3ZV4A

Crystal structure of cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (bphb) from pandoraea pnomenusa strain b-356 in apo form at 1.8 angstrom
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
275
structure length
265
Chain Sequence
MKLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAHGGNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTALADLPEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAPHVRVNGVAPGGMNTRGPSSLGVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGDSLPATGALLNYDGGMGVRGFLTAAGGADLPEKLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
publication title Biochemical Studies and Ligand-Bound Structures of Biphenyl Dehydrogenase from Pandoraea Pnomenusa Strain B-356 Reveal a Basis for Broad Specificity of the Enzyme.
pubmed doi rcsb
source organism Pandoraea pnomenusa
total genus 94
structure length 265
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.3.1.56: Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase.
pdb deposition date 2011-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zv4A00
1U3TA 1ZEJA 1I3MA 1R4NA 1Y9EA 3FTPA 3ZU4A 2UUPA 2XOXA 4FD3A 3JQFA 3IUSA 4M8SA 2EKQA 2Y1GA 3GVIA 2E6UX 2PFGA 4L8VA 4XEHA 2VUSA 3QIVA 3PGJA 4DMMA 4IDEA 3GLQA 3LT0A 3DDNA 3KSZO 2I3AA 2VUUA 4DYDA 4R51A 1B7GO 1PR3A 4YQYA 2Y0DA 1B3RA 2AA3A 4MVJH 3G1TA 4BO7A 1IHYA 1UXIA 1K6JA 1YONA 3FRJA 3TZCA 3WYCA 1RPNA 1JA9A 2W90A 2O3RA 3K6JA 4TKMA 3JYLA 2VWGA 5KKAA 4Z6KA 3C1OA 3TZHA 5L7WA 3GVPA 4G5HA 4BNZA 4CMIB 4O59O 4B8WA 4Q3EA 5DCUA 2DQ4A 3ANNA 1QLHA 3GQVA 4CM9D 3GHHA 2G17A 3VKVA 1SZJG 5EINA 1D4FA 2PWZA 4WNCA 2IXAA 1FDSA 3HDHA 4NBUA 5IDXA 1JQBA 4CM4B 3MJ4A 4PVDA 5TRTA 4CM8B 3DL2A 1SEPA 1DPGA 2YYYA 4RPJA 3JQDA 4DUPA 3W6ZA 1KVTA 4E5KA 3LYLA 5HTOA 1AE1A 1GV1A 3GGPA 2IDZA 1U8XX 1I0ZA 1ZW1A 2X4GA 5JS6A 3NJ4A 1SEVA 4NMHA 4CQLB 3E48A 4WJZA 5G4KB 3H3FA 1DB3A 5ITVA 3ETGA 1GQQA 4PLFA 4O63O 4UVGA 3ULKA 2YHIB 2VHXA 1XG5A 3LC7O 4YPOA 1LU9A 3R6DA 3ZWAA 1SB8A 4XRRA 3VPSA 5T6BA 5TNXA 4HX5A 3DOOA 5KVCA 3D3EA 3I5MA 3JQGB 7ADHA 2IYOA 2V7PA 3D4OA 3RU7A 3QE3A 1M75A 2FWMX 5C3MA 1KEPA 3WWYA 2Y93A 5JDIC 3E9QA 1BTOA 1QYCA 2GRAA 3OJ0A 1XEAA 4QEDA 1JVBA 4BNKA 4HFJA 4Q3DA 1K6IA 3ANMA 4E6PA 1LC0A 3AU9A 1B8PA 1WNTA 3GDFA 4BVAA 3M1AA 4YJHA 1NR7A 4I9UA 3HWRA 5BSHA 3NTRA 2FP4A 4YJGB 4BNGA 2JCVA 4J9VA 3TN7A 3FCOA 2DPGA 3AOEC 3W4KA 4JN6B 4DREA 4OIMA 4K26A 1SCUA 2VOJA 3F3SA 3S2IA 3V5NA 1DJNA 2ZIZA 1YE3A 4S3MA 1P33A 5KOIA 5EESA 4J90A 3ETDA 4Z9XA 3Q9UA 1GU7A 1GZ3A 3DMTC 4NDNE 2VHWA 4TRJA 1YQGA 3PHIA 1PZHA 3IKVA 5IZCA 3DZHA 3K8ZA 4ALNA 3BZUA 1B8UA 4BQRA 1LLQA 2I66A 3EGOA 3I83A 5L53A 5I7SA 2NU6A 4IIVA 2Y68A 5DP2A 1GFSA 3DBHB 4JIGA 4NFYA 2OHXA 1BMDA 2PGLA 2JKVA 1E3LA 4DXHA 3NDRA 3Q2IA 1EVJA 4UUOA 4DWVA 5AQ1A 4IINA 3M6IA 4LSWA 3CKYA 4NFHA 3G1UA 5CEJA 3ENKA 1YOVA 3HE3A 5BT9A 1OFGA 1DC3A 2BHLA 3PLRA 3OIDA 1YQDA 3CSDA 4PLVA 3WGHA 2OP1A 5IG2A 1HRDA 1SOVA 1VRWA 3EUWA 4IMRA 1JU9A 2QZ9A 4RVFA 1ZFNA 5C7OO 2YV2A 3E9NA 2RH4A 4BMVA 4BGUA 4J1QA 1XQ1A 2J3HA 4G81A 2VYVD 1JWBB 1V3UA 3OJLA 1C0IA 5BSFA 3GN2A 4E32A 3GDOA 3GMSA 3ZV4A 4CL8A 3U4DA 1VKOA 1PJCA 4ND2A 4J9UE 1X7GA 4BMSA 1UXKA 1UAYA 3DXFA 3MWDB 3OA0A 5MDHA 3QWAA 4OJNA 4FCCA 5FWNA 4LMPA 5JCXA 3DOCA 3S2EA 4Q3AA 3GAZA 2VHVA 1FJHA 4Y6RA 2X0RA 3VVCA 2Q1TA 1R4MA 4BNWA 4PIVA 3KETA 1OBFO 3ICCA 3N58A 4L73A 4CPDA 3QY9A 3PXXA 2JD2A 3QVXA 3IOYA 5COQA 4NZ9A 4CMHA 1N5DA 2QQ5A 4FGSA 3JQ6A 4IXWA 2Y0CA 1PS9A 1T2FA 3STHA 5JAZA 4HBGA 4W4TA 1XYGA 2VRBA 5KCZA 3T7EA 1U7HA 1T2EA 1X7DA 2VT3A 1LSSA 4QUKA 4TRMA 1BXZA 4NH4A 4D46A 4FIZA 5CFZA 1P31A 3AY6A 3RUHA 2PTGA 3WJAA 1YDWA 4GLLA 1X1TA 3A14A 1DC6A 5U4QA 4RZIA 4AICA 1EUDA 4DQXA 3F1KA 3WWZA 4GPD1 3NUGA 1PR9A 4GMGA 1EFKA 3EW7A 2VTEA 2CY0A 3S55A 2VYND 4DBVO 5JY6A 1V9LA 4MVJF 1PTJA 3PJFA 4W9NC 4IS3A 3RD5A 2EGGA 4CM6A 2NQTA 4RDIA 4XDYA 3OEYA 5JAQA 4CODB 5BQFA 1YB1A 1XDWA 4PCVA 2EF1A 2ZTVA 4R5HA 2R00A 3ZWNA 5ITWA 1Y5MA 1I32A 4DPKA 2HMUA 3JD2A 1PL7A 1A71A 5JYDA 1O5IA 1FDVA 4BS9A 1EVIA 4FN4A 3RUCA 4RF4A 4Z3KA 1VM6A 4QFCA 3CTMA 1P0CA 2C7VA 3WGYA 5L7TA 1I30A 4RPGA 3WB9A 1HDXA 2VN8A 1LJ8A 3L77A 1F14A 1YJ8A 4ITUA 3KVOA 4DC0A 1W6UA 3JQBA 4YJFB 3WR5A 1N8KA 4DIBA 5LDGA 5G4LA 3PHHA 5C7IO 3P2YA 4GX0A 1U2DA 1U4SA 3QW2A 4IDCA 1ZUD1 3WJ7A 1KETA 5K9ZA 1HE2A 1QYXA 4PRKA 2GLXA 1VJ0A 2O3UA 3BIOA 4CMIA 4WLUA 1QYVA 4J0FA 3VTZA 3A1NA 2Q2VA 5B4UA 4OH1A 4YAJA 1YVEI 1E1KA 3P19A 2CDCA 2GZ2A 5F1PA 1DIAA 4J6FA 4J49A 5B4VA 5L7YA 4CM4A 1J5PA 3OHSX 1H0KA 2ZTLA 4J3FA 4CM8A 3ONFA 4GL4A 1XKQA 4CL3A 4Z0HO 2WE7A 4CMCA 2HMVA 5KVQA 2DUUA 4HXYA 4UUPA 1E3JA 4U6SA 4R9RA 2NVUB 5CPFA 1EDZA 3VZRA 1WVGA 3BTVA 3IL2A 1YO6A 1J6UA 3ICPA 5CEEA 3PVZA 1LQUA 4PVCA 2O2YA 1UXJA 4LMRA 5B12A 1PGJA 2EJWA 2G76A 3INGA 4L4SA 4PLCA 3PFWO 3PLNA 2YHIA 3QWHA 4UVDA 3F9IA 3GK3A 3ZWVA 1T4DA 3AK4A 3GNSA 5ENVA 4NJMA 3I4FA 1ZNQO 3JQFC 3NX4A 3GEDA 3JQGA 4P4GA 2AHRA 3DR3A 4OMUA 4PLHA 4OQZA 1NQOA 1ADCA 1K89A 4RCVA 1MV8A 1HYEA 2WE8A 3WBBA 5JCJD 3KV3O 3AI1A 2PD6A 2BELA 9LDTA 4EI2A 2HUNA 2PA3A 4FGWA 3WQRA 3AFNA 3VDQA 4DIFA 3BTUA 2P9CA 3W6UA 5JDCA 1GAEO 4BO4A 3IJPA 3TOXA 4PZCA 1X0VA 1Y7TA 1ZJYA 1DC4A 3KTDA 5LCXA 1EBUA 