZNXA 2FZGA 1T9KA 3FY4A 4KLNA 3SFTA 1C1YA 3IP1A 5EEGA 1OFGA 1PFGA 3AINA 5MF6A 3EIHA 4H3SA 3GG9A 4IGEA 2OHGA 2VF5X 3VOSA 5HIAA 3FVTA 4QYTA 1EWYA 4CR6A 1FYDA 1SKUA 2D2FA 2JAQA 3A6EA 4XH9B 5EJGA 2HBYA 3BULA 4E14A 2AEJA 2V7GA 3D02A 4ZT4A 4OBBA 4TTRA 1U0EA 2WU0A 3V1TC 3L4BA 4FJ2A 4UHKA 3DZKA 3R7LA 4H3KB 3UF0A 3P9XA 1LH0A 4RVUA 5ABPA 2X5NA 5TMPA 2DM6A 3T99A 3LC7O 3E9CA 3FFXA 2ALJA 4MQFA 1DBQA 2PAAA 2BFNA 4MP8A 5EIBD 4PY2A 4OHXA 3K9FC 1LX6A 4FZRA 4I1RA 3ZD6A 1FUKA 4J43A 1ZW6A 3CLRD 2VT6A 1OLSA 2BCJQ 3ZHOA 5ALJA 4B83A 1UEXC 3PQ7A 1D09A 1PDOA 2HZ7A 4LJLA 4PWZA 4QNRA 5G53C 5KSPA 2WR8A 3H5VA 5IXSA 1E4OA 1QU2A 2Q6VA 1HDXA 4H1TA 2GHIA 4OQDA 1TOAA 1Z56C 3LBFA 1UKVY 5JSZB 1PIWA 3E3MA 3PKIA 4M8SA 4F6RB 1Q1GA 2QLMA 1PJQA 1W47A 4S1PA 2ZTUA 3AWIA 4LDRA 4E4TA 3ZCUA 4WXHA 5B4TA 2JIOA 3ISJA 4A8JB 4F1JA 2EU8A 3CA8A 3LQQA 4JLDA 2O2JA 1I36A 4BE4A 2ZCJA 3R3WA 2GERA 3Q40A 3TW8B 4JS0A 1PQ4A 3UCXA 1W4ZA 2PXHA 4HADA 2H1SA 1HG1A 4IHJB 3LUPA 3DG9A 3ILHA 3TGLA 3SBOA 3OC0A 1QO9A 5LZ7A 3RRMA 1TKRA 1SPBS 1XCLA 2Z95A 5JY1A 4W5WA 4PPFA 2XKBA 5FLYA 3EG9A 3LDAA 2ID9A 3VA7A 2QUBA 1JTFA 3KL4A 4U63A 2Q8PA 1ZEMA 3OAAD 4DPKA 4HKTA 2ZRHA 5FUWA 4UUAA 1KXZA 1BOOA 4MV6A 4LYGA 4U4AA 4BQPA 4DMFA 3KTDA 4PO9A 5ECDA 1DEHA 1WLSA 3ELDA 5JBNA 2I2XB 5E9QA 1ZR2A 2ORIA 3F2VA 2GK6A 3PD1A 4ZC8A 3PGKA 3PC3A 4LJKA 3ZDCA 1RYEA 5DCUA 4IL5A 4E7OA 2BLLA 5JV5A 1KVRA 4HSGA 2FN4A 1X74A 3U0VA 3NHMA 5C81A 4A36A 4X7BA 4EARA 1DUVG 2X58A 1C2TA 2ASVA 3KKLA 2FWIA 3LC2O 3P1JA 3PQ2A 1VJRA 1Z45A 3EAQA 3U1VA 2AN9A 2OBFA 2QAGA 1JECA 4R8RA 2NTVA 4NMWA 2VBGA 1CY6A 5HGXA 3BFKA 2FHPA 4RC9A 5JHGB 2ZYTX 3WLOA 3OTGA 5KYUB 4S12A 1KE2A 1Z34A 4G84A 3W8FA 2DXIA 5EXXA 3QEBZ 1AUOA 3A9SA 3IVGA 3ICCA 5K4GA 2WZDA 3WLLA 1FFHA 1NLZA 3NM5A 3BERA 4MOWA 3AY3A 1U4NA 3MRVA 4PLHA 2VLIA 2R00A 3IEPA 1UC8A 4EY6A 4PNPA 2CXNA 2JI6A 2H51A 3HYLA 1W35A 