3ZV4A

Crystal structure of cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (bphb) from pandoraea pnomenusa strain b-356 in apo form at 1.8 angstrom
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
275
structure length
265
Chain Sequence
b'MKLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAHGGNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTALADLPEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAPHVRVNGVAPGGMNTRGPSSLGVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGDSLPATGALLNYDGGMGVRGFLTAAGGADLPEKLNI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
publication title Biochemical Studies and Ligand-Bound Structures of Biphenyl Dehydrogenase from Pandoraea Pnomenusa Strain B-356 Reveal a Basis for Broad Specificity of the Enzyme.
pubmed doi rcsb
source organism Pandoraea pnomenusa
molecule tags Oxidoreductase
total genus 94
structure length 265
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.3.1.56: Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase.
pdb deposition date 2011-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zv4A00
1ZNQO 3OETA 2EJVA 4ESOA 5I9MA 4OM8A 4AJJA 4KMSA 2ILTA 4YT8A 4CLOA 3JQAA 3ONFA 4GWKA 1SOWA 1XYGA 4IS2A 4L74A 5KTKA 1HSZA 3DBHA 5MDHA 4BKUA 4F46A 4B7XA 2I66A 3IS3A 3SC6A 2Y1OA 3TZHA 1PS0A 3IL2A 3QVSA 1AXGA 3DFZA 1E3LA 5TQVA 1E1KA 1QXSA 3LLSA 5COQA 1R37A 3K31A 5U4QA 4CV1A 1N9GA 3VC7A 3BHMA 1XEAA 2VOEA 5TJ9A 1VRWA 1MUUA 4OIMA 1FMCA 2Y68A 3OSUA 1H2BA 3PRJA 3AOGA 1KERA 2BMAA 3I9KA 3VH2A 1WVGA 3G3EA 5KKAA 1XR3A 1R6DA 4BKPA 2HRBA 2F1KA 1BG6A 4GQAA 3ZDFA 4GX0A 2G17A 5JAZA 1C1DA 3BA1A 2UYYA 3G1TA 5G0WA 5T8KC 5CDGA 1XQ1A 1HDGO 1W6UA 3DBLA 4OAQA 3PHHA 4B3JA 2JHGA 2J3IA 3OMLA 1E1MA 2X5JO 3PJGA 1IOLA 4BNFA 1B2LA 5CDYA 3F4BA 1LQUA 4L4SA 4A5OA 3ZWCA 3FBTA 1K5HA 4YCAA 3WQSB 3KEQA 3ZW9A 3NTRA 1A7AA 5AQ1A 1A72A 1IPFA 2LDXA 2IXBA 4BO3A 3SLKA 3AW9A 1AE1A 3HUDA 2VYVA 4XIJA 3IDSA 2ZIZA 4GX1A 3MJ4A 1NPYA 3RUDA 1UXKA 1X7HA 4KZPA 5A02A 3DMTC 2VTEA 4MVJH 5A04A 4FFPA 2O48X 1U5AA 4JP3A 1GUFA 2D5CA 3B1FA 3RC2A 4RLHA 1LTHR 3HDHA 3PJFA 1C1XA 3OM9A 3CMCO 3TOXA 4BQRA 1LLQA 3GEGA 3ZCXA 1IULA 4YDRA 3WTBA 4BO2A 3BTSA 3UXYA 1UP4A 2VYNA 3AM4A 4D45A 1DAOA 4QFDA 1JLLA 4YBZA 3QWFA 4IY1A 4MINA 3RUHA 3ADPA 3JQGA 5F1PA 2XF8A 4YWJA 5CEJA 5A9SB 1DLIA 3PWKA 4W7HA 3LT0A 5I9LA 3RJ5A 1ZKMA 3QIVA 5IDYA 4RJTA 5IZCC 1HYEA 3IJPA 1TT5A 1LLUA 1PZHA 5KCZA 4P4LA 2W2KA 1NTOA 4PLTA 4R9SA 1A7KA 1EZ4A 1P45A 1R16A 3TN7A 5KJEA 3L6DA 4RF3A 2X0NA 4I5EA 1YVEI 2B83A 3HB5X 3S2FA 2RHCA 1B3RA 3WMWA 3EC7A 4L8VA 3VTZA 4B3IA 4EYEA 3I52A 3Q2KA 1LSJA 3FR8A 4W6ZA 5DN9A 3CPSA 1UXJA 3P2OA 4K6CA 4MVJM 2GPTA 1F8GA 1YDEA 3I9MA 5JDCA 1XCBA 1NFQA 4QECA 4I5FA 1NQOA 1O89A 2EKPA 4BNTA 2RHRA 2IZZA 1KEVA 2D4AA 4UREA 4BNYA 4Z6KA 4L76A 1VKOA 2GDZA 1UXGA 2O7SA 4ZJUA 2Q2VA 4UVIA 3WGTA 2IEBA 1K6JA 2NNLD 3H9QA 4C7JA 1B14A 3PFWO 2CFCA 5JO0A 3TSCA 1F0YA 4NMHA 2AHRA 4D41A 3O8QA 1UZNA 2ZB8A 3OH8A 1LRLA 3C7AA 1SMKA 2DBQA 4BGUA 4H15A 1U3UA 3FR7A 4UEKA 3BMQB 4U6SA 1HZZA 4IDGA 3BMOA 3D0OA 4A0SA 2X9NA 4ILKA 4Z0TA 3ST7A 4BO5A 4PLVA 3RAJA 3GQVA 2DUWA 4CMHA 1T1SA 4HX5A 5IF3A 5IN4A 3JCZA 5T64A 4KDFA 2VWQA 2Z1NA 4B7UA 3ZV5A 4PLYA 1CWUA 4NQZA 3CKYA 3AY3A 2C7GA 1BVUA 1H9AA 1QLJA 4JJFA 4BNNA 3PYMA 1SNYA 3W8DA 2O3QA 3OP4A 5JCXA 4AJKA 1BVRA 1TVEA 3Q2IA 2VZ0A 5F5LA 5J23A 3I9JA 4D42A 1LUAA 3COSA 1EDOA 3F5QA 4PLZA 3D7LA 3FPLA 3KZVA 5ITVA 1KY4A 4DVJA 1GZ3A 2C59A 3EMKA 3ZV6A 3AM5A 3INTA 1ZK0A 3S2GA 4BNXA 1XDWA 4CM4B 1BXKA 4WPGA 4BNZA 2FHSA 3L6EA 1R4NA 2CVOA 5JDIA 1TLTA 3K6JA 4AJEA 4I9UA 2ET6A 3ZHYA 1E3IA 5TJHA 1DC4A 1CYDA 2FPGA 2VNSA 3NJ4A 2C2XA 4MKZA 4YA6A 4XGNA 4BV8A 2P5UA 2PFGA 4J1QA 5GZ3A 1PL8A 2DVMA 3NX4A 3GK3A 1Z82A 4EDFA 4B8WA 3TL3A 1YBMA 4R1UA 4L4XA 5A3VA 4UVHA 4JJGA 3OJFA 4FC6A 4YAKA 2BI7A 3H4VA 3NRCA 3RUAA 4OJNA 1GAEO 4GSLA 2AW5A 4EEXA 2HJRA 1UJMA 2BFAA 3HDYA 3WGGA 4E21A 4IINA 2O2SA 3EVNA 3KEOA 4BKQA 4BNLA 1DHTA 1X7GA 3NTOA 2BGKA 3O38A 1VE9A 2Q1TA 2DBZA 4TZTA 2I6TA 1XA0A 4U0JA 4Z0PA 4J7CA 2A4KA 3Q11A 2HU2A 4HXYA 2JFFA 1NQTA 3A28A 3E6AA 4GWGA 2RIRA 3JYLA 1LI4A 3GVHA 3HWRA 1P1HA 2A94A 1P0FA 1ISFA 4LVUA 3VAZA 4I5DA 3BHJA 3ULKA 4LRSB 1UXIA 4CMGA 2QHXA 2HO5A 4U0KA 2Y05A 4PG6A 3EYWA 1OZAA 5A9RA 4TRJA 3UCEA 1P1FA 2V6FA 2FR0A 4Q3AA 1LEHA 3ZWMA 3F1KA 3MWEB 2FPIA 1Q2XA 4NJMB 2VRCA 3KSUA 4XQGA 1T2DA 3OJEA 5FYDA 3EZLA 3OEYA 2BKAA 4E0BA 1VJTA 1KEWA 2BFOA 3KM0A 3CZMA 4ALIA 5G2OA 4D46A 1IYZA 5JAIA 2P2SA 4KUGA 2CMDA 2B4TO 1BW9B 1QMGA 5JMPA 2XXJA 4BO4A 1YB4A 1NVGA 2X1HA 4FIZA 5BR7A 2H63A 2VZ9A 2IYPA 3KUXA 2GYYA 1XGKA 2JD0A 2ZATA 1PWXA 3O9ZA 2DFDA 1NQAO 3AOEA 4O1MA 3JD2A 4NG5A 4IQGA 3I9OA 3CIFA 2OORA 1OAAA 2ZK7A 4W9NA 1GTMA 3KO8A 5BNFA 4RORA 1DPGA 3LU1A 3N74A 5KKCA 5CDTA 3QSGA 4F3YA 1H6BA 2IYOA 2R00A 1IHXA 2VZ8A 1FXSA 3ETDA 2GN8A 2NVUB 4DPLA 2NM0A 3FNFA 1LDYA 1NFFA 2NU9A 2ZB7A 2WYWA 3QWHA 4O63O 3W4IA 3ADOA 1BMDA 2QW8A 3EHEA 3ZWNA 4ALLA 4GSKA 3U3XA 4G65A 3U0BA 3G49A 1BRMA 5L95A 3GNSA 4N18A 5B37A 3U49A 1HE5A 3TJRA 3FWNA 3DZJA 1ML3A 1T24A 4W4TA 1HYGA 2B4QA 4D7AA 3IMFA 5BT9A 1EQ2A 5AYVA 2JD2A 3F4LA 3RI3A 1Q7CA 3G17A 4D3SA 3JYPA 1D1SA 3NYWA 2UUOA 