4IZIA 2D59A 4M54A 1FDTA 4BMNA 3CMMA 3L9XA 1UZLA 4WECA 3GH3A 5GZ3A 1ZXLA 3C7AA 4WLOA 1EVZA 1F17A 3ZH2A 4KDFA 2PZLA 3ZNPA 3GRKA 3DC2A 1V35A 4WKGA 1NXQA 1CQIA 1YDEA 2EV9A 1QR6A 2BKAA 2VNSA 1VLLA 4CLOA 1RYDA 1ZVMA 4ZRNA 5JO9A 1SNYA 4ZJUA 4JBHA 2AEFA 4QFDA 1HZZA 3I52A 4YT5A 1ZO8A 4R3NA 3ZNQA 3WSWA 1RKXA 1LC3A 1DFHA 5T5QA 3WMXA 1NQ5A 1E5LA 4C4OA 2OFPA 5U9CA 3IKTA 1WDKA 5AXCA 3DBHA 2WM3A 4CM9A 4GLOA 1IL0A 1IZ9A 1NP3A 3GR6A 4MP6A 2NV6A 3E9MA 3UHAA 4YRAA 1RM4A 2J6IA 3B70A 1YBVA 4J16A 1R15A 2H9IA 3F4LA 3WMWA 1HDGO 2YDXA 3JQCA 3RKRA 4KOAA 2P91A 2VOEA 1R37A 2FOIA 2C2XA 1U3WA 3OQBA 2YV3A 4NI5A 4XA8A 3VC7A 2NTJA 5I9LA 5ADHA 2OXIA 3DTYA 3W4JA 1B15A 1Y5RA 4E0BA 1HTBA 1LSUA 3WBFA 4Z9FA 4AJEA 1J0XO 3H9EO 2EW2A 4BIIA 3JD1A 3PPIA 1P74A 3RFXA 3OIGA 3RUIA 4TRRA 3IC5A 1E1MA 5A9SB 2P9GA 4L9RA 4NK5A 1UZMA 2JFFA 3H8VA 1ZSVA 3DZKA 4DA9A 2HCTA 4ZGWA 3LVFO 4CLXA 3DZBA 1JAXA 5JAIA 2NADA 3ON5A 1HLDA 5TJHA 3A06A 4MKZA 2Y1OA 1GD1O 1CEQA 4E31A 3ITDA 4P22A 4M49A 5HS6A 2ZYGA 5KTKA 1ZKMA 2NTVA 1N92A 5IZCC 3O26A 4BNLA 3K96A 4OSOA 4TKLA 1E5QA 4YJDA 3I9MA 2Q1SA 3GRPA 1VJTA 3ONDA 1U3UA 2QG4A 3NDJA 2X5KO 1DHRA 3AWDA 5HA5A 1NHGA 1U3VA 4Z0PA 3OP4A 4EEZA 3JD3A 2C54A 5DN9A 2GDZA 2Q4BA 1GDHA 4FC7A 5ICSA 5A1TA 4JBIA 4CM1A 3SJ7A 5KJ6A 4A7PA 3IP3A 1RWBA 4J7UA 3HQ4O 5A02A 1E3IA 4RQTA 2BGKA 2H1SA 5JE8A 3MJTA 1EK5A 3S1LA 3U62A 4LRTB 4IDGA 1VL6A 4RPKA 1N9GB 3EMKA 5DDIP 4RLHA 5A06A 1NYTA 2JHGA 4DLBA 3EK2A 1DC5A 3PHLA 4BGEA 5EN4A 1VJ1A 4JGBA 1B0AA 5CDYA 2NUAA 2P4HX 2XXBA 2YV1A 1IPEA 3UN1A 1C1XB 4BNTA 1GADO 1GZ6A 2W2KB 3FNHA 3R1IA 3WNQA 2GYYA 1QORA 2FY8A 3V1TC 5DZSA 2J5RA 3Q2KA 4F45A 1YXMA 5DNAA 5GMOA 7MDHA 2ZQYA 4JROA 4YJFA 4WOJA 3L0DA 1VL8A 2NLOA 2V6MA 3C85A 4FFOA 4N5MA 4B4VA 5CG2A 4MVJP 3GUYA 3UKOA 1H6CA 3D4NA 4FFMA 3ZWXA 2POQX 2YQ4A 3RBVA 2Q45A 3ZI0A 4IJWA 2O48X 1HDOA 4O6VA 1LTHR 3NTQA 1Z73A 3UAGA 1ARZA 3L6OO 3KRTA 1UR5A 3OQ1A 4YT4A 4RJTA 3I6IA 3VZQA 2NU7A 1V3VA 1VSUA 4M55A 3C1TA 2ZK7A 2VQ3A 1BHSA 3SC4A 2AQ8A 1RM0A 2ZCVA 4BV8A 3WYBA 3MWEB 3SC6A 2GERA 4GX2A 4HADA 3SEFA 4CLRB 3PHJA 3ZHXA 4YAIA 5DOVA 1YJQA 4KQXA 2ZQZA 5FFFA 2RBEA 2ZKLA 2R00C 2DTDA 3H5RA 4XX0A 1ZZEA 1BW9B 5A3VA 9LDBA 3KUXA 4RPLA 4DL9A 3RFVA 2D4AA 3OA2A 5KVSA 2HMTA 2X7HA 4MKRA 5DCWA 4BNYA 1H93A 3L4SO 3VHRA 3EZLA 1U8FO 2VYNA 3GF4A 2I76A 1XR3A 4NBWA 4RV9A 2BI8A 4CQMB 4UVHA 3GG9A 1YL5A 4D45A 4N18A 2EG9A 4AJIA 2X0NA 5DCYA 2GPTA 2J8ZA 1VL0A 4YAEA 4J1SA 4WK6A 4Y67A 2C2YA 1D7OA 6LDHA 5MGBA 3NAQA 1H9AA 2VNAA 4K6CA 1N2SA 3ZV6A 1L1FA 3OFSA 4FFPA 3GVCA 3PWZA 2XXJA 3Q0EA 4BUCA 4UREA 5F1KA 1P0FA 3JYQA 5A3JA 3P5SA 3ZW9A 1NPTO 5IDWA 4JJIA 4R68A 3DHNA 4XCVA 4OAQA 3AI3A 3WIEA 1OI7A 4G65A 1E6UA 4EUHA 3P2OA 1CDOA 3C8MA 2HQ1A 4XGNA 2CZCA 2EP7A 3AY3A 3LK7A 3VZSA 3TFOA 1E3SA 2OBYA 1H6DA 3PYLA 3UW3A 1AUPA 3VPGA 1U7TA 5U1PA 4DQVA 3GFGA 4KQWA 2PH3A 1QMGA 1KVQA 2NU9A 3T4XA 2Q2QA 3PIDA 5CEFA 2SCUA 4U8GA 1SB9A 1WDMA 3MCVA 4IS2A 4CM3A 2YFHA 3KYCB 3PFFA 2E82A 1I36A 2JAHA 4HWKA 4D3DA 1R16A 3ZNOA 4LISA 4J1TA 4QO8A 2DVMA 3HADA 5J23A 3K92A 4CM5A 4WGGA 3X2EA 1WMAA 2EIHA 4XQEA 5CDGA 1D1SA 4PLZA 1M76A 3DZGA 3JQAA 2C5EA 4TZTA 2EW8A 2Q3EA 1TA4A 5GY7A 3L4BC 1M66A 2D0IA 4ID9A 4NIMA 1B8VA 1HF3A 5TLSA 2H6EA 1Z7BA 3GNTA 4RGBA 4RORA 2B37A 1AXGA 1F12A 4IM7A 4MJLA 4E5PA 3C1AA 2AQHA 3PRJA 1GCOA 2O3JA 3GVXA 5ES3A 3IJRA 5JDCC 3JSAA 4KZPA 2CVZA 1UAGA 3K31A 3SVTA 4XR9A 4AFNA 1ONPA 3E1KA 4H3VA 1EBFA 4CV3A 2BFOA 3BHIA 2A35A 4XYGA 5JCJA 2FR8A 1OMOA 3PDJA 3UICA 1LBEA 3GGGA 4DLAA 4LRSB 3LSYA 3QWBA 1DO8A 1F8FA 2O3TA 2Y66A 4GWGA 3GZNB 3PZRA 2X23A 4YEDA 3OJEA 4EUFA 3GFBA 3PDUA 4ZRMA 3Q3CA 5CG1A 3GAFA 3PGXA 1JKJA 2B5VA 2TMGA 4GX5A 1GQYA 2F1KA 2DFVA 1BWSA 4FOSA 4FOOA 4TZKA 2PD4A 1PU2A 2WYUA 3PHGA 1C0PA 5AVOA 1YBAA 1ULUA 3W4IA 4PG8A 4D3SA 1IYZA 1PS8A 4CMAA 2P5YA 1I2BA 3PQEA 4AJOA 4DQUA 5JBIA 3I9KA 2GZ1A 3JQEA 4D3FA 1PJ3A 5LC1A 1LA2A 4B3HA 2YFQA 5BNTA 4AJ1A 1PL8A 3GC6A 3VKUA 2A94A 3VH1A 1VSVA 4BB5A 4YACA 5F3RA 1N7GA 4U5QA 1LLCA 2FR0A 1HE3A 1TVEA 3RASA 3PZBA 4L4XA 4BNNA 1F0YA 2Y1DA 2PKRA 3KB6A 3PJEA 4CLHA 4GI2A 1N1GA 2WD7B 1K0UA 2AEJA 4TVBA 4BKUA 1OAAA 2A4KA 4J43A 5JFOA 1N9GA 2PNFA 1DBVO 1LQTA 1R12A 3H7AA 4OXNA 4AJ4A 2GN4A 4CMKA 4GKBA 2UDPA 1LDEA 4HFNA 4IJVA 3VPFA 1EQ2A 1NPDA 2AXQA 3JYNA 3L9WA 1C1XA 4QQRA 4RF3A 3RC1A 3GHYA 3LZ6A 4BNVA 1CRWG 3ITKA 1J49A 3TZKA 4CMEA 4WLEA 2ET6A 1ISIA 4Y6SA 1NVTA 4P8RA 1TLTA 3DWFA 4I1IA 5EERA 4A73A 4A2CA 4QXMA 5JLAA 1BXGB 4D42A 5EMHA 2I5PO 3AW9A 3JV7A 5T67A 3MEQA 1HDRA 2D5AA 1LRKA 1EEHA 2D3TA 4NPCA 4F46A 4D44A 2GGSA 4R01A 1XGKA 3QVWA 3LDHA 4AJNA 1EZ4A 1SPXA 2OO5A 4IZHA 4LSMA 5JPIA 3UCXA 3HN7A 5CP8A 5EIOA 3WTCA 5JNLA 1P1RA 1V3TA 3D5QA 1Q7CA 2E48A 3NT5A 1YS4A 5JMPA 1QSGA 2IODA 2HMWA 1HZJA 3LQFA 2UYYA 3W1VA 4D7AA 3VVBA 4YAKA 3RUEA 1A9ZA 2A9FA 4ZQFA 1NQAO 2OL4A 5HBRA 1IE3A 5H81A 5KNLA 4BO8A 1E7QA 3WGGA 4TMFA 3WQSB 1YB4A 4UEKA 3NKLA 2HO5A 1P9LA 2B4TO 4TVOA 3RWBA 3NYWA 1C3VA 2X58A 2DBZA 1HWYA 4EITA 3JYOA 1PGNA 3E18A 2HU2A 4QSMA 4ZA2A 5ICMA 3OJFA 5TC4A 1W73A 1BVRA 3WGTA 3MJCA 1GYRA 2OP0A 4C7KA 4CUZA 1GL3A 2CVOA 3FR8A 4XR4A 1BW9A 1H94A 3G17A 5TJ9A 3COSA 3MTGA 4ESOA 3TL2A 4O1MA 3RBXA 1NWCA 4FJ1A 2B69A 5JAMA 4BO5A 1IB6A 