2IRWA 2O14A 1Z8NA 2OLEA 2WJIA 3DHEA 4PC7A 3FPCA 4TQGA 3V8MA 2AYZA 5HUHA 3U7GA 1NKSA 3ZI7A 4L51A 1TJNA 3LE8A 3T4XA 2HA6A 4RVOA 2K5UA 3GVIA 1J09A 1QUFA 1Y3DE 1YZ3A 2NV2B 4C2AA 2CV0A 3AEUA 1ECCA 5DYNA 2BOVA 3Q3EA 4AJJA 3AR3A 4UHEA 5KYWB 3KCQA 4YS6A 2W43A 3L6OO 3AFHA 4JN6B 1TO2E 4X84A 3CVVA 2KI5A 4ZAWA 3AUYA 3B51X 3C6QA 3THRA 2GO1A 1XZGA 3JQQA 4CG3A 4D74A 1JDBB 1C8BA 3QA9A 4BUCA 3K8ZA 2IS2A 1R37A 1VCNA 4MV1A 4NOLA 3JQBA 4NK4A 3TB6A 4MQUA 2HEIA 4AT1A 1ZK2A 1WCIA 5EA2A 4IMRA 3W9SA 2UKDA 1A1VA 1SOMA 4EM6A 5TQJA 4IUDS 1DHRA 3UCFA 1LJUA 1EP3B 4GBMA 4M7WA 1XA4A 8OHMA 3HU1A 5EGSA 2CLMB 3T1HB 4PSKA 5ILQA 1KNXA 1YCGA 4XQ0A 1GPLA 4BQRA 1II0A 3TRJA 5LOVA 1GZDA 2DKFA 3LLVA 4WEOA 1JRLA 4KAXA 3A70A 1WEKA 1DWQA 4HNHA 4C6HA 3JPYA 2TMYA 4DMKA 3HWX1 2BGMA 3OHMA 3QF7A 5MFPA 2A88A 1KKLA 3FYHA 3WWCA 4BY9E 4HRYA 4QLOA 1J0CA 3CXUA 4O33A 3OTIA 5ECYA 4AQDA 4LV5B 4LHEA 4GZMA 1CUFA 1W5AA 4FEEA 1S2GA 4PG8A 1SOWA 4HZIA 2IHKA 1AZLA 5DSTA 1JFFB 3EIFA 1OLSB 4GP7A 2HTEA 3JARA 4DNPA 3ZJUA 1PV2A 3PR1A 4OG2A 1QOQB 4RYLA 3N2LA 3I45A 1RRVA 1MJFA 3FNEA 1PG5A 1PR1A 3JSAA 5EWJB 1YXMA 3HG7A 3KJXA 4FFWA 1OVGA 5EMMA 5BQ5A 1DAIA 1F2TA 2DF8A 3NXSA 1N5IA 4PFSA 2ZQ5A 4Q39A 4S2EA 5FOWA 3VISA 2R0QC 4AB1A 4BLWA 2XTJA 3VJMA 3MPOA 1D3AA 1USVA 2PD4A 5KTPA 5EKXA 1C3EA 2NMVA 3E58A 4LJ4A 3RT7A 2HZBA 4ZWNA 1G7TA 4L2IA 2BW0A 5DGHA 4RPJA 1XALA 3E27A 3CVXA 1LSOA 5JRDS 3HI4A 2VDQB 3OU2A 4J0KA 4UU1A 1HYBA 1BHSA 2O0MA 3NXKA 3FUXA 4BZZA 2N3ZA 2I6TA 3AM4A 3GQBA 4NWIA 3SIWA 3UK7A 1YC5A 3LFUA 2GCPA 1ONOA 3L0IB 4YRPA 1RI4A 3UK1A 1V48A 3JQ9C 1H5NA 1L7QA 1JAIA 2QXYA 3AHIA 2G77B 2VDWA 3DZJA 1KU0A 4YQZA 1XCPA 1HLFA 3HBJA 4HB3A 4YAFA 2WICA 3HEBA 4H6WA 3OZ7A 3COPA 1N1DA 4OHBA 5E2AA 1FW6A 4HV4A 1C9EA 2QW1A 4RD6A 2IIVA 4TL8A 1O9HA 4M7RA 1JHXA 2ZJYA 3AR5A 4IJVA 5KNCH 3ZLJA 3D8HA 1RJWA 3HABA 1HI9A 2ZQZA 2GAIA 2YHSA 