3L9WA 4BUCA 4GKBA 3HDQA 1E92A 3X2FA 5ENVA 4Q3EA 1DLJA 1H0KA 3D1LA 3AUSA 3JYNA 3DWFA 4AJHA 2CY0A 1WZIA 3LZ6A 3RUEA 1QLHA 1GQYA 2Q99A 3K73O 8ADHA 1HKUA 2JCYA 2WWRA 4NFYA 1E6WA 3IIEA 4DWVA 4FGSA 4NK5A 1I2BA 4DMMA 2VWHA 3IC5A 3SBOA 3QWIA 2UV8A 5CPFA 4IGFA 2JFHA 4CLRA 2W98A 3KYDB 1I01A 4RZIA 3ZNNA 3AU8A 3JQ7A 1C0KA 3QJ5A 1VJ1A 3L4BC 3SJ7A 2WYUA 3LT2A 3AI1A 4LMPA 3AM3A 5JXWA 3K30A 3M1AA 1DC3A 1YQXA 4CM5A 4PG8A 3WJAA 4E32A 1PJ4A 4W82A 4L73A 4XR4A 5DOZA 4ZQFA 5DP1A 4ZN6A 5A5EA 1DC5A 2G5CA 2JCVA 3NTQA 1YGYA 3NDJA 3DHYA 4FFLA 3V1UA 5HM8A 1DRWA 4AG3A 2VRCD 4FPXA 1VM6A 5AXDA 5JAQA 4CUZA 4WGGA 4EJ6A 1RYEA 1JWBB 1AUPA 1KOLA 4YRAA 5JYEA 2QX7A 4IIUA 2Q2WA 2YHIA 3NGLA 3BAZA 3DZIA 3K2EA 3RKRA 3INGA 1E77A 4IPTA 5I8ZA 1T2EA 2PV7A 1ZH8A 3C1AA 3NUGA 3KV3O 4IDEA 1S6YA 3D5TA 1I36A 5COAA 2H1SA 1EVJA 4WCFA 1O9BA 4CLXA 2PH3A 5DBFA 4IDFA 1XHLA 1EBUA 1HSOA 2VQ3A 1MG5A 4KDEA 4WOJA 3QY9A 4QUKA 3HN2A 1IZ0A 1V3UA 3WOHA 5F1KA 4PG7A 7ADHA 3KXDA 1O94A 1SB8A 1DEHA 3KYCB 5T57A 3CZRA 3HJAA 2NWQA 4J2OA 3GGOA 1AHIA 4GH5A 2NV6A 2Z1MA 4OYRA 4MIOA 1PTJA 1QV6A 2A9FA 3RC1A 1E7MA 1I3MA 2QYSA 1ZSYA 4A03A 3QE3A 2BH9A 4BMNA 3E5MA 3GT0A 3OBBA 1UAGA 4FR5A 4JIGA 2B36A 4NZ9A 3WGYA 1ISHA 1ORRA 1ZK1A 3ZWXA 1AHHA 1E3JA 5DULA 1B16A 3WWYA 5DP2A 2BI8A 4UEOA 1KY5A 4KQXA 5EPOA 4E13A 2NUAA 4TRRA 4IZIA 3GN2A 1I24A 2YJZA 3ZU4A 2C82A 4XDYA 4PCVA 4Z3DA 4IMRA 3F9IA 3DTTA 3ROMA 2PGLA 3PVZA 4BMVA 1RKXA 1VL0A 1IL0A 1N7GA 1M76A 1HRDA 1E7RA 2YDXA 1M6HA 5DBGA 4C7KA 1SO8A 2DUUA 1M2WA 1F14A 3EGOA 3MTGA 5DOVA 4Z9XA 5ES3A 3V8BA 1PZGA 2ZQZA 4LRTB 5U1PA 4BNIA 1R15A 2GERA 3SEFA 1EFLA 5B1YA 2D8AA 2D0IA 2RBEA 3ENNA 4IZHA 2R2GA 4JBIA 3E03A 2EJWA 1XQ6A 4IM7A 2E6UX 3ZZNA 4XD2A 1VL8A 1LC3A 1X0XA 1KVQA 3EW7A 3AUUA 3KOUA 3OIGA 3PDJA 3QP9A 3TOZA 3GC6A 1OC2A 4RGBA 5EINA 4U5QA 2ZB4A 5IDWA 1QYXA 2H9IA 1LNQA 4CQMA 2CUKA 4BNJA 4TVOA 2OUIA 2EERA 4IDDA 3LC7O 5EERA 3AUAA 4DQXA 3UKOA 1NYTA 3KBOA 3WSWA 3S2IA 5IFLA 2CD9A 2GSDA 2Q4EA 2EW8A 4Z9YA 1L1FA 4J4BA 4XQEA 2XXBA 4ITUA 2IDZA 5L40A 4HFJA 4EBFA 1ZBQA 1QSGA 1OMOA 3UICA 1IPEA 3OJLA 3V5NA 1JW9B 2GGSA 3GN1A 3ZWWA 4TVBA 5T67A 2YQ4A 1HWYA 2B35A 2NADA 2X0IA 1C1XB 4FJ1A 3RCBA 3TDKA 2ZB3A 3WGIA 3FBGA 3AY6A 4CMKA 1X13A 1DIHA 3E82A 4GKVA 4EGFA 5TIIA 3H3JA 4YEDA 4AVYA 3UVEA 1FJHA 4DLLA 2RAFA 2DFVA 1N1GA 3JQGB 1I2ZA 1PQPA 4UULA 5T6BA 4XJSA 4BGIA 1EVIA 3DZBA 3GRKA 5BNIA 1I10A 3VPGA 3LK7A 4R3WA 3LLVA 2X4GA 3VZPA 1GADO 5T8KA 1U2DA 1ZO8A 4IJVA 3RUIA 4IIVA 4HADA 4DRYA 3ITKA 4PGFA 1ZXLA 3AY7A 1D3AA 1CQIA 2Y0EA 3M2TA 5A06A 3IP1A 1Q0QA 2Q46A 2WD8A 1YOVA 2OBYA 4PLWA 4WE3A 4Z9FA 3HN7A 4XB2A 3MEQA 4BNVA 1BTOA 3UUWA 1E7SA 3WQRA 3H9GA 5I7VA 3FF4A 4R69A 3WB9A 1UP7A 4ROSA 4E3ZA 2C0CA 1CQJA 4BNUA 5JFOA 5JMWA 5ILOA 3ONEA 2VUUA 1I3KA 3DAFA 4BV9A 4CODB 2DM6A 3DMTA 4PLHA 1Z6ZA 1PWZA 1F06A 2X5KO 4J9UE 1BDBA 1CEQA 1QYDA 3FD8A 1OC4A 1MXHA 2C5AA 1DRUA 1EUDA 3P19A 1EVYA 1T2CA 4E2WA 5MGBA 3GF4A 2HMWA 2V6GA 2WYVA 4LISA 4RL6A 2O3TA 4YAEA 2WTBA 1EK6A 1JAXA 2NTVA 3PLRA 3LSYA 3WGHA 1NVTA 4WASA 3GLQA 1LRJA 5IZCA 4A26A 3U4IA 3S55A 3GR6A 1DFGA 3WG9A 3WS7A 1OFGA 2FR1A 2B5VA 2Y66A 3IQDB 3DHEA 5B4VA 3NV9A 3ONDA 4TQGA 2AQHA 3PQFA 3DQPA 2Y0CA 2C7VA 4CM9A 1WPQA 3MJCA 4YXFA 1G0NA 4J91A 4CQMD 2DQ4A 5CG1A 2P91A 5G0SA 4IXWA 2G82A 1B8VA 1F8FA 2YFHA 2GZ2A 3CXRA 3N58A 4K26A 5B4UA 1HLPA 1P1RA 1HDOA 4FCCA 2BHLA 1PIWA 3P5SA 1DIAA 2TMGA 1ZK3A 4EUFA 3WGQA 1DAPA 4J9VA 3ANLA 4EW6A 1H6DA 4LCEA 4B7CA 2QZZA 3GZ4A 1C0LA 2Y99A 3STHA 1E5QA 1A4IA 3DL2A 2NVWA 4E4YA 3ZH2A 4P4NA 4YJGB 3W4JA 4M1QA 3DZFA 2Y0DA 3KLMX 1GV1A 1CETA 1U4SA 2POQX 3RUCA 2B0JA 2UVDA 5CEEA 1VC2A 5IDXA 3E18A 3AWDA 3GUCA 3JQEA 2D1YA 2HMUA 1MLDA 5CPBA 2Q3EA 1JKFA 3WQQA 4GLOA 2V6MA 3ZWBA 1H5QA 2Q50A 3FI9A 3MJSA 5HS6A 4CV2A 2Q1SA 1E3WB 1PGOA 4G2NA 1DC6A 3RU9A 4KOAA 3PJDA 3GDOA 4Q3DA 3RJ9A 2PD6A 2C5EA 1CJCA 5HA5A 2Y93A 4Q9NA 2I3AA 4BL5A 1NXQA 2CZCA 4MVJF 4LW8A 4EEZA 4ZD6A 3D64A 1W4ZA 4CQLB 5BSFA 2PKRA 2X23A 4R9RA 1HF3A 1Y1PA 1P9LA 3ORFA 1LA2A 2G76A 2QRKA 3AI2A 3VHRA 2QZ9A 1RM0A 4M87A 3GMSA 2BRUA 1NASA 3L6OO 1ZXBA 4HY3A 4QT0A 3GFBA 5C37A 2EWMA 1XU7A 3LF2A 1M67A 3KSDO 3VPFA 1PS9A 4YJHA 3V2GA 2BD0A 1NWCA 4JBHA 2BLLA 3ROKA 1X14A 3FHLA 2E4AA 4TZKA 2DAPA 2GZ1A 2PZLA 3KSZO 1TA4A 4J6FA 4NBRA 4CMEC 4WLVA 2VNAA 4W99A 2DPGA 4MO2A 1M6WA 3PEFA 5IXYA 1DXYA 3JQAD 3VH4A 4MIYA 1NAHA 3TZCA 2E48A 3Q1LA 1EBFA 1R66A 2W4QA 1PQUA 4A10A 4CR6A 3DDNA 4OOEA 4R5MA 5BQFA 5IAAA 3GHYA 4R41A 4OXNA 1KVUA 2OZPA 1ONOA 3I5MA 3WIEA 1U5CA 4FQ8A 2V65A 1PZEA 3JV7A 4RV9A 4MJLA 4NIMA 2CVZA 2PZMA 2HK8A 4ALJA 2AXQA 1ZEJA 3K2BA 5TNXA 1B8UA 3GNQA 1BHSA 2Q1UA 4U6QA 2UAGA 2RH4A 5JCJA 1RPNA 1ONPA 4MIEA 1ZEMA 3TFQA 5H81A 3K8ZA 4CM9D 1UZMA 2BGMA 3ROQA 1XG5A 2RCYA 4MKXA 1ADCA 1PSDA 2PZJA 4L0QA 4M54A 4PLFA 4CJXA 3OA2A 2AQIA 4F6LA 4EITA 2VHXA 3VKVA 4ZVVA 1GEGA 1ISMA 2PGJA 4DIFA 1T1RA 4IDAA 3UHAA 5HRUA 4YT2A 4R1TA 3NT5A 2TMDA 1H6CA 3RUFA 3CEAA 2ZQYA 4QO7A 4EJMA 1JWAB 4UAGA 4WNIA 5F5NA 2X58A 1E6UA 3JQ9C 2GN6A 4ALMA 5AXAA 2G0TA 1YWGO 4JJIA 5G0VA 4OMUA 3H2ZA 2P5YA 4WLOA 5EESA 4NNJA 4WECA 1IB6A 1NHGA 1R0LA 2J5QA 4YYZA 5FI3A 2VYVD 4FDAA 3JD4A 1GPDG 1X1EA 1C3VA 2PKQO 4WLFA 3QWBA 2HMSA 3HHPA 2AMFA 3PZRA 4RCVA 