1D3AA 1DFGA 4GGOA 3W8FA 5L4LA 4IDFA 4H15A 1UH5A 1I2ZA 1JVSA 1C1DA 2W2LD 5EQDA 4RDHA 2HSDA 1T4BA 4XIYA 3O38A 1I33A 1F8GA 3KEQA 1WXDA 1PZEA 3CIFA 3E5RA 1B2LA 2G0TA 1KC3A 4BNXA 4G2NA 1IULA 1LXCA 1NWHA 4PG4A 5I7VA 3DTTA 1XLTA 4JCOA 3OF2A 4J4TA 5I9MA 4YXFA 2YDYA 3A4VA 4YT2A 4KWHA 4RZHA 3GDGA 1JTVA 1NFFA 5DP1A 5DT9A 3VH4A 4K1LA 2V6FA 4Q3BA 1WW8A 3IP1A 5KIAA 4ZQGA 1MUUA 2HDHA 2RHRA 3ZHYA 1BSVA 3QV1A 5EL0A 4OXKA 4F3YA 5JO0A 1FF9A 3GUCA 4MVJD 2E4AA 4J7CA 5B37A 5COBA 1KVSA 3QA9A 4IY1A 1P45A 4HP8A 3RJ9A 3TWOA 4R1NA 3MOGA 3Q9NA 5L9AA 2CDBA 2HMSA 1I3NA 2UUOA 3WYEA 5C5IA 2O3QA 4B3JA 3QWIA 1ZK2A 1NM5A 1PSDA 4L76A 3KYCA 3WQQA 1QG6A 4ND3A 1QKIA 2BH9A 4IDAA 3OBBA 5HRUA 4QO7A 1AHIA 4E3ZA 4RVDA 4YDRA 1JN0A 1O8CA 1DRVA 2Q4EA 2WJPA 2GO1A 3RJ5A 4A03A 4DVJA 4PRLA 3O8QB 3HZZA 3H9QA 4KUHA 4XB1A 4UAGA 2DBQA 4J7XA 3VAZA 3FNEA 4CM7A 4I08A 1NASA 5CAEA 3ZWMA 2CD9A 4A26A 1LSJA 1C14A 1EUZA 1XSEA 2YUTA 3TL3A 1H2BA 1U5CA 4WLNA 4DC1A 2C59A 2J3KA 2Q99A 4OO3A 1E7RA 3RU9A 4YR9A 2GN6A 1ADGA 4DBZA 3NDIA 3KZVA 3ROQA 2GSDA 4XQ9A 1EQUA 3JD4A 2I3GA 5AYVA 1PQPA 5L40A 4CQLA 4OSPA 3MJEA 1DRWA 4AJKA 5G4KA 1A5ZA 2HJRA 4BNMA 4UUNA 1CQJA 1XU9A 3VDRA 1BRMA 2XPCA 2P4QA 4K28A 2R2GA 1PJLA 1HXHA 4FR5A 3GNQA 4XGKA 3BMCB 4XQCA 4ZICA 1NVGA 3PJGA 2X9GA 2JD1A 3ZHBA 1MFPA 3WGIA 1T1RA 2AG5A 3EVTA 4PZEA 6ADHA 3L4BA 1Q2XA 3DZIA 3D64A 4LN1A 2V6GA 4B4UA 1D8AA 2J3IA 4B7CA 3AUTA 3LC1O 4DPMA 3OIFA 1A72A 4Q3NA 2Q2WA 1NX6A 4DGSA 1DAOA 4JP2A 3ADPA 2PK3A 2J5QA 1X1EA 1PZFA 3EC7A 3TZ6A 1X0XA 4W99A 4Y9DA 4IGFA 3WX0A 5T64A 5K6AA 5JXWA 2JCXA 4B4WA 3GG2A 4ZQEA 4J0EA 1DLJA 3QHAA 4YJGA 5KJFA 4L75A 1NTOA 4GX1A 5AXAA 3HDYA 3CXRA 3EDMA 2FZWA 2FSVA 3G79A 2X0JA 3OICA 2V65A 4MVJM 2WD7A 5BR7A 3SX2A 5FI3A 5I9NA 3DEYX 4GMFA 4YQZA 3TFQA 1DFIA 4E2WA 5KWEA 1PJ4A 1U4OA 3DBRB 3G0OA 3FBGA 3FNGA 4MKXA 3RUFA 3FR7A 4R9SA 4I8XA 1R0SA 1WMBA 2X1HA 1OZAA 1PJSA 4DMLA 4B8ZA 3K73O 4ALIA 4NR0A 4ZU3A 1UDAA 3OM9A 1ISFA 1AHHA 1RM3A 1WWKA 1EFLA 1ZSYA 4IDDA 3ZGYA 1MB4A 2WYWA 3I9LA 1MC5A 5I8ZA 5FF9A 1R4NB 4RO0A 3CZMA 1KIFA 4DPLA 1IZ0A 1W4ZA 2J3JA 1SOWA 5B1YA 2JAPA 1VKNA 1YL6A 8LDHA 4N5LA 2BGMA 3ZV3A 3H9JA 4H7PA 2WEKA 1ZK4A 5TT1A 4XJSA 3OETA 1UJMA 3VZPA 1YRLA 1UP4A 3EYWA 1EDOA 1GV0A 4IPTA 2WD8A 4W7IA 4EJ0A 1I10A 2JJYA 4XJTA 3JCZA 3PYXA 1HL3A 5AXDA 3SLGA 1NVMB 3ORFA 5TIIA 4INAA 1HDYA 1U1IA 3OEWA 4EJ6A 4BNUA 3LT2A 4MIEA 5TF4A 1PJBA 2IRWA 2IZZA 4YTEA 3INRA 4XYBA 2CDAA 2VTDA 5A03A 4HNGA 4KDEA 3AJRA 4ALJA 1KS9A 1GUFA 3WGQA 2Q1UA 1M2WA 1ZK1A 4C7JA 3FWZA 1HSOA 1E6WA 3S8MA 2GN8A 3O4RA 1GEEA 3HJAA 2BF7A 4NFSA 2CF6A 1T26A 2PKQO 4L4RA 4OHUA 2DUWA 3G49A 3H2ZA 5T57A 2QZZA 4M87A 4CLDA 4XYLA 2BFPA 4WLVA 2NVWA 4MVJI 4Y98A 3BMOB 1KVRA 5G0UA 4IJKA 5TGDA 1KC1A 3X2FA 5L45A 1LDGA 1P3DA 2BGLA 1AGNA 2X8LA 1MXFA 1MC4A 1MGOA 3OQ6A 4CMEC 4EDFA 3BMQB 1DOHA 2RAFA 1MFZA 1E1LA 1Z7EA 2EWMA 2Y05A 4K6FA 3CEAA 4CR7A 3W8EA 1RYEA 3NJ8A 4HY3A 4M1QA 3NT4A 4RF5A 3U4CA 3BMNB 2FPPA 2HRZA 2I9PA 2X9NA 4CUKA 3GY0A 5L4SA 3I9JA 2AEMA 4EZBA 2AMFA 5BSEA 1ZK0A 3KEOA 4R3WA 4R16A 1U5AA 3DAPA 1UDCA 2VT2A 1O6ZA 1ISJA 4CQMD 4AVYA 5A05A 4II3A 4Q3CA 3OMLA 4OYRA 4YBZA 4WCFB 1X7HA 4UEOA 3FNFA 3DMYA 4LCJA 3TPCA 4IXTA 3S2FA 1H2HA 4EW6A 4WASA 5IN5A 3TDKA 2IZ1A 1JKFA 3JQ7B 3FPCA 4L0QA 4Z0TA 1UUFA 2DAPA 3WTBA 4JQCA 3WSVA 2DKNA 1NHWA 1O94A 2PZKA 1J4AA 1I5RA 2G82A 3ZWBA 3N74A 4BV9A 1PX0A 3QRWA 4OOEA 2E37A 4DTIA 4J1NA 2VYVA 1GTMA 1MLDA 3UCEA 1ZK3A 4RVHA 5CPBA 1OC2A 1D1TA 4I5GA 3WLEA 4WLFA 1RM5A 5LDHA 5DOZA 4JNKA 2QRKA 2YY7A 1HYGA 1O9BA 2CSUA 3FSRA 3T7CA 4N5NA 3ZW8A 3LU1A 4KUGA 3HUDA 1SO8A 2FHSA 2FRDA 3ASVA 1MA0A 5G0WA 1PJQA 1YOVB 2JL1A 1E77A 2IEDA 4EBFA 4E2YA 1ONOA 2WDZA 2UV8A 4R5MA 1HSZA 2G5CA 2PH5A 4BO1A 3DBVO 1T2AA 4WCDA 1PGQA 3K9QO 5ER9A 3RVDA 1CYDA 4TQGA 1FXSA 1E7WA 4I5EA 4XB2A 4AJPA 2BLLA 3IIEA 1SC6A 1LX6A 2NVUA 3PYMA 4BO6A 1P1JA 1DIRA 1EVYA 2B4QA 4W7HA 2W2LA 3OSUA 1UDBA 3SLKA 4AL4A 3UH1A 2IYPA 4BL5A 4CJXA 1E6EA 1WPQA 2CMDA 2W8ZA 4IQ8A 2BI7A 1YGYA 2Z95A 1A7AA 3GZ4A 3BMCA 1ULSA 5DBIA 3UOGA 2IE0A 5IDQA 3WFJA 1XIVA 5FEUA 2R6JA 4ONEA 1HE4A 1E1NA 4JJGA 4NHEA 2P68A 4KTVE 2XAAA 3HNPA 1C0LA 4NU5A 1V6AA 3H9GA 2E49A 3DO5A 2HJSA 1GYPA 4IJUA 3KLPX 1NQTA 1Y8RB 3JYPA 4A5OA 4MDHA 1PJ2A 4FJ2A 4PG5A 4NBVA 2PKQP 4MIOA 4MVJA 4TROA 2DFDA 4CV0A 1IY8A 1JDJA 1CETA 1JKIA 4X54A 3RKUA 4BO9A 4WEQA 2X9VA 4U6QA 4TRNA 4HFRA 2WMDA 1IPFA 2H63A 4IQ0A 4FSHA 3BAZA 2QRLA 3WIDA 1KERA 4FC6A 3FHLA 1KY5A 1XCBA 3TRIA 3BTOA 1I24A 2DC1A 5G0SA 4YWJA 3B20A 3JQ9A 3TNLA 1DSSG 3JQ8B 2HK7A 3DBRA 2NWQA 1R6DA 3NTOA 1GUZA 1Z6ZA 1GQ2A 4RLSA 3QJ5A 2UVDA 1HYHA 4EGFA 3LF2A 3DFUA 4FS3A 2EERA 1K2WA 1KEVA 3D7LA 2C5AA 4B4OA 5F21A 3ZNNA 3HG7A 4OM8A 3OJOA 4FPXA 1U9JA 4FBGA 2RHCA 1AXEA 1ENZA 4NQZA 3UF0A 3LLVA 3VOSA 2GZ3A 1ADFA 4I9HA 4XIJA 1DIHA 4JLWA 1PZGA 3K2BA 4LVUA 3RBZA 1SBYA 4ZQBA 5BSGA 1E7MA 2PLAA 4J91A 4P4LA 1XQ6A 4XQGA 3GPIA 5JC1A 2DM6A 4BKPA 4A27A 4J4BA 1LRJA 4BO2A 1EE2A 4PZDA 1UP7A 1NNUA 3H65A 1Q7BA 2NSDA 3W8DA 1A27A 3HB5X 5ILGA 1GY8A 4HKTA 4WEOA 2C82A 3U49A 3ZZNA 3V2HA 2I6TA 5DULA 1Y9AA 4E5MA 3MZ0A 4PLWA 1M67A 4KUEA 1E3EA 2PZJA 2PZMA 4I5FA 4ZQHA 3MJSA 4XWYA 3RUDA 5K6AC 1HKUA 5A9SA 5KJCA 2AG8A 3JD0A 4GGPA 2QRJA 1B3BA 