1THMA

Crystal structure of thermitase at 1.4 angstroms resolution
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
279
structure length
279
Chain Sequence
YTPNDPYFSSRQYGPQKIQAPQAWDIAEGSGAKIAIVDTGVQSNHPDLAGKVVGGWDFVDNDSTPQNGNGHGTHCAGIAAAVTNNSTGIAGTAPKASILAVRVLDNSGSGTWTAVANGITYAADQGAKVISLSLGGTVGNSGLQQAVNYAWNKGSVVVAAAGNAGNTAPNYPAYYSNAIAVASTDQNDNKSSFSTYGSWVDVAAPGSSIYSTYPTSTYASLSGTSMATPHVAGVAGLLASQGRSASNIRAAIENTADKISGTGTYWAKGRVNAYKAVQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of thermitase at 1.4 A resolution.
pubmed doi rcsb
source organism Thermoactinomyces vulgaris
molecule tags Hydrolase(serine protease)
molecule keywords THERMITASE
total genus 105
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.66: Thermitase.
pdb deposition date 1992-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1thmA00
2XTJA 3WQBA 3DE4X 5I9SA 1YU6A 1PFGA 2DUJA 4C3UA 3DE7X 2ID4A 3WIUA 5FAXA 3DDZX 1TO2E 1TM4E 1Y3FE 1YJAA 3VTAA 3A3NA 3D9QX 4KB5A 1P7WA 3PTLA 3EIFA 3TECE 1TM5E 2PYZA 2WV7A 1SCNE 2Z2YA 3DE2X 1GTG1 3EDYA 1C9MA 1SBTA 1LW6E 5JXIA 3SQOA 3PRKE 1Y3DE 3TI7A 5K7SA 3TI9A 1Y4AE 2ZWOA 1JEAA 4BWGA 1TM7E 3GCXA 1WMEA 1ZVJA 3GT3A 4OMCA 5ARCA 1MPTA 1TM3E 1SBNE 5JXHA 1CSEE 2PKCA 3GCWA 1SIBE 3UNXA 1ST2A 1GA1A 5AVKA 1KE1A 1SCAA 2W2MA 3A3PA 1SUPA 3DE3X 1AVTA 1C3LA 1R64A 1YJCA 5B1EA 2SECE 2P4EA 2DQKA 1HT3A 2PQ2A 1SVNA 5CW1A 2XRMA 3P5BA 1Y3CE 3VV3A 5JXJA 1XF1A 4GI3A 4H6WA 1SUAA 1BE6A 1CNMA 1PTKA 4ZARA 1TMGE 2Z2ZA 1GTJ1 1GT91 1GA4A 3A3OA 4AKSA 3QMPA 3T41A 4JP8A 1SPBS 2X8JA 2V8BA 2W2NA 3DVQX 1SUBA 2X8JB 1ZVKA 4NE9A 4NE7A 2Z56A 1T1GA 1YJBA 2WWTA 3DE5X 3OSZA 1IC6A 2PWBA 1NLUA 2PMWB 2W2OA 3BX1A 1AV7A 3Q5GA 1EA7A 1THMA 1SH7A 3VV2A 2GKOA 1SBCA 2QTWB 4M1ZA 5AQEA 4CFZA 4HX2A 1VSBA 3QFHA 1TK2A 1Y9ZA 1WMFA 4OMDA 5ARBA 1PJ8A 1TO1E 2ZRQA 1AQNA 3H42B 2WUVA 4K8RB 4NMXB 4ZOQI 2E1PA 4LVOA 3L1KA 3WIVA 2ZWPA 1GNVA 1SIOA 3DE1X 3QTLA 1KDVA 4B5LA 1DBIA 1S02A 1SCBA 1EGQA 3CO0S 3AJ9A 2Z2XA 3BGOS 3EE6A 5AMXA 1AU9A 5FFNA 4DJ5X 1BFKA 5JXGA 1TM1E 3AJ8A 1DUIA 3DVSX 4MZDA 1OYOA 2Z30A 3ZXYA 1A2QA 4Z2AA 2ID8A 1SUDA 1SUCA 1SCJA 2W2QA 2SNIE 1AK9A 1SBIA 1Y3BE 3I30X 4FONA 1Y34E 1KE2A 1IAVA 2Z57A 1AH2A 1Y33E 1GCIA 3I34X 4J94A 3WHIA 1P8JA 1R6VA 3DWEX 1Y1KE 3I2YX 3SICE 1P7VA 3LPAA 2B6NA 3Q40A 1SELA 5AVJA 2TECE 1SCDA 2IXTA 4C3VA 1BE8A 1BJRE 4KG7A 4OV6B 1SUEA 3DYBA 4AKTA 1GTL1 4H6XA 1V6CA 3VHQA 2SICE 1TECE 1Y4DE 3CNQS 3DW1X 5JMOA 2IY9A 3F49S 2ST1A 1T1EA 1Q5PA 1WVMA 1BH6A 3LPCA 1OT5A 2HPZA 1T1IA 1OYVA 1PEKE 2WUWE 1WSDA 4I0WB 3ZXXA 5ARDA 2G4VA 4DZTA 4CG0A 3I37X 1V5IA 1R0RE 4KPGA 1C9JA 1NDUA 1S2NA 3LXUX 1SN7A 2DP4E 2Z58A 4RYDA 1S01A 4H6VA 1SIUA 2W2PA 1SBHA 1Y48E 3DE6X 4HVLA 1UBNA 1C9NA 3DW3X 3BPSA 3LPDA 2PWAA 3GT4A 1MEEA 3VSBA 1GA6A 5FBZA 5SICE 5B1DA 1ST3A 3D43A 3HJRA 3F7OA 1KDZA 1WMDA 3AFGA 4WOCA 4CFYA 1BFUA 1AF4A 3DE0X 4WOBA 1KDYA 3F7MA 3VYVA 4LVNA 4DWWA 2HD4A 1NDQA 3DVRX 2SBTA 2PRKA 1GNSA 4YN3A
chains in the Genus database with same CATH superfamily
1W1WA 4NNJA 2YL2A 4L57A 3VZSA 2XVXA 4EKGA 4YUAA 5D3ZA 3BUSA 4XKJA 4FUTA 4PVDA 4RZHA 2GKGA 4UXHA 4RX1A 4H4CA 4WK4B 5EZ6B 5T3UA 4RNDB 2WJAA 2PUCA 3N8HA 3F1KA 3Q7RA 3L7DA 3Q3EA 1OFGA 3DMNA 2XUKA 5C0OE 3ASYA 1U8XX 2YFQA 2H5IA 2B20A 2J7KA 2B5WA 1FIUA 3GFQA 3MUOA 4UTOA 1EFPB 1F2TA 1MMFB 3TK1A 3K9HA 4ID9A 4C6HA 2XRZA 4CMKA 4KHPB 4R2HA 1PG5A 1SVUA 2GZ2A 5FBWB 1KK2A 4BEWA 2WSIA 3RHTA 3TLZA 4EKNB 4KV7A 1T9GR 4F3KA 1DCKA 5F9HA 3HU2A 1D7AA 3M49A 5CK5A 5K4HA 3E5RA 3UKJA 3RIHA 2V7GA 3FFWA 1XEWX 3BORA 5DGIA 1PZMA 1YZHA 3UV3A 3HKEB 2GA9A 1CJCA 3O1LA 3IVAA 1H8ED 3Q2KA 2ZB8A 1QYXA 4M6WB 5BVGB 4N76A 3NDBB 5JQGB 1GPWB 1N4AA 4TT3A 4IH4A 4UOEA 1S8FA 2GH1A 5IUNC 5CXXA 5ALFA 9MHTA 3CF6R 3BA1A 3HA2A 1NMSA 1XXHA 4L0QA 1XCJA 4I2NA 2JIZA 2HA7A 4GP9A 1YH3A 2X1MA 4LWZA 4X9XA 2O0KA 3BXXA 4FR0A 4JT2A 1BJTA 1LGYA 3KTFA 2O7QA 3AQIA 3G2PA 4KDCA 3ZZUA 1GAQA 3V1TC 1WPXA 1XTJA 4FLMA 3L5OA 4E5VA 5KVCA 1C9YA 4FT2A 4IHJB 2CW5A 4MS3B 2V3WA 3G2OA 1SOMA 1LCIA 2Y0BA 5AVXA 4ZEVA 3HBMA 4Q02A 2TS1A 2HO4A 1QK4A 1BCSB 1FLAA 3OFKA 3U3OA 2GEFA 1RT9A 4NY1A 2AOTA 1Y81A 1ISGA 1QZUA 2VCYA 3BIWA 2YVLA 5ALOA 4CGZA 3ON5A 4HWOA 4FBMA 1MQ9A 4A8TA 1YBMA 3WYGA 4TXNA 2YXLA 1II8B 4RZIA 4F2WA 5JLAA 3FOFC 1N32B 3ONDA 2BGTA 4DA7A 4KITB 2CC2A 1M2VB 4Y0VA 3E8MA 5CB0A 3NAMA 1VMAA 1PG0A 2EV9A 1IUPA 2ISSD 1L7NA 1FOEB 4TZTA 3DM5A 1QGAA 1Z4MA 1G4AE 4ZCPA 1SVLA 4DIEA 2XYPA 4BWVA 2HRZA 3RVSA 4GOLD 5L4SA 3VU1A 2CF5A 3HS3A 1JIQA 2WDPA 4H3KB 2G4VA 2PVCA 3DZHA 4G4JA 5C1IA 1BVRA 1I7NA 4P6VF 5KYKA 4Z0TA 3DE6X 1MOPA 2XB6A 4IZIA 2H6EA 4J8PA 4LDPA 3N5KA 3MTGA 5DM0A 3SLKA 1P1JA 2MT9A 3CRRA 4G8DA 4LHXA 1JLSA 5KTPA 1UJ2A 4EHLA 4HP8A 2I3DA 2ZYHA 2YYSA 3BTSA 1FF9A 2HI0A 2PAAA 2JLCA 3HBFA 1BXZA 1D07A 1MX1A 4FOLA 3BH7A 4K1XA 4WT7A 1EDZA 3AEUB 1GXSB 2CMHA 3K9BA 3TLBA 1GDTA 2QD2A 2WFMA 1Y7PA 1QLJA 5E7MA 5LB4A 5TS3A 5C7OO 1NW7A 2XYQA 1KRWA 3ELDA 2VXYA 4UAUA 3BK2A 3LP5A 2Q1UA 4MA4A 5KKAA 4EYGA 3G6WA 3AUAA 5KU1A 1E92A 2I2WA 2ZQYA 1M7GA 4QZVA 3LF1A 4C3OB 4D3XA 1C3OA 2DMRA 1DAOA 2I99A 4KQ6A 4D9HA 2XCSB 4PZUA 3MS7A 5HRUA 3T4PA 2J87A 3VU0A 1RAGA 3H5LA 3P0RA 1MOZA 1Q1ZA 2J09A 