3DOEA

Complex of arl2 and bart, crystal form 1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
189
structure length
189
Chain Sequence
b'GLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTADLEHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 2
publication title Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
total genus 63
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3doeA00
1KI2A 2ZROA 1A82A 1Z0FA 4OI2A 4XVQA 3CH5A 1CXZA 2VSOA 3IQXA 5JS7A 2RGCA 3HR7A 4B34A 2VHTA 1I2MA 1CP2A 1RJ9A 1SXJE 1YRBA 2F7SA 4AI6A 2YKGA 4MITA 1SXJC 5JLJA 1DAHA 1NMYA 3NG1A 5FOXA 4AYTA 4ERNA 1IAQA 4BFVA 1RRCA 1ZM4A 5GJVC 2OLJA 2F1IA 1US8B 4ZDIA 4A0GA 3ADCA 2DWPA 4EKDA 2WWIA 1OIXA 1HT1E 1VYTA 2HT1A 1W4RA 4LHVA 2VP2A 3KJIA 1KK1A 2H18A 5FBRB 2ZI6A 1KO8A 4LOAA 2YWFA 4V0ME 2E9SA 2NGRA 2B21A 3GLFA 3KB1A 4D4KA 3D31A 1PLJA 5KPJA 4LJ4A 4QJ3A 4MKIA 2HF9A 5EUQB 1WRBA 1VIAA 4EUNA 3BBPA 4R9UC 1EK0A 1PUIA 4N0DA 2IHBA 5D3MB 1AGRA 1SVWA 3UMFA 5EJEA 5FPKA 4ZV4A 5G53C 1F48A 3UIEA 3GEHA 3GLIA 4RD1A 5JI2E 1F2UB 3ICEA 2W83A 2ZU0C 3M6AA 2KB0A 2CE2X 1NBMD 3G82C 1SZPA 2JIZD 2RGXA 3OEED 1GNQA 4O25A 3FFAA 4MKGA 3ZJYA 4UXJA 3U7FB 2AKYA 1K6MA 1K8RA 4TT3A 4E22A 2F9LA 4Q1FA 4WAUA 2V54A 4V03A 3ZZ0A 4UJ5A 5KOYA 4Q1EA 5K8LA 2RGNC 2E1RA 1DO2A 2C77A 2J1LA 4H1VA 2XXAB 4GSYA 2J7PD 3UWOA 2CJWB 1MRSA 3AVUA 1KO1A 2WJJA 1DAGA 1XZQA 3Q7PA 2C96A 4HZUA 4TMZA 4YXWA 3MWLA 4EJSB 3ND9A 1BKDR 4QHTA 1N0UA 2ZSAA 3QY0A 2OBLA 1Q3HA 4F93B 4RD4A 4V02A 4YC7A 4Q7JB 4EQ6B 4XWAA 3PJRA 1Z0JA 1L4UA 3AF3A 5FPSA 4ZKDA 1G5RA 2GHIA 3SOPA 4LSGA 2Z4RA 4PQRA 2IW3A 3EZFA 3T15A 1FW6A 1F2UA 4AKHA 5DN6A 4LHYA 3CUEF 2R6GA 2ZSFA 4A82A 4F38A 1XPUA 2VP6A 4DHEA 3Q85A 4NZYA 2ZRCA 4ZCLA 5L3SB 5HZHA 3JZAA 3WYGA 3FMPB 3U5ZB 4TLAA 4QC2A 1C1YA 2X1VA 1ZNXA 3NBYC 2OV2A 5FTMA 2ZI7A 5FR1A 5JMTA 2O8BB 