3ZV4A

Crystal structure of cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (bphb) from pandoraea pnomenusa strain b-356 in apo form at 1.8 angstrom
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
275
structure length
265
Chain Sequence
MKLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAHGGNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTALADLPEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAPHVRVNGVAPGGMNTRGPSSLGVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGDSLPATGALLNYDGGMGVRGFLTAAGGADLPEKLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
publication title Biochemical Studies and Ligand-Bound Structures of Biphenyl Dehydrogenase from Pandoraea Pnomenusa Strain B-356 Reveal a Basis for Broad Specificity of the Enzyme.
pubmed doi rcsb
source organism Pandoraea pnomenusa
molecule tags Oxidoreductase
total genus 94
structure length 265
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.3.1.56: Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase.
pdb deposition date 2011-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zv4A00
1LLQA 2Y0EA 3JTMA 4TRMA 2FR1A 3M1LA 5T57A 4MVJA 4X54A 4IQ8A 1NXQA 3FNEA 2QYSA 2XXBA 3H9UA 4D7AA 3FRJA 3KM0A 3NAQA 4J7UA 1EDZA 1C14A 4CLRA 3PQDA 2UAGA 1Y9EA 1DJQA 3BMCB 3QE3A 3JQCA 1PJLA 3M2PA 4P38A 2DBVO 3B1KA 3ICCA 3K8ZA 1PJ2A 1U2GA 4I08A 4XZ3A 1HDYA 3IS3A 3RC7A 1P1HA 3GGOA 2VRCA 2OXIA 4EUEA 1C1DB 5HA5A 4CV0A 1CWUA 3WLEA 3DZKA 3DZHA 2PNFA 3QW2A 4LK3A 4NJMB 2HKIA 4S3MA 1YQGA 3JSAA 4BOYA 3RJ9A 1JWAB 1U5AA 2NUAA 4ALMA 5TGDA 1LDEA 2C29D 4IINA 3DAPA 1YBMA 4GX0A 2O23A 4C7JA 1Z75A 1HF3A 1PJQA 2VZ9A 3NJ8A 4Z9YA 2UUOA 2VHYA 3TNLA 4YJGB 3CXRA 1WPQA 4TWRA 5TS3A 4PLGA 2X1HA 2WYWA 4ZD6A 3P19A 1SZJG 4P4LA 3QVSA 2WEKA 1D7OA 4M1QA 3U09A 7MDHA 2HMSA 4GMGA 5C7LO 4YJFB 3HZZA 4FOOA 3PEFA 4RF4A 4BKUA 1EUDA 1KYQA 3UKOA 4J49A 3EVTA 1EVIA 4AJJA 3QHAA 2X8LA 5IDXA 3AOGA 2GLXA 2NWQA 4HBGA 2YFQA 1PWZA 3M1AA 4I1IA 5LC1A 1WAMA 3K5PA 1RYEA 3WYEA 3GPDG 4CLXA 2CDAA 5CHEA 1DEHA 1ZSNA 1A4UA 3PYMA 2Y1CA 5TF4A 5IAAA 1FDTA 3RASA 2CMDA 4BNKA 2BFPA 3ZU3A 1T4DA 2D5AA 5L40A 3X2EA 1C3VA 2GZ1A 2X9GA 4BNMA 3ZWOA 2P5UA 1GDHA 2H6EA 3GNTA 3VPSA 2ZJ0A 3RSHA 2PR2A 3WGOA 1V3UA 4YQZA 3GR6A 4BGUA 4BNNA 4EEZA 1NYTA 2GYYA 2O50A 2HRZA 4UEJA 3ULKA 1HDXA 4N5NA 2BRUA 4L73A 4WASA 4CM5A 3RFTA 2HK8A 4WEQA 1K2WA 4CUKA 3WYBA 1LC0A 4JCOA 5IXYA 4OL9A 4E5MA 4CMAA 5EN4A 1FK8A 1K89A 3F46A 4CLHA 4CMJA 4EW6A 4ILKA 4RO0A 5JAIA 3OJLA 2QIOA 4M49A 1Q7GA 2PV7A 1MX3A 1PR9A 2IODA 3JQAD 2TMDA 1WNTA 2FSVA 1NHWA 5COAA 3OA2A 1Y81A 4L4XA 5KCZA 3BMNB 4XGIA 1NHGA 3UHAA 3WDSA 3CTMA 4EJ0A 4EUFA 3LT2A 3PZRA 1O95A 2WD7B 3HB5X 4MINA 2EJWA 5COBA 5B4TA 1TXGA 1ARZA 1JKIA 2RHRA 4XDYA 2G17A 4IDDA 1C0KA 3DHNA 4MVJD 4MVJF 1T1RA 3KYDA 3GEMA 1HRDA 3ROQA 3WIEA 3ZWYA 4M54A 3KTDA 1IY8A 5KVCA 1NFFA 3WXBA 2OOSA 1A5ZA 2ZYDA 3F9IA 1H9AA 2X0JA 2IEBA 4OAQA 3DOCA 4LISA 1XWFA 1CDOA 3HDQA 4BQRA 4FB5A 5L4NA 2VRCD 1H2HA 2HSDA 4IS2A 1YBVA 1F12A 3LF2A 2CSUA 1I10A 3E9NA 2OP0A 4DMLA 3DBHB 2B35A 1L7DA 2D2IA 1GQ2A 4JJGA 4XIYA 1P1RA 2FN7A 3NV9A 4XYMA 3VH1A 2ZTVA 3GRKA 3ZWBA 3SLGA 5A5FA 2Z95A 4FJ0A 3CMCO 1NFRA 5I9NA 1N7GA 4FC6A 4EJ6A 1AE1A 2ZKLA 3KV3O 2QZ9A 3V1YA 3AUSA 1EE9A 4JIGA 1BVRA 5DOZA 1V9LA 3EZLA 4RGBA 3W6ZA 4R1NA 4K28A 1EZ4A 4CMHA 4BNTA 5J23A 1E6UA 1FDSA 1YONA 4BO3A 1LLUA 5I7EA 2DQ4A 4EEXA 3UF0A 2EWMA 3JYNA 5DP2A 5JCXA 2IE0A 2VT2A 4EUHA 5EERA 1E77A 3F6YA 3UICA 4BGEA 2P5YA 1B7GO 3JD4A 1I3NA 3G49A 3H5AA 4XYGA 2PD4A 2FMUA 2LDXA 1TLTA 4BKQA 3B1FA 1I32A 3ZI0A 3H9JA 4YRAA 4LSMA 1I0ZA 3LT1A 4D79A 1HE2A 2FPPA 4UVGA 2QW8A 1E7QA 1M6HA 1ISIA 4L9RA 4PLWA 1GCOA 2WYVA 1A7AA 5JS6A 3DR3A 1R6DA 4CLRB 3AI1A 1LEHA 2Q1WA 2GN6A 2JAHA 2DAPA 1Y1PA 1NWHA 3UH1A 3ITKA 1ZK4A 5JNLA 1JKJA 3H2ZA 3LQFA 1VSVA 1DO8A 1XYGA 2NU9A 1H5QA 4NBWA 5JY6A 5MDHA 5H82A 1ADBA 1RWBA 3KVOA 3TZQA 3DZFA 3AUAA 3VKVA 1X0VA 3DEYX 4DQVA 4YWJA 3HFGA 3EYWA 4IJUA 1JU9A 2DFVA 3E48A 3UAGA 3OIDA 3WICA 3DZIA 4D41A 3KHUA 1DFGA 2HJSA 4R68A 3ZNQA 1ENPA 4MKZA 5FWNA 4CPDA 2GPTA 3GG2A 3EHEA 1BDBA 1KETA 4OM8A 2BELA 9LDTA 2G5CA 2ZK7A 4HV4A 3CIFA 5HS6A 2Y0DA 3VH2A 2X7HA 3ONFA 4QX6A 3ZU2A 1TI7A 2I6TA 3OECA 1ZUD1 2C20A 3OF2A 4H7PA 3O9ZA 4JK3A 5THKA 4ALIA 5T67A 1GYPA 4KDFA 1Q2XA 3JQEA 4XDZA 2D59A 3RUHA 2NTNA 3B6ZA 3W8DA 1I8TA 4XWYA 4J0FA 5G0SA 3CINA 3PHLA 4XR9A 3ZWAA 3GVXA 3R6DA 4LVCA 1R16A 3I23A 1W4ZA 3DZGA 4BNZA 3FPLA 3V8BA 4Y9DA 3UOGA 4BL5A 5I7FA 2W2LD 1LX6A 3RUEA 4ALNA 5KJ1A 4DC1A 4WLEA 1WLYA 3ENNA 3JCZA 1E5LA 4N5LA 4IJWA 4TVOA 4UVDA 1XU7A 3GDGA 3AOEA 4AL4A 4C7KA 1I2CA 5A1TA 1I30A 5A4DA 2PKQO 4HXYA 3RU9A 1FDVA 3TN7A 4YEDA 5COQA 4M86A 4W9NC 3ZWCA 4CQLB 4J91A 4GH5A 4JGBA 2DVMA 1JKFA 1P1FA 3OQ6A 2X5KO 1HL3A 3S55A 2PGDA 1SC6A 1L7EA 4IZIA 2B83A 3WGTA 1YL5A 5KOIA 3ASUA 5FFFA 2I3GA 3ZW8A 1F8FA 4N18A 3F47A 3H9GA 1H2BA 3RUFA 3AU9A 5DCUA 4IMRA 1PZGA 1UAYA 3ETGA 1UXIA 2Q46A 3AY7A 3FPCA 3ITDA 3KLMX 3MJTA 4NH4A 4RPLA 5BSEA 5I7VA 3INRA 4WLNA 5TC4A 3AUUA 2H63A 2GSDA 3U4HA 1H6BA 2CF6A 2VYND 1NBOA 5FEUA 1CYDA 2IZ1A 2I76A 2CZCA 2DUUA 2CF5A 1KOLA 3JQ6A 4B3JA 3MJCA 1R66A 3T7EA 2VUTA 3GFBA 1ZK0A 5CDGA 4FBGA 3Q2KA 1I24A 