4CF4A 4N0QA 4AU1A 1YQEA 5A6VA 2OHVA 3SD7A 4KLNA 4EG1A 3AIOA 3K5WA 3ZWXA 4C43A 1JFTA 3GDGA 2WM2A 3UAOA 5T64A 3TZKA 3ZLUA 1GZUA 3EYAA 5B7QA 1J5EB 3RS0A 3O21A 3FCUB 3N74A 4TKZA 1UKAA 1Z2EA 5EOVA 1KVTA 4Z1MA 4U8GA 4MYRA 2WG2A 3SSOA 4BZPA 1HT3A 3AXTA 5LOVF 1VG1A 3HP1A 2CSXA 1V4VA 1WJGA 3AHGA 1XP5A 4YT2A 1I9CA 1ZNXA 4PSCA 1GT91 3KPVA 1EGVB 2Y1FA 2VUUA 1G9SA 3FAZA 4D8XA 3AB8A 4FYMA 2EFEB 4QBIA 1AUPA 2PX5A 4WA8A 1KIFA 1EGMB 2P2LA 1XTZA 1E3DA 2IHVA 2RC5A 5I5GA 3OF2A 3Q3IA 5ALVA 5E4FA 1AD2A 2E4YA 1TAGA 4RVUA 1CIPA 3OH8A 2Q0QA 1DUVG 1ML4A 3VR1A 3QXHA 3JWHA 4GHWA 3MWJA 3EZGA 4V39A 5KHLB 1M10A 1EDOA 1P1RA 1WZIA 1CEYA 3DPSA 2WHRA 5TJHA 1Z22A 1FNDA 5KJFA 2VTBB 1URPA 2D1SA 2D59A 5HA5A 4C22A 1BEZA 2QIOA 3H17A 4IQGA 4IW3B 1FP7A 2RG7A 4IIJA 4C4SA 7REQA 3D7RA 4PRYA 4OXYA 4RXUA 1Q92A 4HVAA 3OHSX 4N3BA 1MIOB 4ZCLA 1ZK1A 1RAAA 4D4JA 3KUKA 4F85A 1FNBA 4ZDWA 2A33A 3HI6A 1ZINA 1VMDA 2FZKA 3CW2A 4HSEA 4J0QA 3W3AD 4RVCA 3Q7QA 1S7CA 3LU1A 1OTYA 3SF8A 5BW4A 4WX2B 5LJLA 2UVPA 2J6BA 1RBQA 2WJ6A 5KZMB 5B3AA 3I28A 2IIPA 2LGJA 4YIHA 3A4LA 2H06A 2D06A 4ZVUA 1WUIS 2FRXA 2JFQA 2FXIA 3ELYA 4G4SO 4QWMA 3UUGA 3AYZB 3UJ6A 1VJ0A 2FQYA 3DW1X 1KGDA 4R31A 2XYRA 3ABZA 1N6OA 4X7MA 2ZRBA 4S24A 1R74A 2CXUA 3VC1A 1Q6ZA 1K6IA 3HEMA 2B94A 2ZYIA 4S35A 1F8YA 4LQ4A 4YP1A 4B6OA 1WBBA 3KB2A 5HFNA 3FZGA 1VL8A 2REOA 2QNRA 3GLGA 1TUEA 2B83A 2WOJA 5EZ5A 1YULA 3DTVA 5FULA 4I99A 3HKDB 3ZWQA 3NU1A 3X1XA 1EUYA 4GOND 4A9AA 4BMZA 5JARA 5E2AA 2QRUA 4H4EA 1GPYA 5JQGF 1CULC 4V0QA 4KIWA 3JWJA 2V5VA 1Y9JA 2QRQA 1OLSB 4Q4HA 4TQUS 1MRZA 3WGGA 1DP4A 4MO9A 3CVJA 2QYHA 1RTTA 3CX3A 2BUCA 1TVCA 3BG5A 4KX3A 4LRQA 3M1AA 1BFUA 5ALZA 4UM5A 2NU8B 2Y76A 4P92A 1GTZA 1FS6A 2Q1YA 3IVXA 4AUEA 4IVRA 3EG9B 3GLHE 3Q8XB 3LFHA 2OPHA 1FXSA 3PNQA 3NC0C 4QLAA 4D81A 3SBDA 5KNDA 1BMFA 1JAZA 3HPRA 4A8JB 3RJTA 3KT8A 4P3KA 1G21A 1ENPA 4OX9B 2QA5A 2W43A 5K2OA 1H2ZA 4IOLA 2GBIA 1GUBA 2O5VA 5A3JA 4BNJA 1ONOA 4GNRA 3WLHA 3ZU2A 3OFNA 4NYMR 4HNGA 2Q2QA 3HKEA 4HEQA 4PZCA 2PBZA 3BGWA 3RE1A 3FB4A 4ETMA 3NDRA 4G5RA 3MERA 1PKEA 1MC8A 1DV2A 1RC0A 2O0JA 2X19A 2XBLA 2FRDC 1SG0A 1AVTA 1EAYA 5MN5A 5BSHA 2ZRNA 2CNNA 2Q2OA 4J4TA 3G3EA 4O8ZA 4RIHA 3SQWA 5T5QA 1EMDA 2HQ1A 5DEIA 1UMBB 3EF0A 1T9DA 3I2FA 3CVXA 2OV2A 2CF6A 4RLSA 1ZCBA 1KPHA 1O5OA 3H3JA 2OO7A 3KHSA 1F0PA 1PK7A 1Y37A 1JDSA 2O2GA 3C5VA 3W9YA 4C5AA 1LBTA 3WP1B 2GCGA 3TTVA 1V26A 3E9ZA 3F5DA 1PSDA 1W8IA 1W1IA 1YJBA 5FPSA 4ZT3A 1EEXB 2KW5A 4ZGWA 5DM2A 4ZC1A 1LVUA 4FW9A 5AW0A 2C9ZA 4M1ZA 5IC6A 2V7TA 1AUXA 2WI8A 1YAHA 3FRJA 1EHIA 2B4TO 2C95A 5DYGA 4R1PA 2QP9X 3PHGA 1A98A 1G59A 1XNGA 1ZH0A 2E1PA 1LPSA 1YOVA 4I08A 5KTKA 3FKJA 4KMSA 2H07A 4C3VA 2RGBA 3ETLA 3JQBC 5BUZA 3AL3A 3AHCA 3AJ9A 4E15A 1VC2A 1G41A 4J1QA 4FJ1A 2NZ8A 2A9KA 2PGNA 3M3HA 3FNGA 1AQYA 5E1DA 1NMYA 2OBLA 4ZV7A 4HWSA 4E07A 1UF9A 2VSXA 2CHQA 4JX8A 4MLPA 1S89A 2PRJA 2W6OA 3LW7A 4IILA 3C6ZA 3LZDA 2ZIFA 2CLSA 1XZDA 4WBSA 1F8GA 2E21A 4WCFC 2JZCA 1T5TA 2AYYA 3GJYA 5D1NA 3NBKA 3R9WA 1VJGA 1SC1A 1YIOA 2BH9A 2XE8A 5B6PA 2XQFA 2A6PA 3ZS8A 1PP4A 1GQ2A 4HS4A 4R8LA 3NWOA 2ZWVA 1EP1B 4OUKX 4ARUA 1K7CA 4DMFA 2FK8A 2LIPA 5BN5B 1P0IA 1EFRA 3KZVA 3MD9A 3JYNA 3RS9A 3VJRA 3QHPA 1XDDA 2O7RA 3ML1A 4FIZA 3CPSA 1N33B 4X1KB 2IH5A 3LYUA 2A5GA 2XZLA 2PMBA 4NYIQ 1O3YA 5AJHA 2WKQA 3J7AC 4I6JA 2YASA 1P77A 1UPUA 1H2WA 3UC9A 1O6CA 1G0NA 3U4GA 5A5FA 3RRMA 2YICA 3VR3A 3FPHA 3SAJA 3N2IA 1CS0A 4R8VA 2P2NA 2WJJA 4QXAA 3ED5A 2CVPA 1RI2A 1XRNA 2D1RA 4F4HA 5I7UA 5JY1A 3BPSA 1MXFA 3OZWA 2LD4A 1B0UA 1CR2A 3UATA 2QI9F 2RHJA 2BBWA 4PLYA 5E8JA 5JZOA 1MNAA 2A9RA 1L5FA 3PU6A 4FHZA 2FLKA 4AURA 1J99A 5ICGA 3GP3A 1XZ8A 4GRAA 2O1WA 2IX3A 3RC8A 4F97A 1N5LA 1C1XB 2HHLA 1CUEA 4JP3A 5J2TA 3OC0A 4MSUA 1V71A 3L7BA 3LPLA 3GLIB 3F6RA 1FCJA 3VFDA 4V0RA 4HAOA 4C3UA 3QUBA 1I4DD 1PRYA 2OFPA 4HDNB 1C30B 3MTEA 1NOIA 2IYYA 5IARA 1M7HA 2V45A 4UHDA 3FNIA 2PYZA 4LF9B 4IR7A 4UBMA 1QHHB 4PO3X 4KPUB 3ZYZA 2XQKA 2V7QD 4B4VA 4BB5A 3UMYA 4TKVB 5JXIA 2REQB 3M6UA 3ZV7A 4YX9A 3HB9A 3FPSA 1HF3A 3A4VA 1RM3A 3AEKA 3CZMA 4GP6A 4GXTA 4YJFA 5DJ5A 5ALDA 3R8XA 4CEHA 1DFIA 1FUYB 2G04A 5CD9A 2NP7A 3O82A 1M0EA 3A6HA 3DUFA 2ZJ2A 1FMCA 2Q5EA 5CFRA 1EXMA 1YCFA 1ZGJA 4KQ2A 4PX9A 3RQIA 3ZW9A 2ID7A 1IU9A 1BD3A 3JQAB 1L2TA 3E9MA 2C83A 5AJXA 1HR0B 4GXNA 3RU7A 3QXJA 4WKBA 3A9WA 2Y05A 3CYFA 3WL4A 3MMXA 4A0GA 2ISQA 1VG0B 1NKVA 2BRUA 1Z5UA 3RNLA 1JLLA 4ND3A 4UVEA 4FD2A 1E6KA 2FPLA 1YVEI 1VXRA 4K6FA 2AEMA 4QU0A 3PTZA 5CIQA 2ZP1A 2Y4NA 3CSSA 2OZKA 3FPFA 2C78A 4NS1A 3TSWA 1KC1A 2DLNA 3NHYA 3ETDA 4BBAA 4MGIR 1RC8A 3IEMA 1MHPA 2GEKA 3C5EA 2FR1A 4KZKA 2F4NA 1C8VB 5AW2A 3W6ZA 1NYTA 2VL7A 3LQRA 4HBZA 5F7JA 5KUTA 4PGGA 1QO0D 3TTSA 2MOKA 1CY7A 4POAA 3G88A 2XH8A 1R50A 3JSAA 3MZ0A 3A8TA 4FMCF 1X9IA 3B12A 3WNVA 4H1TA 2KWIA 1Z15A 2GA8A 2QW0X 4MZXA 1PK9A 3EQ2A 1ZLXA 2O2IA 3RYFB 3T9CA 3PPIA 3ZE9A 4PF1A 3LL4A 2AMVA 2Z5LA 2Z4SA 4QUKA 2BISA 5BYAA 1U8UA 1OLXA 3DLCA 5H0IA 1RPNA 3KR0A 1FXWF 3FUXA 4EF4A 5DNVA 1VB5A 1KQPA 3PCTA 1F6DA 4NWIA 3SVLA 3W2IA 2OXEA 3CEJA 2GBPA 1UFQA 4GMGA 3U9TA 3K6SA 1PZGA 2A4KA 9ABPA 2WZBA 2I2FA 1FP4A 2QD3A 4IWXA 3PFHA 3C3MA 2Q1XA 1M6HA 2BV3A 1L8QA 2RGRA 3FFXA 5ECWA 