3NGXA 2W4QA 3VPXA 4AG3A 2OMEA 4XGIA 1KEUA 2RH8A 3PQDA 4R1SA 3DAGA 1I8TA 3C3XA 4JK3A 1TB4A 2I67A 3GMDA 2Y99A 5I7FA 3DONA 4W82A 2WTBA 4ZN6A 3PK0A 2B35A 3BMOA 2BFAA 1PWZA 3Q6IA 1ONNA 1S6YA 1OC4A 2C7GA 3FF4A 3ZWPA 4PLGA 1U28A 5K0ZA 2BRUA 1Y6JA 3BMQA 1R0KA 3MJVA 4RPHA 5A5EA 3K30A 1CWUA 1SMKA 4OKNA 3IS3A 4NJMB 3HDJA 3L6EA 3PWKA 2JHFA 4BKRA 4YYZA 4E2XA 3DAFA 3BMNA 4XRGA 3LT4A 4GH5A 1PS0A 3I3OA 3EZYA 3AM4A 1DAPA 3U0BA 2DTXA 4QT0A 3WXBA 1Z45A 1ENPA 2BMAA 1DRUA 2AW5A 2TMDA 5TX7A 3WDSA 3FPLA 1YKFA 1A4UA 3I6QA 3KHUA 2PR2A 2ZB4A 2B36A 4WCFA 5THKA 4A0SA 2Q46A 1RJWA 5A5FA 4GQAA 5IXYA 3IQDB 4J4HA 3JQ7A 3V1UA 3DFZA 1ORRA 4J2OA 4MINA 1GPJA 3BYZA 2LDBA 1LDBA 3KYDB 2GASA 3A28A 2ILTA 3QVOA 3U09A 4F6LA 2OORA 2DU8A 2Y67A 1NR1A 4PLTA 3F1LA 2W2KA 1N7HA 3KSUA 3VH3A 4JBGA 1QP8A 5KVVA 1JLLA 4BGVA 3SXPA 1CIVA 1EE9A 3ROPA 3O9ZA 4CLOB 5CDUA 1UXGA 4BNFA 4RF2A 2HRBA 2EJVA 4M89A 5COAA 3AU8A 5IJZA 1G1AA 2FR1A 3L6DA 1C0KA 4YB8A 2B4RO 4Q9NA 4PGFA 3AY7A 1ZXBA 3VH2A 2G1UA 1DJQA 1KVUA 3IDSA 1BDBA 5JYEA 4LCEA 1P1HA 1XA0A 4GVXA 3OH8A 4R41A 4KWIA 2NVBA 4ROSA 2C0CA 3H5AA 2CF5A 3P7MA 4YVFA 1I01A 3ETEA 4AJHA 1YB5A 5JW6A 3V2GA 2HAEA 5KJEA 3D5TA 4J2HA 4IUYA 5A04A 1E3WB 4GSKA 4EUEA 4PN3A 1DIGA 4WPGA 5H83A 5CHEA 1LLDA 1V0JA 1X15A 3BXXA 3EVNA 3ENNA 1JW9B 2EKPA 4E4YA 5F5LA 5T8KC 3ABIA 4HNHA 4R1UA 4GKVA 3RUAA 4IMPA 5CDSA 1L7DA 3EY4A 3PI7A 1XU7A 1LDMA 1PGPA 3E03A 4JJFA 1JAYA 4R4JA 4ZD6A 4CLRA 3V2UA 1ID1A 2DBVO 4CR8A 1LEHA 2QYSA 3KXDA 3K2EA 1U2GA 1EUCA 5I8WA 3F4BA 2HLPA 3RROA 4TWRA 1WP4A 5HM8A 3TOZA 1GYQA 1M6WA 5TSDA 2VZ0A 1NFRA 3G3EA 1LLUA 3KOUA 3KO8A 1PEDA 4D43A 1Q1NA 1N1EA 1YQXA 3B6ZA 1TI7A 3NRCA 2GNAA 2ZB3A 3GVHA 3KYBA 4BO3A 1LDYA 4CQMA 4LGVA 5L95A 4DIOA 1IUKA 1LRLA 4R54A 2QYTA 2EHDA 4FQ8A 4II2A 3RSHA 4XKJA 4OGWA 1QYWA 1Y8RA 1NAHA 3E8XA 5F1OA 1R0LA 1G6KA 4HFMA 3IAHA 4WUVA 3TQHA 2QIOA 1ISMA 5AOVA 2VWPA 1E7YA 2C20A 3R0IA 1DIBA 3ZWYA 4URFA 5JY1A 1WAMA 1ZSNA 2P9EA 2GD1O 1ENYA 3EAGA 4D41A 1ADBA 1QLJA 1ZMOA 3ADOA 3FWNA 1H6BA 1Y1PA 4U7WA 4E30A 2V6BA 2HK9A 5A9TA 1UZNA 2O50A 5TT0A 3CINA 3LT1A 2DTEA 2O7QA 4R1TA 3OECA 4B7XA 2AQKA 3KBOA 1H9BA 4UULA 4XDZA 1NBOA 3I9NA 3JQ8A 3PP8A 1ISHA 3QQPA 3B1FA 4U0JA 4LW8A 5EPOA 3ROKA 1FK8A 2FSSA 4UEJA 3H5NA 2VRCD 3U5TA 3JTMA 3TJRA 5IFLA 2IZ0A 1IOLA 1BXKA 2B0JA 3NV9A 4E13A 2CVQA 4GBJA 4L74A 1X14A 1TXGA 1Q7GA 3DZJA 3BHJA 4ILKA 1Z82A 1IHXA 4MPDA 2EP5A 2GF2A 4PG6A 2IXBA 2PGJA 5FYDA 1B26A 4E5NA 1OOEA 2X6TA 2OZPA 2NTNA 1HETA 5TS3A 3RCBA 3T4EA 2CFCA 4E2ZA 2ZYAA 2ZJ1A 1HDZA 1NPYA 3M1LA 4KTTE 2Y1CA 4NK4A 4ALKA 5DBFA 3M2PA 4CR6A 1BVUA 1GR0A 3R3JA 4RVGA 1UP6A 3AUSA 1JWAB 4AJJA 5GZ1A 2O4UX 1KYQA 1ZIDA 2ZTUA 2O4CA 1MG0A 4O5OA 1A4IA 3F5QA 5EJ2A 4MP3A 4NU6A 4OOFA 5L51A 2NU8A 3H4VA 4PFJA 3DBLB 3RC9A 3FTNA 4OKIA 3RC2A 4CLEA 4XZ3A 2C07A 1YH3A 2NACA 4TSKA 4BO0A 1FDUA 5G0VA 2D1YA 4XYMA 1DDOA 2EGHA 2ZATA 4FJ0A 4Y6PA 2HKIA 3WOHA 1L7EA 3HDQA 5L3ZA 4EYEA 4ALMA 5L4NA 3ANLA 2VWHA 1X13A 3HN2A 3CMCO 3JQ9C 3AI2A 1TT7A 1A9YA 3ZCXA 4E21A 1FMCA 1ZBQA 3GZNA 1TT5B 3ROMA 2IEBA 1V8BA 3TSCA 2D2IA 4XYEA 1E92A 4HV4A 3JQAD 4FW8A 3MTJA 4Z9YA 4AJLA 3I23A 4B79A 3QSGA 1G0NA 2HK8A 3DHYA 3MOIA 1Q0LA 1O0SA 3DB2A 2O2SA 1O89A 3INTA 1GCUA 4MIYA 4P38A 3UUWA 1QV7A 5IN4A 3H9UA 3IMFA 1DXYA 2W98A 4Z3DA 3CPSA 3UCFA 4QECA 1PGOA 1T24A 4HUJA 2D5CA 3PTZA 3AM3A 4W6ZA 3ZHZA 1QV6A 2DPHA 2FMUA 1VPDA 1Y81A 3AFMA 4KMSA 4OQYA 2I99A 2VUTA 1GZ4A 2O3SA 3DQPA 5JMWA 2GUGA 5I7EA 5G0TA 4U0KA 3DOJA 5AXBA 3WG9A 5KJ1A 3PJDA 4BOYA 3AUAA 3ZWCA 4YT8A 4E5YA 1Y8QB 4BNJA 2FPGA 2WSBA 4MOWA 5IDYA 3U4HA 5IAAA 1LUAA 3ZU5A 1ZCJA 2Q50A 1T2CA 2CNBA 3F5SA 4NBTA 4N7RA 2JFHA 5DF1A 1PIWA 1ML3A 1ZEMA 3LC2O 4BHTA 4GVLA 3RC7A 3NGLA 5HS4A 5BNFA 3HFSA 2NNLD 3BTSA 4BGIA 3ZWWA 4P4NA 1HEUA 1CF2O 1GEGA 1GPDG 2B5WA 4WOKA 3KYDA 3HHPA 3H2SA 4GWKA 2EEZA 3D3WB 1KBZA 1SAYA 4JP3A 3FN4A 1PQWA 3PIIA 4ND1A 1B14A 2OGUA 1I3KA 4UUMA 5IF3A 1MP0A 3ZU3A 1BXGA 2PY6A 1K6XA 2WWRA 4R69A 4H16A 3QLJA 2VHZA 4RQUA 4CMBA 4GAEA 1LSOA 2QW8A 1EMDA 4D0RA 3KM0A 3FI9A 5JC8A 1NFQA 3E6AA 4CV1A 3PEFA 1I2CA 2F00A 2O7SA 3KSDO 3RAJA 2EKLA 2UAGA 4EJMA 5JDIA 4BB6A 1H5QA 2X22A 4BNIA 2LDXA 2VCYA 1EK6A 2YJZA 4JXKA 3ZDFA 4A10A 1XHLA 4YRDA 1G0OA 2Y0EA 4FFRA 1VE9A 4UVIA 1E3WA 4NNJA 4BKQA 2GN9A 3JQAB 3ST7A 1NAIA 2P5UA 3TF5A 5FI5A 3HFGA 4K9DA 4DYVA 3AOEA 5B4TA 3D0OA 3GEMA 3FD8A 3PWSA 2CUKA 2ZB8A 2JFGA 1ISGA 4B3IA 2ZB7A 3B1KA 4WCFC 5JSFA 3DMTA 4PLPA 4N54A 3LF1A 1MXHA 4WE3A 4YA6A 5CDTA 4RL6A 3WS7A 3Q11A 1PQUA 4ND5A 1R66A 3GT0A 3N7UA 4BNHA 1LI4A 2ZTMA 1E7SA 5DBGA 3AM5A 3TZQA 1KEWA 3U4IA 4ALLA 1MG5A 3U9LA 4IQGA 1K3TA 1WLYA 2Z5LA 4PG7A 3D1LA 2OOSA 2PGDA 5EQFA 3HSKA 5C37A 4IGEA 2ZJ0A 3R3SA 1K5HA 8ADHA 5IXSA 3E5MA 3V1YA 2VWQA 3ZN2A 2FN7A 3WNVA 2X5OA 3M2TA 5T8KA 2Y1EA 3I1JA 1PJTA 4OL9A 3F46A 3H6KA 1QRRA 2Q1WA 3CZRA 2NQ8A 3AUUA 1HDCA 3QP9A 1YBMA 4QX6A 3BA1A 2RCYA 2ZYDA 4NBRA 1ENOA 2Q49A 3FBTA 3C24A 1FDWA 3LLSA 1BG6A 3QVTA 2VZ8A 2X0IA 4YJHB 2I65A 1BDMA 4YRBA 1F06A 2ZCUA 2H5LA 1CERA 3GEGA 2C29D 3EHEA 4YCAA 1KOLA 3UXYA 1XELA 1WZIA 1YWGO 2X5JO 4I5DA 4DRYA 1Q0HA 2RIRA 2X86A 3K5PA 2QX7A 1DLIA 1KY4A 4FFLA 2YHUA 2EXXA 5F5NA 3S2GA 3SJUA 1T25A 1ZMTA 4MVJG 3F6YA 3GA0A 5BNIA 3U3XA 