4XJTA 4R16A 4BO9A 3C8MA 3FNHA 4YB8A 4P38A 1A5ZA 4P8RA 2YV2A 3RFTA 3PYLA 5F1OA 1R4MB 5H82A 3HB4X 1J6UA 4CMCA 4DA9A 2P4HX 1I32A 3I3OA 3PPIA 3T7CA 1O0SA 4BNMA 1NWHA 4XDZA 2LDBA 1DJNA 3FTPA 2AA3A 2VYND 1O8CA 2VWPA 2A92A 4MKRA 5EL0A 3G0OA 4N5LA 1H93A 1RM3A 3D4NA 3M2PA 2WMDA 3ZWPA 2OOSA 3JQ7B 4FS3A 1U9JA 3TZ6A 4PLPA 1C0IA 1KC1A 3DOCA 1Y81A 3T4XA 1HEUA 4N7RA 1P1IA 4XZ3A 2NQTA 3KHUA 3UCXA 5IJZA 1ZVMA 4ZRMA 5HS4A 3DAGA 1GUYA 4IUYA 3X2EA 5KVSA 2AE1A 1NX6A 1A9YA 1P44A 2W2LA 1HE3A 4M89A 3WXBA 3NAQA 4QXMA 4D3DA 4KP7A 2QIOA 3TWOA 5JYDA 2WD7B 4AJ2A 1N2SA 4JP2A 2ZJ0A 4YACA 3VKUA 1I30A 2YHIB 4DTIA 4AJLA 1ZFNA 4CR8A 3C7CB 3PP8A 3OIFA 4NI5A 4RPLA 2X8LA 4YJDA 3U09A 1UXHA 1VSUA 2IZ0A 4IQ8A 1XLTA 1HT0A 2FSVA 4Y6SA 4R3NA 1ISIA 2J3KA 5L4SA 3PYXA 2ZKLA 3ZNOA 2HQ1A 5A9SA 1SBYA 3BYZA 5COBA 4CMAA 1Z73A 5A05A 2HSDA 1E6EA 3OHSX 5TS3A 4E33A 5L7YA 2GO1A 1I3NA 2WEKA 3ABIA 4DPKA 3GVPA 4N54A 1MXFA 2WE8A 3GHHA 4BKOA 1BGVA 4J3FA 3OFSA 1YL5A 1ISGA 2DLDA 4WEOA 5JCJD 2IXAA 4MPDA 3D3EA 2BF7A 2C07A 4XCVA 4J16A 1F17A 1PR3A 2FZWA 3L4BA 3V2HA 4FGWA 2O2YA 3QWAA 3UW3A 1NQ5A 5TT1A 4UVGA 3VZQA 2Y1CA 1NR7A 1V8BA 2I99A 3GH3A 5JDIC 5JS6A 2EKLA 3WIDA 3OEWA 2ZCVA 3D3WB 3LC1O 3S2EA 1DJQA 5DDIP 1MC4A 3SXPA 1EVZA 1XIVA 2NTNA 2VT2A 2O3UA 3BMNB 3LYLA 3W6UA 2O3JA 4CV3A 1JDJA 4FBGA 1NP3A 3H9UA 4L4RA 5FWNA 1PR9A 3BHIA 4DPMA 4BIIA 4I08A 4XGKA 4C4OA 4CUKA 2EXXA 3GDFA 4JNKA 1GPJA 3AUTA 4INAA 2O4CA 2Y1GA 1OBFO 3T7EA 3TFOA 3TZKA 1P74A 1LDGA 4E6PA 2PA3A 3BMQA 4E5PA 4FB5A 1Y6JA 4FJ2A 4BB6A 4URFA 5IG2A 4JX8A 1B15A 2IE0A 4O59O 3UAGA 1L7EA 1IUKA 1ZMTA 1M66A 2AE2A 5ADHA 1Z75A 3P2YA 3QRWA 2GASA 4BGVA 2Y1EA 3TL2A 1B7GO 3DBRA 1WMBA 1NR1A 4YJFA 3VDQA 4Q3NA 4MVJE 4YT4A 1BSVA 5BSEA 3BMCB 4CM8B 1V9LA 3WGOA 1Y8QB 3U4HA 2DU8A 3FNGA 4ND2A 2OP0A 3WR5A 5JNLA 5THQA 4HNGA 4UUPA 3DO5A 5LDHA 3AU9A 4J7XA 3C1OA 3GDGA 4OOFA 3RBZA 5DCWA 3IUSA 3U5TA 4CQMB 2FZEA 4CM4A 3QLJA 4W7IA 5KOIA 2EG9A 2NSDA 4G5HA 1AN9A 4PVDA 1LSUA 3AJRA 2Y67A 2GN4A 2OBNA 1C14A 1KC3A 4AJPA 4E5KA 3MZ0A 1O6ZA 4ZHSA 1TEHA 3DZGA 1XSEA 4WLUA 1GYRA 4BOYA 1M75A 4B4WA 3VPXA 3O4RA 4CM1A 1H94A 1DFIA 4DBVO 3DTYA 1YRLA 4E5NA 2PKQP 3FPCA 1PQWA 5HBRA 3VH1A 4PRLA 4H3VA 3Q9UA 3C85A 2DC1A 3MJEA 5HWSA 1W8DA 2HK7A 3OJ0A 2YQ5A 2YV1A 4L75A 1N7HA 1Q0HA 3QVXA 1GU7A 4H7PA 3WJ7A 2OP1A 1WDMA 3E1KA 4B4OA 4D43A 1U3VA 2JKVA 3H65A 3NT2A 4DREA 4RVSA 1LDMA 5L51A 4RZHA 1Y5MA 5G4KB 1K89A 4ZQBA 3TQHA 2NQ8A 3ZWVA 2FMUA 1PEDA 1EUCA 1G1AA 4FOSA 1U1IA 3PHIA 5CFZA 4JXKA 4XWYA 3WX0A 1E5LA 4XYEA 1W73A 4UVEA 3HZZA 2FN7A 3U4DA 3WDSA 3K9QO 2FPPA 3ASUA 4UUNA 5JY6A 1PJTA 3DB2A 3ROPA 3JQ8A 1ONNA 5GZ1A 1T26A 3DONA 4CMIA 2DPHA 4DQVA 1UDBA 1WDKA 4B4VA 4TRMA 1YOVB 1QRRA 3GVCA 3PK0A 4MP6A 4DBZA 5LDGA 2D3TA 1KVTA 3FN4A 1UUFA 2GN9A 3A4VA 5THKA 4JK3A 5IXSA 1GQQA 4KQWA 1DHRA 3I23A 4P4GA 4UVDA 2A35A 1E7QA 1P1KA 2Y1DA 4Y98A 4ZQEA 1U28A 4NJMA 4BQPA 4R1SA 3GFGA 3Q9NA 3T4EA 3GMDA 2D59A 3HQ4O 3NKLA 1XKQA 4AFNA 3IKVA 3LDHA 4JBGA 3JQAB 4IBOA 4CLOB 4DIOA 5IZ4A 1YH3A 1K6IA 3EY4A 3E8XA 2FY8A 3IJRA 2YZ7A 3DBHB 2ZCUA 1BW9A 1N1EA 1G6KA 1YE3A 4NPCA 2C2YA 4HFMA 4D0RA 5B4TA 1RWBA 4E2YA 1U2GA 1VPDA 1GL3A 3W6ZA 4BO7A 3GA0A 2HK9A 4S3MA 3K92A 3ZHBA 3RBXA 1A4UA 5AOVA 3WMXA 1BXGA 2PK3A 3DEYX 1N9GB 4BNHA 1ZCJA 3KRTA 2Q49A 3BZUA 5BNTA 3WLEA 3L77A 3SC4A 5I7SA 1Z74A 4D79A 1JN0A 4JLWA 5ICMA 4OGWA 3H2SA 1Y9AA 1FDUA 3ZW8A 4X54A 1HZJA 1X15A 1NPTO 1PJLA 3C24A 1TT7A 2YY7A 4RO0A 1KVRA 1ZK4A 4PG4A 1ISJA 4BO6A 4BO8A 2NVUA 4J49A 1VJ0A 4YQZA 4CL8A 5L4NA 2HMTA 1C1DB 2I9PA 1J4AA 3CSDA 2FR8A 1LU9A 2DTXA 3DBVO 3QVOA 1QORA 3DBLB 4M55A 5GMOA 3O03A 1ZZEA 4E2ZA 1HE2A 3H5NA 3QA9A 3OECA 3KLPX 7MDHA 8LDHA 1H9BA 2EIHA 2AG5A 3F6YA 3ZWYA 1ENOA 1JVBA 3WYBA 4ZA2A 4DIBA 5DCYA 2WJPA 3NEPX 4U8GA 4MP8A 4RDHA 3JQ6A 4DYVA 2RH8A 3I6QA 2NU7A 3PQEA 4ALKA 1V3VA 4ZQGA 2AG8A 4XIYA 4EUHA 2ZJ1A 1QYWA 5I8WA 5EQDA 4WK6A 3GG2A 1UDCA 3MJTA 4E5MA 4R68A 3EVTA 2OXIA 4Q3BA 4RF5A 2GD1O 1SAYA 1EE2A 2PWZA 3B1JA 4HNHA 5TSDA 3DHNA 3RD5A 5FFFA 1CIVA 1PU2A 4LGVA 4TMFA 1LLDA 1HDZA 4FN4A 3PWZA 2CDCA 1QR6A 5TLSA 4ALNA 1MV8A 3KYDA 3BXXA 2BGLA 1ADFA 1MFZA 3R3JA 4XR9A 3DAPA 3IP3A 4NBTA 3CUKA 4BMSA 4RVFA 1ARZA 6ADHA 1SPXA 1TT5B 2CDAA 2YHUA 4MVJA 3I83A 4R5HA 3V2UA 1ZW1A 1GCOA 4CM7A 4I1IA 4ZICA 1Y8RA 1SC6A 2W2KB 4J43A 3QVTA 3GGPA 2J8ZA 3B6ZA 4XYLA 5K6AC 1Y5RA 2GUGA 4K6FA 3PWSA 3VVBA 9LDBA 3QQPA 4OO3A 3I4FA 1PL7A 1YBAA 1P0CA 1EUZA 2AEFA 4A2CA 4WKGA 3WNVA 3GVIA 5G0UA 4OL9A 3EAGA 3JQFC 4BHTA 4NU6A 5G0TA 1DRVA 2DT5A 1CERA 5KIAA 4OSPA 2JFGA 1KETA 2JL1A 3OF2A 1TB4A 4ZU3A 4A27A 1J49A 4UUOA 4Q39A 3F3SA 4HP8A 2HUNA 1LSOA 1Z45A 3VOSA 2EGGA 3SJUA 5L53A 3O8QB 4RPKA 4DGSA 4GAEA 1HETA 3OIDA 3D5QA 4TROA 1SZJG 4GBJA 1WP4A 2FSSA 2ZYDA 5TF4A 3KYCA 3BMOB 4MOWA 1E1NA 4RQTA 2CNBA 4HFRA 4PIVA 1IZ9A 2B5WA 3H9EO 2CSUA 2WE7A 4QQRA 4WEQA 3UFXA 4IDBA 5L9AA 2JCXA 4UUMA 5C3MA 1NBOA 2OFPA 2DBVO 3ON5A 3SVTA 1SOVA 3PIIA 4JQCA 4XRRA 4KUHA 3EUWA 4RF2A 2OHXA 5KJ6A 2PD3A 3ANNA 2JHFA 3JQBC 4YTEA 1GYPA 4AJ1A 4AJ4A 4GX5A 2JAHA 1YJ8A 4II2A 2F00A 4CMEA 2CF5A 1AGNA 1VLLA 1B26A 1K0UA 4PZDA 3S1LA 4YRDA 1YO6A 3NJ8A 2XOXA 1Z7BA 1MC5A 3H5RA 1U8FO 1P77A 1R4NB 2VHVA 1JVSA 3VPSA 1V6AA 9LDTA 4GGOA 2V6BA 3LVFO 