4E3WA 1JEEA 4RL6A 4J49A 5CM2Z 2E9SA 5EIWA 3SS8A 1RM4A 4DTCA 2I4RA 4HMQA 2NO0A 4Q15A 1J07A 4E51A 5BURA 5F35A 2RDMA 4LHEA 2VOEA 4UHBA 4ZZ2A 3W4JA 4B9AA 1P4HA 2IODA 2IYAA 2EX1A 3MCWA 1IEVA 2QVZX 1YE3A 3OE7D 4ZP1A 3RU9A 3ZV6A 4Y6RA 2O8DA 1FLNA 3N2LA 4JEMA 3IE1A 4PZ0A 3BICA 4YAJA 3G5MA 4O4IF 4UDNA 1JU4A 4ZT6A 4CMIA 3IP9A 4MVXA 1L9KA 2P5UA 4JELA 3D3NA 4O2BB 5C34B 2UYYA 2BKVA 2BFEA 4UUOA 4MEBA 3C3JA 2DSTA 1JR3E 1OFTA 1XZKA 3D9QX 2QZPA 4GR9A 4DYDA 4YPFA 3KT0A 4FYJA 1T91A 4EQ6B 1A9RA 3K5HA 4PYLA 1QVVA 1E1MA 1PWHA 1TTPB 1K7SN 1OILA 1X9GA 3G23A 3K15A 2VRBA 2Q9UA 3HC7A 1LLUA 3TBFA 1SVSA 3JQBA 5K8LA 5LYJF 2CXRA 3LUCA 3K2EA 3NCTA 3GRAA 4M21A 5AW4A 2YOHA 3D7KA 1RXYA 1Y5RA 2R1TA 2E7ZA 2W6JA 3HVKA 1SKAA 4Z4CA 5KSWB 1JLKA 3GUCA 1L6RA 2ZWIA 1WXEA 4V1CA 4NCJA 5ILQA 1ODKA 1YQWA 3D4LA 3FLAA 3HYNA 3OT5A 4LW8A 5EJGA 2ZUSA 1TYZA 2JEYA 5LQCA 2RH9B 3AR7A 1L4GA 4LTMA 5EE5B 3UJ8A 3FMIA 4LXQA 3DAOA 1KEZA 3ZBQA 4HAYA 5IKEA 3KYBA 3LQ1A 3N58A 4H35A 3WNZA 1QWSA 2ZSFA 3PHHA 5ELXA 4LDNA 1V45E 5CLGA 3PC8C 1K5PA 1QAOA 3L7KA 4UTXA 1DDOA 2OD7A 1E32A 2B61A 2YVUA 3EH1A 1ML3A 3F9IA 3JY6A 4NE9A 1DJPA 1J9ZA 1IHDA 4XDYA 4TROA 5EXEA 5HIIA 3F6SA 3D8NA 1C0EA 1NLYA 1UDAA 3D8HA 4FFRA 3HVJA 3HZHA 3RJ9A 3ESDA 2IOFK 2O3TA 1NT2A 1Q11A 4RK1A 3GIDA 2C03A 3JQAA 1HYEA 4Q18A 3EGXA 3QXCA 1TLLA 2VDNB 1VI2A 3I9LA 4Z9XA 3GUVA 3VJMA 3ZWBA 1BWQA 4E70A 2JVKA 4FI3C 4H15A 3GJQA 1VA5A 1ZO8A 2F7SA 2JAHA 4S1TA 3T1VA 2A0KA 3EE6A 4M38A 2IEIA 4JC8A 4S1VA 4RZQA 5EHQA 2VH5R 3WLIA 3DT9A 5KDDA 4LRWA 4BNTA 2E18A 2HF9A 1A2QA 2P9HA 5IXJA 4KFUA 1DPFA 4KRXA 4OP1A 1XFAA 3WLKX 2AGVA 3P9CA 5EL0A 1DOZA 2AVNA 1U9JA 2M1XA 3VGPA 5DHAA 1QRRA 4TZ6A 3D2AA 4CTKA 1NBIA 4H7FA 4NDNE 4HDOB 1VJTA 2WWXA 1R1DA 5LMCA 3MQ2A 4F84A 1IJEA 4N8SA 4EGFA 1ZR4A 4IGKA 3BGIA 1EVJA 3ODPA 2QD1A 1QJ4A 5IHXA 3HU1A 1LS1A 2EKZA 2N9UA 3GEGA 4NAHA 1A27A 3ADPA 1RKUA 4TMXA 3S27A 2WWWA 4DXHA 1P45A 3FYSA 2ZR8A 4ZXFA 5KTOA 3FOEC 5GV7A 3ZLJA 1X1AA 4LWPA 1QX4A 4TSFD 1T36B 1MEEA 4FMPA 1PJ3A 3GYBA 3EPHA 1NKSA 2QTZA 3DMRA 1E2GA 1V4NA 2HO5A 3LT2A 4GOXA 3VMFA 2C5AA 2XR1A 3JU3A 3L6UA 5LQJA 3GPLA 1LQTA 3KRTA 4P9NA 3EPKA 5K03A 4M8SA 4NYIR 4U7GA 4JFRA 1KHTA 4NJEA 3S1LA 5F77A 3EUEA 3EG5A 4IO1A 3WL5A 2FVXA 3I53A 3O83A 3KB6A 4J2HA 5DNAA 3TEFA 4ZIRA 5HHTA 1NBHA 5CBPB 2IGTA 2YY7A 2D4HA 1KYTA 1UQUA 3OHMA 1U6KA 2QXUA 1U4SA 2WV7A 3L92A 3NQ41 4XM0A 5EP4A 1LW6E 4L5YA 4G0UA 2FW1A 1JNXX 1NYQA 3EZ9A 5A5VA 1AE1A 2H18A 4KTVE 3R76A 1UMCB 3ZLBA 3U3JA 1KRHA 1YQ9A 4K2HA 5D7BA 1V4BA 4ONEA 1L3BA 2G9UA 4TV8A 3D6NB 2V58A 5DE3A 4YP6A 5BPHA 2IPNA 4KDRA 4GQBA 1IHOA 4LHVA 5SY9A 2HJRA 5CUQA 2ZRJA 1Z62A 1UOOA 2BHTA 3EWNA 1KJIA 3KFLA 4YPVA 1VRCA 3NX4A 3ZQUA 1SJ9A 1HE8B 1KSGA 5LPNA 2B0CA 2BEVA 4AIIA 4YCJA 4C0LA 1JU3A 2F00A 3VTFA 4QT4A 5BXQC 2V7PA 5JROA 1AIPA 3DL2A 2R8YA 1Z8DA 1LEHA 1X7XB 3QOYA 1E0KA 3OC6A 1DDIA 3RU3A 2BGWA 3OQBA 4EMBA 1KQGA 3RREA 3RRBA 3PDIA 3Q98A 4I3FA 1DUSA 4M7WA 1CZHA 1SUBA 1OX4B 1ZVKA 2H3EA 1MORA 3H1EA 1VIYA 3HLKA 1Y5NA 5I8WA 2PZEA 1FFGA 2QRJA 2XUHA 3EGOA 3BX1A 1ESEA 1H2AS 1AUQA 2WJ4A 4PTZA 5LU9A 1SBCA 5SYNA 1N2CB 5TMBA 3U7GA 4IIVA 2B1QA 3ZN2A 3L6BA 2GJKA 4KQIA 3RM3A 1TIBA 2Q41A 3AUTA 4ZYLA 4OHCA 4WTOA 3OKPA 4R0NA 3PI7A 3UT5A 3HADA 2ROQA 4U7DA 3MTIA 2YJ6A 2B8TA 4R0VA 2E6UX 5DVZA 3RASA 3ENVA 2M1ZA 1T5DX 3CRMA 3HZRA 1K8YB 1DOAA 4NICA 5ECGC 1NQWA 5HCIA 4FX2A 2O3UA 2VPIA 2FI1A 3ZBTA 1ILWA 5FWXB 1CDZA 3GA5A 4TXJA 2ZJBA 3IEIA 3RC1A 4A73A 1D04A 4PYJA 1EIWA 1HOTA 2HJVA 3QBEA 1FRQA 1QZXA 4MGEA 3QUSA 1I1QB 3TLGA 3W5IA 2HCRA 5IEJA 5AKYA 2H4WA 2PKRA 3ITEA 3Q40A 4GZ3A 4LA4A 3X2EA 2OHOA 3GN1A 4NOKA 1PJ2A 4PLPA 3HV0A 3DLHA 1E3JA 4RQUA 3DGFC 2FFRA 5DHRA 4RH3A 2BTEA 4LJLA 3VKFA 1AQ6A 2ZYUX 2V7XA 3UJAA 1E2FA 1UPAA 4AG6A 2EF1A 4HDNA 1N2BA 4AROA 5GGXA 1E1RA 1WDKA 4ABYA 1WBDA 2BFNA 1U9IA 2VDOB 3U3DA 3QPCA 5JSZB 2RGYA 4LF8B 2ZE6A 4GI7A 5EEGA 1NMZA 2FEWB 4WZ6A 4YUWA 1KJQA 3JQ7B 1EP3B 4ERXA 4K9RA 1P80A 3THWB 4C1BA 3RVQA 2B4YA 2GZHA 2JGDB 1P3DA 4QGBA 3NI2A 3GOQA 1MXHA 4FYWA 3F7OA 4IMPA 2OBMA 1E3WB 1JW9B 1YVUA 2XDYA 3B9RA 3KWJA 1V8DA 2WT4A 4E08A 1TGVA 4J2OA 1F06A 2X40A 4LYJA 3H2YA 4WECA 5K9ZA 2EZ9A 2ZRHA 3FWNA 1Z0JA 2BMVA 3QNMA 2ATVA 1Z3IX 3QM1A 1MAWA 2XOEA 3LQFA 1BYUA 1XK6A 1YKGA 4RS4A 1TZCA 3OPNA 3AIKA 1AJEA 1E64A 3RFXA 1Q95A 1QIJA 1QGUB 1DEAA 2GGSA 5FAKA 4J4BA 4AI6A 2NQ2C 5EWJB 3VDRA 3RLFA 1UDXA 3TFQA 4CGYA 1RQ2A 1TM3E 2Y1XA 4I9UA 4BLOA 3HP4A 3ZHVA 1MZPA 3LA6A 4B6EA 1CF2O 3OESA 1GSAA 1C0KA 2P9CA 5JYEA 4IVPA 1F8UA 2E1RA 3FDFA 1JSXA 4HNAA 3EPRA 3MCTA 2FG7C 4IL5A 3UZUA 4LJKA 3L0IB 1BDBA 2HQRA 4KXVA 1SK8A 2AFHA 4Y1EA 2DQKA 5CNKA 3T15A 3PEWA 1RRCA 1R6TA 1KTVA 1ZR2A 1H69A 3Q9LA 3K32A 2WU0A 4OGWA 2ENUA 2V1XA 4NNOA 3VXKA 4X3CA 4B40A 6CHYA 2HV8A 3AYXB 4NBNA 3R7WA 1EZ1A 1MGOA 3KOOA 2IS2A 4NCHA 1XEWY 4PO1A 3RSGA 4UVHA 4WIAA 2XNSA 4KWCA 1NW6A 4N65A 4AUMA 1DSSG 4GVXA 3BN3A 3NH9A 1MW9X 2RHMA 2OAEA 4BU1A 1NM5C 2WIFA 3A1WA 4JJ6A 3VBEA 3VI3B 2HL6A 2BOVA 1T3SA 3EGWA 3HE3A 5BSRA 1Q6YA 3WWEA 1Z4PX 5EIHA 3R4VA 1Z45A 5HKLA 1Q84A 4Z3OA 2IW1A 2R68A 4QKQA 3L7JA 1R6DA 3DAYA 2FPPA 1C7QA 2C57A 4GE0A 5ITSA 4KO2S 1IOWA 1JALA 1ODFA 4N49A 4Q3DA 4D25A 4HB4A 4Y0AA 