1O95A 3BHMA 1W0CA 3RI3A 1WDLA 3WGOA 2JCYA 4M86A 2OBNA 3GPDG 1T2DA 4JX8A 1P1IA 2BFMA 4CMJA 3WICA 4E33A 3WLFA 4F6CA 2A92A 3GGOA 3V8BA 4O0LA 4EEXA 3UFXA 5ILOA 4OXYA 3H3JA 3O8QA 1P44A 3NT2A 4ND4A 3UGKA 3Q1LA 3GOHA 3WFIA 3ZWOA 3QVSA 4RVUA 3SBOA 4S1VA 4LVCA 4LK3A 4D79A 1MX3A 1VC2A 5GZ6A 1HT0A 1QYDA 5IZ4A 3PQFA 4WNIA 4IIUA 2DBRA 1DEHA 1AN9A 2Y1FA 3ZU2A 4FDAA 5G2OA 4CUJA 4MP8A 1GUYA 1XWFA 3DBLA 1I3LA 4BQPA 2GCGA 4W9NA 3VTFA 1ZJZA 2D8AA 4FFNA 5A9RA 3VPHA 2J5KA 2B83A 1LNQA 5A4DA 4CV2A 1VI2A 3HB4X 3GN1A 1W8DA 4FB5A 2AE1A 3ZV5A 1S7CA 3UVEA 3RIHA 1Q0QA 4KP7A 2DT5A 1Z75A 2AE2A 2QHXA 2YZ7A 4BKOA 4QTZA 4B7UA 3AOGA 1UXHA 4AJ2A 1TT5A 2O23A 4GSLA 3F47A 3QWFA 1T1SA 4D0SA 2BD0A 3ONEA 3I9OA 3A9WA 3NEPX 3L07A 3DZFA 5ER6A 1R4MB 3O03A 5C7LO 1B16A 1WZEA 4RVSA 1PWXA 2VHYA 5KKCA 2YW9A 2FZEA 2OUIA 1QXSA 2YQ5A 3C7CB 4IBOA 4DLLA 2VZ9A 1Z74A 3E82A 4Y8VA 3C7DB 1YL7A 4ZVVA 2DLDA 5HWSA 4NG5A 1PL6A 2VRCA 3ASUA 5THQA 2XF8A 4MVJE 1TEHA 4E12A 3CUKA 1C1DB 1Y8QA 3JQBC 1P77A 1M6HA 4IDBA 3RFTA 5ENDA 1BGVA 4I9NA 3KLMX 1A7KA 2NM0A 3I4CA 4PLYA 4YAGA 3RQSA 1CJCA 4CMGA 1LDNA 1E0DA 1P1FA 3B1JA 5TQVA 3WGZA 2P2SA 2PV7A 3CH6A 3DHEA 4ZHSA 4Q39A 4UVEA 1DHTA 1HLPA 2WYVA 3CE6A 3D4PA 1ZH8A 2FPIA 2Z1MA 4XD2A 1P1KA 2JD0A 3IUPA 4MO2A 5H82A 2GR9A 2AQIA 2Z1NA 4NJOA 1H6AA 3D3WA 2PD3A 1HE5A
chains in the Genus database with same CATH superfamily
3TUIC 1KU6A 1I3MA 4Y6OA 4MS1B 3H86A 1PG2A 3RLIA 3FTPA 4QG7A 4DLLA 1O3YA 4M8SA 1HY3A 2RAPA 3EEYA 4NCKA 1AUQA 2EYUA 3GT4A 3GVIA 2PFGA 4C20A 4XEHA 3PGJA 5HIJA 5IVDA 3G7UA 1Z35A 2G5GX 3HGTA 4YJKA 3ZIAA 3GLQA 3TSZA 1Z26A 4NCJA 2OFXA 2RG1A 5L3VA 3BFPA 4KLNA 2EQBA 2I4TA 4MVJH 4Y6GB 1XTZA 1IHYA 2HQSA 4L85A 3FRJA 1BN6A 1RPNA 3IT3A 3D0RA 1W0JA 1JA9A 2BFBB 3GWZA 3HDTA 2VL7A 3HLKA 4OHVA 2NSLA 3CH7A 1G19A 3EY9A 3NHBA 3EZGA 3O92A 1K7YA 1OYYA 4K46A 4BFUA 1RQPA 4F60A 4BNZA 2I9KA 4O59O 4BUJA 4B8WA 3GUZA 1RPAA 4YRMA 3KT6A 5CAEB 4DM7A 3BJIC 1QLHA 1YVRA 4CM9D 5ICCA 5HR5A 3BN3A 2ZBPA 4H1TA 3K70B 1E2LA 1SZJG 3HJCA 3Q5EA 2IXAA 1FDSA 2IF2A 3HDHA 5D85A 3KVVA 5EXDA 4PVDA 4RM2A 4CM8B 4G5YA 3BCUA 4RPJA 1HM5A 3QU2A 4KSCA 5A4IS 3TB6A 3LDAA 1KVTA 3WWOA 4E5KA 2VF2A 1XPOA 3LYLA 3AFOA 4RPIA 1I4DD 1U8XX 1I0ZA 2QQFA 3BFXA 4PR3A 3AXTA 3QGMA 4G8DA 1TM4E 1OH6A 4HVAA 1PQYA 4CQLB 3E48A 5IYZB 2OGTA 3F8SA 1M2VA 4ZO7A 5K8CA 4RTKA 2JLCA 3FOFC 1DP4A 2G7MC 2PWAA 3NOOA 4PX9A 2QL5A 4OXRA 4XWAA 2BUAA 3T5PA 2Q4OA 1IJEA 4QU0A 3WYGA 4DA0A 3LA8A 1XF1A 5TNXA 1THZA 1QHNA 2EAUA 2IYOA 3UY4A 3D4OA 3O95A 3VUFA 2DPYA 3KKQA 1M10A 3EG9B 3KJEA 5BUSA 4EHDA 2IUTA 3VR5H 3GP8A 2VP9A 4BRWA 1NURA 2GRAA 1JG2A 3GJZA 3A26A 4BNDB 4BNKA 5B1DA 1QO0D 3NHFA 3ANMA 2P0YA 3ZZMA 4QJIA 3THYA 3KUKA 4BQSA 3AU9A 1K9VF 4LRYA 5KQLA 2CDRA 4R7GA 3EZ9A 1MNQA 2Z30A 1RBQA 2C9CA 3M1AA 4LDQA 4YJHA 5C7YA 2B30A 3ZDCA 4Q4CA 1YDMA 4PS0A 4EW2A 3N2KB 4UM5A 5LXTB 1ODFA 1UZAA 5JZSA 3NASA 2AJBA 1BX1A 4JSYA 1AKNA 4JWKA 4D9EA 4EB3A 2ZRPA 2HV9A 3W4KA 1CNFA 2QEQA 2GD2A 1GA1A 1RYYA 4OBWA 4XLLA 3RAGA 3S2IA 3A4IA 1OYWA 3HLYA 4S3MA 1JKXA 1OU0A 2A9OA 2XCIA 4Z9XA 5EESA 5J2UB 3UYKA 1OVGA 1PKXA 3W6OA 1GU7A 1GZ3A 5EJ8A 2V1UA 1ZBDA 3DMTC 1K98A 3A04A 2WKRA 4FEAA 3KPVA 4NDNE 1BMFA 3NZEA 2MMGA 1YQGA 3UJNA 1K6EA 3OX1A 4GZ5A 1FMFA 5DNWA 4C4SA 2FW1A 2L0XA 4C30A 4ALNA 1PNRA 1E4VA 1Q20A 3BGDA 1B8UA 4BQRA 2I66A 4Y6QA 4TSFD 3FMIA 1TIKA 5I7SA 4IIVA 3OT1B 1GFSA 2LNDA 2Y71A 1LI7A 3DBHB 1CUVA 3QMWA 5ANRB 4NFYA 1S2MA 2G28A 3CG0A 2NO1A 1TFUA 2QG6A 3VHXA 3RS5A 3LT5A 4WFIA 1E3LA 3GFRA 3BH6A 4UUOA 3RJMA 5AQ1A 1FFXA 1SVOA 3EGDB 2PIDA 3CKYA 1R64A 4H1UA 3G1UA 3WYFA 3N8NA 5DLPA 4TKVA 5CEJA 4P53A 3DR5A 1P19A 3QX7A 1FS4A 4RU1A 1G66A 2QF7A 1RCUA 3CUEF 4RK0A 5BT9A 4BWVA 5JNUA 3PLRA 1RTTA 4Q4LA 4OA5A 4JJ7A 1CJBA 1CF9A 3GPBA 3SYKA 2XTAA 3DA8A 1U8AA 4HYQA 4WHMA 5HKAA 2AZMA 1VRWA 3ZZTA 4IMRA 3K0CC 1ZFNA 5HMMA 1O94D 4P98A 1UBJS 3SQLA 1DARA 1F3LA 1R2QA 1SXJD 3E9NA 4PZ9A 1BROA 1E6MA 1E1QD 2AYXA 4BMVA 3I9V1 4J1QA 4BGUA 2HA3A 5EJIA 2QVXX 2VYVD 1JWBB 2J9YB 2C57A 1BYIA 2BMWA 3OJLA 4B6OA 2YWXA 4RMJA 1DINA 4TUYA 5BSFA 1GKUB 3D2AA 4FDTA 2JVKA 4MUBA 3IGFA 5K51A 3ZV4A 4JL5A 2VAPA 4QRHA 5H8WA 5TQ2B 1F2DA 5TMBA 3U4DA 2GAFA 4WD3A 2V3CC 4M37A 2XE8A 2XI4A 2Z4TA 2BHRA 4BMSA 5LLDA 4H60A 4D9CA 2WPDD 4GICA 2Z2XA 2Q9UA 5F7JA 4LMPA 5B7PA 4YR7A 3GPLA 3IT1A 3DF9A 1VQ1A 3BH0A 4OK5A 5BNWA 1FJHA 4OXQA 5BVHA 4MA4A 2W6QA 2PNJA 2X0RA 2XYVA 3VVCA 5BR4A 4MVYA 1R4MA 1ZJJA 2GZMA 3BRWA 4PIVA 3UXMA 1OBFO 5D01A 3E0QA 3DZ8A 1ZRSA 2YXEA 1W2WB 5JTTA 3X1ZA 3PXXA 3R5SA 4UTOA 4UTZA 3IOYA 5COQA 4CMHA 1N5DA 1L4GA 2Y6UA 3JQ6A 3GCWA 4IXWA 2JEYA 4RMIA 5D3KA 1NVXQ 1PS9A 2A1UB 3DM5A 4WDQA 5CCDA 4A8JB 5JAZA 5SY4A 2XB9A 4W4TA 1U7HA 1T2EA 3LIIA 3D54D 1NOJA 1Y1LA 4JEMA 1JAZA 2FLKA 3NHWA 4G1FA 5EXPA 4NH4A 1G8KA 5CFZA 4A82A 4PF1A 1ORTA 3AY6A 3NC1C 3RUHA 1CP3A 1K0FA 2PTGA 3QXSA 4P93A 3ND5A 1Q3TA 1RJFA 3FB4A 5FI1B 1ZC4A 1DC6A 3IPCA 1ECJA 1PEKE 2ZROA 2P2ZA 2JBAB 3TNYA 1IBMB 3N0WA 3CF4A 1LPBB 2KX7A 3MWYW 4R2XA 1J1UA 3W7BA 2UVPB 4L0CA 2CY0A 4K9SA 4N6OA 3S55A 3WK7A 2D7CA 5EE9A 1M7GA 5HK9A 4QT4A 2VPXA 1VCNA 1P8AA 1SG9A 2AIRA 4CM6A 2NQTA 4Q34A 1D2CA 4RDIA 1NF8A 2QSJA 3F5DA 4J94A 4V0QA 3W3AA 1IJBA 4PCVA 3UTCA 1TK2A 4KBGA 