2FPGA 3C7CB 3LC2O 4EZBA 9LDBA 2W98A 3IP3A 5BQFA 4E32A 1A9YA 1BG6A 1NVMB 4D0SA 3KYDB 4GX1A 4FS3A 4KQXA 2Q49A 1YB1A 5TRTA 3N74A 5JC1A 2Q4BA 3AK4A 1XEAA 1K5HA 3QVXA 4IJVA 4CJXA 3U4DA 3GOHA 4DQXA 4NJOA 5F21A 1X13A 3X2FA 6LDHA 1DC6A 5IDQA 1E6WA 5L51A 1OFGA 3JYOA 3PGJA 4YT4A 1GPJA 1VSUA 3RC9A 4AFNA 5A05A 5BT9A 4D46A 4R1TA 3DOJA 4R9SA 1Z45A 2EKQA 3PTZA 2B5WA 4OOFA 1EEHA 3U62A 3PIDA 3KO8A 4CMCA 2LDBA 3C3XA 2VOEA 3QVWA 4J2OA 4ZQHA 3D7LA 2ET6A 4FW8A 1XG5A 4QECA 5FI3A 2J8ZA 4TROA 2BFAA 4E21A 4XRRA 3OJOA 4DLAA 3IC5A 1U2DA 4HKTA 5A5EA 4E3ZA 3E82A 2D5CA 1KEVA 1GL3A 2D8AA 3BMCA 1JLLA 3C24A 5BSFA 1BSVA 3L4BC 4RVSA 4WCFA 2GZ3A 4YAEA 4QQRA 4MVJH 1A71A 4BO1A 3TOXA 1MFPA 1NAHA 1NFQA 1IB6A 4IY1A 4O59O 3GMDA 3WBFA 4OSPA 4N5MA 4FN4A 1IPEA 3WSVA 4J1QA 2ILTA 4NBUA 4RZIA 4CUZA 3UUWA 4RQTA 4PG6A 1P0CA 4RQUA 5B4UA 4PZDA 1VJ1A 1V0JA 3F4BA 3H6KA 3ZWXA 5DCYA 1M2WA 3IUSA 1OMOA 5LCXA 4KMSA 1MB4A 4CM4A 4B8WA 4PLTA 4MKRA 2NVUA 2CUKA 4G5HA 3RBVA 4II3A 3NKLA 1XHLA 3ASVA 4J4HA 4KWIA 2E82A 1Q0LA 4JP3A 4YJGA 3RJ5A 3OSUA 2CD9A 1C0PA 3QWAA 3A28A 2NU6A 3V2GA 4UVHA 2GN9A 4IXWA 3ORFA 1ENYA 4W7IA 2HCTA 4IDBA 1M75A 5DNAA 3HN2A 3H3FA 1SO8A 1VKNA 1NVTA 1X1TA 3HQ4O 4Z0PA 1WP4A 4WLVA 1PL8A 1MA0A 2B0JA 3DTTA 3K96A 3Q9NA 1XDWA 2VWPA 1MG0A 3PHHA 4GLLA 3WOHA 5AYVA 2QX7A 2A4KA 4J4BA 2NU8A 3AJRA 4YTEA 4EGFA 8ADHA 1QXSA 4Y8VA 5JCJA 1PQPA 4MO2A 3ZWWA 1LRLA 4WPGA 1PGJA 2B4TO 3NT4A 2H5LA 4UULA 4XQGA 2PZJA 1CQIA 4NI5A 1WVGA 2O7SA 3QRWA 4IMPA 4BO5A 1IHYA 3QQPA 3TOZA 3RCBA 3ZGYA 1LQTA 3UFXA 3QIVA 5F1OA 4E2ZA 3LC1O 4BS9A 3AI3A 1XQ6A 3K2EA 4HP8A 4DPKA 2I9PA 3L6OO 3IIEA 2OP1A 4ND3A 3QSGA 2AG5A 3NTOA 3SJ7A 4CM3A 1OOEA 2AE2A 1O0SA 4DTIA 4ZJUA 5CDUA 4KUHA 1EE2A 3U9LA 3H8VA 4GX2A 4I8XA 4EJMA 3GEDA 1UDAA 4PLPA 3PQEA 3DMTA 5A03A 1PWXA 2FPIA 2X9NA 3HADA 2E48A 4OO3A 3AFMA 1DIBA 2NSDA 3WLFA 3I9NA 5TJHA 4OXKA 1J6UA 3PP8A 4IQGA 1T25A 3D4NA 4BO4A 3WGZA 2VHVA 3NTRA 2DKNA 1HDRA 2WE8A 3V5NA 4NZ9A 3U4CA 4BNFA 1ISGA 4TRNA 3RROA 3FR7A 4JLWA 2QRKA 2B4QA 5I8WA 4L4RA 4BO7A 1LU9A 4TMFA 5ENDA 4AJOA 2CFCA 4K9DA 4NBRA 3KYCA 3OH8A 4W99A 5HBRA 4RPKA 2Z1MA 5T6BA 1I33A 4QFDA 3ROMA 2R6JA 3VZPA 3ZNOA 3S2IA 4QFCA 4ZN6A 2J3IA 5CDYA 1P1KA 1DXYA 2Y99A 4P4NA 2AHRA 1PJBA 1ZVMA 3VDQA 5H81A 2O4UX 3S1LA 4B8ZA 1G1AA 3ONEA 1T26A 3W6UA 5MGBA 4PG5A 5TLSA 2C07A 1E5QA 1LI4A 3DBHA 4Q3BA 5TIIA 3MCVA 3T4XA 4MIYA 4CM9D 2Y1FA 1KY4A 1JDJA 1Y5RA 3NT5A 3TL2A 4YT8A 1NR7A 2YHUA 2RCYA 1K6IA 3FTPA 4FFRA 3EC7A 4B4WA 4MJLA 3NX4A 3F3SA 2PGJA 4BUCA 3FNHA 1F0YA 3L9WA 4MOWA 3EMKA 5DBIA 1S6YA 3KEOA 3S2FA 4BO0A 3IJRA 2CVZA 1HDGO 4BB5A 4JJIA 1E1MA 1GEGA 1U5CA 3ZV6A 5K6AA 4RVUA 3O4RA 1PGPA 2QQ5A 5EQFA 5TNXA 2G76A 1E1LA 1VL6A 2OORA 3QVOA 3WB9A 2H1SA 3ROPA 2P9GA 3IAHA 1OZAA 3JQDA 2EF1A 3MWEB 2O4CA 1I2ZA 1UJMA 2O3SA 3L0DA 3NJ4A 1J4AA 3ZHBA 1JWBB 4LRTB 3NT2A 4J1NA 4LSWA 1KVRA 1ZH8A 2YQ5A 1S7CA 3HUDA 2JCVA 2GERA 2JFFA 1YQDA 2GUGA 4URFA 1RM4A 3K92A 4FFMA 4AJPA 4EI2A 1X7DA 1E7MA 2O2SA 5L4LA 1PS0A 4XX0A 2Z1NA 3H9QA 4FCCA 3CMMA 1VM6A 5HTOA 5JAMA 2VYVD 4E33A 4I5FA 4OGWA 5CG1A 7ADHA 4JXKA 3W4KA 3F5SA 1FXSA 4NPCA 4WCFB 4J7XA 4R4JA 2OBNA 1IULA 4ND4A 5CEFA 3SLKA 3TPCA 2RHCA 1NPYA 3JQBC 5BNFA 4PIVA 2C54A 5A3JA 1WZEA 3IDSA 4ZHSA 2Y66A 2C5EA 3FTNA 4WK6A 2Y68A 3FNGA 1N8KA 3ZWVA 2AEJA 1U28A 3BYZA 3JD2A 4B4OA 1PJ4A 4OXNA 3K2BA 4RVHA 1LRJA 4CM4B 1G0OA 1JAXA 1PSDA 1R0KA 3W8FA 1O8CA 2AQKA 4Q3DA 2NVUB 2AQ8A 2VWGA 2Z5LA 4F3YA 3O8QA 4ITUA 5B4VA 4IM7A 2O3QA 3KYBA 4J2HA 5ILOA 1YO6A 3WR5A 5HM8A 3E6AA 4ID9A 2YHIA 3CKYA 4H3VA 2O48X 5ENVA 4NG5A 1Z7EA 2D3TA 3HFSA 1IYZA 2YJZA 2CNBA 3G1TA 1Z73A 1Y7TA 1ADCA 4C4OA 4OHUA 3ENKA 1B8PA 3Q1LA 4Y98A 5G0TA 4JBIA 3AM3A 3A14A 4CV1A 1H6AA 3HN7A 4F6CA 1DIAA 3UCEA 3WGGA 2ZQYA 1WDMA 5EPOA 2HMUA 2PD6A 1PJSA 2C59A 1T2CA 1PL6A 3DZBA 3D4PA 1HEUA 1KVQA 1OC2A 1LA2A 4FR5A 4CUJA 3Q11A 2WMDA 4CMIB 1DC3A 3LLVA 1PJTA 3WNQA 1T4BA 2PKQP 1XCBA 1TVEA 4HFJA 4QO7A 3DBVO 4E5YA 2PKRA 2ZCUA 2TMGA 2GASA 1P9LA 3WSWA 3ZH2A 4D44A 3NUGA 5I8ZA 4AG3A 4A2CA 3ZZNA 1GADO 3VHRA 3G3EA 5G4LA 5JFOA 4I9HA 4QO8A 4FC7A 1B16A 1YDWA 5ITWA 3DL2A 4ROSA 4BMNA 4CQLA 1X1EA 3DBLA 3IL2A 3VPXA 4OXYA 5CFZA 3MOGA 3JQFC 4J43A 1MG5A 5T5QA 1E7SA 2WM3A 2DTXA 1ENOA 1LXCA 4BNUA 3DZJA 3W8EA 2HMVA 2G1UA 3Q3CA 5BNTA 4R1UA 5JO9A 4I9UA 3RVDA 1IUKA 5JMWA 2ZATA 3U0BA 3GT0A 3RFXA 3L6EA 3UCXA 3ZNPA 4HY3A 4R54A 4BNGA 2Q2WA 5KKCA 2YZ7A 3PWSA 2J3KA 4DPLA 2IXAA 4M89A 5KJCA 1DSSG 1B2LA 3C1OA 4RF3A 2I65A 4IIUA 4ZQBA 2PLAA 1U3WA 1LLDA 2FZEA 3GUCA 1NQOA 1U8FO 4GVXA 3GLQA 5IDYA 3WTBA 1I2BA 1KBZA 1HYEA 3JQ9C 3KYCB 1PL7A 4Y6PA 3KRTA 5A02A 3I9OA 4J3FA 4J1TA 4YT2A 2IZZA 2DM6A 3MTJA 2EV9A 3GVIA 4BO6A 4BNHA 4DYVA 3I4CA 2CDBA 2EP7A 1KVSA 4ALKA 1AHHA 3VPGA 4D0RA 1N2SA 2X58A 1ZIDA 2GO1A 1PJCA 2EP5A 5DZSA 1AXGA 1Z82A 3HHPA 2UV8A 1U7TA 4Y67A 1EFLA 1H6CA 2GD1O 4GAEA 4ZQEA 3B1JA 5T8KC 2RIRA 3KUXA 4FFNA 4ZQFA 4ND2A 3GUYA 1V8BA 2RBEA 1E1NA 2IDZA 4JJFA 3ANMA 2VHWA 3QA9A 1H0KA 4H16A 4BNIA 3RBZA 5AXDA 3GVHA 1MXFA 2NTVA 2P9CA 1DLJA 3CUKA 5G0WA 4A7PA 5CEEA 4N7RA 3LT4A 1UXGA 1NVGA 1XA0A 1VPDA 5EINA 3BTUA 5IZCC 1ULUA 4II2A 1VI2A 1SNYA 1EDOA 1X7HA 4KZPA 2V6MA 3L07A 6ADHA 2A9FA 4CQMA 1LSJA 4MP3A 4NFHA 1SB8A 2Y67A 3AI2A 