2GXUA 1AS2A 2DWQA 2H8KA 3ETLA 5JHGB 5F3WB 4MGYR 5EE0A 3QVVA 3WNCA 3SU8A 1T4GA 3RYTC 2H1LA 3EIQA 4ZDKA 2XXAA 5AR1A 2YV5A 1TF7A 2CJWA 2W6ID 1NG9A 1ZIOA 3VHXA 2NPIA 4ARZB 3NHBA 1D2MA 2QMEA 4TZ0A 2ZI4A 2ZYVX 3NH9A 1V5WA 5FBQB 3HU3A 3QXJA 1KJZA 3V4FA 5JRZA 2IT1A 3GFTA 4UNRA 1UF9A 2C03A 2NG1A 4AC9A 2G0NA 4CEIA 4MKHA 3TNFA 4LDJA 5HZKA 1AN0A 3K70B 2V7QD 1E6CA 4ILEA 2I4IA 1NP6A 3H1TA 3CRQA 3QENA 2WJIA 4TMTA 1CJVC 2BEJA 2WPDA 4O2LA 3X1ZA 2J0SA 4W5WA 2FN4A 2B92A 4JSYA 4B35A 4D0NA 4E03A 4LHWA 2V6IA 1ZRHA 1B0UA 3VR6A 2QL6A 3ONWA 4JJZA 3NWJA 1VPLA 1G8YA 2WMOB 3TVDA 3WHLA 3VR2A 4OI0A 3VNVA 1KI8A 2J87A 3KXKA 4ESHA 2O8BA 2J59A 1R0ZA 2FEMA 3O8DA 4IHQA 3PUZA 3NBFA 4MRPA 3NIBA 3LXRA 2D4HA 2Z43A 4JVMA 2OLKA 4B75A 1N0WA 2IXFA 2XZPA 1OFUX 521PA 4N3NA 2GAOA 1CJTC 1SVIA 1UM8A 1R5OA 4BZQA 4EPWA 3N2IA 4ARZA 2EFEB 4LPSA 1W36D 4URXR 4HB0A 4ASUA 3PUVA 4PC3A 5FUYA 4QHSA 1KMQA 1W2GA 1X8JA 4C30A 3MJRA 2GBLC 2UZ3A 3P32A 2A5DA 2IYRA 3R8CA 4BEJA 4JKIA 3GLHB 2AL7A 3LAWA 1W47A 5JRJA 4P4UA 4DDWA 3KUDA 3FFBA 4OHYA 3C4JA 1SULA 1RW4A 2ONJA 4RCYA 3O8RA 4PPNA 3SJAA 3U4QA 2PT5A 2P0EA 1Z6XA 3CWQA 1E98A 3I73A 1Z06A 2VHCA 5EP2A 5IRCD 4C0SA 1XNJA 3RS2A 2MSCB 3MG9A 2JA1A 4IVRA 4CRWB 2JCSA 2NO7A 3K8YA 1TUEA 2EWWA 1JQJC 1ZUHA 2WTUA 2C5LA 821PA 2JLZA 1KGDA 2J0UB 4CZ2A 1DAFA 1H65A 3OE7A 2OG2A 3X1WA 2ZITA 5E7MA 3W34A 4XTRA 4TYYA 2HYIC 1BYUA 1U0JA 1NVUQ 2WVJA 1QDEA 4J0QA 2I3BA 5TMPA 1FQKA 1JI0A 1HTWA 5EUMA 4LV5B 5EXPA 5C2JB 2EFHB 3MJHA 5SZJA 1HH4A 2CL0X 2ORIA 4GOKA 3L0OA 3CX7A 3K9LA 1QVAA 1XEWY 3DKPA 4Q48A 3ZS9A 3KQNA 2HXSA 4XOIA 2JLVA 4I99A 1KDRA 1F2TB 2D2FA 3QNUA 3TR0A 5L3VA 1XXHA 1B23P 1TQ4A 1LF5A 4UXHA 1U9IC 1E0KA 1OXSC 4G5QA 1LB1B 3KKPA 1NL3A 4JL5A 2IBMA 4HB2A 2C2HA 4ZI3A 4US2R 4BEBA 1XPRA 1E9CA 1EFCA 2ZJAA 5AUOB 4WXRA 1AZSC 5J4HA 1SXJB 4G0NA 5KSPA 3GJ4A 3T5DA 1XTSA 