4DUGA 1QE0A 1XXHE 2EF1A 5CX1A 4AKGA 3HZOA 4NU8X 2B8TA 3NTLA 2EWWA 2R00A 5FD8A 1BDHA 4LZAA 3A6HA 4LTNA 5FTJA 2NUAB 5CVCA 1C0EA 4ZI2A 3TD6A 3I39X 5DYWA 1OIWA 1ZICA 2ZEJA 3GCZA 4BS9A 2ZUUA 1RLOA 2YJNA 1TA0A 4FN4A 4OFZA 3C6KA 3ND8A 4QFCA 3PRYA 4X8HA 2OMKA 3WGYA 3MILA 1I30A 2C78A 5F7OA 5F12A 1UBGA 1RAAA 4BAZA 2QWXA 2VN8A 2HFKA 3L77A 1XDGA 4CDGA 4F9GA 1YJ8A 8ATCA 3GYGA 3JQBA 4YJFB 5AOAA 3WR5A 1LWOA 1CB0A 4AUNA 2HPVA 1GO2A 2JIMA 5LDGA 2J6HA 1Z13A 1X2EA 3KJZA 3BDIA 1Z28A 2OAP1 2P9HA 3QW2A 3Q10A 1KETA 1QFJA 1HE2A 1NJ8A 1QVRA 1USIA 1W0KA 3WOVA 5I4CA 1JIUA 4FI3C 5KREA 4PRKA 2XNHA 1VJ0A 5KNBA 2NPIA 2O3UA 1FDIA 3AB3A 1L3BA 1G8FA 1BZYA 4J0FA 5AUQA 5AW5A 3O2JA 4CMIA 3MMSA 3JARB 3R3WA 4COKA 5BV1A 2P6RA 1L7OA 1QHFA 1E3MA 4Q15A 3R7DA 1SK8A 2M6KA 1YVEI 2IU4A 1UDXA 2XGJA 3WHLA 3MTEA 2CDCA 1U3CA 2GZ2A 3JX9A 4IOJA 5F1PA 5J1TB 1WB9A 1GCGA 4U3JB 5L7YA 4P92A 2BZ0A 2IIPA 4J3FA 3ROEA 3OKAA 4GM0A 3LUHA 2C31A 4RJJA 4Y30A 4CL3A 2WE7A 3DVRX 2ZUFA 1W34A 3V1LA 3QHPA 3R75A 2C98A 2IZ6A 4MRNA 3OLYA 4XUDA 5ALTA 3UAXA 1PW7A 4MGYR 1U8YA 2D2FA 4HXYA 4UUPA 2GWRA 2YVLA 5M34A 4LJYA 4U6SA 3WKEA 4LHXA 2O8BB 1T4MA 4F93B 1DAIA 4NX2A 1MEOA 2JS7A 2PZFA 1YO6A 4U7JA 3ICPA 2PUDA 5LUBA 1EDBA 1IBRA 2H5EA 9GPBA 4AY2A 2G76A 3INGA 4L4SA 4NWIA 5T7BA 3WNCA 2EBHX 3PLNA 3QWHA 4FGLA 3IR6A 2JVJA 3AK4A 4X7RA 4XUEA 5JNRA 3GNSA 5ENVA 3VNRA 3LK6A 1TL7C 1TU4A 1Y63A 2MYPA 3VNUA 3JQGA 4P4GA 5E6UA 1CY1A 1YQ9A 2H3HA 3MMXA 4PLHA 3TDNA 1QG2A 1TIBA 2ZGVA 5K20A 1ESDA 3WBBA 1HYEA 4F72A 3R23A 4JI2B 3AI1A 3GJYA 4RHXA 4B34A 2WV9A 3P5BA 3IAS6 2VJCA 2PA3A 3TVDA 2J6BA 3VDQA 4L07A 1P2GA 2ZVQX 3O84A 1G7SA 1QGYA 4CDMA 1Z2DA 1Z34A 2P41A 3W6UA 1JKMA 1GZVA 3MFQA 4ER6A 5LQUA 1X0VA 1Y7TA 1ZJYA 3KTDA 2B3TA 3ER9A 2NYRA 1AH2A 4G85A 2BUCA 4O33A 3QLEA 2RARA 3CMMA 3KS9A 3L9XA 4I4TA 2QTLA 1UZLA 4MI9A 5KAPA 3OQHA 4HWGA 1R00A 2QI9C 4Q37A 1E2UA 1EVZA 2PMBA 1C9DB 3L7BA 5FA6A 5INTA 3QX3A 3DFIA 5AVVA 2WJHA 2PZLA 3PA6A 3DAOA 5ALXA 3ZNPA 3AX6A 1V9SA 1V35A 2IDKA 1NXQA 1CQIA 4R81A 3UK2A 1YDEA 4G67A 4RULA 1QR6A 3SOZA 4REOA 1Z39A 3WMGA 2XZOA 2G6BA 4CLOA 4ZZ1A 2BWJA 1RYDA 3K5HA 4QFBA 4GOND 4XWGA 5JO9A 3DWEX 4I66A 5ALGA 2AOWA 3FKSD 4JVMA 1OX4B 3WKDA 1ZO8A 1F0NA 1NYQA 2VJNA 2YQZA 1WSDA 3H42B 1P29A 3ILVA 4MV3A 1QE3A 1ZGZA 1OZ0A 1VIDA 3H16A 1DEAA 2NU9B 3WMXA 3WGVA 1NQ5A 1B8NA 1ZMBA 2VAXA 3A3KA 4H6PA 4K2HA 3F71A 4QPJC 4YDSA 4ZOCA 5IBQA 4BVJA 4C4OA 5AXCA 4EYKA 4GLOA 3GR6A 1NP3A 1W5EA 2ZSIA 4UUBA 3AKDA 3UHAA 1RM4A 1UXOA 2WICA 3IKMB 3OIYA 3B70A 1YBVA 4DBLE 3K1JA 4TYYA 2HCBA 1OLXB 1GTSA 3O3CA 3F4LA 1HDGO 2Z2JA 1TCUA 3MT0A 3FDZB 5KVAA 4DLNA 3CJRA 2VOEA 3MLAA 4G1CA 5GONF 1ZI9A 3R9XB 2B94A 1XKXA 4L4YA 3S68A 1LVHA 1NQWA 3VC7A 5I9LA 4RTLA 3OLXA 4D8VA 2HPZA 1Z5OA 1G6HA 4F96A 3KHSA 5DXFA 5HDQA 2OXIA 4KLZA 1KPGA 3W4JA 4K87A 1Y5RA 3BD8A 5AIAA 1ZISA 3PNMA 4Z9FA 3HHEA 3H9EO 1JNXX 2H57A 3BS4A 3AHJA 4L5YA 4V0MA 3ZXXA 4FFBB 2DY0A 3TB4A 1OIXA 2PDAA 3JR3A 4TRRA 4LZWA 1RYNA 1E1MA 3TM4A 5C8DA 2P9GA 3MK31 4WK2B 2JGKA 5E8JA 2JFFA 1U8UA 2ZJZA 2WYHA 3DZKA 4DA9A 2HCTA 4ZGWA 3GLFA 2DZDA 2ZIAA 4YQEA 4D4LA 421PA 5KOJB 1JT9A 2R1TA 4OU5A 5ALRA 2PZEA 5AUOB 3ON5A 5JQGA 5HK8A 5F9FA 1HLDA 1L7MA 5TJHA 1W7AA 4P5EA 2UUCB 3CPEA 5FBVB 4MKZA 4YMLA 3EFOB 3WNBA 1YQWA 3P9ZA 5CVUA 3SBXA 2ZRIA 4E31A 1GT6A 4FOPA 5C8YB 3CLRC 3T5MA 3DL4A 5EGNA 1NE7A 3NTUA 2HHJA 1ZKMA 2IHTA 2IPXA 3B82A 1C29B 2N46A 4XVUA 3F7OA 3L0YA 3O26A 2VJKA 1E5QA 1KFKB 4D25A 3FJYA 2B2NA 5KSOA 4UMFA 1VJTA 4B35A 2BZ1A 4X9XA 1KE1A 1F8YA 2H0RA 2JH3A 2E5FA 3UIEA 3OPQA 5FR2A 5DYNA 5AKJA 1U98A 4M88A 3AWDA 1NHGA 1U3VA 2VDNB 4EB6B 4CQNA 4Q1EA 1UBKS 3JD3A 5F9MA 3UJ7A 4DMHA 5CB4B 1YTUA 3A0RB 4GKKB 4R31A 2MT9A 1JQJC 3MGGA 1TVKA 4UXIA 5ICSA 1AKVA 2ACWA 5A1TA 3SJAA 4MNTA 5KJ6A 1ACLA 2E18A 1RWBA 3RVJA 1E6CA 4EPVA 3ZJVA 1RZ3A 3HU1A 2OO5C 2WSYB 3UWKA 4FGUA 1SQ6A 2WWWA 3FGPA 4EF5A 4F9TA 4FMPA 5ADWA 3HBJA 2V74B 2CL7X 3FDJA 3L6CA 3WL4A 1JAIA 2B4AA 3TPZA 2VPPA 2I7CA 2WTNA 2EG5A 4RPKA 4UATA 3AEYA 2WWTA 4RLHA 3K9CA 1SUPA 5KYXB 1SKBA 1RRKA 1B0AA 4JGBA 5JARA 2P4HX 2XXBA 2HIAA 2ORIA 3IQIX 2R85A 4ZFNA 2VZLA 3HKEA 2GPSA 4YP1A 3SDBA 3SR3A 1VPWA 1R5JA 1PAUA 1P0MA 1JDUA 2AH5A 2C5FA 3CRRA 5BN3A 3VA7A 2FQQA 2BEVB 1M0WA 2RONA 1UMCA 3II6X 4HD8A 5H80A 1KJYA 5JH7A 3BXOA 5JYCA 1NW4A 4DCUA 4EHFA 3WNQA 4KIJA 2GYYA 1W85B 1KI9A 1O4VA 4WERA 2J5RA 2BP7A 2JGLA 1GNTA 1H2ZA 4WXPA 2DUNA 4YJ2F 5CNJA 4XW2A 3FG9A 3PXAA 2OSVA 3U81A 1GPH1 4WOJA 2Q5JA 1GTZA 2NLOA 1KH3A 3MS7A 4JEUA 3SKVA 1YFKA 2CSXA 5K2OA 5A7GA 4C4YA 4DG5A 4N5MA 4OVKA 1H6CA 2ES4A 2VDMB 5D87A 2O6HA 3EBOA 2Z6QA 4MITA 2XMZA 4DNOA 3TTYA 4K8OA 4DRZA 3O3MB 2YQ4A 3RBVA 2Q45A 2XRYA 4P58A 3C0KA 4MV1A 3EUEA 4O6VA 1LTHR 2CLSA 2XOEA 2H1LA 1TM3E 1Z73A 3I0ZA 3KUCA 3V42A 1L5NA 4D0NA 2P9TA 2CUNA 3CR7A 4W1RA 4BP3A 3LPDA 3KTOA 1ZU4A 3OQ1A 1L2TA 1BD3A 3UGTA 5E9WA 2UVQA 4JMLA 5CGQB 5F23A 3DE1X 3I6IA 3QPUA 2JIRA 1WSBA 1V3VA 4D5GA 2AN3A 1SUIA 2IEGA 2E4WA 2YC4C 1WUTA 3C1TA 4IHJA 3KDSE 4IXNA 4LZNA 2BM0A 4WNAA 4Q9IA 3SC4A 2OCLA 1H05A 2IV2X 3ZCPA 4N0PA 4WH0A 3WYBA 3MWEB 4HWSA 4GX2A 3JQQA 1WXGA 3SEFA 1G5PA 4NOMA 4YAIA 5IBCA 2BGNA 2EJUA 3QHQA 4KQXA 4Z7OB 4BWYA 1NXVA 1YZVA 2VDKB 1J97A 4C1NA 5B7GA 