5JDIC 4IIVA 4BV8A 3KSUA 2DBZA 3WS7A 1P1IA 3NRCA 4U6QA 4JNKA 1VLLA 4WECA 4BKOA 2BF7A 3FWZA 4IS3A 4WNIA 5U9CA 1PQWA 4NQZA 8LDHA 5DN9A 1E1KA 1GEEA 4CMEC 4UAGA 1G6KA 3GY0A 4BNWA 5ER6A 2ZYAA 4YR9A 4UEOA 2VHXA 3SVTA 1C0LA 1DRVA 4J1SA 2X0IA 5KVSA 3ZWMA 4W4TA 5GMOA 2ZIZA 4NK5A 1NQTA 3OP4A 2PY6A 3WWZA 3ONDA 4GSLA 1RJWA 4QSMA 4WEOA 1B14A 4IQ0A 4R51A 1F17A 2WE7A 3I6QA 3FBGA 3A06A 4CL8A 3GGGA 5AQ1A 5C7IO 3JQ8A 2JAPA 5GZ6A 1P0FA 3FD8A 4HFMA 1AGNA 2W8ZA 5U4QA 2EIHA 3ABIA 1QRRA 1X15A 4K1LA 4RVFA 1WMAA 1WW8A 1P1JA 1TT5A 1AUPA 3MTGA 1Y8QA 3A9WA 3GC6A 3FNFA 1BTOA 4ZA2A 2Y1GA 4BO2A 1O6ZA 4OQYA 4D3DA 3WG9A 2X4GA 1I3LA 3S2EA 1HLDA 1TT7A 1XELA 4RDHA 3GA0A 3STHA 1NX6A 1U3UA 3DWFA 1GV1A 3O8QB 2R00C 3HB4X 1SCUA 4DUPA 1CETA 4LVUA 4NDNE 2AQHA 2IRWA 4RPJA 4W82A 1VE9A 4YACA 4LGVA 4UVIA 2YHIB 2GNAA 5G0UA 4OYRA 2HAEA 1Q7BA 5IN4A 4XKJA 1YRLA 1F14A 5G0VA 3R0IA 1E3JA 3LF1A 3E9QA 2IZ0A 3HDYA 3QY9A 3BHMA 3DHYA 4PG4A 1XIVA 1LTHR 4WOJA 2J5RA 1PU2A 4E2YA 3SC6A 3GN2A 2VUSA 1LLCA 4KUEA 1NASA 1P77A 1N9GA 3HG7A 1MGOA 4BV9A 4IZHA 2WDZA 4NK4A 4DXHA 5GZ3A 2V6GA 3OJ0A 1HYGA 4ND1A 4L0QA 4PZEA 5TSDA 1ZK2A 1HXHA 1C1XA 5DBFA 1Q7CA 2EEZA 2FHSA 1PGOA 4BNVA 3VVBA 3CH6A 5AVOA 4KOAA 3IMFA 4NNJA 1QORA 1EQUA 2FRDA 3R3JA 1ZCJA 3VZQA 3DAGA 5JY1A 3S2GA 2DU8A 5DDIP 2HMWA 1R0SA 1XKQA 3E18A 4LN1A 3CEAA 4FFOA 1KC3A 3PQFA 4RJTA 2P4HX 1BXZA 3W1VA 2P68A 5JLAA 3PHIA 1HE4A 3RC1A 1LUAA 2UYYA 1AXEA 1U1IA 3DBLB 3OQ1A 4L74A 4RZHA 5I9MA 1B3BA 5TT1A 4BB6A 4Z3KA 3OEYA 1CIVA 2YDYA 1DRWA 4GPD1 2AEFA 3ZWNA 3UCFA 3IKTA 1PR3A 3L4SO 3RKUA 3FWNA 4PLZA 3VPFA 2GN4A 3INGA 1UDCA 1DRUA 1EBFA 3I6IA 3K30A 4MVJG 4W6ZA 1YE3A 2DPGA 1ZZEA 3MJ4A 3PJEA 2HK9A 4F6LA 3RD5A 1O9BA 4GWKA 1YGYA 3U4IA 4EYEA 4CLOA 2YUTA 1YKFA 1KEUA 2F00A 2PK3A 4BO8A 3PWKA 5K9ZA 3RUCA 4TZTA 1B26A 4BNLA 1EFKA 1YH3A 2ZB3A 4A10A 1YS4A 1PTJA 4LW8A 4W7HA 5CDSA 1NWCA 1XLTA 5A04A 1JW9B 5IZCA 4HWKA 5ICMA 2OL4A 2POQX 1QSGA 1YBAA 4R16A 3I1JA 4Y6SA 4L75A 4XR4A 4D3FA 3OIGA 1J5PA 1Q0QA 1XR3A 1N1GA 1OC4A 4RLHA 3D64A 3GF4A 2VTDA 4J9VA 4S1VA 1I3MA 2NNLD 5KTKA 5EQDA 2JFGA 1V6AA 1SEVA 2PFGA 2FZWA 3ROKA 3SX2A 1HDOA 1ZEJA 2NLOA 1PIWA 3AFNA 1N1EA 4YAGA 5TJ9A 2WSBA 3NEPX 4KP7A 2JHFA 2Q3EA 3LSYA 4XYBA 3UGKA 1T2EA 2Y93A 5JDCC 3WFJA 4FIZA 1GYRA 4GGOA 2FY8A 2ZTLA 2EKLA 3JD0A 4OSOA 4JN6B 3HJAA 1N5DA 4DLLA 5ER9A 1ADFA 1Y5MA 1KVUA 2B69A 2B4RO 4YAKA 4J7CA 3EUWA 3PDJA 3K31A 3CZRA 5JW6A 1AN9A 3LT0A 3GHHA 1U4OA 2HO5A 4DIOA 2J6IA 3OM9A 1LDNA 2C82A 1E0DA 1GFSA 1QLHA 3GHYA 3PJDA 4YDRA 4CQMB 4RPHA 3EGOA 4KTTE 5T64A 1GD1O 3HSKA 3FSRA 1IE3A 3E5MA 3WBBA 1Y8RA 1NPTO 4YRBA 3DB2A 4NU6A 1CF2O 5IF3A 1GYQA 1UXKA 3GNQA 3PHGA 1DBVO 1WDKA 2BGLA 4Q3AA 5CEJA 2GN8A 4DMMA 3I4FA 4WNCA 1UZNA 4Q9NA 1HETA 2VNAA 1ZSYA 2BFOA 4A03A 4J6FA 4A5OA 3ZHZA 1CRWG 1GPDG 3VZSA 4BQPA 5A9SA 2Q1TA 5CPFA 4PN3A 2AG8A 1ZFNA 1DIRA 1ZW1A 1R0LA 2EGGA 4IGEA 1HSZA 3QWFA 4OH1A 3HDHA 2CVQA 4PLCA 3WX0A 1QG6A 2GRAA 1ULSA 3OETA 4XRGA 2I99A 3JQ8B 1K0UA 1QYXA 4U0JA 3RU7A 4CM6A 2NQ8A 3GH3A 1D1SA 3PLNA 1TB4A 5JPIA 1MUUA 2AXQA 4AJIA 2X23A 3LLSA 4WUVA 4BO9A 4E30A 1E3SA 1ONNA 3SEFA 3V2HA 1OI7A 1LSOA 1TT5B 3T4EA 4CMIA 1Y8QB 5JC8A 3PGXA 3TF5A 1B3RA 3D5QA 1NM5A 3IUPA 4JBHA 2XF8A 4PGFA 3T7CA 3TL3A 4QT0A 3L6DA 1ZMOA 3C1TA 1GR0A 4J4TA 4K26A 3LZ6A 3OA0A 5AXAA 3UVEA 3PIIA 2VRBA 2V6BA 2Q4EA 2ZTMA 3ICPA 3MJSA 3NGLA 1DFHA 3LDHA 3I9KA 1WWKA 3VKUA 3EW7A 2YW9A 2WD8A 4ONEA 5CP8A 1HKUA 2BI8A 1NPDA 2DC1A 4W9NA 3GG9A 1YB5A 3BTOA 3JD3A 1EUCA 2B36A 3QWIA 1EMDA 1QYWA 2W4QA 4U5QA 1P74A 4J16A 5AOVA 3LC7O 3RWBA 1N9GB 1JTVA 2QRLA 3FBTA 4INAA 3PHJA 5U1PA 2C5AA 5L53A 1H6DA 2BKAA 4FSHA 3M6IA 1M6WA 5A9TA 5F1KA 1C1XB 3TZCA 1JQBA 5L9AA 3GEGA 4OJNA 3DFUA 2UUPA 1DAPA 1ML3A 3KBOA 3I52A 3WQQA 1BVUA 1B15A 2OMEA 3ETEA 2GR9A 1BXGA 2O3UA 2OFPA 1D4FA 3B20A 5LDGA 1DHTA 1W6UA 3K6JA 5HRUA 4A0SA 3Q0EA 1EK6A 1P3DA 4DYDA 1GZ6A 1RPNA 1HDCA 3WTCA 2X0RA 4U8GA 2FP4A 2PTGA 4CLEA 5L7TA 4PLHA 3PRJA 2HK7A 2P4QA 3VPHA 1DC4A 1R37A 5KJEA 2XPCA 4U6SA 1O89A 1WZIA 4RVGA 3RAJA 1GQYA 2AA3A 4Z6KA 3WQRA 2YYYA 5L7WA 2BGMA 3HWRA 3RUIA 1JVBA 3MJVA 4IDFA 1M76A 3C8MA 1EQ2A 4MIEA 4B4UA 1CERA 3GGPA 4CLOB 1Y6JA 3RIHA 1NQ5A 2AEMA 3HDJA 3E1KA 3JYLA 1QP8A 3L4BA 4G81A 1HE5A 2B5VA 1T2DA 3UXYA 3WGIA 4TZKA 1ZXLA 3D4OA 3KSDO 3TFQA 3MJEA 1YVEI 3V1UA 1ZBQA 2EERA 1EBUA 1QMGA 2IYOA 4I5EA 2NV6A 4PRKA 1BWSA 4UVEA 1GZ3A 3H2SA 2PD3A 4XJTA 1BDMA 4H15A 4IDAA 5HS4A 1YL7A 3BHIA 1ZO8A 4XA8A 2EXXA 3ZN2A 5JCJD 5CG2A 1E92A 2VN8A 3E5RA 3I9MA 4B7XA 2P2SA 2OGUA 3KOUA 4DC0A 3VTZA 4DBVO 2Q50A 2QRJA 3F1LA 4YA6A 4D43A 2X5OA 3GMSA 3JQAA 1PZHA 3SBOA 1SOWA 1UP6A 3W4IA 1BRMA 5G4KA 4CM1A 5IZ4A 4AJ4A 1GTMA 3INTA 1Q1NA 4GGPA 4IXTA 4BGVA 4DL9A 2WWRA 5JYEA 4BHTA 3SXPA 1LNQA 2IYPA 4AJKA 1E3WA 4I5GA 1SPXA 3KLPX 4OKIA 1RM3A 1YL6A 2HU2A 3LK7A 5BR7A 1SBYA 2FR0A 2Y1DA 4MIOA 3LVFO 2JL1A 1DLIA 2NACA 2QHXA 1Y8RB 4AJLA 3G17A 3WNVA 1KC1A 2X9VA 4R69A 1DB3A 5KWEA 3COSA 3P2OA 4JBGA 1SEPA 4BKRA 4QUKA 1A72A 2DPHA 2Y0CA 4YXFA 4DWVA 3DBRA 2J3HA 4DVJA 1HWYA 4DLBA 5JMPA 5A9SB 1LRKA 4KQWA 1HSOA 3H9EO 1Q0HA 2V7PA 4KTVE 2BGKA 4E13A 3AM5A 4MKXA 5B12A 4GQAA 1A9ZA 2HUNA 2FWMX 4PVDA 2VHZA 4ALLA 3KB6A 4YYZA 3IP1A 5LDHA 2P9EA 2HDHA 1L1FA 3K73O 