3C5EA 1KTIA 3LGXA 2EZUA 2EEZA 4KO3S 4KV9A 3ZHQA 3A3KA 3U7EB 4N8SA 3R24A 4AJIA 2R1TB 2GEJA 1JVBA 2ZYRA 3JARB 5B12A 1R0YA 3ZE8A 4Q9KA 3MHTA 1JLKA 3W2TA 1ETUA 3VVLA 4BNGA 4EW2A 2BEKA 3H19A 2WYIA 3VKFA 2DKOA 1FJGB 2RGNA 1P81A 1X80B 2OFOA 4QPDA 5FAKA 1FTSA 2CSXA 4MVYA 1DRKA 5FO0A 5K3OA 1Y0BA 2LKCA 3OQ1A 3FOWA 4B6GA 4L85A 3GN1A 1OX5A 1S4QA 4ENQA 3P0FA 2O2YA 4BCCA 4B81A 1OF1A 4MI9A 1YV9A 4CT4B 4DV7B 2HA2A 2O8DB 1N2OA 1LF5A 3D0OA 3KLOA 5KTMA 1YZGA 2QR2A 2Z4RA 1MW8X 2ZB2A 3HADA 1DFGA 1V1RB 2G72A 4DMCA 4PLPA 4WI1A 1XJ0A 3HCDA 4G4IA 4DA7A 3GQBB 2G1JA 4FFPA 4KR2A 5ADHA 3N2ZB 4OY3A 1AN0A 2OXEA 3F2IA 3LY8A 3QOXA 5DGTA 3ZIAD 4S1NA 1U28C 4UATA 5BSMA 4ZI2A 4M1KA 4QDOA 3PUVA 1ZBDA 4BLOA 3M49A 2XZLA 2WWWA 1PGPA 1I5OA 4IG4A 2A4MA 4PZ0A 4UJ3A 6NULA 2D2IA 1NVAA 1KOJA 4K6MA 4XB2A 1CY8A 4O2LA 4CKCA 4JOSA 4CR8A 3D1LA 2Q3FA 2CXXA 1TA4A 2LWIA 1SZPA 1UPXA 3P8ZA 2XGMA 3DBHA 1JFVA 5CFMA 1IC6A 4MW1A 1JR3A 3OPXA 2Q1YA 1V2HE 4YDHB 4JITA 3HXQA 4Y1FA 1TRHA 2CVQA 4NBRA 4EY7A 5AK0A 4UXJA 3NGMA 2KBFA 3EGWA 1TIPA 1XSEA 2IOFA 4RKWA 3ZVKA 3PPVA 4QBIA 1Q1EA 4LE1A 4BZQA 1NXVA 1X7ZA 2E4XA 3HK2A 3KQMA 1ZCBA 4NU8X 5BWNA 1AT1A 3DE2X 3AZPA 3RTEA 2CV1A 1U4SA 1P29A 3T8YA 2QVLA 4MVJP 1UPUA 3HBFA 3BN3A 4IDFA 5KDOA 3BEDA 3USCS 3F3SA 2X3UA 1EUQA 3RSHA 2RH9B 3FLEA 4MGHA 1WM1A 3O4GA 2H4JA 4PG7A 2DHDA 1A9SA 4ZYWA 3VJLA 1RXYA 3EVAA 4DR4B 3CYFA 3W7BA 4JLKA 1X9HA 3RRJA 3F5FA 2ZYWX 3WAGA 3OX4A 2YVUA 1WVMA 3Q7IA 5AR1A 3T1TA 1SK8A 1O9BA 1I2BA 2GTPA 4FYYA 2D7CA 1VL6A 3SS7X 3DFUA 2D1QA 1N9KA 1V16B 2DR3A 3OCXA 1B16A 3CNOA 4GXTA 4OAPA 4DLBA 3ON5A 2XKKA 1HNNA 1Z4JA 2QU7A 2I3AA 2Q46A 2WWVD 3EY9A 4CRWB 1UOOA 1X9GA 2MYUA 2NZYA 1QE0A 3HWSA 2EFGA 2XDAA 3Q5DA 2AUMA 2R2AA 4ZVNA 3T94A 2P9JA 4G37A 3QLTA 1GQQA 2EKDA 3QFCA 2R84A 2A86A 3FDIA 1CRLA 3HA2A 4YRLA 4DJDC 4BBAA 4DBZA 5EJ7A 3QVVA 2FMUA 2ZBEA 3N2KB 2EW1A 4BQQA 