3HSKA 2FWMX 5AXCA 3GZNA 1LXCA 4Y67A 4FFRA 1KYQA 3R6DA 4QTZA 5DNAA 3IAHA 4J7UA 3TNLA 4NBVA 1BDMA 2YFQA 1LDEA 1KS9A 2ZYGA 2BFPA 3PQDA 4U7WA 3RC7A 1E1LA 1DBVO 4HKTA 3OQ1A 3MCVA 1FDWA 1GZ6A 1LJ8A 1RM5A 1I8TA 2OO5A 3PI7A 4YAGA 2FRDA 1MP0A 5A03A 1YDWA 2EGHA 3B70A 5JO9A 2GNAA 3VH3A 3JD1A 4P22A 5DT9A 3ZI0A 2D5AA 4NK4A 1HDXA 1QYVA 3L4SO 1H2HA 5BSHA 1E0DA 1GR0A 3D4OA 3ZV4A 2NLOA 4YR9A 5JC1A 1F12A 1EK5A 2AEMA 1PGJA 3RVDA 2XPCA 4OXYA 1CRWG 2EHDA 4FFOA 4CM6A 4WOKA 3I1JA 4IJKA 5TC4A 1YXMA 2HDHA 4GPD1 4LK3A 4PZCA 4MVJD 1C0PA 3LF1A 3PHJA 2DTEA 2IRWA 4GX2A 2NTJA 3I9LA 3WBBA 3PGJA 3AFMA 2WM3A 2NU6A 1BWSA 4RVUA 1S7CA 4QEDA 1XU9A 5L3ZA 5IN5A 1NNUA 2X9VA 4MVJP 3L9XA 3LT4A 1P3DA 3CE6A 3JQ9A 2PD4A 3AK4A 3UN1A 1RYDA 5AVOA 5EN4A 4XYMA 5C7IO 3VPHA 5FEUA 2EP5A 4EZBA 4TKLA 5KVVA 1PGNA 4ND3A 2X7HA 3I4CA 4DQUA 5KJ1A 4BO1A 5L7TA 1ZMOA 1HDCA 4IJWA 2HRZA 3A9WA 4KUEA 2IEDA 4MP3A 1EQUA 3GY0A 1YONA 3RQSA 3OJOA 4GVLA 3O26A 3DC2A 1B0AA 1JTVA 3DZHA 3LT1A 1JA9A 3Q6IA 5TT0A 4WLNA 5ENDA 2EKQA 4AICA 2X9GA 3RBVA 1RJWA 3E9NA 2QRLA 2O4UX 3ZU2A 3K96A 1NM5A 2W8ZA 4I9HA 1QV7A 4PN3A 1Q7GA 4J4TA 1WAMA 3NT4A 3AFNA 1ZK2A 5ICSA 3KVOA 4G81A 1QYCA 1AXEA 4GL4A 4A73A 1DOHA 4IMPA 3U9LA 5TX7A 2EV9A 4LSWA 3MTJA 4OXKA 3ZWAA 2PLAA 4Z3KA 5A5FA 3KTDA 4J4HA 1DIBA 1K6XA 4YAJA 4H16A 4AJIA 1HDYA 4RF4A 4CLHA 2IODA 3DMYA 1PJ2A 2ZTMA 4BNGA 5CAEA 2H5LA 5KVCA 1PJBA 1UAYA 5EQFA 4TSKA 3WLFA 4ZGWA 5A4DA 2PR2A 1YKFA 4WUVA 3GAFA 4O5OA 2PY6A 3LQFA 1NHWA 2PTGA 5JY1A 4R54A 3E9MA 2EEZA 3HFGA 4B4UA 3VZSA 1DO8A 3R0IA 4DMLA 1DFHA 1DSSG 1YL6A 3ZHXA 3ZWOA 3WTCA 4FJ0A 1GV0A 2QG4A 3D4PA 2VHYA 3P7MA 1LDBA 2CDBA 1KIFA 3DBRB 3BIOA 4QX6A 5JE8A 1V0JA 4YJFB 1ZJYA 1U3TA 3INRA 4NR0A 1J0XO 5JC8A 4AL4A 4R1NA 3IKTA 3ETEA 3UGKA 3L0DA 1JQBA 4D3FA 1YBVA 4OKIA 3FSRA 3RC9A 3DZKA 3E48A 4ONEA 5A1TA 4NHEA 3G79A 1VL6A 1T2AA 4RPGA 3VVCA 1HL3A 1PGPA 3CTMA 1VKNA 3M1LA 3JSAA 5G4LA 4DLBA 3ITDA 4ND4A 4PLCA 1EE9A 3Q3CA 5I7EA 5K9ZA 2HKIA 3RWBA 2UDPA 1WXDA 5JAMA 5KJFA 1KVSA 1UZLA 3PFFA 3PHLA 4KWIA 3R1IA 4NFSA 3RROA 2ZYAA 3MWDB 4I5GA 3JYOA 2Z95A 4CLRB 4JGBA 2YUTA 2BELA 1YJQA 4WLEA 4YJGA 4YVFA 5DCUA 3JD0A 4XQ9A 2CF6A 3ZNPA 2X0RA 1ZJZA 4FSHA 1NAIA 5JDCC 2P68A 1YQDA 1T25A 2FP4A 4II3A 1E7YA 1EFKA 3B1KA 4OQZA 1UH5A 4K9DA 3PHGA 1UP6A 2BFMA 5AXBA 4NFHA 4RVDA 5C5IA 4YRBA 1ULUA 2DBRA 3JYQA 3F5SA 2VOJA 2X86A 5C7LO 1YS4A 3WBFA 2IZ1A 1E3WA 3ZV3A 2Y1FA 3ETGA 3EZYA 1FDVA 1HYHA 2J3JA 1Z7EA 4MVJG 4R4JA 3WWZA 4CMBA 5JPIA 5TRTA 4L9RA 1LQTA 3ZU3A 3A1NA 4RDIA 1LRKA 3L07A 2D2IA 1ULSA 3TPCA 1JAYA 3H6KA 4EJ0A 2GZ3A 4GMGA 1K3TA 3PIDA 1O95A 1A9ZA 3EK2A 3HDJA 4XEHA 2XAAA 3FTNA 2J5RA 4DLAA 5F3RA 4BNKA 4CQLA 4PLGA 2C20A 3A14A 2Q45A 2WDZA 4M49A 2NU8A 3JQ8B 5CP8A 4B79A 4E12A 1VI2A 4WCFB 3JQCA 2X6TA 4CMIB 2GLXA 2VUSA 3WYEA 1PJSA 1FDSA 3V1YA 2PNFA 2FOIA 3TF5A 4RQUA 1Q1NA 1YB1A 3EDMA 2YYYA 5DF1A 4EI2A 3RSHA 1I33A 1MG0A 1N5DA 1JKIA 2I67A 4Y6PA 3H5AA 3QHAA 1MA0A 5A9TA 1MB4A 5KNLA 3ICPA 2Q2QA 3MOIA 1ID1A 2B4RO 3MOGA 2Q4BA 4B3HA 4HFNA 2P9EA 2PH5A 5B12A 1SCUA 4WJZA 3U62A 1ENZA 1LDNA 5CG2A 2YW9A 1P33A 3PLNA 2AEJA 2PGDA 1ENYA 1H6AA 1Q7BA 4CV0A 3GNTA 3K5PA 3JTMA 1X7DA 1Y7TA 1FF9A 2QYTA 4LSMA 5CDSA 1WLYA 4GGPA 1WDLA 2HJSA 2NVBA 2OL4A 1BXGB 3ENKA 2VRBA 5ER6A 4J1TA 2ZTLA 1PJQA 3RIHA 1D4FA 1XWFA 2GRAA 3IUPA 1J5PA 4FFMA 3RKUA 4PVCA 1LX6A 4XYBA 2O3SA 4CR7A 4QO8A 4XA8A 3GOHA 2PZKA 1ENPA 3C7DB 4O6VA 4LMRA 1I0ZA 1Y9EA 3DOJA 2QQ5A 2OMEA 4BGEA 4KTVE 1E3EA 4YT5A 2VWGA 1EDZA 4Y9DA 1LBEA 3GGGA 4MVJI 2O3RA 2G1UA 4IQ0A 1NVMB 4F6CA 2HLPA 3VTFA 1T4BA 1LC0A 4LVCA 4NJOA 1DB3A 5JW6A 2P9GA 3NDRA 1NFRA 1VSVA 5L45A 1JU9A 4ND5A 3W8FA 3RASA 1U7HA 3KETA 4QFCA 4RPHA 5F21A 3WICA 4XB1A 5GY7A 2CVQA 1ZUD1 3IOYA 1TXGA 1HE4A 4DXHA 1GFSA 4S1VA 1MFPA 2VTDA 3W8EA 3ICCA 4AJOA 2O50A 3ZN2A 2W2LD 4FW8A 4NH4A 3PZBA 3S8MA 1E3SA 1Q0LA 1FDTA 5DZSA 2H6EA 3NDIA 3QV1A 1D7OA 1T4DA 1RM4A 5DBIA 2J6IA 2X5OA 1R4MA 4ZRNA 3DOOA 3GAZA 4CUJA 4R51A 3E5RA 1WNTA 2EP7A 3KB6A 4OKNA 4TKMA 3H9JA 1EEHA 5FI5A 4TWRA 3V1TC 2JJYA 4KWHA 4LCJA 1PGQA 4RLSA 4IXTA 2GF2A 4RVHA 4M86A 4IJUA 5JBIA 5KVQA 4DC1A 3AOEC 3ZGYA 5TGDA 3OQ6A 1MGOA 1WZEA 4JCOA 6LDHA 3GUYA 3WGZA 1WW8A 4J0FA 2B69A 5K0ZA 5I9NA 1DIGA 1YL7A 4W9NC 3JD3A 4J0EA 3F1LA 1Y8RB 3CINA 4D44A 4CPDA 2VN8A 4BO0A 2P9CA 3GRPA 4M8SA 4ZQHA 2UUPA 3GVXA 3HFSA 4GLLA 4ID9A 4D0SA 4WCDA 2VHWA 2R00C 2P4QA 3DXFA 3VDRA 2I3GA 2WD7A 3MJVA 1D1TA 1ZSNA 1N8KA 3E9QA 3WSVA 5BSGA 5IDQA 2YV3A 3U4CA 1LLCA 2HCTA 5EJ2A 5GZ6A 1GCUA 4FD3A 4KTTE 4UEJA 4FFNA 1R0SA 2GR9A 2B37A 4BNWA 1IHYA 1QG6A 3PGXA 3RU7A 4DUPA 5KWEA 1P1JA 3CMMA 3QW2A 3OQBA 1TI7A 3OICA 4MDHA 4XKJA 1ZSVA 4Z0HO 1ZIDA 3UCFA 1B3BA 5HTOA 1QKIA 1KEPA 2E49A 1P31A 5EIOA 1GDHA 3DR3A 5JLAA 1HXHA 4BB5A 2E82A 4J90A 2I65A 4LN1A 5L4LA 4IS3A 4BKRA 4XRGA 3SX2A 2J5KA 4YAIA 4EUEA 1X0VA 1EMDA 4N5NA 3H8VA 1PL6A 1IY8A 3GEDA 5LC1A 4Y8VA 2ZTVA 5H83A 4TRNA 2AQ8A 2Z5LA 4XX0A 4PG5A 4XYGA 4GI2A 4B8ZA 1SB9A 4I9NA 1KEUA 5CHEA 3FRJA 1R12A 4GVXA 4O0LA 3D3WA 4HV4A 1E7WA 1D8AA 4BVAA 1PS8A 4HBGA 4I8XA 4PFJA 3BMNA 2Q1WA 1DDOA 2GCGA 1HLDA 5ER9A 4F45A 1NPDA 3H3FA 1GYQA 4IDCA 1GQ2A 1ADGA 1O5IA 5K6AA 1GY8A 4JROA 5JSFA 3B20A 3FCOA 3KYBA 1WMAA 3UOGA 2J3HA 1UDAA 1DIRA 1GD1O 