4AJNA 3GRPA 1YOVB 3D3EA 3VH4A 3MWDB 4IJKA 3RFVA 5I9LA 2UDPA 3PYXA 4Z0HO 3ZHYA 4L76A 5A06A 4IDEA 4TSKA 2PH5A 3O38A 2H9IA 1BMDA 1HDZA 4Z0TA 3V2UA 3GPIA 4QTZA 5F1PA 4N54A 1ONPA 2Q1SA 1W0CA 3W4JA 4FOSA 1X14A 2I66A 4NBTA 1ISFA 4MP6A 2W2KA 2YV2A 2AQIA 3BHJA 2ZB8A 2I5PO 4IUYA 2C2YA 4LCJA 1LDMA 2F1KA 4PFJA 4Z9XA 4P4GA 1W73A 3FHLA 3DXFA 4R5HA 1V3VA 2EKPA 2BFMA 2DTDA 2ZYGA 5H83A 4TKMA 1Z7BA 2QZZA 3QP9A 1N7HA 5TX7A 4BVAA 1JA9A 2RAFA 1GV0A 2C2XA 3H4VA 3GDFA 4WGGA 3PXXA 1PZFA 4DREA 3DO5A 1UDBA 4YVFA 1VRWA 3GZNA 3BXXA 1G0NA 2X22A 1JAYA 3RUAA 3UN1A 2BHLA 1LQUA 4M87A 1QR6A 4GX5A 3ZV5A 3ZU4A 1HZZA 5HWSA 4HX5A 5I7SA 1HZJA 5KNLA 3OMLA 2XXJA 4O63O 3WMXA 1R4MA 2GZ2A 3NGXA 2A94A 3ZWPA 2NVWA 4XEHA 4OMUA 1EVYA 2PZKA 3I3OA 4UUOA 5B37A 3KETA 2PZMA 3V1TC 1DIHA 1GZ4A 4NFYA 1BXGB 1TA4A 4BIIA 1SAYA 4OIMA 2EW2A 2G0TA 1UXJA 5DBGA 2CY0A 4BMVA 1DPGA 3UW3A 1GUZA 1O94A 1KVTA 3JYQA 3ZHXA 3TZKA 1RKXA 1WXDA 4AJEA 1HE3A 2NTJA 1EK5A 5L7YA 4CODB 1GUFA 1ZK1A 3GN1A 5EL0A 4XYLA 3FCOA 1NNUA 1YQXA 1ZSVA 3WJAA 1MP0A 3C7DB 1VC2A 3O03A 4MPDA 1UAGA 4OOEA 1FDWA 3DHEA 2VOJA 1T2AA 1B8UA 3I9LA 3AOEC 3TJRA 4WLUA 4CM8A 1CQJA 1KIFA 4RL6A 1FMCA 3QWBA 2JCXA 5DCWA 1H9BA 2BMAA 2NVBA 4D42A 4KUGA 4IGFA 5CPBA 4WE3A 3KEQA 3EDMA 2PH3A 4ESOA 5EMHA 3DTYA 2HJRA 3KSZO 3PDUA 1IHXA 4CR6A 2PA3A 3ADPA 3JQGA 3WFIA 3U3XA 4RF2A 2WJPA 3FI9A 3WYCA 1W8DA 2OZPA 3AWDA 5L4SA 2BD0A 3ZV4A 2HRBA 2W2LA 2ZB4A 3JQBA 4TKLA 4UUNA 1ISJA 3QV1A 2BH9A 1E3LA 2DTEA 4J90A 1GAEO 3BMOA 5CDTA 1V3TA 4GVLA 3GNSA 1JN0A 2Y1OA 4YT5A 4P8RA 1J0XO 1VJTA 4RDIA 1SMKA 3JQ7A 4E0BA 2O3JA 4O0LA 3DDNA 5KJFA 3EZYA 4LCEA 2P91A 4PG8A 2YV1A 4UUPA 2IEDA 5C5IA 4FFLA 2HQ1A 3E9MA 2WTBA 4O6VA 4FQ8A 1BXKA 4CV2A 1DHRA 5IDWA 2AMFA 1UZMA 3PI7A 1JVSA 4OKNA 4CMGA 4PLFA 1U3VA 5A9RA 3BZUA 2GGSA 5DP1A 2EHDA 3JQAB 3ZNNA 3B70A 2J3JA 3QWHA 5IN5A 3ETDA 1FDUA 3IJPA 4DIFA 4E31A 1D1TA 5G4KB 2V65A 5C37A 2VYNA 1ZKMA 1FJHA 5THQA 1GU7A 4E12A 3PLRA 4FJ2A 1ENZA 1P33A 3NDRA 4XQCA 4XYEA 3A4VA 4HADA 3TDKA 3M2TA 4ZVVA 2YY7A 2OUIA 3BAZA 2Q2VA 4CL3A 1J49A 1E3WB 1GUYA 1MLDA 4UEKA 1QV6A 4JROA 4CM7A 3GFGA 4EITA 1YJ8A 1XQ1A 3ZU5A 4GBJA 4TRJA 4P22A 4PZCA 1DJNA 3MOIA 1AHIA 3PK0A 4XGNA 2DFDA 4A26A 2JD1A 2FSSA 1QYCA 3D0OA 4DRYA 3KXDA 2Y1EA 4DBZA 1LSSA 3ANNA 3OFSA 2JHGA 3PPIA 4NIMA 3QVTA 4QEDA 4WCFC 2DLDA 1BGVA 1ZEMA 1IZ0A 3H5NA 1OAAA 4KWHA 4RPGA 4ZU3A 1ID1A 1Z74A 3DBRB 4E2XA 4J9UE 1E7RA 2ZB7A 4MVJI 3TFOA 1KERA 1GCUA 4K6FA 1H94A 3PJGA 2E4AA 2JCYA 4GKVA 4YAJA 5JE8A 2IXBA 4A73A 3ST7A 1X7GA 3EVNA 3OJFA 3D3WA 1PS9A 4UREA 1U4SA 3GQVA 4AVYA 3JQFA 5FI5A 4B7UA 1X0XA 4U7WA 4HNGA 4IBOA 2J5KA 1U3TA 4EDFA 1ONOA 5ILGA 4F46A 1LSUA 1HTBA 4XJSA 3WGHA 4ZRNA 3IQDB 2YV3A 3VH3A 1DOHA 1BHSA 1GQQA 4E4YA 5TT0A 3PFFA 3OHSX 3TZHA 1F8GA 2ZTUA 4FJ1A 2A35A 1HLPA 3I9JA 3WMWA 5DT9A 3OBBA 4D3SA 1U9JA 2W2KB 3TQHA 3IOYA 3I5MA 4Z9FA 1E7YA 5AXCA 1XU9A 4IPTA 1Y9AA 1U8XX 2E49A 3DONA 1CEQA 1MXHA 1PZEA 2AW5A 5ES3A 4JQCA 5F3RA 3JQ9A 4BNJA 4PG7A 3OQBA 1VL8A 1K6JA 1EVZA 1QKIA 2YFHA 3FN4A 1YWGO 4B3IA 1I3KA 1LJ8A 3ON5A 3PFWO 3OJEA 4CQMD 3OIFA 4PLYA 3GZNB 4DPMA 2I3AA 4Z3DA 3P7MA 1D3AA 1I01A 2VTEA 2X6TA 3JD1A 1CJCA 5JAZA 3ADOA 4CLDA 3RI3A 5T8KA 1KEWA 2SCUA 2PZLA 3IKVA 2BLLA 4WLFA 3VDRA 1R4MB 2JFHA 4RLSA 1Z6ZA 4YRDA 5BSGA 2NQTA 2I67A 1T24A 3F5QA 3E03A 4L4SA 4RCVA 5TQVA 1IL0A 2GDZA 4D45A 4YJHA 4PVCA 1A27A 3K9QO 4FGSA 3QJ5A 3S8MA 5JBIA 1YDEA 3DMTC 1F06A 1YJQA 2ZCVA 3LYLA 5CAEA 2NADA 1KY5A 3CSDA 4G65A 4CMKA 1NP3A 1YB4A 3Q6IA 4Q39A 2VZ8A 5JDIA 4Y6RA 4ZRMA 1DFIA 1R15A 5JSFA 1E3IA 3TZ6A 5ICSA 4MP8A 2EJVA 2FR8A 3G79A 3DQPA 2D4AA 4CMEA 4GKBA 2XAAA 4U0KA 2VWHA 4UUMA 1PGNA 4BNYA 1ISHA 4CM8B 1K6XA 4WCDA 1FF9A 1MFZA 3GAFA 1D8AA 3GVCA 3TRIA 1UZLA 5JAQA 1VJ0A 3BMQA 1B0AA 4MDHA 2D1YA 4PRLA 1BW9A 4XB1A 3E8XA 1IPFA 3JQGB 1E7WA 3HE3A 1ORRA 3WQSB 5L3ZA 3GVPA 1R4NA 1UR5A 1UUFA 4JP2A 4B4VA 2ZJ1A 4Q3CA 1UP7A 2WYUA 3ZW9A 1E6EA 3N7UA 2RH8A 3EAGA 5BSHA 1XGKA 2QG4A 3Q9UA 5F5NA 1WMBA 3AUTA 3BMOB 1IZ9A 1PX0A 4R5MA 4RF5A 2YQ4A 5IFLA 1P44A 5C7OO 1M67A 3GDOA 3JV7A 5KJ6A 3PJFA 3JQ7B 5EESA 4AJ2A 4PLVA 3WGYA 4GWGA 3PWZA 5K6AC 4YPOA 5EJ2A 2AE1A 3AW9A 1YXMA 2R00A 1C1DA 3PYLA 4RORA 5IG2A 1ZMTA 3R1IA 5KIAA 3C1AA 2PWZA 5DOVA 4NJMA 4CV3A 1NQAO 2J5QA 4YBZA 3U49A 3U5TA 4DGSA 3NTQA 3VOSA 2CVOA 2DUWA 2QYTA 1C0IA 1H93A 3TWOA 4XQ9A 4GI2A 3L9XA 4GMFA 4TQGA 3GAZA 1PQUA 4MVJP 4PCVA 4BKPA 3AM4A 4CM9A 4Q3EA 3ANLA 3P2YA 4WOKA 5GY7A 4J0EA 4ZICA 1E3EA 1UXHA 1SB9A 1YOVA 4AICA 4HFNA 2GCGA 1MV8A 1PEDA 2VUUA 3L77A 3N58A 1A4IA 2EW8A 4MVJM 2JKVA 3RQSA 1WDLA 2W90A 2X5JO 2C0CA 2BI7A 4ALJA 4IDGA 4NMHA 2YDXA 4ZQGA 3RUDA 4B79A 5DULA 4MVJE 3DAFA 1TEHA 2Q1UA 1OBFO 4BGIA 3ZV3A 1K3TA 4YJFA 1PGQA 2PGLA 3PVZA 3RBXA 4LMPA 1LDBA 2A92A 3D5TA 1PJ3A 2Q2QA 3FF4A 3H3JA 3VC7A 3WWYA 1LC3A 1QV7A 2VT3A 3MEQA 1T1SA 2NU7A 5GZ1A 3C7AA 3GK3A 3ZCXA 3CE6A 4YQYA 3ZDFA 3BTSA 2Y05A 2RH4A 3QLJA 3D3WB 4DA9A 2E6UX 5JO0A 1SOVA 3PZBA 2O7QA 4Q3NA 4XD2A 1ADGA 4KDEA 1EVJA 3JYPA 3AY3A 2VZ0A 3NDJA 4GLOA 5L45A 2VYVA 2D0IA 3H7AA 1ZNQO 2EG9A 1HYHA 3DC2A 4JX8A 4YAIA 4WLOA 4DIBA 2C7VA 2JD0A 3WGQA 5L95A 3SC4A 3VZRA 4F45A 1DC5A 1HT0A 1LDYA 4CR7A 3H65A 4E6PA 4XGKA 3G0OA 3NYWA 2DT5A 2HLPA 5EIOA 5K0ZA 1V35A 