1GITA 5C46F 5JJIA 1ZNWA 1HUQA 3B7GA 4KAXA 1TUIA 2QENA 2IYVA 1DTSA 4MKFA 3VTKA 3IUYA 5GADl 1G7SA 1X1SA 3D8BA 2O8EB 5CDFA 1DAIA 4NBSA 4CYMA 2JASA 1N5IA 3LX5A 1G3QA 3PR1A 4URWR 1GTVA 1Z6YA 2KI5A 3SBDA 4EIWA 4QKQA 4LC1A 4D25A 2N1BA 3V9PA 3AEZA 3WHKA 2GTPA 4Q9IA 4Y0AA 3H4MA 6Q21A 1F2TA 3K1JA 4IFBA 5KO2A 4DEYA 3U2QA 1M34E 4I81A 2VPPA 4L9WA 3I5YA 1T3LA 2FSFA 4G5RA 1TTTA 1FP6A 2H7VA 1R6BX 1U0HC 2JDID 4NKRA 1FQJA 1G64A 1Q12A 4HAXA 3MRSA 4KV9A 4UKDA 2Q9BA 5DYGA 4DSTA 2R6DA 1E2EA 4BGDA 2FFHA 4B73A 3V4RA 2O8DA 1QHYA 1N6PA 2ZRBA 1LVGA 5DYIA 2XTZA 1M7HA 4WW0A 2P65A 2QUZA 3U3MA 1OYWA 2NOAA 4OJKA 1YR7A 1A2KC 2RMKA 4BLQA 5C4GB 5FL7D 1C9KA 2RGBA 1K5GA 1BIFA 3L0PA 2YWHA 4PO1A 2O8EA 3CNLA 1UBCA 1G7TA 3KFXA 2Z4SA 2GEUA 2Q21A 3QF4A 3GLFE 1KSFX 2QM7A 4RZ3A 3HU2A 5FH9A 3BIFA 3LQQA 3D6TB 1OHHA 1ZIPA 5EQTA 4IVPA 4A4DA 4BUJA 1TNDA 3UPUA 5EE1A 4LK2A 2W6JA 4U5XA 1X3SA 2ZS8A 2GILA 3LW7A 4ZO4A 1OXUA 2VSFA 4JLNA 1KHTA 3RAPR 1QHHA 4HDCA 4IDQA 5CIWA 2QP4A 3GLIE 4XD7A 2WSSD 4U00A 2WOOA 1Z0DA 1KI7A 5TXGA 3QEJA 1G18A 2VP5A 4Q21A 3TK1A 3C5HA 3NDBB 5FFMA 2ZSBA 5AJZA 3C14C 2KBFA 3RRZA 1JR3A 4Q7MB 2NZJA 3OIVA 4FWTA 1HE1C 1KDTA 4FMDF 4WZAE 3IDQA 1S0UA 1SVSA 1JBKA 1AKYA 1VG0B 1Z22A 2FEOA 3NXSA 4Q4HA 3LLUA 4XIGS 4Q9JA 3R8FA 1FTNA 4AKEA 3THXB 2ZPTX 3BXZA 4B74A 2GESA 4GZMA 1DAMA 1S4QA 5EZ6B 2IS2A 4LUCA 2ZTSA 3AQ4A 1FPMA 1E2FA 4Z8XA 3SC3A 2IC5A 3CF0A 4LYFA 4HDQB 2C04A 4RFVA 4WBSA 2IYTA 2W2XA 2QTFA 4ZKEA 5JI3E 1NVXQ 3EX7C 2ZXUA 3AF4A 1P72A 2CE7A 2CL6X 2IHYA 1G3MA 2ZUCA 5EZ5A 2BOVA 4YMVA 3FHTA 2BBWA 4A2QA 2RH5A 3TUZC 1T8UA 4PPFA 4ZCIA 4XVUA 2IYSA 3L43A 2IK8A 5G3YA 1PUJA 1X86B 2CEAA 1BMFA 2ZJYA 121PA 1YR6A 4NCHA 4JYBA 3LXXA 1BH2A 2XSZA 3NC0C 5BN3A 2BKEA 3GLGA 2XZLA 3T1QA 2ERYA 2RGDA 5FI0B 3SFZA 2ZANA 1KYIA 4XVRA 4M53A 3NEYA 1E2LA 3CRW1 1XEFA 2HLDD 2WJHA 4US1R 3NBZC 