4CM3A 1KBZA 4WNCA 2YDYA 3HNPA 3JQFA 5FF9A 3I9NA 4BS9A 1GEEA 4NBUA 2OGUA 4E5YA 3GZNB 3G1UA 3UH1A 3GPIA 3TZQA 4N5MA 2C54A 2JD1A 2EW2A 4CMJA 4DYDA 2DTDA 4OHUA 5L7WA 2NACA 3PDUA 1W0CA 2W90A 4PRKA 4E31A 4FOOA 4DC0A 4A7PA 3BTVA 5T5QA 3BMCA 1FK8A 1I5RA 4CM8A 5CDUA 1PX0A 3PJEA 1Y8QA 2O23A 4XGIA 1U3WA 4Y6RA 2E37A 3A06A 4XQCA 3ZHZA 5A3JA 1G0OA 2V7PA 3HE3A 3WNQA 5LCXA 4J2HA 2VT3A 3W4KA 2QRJA 2VHZA 1OOEA 1SEPA 1N92A 4JN6B 4WCFC 3RFVA 3WFJA 4NBWA 1YB5A 4PZEA 4OSOA 3BTOA 5KJCA 1A71A 1L7DA 1HTBA 1I3LA 3WYCA 1X1TA 1SEVA 2R6JA 4OH1A 1PZFA 4AJNA 1GUZA 1CDOA 1U4OA 3AI3A 3JQBA 3C3XA 3F47A 2JAPA 1LSSA 1JKJA 1I2CA 1K2WA 4RPJA 2X22A 3ZNQA 4NDNE 3N7UA 1YQGA 4HUJA 4YPOA 4DL9A 3GG9A 2WSBA 3OA0A 5C7OO 2AQKA 3GPDG 3I6IA 4J1SA 4NU5A 3F46A 3HG7A 4Q3CA 3ASVA 3PTZA 4YJHB 4E30A 3NGXA 2O7QA 1U7TA 3M6IA 2ZTUA 4ND1A 3ZU5A 1UR5A 5I7FA 3TRIA 3C1TA 4OQYA 3FWZA 4CL3A 4R01A 5G4KA 1IE3A 2SCUA 1QP8A 4K28A 1OI7A 5EMHA 4K1LA 4GMFA 4CLDA 1WWKA 3DFUA 2VUTA 3BTUA 3JQDA 5CEFA 3CH6A 1HDRA 1A27A 3Q0EA 2X0JA 1GZ4A 4YQYA 5ILGA 1BXZA 1V3TA 1V35A 2I5PO 4FC7A 4IGEA 3LC2O 2I76A 2EF1A 3QVWA 3ANMA 4E2XA 1CF2O 3FNEA 2HAEA 3RFXA 5ITWA 3SLGA 3WFIA 1U8XX 3UF0A 4RVGA 1PJCA 3HADA 3PXXA 3VZRA 3W1VA 3GEMA 1R0KA 1XELA 1MX3A 2DKNA 1ADBA 1T2FA 3H7AA 4J1NA 4QSMA 4CLEA 2HMVA 4HWKA 1PJ3A 2C29D 3R3SA 5U9CA 2VCYA 1B8PA
chains in the Genus database with same CATH superfamily
3ZVLA 4BFUA 3G5LA 5I9MA 4AJJA 3LP8A 4ESOA 1IZ8A 2NXJA 3DLIA 3UJAA 1RMTA 3QK7A 4BZQA 5F98A 1Y8AA 1BFKA 3AC0A 3RK1A 3NLLA 4ZAZA 5JXHA 5M04A 4FZRA 4JGIA 4ZAGA 1OZFA 2W6NA 3RHTA 1ICIA 2VDPB 4IS2A 4L74A 1UKYA 1UC9A 2GM9A 1PT7A 3DBHA 2FCRA 5MDHA 4BKUA 4HD8A 1BAPA 3U7EB 2AOXA 4B7XA 2I66A 4PHCA 1R6XA 2Z9BA 1V39A 2PYZA 3JX9A 4Q34A 2LCIA 1PS0A 2QL5A 1ZN8A 3BHNA 4EHFA 4AZVA 1MOZA 4WK4B 4DY6A 1KP2A 1B73A 5U4QA 1SH7A 2XKKA 2RGWA 3VC7A 4HWSA 3MC1A 1MUUA 1FMCA 4ERXA 4FVTA 3MIIA 4L72A 4YRMA 1BOOA 1H2BA 3NXKA 2TMKA 1NLYA 3I9KA 3MILA 1AKRA 3NOVA 3E27A 3G3EA 4RL4A 1BQEA 1XR3A 3D0RA 4XVUA 5K8CA 3AR8A 4BPBA 4MNTA 3KXPA 1PNQA 1SD5A 4CG0A 4FKZA 2IWRA 3FZNA 4GX0A 4CRWB 1NMQA 2G17A 5BQXA 3LFTA 3WLKX 2EZ4A 3ZZ1A 1C1DA 2VP2A 4BZPA 3T3MB 3GCDA 5I7OA 4C4YA 5CB0A 2OFXA 2HSWA 2O7RA 2RGEA 3OPYI 2WKQA 3G1TA 5CDGA 1P18A 5BN4A 1HDGO 1U2DC 4X8MA 5FV4A 4Q24A 3N2LA 2IGBA 3OMLA 1H2XA 4XM2A 1E1MA 3T52A 3R0QA 4Y9UA 3B51X 4J3NA 1SJ9A 3NHBA 3A4LA 3HI4A 2AI1A 3AR6A 1B2LA 1FP1D 4JVOA 2C1ZA 5CDYA 1KEEA 3F4BA 2BHNA 1K5HA 4RTSA 3KEQA 2CZQA 3IRVA 2JAWA 4PYLA 1A72A 5M3BA 2AN5A 1IPFA 2LDXA 4IIJA 4E09A 4BP1A 1IY9A 2VT7A 2QN6A 1NX9A 2JIZD 3AW9A 4AWXA 4E03A 4D56A 4PHTA 2NP6A 4RU1A 4M0DA 4WMLA 5LPNA 1XTIA 3V4ZA 2YOHA 3OQNA 3MJ4A 3HCNA 1C29B 5DW0A 3V8NA 1VLHA 1NPYA 2Y1XA 5DTMA 1UXKA 3ENVA 3R76A 2IS1A 5A02A 3DMTC 3Q7PA 3Q98A 4FFPA 4P08A 4JP3A 2D5CA 1ZNZA 3PGKA 2HMYB 3HDHA 3RBAA 2ZYIA 3C16C 4DJJA 4G41A 3E9EA 3D7RA 1P4AA 4KX3A 4D4LA 2AI3A 2W2TA 1JHPA 5HE8A 3TOXA 1F6BA 1KFCB 2PTHA 4PX3A 4YLYA 1AKYA 4JFAA 4BO2A 2GPYA 3R23A 4ZT7A 1VSBA 3SOZA 4LBYA 1G4UR 3LUHA 3D8BA 5K4HA 3GV0A 1FQKA 2QN1A 4WFQA 3UGJA 2XF8A 1DLIA 1A9OA 1PVDA 5IDYA 4ABTA 3IJPA 1TT5A 4NS1A 4N5HX 1P9RA 3OT5A 3C0KA 1YAJA 3B5IA 4XJVA 2GEJA 4N6OA 3Q7SA 5LBUA 3RTAA 5JNVA 4ZOLA 1KH1A 1KYYA 2EARA 4R9SA 1A7KA 2VH5R 4EQ6A 2IOQA 4PTLA 3ZCUA 1XB2A 1YVEI 2B83A 2VCEA 3CKLA 2FSIA 2RHCA 4LJ5A 3FNRA 1MPTA 4L8VA 1ISSA 3I52A 3BB1A 3Q2KA 3FR8A 4ARSA 5FQNA 3P2OA 4BNXA 3CZ4A 2QZPA 3MFYA 4MVJM 3DV2A 4F1WA 1E79D 2J87A 3SM9A 5EPUA 3E7XA 5SY6A 5EKXA 4GU5A 5JDCA 1MU0A 5FOSA 3F3KA 4QECA 1H22A 1BH2A 2OILA 2IPLA 2PHZA 1BXRA 3G2LA 1W36D 1W5TA 4BNTA 2FPRA 3OU7A 3FMFA 2B8JA 4WA7A 5EHNA 3I8XA 1KEVA 4IF6A 4UREA 1YR7A 2PGIA 2PMFA 4BNYA 3J81k 1RMYA 2O7SA 5H4HA 3T1OA 2ATEA 3CKKA 4GLFA 4UVIA 1FX1A 2CHUA 3I6YA 3EVFA 5I3CA 1K6JA 5KQPA 1BFDA 3ENQA 3QI2A 2LWIA 3BH0A 4ZVOA 2G40A 4B6EA 2Q2NA 3O8QA 4L6AA 2ZYUX 2R1TA 4ZEWA 3KEFA 3IAXA 3FPFA 3B53X 4H15A 1I6LA 1XHFA 1UOOA 4U6SA 3DE0X 2VDJA 4R2KA 3T5DA 4DZRA 5BN5B 2G88A 3D0OA 4BO5A 1UBUS 4PLVA 4CMHA 2JAUA 3L8FA 1T1SA 3NU1A 4Z9AA 3TB6A 3HJFA 2H1HA 1CJTC 1CUGA 2Z1NA 4BJ5A 3VMMA 2EAUA 1S3FA 2NZJA 5H02A 3WK9A 4C2AA 1GNSA 3CKYA 2O2ZA 2F43A 4I1SA 2C7GA 3LQYA 4QYTA 5JCOC 5KDDA 4G63A 1Z7GA 1L5YA 1OGJA 4Q4CA 2H65A 5FKJA 3V4PB 1I4WA 3OP4A 2H4HA 1BVRA 1VECA 4P7BA 1WRBA 5F5LA 3DB1A 4GFDA 4YH1A 3ECCA 3F5QA 2IXGA 1FJGB 1O9GA 5G02A 1KDTA 3KZVA 1G1MA 4Q02A 4TLMB 1WB4A 1CR1A 3ID6C 3ZV6A 4B43A 2NUBA 4ZCLA 1KIMA 3R5FA 4RADA 4JELA 2DECA 3GELA 5C4GB 4B6RA 2XEXA 4JU8A 4L8YA 1PTKA 4GZMA 4HGNA 1DX4A 4YRZA 1K66A 2FHSA 2CVOA 4UM9B 1Q1ZA 3K6JA 4AJEA 4I9UA 5D5QA 1E3IA 4Q4AA 1CYDA 3K9NA 1FRVA 2VNSA 4H6XA 3VU0A 4BV8A 1EB8A 4M0UA 4TKUB 2PFGA 4J1QA 1B23P 3IXMA 4HATA 2HZBA 3T5BA 2DVMA 1YFLA 3NX4A 1Z82A 5BOVA 3E2MA 4EDFA 3O84A 1YBMA 1LB1B 2WDPA 2XGMA 4L4XA 3GFOA 4OUDB 2CLLB 4PINA 4AKGA 1OXVA 4UVHA 3WAGA 3H4VA 1UWLA 3IBSA 3BEOA 3AM1A 4OJNA 1DQYA 3H6GA 2ZE5A 2HJRA 2BFAA 2R84A 3D6FA 3P9YA 5EIFA 3GWZA 4L8FA 3MXTA 5H7XA 1N7IA 5E9WA 3JVVA 1KI1A 1GWNA 3NDPA 3EVNA 4BKQA 4BNLA 3QHQA 1U5BB 2Q9AA 3QW4B 4OQ4A 2GWRA 5HHTA 3OOEA 1SVMA 3G0BA 4ZJYA 4RTRA 1DQPA 3WYNA 1Q1AA 1KQFA 1FP6A 1BN6A 4JJAA 2CLSA 1XA0A 2I6TA 2JFZA 1XTQA 2JHCA 4HB2A 3CEJA 