2QTVB 3OCWA 3DDHA 5BQOA 1UBJS 1EBBA 1E6LA 1ISFA 5BR7A 5AXDA 3KO8A 5EESA 4PG4A 1P19A 2VJCA 4TLMB 3KAPA 4M89A 4Y98A 1HEIA 1ZK4A 4N9QA 4YRFA 2HU8A 5LM3A 3A2LA 4BCCA 2NSHA 4X94A 1CU1A 4OM8A 3KVVA 4ENRA 3DV2A 4BQPA 1OXUA 5MDHA 1WAMA 2R7AA 3TGPA 1PR5A 1RWOA 5K3AA 1ZESA 3U6BA 3C3EA 1BKYA 2F90A 4WEQA 1MPXA 3PD0A 1ZIOA 1XZQA 1N2OA 5F7ZA 3O8LA 3IBTA 1OIWA 4HB2A 2D2VA 2OCDA 1PHPA 2G9ZA 2YWRA 2FPMA 3B5IA 3KVNA 2VDLB 3Q3JB 2VHXA 3VKUA 2XCUA 5TF4A 4B2PA 1EG2A 4FEGA 3O7MA 5JZSA 3WY9A 1PZNA 2QMEA 2R66A 4XCVA 4DC0A 4YT8A 2Q49A 1FW6A 5A0VA 4XWOA 4OH1A 4AG3A 5IULC 3QFTA 2ZS9A 4L1KA 3JASB 1SUSA 1D1QA 3TCNA 3QNUA 3M1YA 2C8VA 4IG4A 3C8ZA 4G4GA 3T1QA 1RQGA 5JMPA 3AKYA 4PU0A 5JPDA 4KR2A 1EU1A 4GBMA 4GMKA 5KDLA 1MG5A 3IPCA 5JDCA 1ONPA 4N7BA 4OXQA 3L02A 4CM5A 5TE9A 1EFKA 2FJPA 3D4BA 1BFDA 4CUJA 3H11B 4D45A 4JBIA 4U5XA 2OHXA 1ESZA 3BWVA 3K09A 2O05A 4KXNA 1OVGA 3E7XA 3H5VA 3NCHA 5IVKA 4OSEA 5CLQA 2AG8A 3DKIA 4GQIA 2Z6VA 1TRKA 3QITA 2E85A 3PXUA 5TV2A 5HX7A 2G3YA 5C1DA 5JSUA 5CNJA 5AFSA 1MQ8B 3CV3A 3QVOA 4KXWA 2ZWAA 5DK4A 2GCEA 2JGRA 2RHGB 4UJ3A 4LYFA 3DZJA 3QKRB 4MQFA 4M0KA 3CVYA 4I5GA 2AE2A 1SOVA 2IPAB 2ZM6B 2J6CA 2PH3A 3T3IA 1RWXA 2H8GA 3V8MA 3R6LA 5JS8A 4FM9A 2KI5A 2VP0A 1ODSA 4Z4FA 3OD1A 3L4SO 2I6SA 3FNRA 3N2GA 3EZLA 4GFDA 2FF5A 4L5IA 1EKXA 1Q77A 1ZOOA 4UUMA 4DFDA 2YHIB 5L3SB 3GLGE 2QJOA 2NP6A 3C3KA 4UE2A 2F43A 5K4AA 4B2IA 4GSKA 2BFBB 4FMBB 1PBNA 4WMLA 2JNWA 2GZAA 3CRQA 3D3QA 4TWZA 1ZL2A 3BWBA 4BWFB 4TPKA 4EDHA 5ICSA 1X15A 2B8JA 1JE0A 1KO4A 3JWPA 3PA8A 4ETWA 1IWBB 1KAHA 1G8PA 5AQEA 4KNWA 2UYHA 4ARIA 4B4UA 2AFHB 4ALIA 3OUZA 1ISJA 3ABSB 1HZZC 1GXSA 2CDRA 3PP8A 5BORA 1F2DA 3CB2A 1DG9A 3U40A 4X63A 3AOEA 5CYPA 5IT0A 3WQRA 1W85B 1AGPA 3D6AA 4MVJG 4LOKA 4CMEC 4L7QA 2BFCA 2XGMA 3MK31 1RXUA 3E8SA 1QIEA 3C98A 4MKGA 4I6GA 3HCAA 4QBTA 5GTDA 2WYUA 1XDWA 4OFWA 3HBJA 1G5QA 1SVIA 4Y9UA 3VSCA 4BFTA 3OG9A 2CVOA 4B4WA 5LMNB 1IWPB 1IAVA 3N87A 1DARA 3CW9A 4TXHA 4GWGA 4W8GA 2Q5LA 3OTIA 3ZJ4A 4WWHA 4NAUA 3T3DA 5JXWA 3WIOA 4QXRA 4V0SA 4UFOA 2J9XB 3QBVA 3IERA 1SRQA 1X7YA 1AM4D 1Q0UA 1AGYA 2GLTA 3IMEA 2CL6X 4O25A 1DQNA 5CJPA 2C7GA 4A1FA 3HUFA 2QNBA 3Q5EA 5FTLA 2DERA 1SCKA 2PT5A 3I5UA 1J2RA 3BK1A 3H0EA 3QKSB 3RVLA 1ISRA 4OK3A 2AD1A 2FY8A 1KR2A 1USKA 2AV6A 2N3ZA 5T6MA 2I4LA 5M7EA 2Q4RA 3FFBA 3GD7A 2AXEA 4K87A 2GM3A 4BNDA 2JG3A 1R0WA 4POOA 1M6VA 1N9ZA 1E6EA 3S8EA 2OBYA 4D3SA 3RSLA 3MT7A 1XLVA 5AVZA 1J1UA 2BGLA 2Z95A 4C6TB 1XQ6A 2PT9A 2IBMA 4X1OA 2VHUA 5C7IO 4GZMA 4LCJA 2HT6A 3EZ7A 5BW6B 4XWYA 1FYDA 2LKDA 4BO4A 1K3TA 4IO0A 3ZZ1A 1GNRA 3FHJA 4LSMA 3CR8A 4RJ2A 1OHHD 2ZXFA 2NAPA 2R87A 4HRXA 4BWYA 2J3HA 2R8PA 1RPJA 2WUGA 5EJAA 4HQFA 1IB6A 4II7A 5LOVA 2IS1A 1A9OA 1TO2E 1TOAA 4OAQA 1Z8FA 4XYLA 1UP4A 1ZA1A 3P9XA 4N1AA 2OTCA 3EA0A 3ZYCA 4EJSC 1S4MA 5TPWA 4AC9A 2EHJA 4Y6PA 2BWJA 3CUTA 2CL5A 2CFOA 3EMVA 4ARBA 5KYTA 3MTQA 2E5LB 3DSRA 1A4IA 3U4QB 3PUYA 2YCLA 4JQYA 1E2UA 5ALWA 2P4QA 2VCEA 2IIQA 1O77A 3BS4A 4JCCA 3ZZTA 2F55A 1QFYA 1ZUD1 2F8SA 3PPVA 3FHTA 3HFJA 4DM4A 5IABA 1ECLA 4BNLA 4HLUC 5JJLA 4WLUA 4E14A 2PKQO 3H5RA 1PGPA 1QORA 1I2CA 2EEPA 1E94E 3SR0A 2IYQA 3A4YA 1AZSC 1EUDA 3EVAA 4D5EA 1PVOA 3E3LA 2PJZA 2DQ4A 2WW8A 3OZIA 4W9MC 4MI1A 3FVTA 3MT9A 1R3DA 2P68A 3LBAA 5JG7A 2VDRB 5ALQA 3OE1A 1P1KA 1OXMA 3F67A 2H7YA 1CQIA 1R4MA 2FWIA 4IJWA 3P4XA 4NJEB 4R1SA 4X8LA 5TXGA 1Z06A 3VH2A 4L8FA 4D3ZA 4NK4A 3S2YA 5KNDH 2UUAB 4N40A 4RUKA 5JD3A 2CFSA 4OEHA 1HDGO 4RCYA 1GL6A 1NJSA 1U8CB 3DUWA 3UGQA 2HWKA 3COVA 5I9MA 2QTFA 1A5BB 3UENA 4CCYA 1DAIA 1JPNA 1WG8A 4MWCA 5KKCA 5FR2A 1TRHA 1GPUA 2GERA 4C7OB 2NU9B 4DNOA 1VBKA 3K9NA 5CK4A 2FUG1 1IJFA 1LSOA 2I0FA 1K0FA 3C8HA 3HGMA 3KTDA 1G21B 2FUNB 1HV8A 1P2DA 3L82B 4J07A 1O4WA 3N2KB 5CPFA 4BFXA 5KYNA 1KYVA 2I9KA 1HKHA 3IQGX 1SA0B 1LDEA 4KIUA 1DS6A 3QVKA 1KMCA 1ATIA 2ECKA 5BYBA 4B3GA 1X7WB 2W9XA 2Q0XA 3X0DA 3KZMA 3RIMA 2JLZA 1DAKA 3A6JA 1ZU5A 5T8KC 3H86A 3S7ZA 3S8YA 2PPVA 5CYGA 1R5NA 5LBUA 4DV6B 5DEOA 3KJNA 1JIIA 4ESEA 3V7UA 3HVRA 1KI2A 4AKTA 1Z5WA 4C7XA 5ELMA 1WZEA 3ZUGA 4KLAA 3SDZA 1QHIA 2IELA 2LZ0A 3IDAA 5AKIA 3DHNA 3O26A 2D7DA 4O4JB 4PICA 4H59A 4Y2TA 1PEKE 4K9SA 3U4AA 5BQPA 1E6WA 1I30A 1OY1A 1G21E 3DAHA 5IU6A 1KYIA 4AD8A 1OGJA 2ZGVA 1A7KA 4TMWA 4CODB 1RYFA 2H2HA 4DCMA 4A8PA 2ZWMA 4YBZA 3VC2A 2H29A 1LZLA 1W87A 2KLHA 3HCBA 2FSVC 3MWFA 2PWAA 3EFBA 3WRXA 1LK7A 3R8FA 1DBPA 2ZS7A 1K9VF 4IIJB 5BOVA 1Q50A 4FYKA 2GAAA 4BFVA 2P8SA 2B8NA 3STTA 5G2OA 3S4YA 1SUFA 2QD4A 4OLJA 1JWBB 3NALA 4R71A 4ENWA 3RS7A 1E1CA 4F1WA 1T5HX 3ABOB 3TQTA 3ZTTA 4HT3B 3UAVA 1ZSNA 3LLUA 1C1DB 3Q7IA 1M1NA 3W4IA 3IJEB 1CZUA 5K3BA 3O1HB 3KSDO 1W49A 1A5ZA 3G9ZA 3IKMB 2FWNA 2C58A 4XEHA 4DHWA 3P9QA 1XN4A 2EX4A 1C9MA 4IZHA 1YS4A 3W1VA 3RYCA 1O8BA 1XA3A 1P33A 3OQIA 5CAEA 3KVOA 4KE7A 4JCOA 3BDIA 4GPD1 4Q9IA 1G3RA 1GFWA 1XHLA 2IZ0A 2P5TB 2OCXA 4K6MA 5BRAA 3AHJA 4JWTA 3L01A 3EOBI 3COYA 2Z8ZA 3VU3A 2ZUCA 2UV8A 3LO8A 3Q3CA 4BMXA 4TRNA 2VQSA 5BSVA 2GO1A 2YDYA 2CVZA 4HWPA 4JI5B 4C0KA 3BWEA 5J59A 3NIDB 2PVPA 2FX3A 3D6HA 4U39A 4RKWA 5DWQA 1LK0A 2H16A 1BGXT 2L82A 1ZMRA 4PGAA 4WD3A 2RH4A 4F3CA 4Q47A 2C1ZA 5HNKA 3WB9A 4QPZA 2C2WA 2OCAA 4WBNB 1BU5A 1OX4A 2WIBA 