2F9MA 2ZIAA 3BH6A 2PH1A 2QMUA 3BORA 4NU0A 4TYQA 1E79D 3AB3A 5HKKD 4IJMA 4OL0A 3JVVA 4OK3A 3SDZA 1LW7A 4FW9A 4Z51A 2EVWX 1EXMA 3B1WA 3KJHA 1CJKC 1ZBDA 1TQ2A 2O52A 4KHZA 3ADBA 1TU4A 3AGQA 1HY3A 3C5CA 3HPRA 1FZQA 3CLVA 5FBWB 1OB5A 5BWMA 2JLUA 1NN3A 2JLQA 4Q4AA 2EQBA 1AQUA 3KJEA 3O8CA 1RYHA 1S1CA 4CT5A 1I4DD 1DE0A 4UNPA 1G17A 4II7A 4MDEA 2D74A 2PT7A 3LBNA 5P21A 4A8JB 5KSOA 2CMKA 3CPJB 1IY2A 4LJ6A 4KFUA 3L0SA 2FX3A 1ZM3A 1PLLA 2ONKA 4Q03A 3T35A 1W0JD 1OFIA 5HE9A 3RC3A 3GJ7A 4DT1A 3VKGA 1LY1A 2GVDC 1S9HA 4YDSA 1U8ZA 2CHQA 2CHVA 4HLUC 4YMWA 5B64A 1N6HA 4Q7KA 2C99A 2LKDA 5GJWC 4G5SA 3HYRA 2YWGA 3FB4A 1Q1QA 5EXTA 1YZTA 2FZ4A 3ZQJA 1XTQA 2C9YA 4PZZA 4OQMA 4PXAA 2BBSA 3HJNA 2ZS7A 4KO8A 2XZOA 3MFYA 2TMKA 4CEHB 1TL7C 3WY9A 1TEXA 3CO5A 1E0JA 3PUXA 2YJTD 4MYHA 2P2LA 3I72A 1II8B 3Q8XB 4PC2A 4TLDA 1J70A 4D2IA 5JBQA 1Q3TA 4M9QA 2XJ9A 4DJTA 1FUUA 1SXJD 3W9YA 5JECA 3K70C 3SBEA 3W8RA 5DIFA 3T12A 2FFBA 3LO5A 4KSCA 2JJ1D 2ZE8A 1OB2A 1RC8A 1MOZA 1OT3A 3CBQA 4D81A 1NVVQ 3E70C 2PL3A 2W58A 3NTUA 1OIWA 3PEUA 5BW8A 4A8JA 3K0AA 1XF9A 2ZRLA 1GNPA 5DH9A 2BM0A 4BLTA 5KDDA 3RS5A 4JLKA 2O8FB 1KNXA 1CBUA 2IYZA 1M1YE 2XNDD 2WJVA 1E0SA 1UFQA 4NYJQ 1IQPA 1XMIA 2J46A 2HXYA 4XWKA 1RYFA 1SHKA 1P2VA 2GVZC 3KFVA 3BH0A 3L82B 1A5TA 1G16A 3D7MA 1E4VA 4ABYA 2AD1A 1S2MA 2ZRPA 3IIKA 2I1QA 5HTKA 4CEHA 3GFOA 2FF7A 4P31A 2ZJOA 4I1OA 4NMMA 4P4SB 1II8A 2Q3FA 3P27A 3A1WA 2IWHA 2FPLA 3WRXC 4GPTA 2FJUA 2Z0MA 3A4LA 1P60A 2IXGA 2D2EA 4JLAA 3TUIC 3HYTA 3IEUA 1Q20A 2NTYC 1P61B 4MRVA 1XXHE 1VKJA 4D4LA 2GNOA 1E9FA 4RCZA 2DY1A 4M1KA 1KNQA 2P5TB 5E95A 1DG1G 2J7KA 2HCJB 2HUPA 2WJYA 1SKQA 3GP8A 1E2IA 5FTNA 1G6HA 3O47A 1ZD8A 1KOFA 3BJIC 3EA0A 2OM2A 1UKZA 4C0AC 1ZU5A 2YZ2A 3SS8A 3W5JA 1LFDB 2O8FA 4IOMA 1IN7A 4LJ9A 1MT0A 3K09A 3TQFA 4B71A 4MQBA 2A30A 1E1QA 2ZRGA 3AVOA 4NYIR 2R9VA 