2RK6A 4V0RA 3BQNB 1TO2E 1MB9A 5FOVA 5IT9A 1F4LA 2E5LB 2AT1A 4C21A 4D4JA 3Q11A 4PAMA 5CA0F 4H7EA 3BERA 2M9MA 1RYZA 3C3BA 3CM0A 5F9MA 3Q88A 4KOEC 4KU4A 1TGYA 4Q93A 5EKUA 2JIBA 1LI4A 2A94A 3OP1A 1CJMA 5BWBA 4Q4HB 4AMBA 3VAZA 5JAUA 2VNHA 3O9VA 4LVUA 1RQRA 3ULKA 1RWKA 3GA7A 1X42A 1ZOSA 2YXDA 3I5AA 4CMGA 3N5CA 5JS1A 1K7XB 4MQ6A 4AI6A 4YV2A 4XIGS 2HHHB 2P0YA 5J1TB 1AK2A 3ZJ4A 2W2MA 1ZI6A 5I9NA 5A9RA 1V6CA 1SZDA 1XDDA 3Q3VA 5JH7A 5JRJA 3UCEA 5M5BA 2O8CA 2R1VB 1YCGA 2C9MA 4KVGA 2V7EA 3HLTA 3QMMA 1MABA 2VF7A 5BQOA 3FY4A 3IUQA 1F7VA 3UK7A 3CX8A 1KIAA 2YYZA 4YGXB 1T2DA 2WHYA 3PVCA 2QBYA 1P2DA 4OBEA 1OVMA 4QATA 5CXUA 3OEYA 4E0BA 2M1ZA 1M10A 1N6KA 3W5CA 5JJIA 3WP1B 4QHSA 4URWR 3S68A 3NWEA 3ZLJA 1XE3A 1G6Q1 4PC6A 3PE6A 3HTXA 1ZIPA 2IHUA 4ALIA 3QPCA 1GRCA 2ZWVA 4KPUB 5K8LA 2CMDA 3H2HA 2JAOA 4P83A 1BW9B 1QMGA 3AERA 5TGZA 2I7DA 2BM9A 4QOIA 1OI2A 3OI7A 4C5CA 2SHKA 3KPUA 3AOEA 1ESCA 1SN7A 4K03A 4O1MA 3LGAA 3JD2A 1PZXA 2BKUA 3DFKA 3I9OA 4YCJA 3TTYA 2H7XA 1HI9A 3THYA 1RLIA 3PXUA 4P3XA 2ECFA 3KO8A 5BNFA 2RKWA 2JLVA 1YVDA 3SN6A 2FPLA 1TQ8A 5FR1A 4RGYA 3WKEA 1K68A 2H3HA 3NIFB 4JC5A 4B9AA 1T0IA 1RAGA 1JIKA 3TEFA 2CL5A 3BC1A 3IDZA 2OQRA 4LHYA 5CLIA 3VYRB 4EPRA 1FP2A 4QYXA 2MWMA 4YONB 5LQDA 4IWNA 5JXJA 5LQMA 3ETDA 2GN8A 4JQZA 5BWNA 5IASA 3S7ZA 1GPWB 2OM2A 5LIRA 3ADOA 2QW8A 3EHEA 1EFHA 2OO7A 3DPIA 1JLRA 3IT2A 4X0EA 1PFYA 4ZC8A 5IKPA 4R0MA 3ZZMA 2ZRKA 4G65A 1W87A 1AKVA 2NG1A 2Y9PB 1BRMA 3EMVA 3G49A 3M4XA 3U0BA 5CD9A 5K7SA 2XMQA 5L3QA 2RK3A 5L95A 2FNAA 1F5SA 1ODCA 1RAIA 1Z5VA 3U49A 1HE5A 4DLWA 4F8EA 3O1LA 5JZ9A 4N41A 1X1DA 4NYJQ 5F2EA 3A1UA 3WMRA 2BUCA 4C6RA 4YI3A 3JWIA 2X2FA 3KQSA 4PZUA 4ZU6X 2JK1A 3EUAA 3SHTA 2B4QA 4JI7B 1RWXA 4AB1A 3RE1A 4OHVA 2C92A 2X5XA 5AYVA 3N76A 5KWIA 2LRHA 3F4LA 1Q7CA 3RI3A 1OASA 4QHYA 4TYQA 3JYPA 1PD1A 3E9ZA 2WP8J 1DQNA 3IMEA 1TU4A 4GOJA 1I0IA 1CEXA 1SKQA 1WJGA 2O14A 3L9WA 4GKBA 3HACA 3O3NB 4HLNA 4RCYA 3HDQA 2BDUA 2XA1A 1JJIA 2QTWB 4I1YA 1P72A 4M1YA 3X2FA 4DVGA 4MHTA 4KFUA 4Q3EA 4YX9A 4X7RA 2WSSA 1HTTA 2D1TA 2JS7A 3L79A 4DSAA 5K99A 2YZ2A 2IOYA 3KZNA 1WZIA 1C3JA 4TS4A 2X5NA 2ZJFA 1TCBA 3BD6A 3PC6A 3K73O 8ADHA 1YVPA 3NVKI 3UC5A 1HKUA 5LBIA 4M9ZA 2Z2IA 1ODTC 3ZXYA 2WWRA 3N05A 1Z13A 2OXRA 4I55B 1UMDA 2P6NA 1MJFA 4C78A 3IAFA 5KQLA 4NPAA 1D07A 1SKYE 2EBFX 2YV5A 2WIAA 2V7UA 4EAAA 2UV8A 2VL7A 3MCTA 5ALOA 2JFHA 3E9RA 4RVOA 4G5RA 4NOMA 2D1FA 2W98A 2GZHA 1QCDA 1Z17A 2XA9A 3LYUA 3JQ7A 4R98A 3RDPA 3ZNNA 4P81A 3QVMA 4OJMX 3SJ7A 4DNPA 4RSRA 1Z88A 3H99A 2SKEA 4LMPA 4BJ6A 3B1VA 3NPAA 4BASA 1P2SA 2VKTA 5JXWA 4I1OA 3P27A 4S35A 1JAZA 1Q1EA 3M1AA 3L0BA 4G8BA 4PG8A 1QHSA 2M1XA 2FUNB 1DC8A 3WJAA 4AZWA 5JCZA 1GFZA 2O2DA 3BSYA 4QEZA 1PNTA 4RK1A 1WR8A 4XR4A 4ZQFA 5A5EA 1DC5A 5ADVA 1Z68A 1YB2A 2G5CA 2JCVA 3NTQA 3T9CA 3NDJA 3TOVA 3UGTA 1K8QA 3WQHA 4BX0A 3VR5D 3VKWA 3T9AA 1TKRA 2GA9A 3VAYA 4YCNA 5AXDA 4CUZA 1U0FA 1VDZA 1AQNA 3L7CA 1RYEA 2G07A 1Z2NX 2VG8A 3OQIB 3HJRA 4U8HA 1KOLA 1V43A 4IIUA 3IIIA 4X1KB 2WV7A 3UK6A 5HYVA 3BAZA 3N2IA 4FWTA 2H54A 4DUGD 3DZIA 1MTZA 3KKZA 5FPTA 1II9A 1JTEA 4REQA 2C96A 3OX3A 5YASA 1T2EA 4LJLA 1QPBA 3A4IA 1JXMA 1PF7E 3LPCA 4WD3A 5G1OA 3KV3O 1N25A 3AUKA 3LW7A 2H1SA 3B52X 1EVJA 3LVBA 2VDKB 4WCFA 1TM3E 3OCYA 3ICEA 5LA6F 1X8JA 4BRZA 1V26A 1CP3A 2VQ3A 5J5AA 5CLJA 1DG3A 4WOJA 3EAQA 5IYZB 4QUKA 4DW8A 4EKIA 3MRTA 3PNBA 1TKBA 1EHYA 1G21A 3LZCA 1NJFA 1V3UA 3OZBA 5JD4A 2FRXA 1NW6A 4MV1A 4WHMA 7ADHA 1IOWA 2IU3A 3ZD7A 1O94A 4B09A 5E6RA 4ZO7A 2NWQA 2R11A 3KOYA 3QG5A 3GGOA 4CHTA 1THZA 1LI7A 2V74B 3N8NA 4WKOA 1EB9A 4XGQA 3T7DA 4PRYA 3KU1A 1M5TA 1H2ZA 3I09A 1J21A 3OFKA 4MIOA 1QV6A 3S2ZA 3RC1A 1JHMA 1E7MA 2IYQA 1X8LA 4H7FA 4UM8B 2BH9A 3O21A 1XZGA 1D2HA 1VHQA 3UJCA 3OUUA 1G8PA 1U1DA 2B36A 3QF4A 1RWWA 4PONA 2QRQA 3W2EA 1CEYA 4Z8YA 2IHZA 2W2OA 2ETVA 3ZWXA 3KHSA 4BLUA 5L3VA 3T3OA 5CXSA 3B13B 2EFYA 3DL4A 1OAOA 2VK4A 4P34A 3TBKA 5DP2A 5BP7A 2UUAB 4QPCA 4UEOA 1R9MA 1Y3AA 1BCRB 1JZTA 3FRHA 4KBYA 3AR3A 5AJZA 3GUHA 1I24A 4WGFA 3S0JA 4L85A 1UAAA 2FDCA 1H2RS 2C82A 4HQOA 4MV9A 4BQEA 4H17A 3TM5A 2CXRA 3SHFA 1N2CA 4R2IA 4PCVA 4D96A 5BPHA 3P4YA 3NNNA 4S1OA 1WOMA 3C4JA 4RBNA 2PGLA 3CRZA 5KSPA 3TSOA 1N7GA 1M76A 1HRDA 3R44A 1QPGA 4H1VA 1QVWA 4UFNA 3SQDA 3ZIUA 3SK0A 4X7BA 3CBGA 2QGNA 1NATA 3EGOA 4QICA 2IFTA 1U80A 2QMYA 4JV5B 2GERA 5HK8A 1RJFA 3RT7A 5HJ2A 1X7ZB 4Y9TA 1DAKA 2V3WA 5B1YA 4RFVA 5CRIA 2R2GA 2ZGVA 3ANTA 3AUYA 4KQGA 3E03A 2EJWA 1XQ6A 3BVPA 3UK0A 5DHQA 3RTBA 1E89A 4XD2A 1VL8A 4I4IA 5DBOA 3AEKA 1X0XA 3R5TA 4MTLA 4DADA 3AVTA 4B17A 1RQ7A 4GR5A 2Z43A 1QHYA 3D8HA 2A1TR 1OC2A 2ZM5A 2AXNA 2G7MC 3ZX5A 4CQMA 1UKZA 4JODA 1NVVQ 1YB7A 4LY0A 4NFLA 4TVOA 6GPBA 4MRMB 2YYAA 2QVGA 3DWGA 1LNSA 4D6YA 4LF7B 1N2HA 2JW5A 1ZD1A 3LC7O 5EERA 1MOPA 4BWFB 1RZ3A 1I80A 3AUAA 3KVYA 3ACBA 1A82A 3QG1A 2VHUA 4LV8B 3WSWA 5IFLA 2CD9A 2GSDA 5ALPA 5LFAA 4JJZA 3DLAA 4FSXA 4W6QA 4J4BA 1BKYA 4Z9YA 1L1FA 5K0BA 3CGGA 3CPEA 5K0LA 3ABRB 1UBGA 2NU6B 3IRUA 1XLUA 3BSSA 4HFJA 1P73A 1NJSA 1ODJA 3OAAA 4DRXA 5TPZD 1ZPDA 3IUYA 1BMTA 5KNDH 5KPJA 3GLIE 7GPBA 3U60B 2UZ1A 3UICA 3G02A 3PRKE 4KSYA 4JUDX 1AY0A 4MB2A 7ABPA 5T67A 3HJHA 2QR5A 4YUAA 3KC2A 5C80A 2PRIA 3LUKA 3FUCA 3OPVA 4MKIA 