3F1KA 4WKGA 2FOIA 4IDCA 4HFRA 4AJHA 4DQUA 3VVCA 4R01A 5KVQA 3TSCA 5ITVA 1IOLA 3EK2A 3EY4A 1ZJYA 2X0NA 5JXWA 4FFPA 1UP4A 1P31A 2XOXA 1I36A 1VKOA 3CPSA 5KKAA 4HNHA 3BTVA 3WIDA 3O26A 3C85A 4RVDA 5FYDA 4E5PA 5G2OA 2EGHA 3BMNA 4BMSA 3HNPA 4BNXA 4L8VA 5IXSA 2OO5A 2NM0A 3VTFA 2VCYA 4I9NA 3A1NA 5B1YA 3P5SA 2WD7A 3DFZA 4WJZA 5JYDA 3G1UA 5A3VA 4CMBA 4O1MA 1T2FA 3I83A 1RYDA 1B8VA 4XQEA 4HUJA 5ADHA 1XSEA 2JJYA 2O3RA 4EBFA 4NHEA 2Q99A 2UVDA 2B37A 1P45A 2ZQZA 4QXMA 4FGWA 3LU1A 5DF1A 1UH5A 5JDCA 3CZMA 4E2WA 4I5DA 2V6FA 1EUZA 4ND5A 4NU5A 4GSKA 4AJ1A 4E5KA 4E5NA 3KZVA 1N92A 4GL4A 1NAIA 2OHXA 2CDCA 1I5RA 4M8SA 1DIGA 2E37A 2HMTA 4YCAA 5FF9A 3RKRA 4B7CA 4B3HA 3DMYA 3OEWA 3FR8A 3MZ0A 4M55A 1LDGA 4YJHB 1QLJA 1QYVA 4CR8A 4FDAA 2DBQA 2O2YA 4XIJA 5F5LA 1GY8A 2Q45A 2VWQA 4OQZA 1M66A 3GZ4A 3SJUA 5KVVA 1KEPA 3D1LA 1ZJZA 1LBEA 4YB8A 4TVBA 5AXBA 1VL0A 1RM0A 4NBVA 4XCVA 1MC5A 1DDOA 2VNSA 3VAZA 2JD2A 4XB2A 2X86A 4R9RA 1MC4A 1O5IA 2R2GA 4O5OA 3AY6A 3BIOA 3F4LA 1NTOA 1ISMA 3Q2IA 1NR1A 1QYDA 1KS9A 4A27A 2C7GA 1DAOA 2G82A 1RM5A 1ZXBA 2VQ3A 5BNIA 4ZGWA 4RV9A 2GF2A 5C3MA 4R41A 2O3TA 4FD3A 4K6CA 4R3NA 3WJ7A 4TRRA 3BMQB 2OBYA 4LRSB 1ZK3A 1BW9B 5IJZA 4NR0A 3OICA 4FPXA 1A7KA 4LMRA 3NDIA 1R12A 4R3WA 4YJDA 3H5RA 3BA1A 4G2NA 3R3SA 3RC2A 2DBRA 1U7HA 4NFSA 3AU8A 1R4NB 3DOOA 4R1SA 1PS8A
chains in the Genus database with same CATH superfamily
2Y0EA 1REQA 3M1LA 5T57A 4YR7A 2JK0A 4IQ8A 2FLVA 4MRMA 3FNEA 2XXBA 4D7AA 3NAQA 2F17A 3Q7TA 1U1FA 1A82A 2YZGA 4PICA 1C14A 1NSTA 2RONA 3O4GA 2UAGA 5EEGA 1Z5UA 2KW5A 3BMCB 3QE3A 3JQCA 1CJBA 3DL7A 1A1SA 2QJOA 3D6AA 1JH8A 3W2FA 4J3NA 3UFBA 1PJ2A 3DZCA 2A84A 4XZ3A 3OQMA 2AEEA 1FTYA 2P9TA 5EWMB 4X1OA 4DJTA 1YRHA 5K0NA 1OUMA 2DBYA 2JFYA 3GGOA 5JT1A 2OYCA 1M7BA 2IXEA 2XJ9A 2ISSD 2O2IA 3VI3B 4LK3A 1HYQA 5ALJA 1ZHHA 5IWAB 4K9OA 1IH8A 1Z8NA 4UAVA 5AHXA 3RC3A 4LWZA 4M1KA 1N5MA 2G80A 3JSAA 1HL7A 4FEAA 3V48A 1V96A 1Z7YA 3W2IA 4DLWA 2FG7C 2M6RA 2NUAA 1KQOA 5CM2Z 3RBAA 2X8JB 4ALMA 4NYMQ 4EHIA 2PU7A 3DAPA 2H0AA 4J29A 1USGA 1UK8A 2X2EA 4DLTA 2HRDA 3TW0A 1HF3A 2X9LA 2VK1A 2VHYA 2V6JA 2PZFA 1MR3F 4BFSA 5KI6A 4BX3A 2WIAA 1V47A 5BVGA 1T5TA 1P6UA 2ODEA 3EASA 1ZH2A 2X1HA 3ZBTA 3IKMB 3L6CA 3P19A 1GA1A 4F91B 1L3BA 1SZJG 1Q14A 4ER7A 2GPWA 1EXNA 4WERA 1XEXA 3VO8A 4G0QA 3BN3A 3PB3A 4OQLA 3LLCA 3HCAA 2ZRFA 2VIIA 2HMSA 1KH1A 1DKOA 5C7LO 3X44A 1XALA 1L1QA 3E1GA 1JJIA 1GN9A 4LDZA 4RF4A 5KTSA 3ZD7A 1XRRA 2ECFA 4I55A 1ZD4A 3BXHA 3QG5A 1EVIA 4ZAFA 3P2EA 1VRVA 3AOGA 4M9UA 3ZXSA 1PEAA 5I4BA 1I9GA 2YFQA 1PWZA 2W2MA 3OZAA 2Q5OA 1JHMA 1YB6A 1RYEA 2ZVJA 5REQA 1OZFA 3PEEA 4AF8A 5KQRA 2C5LA 3NG1A 5CHEA 3CJQA 2BFDB 5KAPA 2Y1CA 3AL2A 5TF4A 3HFRA 5IAAA 1Q0RA 2JI4A 3F5DA 3KVRA 3HUEA 2V7GA 2CMDA 1QTRA 2QE7D 3ZU3A 4EARA 3LDUA 2D1QA 2D2XA 2GZ1A 5TR9A 1JMVA 1D5CA 3KR2A 3T6KA 2G07A 2P5UA 3UJ8A 2HF8A 3TX6A 3RYFB 4KACA 3OFNA 1VSTA 1PD1A 2PR2A 3F98A 3RSHA 3WGOA 1G9SA 2IUFA 2C4WA 2GYYA 3NXKA 1Y8AA 4MJ3A 2PGXA 2REBA 3EXG2 5EIXA 4G41A 4N5NA 2QL7A 1SK8A 2H85A 2NTYC 1KF0A 2CLIB 1G8YA 2HK8A 3BZWA 3P94A 4L95C 4Y0NA 5FBWB 2HIAA 2NSYA 2O19A 1RJFA 2FDCA 4JCOA 5JXGA 4L9WA 4AMYA 3C3KA 2FSPA 4EG3A 5IXYA 2IPOA 3TBKA 1OILA 1MO5A 1IZ7A 1HE8B 2C4KA 1OYOA 3OJLA 2JB9A 2QIOA 3SU8A 1FX0B 3HUFA 3TTUA 1PR9A 1U9YA 2CLCX 3JQAD 4Q6WA 2TMDA 4H1HA 1NHWA 1RHRA 4L9SA 3OA2A 4RMIA 2XCSB 3S28A 2IEZA 1OHHD 2VP6A 1PJ8A 3TXAA 3UHAA 3LS2A 1I7DA 3AVUA 3CTMA 1MX1A 2F3RA 3SMQA 1AKVA 1ORIA 4MINA 4DEVA 3CLHA 2WWGA 2X14A 1C7RA 2CLLB 2FRDC 4U7TB 4KBFA 1BYUA 3B48A 1JKIA 2Z56A 4QPZA 5EUQB 2YWEA 1FFDA 2G17A 2ZDGA 4IX1A 1ODLA 1P7WA 4IDDA 3S5UA 4XH9B 4FNMA 4CTJA 5LL6P 3ZY2A 2PUCA 1Y6ZA 3L02A 3PD1A 4B82A 2PMBA 4EWLA 5A4FS 2GHTA 4C0WA 2GFQA 3LDFA 2XODA 2OB2A 4E03A 1OB2A 3ZVNA 3LKZA 3KTDA 2IU4A 4KC0A 5EMMA 1NFFA 1MZPA 3ZQJA 3CWCA 1LK7A 3FZGA 4DCCA 1Y98A 2OV4A 4GI5A 1A5ZA 4X20A 1A7JA 1B42A 2Y27A 3F9IA 4G56A 2EIXA 4QGAA 4ZCTA 4ZCMA 3O1JC 1AKEA 3SR0A 4HDCA 2JGEA 1CDOA 4K86A 2RHMA 3M6XA 5KNCD 5L4NA 1RS0A 1ZOIA 3GYBA 3SQDA 3BWXA 3OO1A 2WG2A 4D6PA 4XB6B 1SA0A 3G5TA 3LY8A 3ACCA 3OOJA 1DRJA 2BUAA 2LUOA 1BKDR 1JFRA 1G5TA 2EC5A 4MV7A 5AM0A 2V9CA 2WV9A 1GQ2A 1JDTA 1VYUA 1OVGA 1Y1KE 3A04A 3K53A 4KRXA 1P1RA 3QQ5A 3MGKA 1RWOA 4HVTA 4X92A 2VK2A 2Z95A 3QTTA 2WAXA 1U2ZA 1CB0A 1A5AB 3NU1A 4RBNA 1U9IC 1A0OA 3CYFA 3IX7A 3ME5A 2FF5A 2ZOSA 4J2TA 5HXAA 1ZUHA 5JH7A 4TXNA 4EJ6A 1ZP6A 2QZ9A 3V1YA 3ORHA 1MA3A 3AUSA 1PTJC 1RWWA 3IBGA 3K1AA 2PWYA 2R1TA 2W6CX 4FYXA 2IXTA 1RZVA 2MTBA 4OB7A 4KQIA 1V9LA 1YZVA 1JQKA 3NBYC 4K28A 2VG8A 5AHWA 2EHJA 2EQBA 1LLUA 3BZBA 2DQ4A 4EEXA 2K7ZA 2ZIEA 4IJMA 3PEYA 3V7WA 2UKDA 3CS3A 3L40A 1KZ7B 1FCJA 3JAMA 1E77A 3CH7A 3ZZMA 2JEZA 1V5IA 2QRGA 3ZJUA 1N2IA 3G49A 4FSDA 1VSQA 5CX1B 1AGYA 2LDXA 1OZ0A 5DFAA 4Z49A 1MOSA 1IBCA 1TQ8A 2IIVA 2ZTHA 4ML3A 4DCPA 3RYIA 1A9XB 5A5VA 5EP2A 3IV9A 3H9JA 4FFSA 4JUAA 4YONB 4EGSA 5BV0A 2XXAB 3LUHA 2NXNA 5CA1F 4C08A 4NECA 3LKBA 4EMSA 1HE2A 1OSNA 4RKRA 1ZICA 2FPPA 4UVGA 1KJNA 1Q1GA 1U6IA 5CK5A 3Q98A 4L9RA 3DJYA 1GCOA 2FW7A 4E09A 1A7AA 5FA8A 2NX2A 1JXOA 1G9XA 2Z9DA 2H51A 4JJKA 4K5QA 3R7AA 4RSMA 4WNAB 1Z0IA 1XCLA 2Q1WA 2NO4A 2DWPA 5B64A 1P5JA 4MR9B 2CEKA 5DX0A 2DAPA 1Y1PA 1TLLA 2PGNA 2PUWA 