4L9SA 1MABA 4JL8A 3G5UA 4QBHA 1GNRA 2NO0A 4P4TA 2OZEA 5FOTA 1QHXA 3W5IA 5CDFE 4P4SA 2AN9A 1II9A 2CHGA 4L16A 4URYR 2W6IA 3CNNA 2HF8A 2QE7D 1E69A 4LRWA 4QXAA 3PQCA 2W0MA 3BRWD 1DO0A 5IT5A 1ZJ6A 3IPXA 1KK3A 3L8ZA 4V0LA 4LHXA 1S9DA 1LV7A 2ZRKA 5FBLB 4JT4A 5JWHA 1R5NA 4B6FA 2V4ZA 1M7GA 4LYJA 2GKSA 2QM8A 1E1RA 1G19A 4ZPXA 3FYHA 3CF2A 4OK5A 4DLVA 2XTMA 3CB4A 2FNAA 5DI3A 3QPUA 1COWA 3GLIB 3BFKA 1FNMA 1R2QA 3K0EA 1Z6TA 3SQXA 1CULC 2QP9X 1A7JA 3AVYA 4DCTA 1P4SA 4Q66C 4P3YA 3B82A 4N0EA 5HCNA 3QOFA 4ACAA 1QHGA 1WQ1R 3PIRA 3REGA 3EPLA 2XB2A 1GZSA 2IF0A 1XCMA 4QG7A 5DHFA 5DSZA 4DSOA 4QBFA 1E2HA 1G5PA 2YHSA 4PHGA 5CIQA 1N6OA 1KDPA 1NKTA 1SVKA 1W5TA 1XMJA 1XZPA 2OXCA 4B3BA 4F4CA 1YVDA 3VU9A 1CR1A 3MWJA 5AJVB 1NVWQ 2O8CB 1CJUC 4B47A 1YKSA 2N46A 2BJVA 4DLXA 3K0CA 3KKQA 4HZUB 1M74A 3SEAA 3I5XA 3JVUA 2BDTA 2KSQA 2GCNA 2K5UA 421PA 3SQWA 3UMRA 1DVRA 1VG9B 3OFND 3SJCA 3EZ2A 3X1DA 1D9ZA 1LS1A 2ZSEA 4X8OA 3AV0B 2ZR9A 4NCNA 4OQFA 4A9AA 1P9WA 1PZNA 5AUQA 2WIBA 1M8PA 4KBFA 4B43A 4RD3A 4U02A 1N5JA 4Q1AA 1EESA 1Z83A 4BE7B 2GK7A 4DDVA 3ICQB 1N6NA 3TAHA 1JR3E 2J41A 4LBYA 5FOWA 1ZU4A 1ESMA 5IK2D 2R6AA 2OO7A 2J0VA 3TH5A 5A4JA 3RS7A 5C1BA 1JXMA 3TMKA 4IOJA 5JJKA 1MO5A 3TSOA 1DADA 4NCKA 3SR0A 1XTJA 4DLUA 4B2LA 1T6NA 2WWYA 2XOKD 1NG1A 2RCNA 4D82A 1EWQA 2GXSA 3U60B 1VG1A 2Z6VA 1OV4A 2OFXA 2QAJA 4B3GA 2O8CA 2KJQA 2OUKA 2ZJ5A 3EC1A 3EG5A 4LCBA 1EFUA 4GT1A 5FR2A 3FKQA 3I62A 4XH9B 1ZP6A 3KKNA 4ZDJA 4QRHA 4BZXA 2IUUA 2H17A 3RS4A 4CEIB 2MMGA 3RRNA 4RFSB 4FN5A 2EU8A 4O0MA 1E99A 3QUSA 5FPYA 3LWNA 2QMOA 1WDTA 2FSGA 1ZD1A 1ZD9A 4HAZA 4IKEA 5LBIA 1G8PA 1Q21A 2QRNA 5TVKA 5L3QA 5EE5B 3X1YA 1W5SA 3GLGE 2FSHA 2AX4A 3CRMA 4R98A 221PA 1WXQA 3CR8A 3UG6A 1KY2A 1J7KA 2IS6A 1YZGA 3WRYC 5FPHA 3PEYA 4MA4A 2QMHA 3I8SA 5TY0A 4QBGB 4M1TA 1KY3A 4DZZA 1ZMXA 3FDIA 1NN1A 3DHWC 5LB4A 