3KAPA 1XHFA 5HUHA 3EXEA 3SQDA 3W0LB 9LDBA 5AJUA 1NYRA 1RE0A 4CTMA 3RFVA 3H2GA 3Q7RA 1JZSA 4IEIA 5B2EA 5HIMA 5KVSA 1Z0ZA 1A8UA 3JAWA 3SG0A 1POWA 1LK7A 2GSWA 3R0JA 2RHMA 4LWPA 1O77A 1XTSA 1GUDA 2HHCA 2ZSBA 2VYNA 4NS1A 4C7XA 4Z54A 4DB2A 3LRXA 3EPHA 3LBAA 1EM8B 2I76A 1XR3A 1RI4A 1Y4UA 2CE2X 3AJAA 3G9TA 4NBWA 4RV9A 2BI8A 4CQMB 3FWYA 5K3CA 2ZCJA 3GG9A 1L4HA 4D45A 4N18A 4GYWA 2AMLA 3O4IA 5CTJA 3URMA 1FW6A 4YC7A 4DR4B 2XJ9A 2WTMA 4WXEA 2J8ZA 2XRFA 3H4IA 1SQ5A 2HI0A 4D81A 2DCUA 4J1SA 1SBIA 2C2YA 1UOEA 1S3GA 4KSYA 4U2FA 3VTKA 4Q4DA 4BASA 2VNAA 4EGCB 1V16B 2GUWA 3QV2A 4GBMA 2RGNA 2CV1A 3GVCA 1EGHA 3VSBA 1VCIA 1KI3A 4LBVA 3EWIA 3JYQA 3DEHA 5A3JA 1C80A 1SVSA 1NPTO 5F7ZA 5IDWA 4RVOA 1V5FA 5C8VA 1W36C 4XCVA 2OCKA 1SXHA 2OKGA 4OAQA 3WIEA 4EO7A 4X41A 1OI7A 3PEYA 5KQSA 5CVTA 1XJ5A 4EUHA 2OYSA 5KOHA 3GOQA 1ISRA 2HQ1A 2GZHA 1NN5A 1Q0ZA 3NAMA 2O0MA 4S04A 5C1IA 2AXPA 5AVJA 1V8FA 1AUPA 1PDWA 5U1PA 4HVCA 5F3WB 3GFGA 1AKMA 3W90A 1MW8X 1KVQA 2ZYUX 3TRKA 1BGWA 3SC3A 1T0BA 2IIQA 4QDOA 5IU6A 2NUTA 1WPXA 1XL0A 2HSWA 2NZJA 2FXIA 1CJSA 4BV2A 3KYCB 4GM4A 4KQ6A 4LNUA 4O4HB 1TRHA 2JAHA 1R16A 2FPKA 3DE7X 3GEHA 4HH3C 1E9BA 3HADA 4BV3A 3WLLA 2LTAA 4LDJA 1WMAA 4XQEA 5HE9A 3CN9A 3LY5A 2OKCA 5T6MA 5CDGA 2YOHA 3D59A 5L3QB 2VJOA 2C5EA 4TZTA 1JV2B 1EFVB 5EP3A 2FUNB 4B4VA 1XA4A 1SBQA 3B2NA 2WNHA 3GJ6A 4H4EA 1MZVA 5DU2A 1W52X 2YMMA 2AJDA 3N1UA 4I2VA 3A2NA 4CT0A 1ZVKA 3IPAA 5TLSA 2FW6A 4RGBA 5DSTA 4PZZA 4DMUB 5DKFA 4ZI7A 3OO0A 2W43A 3PRJA 2OZVA 3E27A 1Y4DE 3G02A 4GIBA 4MUJA 1DBIA 5ES3A 3RSFA 5DTQA 4ASUA 4B3BA 1NUUA 3CURA 4X94A 3M5CA 3IQXA 2NU8B 4B73A 1BWPA 2Q8NA 1RHUA 4MSUA 2L69A 1UAGA 4D2IA 2NYVA 1Z68A 2GBIA 1YJCA 4U1RA 5FTMA 3PPXA 4M1TA 3SVTA 4PZYA 1CBUA 1A8SA 1M2OB 3E1KA 4H3VA 4XR9A 1EBFA 3SHWA 2QRVB 5A3RA 4QQKA 3KL4A 1CUAA 8ABPA 1KAQA 1CUFA 1YVUA 5JCJA 4YUYA 1Y3BE 2WIJA 2WT9A 3GEPA 1F1JA 2HCFA 4F91B 1NI4A 2Q6OA 3EODA 2Y92A 3RWMB 2QM7A 2YMQA 4EHLA 2QRUA 2CLLB 3GGGA 5IC5A 3MUNA 5C18A 5CVEA 2PSJA 3ID6C 4AUMA 5EHNA 3COPA 2ZYTX 3OAAD 1DO8A 1KPIA 2O3TA 3MJFA 4YEDA 4BZZA 2ZIWB 5CG1A 5KDDA 3GAFA 2FW9A 3Q6MA 3VMFA 4QL3A 2Z43A 1IHPA 3OZUA 2A3RA 2JGDB 4HH0A 4EPXA 5LOVB 1JG7A 3SQXA 2R5NA 2VXBA 4MWSA 2GA9A 2PKWA 4L9AA 1AC5A 3RK1A 3ZHQA 5ETJA 3U9SA 3A10A 3QOFA 4KLAA 4MWCA 1Q92A 4AXXA 1C0PA 4R83A 5HFJA 1ULUA 3S5JA 3STTA 4FR0A 3I1YA 3GO4A 2ZWMA 1PS8A 2ZE6A 1NXWA 4AJOA 1ZH2A 2UYCA 2R48A 1LA2A 3CCCA 5K45A 2GPYA 1G7RA 4RTOA 3NANA 2CNWA 5BMOA 4FYVA 2J3DA 3RFUA 1ZXXA 3V80A 1F5NA 1RQLA 5HVNA 3ZVRA 5DX0A 1HE3A 4ZCLA 1F0YA 1TK9A 2Y1DA 3N2GA 4BNNA 2PKRA 3ZLTA 1P9OA 3PJEA 4CLHA 5K3FA 3VV3A 5CCEA 2FK8A 2AEJA 4TVBA 3LHKA 5K4GA 5BWNA 2BFDA 3CB2A 3V4PB 1YA6A 1OAAA 2QBYA 1VSBA 2A4KA 4MV8A 3FX2A 5JFOA 4O3MA 3ETLA 1G20A 1DBVO 1R12A 2GN4A 4EYOA 4HFNA 4BX8A 4IJVA 3D8UA 5AK4A 4Q16A 1NDUA 3EEIA 2GZDA 3TVYA 4QQRA 1LY1A 4IR7A 5TMEA 2Q5IA 2C1EA 1T6XA 2HEIA 2FWJA 1J49A 2GPNA 3DQQA 4CMEA 1BFKA 2ESRA 2YY6A 4JDPA 4BFXA 1ISIA 3AESB 1NVTA 1M2JA 1QBGA 1WQ1R 2Q7XA 1P7YA 1VE3A 1TLTA 3FJOA 4I1IA 4I4CA 3HYTA 5EERA 5TQJA 4D96A 2HWWA 2QUHA 4A73A 2M9MA 3RYFB 3IT0A 2D4HA 4KWTA 3K7EA 5DBEX 1R0BA 1VMAA 3PR2B 2I5PO 3TR6A 3WNZA 3WKCA 4R0NA 1QTNA 3JV7A 3MEQA 1HDRA 2D5AA 2ZLBA 3AUXA 1O57A 4WV3A 4RAQA 5I7RA 2JI9A 3WGUA 5BYKA 5C32A 1DAEA 2WTUA 1N5JA 3J7AC 1FJGB 2JGJA 1VRVA 2IC5A 1XGKA 3QVWA 5M3BA 3HL4A 3P9IA 5IKOA 1SPXA 2OO5A 1TUBA 4KR2A 1NW5A 5CP8A 5EIOA 1RT9A 4W6QA 3WTCA 3LCVB 2J1LA 1V3TA 1Q7CA 2E48A 1FZTA 4AMGA 1VIYA 5JMPA 1WW2A 4NKRA 3DEKA 1QSGA 2BLNA 4Z7JA 1HZJA 3T3NA 1EP2B 2C4NA 2OHJA 2W2VA 2UYYA 4BFVA 4D7AA 4HCJA 2IYSA 4P4SB 5DE3A 1T8SA 4G5QA 5EJEA 1IE3A 5H81A 3REFA 5KNLA 2VJMA 1T91A 2FSPA 2VJAA 4G5OA 1H4QA 1VYHA 4UEKA 2BE9A 5BWMA 1R0RE 5CA0B 2HO5A 2CYCA 1P9LA 2A30A 4KHZA 4TVOA 4QQ8A 3U16A 2GXSA 2IXDA 3NYWA 2PUCA 3MT7A 3ESXA 2DBZA 1SA0A 1ZUIA 4QOIA 4C78A 1HWYA 3F2IA 3W9BA 3QELB 4MCAA 4Y2RA 3S5UA 1NLMA 1ZGJA 3ELBA 4A23A 1MH1A 3OE1A 3WGTA 3RANA 4CUZA 1J42A 4YRZA 1T0UA 1TRKA 4ENPA 3FR8A 1VHLA 2DETA 2H31A 1TJNA 4XR4A 1BW9A 1A7JA 3ED1A 3G17A 2IUUA 3COSA 5K3EA 2F9LA 3BRSA 3DFKA 1Z16A 2Z58A 3DMGA 1NWCA 2FEXA 1WUIS 2I2FA 5DNVA 4L72A 1KZHA 3GDWA 4CIVA 1T8YA 3FNRA 5JAMA 2FZ5A 4ER7A 3MTIA 5E1MA 2Z3ZA 1EX6A 1I6KA 4P81A 1IB6A 1AHPA 1D3AA 2YMLA 5BMVA 3GLRA 1O94C 6CHYA 5L4LA 3L05A 1SXJC 3LH5A 3W8FA 4BTEA 3JZIA 4TKZA 2WUGA 4JP1A 4L16A 4PAGA 5EP2A 5JSYA 4G0WA 4KJXA 1C1DA 2IEAA 1CRZA 2GM5A 3BWDD 4FHZA 3M49A 1T4BA 2OAGA 4KQ2A 4XIYA 4ZVUA 1I33A 3WE7A 3C6QA 3IUQA 2RGWA 4F7DA 1F8GA 4BNXA 1PZEA 3CIFA 5AKHA 2G0TA 3UBTA 1Q0SA 1J9EA 1DWUA 3GEBA 4WOBA 1IULA 1ZOLA 3BULA 3DWGA 4MRMA 3WB0A 1V1MA 5CVVA 1XLTA 3CHYA 1N0IA 3MBKA 5LWQA 1P81A 4OKSA 2JC3A 4JODA 4YXFA 1S96A 1IXYA 1H8EA 1XP8A 1CP2A 2ECFA 2ZYIA 4X93A 1H5NA 4MWGA 4KWHA 3M0EA 4O25A 3SFZA 3UOAB 3BUSA 3X1DA 1NFFA 4X62B 1KDOA 1NIPA 1V2GA 1KY3A 1BWQA 1JLSA 1W4AA 1X70A 5DT9A 1USUA 4UDOA 1GRQA 1N5IA 1WW8A 3UMSA 1OZHA 4ZQGA 2HDHA 4S35A 1A4RA 2A5DA 4OXKA 1DKNA 4I55A 3W5UA 4F3YA 3OE7D 5K0TA 3RK4A 3KB2A 2E4AA 1Y6RA 2R1ZA 5B37A 4GC9A 3B36A 4JYAB 1QMPA 3MCAA 4P7GA 2PWPA 2J33A 1RWQA 1QOZA 4H7HA 2IP1A 3ETCA 1DAMA 1NKSA 2I7DA 1T3HA 4JT4A 3O1JC 4O4LB 3F6EX 2XEDA 1LW6E 3MOGA 2QDXA 