5EJFA 3G8CA 3ZXIA 1E4EA 1NVVQ 2P41A 4A91A 5FTJA 1VSVA 1DO8A 2GBIA 3ICWA 1T0JB 5I5GA 3Q0IA 4EFNA 5MDHA 3TLGA 4QJ3A 1ODIA 5H82A 1WCYA 5KYWB 3GGDA 1RWBA 1D9XA 3KVOA 4RMJA 3G9XA 4FQ7A 5EHXA 3NWBA 3EZ9A 5BMVB 2CYBA 2GAJA 3GV0A 1Q44A 2DH6A 4W5NA 2Z2YA 2WHQA 3UAGA 1MRNA 4M0MA 2I3DA 3OPYA 4G8CA 1DJPA 2PLWA 3DB1A 1DFGA 1U6JA 2HJSA 3LWBA 5D6OA 4ZT4A 5AVZA 1ENPA 3H5VA 4FFWA 1DI0A 1SUBA 2WSYB 4WBNF 2JLVA 1ZIYA 1Y82A 2A5LA 4CPDA 3GG2A 2WJ6A 2YVQA 1YHYA 4G37A 4Q37A 3EMBA 1PRYA 1G291 4JXJA 4N0PA 5ALNA 3ASZA 4OM8A 4B31A 4RPCA 4EF5A 2H4YA 2ZK7A 5HS6A 2Y0DA 3RAPR 3MK31 2X7HA 3ONFA 4QX6A 4WOBA 1Z28A 1YS1X 3AF5A 3L0CA 4L50A 1ND5A 1XTBA 4JK3A 5THKA 4K3UA 3CKMA 2XYGA 3ELYA 1GGFA 3LP5A 3W5BA 3LXXA 4KDFA 3EFHA 5ADUS 1XTSA 5JBQA 3RUHA 3LPNA 3W8DA 3DYIA 5FJIA 3IUMA 3HUUA 2WHEA 3GJRA 3FI0A 5K3AA 1PD0A 1EQAA 3GUUA 4IIJB 1CDDA 4ZCPA 1ABBA 2NXJA 1XZAA 4Y7DA 4OQDA 3AVYA 2Y3IA 3M6LA 1QHHB 1R16A 3I23A 3KPVA 4LY0A 1W4ZA 1QPGA 3B51X 4Y9DA 1Z38A 1AVTA 1TU0A 4BL5A 1U2QA 1NW6A 5JVDB 4DEXA 5I7FA 2V03A 5CHYA 3K6SA 2WUVA 4HLQB 5KJ1A 2GPYA 3U7HB 1POXA 5CB6A 2R8YA 4Q7EA 1WLYA 3ENNA 2GD0A 4N5LA 1Z22A 3H5IA 4ZKDA 5A1TA 1JQ3A 1L4KA 1TCAA 3G9TA 1PFQA 1Y3FE 3BCRA 2PKQO 3QF4A 4NZMA 4TV9A 4YROA 1KE1A 3IMKA 3WHIA 2ORWA 4CZ2A 2ZSKA 1FFWA 4HXYA 4YEDA 4BX2A 1IY1A 1W52X 4TKUB 5EC8A 4FDMA 4GH5A 4J91A 4JGBA 5L6LB 1HGXA 1RVDA 1UC5B 4B46A 1P1FA 4DCNA 1ELOA 3A6PC 2WW8A 2J09A 2ZS8A 1L7EA 2OQRA 2O8FA 4QT4A 2UYOA 1K68A 4A15A 3R74A 3ZW8A 2XGMA 2LIPA 4D9GA 4O4JF 3EOZA 1JYEA 5A9RA 4IMRA 1RQXA 3ETGA 1UXIA 4MB6A 4S1VA 5BSEA 2AH5A 3MJTA 4NH4A 1I94B 2PUEA 1R6XA 3KUUA 2CFRA 4WLNA 3QU9A 2DX7A 4NX2A 1C9YA 3WGUA 3U4HA 3RTGA 2VYND 3VKFA 4MW5A 3ABQB 1EM8B 3G6WA 2CZCA 1NF2A 3EWSA 2JS7A 4IKOA 5JNTA 1TQ6A 1WB6A 1PNOA 3HFJA 2H7VA 5BV7A 4DLYA 4FBGA 2E0IA 3GBPA 3CKKA 1AK2A 3TTSA 1FVXA 3LC2O 9LDBA 1XCGB 1ZQ9A 1JTEA 5F33A 2J9RA 3BHNA 1E60A 4Q21A 4TS1A 2OE2A 1NVMB 5DSXA 3KYDB 2FW8A 3PENA 4GX1A 3VYTB 4TGLA 1ZRHA 3T52A 4UZEA 2BMJA 3RYTC 1YB1A 1SKBA 4G9BA 3ML1A 4V0KA 4ENSA 2Q4BA 1XAJA 1XEAA 4IJVA 2ECPA 2WNHA 3NASA 1YDFA 1RZRD 1G5QA 3GOHA 1S2GA 2HFJA 3MWEA 4FGUA 4J76A 1NP6A 4LHVA 1G63A 4QEZA 3X2FA 1AHPA 4LDRA 4MTCA 4OUDB 5D84A 4TTAA 3L8FA 2VDWB 6PFKA 1IBSA 1P9RA 4AUNA 1F51E 1GPJA 4B6RA 4EHHA 3D7RA 1ST3A 2YMQA 4TQ9A 5A05A 4WY5A 3REFA 4R1TA 4R9SA 2GQ0A 3V4PB 2AXEA 3P2JA 3AF4A 3U62A 3PIDA 4CMCA 3VM6A 1E59A 3I0ZA 3RM3A 2PPVA 1LPMA 2R60A 3GLSA 4I6GA 3MJDA 2ET6A 3RS4A 4FW8A 4ZTUB 4HS4A 2VLBA 2Q5JA 1D9ZA 3THSA 4MQFA 3RS5A 2BFAA 3BQNB 3D7SA 3O0DA 4DLAA 2Z4SA 3G2PA 3IC5A 3O8OB 1U2DA 1JHDA 4I1RA 3SZOA 5BUSA 3E61A 3NBMA 4X7BA 5EXXA 1J70A 1NP7A 1M2GA 2D5CA 4MUBA 2VJLA 2D8AA 2IF0A 3IR7A 4QHYA 5IM4A 1Q19A 3L4BC 4RVSA 1WBBA 3MRTA 2RHBA 3BCHA 2J33A 3W78A 4BNDA 1K27A 4MVJH 3DG9A 1MFPA 2FQYA 4Q9HA 3UB3A 4XPZA 1U2SA 2XB4A 3GMDA 3AJAA 2FDRA 2ZPUA 3KDPA 4MEJA 1HNZB 1IPEA 3TQQA 2P6UA 2ILTA 3EUFA 2MINB 3F97A 1Y1QA 4NBUA 3KK0A 5KTYA 1UKVY 1NV9A 2ZRDA 1W76A 3OM1A 3VR4A 4BWFB 1S2LA 1SVKA 2DFKB 3F4BA 1V0JA 3STYA 3AHHA 3EGXA 1OMOA 4XDHA 5LCXA 1EFRA 1TVKA 3FOCA 5FR2A 3NGMA 3PUIA 5AK3A 3LQ4A 2DPLA 2V7VA 1OH8A 4QUJA 5JWRA 4WJKB 1F2UB 3DV0A 3RU3A 3ABRB 3OQIB 1VG0B 2WABA 3BQ9A 2HDWA 4KWIA 3ABOB 1VXRA 4RQBA 1GFIA 3EFOB 1XQXA 4JP3A 4YJGA 3DKVA 4HAZA 5FBQB 4ETIA 4Q93A 4PSCA 2CD9A 3MB8A 5LBTA 3RTAA 1P0IA 2P8SA 1RPZA 5BOSA 5DNUA 1JSLA 1Z0DA 1ECFA 3OFVA 4I81A 3DCJA 3RVSA 3AF1A 5DH9A 2OAQ1 2RH9B 4RUKA 3D2LA 4L5CA 3U3RA 2HCTA 5DNAA 4FOTA 3HN2A 3MMPA 1ATIA 1SO8A 1CUIA 3HQ4O 1NVTA 4PFKA 1GKLA 1WP4A 2VK4A 5BSMA 3Q8KA 4F2PA 4H7IA 1DELA 1JSRA 1ZMBA 5FFNA 1P4JA 1X70A 2VQFB 1Y34E 1MG0A 4GLLA 4IIXA 4MW9A 4KN9S 5B53A 4DJ5X 3LBNA 3RTBA 4DQKA 1PJRA 1U0GA 2QX7A 2NU8A 4N0DA 3STTA 4DHWA 3O1IC 4YTEA 1G8HA 2GLUA 3R5KA 4BX8A 5CVTA 5TF0A 4MA4A 3TS1A 8ADHA 5BN4B 5DM0A 3C1UA 4F4CA 3JALA 3W7AA 3ZWWA 4FBLA 2RAVA 3K8QA 3LKVA 5JS7A 4XQGA 1N2JA 2QL9A 1XJ0A 2FMTA 1CQIA 3KIPA 1QB7A 3D1VA 3QRWA 3MWKA 2G6TA 1EJBA 1L4GA 1KSHA 2YV5A 2BJWA 3D3KA 3UFXA 1ZVQA 2RK4A 4ZI2A 5IWCA 3AI3A 2NUPA 4RACA 4FYHA 1WXGA 1E1DA 2C2BA 2J87A 3K2EA 4HP8A 3U40A 2BMDA 3SBDA 3I37X 3W5IA 4DPKA 2I9PA 3L6OO 3T12A 4YY3B 2OP1A 3C5CA 1W4BA 3B3GA 3IKTA 3R75A 3T8YA 3N86A 4OA5A 2AG5A 4KYVA 3NTOA 3SJ7A 1ZD5A 1TEXA 2I2AA 2YR0A 1ZGBA 1EE2A 3G2QA 3H8VA 1FPMA 3LYHA 3PL1A 2XQKA 4BB9A 4ZOCA 4DAOA 4EJMA 5BRJA 1P9WA 4ZWNA 1UDAA 4PLPA 2QI9C 2CB0A 2ZRMA 3WNDA 1PT5A 4DRZA 4UOZA 2KM1A 2BTOA 3WOVA 2D4HA 5D5QA 1ZN7A 4YMUA 2QN8A 3WLFA 4D92A 4CKCB 2I0FA 5TJHA 4M0LA 4M60A 3OLWA 1GN8A 4ZYLA 1J6UA 4QHTA 4TUYB 3T3EA 3X43A 3T5AA 4LHXA 1T25A 3L6UA 5TEWA 4I4IA 4BO4A 1XTIA 2VHVA 4BVKA 1VFPA 2DKNA 3P71T 4H1TA 4QXAA 2WJGA 2QAGA 5HIAA 2VH5R 4NZ9A 4BNFA 1GPKA 1ISGA 3RROA 1AB5A 4MH0R 3L8HA 4GNKA 2HMAA 4M0UA 5I8WA 1WHTB 3T9AA 2R1ZA 3TLMA 4EKGA 4U7HA 4F11A 5ISMA 5ENDA 3HCRA 4LCBA 4K9DA 3KYCA 5FPYA 4W99A 1EDDA 5HBRA 4IHKA 2ZRHA 1OBVA 3FVRA 1SKMA 3JAWB 3L93A 2XB6A 2E4YA 2PX2A 3AW8A 1KU0A 4A0HA 4QFDA 2E4UA 2R6JA 5K3OA 3S2IA 4QFCA 4HOYA 4CCSA 1P1KA 3I9FA 1RDFA 1DXYA 3DD5A 2Y99A 4D4KA 5KSWB 2OGWA 3VTKA 5DTJA 3GUHA 2P69A 2O1WA 1TJ3A 2AKAB 1E2HA 3VPAA 2NOAA 4B8ZA 1G1AA 5ICEA 3W6UA 2GCPA 4PG5A 1Y3CE 5AVRA 4F56A 3T7IA 3AVPA 