4XGKA 6Q21A 2BF4A 3RABA 3U1TA 4I55A 4B32A 1OE0A 3AWIA 2VUTA 4DNPA 3D0QA 3L8GA 1PWYE 1EFAA 4KQXA 4BQEA 2J67A 2HT1A 3AJAA 2RSLA 3AVUA 1PFVA 1TZJA 1DWOA 2PMWB 4R9NA 4DCJA 2YS7A 3GDFA 1R37A 4D4GA 3EBOA 3H99A 3UH0A 1YB2A 3GBPA 2HA0A 4DTIA 1NM5A 1NN1A 3WOVA 1IOVA 2G1UA 1UC4B 2RKBA 5EUBA 1XNRB 4JGGA 4QEDA 2LDXA 1QYIA 2XA9A 2C3YA 1ZMBA 4KJZA 1G9XA 4NENB 4R6XA 3ZE6A 3OZBA 2ONJA 1QHHA 4FFMA 1D0IA 3L7OA 4KE9A 5EKUA 4EUNA 4WUVA 2E2WA 1P9LA 1Y5MA 1I4TD 1W59A 2ZI3A 4M7PA 1KI4A 1BDIA 1NULA 2XB2A 3O2QB 4FB5A 5EIOA 2PRYA 3HXLA 4PCLA 1ZD8A 3AK4A 4C2AA 1JN0A 2PT6A 3C3YA 1BCRA 3GH1A 3D0RA 2B99A 3FA2A 4GIBA 4MKHA 1NUUA 1TVKA 4IUDS 4MYDA 3TQCA 3WMXA 2AC2A 4BLWA 1E3IA 3AVQA 3ZIDA 3S99A 4NBTA 2FE4A 3QYPA 4WLNA 3VNVA 1VJ1A 4WLFA 5JSZA 3CKKA 2O57A 5K3OA 4ID3A 3VH3A 1FUUA 2V65A 4E21A 3GMTA 2GPYA 3MWEB 2RMKA 1BDJA 4DBLE 4FHFA 5LXTB 2HWXA 2VSQA 3QI2A 2HPZA 4NVRA 4PPNA 1UFOA 4JS0A 4EI2A 2B6HA 3PEVA 3IKTA 2GZMA 4AJEA 4B45A 4GQAA 5J58A 3OQMA 2E4UA 1WVGA 3VNQA 2C5FA 5T67A 3NBZC 1A88A 1AN0A 3DTVB 4J3NA 3ZDXB 1SXPA 3DXFA 2PXCA 3LCCA 5DOVA 4OMFG 1XRJA 4W5NA 4FZRA 2Y0PA 3FOWA 2X0FA 1JHXA 4KN9S 2HF8A 2KS6A 2DHEA 5FPTA 2PK3A 3SM3A 2VA9A 2QS9A 1JJBA 2W2KB 5HGJA 2BMDA 2ZBRA 3UH1A 3PQ5A 3QU5A 5JVDF 13PKA 3C43A 4QOEA 4DMHA 4Z9AA 5HDBB 1CRZA 2JBAA 5H5JA 3W8RA 1A72A 3H7AA 1L0BA 3A3YA 5LP1A 2MYTA 4BNZA 1CY1A 1I0IA 2BN4A 4LEIA 2XB8A 3X2SA 5BN5A 3KKLA 3PI6A 3V8RA 5IUKC 4AB1A 3H0KA 4BWGA 4WOKA 2A9OA 3Q8WA 1YR2A 3N28A 4FWBA 3K0FA 2R62A 3I83A 3KLMX 4CL0A 1YZFA 1NWCA 2WB4A 1OOEA 3EYWA 3L1UA 3NYRA 3H4VA 4HL6A 1OYYA 5IVPA 3K6SB 4MQMA 4Q9NA 1NVDA 3B7GA 3NDJA 4ZCSA 1UJ6A 2E48A 1P4GA 3UOWA 4YV0A 2AN9A 1I4LD 1RYZA 1CERA 4IJVA 4BO3A 5FLXA 2FPWA 4FEEA 1QKJA 3D81A 3SC2A 4UXJA 1SBYA 3SNKA 5ER9A 1L4UA 1WUYA 3ID6C 1XZAA 4ODIA 3H4MA 1PNOA 3Q6IA 4R5MA 4D4MA 4XQEA 1ZL0A 4R8MA 1H05A 4JBLA 4OYLA 4JOQA 2CLCX 4PN7A 2Y1DA 4I5DA 2QQEA 4Q4JA 3QELB 4B8YA 3VJKA 3IMFA 3TNDA 5J2UA 5CT6A 4J1NA 4MCHA 1T2AA 4XYEA 3M33A 2GPNA 2K2WA 1EM8B 4JENA 3ENNA 4OQDA 3T9EA 1O9GA 3ANNA 6REQA 3R3WA 2V6IA 4P81A 1KAEA 2II6A 1QMGA 4U2DA 1U2ZA 5FH9A 1JKXA 1P9WA 1PJRA 2QRLA 2ZROA 3HI4A 4FSXA 4RHCA 2RB5A 5DTRA 1OI4A 1ZRHA 3GLQA 1ZRMA 3K6KA 1P3JA 1DQPA 3ZNNA 2BR3A 3B48A 3MT0A 4UTZA 1KE2A 4AMGA 3GOHA 5MGBA 3ET4A 4HOYA 1X8JA 2P27A 3BFVA 3PHJA 4DLTA 1DCTA 4LJRA 2ZXEA 4ZYXA 4YWJA 2FQXA 3L8YA 4GPIB 4X1YA 7MDHA 4EECA 1ZOLA 5EIBC 3RIEA 4PANA 3Q8MA 1GGNA 3PQ6A 1DXHA 1L1EA 3MEQA 4AS1A 1JBKA 5K3FA 1U1DA 4JL8A 5A4FS 2FCRA 2TSYB 3KM0A 2GHTA 3IIMA 3G2NA 4LECA 5LP6A 3PGA1 1MQSA 1XAHA 1HQYE 4MV1A 4RULA 1JBEA 2QRZA 1Y7TA 4HB3A 3E9NA 2QMUA 3L7CA 3U4IA 1W0KD 4IS2A 4KMMA 3W05A 5LQDA 5G4KB 2Z58A 5H8WA 2P9YA 4RA9B 1NE2A 3NWBA 4KZPA 4QUEA 4JUIA 3RAEC 1H3FA 1Y1TA 2HSZA 1L5VA 4FCCA 2IEBA 3HZZA 3QX7A 5KQGA 3GJ3A 4MR9A 3CNBA 4NCIA 1ZI6A 4YRIA 3GJ8A 4BJ5A 1G3MA 2HK9A 2PEYA 3EVDA 1G4HA 5T3YA 5LKRA 1NAHA 1LJUA 1K5HA 4X0EA 1MENA 4K26A 2IPOA 3EJ6A 2N0SA 3KJHA 5AH0A 4HH1A 4LC0A 5FAXA 1VM6A 2HC9A 5ESXA 2LW7A 4DDTA 2OO5C 4OKSA 3T7DA 4BV8A 1DKPA 3FJYA 3C1OA 2WYIA 1E9VA 4E2FA 5IAGA 1GTG1 2OXIA 4BZQA 3L40A 2CUTA 3IP8A 3OLXA 3WRYA 1FSPA 3OJOA 4QODA 1QRSA 3NS7A 2GASA 2VDUE 4U9HS 4QELA 5C1OA 4O4IA 2DQZA 3UF0A 1G20A 2C5GA 4LOLA 2G5CA 4LG1A 1M2WA 4U00A 2VHZA 3TQHA 4NTZA 3ZUPA 4AP5A 1T9AA 2C7PA 3SQXA 3AY7A 1BXRA 2PXXA 1M8PA 4RZ3A 4JGIA 1KBZA 1XELA 4FE7A 1HY3A 3SG0A 3SI7A 1IBCA 2HN9A 5EE3A 3W3AH 4CCYB 2HMTA 3ZLTA 1N75A 2DZDA 2FP4A 1ORVA 4MMXB 1OZAA 2ZT6A 4YB8A 3F5SA 5E7QA 1KMHA 3UJPA 3GHYA 3VV3A 5G3YA 5JTTA 2AC4A 3K0AA 1C3VA 4IKPA 1RRGA 1OFUA 3HXMA 2WF9A 3GJ5A 5EMLA 1OAKA 1RWBA 4R83A 3CLUD 5EKXA 3FR8A 4PLWA 1A8UA 1P1CA 5IH7A 2AK3A 3H5WA 1E5QA 1UBGA 1FXWA 1Z47A 3E9DA 3GA0A 4J0HA 4D6YA 5ABPA 1ZM2A 2OAGA 5LZ7A 5KKNB 5TQJA 4PZLA 4BLRA 3OFJA 1SC4A 4NDZA 1RKVA 4TKLA 2NZWA 1E2BA 4EG5A 5ED0A 1Z17A 3SJUA 4F9EA 2RH8A 2RGWA 4JLJA 4EIWA 1D4FA 2QV0A 3QU4A 4N0DA 4J16C 1SCBA 3DOCA 3GWZA 3SIXA 3MJTA 4L6AA 2GK6A 2IHYA 1EESA 4YRNA 4GM1A 4QU5A 4WN9B 1L4EA 1KY4A 1N2GA 1W25A 4BZZA 4M1WA 2MR5A 2I71A 1NAIA 2OK8A 1YRBA 2GZDA 2X9GA 4YCMA 4J1TC 4MX8A 3X1KA 3PQ8A 4D74A 1DMRA 3VX3A 3ZTYA 2RHTA 4NZ9A 2DULA 1PD0A 1L3IA 2H2FA 4G5SA 3RYHA 1MT0A 4MGHA 4IVQA 3KJIA 5IDVA 5EERA 1DJLA 2FUG6 2QRVB 4ZFNA 1ZXBA 2OVFA 2VH1A 1R6XA 1VHLA 2BTQA 3QU9A 1MJNA 4IJKA 4CTJA 1E2JA 4GOJA 2IY9A 5K0SA 3I4LA 1M1NB 4LJYA 3OX2A 4O4HF 2CBZA 4YLYA 5GOZA 1QH8A 2NO9A 1DEOA 5MFPA 1VDMA 1A5AB 2R6AA 1WSDA 2EL7A 3LDUA 1LPPA 5FL7D 2ZIXB 1YL7A 5DTMA 1PTJA 1V3QE 3E3AA 1G8AA 3AR6A 2GAIA 5HZKA 5KMGB 3FMOB 1OTHA 3P9SA 4LY6A 2H1CA 4P38A 5FA5A 5AD1A 5CDHA 5FV7A 4XUDA 3SMVA 4ANFA 1MC1A 1DDGA 5BWBA 1GA6A 3COZA 1GV0A 1NN0A 3LPMA 3R0JA 3R23A 2PSJA 4D8TA 2VHJA 4CFYA 1WMDA 1V5WA 1QSGA 3DE0X 4EVRA 4MUKA 2NYRA 5EMNA 2CUNA 2HD4A 3WGVA 4NBRA 2XZDA 4OHVA 2EJTA 2ZYVX 4DMUB 4G5HA 1R0ZA 1D03A 3RPEA 1U7ZA 4C7KA 3CWZA 3O0DA 1AKMA 1S2MA 2P1DA 4KI0A 5C46F 4BC0A 1H85A 1TD1A 4ER5A 3GQBA 4F5DA 3TNFA 1XZMA 2Y99A 5K99A 2C5LA 2Q2NA 3RUAA 4DCOA 2HFJA 4EGSA 3MBOA 1JHZA 1KKLA 1LH0A 2F3UA 2ZJ1A 3IIIA 4JH0A 3W5VA 1Z2CA 2YZ7A 4EOGA 1JILA 1GPMA 1F9AA 1UOEA 3FW1A 1J8MF 2YC4C 1N2ZA 1XU9A 2P75A 2R47A 3QEBZ 3CZ9A 