4P4SB 2Z6AA 4X8LA 4OOFA 2GEKA 3RAPR 3G0IA 1TZKA 3FLMA 5JS8A 1YFLA 3G0OA 1G7SA 1V8ZA 3DDCA 2ZS7A 3SEAA 5AM5A 2ZJ4A 1AQJA 2ATEA 1ETHA 3C8ZA 3GT4A 3NOOA 3QOFA 2PE5A 2KWIA 1KJNA 5AVQA 2OLKA 1ZH4A 4NV3A 3LNTA 4O29A 1FUYB 2KS6A 5IHPA 3ILVA 2OG1A 4ABYA 3KAJA 5DVZA 1OYYA 2CDNA 5HEKA 4IHJF 1IJBA 1Y81A 4AZTA 3R9KA 3ZWBA 2I87A 3F98A 3SYKA 2CZCA 4E5NA 4MUAA 2DUJA 2EZ4A 2FPIB 3DP9A 1BN6A 3PITA 2RHJA 1EWTA 3W6NA 1OW3B 2F17A 1NE7A 4XX1A 5CVDA 4OU4A 3BTUA 5C7LO 1Y7IA 5FBWB 3DCIA 3O74A 3ST7A 3WB2A 4CDRA 3ADOA 4D3ZA 1WZIA 2W7TA 4D0SA 2JLUA 3KPWA 1ZAYA 3IV9A 3FJ1A 2YVAA 4DADA 1KTVA 3AM3A 2BGJA 1LPPA 2ZRJA 4P6VF 3GBVA 5CW1A 3PJFA 3UUGA 4OI0A 1TI7A 5LBUA 3RANA 1QH9A 2YHAA 2J5QA 4XM0A 4TLCA 1J22A 3B5IA 4QDUA 2O2DA 1X7YA 3A6HA 3A9TA 4RVNA 3UNXA 3KYCA 3VZCA 5FD8A 3ZU5A 1Y6RA 3B3AA 1JH9A 4NZPA 1PZNA 4G8CA 3MNFA 3T5DA 1FDTA 3M83A 4R1UA 3JZDA 3C7TA 3RAFC 3EDMA 2JIDA 3SE0A 1E60A 1N9GA 4LRXA 1E7SA 1TVKA 1W59A 2CJYA 3M70A 1Y3IA 4FN4A 3MWYW 4JFAA 5EZYF 4DXAA 1K5HA 2V7QA 3ANMA 4E5PA 3ZV6A 4D0NA 5BR1A 4L5YA 2QG9A 3K2BA 4TYPA 3NRJA 2HSWA 4ZZ1A 5JSHA 3BIOA 1THZA 3C4VA 4Q3OA 2B2XA 3PHIA 3C6MA 3UYKA 1GZSA 4E31A 1VSBA 6YASA 2IDJA 3DOIA 2O1SA 1DAPA 1N6OA 2MMGA 4Q1CA 5B2EA 1PF7E 5B36A 1MENA 1E9AA 1A9PA 1N36B 2ZS8A 3NCTA 4EITA 2EZTA 3U4AA 5LJLA 3ZDDA 1RZRA 3P0JA 5AKYA 3NOQA 1QWSA 3RT9A 5HFJA 4CKWB 2VJDA 3ND6A 4BVKA 4LDJA 4MVJE 1W1WA 2TMGA 2XYPA 3NIBA 2GBGA 4URUR 3QSYA 1M3SA 3N0WA 1E3TA 1R6AA 1KPGA 2X0RA 1BW9A 4MQFB 1KFJB 2QM7A 5EZYA 1SURA 1WXFA 3WHKA 5LP6F 5E3IA 2EL9A 1VE9A 5DRTA 3QGMA 3JALA 1WLYA 3ZHTA 1GV0A 1FLVA 1ZZGA 1RFGE 1YR1A 3MAAC 2Z9BA 3I76A 4KE9A 4QULA 2FG7C 4LUCA 5SZIA 3A7DA 5A9SB 2J0VA 1LDNA 1SVUA 1VGQA 4IYRA 4PS0A 2ZE7A 1TLFA 2BFDA 2YN0A 3HU3A 3KB1A 4HUJA 1ZK0A 3U3RA 1X86B 4G4SP 4AKIA 2FDRA 4LGVA 4ZEMA 4RPCA 1BU8A 4X0EA 8GPBA 3DXXA 1QHGA 1JNXX 5J2UF 4O59O 2RGUA 