1L8LA 3SVLA 2C07A 4WA7A 1BX3A 3DBHA 3QLEA 1I51A 3MCVA 2V7TA 4ZOLB 4CM9D 1KY4A 5A6VA 4OJKA 4R7ZA 3OEED 2QD5A 3SZUA 2ZBRA 3S81A 3L79A 3TVDA 1GKIA 2EQ5A 5AVVA 3FKSD 2RCYA 4EHLA 1CY4A 3PCTA 3EC7A 4MJLA 3D54D 4BASA 1JFFA 2AF3C 2HRRA 3FNHA 3HWX1 3MFYA 1N2GA 3GPLA 1PAUA 4MOWA 2LWIA 3S2FA 2FPGB 3KEOA 1P19A 3IJRA 4QATA 3IQEA 4JJIA 2IH2A 4HDMB 1UKYA 3FCSB 4MXDA 4XFKA 2A0UA 3VOTA 1KDTA 3ANXA 3KAJA 4LRYA 3I6BA 1LV7A 3QVOA 2ZI4A 4PGMA 3QKTA 3JQDA 1O94C 2EF1A 4U7JA 4H7JA 1I2ZA 4KWCA 4M1ZA 4MUIA 1VLHA 3WWOA 3L0DA 3UMCA 4Q4CA 3KXIA 2VQSA 2ZUTA 3BDVA 3QBTA 4LSWA 1KVRA 1WP9A 3GRUA 4MCHA 4TWIA 3UUEA 3F5FA 5ESRA 3NRJA 1TF5A 1SUIA 1S7CA 4C6SA 5E9JA 5AD1A 1RRKA 1W59A 1QIDA 2JFFA 3EZXA 5LQMA 1RM4A 3PX2A 3K92A 3LUPA 4B33A 4G4IA 3IRVA 4OSEA 4Y1RA 2JGMA 1OX6A 4EI2A 1J56A 2QMOA 3KJIA 3B85A 2GS9A 3H9QA 3P9SA 3CMMA 1HNNA 2HHLA 2IYNA 4LHWA 5LZ2A 4E33A 4EG4A 2C2WA 4I5FA 1A9TA 1NBME 3DA8A 4E6EA 2A1TS 3F5SA 3L5OA 4MGEA 1JLLB 3EOAI 3HP4A 3OCVA 4HWRA 4WSOA 1IULA 2WTXA 3DDWA 4RFSB 4HUQA 2RHCA 1X87A 1CR1A 1NPYA 3ZD6A 5EMLA 3UAOA 2NYVA 1SG0A 2R68A 1W6RA 3CSSA 4JITA 4PIVA 3U19A 3QEKA 1ZGJA 1PKXA 2P67A 1WETA 3DKRA 2QV0A 1DBPA 1E18A 5EZSA 5FNVA 4JQZA 4TT3A 1OFTA 4FDLA 1N8KA 3K6RA 4DJDC 5EHZA 1IN6A 3JD2A 4PHCA 2UVPA 2XTMA 1LRJA 4CM4B 5K3CA 1ZMXA 3S4YA 4PSAA 3VR1A 1R0KA 1YCGA 2AQKA 2NVUB 1AZTA 3PA8A 4LBVA 2J4DA 3FUWA 1M7GA 1VG8A 2Z5LA 4IH9A 1ZLYA 3O8QA 4TS3A 4MYDA 2E85A 4V2UA 5D51S 4CF4A 1A69A 5IABA 4IM7A 1B41A 2JGRA 2WPDD 4J2HA 4RMNA 1YO6A 1HO3A 2WHYA 5HM8A 4ID9A 3LUAA 2GEFA 4H3VA 1AQLA 1ZUIA 1Z7EA 3IEIA 2I22A 1Y7TA 2DUJA 2WAAA 1CY7A 3VO2A 3IVGA 4C4OA 2P78A 5E7QA 2UXDB 2CJPA 2ZRIA 1P5RA 3ENKA 4I14A 1T9DA 4P80A 2CD7A 2PQ6A 1L5OA 5KOHB 1QIHA 3UOWA 4CV1A 1PHRA 1QGUB 2B4YA 2XE7A 3NS7A 4LGYA 4ODIA 1ZCFA 3WGGA 2WJHA 2E3JA 1K8XB 3KFXA 4LNUA 1AHNA 1GA6A 4NAHA 1XMJA 5EPOA 1T2CA 4BUZA 3NB0A 1SIWA 4FR5A 4HGQA 4K6GA 3TZBA 1HOXA 4GE0A 5IARA 3S70A 1SWWA 4D6XA 1O6BA 2ICAA 2GJSA 3BE4A 4C7OA 3LLVA 3EA5A 1PJTA 3NBZC 4RV5A 2PKQP 1UOPA 1XCBA 4QO7A 1B93A 4RYDA 1YASA 2PKRA 2QD3A 1XXHE 3DQQA 2GASA 1P9LA 1PUJA 4IL5A 3WSWA 1QIIA 2X15A 4D44A 4KFCA 2V74B 4KYIB 4G0NA 4DMRA 1O6FA 5FOXA 4A2CA 4ASUA 5BWBA 1GADO 3G3EA 4KAAA 5JFOA 2Y4OA 2C57A 4RABA 1B16A 4P53A 5ITWA 3L49A 4V0RA 1WKCA 2YMMA 3CFYA 1AQNA 1TMKA 3VPXA 1WUKS 5CB4F 1C4OA 2WM3A 4YLGA 1SXJA 4U7FA 2HWXA 2YC2C 2I6UA 2WUWE 3LYAA 5CBKA 2GNOA 3ZXXA 3DZJA 2Z9BA 2G1UA 3SIPA 4CFSA 1P72A 4QHSA 4BJ5A 1OAOA 2WG0A 4LSZA 4R1MA 3SZRA 3UMFA 4FT4A 3O95A 5JO9A 4I9UA 1V4BA 4V2IA 2ZATA 2IYLD 3PUHA 1O6CA 5ARCA 3U0BA 4U7DA 3T1HB 3L6EA 2IIBA 4WW0A 1YA8A 4Y2GA 1GZSA 2JAXA 4A2QA 4RH0A 4ARIA 1T36A 4M89A 2NW6A 3MS4A 1FY2A 2WZDA 3MS7A 4F5YA 5ALZA 5EUCA 3UXMA 2IVZA 5LP6F 4LE1A 1UKZA 1Y63A 2WM2A 1AKUA 1PT6A 3CEHA 3K5HA 4RADA 1B6TA 1U3WA 2IBMA 3DXYA 4HZGA 1A98A 4EKIA 5HGJA 2AN9A 3NEYA 3AB3A 5C81A 3ONNA 4NCNA 3EEYA 3ESQA 3LPAA 2W11A 1WCXA 5CFLA 1GSOA 5EJ4A 4R9VA 2QB5A 3P20A 4M7PA 5EIEA 2IZZA 4IHJB 2QZPA 1SC1A 1RNLA 4BLUA 3DNFA 4ALKA 5B6IA 1C8LA 4IIYA 2JANA 3VPGA 4D0RA 5K4HA 2X58A 4YGXB 1C8VB 4YASA 4KCGA 1LW7A 3S2YA 4C0XA 3KJEA 1NX9A 2ZVPX 3HHPA 1U7TA 2HU7A 4Y67A 4NBKA 1RFGE 1WPRA 3LBFA 4YYEA 2HD4A 1CJSA 1DXOA 3B1JA 3FVTA 5C8VA 5EVCA 2QU8A 4ND2A 3MPUA 3PUKA 4Q4AA 1Q1ZA 2RBEA 3ZHSA 2BFEA 1E1NA 1NYRA 2IDZA 2P9HA 4JJFA 5TQ2B 2VHWA 3QA9A 4KIGA 3TIGA 4BATA 2YJ3A 5AXDA 4UQOA 2QMZA 1MXFA 1F38A 5KX5A 1Z5PA 3PGA1 1JSZA 4DKXA 3I53A 2EARA 3OPQA 4PPNA 4Q82A 3VQTA 3MWLA 1XCJA 3SOZA 2PL1A 3CURA 3I8XA 2VBGA 3PC6A 2ALJA 3VYWA 5JASA 1V7CA 1KI4A 2R7AA 5EINA 1JR3D 3K15A 4TV8A 3S7ZA 5CK4A 1M73E 1ULUA 1ZUNA 4II2A 1VI2A 5IZCC 1SNYA 1X7HA 1YB7A 1NBHA 1U11A 2GO7A 1X8LA 5E1DA 4CG2A 5GP1A 1JXMA 2Z98A 3TO5A 1VLVA 4NFHA 2D3WA 1SB8A 2Y67A 1KAOA 4D0LB 4TYYA 2H7CA 3KSUA 2DBZA 1BAPA 1GNVA 4PE5B 4JXXA 3WLAA 1I3OA 1VLLA 2P7IA 3BG5A 4BKOA 2HZ7A 2P30A 2FR8C 4I55F 3UHPA 1ZM2A 1PQWA 3NHUA 4RKEA 1T8SA 2FLWA 4KXXA 2QTHA 4NQZA 4ZO7A 7YASA 5HIKA 5JAPA 1E1KA 2QZ4A 3FSGD 4AW9A 3BDAA 4BNWA 5I7RA 2CV1A 4YRLA 1D2MA 4UEOA 3HMKA 2CWWA 4RSRA 2FW1A 4BLSA 1QYRA 3AQ4A 1M0SA 2GEVA 2J32A 2W93A 3MG9A 5K0JA 3II6X 5H02A 3IA7A 4YIKA 4QGSA 3LI2A 4X90A 3ZEIA 4NK5A 3NORA 5HZGA 3OP4A 3D0KA 2ENUA 5HMMA 1DAMA 3ONDA 4ZDKA 4L5AA 5L3SA 1RJWA 1B14A 3OFND 4EABA 4R51A 4JJ6A 3VVLA 1V1RB 2NAFA 2TS1A 3BEDA 4UJ3A 1NY5A 3JAKB 4MV6A 4PPYA 1CP3A 1QO0A 2ZBUA 4R1QA 3GGGA 2QRVA 5GZ6A 3TK1A 2XVAA 3HM2A 3UO8B 2O20A 2GBLC 4IOMA 5FUBA 1NI5A 5KDDA 121PA 4L8FA 4A8JA 1BX1A 4QNNA 2Z3WA 5ALOA 2R6HA 4JVSB 1QRRA 3V9AA 5GGXA 3FYUC 3IB6A 5HUHA 3FMGA 3HCNA 3ELDA 1X15A 4K1LA 3WZMA 1WMAA 3IHKA 3R3UA 1XTRA 4PPGA 1FFCA 2PWAA 5AKLA 4W5QA 4LKOA 2DXIA 1P1JA 3T1QA 1L4MA 2V0GA 3EE6A 3GC6A 2AW3A 4BBAA 1VKHA 4DB4A 3WG9A 1ECLA 4N01A 1I3LA 4NBNA 2OAGA 4RDHA 3NOVA 1TJNA 3GA0A 4R9NA 1WQ1R 1OA0A 1NX6A 2FZ4A 3DWFA 3ZVLA 4MMZB 1M5UA 4DFDA 4MVCA 4F4DA 3WA7A 1SCUA 5ESWA 3HXTA 3N2NA 2IRWA 4HN2A 4LXIA 2WUFA 4RPJA 3VC1A 1TAUA 4W82A 4OBWA 4IH4A 4LGVA 4GP7A 1O96A 2D2EA 1YNSA 2YHIB 1MPTA 4N65A 4XKJA 4CF5A 1YRLA 1F14A 5FOVA 3OIWA 4IF6A 5F7OA 2NVOA 2OBLA 4ZHQA 4OQQA 5I9BA 2BFBB 3QE2A 3ZCSA 2OOKA 4MDEA 2WJIA 1JDSA 1Z2PX 2VNKA 3AI7A 1RQ2A 3G8DA 4L1KA 4RVOA 2J5RA 