4RV5A 3KKMA 4UZEA 4XUCA 2QORA 2BGNA 1RWNA 3FI0A 2OMKA 3N8GA 4MCAA 2P2SA 3FDXA 4Y1RB 1OFIA 4CMAA 5AW3A 3T5DA 4NBWA 1G4UR 3E5MA 3PE3A 4WFKA 5AJWA 3K0CA 1KEUA 5ALYA 3MVEA 1WY5A 3T52A 2AR9A 4MB2A 5J43A 4DL9A 1JTVA 3HA3A 1Z7BA 5IFLA 1Y8AA 4ZHSA 1EG7A 2WKSA 3GIWA 2J9ZB 5K2MA 1WB4A 4KXUA 4CDGA 1HOXA 3GHHA 4NE7A 2EVWX 2VHYA 1H1LA 3PR2B 3MIIA 4RFVA 4DC1A 3WSTA 2PX2A 4R9RA 4AG5A 1W5AA 3ZXSA 4YAKA 3BTOA 3KXKA 2DFDA 1LQUA 1EEHA 4B75A 1SPXA 1RU3A 3AB3A 3BL5A 3D4IA 4HX2A 4K0KB 1Y9ZA 1HNZB 5F2OA 3PEYA 3N2ZB 1ZOSA 1GCAA 3N70A 1F1BA 5C4GB 1DTSA 4JQSA 1L7RA 1QOZA 3DEYX 3EVEA 2JK1A 4XYBA 3HUTA 2L19A 2BMEA 2FUEA 1WDTA 4MWDA 4NQRA 2JJ1D 9LDBA 1CRWG 4HDKB 4MV9A 2PE5A 2A35A 1EUCA 2I55A 3T34A 4KGZA 2PBLA 3SZGA 1OW3B 5FWYB 4ZJZA 3DDNA 1CKEA 4ZRMA 1F0YA 4X61A 4ZYVA 2HXYA 4PZPA 4GG1A 4JJ8A 2Z6QA 4Z53A 4UBNA 2D1TA 3PIRA 1GL7A 3SSNA 1MA3A 3ENZA 1D5CA 3L4EA 1W5EA 3KJGA 4ISBA 3I04M 1XRSB 1DKQA 3EWAA 2ZSBA 4FDTA 5DGTA 3KQHA 5KWIA 2NM0A 3DWIA 3JV7A 1P75A 4QATA 1KEKA 2ILVA 2AOUA 3DEIA 2FMKA 1T0UA 3DZ8A 7MHTA 4MDFA 5G4KA 2CJYA 5AKKA 1CRLA 1QNFA 4L5JA 2Y0DA 3AI3A 5K05A 4A10A 4IGIA 4CWAA 2CV0A 1FNCA 1WW2A 1C80A 1QDUA 4EB3A 4DDHA 2ECOA 4O8CA 1OT5A 2QX7A 2D0IA 1T3GA 3HJTA 2VAMA 3ZHUA 2A1TR 2A3RA 1Y8QA 3M9LA 1RP7A 4MQUA 3WGOA 3INRA 3PJRA 4N4AA 1I5OA 2BGRA 3UT0A 1B3BA 3O3OB 1XZEA 3LC1O 4PS1A 3WE7A 3U6KA 4FQ5A 1U0RA 1MFZA 3UWMA 4E5SA 3ICWA 4ZN6A 2WQ6A 3TL2A 3RODA 4I8IA 4TRJA 1P29A 3H1TA 4B44A 2BSQA 1KK1A 1EYZA 2GI4A 4NENA 1Q20A 4MV6A 4QYSA 2MSLA 1YRQA 4XI9A 3BXZA 3HKDA 3KR2A 3W1EA 4BE9A 3HBLA 3H16A 4F4CA 4W5QA 1F48A 1B8VA 2P9EA 3FHCB 4GC5A 4L4UA 5E7JA 1JG6A 2XGSA 2UAGA 1T43A 1JHDA 1QONA 4HB0A 3ZR4B 3OF5A 3P9RA 1U0FA 3C85A 1I2AA 1A8HA 2XUPA 5CP8A 4UU7A 3R09A 1BNCA 1ZK2A 8ADHA 1M9NA 1I0ZA 3B20A 3U44A 3ITNA 3WGIA 2J30A 2WHQA 1C4OA 5AJYA 4OJTA 5B37A 4B6GA 3HU5A 4CLRB 2VBFA 3KNZA 1YC2A 5EHXA 1OREA 3N3BC 1U0LA 2D5BA 1E2QA 1WMEA 4P7GA 2IDJA 2XODA 1TE2A 4QUDA 4BQRA 2GTIA 1E89A 5AT1A 5FUWA 2LCFA 4DEXA 1ZS9A 3SC3A 4GOOD 3T1NA 4WBNA 4JYBA 1TYCA 1FSZA 1GJRA 3UK1A 1CUIA 4ABTA 4RHUA 5D00A 1JPVA 2ZVJA 1JTEA 4M8LA 2HF2A 2RGXA 2HXGA 3FZYA 2RH5A 1T34A 4YUXA 1KRXA 3LGSA 4RFSB 1D8AA 2B4QA 4EI7A 5CYOA 5G1NA 4P34A 5MN6A 2QX9A 1Q91A 2VP6A 3OZXA 4LNAA 4YC7A 2YNMC 5TT0A 5EJ4A 2ODTX 3SJCA 1OBHA 5CVVA 4BV3A 3V8BA 5CVUA 4ATNA 1N9GA 3HDTA 1Q1NA 2I1LA 1E7RA 2ZI4A 3QIAA 4W8HA 4KYTA 3ZW7A 5KVAA 4S05A 4TYNA 1YVPA 3G68A 2BGGA 2AUNA 3AR9A 5CU7A 1WKBA 4M53A 4JJAA 2MSKA 3CGGA 1OMOA 5DRYA 2XUIA 3SZ3A 5CDUA 3IV7A 5LA6B 4UNRA 2PGIA 3BZBA 5AVSA 3HNPA 3IJRA 2ZB4A 4B3RB 5C4MA 1B23P 4RF4A 5BMVA 1QU3A 4F3YA 1UUFA 2ZRPA 3H65A 4N82A 4D42A 1NI4A 5EJ6A 4YAWA 4DG5A 2O59A 2ZS8A 5IK2A 1K4MA 4WE3A 4BNVA 1T2DA 3M5DA 5CBPA 2HXSA 4Q1DA 1Z6QA 3B1VA 3GLRA 4P86A 3QJYA 1JI0A 3WMEA 2J3IA 3T3NA 3Q6NA 4TVSA 4RPHA 5IJ0B 5L8VA 3TJZA 3RTGA 3WL8A 2FRDA 4RZSA 1OQAA 1FBNA 1T4GA 1VE6A 1I14A 1Z6XA 2OGSA 3AFMA 2J41A 3AB7A 1WMSA 5BYJA 3IHLA 5BUQA 3R3SA 3EY4A 3WZ2A 3B53X 3KYDB 4MULA 1TCVA 3K70D 1TEZA 1RJ9B 1T2FA 4B8ZA 5ADUS 3NOVA 3GLHB 1UR5A 3KVRA 3B1KA 4J76A 4E11A 3ESXA 1ZY2A 5CVJA 1XVLA 2OM6A 1YASA 4ERNA 5BMOA 2W6CX 5AK4A 5CCXA 1AN9A 3MWKA 3I61A 1WU8A 4FLFA 2P3QA 3P2MA 3ROPA 2NV2B 3S5JA 2YCBA 5LP6F 1NJ1A 4ZJYA 3O8QA 3U48A 1ZVVA 3IR6A 4YDSA 2AJDA 2Y9PB 3TRFA 3A1NA 2DT5A 2ODWA 3B13B 2IXFA 1J23A 2JGJA 3GUUA 3VO2A 1O0CA 1T15A 1RAFA 3BIXA 4OATA 2IBSA 3FTEA 3OLVA 3DOJA 4DA6A 2EZ4A 2PQ0A 2R2AA 3OT1B 5GIPE 5C8XA 2YIDA 5DISB 4GOMD 3B60A 4QOGA 4R54A 4Z4IA 1KZGB 4V0OA 4KUHA 5B3KA 1ACLA 4QO7A 4N7JA 2B2CA 4RF2A 4BBZA 1YJ8A 2DUJA 3DV9A 4TV9F 3LVQE 1RQLA 3BF8A 1FPMA 1TPZA 4GVPA 4J1SA 3BSYA 3NIFB 1SHKA 3SFTA 3WZLA 3LY8A 3GRUA 5K1ZA 4LF4B 5D87A 3SHQA 1L4KA 4UDYX 2H4JA 2AFIA 4J0IA 3M6WA 4B6QA 1U0GA 2B1GA 3TI9A 3L0PA 2PFSA 1HC7A 2O0HA 3I64A 4LZOA 4C3ZA 5AKLA 4E88A 4G67A 1GAWA 1ECGA 2I4TA 1JSLA 2H85A 2W6QA 1G5RA 2WJHA 1X7YB 4Q3AA 2A4MA 3KDPA 4HX9A 1VPDA 3IXMA 1EJ0A 3HDYA 3RGWS 5JFOA 1ZM9A 4M22A 4YQEA 1Z6GA 4HNAB 4MV0A 3AFOA 5TQVA 4EL0A 1ISPA 2GVNA 2P4EA 4KDFA 1F38A 1VP3A 4MAAA 1YHYA 4OQXA 3M5PA 4V38A 1A9ZA 2XBMA 1FU4A 1NF3A 1AB6A 2IX9A 1LJ8A 4OQQA 1LRLA 1M2NA 3GCZA 1U0SY 2ZT8A 1HFKA 1VB3A 1LA2A 4XCXA 4DVGA 3G79A 1NUAA 3R7WB 1R9MA 4QXPA 3UAWA 1VPLA 5BT8A 2B8WA 3WJ1A 1T4BA 3JAKA 4GL2A 2PFGA 1PNQA 2XSZA 1IC6A 1D4AA 2IA5A 2JCVA 2VP4A 2I2BA 3IMKA 1Z0FA 3ZOKA 1YIDA 4RLQA 3A25A 3FE2A 3K3PA 5LDHA 1ZD3A 4LSGA 4Q1EA 4IV0A 3B5EA 4QDOA 2X1VA 5BOSA 4DBVO 4DLVA 1FJGB 2QXTA 3U4MA 3C1TA 5FNVA 4PHGA 2D3WA 1SD2A 4B6FA 3EEFA 1NUPA 4CI0B 2F8TA 1X1RA 5K8VA 4TMZA 1T29A 2EFGA 1I3OA 3MTAA 4BCBA 1PWEA 2YZGA 1KKMA 3H05A 4HJRA 4CV3A 3UA4A 4R1NA 4AN1A 2QR5A 5BVHA 4YAUA 1XRPA 2RJOA 3OAAA 1Q22A 2NU6A 2JCYA 5DCYA 5MFZA 2D0DA 3ODGA 2EBWA 4JEUA 4QGFA 4C5CA 1L4BA 3SJ7A 3T7EA 2D4AA 1GR1A 1E4OA 1M8FA 2VJAA 4L3OA 4JI7B 4TV9B 3CVOA 2DWUA 2FP4B 2GYUA 4LJ4A 4LSWA 3T4XA 3UIEA 4RTJA 4OQMA 5EMKA 2ZB7A 3PRHA 1THTA 1I94B 3NONA 4ND8A 1SELA 1XRQA 3W9UA 4RGYA 1P17A 1GGMA 2MTBA 3TW0A 2ZUFA 1Y8QB 3W90A 1X70A 3PRJA 4DLUA 4R7GA 1FJ2A 4XIYA 1FQOA 1R2QA 4IIJF 1Y4DE 4KYUA 3WIEA 2AA3A 2G1JA 3GRKA 4DLNA 1EGAA 1ZK0A 2QUAA 2XI4A 4JUCA 4DCSA 1MV5A 4DS3A 