2RHGB 3K35A 1W85B 4QWWA 1WXIA 4M83A 4V2IA 3T3OA 3IVXA 3LK6A 3DP7A 3EQ8A 3E2MA 3HWWA 3N59A 5G0UA 1AHIA 1BS1A 4O2AB 3B5JA 2I3GA 2O7NA 1HL7A 3NRCA 4J0FA 1Y4AE 3O73A 4RKRA 3REOA 1KMMA 4WFKA 1VC2A 1KQGA 2AKEA 3DMTA 1QIMA 4RDHA 2ZYSA 1Z82A 2Q7DA 4D81A 4QJBA 3ZHYA 2XZDA 2JLBA 4IILA 1P1RA 1R15A 3PC8A 4IJMA 4JP8A 3H2KA 3T52A 3K16A 2WHQA 3CW9A 1N0IA 2QZPA 2EFCB 4IZHA 4YRZA 3LH5A 3N7UA 1PSWA 4ASUD 2XIQA 1NXSA 1X77A 4DJ5X 4DDUA 4YQFA 4ZQIA 2XIJA 3MOSA 3G0CA 3GT0A 4E5UA 2V5VA 2ZJBA 4NH4A 3ZWAA 2IODA 2OHOA 4TN5A 4JI3B 3F6EX 4YV2A 1AK2A 2RGDA 4NE7A 2IPLA 2C2WA 5LQSA 4X60A 3LI2A 1RI2A 2WW8A 3CB4A 2I67A 3L92A 5AKKA 2WTMA 3ZQKA 4A2WA 7AT1A 1JR3D 2J48A 1NBMA 2DWQA 3KTAB 2I62A 1Y82A 3G59A 4LV8B 1G1MA 1GL3A 3VU0A 4L0QA 1SR8A 1BCRB 1R9NA 5DI9A 2X0KA 2VHJA 1H1TA 4M1MA 2BR4A 3ZOZA 4HXGA 3WJAA 3ULKA 4Q4AB 4EG4A 3ZGNA 1RJ9B 1E6MA 5A0FA 2J4CA 2XYGA 4L4YA 3UTDA 3WVNA 2PX8A 4NNPA 3ZDZB 5JHHB 2V7EA 1HSOA 2O23A 3A6DA 5BNFA 3PX7A 2DSNA 3Q0EA 4BMNA 1Z83A 5EP3A 2O1WA 5CT4A 1VZ3A 5C0OE 3AR4A 4ZT2A 2UZ0A 5IZCA 5LXTA 1AV7A 1KDPA 1OUMA 2CCJA 2QR5A 2XBLA 1SXJD 3DDOA 4UMFA 2GASA 2BN4A 4TS3A 1U3UA 3ENWA 5D6OA 1G3UA 3RIEA 4G9GA 1ZWKA 3IS3A 2WM3A 2FWBA 3OA0A 3T3HA 1SUIA 2OV2A 2QMQA 5JXWA 1T10A 1U8ZA 3LNCA 4PGFA 4UNSA 3UGJA 1SWWA 1E8MA 1N4AA 1Z08A 2W37A 2P2CA 4WECA 4IY1A 3JWPA 3I2FA 4ZAXA 3ZQ6A 1KR5A 1XUOA 3PWSA 4AWBA 2FPMA 4POOA 1Y8QA 1Z8DA 4AWAA 1CEQA 1ZCJA 1JVSA 1N6PA 1DT5A 1OPRA 2BFCB 1CVRA 3OPNA 3BWXA 3ICPA 3M4ZA 1R9JA 5T6MA 4GC9A 4K7JA 1R10A 3G8AA 4ITUA 1K8ZB 5JD4A 5KYYB 1AUPA 1SCUA 1OV4A 3MCAA 4E13A 3R0XA 4MZDA 1QRDA 3DMRA 5FH9A 1G4AE 2WVHA 2OECA 5BUQA 3UV7A 3FBTA 5K3AA 3S68A 2UUAB 4RZHA 1OILA 4LFAB 4ZCIA 5P8WA 1RU3A 4LVNA 4IXWA 3NTUA 5DOVA 3PXUA 3TPFA 2BV3A 5E9WA 3R20A 3TLKA 2JG3A 4M9QA 3NOVA 3V8PA 1VYHA 3FDZB 3CEPB 4MUXA 2RHMA 4E5MA 1Z4NA 4CUZA 2Z5LA 5IM4F 3IVMA 2C4WA 4U9HS 