2ZWIA 3RCBA 4OHXA 3WGIA 3AY6A 3BIXA 2VYCA 3QE0A 1X13A 1DIHA 3ZDRA 4EFKA 4EGFA 4RKQA 1YR8A 4OU5A 1S2NA 5ULLA 1WSDA 2AX3A 4EPXA 1U2GC 1FJHA 2RAFA 1BIFA 3H9CA 1W1UA 4ZCMA 3PR3A 5BQ5A 5C8YF 4V03A 3BE6A 4NENB 2OAEA 5TMDA 5T6BA 5DNWA 2YWJA 3QEJA 3DZBA 4BGIA 5BNIA 1Z18A 5TARA 2IDJA 1ORTA 2Q62A 4RXMA 2FZCA 5JBQA 4R2XA 2WAYA 5EP4A 3DOFA 3RRXA 4C3UA 1UJNA 4QVIA 3WK6A 3QE9Y 1WXWA 3CNHA 3AB7A 3WKCA 4OMCA 4NCIA 4Y2QA 2W83A 3PEYA 3DTVD 3HUEA 4HADA 4DRYA 4DCTA 2OQ2A 3EVZA 3K9CA 5T4EA 1YR2A 3GLIB 4IH9A 1ZXLA 3AY7A 3VDMA 2VSYA 2JAQA 2VP4A 2XEDA 2CDRA 2XVAA 1I9GA 2OLJA 4Z9FA 2J07A 1G8YA 1LZLA 5FL7D 2WPDD 1HT3A 2RHWA 2OTCA 5L3RA 2HXYA 1EP9A 2FFJA 4YUXA 1E7SA 2FR8C 5AI4A 4UCFA 2BH2A 2D2XA 3P9RA 3L7LA 4EW1A 4A0FA 1UP7A 1DDGA 4ROSA 1YUMA 4E3ZA 2JGDB 5DGIA 1CQJA 3A4NA 5JFOA 1G6HA 1K4KA 2QP3A 1U0NA 3LD9A 1VBKA 5DGCA 1C3EA 3DUWA 1BA2A 4G8CA 1PJRA 2VUUA 1IAQA 3SKYA 3UAVA 4CL0A 4C7OA 4URHA 3K1ZA 2YJGA 3RG8A 3N6XA 2J41A 5D1NA 4JI3B 3T7KA 2RJOA 1JTFA 1XEWX 4J9UE 1XPJA 4HQ6A 3PCTA 1OC4A 1MXHA 3QPDA 2C5AA 1DRUA 1EUDA 4PS1A 2GTIA 3UIEA 1T2CA 4U3JB 4WKNA 5CYPA 1U1CA 1FX0A 2SBTA 3EIEA 5AKHA 1Y4UA 5ALRA 3UKDA 3OM8A 1TKCA 1T36A 5ERXA 2J7PD 1W9HA 4IMJB 4RAOA 1YS1X 2GM5A 3UWSA 1JAXA 5FJIA 4RIHA 4ARIA 4E15A 3BM5A 4XEUA 1W48A 2I7CA 1LPMA 1NXWA 2WB2A 5IZCA 4E88A 1UL1X 1DFGA 5AUOB 3AVXA 3DT6A 2C2KA 4HAYA 1A7UA 4DMHA 3DHEA 1IJFA 3FFAA 3TVTA 5KX5B 1HX7A 4K9OA 3KFVA 3NV9A 5JQWA 1Z4OA 3JAWB 2FB9A 4U2EA 1LPPA 2XJ4A 5FYQA 4KE8A 1T6NA 4CM9A 1V1MA 1KI8A 4GPZA 1G0NA 2PT6A 3L7AA 3CUTA 4PC1A 1P2UA 1XYYA 5G0SA 4ZI2A 2YFHA 2GZ2A 4K26A 2GNOA 3C45A 3KLOA 2NUTB 4YJKA 4OI0A 2QT1A 2WNHA 3KZXA 4FCCA 2EKDA 1XF9A 4A5SA 5KREA 2RHGB 2TMGA 3JZFA 4NTZA 4S0XA 5BYKA 5IANA 1CUSA 4V0SA 2A9VA 5FBQB 3EASA 1HV8A 2YVLA 3AL2A 3LCCA 4G89A 1B0UA 3WLRA 1XKLA 2QZZA 5HNKA 1DX6A 1W75A 1Z8HA 1C0LA 3BK2A 4DNXA 2Y99A 5EJEA 4XPIA 2CT8A 3DL2A 2IYTA 4MPJA 5AVJA 3HNRA 4LE1A 3QOYA 4YJGB 3W4JA 5BSWA 1GV1A 2POQX 2B0JA 1IM5A 3QU2A 1VC2A 5DI9A 1JSLA 2AD5A 2VQDA 2BEUB 4HG2A 3ZIAD 1REQA 3E9CA 4YO7A 1MLDA 2BGNA 5ALIA 1MQAA 2Q3EA 1JKFA 4OB6A 4Q15A 1GSAA 3WQQA 2HBRA 2QA5A 5KTRA 3GLGE 5CFOA 3ZE1B 5BR8B 3MJSA 1UOQA 3ZKWB 1DV2A 1H4SA 1NYRA 3P9ZA 1M1YA 3UT5A 2ZSDA 2EBHX 5BV7A 5IKMA 3PJDA 4RLQA 1X80B 2PD6A 4NCHA 1YMQA 1TQDA 5ELLA 2HCRA 2JG3A 1CJCA 1M2OA 2P9HA 2Q0SA 4IUCS 1DKRA 4BQOA 3IUEA 4GC9A 4MR9A 5DLYA 1FW6A 4BL5A 5KNCD 4QXPA 3G8CA 5I01A 3K6RA 4EEZA 1GKUB 2RFLA 4ZD6A 3M49A 1QIJA 1WUKS 2PKYX 3OLZA 5GVRA 3VDXA 1I7DA 1GUAA 2WWXA 3N5KA 4K7JA 4OHBA 5BSFA 2C2WA 2QLLA 1V7QA 4GVPA 4G1EB 1UINA 1CB0A 2G76A 4XARA 1U0BB 1MKYA 3EGIA 2QZ9A 1G5FA 1RM0A 3LQ2A 3L6OO 5LQCA 3M83A 2BBTA 1O5OA 1T13A 1E4OA 1ZGCA 2Z9CA 3OPYB 3R40A 4HY3A 4QPZA 1G20A 1OV4A 1U98A 4IF4A 4O1IA 4W9RA 2BD0A 1NWCA 5IK2A 3ROKA 3O3MB 4V2IA 4HSGA 3RS2A 3YASA 4TZKA 1QRTA 1PUIA 2CD7A 2G9NA 4UNPA 3QUTA 4NBRA 4WLVA 1IHPA 1OI3A 5LL6P 4MO2A 5ESWA 3PEFA 5KMGA 3Q7RA 2WNIA 4MCAA 2YZMA 3VH4A 1EA7A 3Q8LA 3F5DA 3WHLA 1R66A 2Q5IA 2GAFA 2W4QA 2P6OA 4JVSB 1J8DA 1D09A 5IYZF 3L7KA 4CR6A 4I9FA 3GHYA 1VGQA 4FX2A 4C7BA 3BREA 3BXPA 2QVYX 2C99A 3QEKA 2OWEA 4FMCF 2V7QA 3DKVA 3IIMA 4DDTA 5KQGA 4LNHA 3VKHA 4FCTA 5HMLA 4FDMA 4KYUA 1JR3A 2GCIA 2PZMA 3MVEA 1S01A 5ECWA 3RAFC 2J3DA 4ALJA 2W43A 3F9RA 2AXQA 5DJ5A 2R751 5ALMA 1ZEJA 4LA4A 3WGMA 1HT2E 1M2VA 1VYHA 3B1WA 4CEHB 3GNQA 4YLGA 2EX0A 2MIIA 1P2VA 2WMYA 2GVZC 4ITRC 1F6WA 1QOZA 5J5CA 4DKXA 2RGRA 1DG9A 5A0VA 1GGHA 4BLQA 4IDPA 1Z26A 1OZGA 2BM1A 2QQ0A 2YVQA 1HFWA 4P9NA 4ENVA 2BGMA 1D2CA 1WHSB 1V9CA 2G5TA 4GYJA 4JCCA 5DGXA 5B1HA 5TB5A 4DM4A 4F4DA 4XLZA 2XCSB 4L0QA 1L4FA 3OA2A 2FW9A 3AUJB 3GDHA 2VHXA 2FSHA 2O0MA 1MT3A 1GEGA 4MUNA 3VKVA 4Z51A 4M1OA 1ISMA 3HV2A 4KIGA 5AFSA 3U3MA 4BUZA 5J43A 4ENPA 1QO9A 3HBLA 1CLUA 2FQWA 5LKRA 3EPLA 3NT5A 3OCZA 1CZKA 2ZVJA 1ILWA 1NQWA 2J0VA 2VPWA 3IP5A 4HVTA 4KGXA 2OV1A 4QUDA 4CEJB 4IO1A 1XTVA 2JGMA 3B3FA 2I2FA 2X58A 4LE2A 5E7QA 2XB8A 2HNAA 5GV8A 4DCNA 2C2GA 4KR6A 4IH1A 4CCAA 4GC5A 1R6UA 3OEHA 1Y7IA 5ALQA 3W3AD 2P5YA 4RXUA 2JZNA 3OHMA 3IE1A 2GX6A 1NU8A 2W6IA 5JZBA 1BU8A 4FDAA 4DB2A 3FPGA 2AJDA 1C3VA 3NW9A 3HUTA 1V5EA 4JDUA 2XNCA 5DYTA 3FCXA 3EFBA 3O1HB 4HXGA 3NIDB 3OZAA 2ZYWX 2CFRA 3TOSA 3ZCTA 3BGVA 3K0HA 4L08A 2O8FA 1CF4A 3ZJUA 3FNHA 1G42A 2UZIR 4K9KA 4H1HA 2AVDA 2CNNA 2YV2A 4LI0A 5AK5A 3OIYA 3PYLA 2HF7A 3SDZA 5K51A 3HI6A 3SQMA 1RP1A 1JKXA 1YRYE 3HB4X 5H16A 4CNQA 2VYFA 3D0QA 4ZKEA 3IYLW 3OE7A 4GG1A 4R9UC 3SZUA 1G4AE 2ZI6A 3IALA 2IHTA 3T7CA 4BNMA 4ZI7F 1SG6A 5IJ9B 1XNRB 4N48A 4ECEA 1M1UA 2IP2A 2O5CA 2GPJA 2VYND 4HAIA 2R8BA 3MT9A 1VKHA 2AOUB 1QO0D 2FXIA 2Y76A 4UZSA 5MGNA 1H93A 1UODA 1TVMA 4RHEA 2WMDA 3FTCA 3P9CA 3ZWPA 1OKKA 5KYWB 4QASA 1IN7A 2X42A 2ODEA 4WQMA 4A2QA 1EVLA 1BZYA 4JR1A 3WGVA 4Z7QB 2C7OA 2ZZNA 3CZ9A 4N7RA 1ZM3A 2DYKA 5M2QA 2OHJA 3A4YA 1FVOA 3UCXA 2W4IA 3TVDA 3ZOKA 3A4TA 4ZRMA 4Y2UA 3TQTA 4PR0A 1WQ3A 4BP3A 3DT8A 1JPNA 2AE1A 4W8HA 3U19A 3NBFA 1S5PA 1YA8A 3NAQA 2AZ4A 4D3DA 1PDVA 1J42A 2PVCA 1KI9A 4KR7A 3R7LA 4HK4A 4AJ2A 4MSUA 4NABA 5DN6A 1TIKA 2JHAA 3Q6NA 3HFJA 1WZ2A 3HZHA 2XB2A 2F90A 2VTVA 4BXOB 2XSZA 1X8KA 1VTKA 1T29A 5ADUS 5HF5A 4AJLA 1ZFNA 3FYTA 5H0IA 2I4IA 3DZCA 4PC2A 2PCLA 2YNMD 