2V0NA 2VPYA 1K63A 2V6GA 3DEJA 1FXUA 4EATA 3H2BA 3LF2A 3AKZA 1E4EB 2IUUA 1WP9A 4QUJA 5K0ZA 2WVAA 1E4VA 3DMTA 1PVVA 4RW0A 3AFIA 2ERXA 1CHNA 2ZU6A 2P9GA 4LCEA 1K7EB 2XOKA 4OHXA 4WCDA 1Y7IA 1ZEJA 4TTRA 3CH7A 3D5EA 4I5EA 4BECA 1P44A 1FFXA 2FETA 3VV2A 5EPUA 4DUGD 4E5YA 2BL4A 5JMWA 2Q3CA 3OA2A 3ENKA 3DE4X 4FFVA 5DHTA 1DRUA 5FOXA 1JH8A 3UWPA 1VI6A 1CUXA 2AX4A 4HK4A 4J2TA 4PZ9A 1N6LA 3UK2A 4PNPA 4LY9A 3VSAA 2WDZA 5JC8A 3VKHA 2HLPA 1BX0A 2XCLA 3QZUA 3VTAA 2FPPB 3OMXA 5DLEA 5JCJA 4B6PA 3F47A 2BKEA 2PWYA 2QUKA 3OSUA 1GU1A 3HCEA 1NF2A 3OQJA 1ZH4A 2O0LA 1EK5A 4WXEA 1BEUB 3A05A 1IZ7A 4RGBA 3V2UA 2WEKA 3W2GA 1YRLA 3B3QA 3ZGVA 4PR3A 1P2SA 3WKDA 5C52B 5BSFA 2WAOA 3W78A 1GEGA 1RYDA 2PV0A 4FX5A 4YI3A 3G0DA 2WFLA 3DCJA 4HPWA 1TJNA 3GDOA 3F98A 5GAJA 2VYCA 4TYYA 3K9WA 2FPSA 4NARA 1CG6A 5I9NA 4DCNA 2FA9A 4GD3Q 3GW8A 4Z1MD 4KI7A 1KF0A 1NVVQ 3OCXA 1MV8A 4AZ0A 4DV7B 2H5LA 3G2IA 3P5BA 1XL0A 1XI2A 3CT4A 2JAXA 4ROTA 2AFIB 3WLFA 4I55F 4A8HA 4BEJA 1P31A 3Q9NA 4CLXA 2XCOA 4EUFA 1VKHA 4DV4B 3VUFA 2XWBF 4FDAA 4KUEA 1CV2A 1RM5A 2IU3A 4L76A 5H3LA 2W2NA 5EWMA 4TSRA 4GDFA 3CJRA 4JY7A 1PFWA 1SB9A 1Q44A 2NOAA 5KWJA 1USIA 3O75A 2JGFA 2FN4A 4WHMA 3JQGB 3EBLA 4URWR 3UKOA 1XK7A 4YRTA 4AYTA 4LNUA 1SQGA 1ZOPA 1OXKB 3QYAA 2JLQA 5DX8A 1UDCA 2DHQA 1UMBA 1DBSA 1IIRA 1Z2DA 4HDMA 1RZRA 3KT3A 4MWEA 4RHTA 1PWXA 1ZAYA 1SWVA 1QRAA 4O1MA 5F76A 1EVEA 5KYVA 5EVJA 4ZOQI 2IY8A 4RL4A 2ZYDA 3IDFA 3NOXA 4LYGA 4UTVA 5H9WA 1F8XA 2XNDA 4G85A 3ORHA 3VR2D 1W4LA 2IDZA 4QPDA 4N3NA 5JVDB 4HF7A 2WY2D 1CNEA 1RHQA 4JI3B 5SZIA 5JY6A 3H11A 1I6LA 2QZ9A 5CJJA 3PUIA 4RDHA 3LVFO 4TQAA 1FYWA 1R16A 1ZP6A 3IQDB 4LBYA 4PPYA 3RCBA 4BX8A 4ECAA 4QM6A 4CR6A 1JDBB 2XQVA 3HM2A 3R20A 1Z35A 4TL9A 4IUCS 1AUOA 2GEBA 2DBZA 4XX1A 5CDFA 1QYDA 1Z29A 2F1IA 3I1IA 2G07A 2EJVA 4EMTA 5IUJC 1AKEA 5THXA 1FFCA 1K9SA 4V02A 1IZ8A 1TQ2A 2IYTA 4JXJA 3TD2A 2N46A 3WZMA 4MVJH 2GEJA 4RPJA 4EB8A 4J7XA 3QVXA 4JYPA 2ZOSA 1VSVA 2VDVE 5EMMA 3HCFA 2ESRA 1HDRA 4IGFA 3K92A 3FLMA 1I0LA 4G07A 2O2DA 4FXOA 3WP0A 1S2LA 3OQPA 2PKQP 1SU4A 1DL5A 1QOPB 1NYLA 3SEAA 1FJXA 1XFDA 2PUHA 4PC6A 2BSXA 1IM2A 2OE2A 1WABA 1KFCB 2OO3A 3UB4A 1OAAA 1XZGA 4K6KA 2ZJ6A 1IUNA 1BGVA 3E7FA 5FBZA 4O4LB 1LPAB 3H2HA 4RDXA 5SICE 2Z1NA 3RTDA 2DKOA 3NP9A 4WOCA 2MIIA 3W5AA 5JAQA 1KDYA 3F4LA 3FCEA 3SC6A 1ZK3A 1YE5A 5FLKA 2PAFA 4W6QA 3HYCA 2FG6C 3IEUA 4TXLA 4RH1A 3D5TA 1T3TA 2EIHA 5K01A 1F3OA 4RORA 4BGVA 1NTOA 1TM4E 5THQA 3PNKA 1W85A 4S2UA 4UEWA 3U0BA 2IHZA 3LFUA 1MNQA 1C0PA 1DLIA 1M1UA 1XXHB 2WOOA 1Y3DE 1GUZA 2P78A 2HK7A 2N1MA 4WERA 5EJ5A 4HTFA 1JEAA 2HWYA 3UAYA 3V5NA 1PZEA 2UUPA 5I7HA 4HEA6 1NFRA 1FBTA 1TL7C 1UDWA 3JQ9A 1RWQA 4H7IA 4IHJF 2YW9A 3AESA 2P3SA 3B89A 4LHSA 1FNMA 2PR2A 2VJNA 3AU8A 3BL6A 2LIVA 3CIOA 4RVHA 4Q9LA 3QE3A 2G7ZA 2GD0A 2OESA 3AR5A 3H4TA 5TQ2A 4XM1A 5E6UA 3TOVA 1RBYA 1W73A 4E4YA 4CIBA 1YVRA 3O2SB 4L7VA 2P0AA 4Q3LA 3H3XA 2NTJA 2NTYC 5G0UA 3ZGYA 5M34A 3ICQB 3GXOA 2CNOA 1QP0A 4FILA 1FYVA 3VJLA 4D9CA 1R9NA 4PHFA 3A31A 3T94A 4YCLA 1XYGA 2EGHA 3GARA 4J0JA 4B3HA 5A05A 2JLVA 3C1AA 2YIVX 3JQDA 1TW3A 4PC1A 1SPBS 5AYVA 1IRIA 4WK2B 4S3MA 5DHQA 1E6MA 2CEKA 3M82A 1J7JA 3I45A 1DKUA 5F4BA 5CFMA 3AM4A 5EGNA 1U3UA 2FCAA 1HK7A 2JBHA 3ELUA 4CT4B 4PC3A 4RDIA 2VWPA 3NM5A 1Q15A 2PUDA 4DR7B 3CCCA 1Q0LA 4OK5A 4RIEA 1XWWA 4TVBA 1AQNA 1WCIB 2DT8A 3M9WA 3DBRA 1H1DA 3OZAA 4JAVC 4M36A 4QVIA 3QW4B 3JARA 4L2IB 4EJFA 1U2RA 2M9MA 2I7DA 1ENYA 3F8SA 3WQHA 1L5YA 2OYSA 4D9EA 5K0TA 1PR4A 2MMCA 4M86A 4YJ3B 5LYJB 1N7HA 1P18A 3FSRA 4N0PA 3GEEA 2JI9A 1ABBA 3I92A 1UT5A 3KQQA 1MABB 4MZDA 5E0OA 5JRZA 1YSCA 1WR8A 1X38A 4FSDA 5BV8A 1ISIA 1O5TA 4JROA 2HKIA 3UYLA 2R5WA 5AKJA 3EXHB 1J00A 4BUZA 3O8CA 1O1YA 1UZMA 4BVFA 1U7WA 4YRCA 4BFWA 4BJ1A 3FHOA 1PN3A 2VYQA 3BL8A 5IVHA 3NHPA 3E1SA 3D0OA 3UHJA 3KTAB 4HHEA 3ZCRA 2WYWA 2XNHA 3OE4A 1AOXA 5J4HA 2MCFA 3EW9A 2PTGA 4J03A 4TMTA 1LF5A 1U7DA 2YQ5A 3GROA 4IPTA 3RLIA 1OB2A 1UWLA 1LWNA 4AMVA 2GRJA 1TK3A 5JAPA 3MM4A 1NPYA 3CIFA 3KSZO 4QQKA 2W6MA 1G1AA 4RVDA 3GWGA 1QF7A 1TU3A 2GZ3A 3LXUX 4JXKA 5DX0A 4RTSA 5LNK6 1KDRA 1K0UA 3O4RA 4UHEA 3HY3A 3GFGA 1Z0IA 4DNQA 3C7CB 1JYEA 1FNSA 1K66A 1QIDA 4QGAA 4RESA 1J0BA 3NHMA 4EHIA 2FOXA 2DKFA 4HADA 4PBTA 3H5NA 3H13A 3I6ZA 4FKBA 4JITA 1KZHA 2OENG 5K8CA 3T3OA 1Q21A 1QC5B 4LJ9A 3T5CA 4K3UA 3V1NA 4PXSA 3LUHA 2BE7A 4GKKB 1GZ5A 1JKFA 1QDLB 5CCBA 2BZGA 3PX2A 4UQLA 1ZCFA 4RKRA 3RH0A 3U37A 1T0HB 1FX0B 2WICA 1B0AA 4HR7A 3N0RA 4Y2QA 3TZHA 4DLSA 1QQAA 1P2VA 3O2JA 4YROA 2XMBA 3MJFA 4O0MA 1F6BA 3SGLA 4XUEA 2UYCA 1WDLA 1WNFA 3M4JA 2BGKA 1CS4C 1P60A 2CJPA 3C3DA 5I7AA 2HBQA 3PZRA 3VZBA 2I3BA 2CE2X 2V7EA 1Z2PX 2C8KA 1ODTC 2GUGA 5B3JC 1L6IA 2F9LA 4ND5A 5DTJA 3UNXA 3PX7A 1GA1A 1K6JA 2VYVD 1KBQA 4HMOA 3A3PA 1OWPA 1C4XA 4CZ2A 1P1BA 5DHPA 1FSSA 1X2BA 4AJ9A 4DCUA 3K1JA 1GKLA 1NR7A 1Z83A 2B3DA 3OFSA 5CITA 4DM7A 2Q6OA 2I7VA 1U7HA 2I1VB 8ATCA 3ND7A 3C8DA 4FCWA 1H2EA 5JXJA 3V32A 2VQEB 2CYAA 2HDHA 1OXVA 2QN7A 1E1DA 4I55B 1F20A 2R3SA 2VXOA 3P5SA 1E5LA 1NXSA 4N0MA 3SXJA 3ZE8A 3ZWKA 4DIBA 3FOAA 3IYLW 3WYFA 3N7UA 2QUBA 4C7MA 1HDXA 2ZIWB 1I51A 1A9TA 2QZZA 1R10A 2BLNA 2MINA 3N8IA 4I8DA 1HZJA 1YIAA 1UKBA 2ECPA 2P90A 