3AVUA 3UCEA 1RJ9A 3A37A 4ZGWA 2IYFA 2WJWA 1QRSA 1MZPA 4DWWA 2GFQA 3D6VA 4UXIA 3RH0A 4D3YA 1GDTA 5CIWA 4KP7A 1JH8A 3OQBA 4XYLA 1KNQA 5CT5A 5E1OA 3ZXYA 4D99A 5BURA 3HC7A 1AKQA 1OYWA 5IABA 4RH0A 1QQAA 2H11A 4R16A 3SSNA 4OSEA 3QG5A 4L3VA 5DWDA 1MV8A 1MH1A 4J0DA 3VR0A 1W44A 1T0UA 1P9OA 2NO4A 2HRQA 3E82A 1H4TA 2J0EA 4NHEA 2IPAB 2L2QA 5DASA 4IEFB 4IWNA 3HVJA 5E4FA 1WKBA 3EOBI 1P4SA 2PBZA 5AJVB 4X20A 2JB9A 1YT5A 2CUNA 4XARA 3PE4A 4GVXA 3RUAA 1TAUA 4IVPA 4MICA 3FOZA 1U6JA 3RFFA 1KEUA 1TQ2A 2QL5A 4IXTA 4JI6B 4EQ6A 4OGLA 2PSHA 2NWQA 1R8XA 4IOKA 1LFAA 1Q7RA 2J4FA 2PRZA 2QUAA 4N5MA 4Z0TA 1MNAA 2ZZKA 3OO0A 1AKRA 1T29A 1MPTA 3K92A 1U9ZA 1YGPA 1ESMA 3H9QA 4ZVMA 4KI7A 5A3SA 3RS9A 4YCMA 1BJTA 1JJFA 1E63A 5KWJA 5I7WA 4ZT3A 4ZOLB 5AO9A 1TUIA 4F5DA 3DOHA 3DV2A 3JCZA 3FTEA 3KD2A 1E6KA 5HQ3B 2C2XA 2HJRA 2JCGA 3QPBA 5JMOA 2BTQB 1T26A 2WQ6A 3ADKA 2KB0A 2YV1A 3I2KA 4YJGB 5LYJA 3QVXA 4IUCS 1UM8A 4WJZA 4A26A 5AKGA 1F12A 4B6EA 5KNBH 1KDOA 4BVGA 2B35A 3UUFA 3RADC 1IHYA 3AJRA 1O96B 1T2VA 4PRLA 2NADA 4ZEXA 4CNBA 3DNMA 1STOA 4NPAA 3T7KA 5I9NA 4PYMA 1J9EA 5G40A 3EZNA 3OP1A 4YMWA 2GARA 4BFZA 3ZG6A 2GXQA 4QNNA 4R1SA 4B3DA 4UEJA 4D1YA 2WNIA 3L9WA 3HKBB 5KNLA 3PHHA 4Z2AA 4RK5A 2I9PA 4IQ0A 3BF7A 2VP3A 4HATA 3SR3A 3CF2A 4DLAA 5IYZF 4ZHQF 1ZW1A 2PX5A 2WA1A 2ATVA 4XQ9A 5HA5A 3TSCA 3LCVB 4E70A 1UC9A 2IBTA 2R751 2OZPA 3QLEA 1ESEA 2YIMA 4EI8A 2QOEA 1HPLA 2WFMA 4JY7A 5EQTA 1KMCA 2D5IA 4Y1GA 3BGIA 4LPKA 3OLCX 4H7FA 4DMMA 1FLAA 2MU1A 2QLTA 4G2NA 5J40A 4DUGD 4ZMBA 4NIMA 4QDJA 3FTCA 4PXSA 4LHSA 1GCOA 3HBMA 1Y7HA 4GOOD 4Q3CA 3FETA 3P0HA 2ZR0A 2OQVA 1C8KA 2V96A 5IKPA 2ID7A 4Q9AA 3WSTA 3MTAA 2OAEA 4N1AA 1W0JD 1NZDA 4QL3A 4DFDA 4TTVA 2I3ZA 1EVEA 4ZI7F 3JTMA 2A14A 5JBIA 1MQAA 4NPCA 1C7IA 2IZ6A 3NDIA 2ZIGA 2JIQA 2K87A 1EAYA 1KVSA 3F46A 1UFOA 1BX3A 3IP5A 4HEA1 4UD2A 4UKDA 2YVQA 4YP9A 5HQ3A </