1PU2A 2DFNA 4WOJA 3RSQA 5TMEA 4F8JA 5KHLB 1IQ0A 1W75A 4KPYA 2VUSA 4KUEA 1NASA 4BJHB 1P77A 1N9GA 2NZWA 3HG7A 1M2NA 1V3QE 3R5JA 3CG4A 4IZHA 2YHSA 3T5GA 2PHZA 1OWLA 1R0RE 4NK4A 5CT9A 5IJAA 1YZFA 4C89A 4F5EA 1HYGA 4ND1A 5C8XA 3O92A 1A8PA 3DUFA 1KMNA 1L8OA 1OU4A 1SKQA 2PN1A 4M99A 4BYMA 5TSDA 1VB5A 2X19A 3MMXA 3Q8XB 5KZMB 1C1XA 3ZJVA 3QUAA 2FHSA 1EX7A 1V11A 3A1VA 2AGVA 3HBLA 4BNVA 3VVBA 5CT5A 2C9CA 2DOKA 2WVHA 3FPHA 4KOAA 1SVOA 3RNLA 4AB1A 1QORA 4R0MA 2JEYA 1R8SA 4KXQA 3VV3A 2BKUA 3DAGA 4BFUA 3S2GA 4YCNA 2Q4RA 3PEUA 3L3BA 4INOA 2PRJA 1ZD3A 4X84A 3OESA 4E88A 3RRNA 2ASVA 4LN1A 3U4MA 1KC3A 3BH0A 2V5AA 3U31A 2KYRA 2PXAA 2ZU6A 3GJTA 1SCNE 4KH1A 2X0DA 3W1VA 1XZMA 3WLIA 4M1OA 2OFFA 4ETNA 3PXBA 3RC1A 3WGKA 4M7OA 3SZMA 4L74A 1AXEA 4D8TA 1H0HA 3R40A 1P0QA 2CBGA 2PX8A 3QIAA 5B1DA 5TT1A 4Z3KA 3E81A 3P2KA 5J47A 1O8BA 3TM5A 2QENA 4K1XA 3OEYA 4DQDA 3LL4A 1TUBA 4ILEA 4V0NA 4B9EA 3ORRA 1CZHA 3PQ7A 3VPFA 1Z6XA 1DRUA 3I6IA 3K30A 4BC0A 4MVJG 2I03A 2DPGA 5E95A 4TSRA 3QOWA 4F6LA 1ODTC 2Q28A 4GWKA 1YHZA 2PL3A 3UJ7A 2G71A 2XUHA 1Y7PA 3Q8WA 1PHPA 5E6UB 3HO8A 4CLOA 5CXSA 1M8PA 1RAHA 1UMDB 5E1MA 1KEUA 2F00A 2EFHB 2ERXA 3E7FA 3PWKA 4X6YA 4EB8A 4YRSA 2PFKA 4XM0A 4TTIA 1EFKA 4P0QB 2ZB3A 4IV5A 4UU1A 1XLTA 2QDKA 1JW9B 1P0MA 2QM7A 4YRQA 5A04A 2FG6C 1Y9DA 3C8UA 4HWKA 5ICMA 2OL4A 2POQX 1D0VA 3CUYA 4B3BA 1E9EA 1P73A 2JFUA 2GHIA 4MUAA 5T4FA 3S1AA 4XR4A 2HW8A 1RHMA 1J5PA 5A0VA 5KYYB 1XR3A 4HRYA 1OC4A 4JV5B 1MPXA 4XWKA 2PYDA 4J03A 3ZCUA 2VTDA 1JJBA 2NNLD 4ZALA 1V6AA 4ER3A 1Y89A 2HV8A 7REQA 4DILA 4XTCS 3ROKA 3DSRA 3IT3A 3SX2A 3CF0A 1U9ZA 1M6EX 2GBCA 3PQ5A 3R2JA 4LJ8A 3UT0A 4BIMA 2WSBA 2J9ZB 1JU4A 1SUEA 2YVKA 3LSYA 2OV1A 2ODQA 1ETHA 2GI4A 1T2EA 3V34A 3GFSA 1T3ZA 2HB6A 1JHYA 1U9CA 3Q6NA 4YJ2A 1S9HA 4S04A 5IMBA 3JD0A 3QPBA 3OJCA 1C3XA 2CXSA 1AMOA 2OFWA 5JAOA 4DLLA 2PRZA 3DJFA 3JVUA 5FLKA 2XEXA 3Q7QA 3ZI4A 3MMNA 3SSAA 1EWKA 4ZAGA 5CLIA 3K0FB 3FCUB 3K31A 3CZRA 5JW6A 5HCNA 4MUFA 5JNUA 1Z13A 2KLHA 3DULA 3OUUA 2HO5A 2XB8A 1JA1A 4KW7A 1UT5A 2DPYA 3LAWA 1G6Q1 4MI3A 1LDNA 2BW0A 3PJDA 4IILA 1V25A 4LDPA 2GK6A 3ADBA 1PX2A 1R4ZA 2XV1A 3EGOA 3ESCA 3LD9A 2C9ZA 2XHZA 1O0BA 3HSKA 5FXMA 1VB3A 1IE3A 2BHNA 1MGPA 2PT7A 3CLUD 3KJXA 5J59A 5G1OA 1MNQA 3DB2A 3RB8A 2QLMA 1KNQA 2QWXA 3JASB 4JB3A 3MA0A 5HILA 5IJ0A 2PXXA 2AV6A 1UXKA 2Y1WA 1IDOA 5BY2A 1DBVO 1WDKA 2Z2JA 3L8ZA 4C14A 5CEJA 3IERA 1RBZA 1E6CA 3QXGA 3U6BA 4XPIB 2Y92A 1WUHS 3ZC3A 4YPVA 1I7SB 5FO1A 3RLIA 1VP9A 1TQHA 2G1JA 5JRDS 2ONCA 5KTMA 4UHBA 3TX2A 3ZOKA 1V39A 2CXPA 3VISA 4ZAVA 1NVBA 3E2IA 2JPDA 2D7JA 3TQRA 4LQLA 1ZW1A 4ENVA 4GXRA 2EGGA 3DW1X 3UHFA 5KQPA 1FP4A 1NW8A 3BB4A 2XZTA 3EEQA 3IE0A 3MINB 1II8A 1O2DA 3WX0A 1QG6A 5I47A 4L57A 2C00A 4G24A 3ZKAA 2GRUA 3IAUA 3OETA 5BSWA 1LX7A 4RULA 4S1PA 2HU8A 3DW3X 3MWDA 4U0JA 1NG1A 9MHTA 3PLNA 5IJXA 2FEWB 2AJTA 4S1OA 3P9RA 1MUUA 1TRHA 4GG1A 5TQJA 1ETUA 3LLSA 1PFWA 2BTQB 2WF9A 3OPMA 4MQLA 3VAAA 1E3SA 4B3FX 5EXPA 3SEFA 5HCUA 1OI7A 4ZTZB 1RPTA 5JI3E 1DV1A 2AMVA 3HO1A 5D3MB 3C43A 3ZHTA 1WXEA 1B3RA 1D0SA 1FBNA 4US0R 4JBHA 4PGFA 3T7CA 4GPEA 1TFRA 2OFOA 4RCZA 1H85A 2HK6A 3C1TA 4K26A 4MV3A 1KFJB 2OCXA 2Q5CA 1CUEA 5AXAA 4RSGA 4BZZA 5K01A 2ZTMA 3KQKA 3AXSA 1UJCA 2V7BA 3LDHA 3ZYCA 5JHGB 3VKUA 4ONEA 1XMOB 3MWFA 3WA6A 2BI8A 4A36A 5CRIA 2VXYA 4CTMA 3BS4A 3JD3A 5JH7F 2B36A 4JU8A 1KQNA 3SXUB 2FCRA 2O0MA 3O3CA 4EL0A 4ER0A 1IUNA 1QYWA 2WKQA 2EU8A 3DVQX 1TAGA 3M6AA 5JZMA 3TTVA 4EPRA 5A4JA 1OXMA 5BQ5A 4DCGA 1B76A 3LC7O 3HR8A 1KZ9A 3FTDA 3UK2A 2WSMA 3K4QA 3QU2A 1CD5A 3BGDA 3E58A 1V6CA 3AZOA 2QR3A 2BKAA 4F9TA 4J6EA 1E5TA 2HJGA 3PXDA 3RE1A 2UYHA 1QIKA 3K8YA 4YNBA 3NYRA 4CI0B 4LPKA 1E2GA 2Z83A 4FM9A 4ARUA 3AJ9A 3LOQA 5LQSA 2QSYA 2Q0XA 1BVUA 3I52A 1X2EA 2MSNA 3VYVA 2OMEA 4V0ME 2GR9A 4IWXA 2QGZA 2QN7A 1Q6YA 2FZLA 2O3UA 4HNVA 2YCLA 5HRUA 1UC4B 3K6JA 4QBHA 1AC5A 3TCXB 2QXTA 5AJVB 5HJ2A 4YUXA 5IU6A 1G7TA 4FSXA 4A16A 4NOMA 4UFOA 1HDCA 3EJWA 1ONSA 5KSYA 2HU5A 5LJIA 1Y80A 2AI1A 2DH5A 2GCNA 4ZOAA 4U8GA 3A6ZA 5G40A 1GSHA 1M34E 2NZUG 4BWYA 3WK4A 5AM2A 3PVSA 3UZUA 2QZJA 3A6LA 2IVFA 2P4QA 3MMZA 4X8HA 3VPHA 4C4SA 4E7OA 3RSLA 1DC4A 3MTQA 4MX8A 2OXTA 3TW8B 4B34A 1WZIA 4E1VA 3RAJA 3GH1A 5B7PA 2XX3A 3UJNA 4OUKX 1QGDA 3IGFA 4GKKB 4O2BB 4WACA 4JGIA 1JVBA 4QFMA 5CJ2A 1M76A 1EFRD 3S29A 2PUFA 2RI0A 3O2SB 4IO0A 3L0IB 1NONA 1OU0A 3BKWA 1Q16A 2WAOA 4G1CA 2XT9A 4B6OA 4XVRA 2WJZB 1QH8A 1FRVA 1SUFA 1QZTA 1F2TA 1FE8A 1EIWA 3MSXA 2VP2A 3SMVA 3E1KA 4O5AA 2QRUA 5TPZD 2F7SA 5LJLA 1QRSA 2WFLB 2IV2X 3UIEA 5M5BA 4G81A 4ZEVA 3ZE0B 4CCYB 1DTEA 2C9DA 3GNLA 4LHSA 4NZNA 2GCEA 4CU2A 1IDN1 4TZKA 2FFBA 3EVAA 4DMKA 3TFQA 4EGCB 2H17A 4HDSB 3QU4A 2IZOA 2EERA 3OIUA 5B6JA 1JR2A 3ZCTA 3A4MA 4EQ6B 1JIJA 3R0ZA 1O95C 5AHKA 2QTCA 4QU5A 3TVTA 4NCHA 2JI6A 3E3AA 4YRFA 3ZZUA 4MUHA 3HEAA 2Q9BA 2DECA 4FGKA 4IGAA 3T7KA 5IW8A 2Q7DA 1OR8A 3NC4A 4UVEA 1GFZA 1GZ3A 3FF1A 2PD3A 4NFLA 5I4KA 3O2JA 1V7PC 2G9UA 2QTWB 2YV4A 4KWEA 5HS4A 1IM2A 1YL7A 2H9AA 1WUYA 2HA3A 2KS6A 1IU9A 1H23A 4P6VF 5LP1A 5LWHA 3VKGA 3S44A 1TZBA 2P6NA 4US1R 1E92A 3OE1A 2YXPX 4Q3OA 5LNK1 4ZVPA 3GBSA 1LFAA 2O1SA 4DC0A 1NF3A 5HKKA 2Q50A 5B2FA 3FTFA 4CIXA 4UE2A 3AP3A 3HRKA 5L6MB 1UBNA 3H0KA 5EJA