4Y1FA 4URVR 1XZIA 3OFVA 2EIXA 2WJVA 1SD1A 2C3OA 4EVQA 1GAEO 2WJWA 4UDXX 2ZDQA 5ESDA 5HPYB 2CFTA 4UUQA 3VC3A 2WU3A 3H0CA 1JAYA 4LVOA 3H04A 2H1VA 1I6MA 5JJCA 2ZSJA 4RSGA 1K89A 2NPIA 3RVBA 1HQKA 3V4ZA 3NEJA 3MJ4A 3EXIA 4FXPA 3A4NA 3ZDQA 2PGLA 2A0FA 5WRFA 4FSHA 1XAGA 5TC4A 4JBNA 5JQGA 1YCGA 2XDWA 2BFAA 2CXTA 4F8JA 1T8SA 5AKGA 4Y9SA 4AN4A 2Q46A 3LXMA 4G5QA 4GKAA 5JSKA 4URXR 2R96A 1WOMA 5AVOA 1CY8A 1FYFA 1KMMA 1RJ9A 1UZLA 2H2DA 2GBGA 1B0PA 1P8JA 3P0HA 2H00A 3OP1A 1W4AA 4L3WA 4US1R 3RSOA 2OXRA 1PT5A 3HN7A 2SKCA 2ORWA 3HCOA 1BEEA 3R5KA 1FFHA 2HRDA 1QS0B 2AMJA 4IUBS 1KOJA 3K0HA 1ZD1A 3CY6A 4NL4H 4ZCQA 1QRDA 1JUDA 3IMCA 4EYQA 5JMOA 2IYRA 3NAZA 4AW9A 1N7JA 3NYQA 2F9FA 2MHCA 1CDEA 1O6GA 3BZWA 4FYHA 3TOZA 4AQDA 4JJEA 2HSWA 3GFPA 1WZUA 3JQ7A 1VKZA 2R60A 1R5JA 4LQCA 4B7XA 3PGVA 1CUFA 2HMAA 4R2JA 4DZZA 5KJCA 1E96A 4UHHA 4J4HA 4OGGA 3BK7A 1QH1A 2J3DA 1GPKA 2ZIAA 4BNGA 3PR1A 1ETHA 3E18A 3HKCB 4EPRA 1T1SA 4H18A 5FRDA 1ZWKA 1RMYA 1NG9A 4X85A 1USGA 3RJ5A 3U49A 4W5JA 5SZJA 5A5GA 4ZV9A 1Y7HA 2J9RA 2BZSA 4TT8A 2Q7XA 5HW0A 1Z2OX 5K6RA 5AXCA 3IALA 2IU4A 3L8DA 3OPYB 3EUWA 4NCBA 4NH0A 1CZOA 4OHUA 3X1JA 1TU4A 3TUIC 3FUUA 3DTVD 1MAVA 2JFGA 1E2NA 3T99A 1CE8A 1NVKA 2G72A 4Z3DA 4S1OA 3AI1A 3MXTA 1RWVA 4AIRA 2A14A 2PRZA 4D0GA 1HBJA 1QQBA 2DKNA 4Z9YA 4H08A 4K03A 2IOQA 2PMDA 3HVHA 4QNMA 4E6EA 2G06A 1DG3A 4YQFA 2YRXA 3CLVA 4PGHA 5BSWA 4FWTA 2QK4A 1TVKB 1D0VA 4YGXB 1UANA 5TX7A 1ZNWA 4RKYA 1P0QA 4X00A 4D56A 1OGYA 1W4ZA 1HYQA 1WL8A 3MJHA 2J6HA 4GE3A 5CLIA 4JGBA 1M72A 2OAP1 1B15A 1N2SA 2J5XA 3WLTA 1Y89A 1CQXA 3L0CA 3F6PA 4BOYA 3PXAA 3WQQA 5AUNB 3P20A 1KYXA 821PA 1WCIA 2BJHA 4GX5A 3TRHA 1UC5B 3LT5A 1P1HA 4TMFA 2FXVA 1J8DA 3NBAA 5L53A 1PZHA 4ZK6A 1WW8A 3FB1A 3A9TA 3CWCA 1M67A 3W4KA 2WMDA 2K5UA 3TIIA 3KLPX 3VR5A 2VKQA 1TMOA 3B9QA 3GDWA 3JWIA 2OHGA 2GILA 4DR4B 3KELA 4TYMA 1U2TA 3H42B 4QOIA 4AICA 2SCUB 5CXUA 2OBNA 1CT9A 2G77B 1EXVA 4Y2RA 2EP5A 1SVMA 1LDGA 3DBVO 2H4XA 4J43A 4OUDB 4EKDA 1EFVB 2C2XA 1RRMA 1A1SA 2Q5OA 4PNHA 2GZSA 3B6MA 2AJBA 4YALA 1N0IA 1UK7A 2OUKA 2X76A 5IM5A 4J3FA 2HV9A 1TJ5A 4TLBA 1G55A 4XA8A 3F8TA 3QY0A 3TNLA 1CK4A 2YWJA 3GY0A 4QA9A 5AVQA 2GRAA 5KQSA 3GJ7A 5CA1A 2R6HA 4HXFB 4G1EB 3TLCA 2BT4A 4Z5XA 4M1QA 5AR1A 4QDJA 3STXA 3LBIA 1K3FA 3SC4A 4L6IA 1Y1KE 2AMFA 2J0UA 2UYOA 3VBCA 4YEDA 4X1YB 2B7LA 4MQEB 3WYDA 1HI9A 3EXG1 4LISA 1GG9A 2JHCA 4RBNA 1NJ8A 4I1UA 4MUEA 4UMEA 3ZV4A 2ANBA 3G9XA 2H1WA 3NBUA 5AOCA 4BQQA 1PEAA 2J3EA 2FR8C 3MUEA 4CKBB 2XGJA 3OX3A 4K6GA 4MUJA 5LP6B 3LPCA 1ETUA 2Q4EA 3ENWA 4MYUA 4ZQIA 3P97A 3CC8A 4ZI7F 3T9BA 1THZA 3RHZA 2H65A 1OXTA 4G2TA 3U17A 2C8JA 3L4JA 2I54A 1QCDA 3GGPA 4A7PA 4R40A 3ABRB 4V0LA 4ZI5A 4DLXA 2I7CA 1JDUA 3ETGA 1E18A 2VP3A 3ONNA 3KE8A 2I22A 4LZJA 3SEFA 1XYYA 4JIMA 2G5PA 3VR5H 5LYYA 4M8NE 3SSMA 3ZI7A 5FWAA 5HBGA 4BTLA 3N75A 3HKBB 1NFQA 3K4PA 4AZ3B 1OSNA 1R6BX 1ADFA 2BEJA 3KWMA 4F5EA 3UMMA 1P0CA 3GPDG 3QLEA 1L4NA 3OJFA 3PKIA 2PH7A 1E99A 4MPDA 3BGVA 5E38A 2IV2X 5B7NA 1BRTA 4AY6A 1WWKA 1A50B 1TO6A 4DLKA 4EABA 1AMOA 5TDHA 2D8MA 3BD8A 4N9WA 4P58A 1NFFA 4CDNA 1VI5A 3GT3A 1OKKA 3RADC 2ZRAA 1GPNA 1CSEE 1KH2A 1AURA 5G0WA 4E6PA 3DLBA 2QLJA 3D0KA 3IPRA 4IJMA 4FE3A 2UZ1B 4RPLA 4YWHA 1VLHA 1N5MA 3CCBA 2B92A 5IC4A 1I3NA 5DXFA 1JWAB 1VL2A 4AYXA 3ZG6A 4BV9A 4GKJB 1BO6A 1YJCA 3GJXC 3WMGA 3LDAA 1N9KA 3QE2A 4BRSA 4BVGA 2DTEA 2ZIUB 3KQVA 2XMRA 4FHEA 4C4XA 3V4OA 1YMUA 2I7TA 3HUDA 1CNMA 2H7XA 2PMKA 4H27A 2FVYA 1ZMOA 4GYYA 2GBLA 4MRMB 2GBCA 2HEIA 2YVKA 5YASA 3HJFA 1C81A 1QKIA 3T38A 1XD2A 1HWYA 2AQ8A 4E1AA 1OR8A 3GZNB 4MV4A 3RYIA 2KLBA 3F97A 4BRWA 1IQPA 1Y7LA 4JJ7A 4UZSA 2ZJ8A 3FOCA 1XA4A 2H1HA 2OSVA 5HJ2A 5SV2A 5SY6A 3ELBA 4EW6A 4ZALA 3VRHA 4BE7B 3PQ7A 2JF0A 1KK3A 2Q0SA 2YZ2A 3AF0A 4MS4A 4QWWA 4ZCTA 4L28A 1A5SB 4L07A 3LQYA 2OYRA 3TZQA 4S2EA 2W0SA 4Z7QB 5ECDA 1YQTA 1VECA 4M54A 3BH0A 5T41A 3ZWYA 3U3XA 4EZIA 3UOAB 4FNOA 4KVGA 4M9RA 4DBZA 1VSQA 2QKYA 5EWLA 2BJWA 1S5PA 4KRFA 1NMXA 3TM4A 1AU9A 1FFBA 4LY3A 1LC0A 3FNHA 2VBCA 3OZFA 2GF9A 3DF9A 1SFRA 2O2YA 2R7NA 3OCCA 1W76A 3A04A 2BBSA 4W1SA 1FL9A 2YS6A 4WNAB 5KQPA 4NZOA 1YR6A 2I65A 1JJ7A 3V2HA 5J4KA 1R8XA 2FFBA 2XWSA 3HR8A 1DRJA 3VR5D 5JYCA 4OQYA 1BXKA 1GSIA 1DFHA 1Y8ZA 3I62A 1ZJ6A 4Q9DA 1EX1A 1FVHA 2RAPA 2AS0A 1Z2NX 2YJ3A 4IH9A 1E6CA 5IBQA 1LDBA 4IKOA 5CLLA 1TAUA 3R9IA 2YR0A 3JQCA 4KLZA 4KTTE 3D54D 4TL6A 1D3AA 5DNWA 4NMHA 4CXMA 1XRLA 3FUTA 2ZUWA 3EJWA 1UFKA 3ICPA 1GRVA 5JW6A 3DH0A 4NR0A 3IRVA 3DOEA 4D8YA 1RLUA 1EVIA 3GPCA 1UKYA 5JE8A 3NBQA 1MRSA 3TBHA 4EHKA 3BT7A 1OYVA 1DKMA 2GYVA 3LY9A 3I3SR 3M7IA 4MKRA 2CYCA 4HQ0A 4CG0A 4L9SA 5A7FA 4MAFA 3N7TA 4Z8YA 3F96A 3IEXA 4Q39A 1Y48E 1P6QA 5MN4A 3NUZA 4JNKA 1T9BA 3U09A 4P22A 4Y2UA 4MWOA 1J90A 3MG9A 3QOWA 4DT1A 1A0OA 1E9RA 1X8KA 2CJWA 3HJRA 5KTTA 3VPGA 1U28C 1X0VA 1Z07A 4PAMA 2ZSIA 4TWAA 5BT9A 4MEJA 4H0FA 4X8HA 5EKTA 1JG4A 1WQ1R 1U31A 2JKYA 2Q6IA 2QQ5A 2WT9A 3DO6A 1B3RA 1RXCA 4OXRA 4PCAA 3IHKA 4RIFA 3B6ZA 4CYMA 2H9IA 1CB7A 1K97A 3MPUA 3M83A 1W96A 4FCVA 3RWMB 2IHUA 2NVBA 4CMHA 3ZCVA 2XEXA 3DBIA 2C9OA 2AUMA 1RM0A 3CLTD 5TMDA 2WPDA 1QP7A 1ONNA 4MIYA 4MS1B 5A9SA 3J7TA 1ZVMA 5GPBA 3O3MB 3LY5A 2GTPA 3U1BA 1E5VA