4IJ6A 4LRWA 1I3NA 2UUOA 3WYEA 4ZDWA 2O3QA 3KAKA 4KVFA 2QR2A 1ZHHA 1ZK2A 3FCEA 3N3BC 3AR7A 4HN2A 3I2IA 4E09A 3HTXA 2VTKA 5DWDA 1NDHA 3SU8A 1KZ4A 2O2IA 5HRUA 4ZO6A 3EMDA 2GJSA 6NULA 1V39A 4V03A 3SICE 2FVYA 1AHIA 1Q83A 2B4YA 2QVCA 2XZDA 4E3ZA 4JY7A 1JN0A 2KBFA 1KO4A 1R27A 1TZJA 1YIAA 3TMKA 4PYKA 4DVJA 3SC2B 3O8QB 2QJOA 2HRDA 5SY6A 3PD1A 1INLA 4XB1A 3T9BA 2OV6A 4QE3A 4OHKA 2WHXA 1NUTA 3ZWMA 4QYSA 1G8HA 1U94A 3P94A 3H05A 4EG6A 1LSJA 3BVPA 3IEMA 2EFJA 2YUTA 2I6UA 5C1BA 1RJ9B 1A5TA 1U5CA 2IU6A 3IAEA 3QKWA 4KG7A 1QDEA 2Q99A 2ZRFA 1L4UA 2Z8YA 3F6SA 3UMMA 3RU9A 5LM3A 5H3HA 4NZYA 5BYJA 5C4MA 1GUAA 1H2AS 2AI1A 4OHOA 5HQJA 2RD2A 3U7RA 1ADGA 3IEPA 1ZAYA 1GSAA 1GRCA 4HWTA 2GSDA 5F78A 3JD4A 4M0KA 1MIHA 2I3GA 2ZI4A 1E9EA 4MJ7A 2JH8A 1XNRB 2ARKA 3K4QA 2VHQA 4JU8A 3RC8A 1A5ZA 3KKKA 2YJ4A 4HRVA 4UUNA 2A33A 1XU9A 1IN5A 4L22A 2XPCA 2XW6A 1Q84A 2P4QA 3HDGA 1YI1A 1JHOA 2R2GA 3D8TA 3NYQA 4QASA 3T3MB 1XNQB 2OK7A 3BMCB 2F17A 4XQCA 3PJGA 1YR2A 2X9GA 3PVSA 4Q1DA 3ZHBA 2ZS9A 1T1RA 1IM5A 1FPQA 1ZJ5A 4D82A 2C2HA 4PQYA 3EVTA 4RX1A 3G0DA 3D64A 3FZGA 2J48A 1UPAA 4WFKA 4Q1AA 4WK0B 5I3CA 1FFHA 1NVEA 3F74A 4GQIA 3WHPA 4ARSA 4C2TA 2BCGY 3ILHA 1B6GA 2P4SA 3LC1O 2C9OA 2ZR7A 4Q3NA 2J46A 3HA7A 1WCIB 2CHQA 3HVRA 2PK3A 1UF9A 2J5QA 3KNZA 4KL8S 4TLLB 1PZFA 3MWGA 4QVKA 4O2RA 1VA5A 1XU4A 2XNCA 2O8FB 4PWZA 3BH7A 4GRDA 1JUDA 4Y9DA 2D5IA 3TQOA 4Q05A 5A5VA 1Y5IA 1Y1KE 4OLAA 3PEVA 3JZMA 1PVOA 4JBWA 3GG2A 3PNVA 4J0EA 2ZS8A 5KJFA 1XI2A 1LNSA 1XCJA 2PKEA 2BFFB 3DHWC 1M6YA 1XTKA 4KXMA 3HDYA 4HZUA 4BFSA 1RVV1 3AGPA 2HX1A 3EDMA 4FGZA 2FSVA 4CN8A 1XKLA 2IYWA 5ITZB 2V65A 5IK2D 1S8FA 2WD7A 1RWWA 2PE5A 4YQZA 3TFQA 2QE7D 1LF5A 3W2GA 4E2WA 2XDAA 4EW3A 3E84A 3WL6A 3ZOKA 1EKXA 5B36A 1QRUA 2CVFA 3FR7A 3ZE9A 2OY0A 3ZE1B 1EDEA 5A4FS 1P0IA 1JFFB 3BIJA 1K4MA 2VQSA 2QTVB 3ZKWB 1MO6A 1U04A 2BKVA 3FDFA 3FW1A 2R86A 4N5HX 4AO6A 4LFAB 1TM2A 1GRNA 4US2R 2PUFA 3QLUA 3PC8C 1KJIA 3IEUA 2OAQ1 1RM3A 2VXCA 1EFLA 1GQSA 1UMDA 1ZSYA 2GCOB 1MB4A 4I5IA 3UUFA 3OPYB 3ZGYA 5CMLA 5E4TA 5FF9A 3N75A 2F1HA 4OF4A 5K3DA 1OXTA 3KJGA 1IZ0A 4G0ZA 5C0OE 4GPIB 2DHDA 1RWKA 3R7AA 1UKBA 2JGAA 1VKNA 5F4ZA 1DT5A 4KV9A 3ZV3A 3SQWA 3H9JA 3B48A 4EG5A 5HOEA 1U2PA 3P1JA 4NV1A 1OH8A 2UUAB 5TT1A 1OXUA 3WZLA 2NXWA 3FSEA 2FN4A 3OETA 2HADA 2WOOA 4QUAA 2N1BA 4UPVA 1P8JA 4XJSA 5ENZA 4R2IA 3EYWA 1EDOA 1AY0A 1GT91 2QN2A 4TWJA 3G9UA 1U28C 4OBEA 4IPTA 2WD8A 2CB0A 2OZEA 4EJ0A 1PT8A 1OW3B 1CUDA 2R4QA 2W6OA 3P9SA 3RNLA 4DDVA 2IYUA 4M7WA 3AI7A 3GLVA 4X00A 5AXDA 1UT6A 4Q3LA 1WZCA 4OBBA 4G2TA 3GNLA 1NVMB 2GCEA 3ORFA 4Q24A 1YS9A 1W5BA 1ZP6A 1JB9A 2HGSA 3FDIA 1ACJA 1PR4A 4DS3A 1BHJA 1SQGA 3L5OA 1RKQA 1NU8A 1VPLA 3VV2A 1E32A 4C0AC 2BBTA 2OV1A 2PX2A 4NCXA 3INRA 4TOIA 2B20A 4JVLA 2ZIUB 4YTEA 3VDNB 4TTAA 2VTDA 1BXRB 5A03A 4HNGA 1NF3A 1G8AA 1OLUA 3GFSA 5CNMA 5HUJA 3IB6A 3O4RA 3K3PA 4D8WA 2OCYC 3AR6A 4F3CA 2LW7A 5EJ6A 3TW8A 2JK1A 5T57A 3BWBA 2YWRA 2QZZA 4E7PA 1ODIA 3BE5A 5CLJA 1ZQ1A 4CLDA 2BFPA 4EGAA 1EGVB 5ALNA 1M1XB 1S9HA 1T8TA 2GPJA 1KH2A 1UCFA 4MVJI 4Y98A 5EXSA 1ZWKA 4H18A 2BZGA 2GCPA 2HLNA 4ARVA 1UEJA 5L45A 3QVJA 3DT9A 5ECWA 2ZJ4A 5DHFA 4HEHA 2WMOB 1YUMA 2X15A 3QLTA 5K0BA 2B9EA 5FPYA 2WK1A 1QQAA 1U6JA 2PSSA 3BMQB 2VTBA 1FUUA 5AW6A 2Q0SA 1IUOA 4I1UA 1PJAA 2ERXA 1UMKA 3Q9LA 3PU6A 1CVRA 1U0HC 1TO1E 5IABA 3CEAA 3FVWA 4PO8A 1RXIA 2FPSA 4LYGA 1T4CB 2XDQA 2WAYA 2Z4SA 3AQ4A 3QPAA 4HY3A 4QVGA 1AA6A 4DKJA 4NENB 2XUQA 1G8GA 1M1ZA 2FPPA 2HRZA 3ONVA 1NR5A 3QE0A 4U7TB 1XZIA 1RP7A 4GUDA 1GG5A 2AMFA 4B33A 1E4OA 1P1CA 4OQNA 4F97A 3JAKA 1DTEA 3M89A 4MI6A 2AFHB 3HVHA 3ZGOA 5C8ZA 5FDFA 2JG3A 1U5AA 3CYFA 1QOPB 2VT2A 3DAPA 4G0PA 4KDRA 3REQB 4P9NA 3T7TA 1PEYA 1O96A 2CL5A 1US8A 1IQPA 1UQUA 3CH4B 1AQJA 2WKPA 3C41J 3RREA 1A98A 4PEVA 4LCJA 3KCQA 3GLGB 3S2FA 4F6RA 3NWJA 4EW6A 4WASA 2LP4Y 2IZ1A 2AHOA 5J2TB 2XTZA 3V4VB 1UUFA 3H8SA 1QWSA 1S3FA 3L0BA 3WTBA 1U6IA 1NI3A 3IDFA 4LF6B 2VEDA 3JVDA 3AF1A 1DKLA 1NHWA 1O94A 3NIFB 4LUCA 4UU0A 1DCMA 4Y7DA 3ZWBA 1TO2E 4IYRA 1E1QA 1FFDA 3QRWA 3VX3A 5EYPA 2QZPA 4J1NA 1YZNA 4LGMA 3S99A 1D2RA 2VYVA 1BE0A 2CUZA 3UCEA 3OX4A 2XTJA 3LX5A 4Y2GA 1R8JA 4D6PA 4RTPA 3IAM6 2D8MA 2IP4A 2XWJI 1AV6A 3JQPA 4ND8B 1SXJE 4M1SA 1JEYB 5DOZA 5I9SA 4IUBS 2BONA 1OI4A 3UFBA 2QPLA 3K6KA 1DX9A 5E2AA 2NU6B 4D8XA 1USGA 3MXOA 2WM8A 4HG2A 2F6RA 3HUEA 3L7JA 4LOJA 3D2BA 2OWDA 5IJAA 3D3NA 3F97A 5DASA 3STXA 4RTMA 4X3OA 2II6A 3KPWA 1OUMA 4GPAA 5AVWA 3B13B 3RQIA 3OEHA 2WWYA 1BH6A 4IIGA 2PFSA 1GGFA 3PE6A 1BJTA 2EKBA 2ODPA 1N2IA 4YH1A 3RIXA 1NN1A 1JG6A 1P2VA 3VPCA 4WACA 2CBZA 1PQ4A 5JTUA 1C1HA 4R5MA 2UZ4A 1KP9A 1E58A 2JF0A 3KWLA 3T3EA 2GA8A 2RGCA 1FYEA 1TC1A 1CK4A 3BB3A 1Q0PA 5JJBA 2ACEA 5CW1A 3T8YA 1QKKA 3VI3B 4A8TA 6Q21A 1HEIA 2HXSA 1E7WA 1E8NA 4UUAA 4AJPA 2PZBA 3DT8A 1SC6A 1CULC 3PYMA 5E7MA 4G23A 3OPVA 4EX6A 1FRNA 1OWMA 3B1XA 3ND7A 1EVYA 4W7HA 5EQTA 4PYNA 2FMIA 3G8YA 3N8KA 1LLFA 2W2LA 2HD4A 3SLKA 4AL4A 1OPXA 3UH1A 2O14A 3LNCA 1LPNA 1QFYA 3K15A 4FSDA 4IQ8A 5AM1A 1Y6ZA 1YMVA 3CLUC 2PUTA 4DV0B 3GZ4A 1MX5A 1FUEA 1ULSA 2AGVA 2IE0A 3MF4A 3O7MA 2QTZA 4OGFA 4BBZA 1ZG3A 3A9RA 3S1AB 4G4JA 1KKUA 1G9XA 2ZJ2A 3R3UA 4G5XA 2GEKA 3THOA 1HE4A 3I2FA 3E7XA 1GUBA 4NHEA