3PNVA 4N9QA 3EIQA 4RPLA 4NESA 1E9EA 1YMUA 5BYJA 4PYOA 3ROFA 5JANA 1HZZC 1VSUA 4PHHA 2D5BA 1HRKA 1ZP6A 1XLTA 1HT0A 2FSVA 2CYBA 4Y6SA 3ABQB 4NJEB 2NPOA 4F6LA 2BOVA 5L4SA 1E3QA 2INGX 3PYXA 4HN2A 3CLRD 1NW8A 1OXTA 4WSOA 3GJ5A 1KJIA 3BYZA 2FEOA 3LLMA 4GE0A 1AS3A 4FMDB 4LJRA 2QM7A 4HNRA 4ZZ0A 1IM8A 4Y2TA 5TS3A 4QLBA 1UK8A 2JB9A 3NRBA 2WEKA 2H11A 2NPIA 3GVPA 4HQNA 3HJGA 4OJYA 1YL5A 1ISGA 2JBWA 1FUEA 2C9CA 3EPPA 4WEOA 2WY2D 2IXAA 2R4QA 1NC3A 4AF8A 4J16A 2MOKA 3JWJA 3ZX4A 3LDFA 3UATA 4BFZA 1NMSA 3I92A 5DO9A 4KO8A 3C6MA 1HNWB 1FLNA 1Q6YA 3L4BA 1T9HA 4NAHA 3LCUA 4CDRA 3QWAA 4N7BA 3UW3A 4JH0A 1CVLA 1WMEA 1O96B 2DCMA 4UVGA 5TT1A 2QX8A 5ALYA 3OU2A 4Y0NA 5WRFA 1NR7A 2FEPA 4IDNA 2OENG 3H42B 4FHFA 3R0ZA 4UHFA 1IATA 4OQPA 1MC4A 3WHKA 3ZPXA 1XIVA 2VT2A 3QFFA 2WZQA 3BMNB 4L1KA 1SG0A 3GMTA 4EFMA 3UW1A 1TQHA 1NE7A 1HDIA 2I80A 3TG8A 4BVEA 3ETCA 1RADA 5EFZA 2OLKA 1ADYA 3GFQA 3LUAA 1XXLA 4HB3A 4DPMA 4BIIA 3CF4A 3AR2A 3EQZA 1A95A 2EXXA 3UMCA 3TLJA 4AZSA 2A5DA 4JNKA 3AUTA 4INAA 3K9LA 4A92A 2P35A 2Y1GA 3TFOA 5CVTA 2PJRA 2CJWB 1ZJJA 5JZVA 1L5HB 3CVUA 2Z4RA 4E5PA 5C2JB 5JUWA 3AF6A 2Q5JA 4C0KA 4ZI3A 1Y6JA 2VCHA 4URFA 5BN5A 3WYDA 5IG2A 121PA 4JX8A 2IBMA 1T4GA 4UE3S 4LRXA 4P36A 1CR4A 1AZTA 1L7EA 1QZUA 2PO5A 3AH8A 1M66A 3HR8A 2XUZA 5CJ2A 4D9HA 3T7IA 3UJPA 1B7GO 1A1SA 1XN4A 1UKVY 3GJZA 3CVVA 3MTDA 5HQ3B 5A4KA 4KQEA 5ITZB 2VJMB 1SK8A 2QG6A 3HCCA 4CM8B 1HO3A 1V9LA 1D4OA 4BC0A 3KDPA 1Y8QB 2ZTHA 3ED5A 1Z2CA 3FNGA 1AJEA 1EG2A 2FCAA 4FE3A 2OP0A 3WR5A 4F86A 5JSUA 3HY4A 5GM2A 2ZAGA 4QZVA 1KYIA 2HHJA 2OYCA 1QG0A 3T41A 3NBUA 3EMDA 2TMYA 2X13A 3E3OA 5DCWA 3IQWA 4NNOA 5LZ9A 3WV4A 2QN3A 4Q00A 5KOIA 2DR3A 1T9CA 3QNUA 1CB7A 3AJRA 4GZ6A 3ND5A 4WAUA 4FOLA 1QRDA 4TGLA 4GMHA 3V34A 3F4KA 1SXJC 5EJ6A 2G6TA 2GN4A 2ISSD 2P65A 1KC3A 4IG4A 2EFJA 5FWYB 3NOOA 3MZ0A 5CJJA 4ZGBA 3FZGA 1TEHA 3A3PA 3SNKA 1JKJB 3BA6A 4WLUA 5DXJA 4AKEA 1LPAB 4JHLA 4RD1A 2PSDA 2XD4A 2WYOA 3O0DA 4CM1A 5BSRA 3UWKA 2XBMA 1DFIA 2VEOA 1YRLA 2C1XA 4Y3UA 4E5NA 2GN1A 4ACAA 2NYVA 3W04A 1LKZA 1WVIA 2WQZA 2CCGA 2DY0A 4OUDA 4AKTA 4D8XA 3IIJA 3G8DA 2WTMA 3Q9UA 5EJ4A 3E5NA 3MJEA 1Y5NA 2YQ5A 3KVNA 3Q3IA 5KOYA 1PT6A 1Q0HA 4LGMA 5H8WA 5M34A 4W5JA 3WJ7A 3E1KA 1JU4A 4B4OA 2JKVA 2WF6A 2Q5QA 1OR8A 3CJRA 2VAMA 4CZ2A 4F71A 3IXLA 3NBQA 4MVCA 1FYWA 1LNZA 4Y2VA 4Y2JA 3R9XB 5G4KB 2P5TB 1U5BA 4NEQA 4F3RA 1SQSA 5BUZA 4WJKB 3N1UA 1KQPA 2P6MA 3ESAA 2EFDB 3NOXA 4I3FA 3QVUA 4P58A 4YUVA 1YIOA 2FMFA 3VO8A 3IBCA 1G4HA 3CR3C 5DHAA 5CFZA 1M34B 2CHGA 3PXEA 4JXKA 5T6MA 1EUQA 2JIRA 4J1TC 1QFJA 3R6WA 3A0UA 5E4JA 1CK4A 4Q12A 2FX2A 1O4WA 4M8LA 3VR5H 8ABPA 5FBLB 1AV6A 2OHOA 1YVRA 3K9QO 3KR1A 1L3IA 2GXSA 5JY6A 4DSTA 1ZYUA 2QSUA 4AW9A 3ROPA 5LR6A 5KAMA 5IVKA 3IPRA 4QLAA 4J03A 4Q4HA 4BMCA 4QAJA 3EPKA 1RHMA 4EQ6B 2AOTA 1Z37A 2ODBA 2WYHA 3ZY6A 1UDBA 2D1RA 4RY9A 1TAGA 3AV0B 1QRRA 3L0ZA 5LDGA 3FN4A 5CM8B 3TAHA 3A4VA 1UEXC 1KJNA 3MT0A 4JK3A 5IXSA 1TK2A 1K86A 1KFBB 3LA8A 4TWIA 5T4HA 4QG3A 1DHRA 2XUIA 5K0SA 4LGCA 4NYIR 4JOCA 1K5GA 1E7QA 4GXQA 2Y1DA 4CI0B 2HPAA 4ZQEA 3LOQA 4R1LA 1U28A 2GA8A 4J7AA 1KKLA 3F6CA 4G4SO 4IVQA 4M0LA 4G0VA 2PO7A 4R1SA 2ODQA 4DR6B 2R85A 3Q9NA 1SBHA 4GBED 1TTPB 5ITSA 1T15A 3GJ6A 2HRDA 1NG1A 2V3CC 3QPVA 1Z4PX 1ZUHA 2A1IA 3FWPA 4AFNA 1T9ZA 4I14A 4IBOA 5IZ4A 3NHZA 1YI1A 3IR6A 5LXTF 3TSYA 3TZLA 4OQDA 3KIPA 4RC9A 3FJYA 4KPUA 3I2YX 2I4NA 2WG1A 1BW9A 4KYTA 1TGVA 1G6KA 1MB0A 1ZGBA 2WJAA 2C2YA 4H35A 4HFMA 4NPCA 5B4TA 1RWBA 1S7GA 3HPRA 3GA0A 821PA 5B5SA 3IMCA 4S05A 3K92A 3DE4X 4IIEA 4KQHA 2DFPA 2M6KA 3WMXA 4WESB 4F97A 2PK3A 4UARA 5FUWA 3R0VA 3UHOA 1F2DA 2ZM6B 1QOPB 1DCTA 2YH2A 2Q49A 3BZUA 3R2JA 5E4FA 4E5VA 4KFCA 1QE3A 2I54A 5J4KA 4JLWA 3AB8A 3EGXB 2ACWA 1XALA 1Y9AA 3H2SA 4OGWA 3ZBTA 3ZW8A 1X15A 1NPTO 3NZEA 5I45A 3BB4A 1TT7A 2EQAA 1CY4A 1MENA 2WF7A 3M89A 2ATCA 3O95A 1U3CA 1ZK4A 1ANKA 3OIVA 5GONB 4W5TA 3SEQA 3GLTA 5JRDS 1KBOA 3DH0A 4J49A 2Z4TA 5AKEA 3WK8A 3GLKA 4YQZA 2WWFA 5C0OE 4RIIA 2I9PA 1T35A 2XJ9A 4PAQA 3SZOA 1KSHA 1NZDA 2DTXA 2HYIC 4F5WA 2HO4A 5GMOA 2NVOA 4MJ3A 3O03A 2MSWA 1OLUB 4E2ZA 8LDHA 7MDHA 5LWHA 5CTAA 1XPRA 3CH5A 1WUHS 3TRKA 1HORA 1RXYA 4AUMA 1D9ZA 1RQPA 1UWKA 1KO8A 1ENOA 3OCUA 2AZTA 2O19A 3D4LA 3EX7C 1ODFA 1Z5GA 4DIBA 1CZNA 4HLDA 2O54A 4MUGA 1CPYA 4MP8A 4RDHA 4UTRA 2ECPA 3UNXA 3JQ6A 4DYVA 4JIMA 2RH8A 3I6QA 4Y1RB 3PFNA 3PQEA 4ALKA 2GDJA 1MB2A 2ZJ1A 4G0UA 4MZDA 1RXIA 5EQDA 2R1UA 4WK6A 3A6ZA 4BWVA 2XQJA 3KEGA 1T8YA 3QVVA 3AXTA 4LRWA 1YCDA 3HGMA 2Y2UA 1W0JD 5JYBA 3PGVA 4P35A 3EVTA 3FVTA 4PYKA 2OXIA 2WOOA 4F21A 1FY2A 1B1CA 1Q6ZA 3GGSA 4YP9A 3RRBA 3B1JA 3BBPA 4HNHA 4TN5A 4I55A 5FFFA 3ICWA 4YRIA 1CIVA 2A5JA 5HF9A 4G9GA 1ZD3A 4JXJA 3R0JA 1HDZA 3MTEA 2J9FB 1O8BA 3FZYA 4JC0A 4IUDS 3DUFB 2CDCA 4FTWA 1QR6A 5AHWA 5AI8A 4G1UC 5ANRB 2HRQA 2Q5CA 4ALNA 1MV8A 3W9SA 1GLGA 3EZXA 3ZDCA 2A0XA 1L5SA 1VB3A 2X6QA 4GDFA 4KLCA 3RSSA 3DAPA 3C6BA 4NBTA 2JPDA 2MU1A 5FLYA 1IRXA 4E22A 1JMYA 2FZKA 4RVFA 6ADHA 3RANA 3PEUA 3PWTA 5FUMA 2XODA 4R2MA 1ZWLA 1ZW1A 3V2UA 3VC1A 4I1IA 4DOMA 5KOHB 1EFRD 4PGGA 3QENA 5E2BA 4BFCA 4WY5A 4FOPA 4PCLA 3PQ3A 2H17A 1AZWA 2VAPA 3PKIA 2LZ0A 3T3IA 4CTKA 3ECSA 3JS5A 1WMDA 4QQFA 3QYPA 9LDBA 1QHHB 3OEEA 3DNFA 4QQ8A