3SFVA 1YR9A 2O5VA 2CNWA 3DO6A 5JCZA 1U8AA 3QKSA 4A92A 1VTKA 2F3RA 5L3RA 1NY5A 5DISB 3DM5A 1IJFA 1KTVA 5B58C 2IWRA 4TLBA 3R7WA 4QGFA 3K9HA 4JIMA 4HAYA 4IOLA 3VR3A 4DLSA 4QJ4A 4C7OA 2ZR0A 4RFSA 1F60A 4Q02A 3IBYA 2ZAOA 4JS0A 3B1XA 5K8IA 3A58B 2D7DA 3AM1A 2GCOB 4TYPA 3S1AB 1I2DA 3A4MA 2VP4A 1JJ7A 2XX3A 5BN4A 1SQ5A 1XBTA 2HEIA 4Q9KA 2ZR7A 2GK6A 4WIAA 4LWZA 5AJWA 4YMTA 1OKKD 3AP3A 3AUYA 4D6PA 3U4QB 1J8MF 2JDIA 3FGNA 3FHCB 4AG6A 5FPTA 3TAUA 1KI4A 2R2AA 4EFLA 2IUTA 5FI1B 1FTSA 3QKUA 1ZYUA 3VMFA 3T5GA 2DHRA 2G1JA 3KQHA 1N6LA 4NYMQ 4YMSA 3WMFA 1ZAKA 1XD9A 4H1UA 4X8LA 5FL7A 4RZUA 4BFYA 4CF7A 2MSEB 5BXQC 4POAA 4AYWA 3HP1A 4ZIRA 2FGJA 2OCBA 4IDPA 4TYWA 2X19A 1ZM7A 4TZ6A 2EFGA 4BECA 1TPZA 2GZHA 2R6CA 4R2HA 3MMPA 3QXCA 3TRFA 5ELXA 3W6PA 4OQLA 1CS4C 1E2NA 2JJ8A 2DPXA 2GCOA 3S1AA 1F3OA 2V1XA 1N6RA 1ZUNB 3OESA 4MYTA 2GWHA 2QBYB 4KFTA 1G1MA 2BMJA 4JJKA 4A8JC 2BWJA 1XXHB 2EYQA 2BKUA 5HCIA 2RB4A 3TBKA 2FPKA 4CDGA 4GFDA 2JJ2D 4A0RA 2WHXA 1T5LA 2WSSA 3RSLA 2IUSA 3B2EA 4ON9A 4JLDA 4P0TA 4KFSA 2PEYA 2IEYA 4AD8A 3W90A 4CEJB 3JZMA 1CRQA 1KO5A 1JB1A 1YZNA 5J4LA 1IY0A 4JBXA 1FP7A 3EIHA 4HLCA 3CNOA 5E3HA 4JVLA 3K9GA 5CM8B 1XEWX 3GJ5A 4K8OA 2XITA 3IO5A 4JVNA 2QNRA 2QT1A 1WCV1 2ZYWX 3BAFA 4OHXA 2G3YA 2QAGA 3BFVA 3QE0A 1TQDA 2ZUBA 4GP7A 4IOKA 4TT3D 5KDLA 1AM4D 4G5GA 4HAVA 1GL6A 1UKEA 3ZS8A 1KSJA 5JSZA 1T9HA 2QBYA 3HWSA 4HB3A 3ZVLA 4TL9A 1VMAA 3FMOB 1ZINA 2GETA 3A8TA 5JFGA 3DMNA 2P67A 1NJFA 2DBYA 1I4TD 4Q4LA 4AY2A 4YXWD 3TW8B 3BC1A 3SJZA 2OILA 2BCGY 2L0XA 4JLVA 3THYA 3OHMA 2BC9A 3RSOA 2ZS9A 3EC2A 3EWAA 3I61A 3K0SA 1E9EA 2O8DB 4CEJA 1QF9A 3NBXX 1N6KA 1NY6A 4EAQA 2P6UA 3AF0A 1P73A 1XMSA 4QFMA 4V0OA 2YNMA 2YVUA 3QKRB 1NNEA 4MRSA 3THOA 3SZRA 1IHUA 4F91B 4D0LB 1TMKA 2OFOA 3L0IB 3R9WA 1VIYA 3CPHA 1NN5A 1OH6A 5DN6D 1BYIA 1C4OA 3AF2A 4LV6A 3SE0A 1RFLA 4OQXA 2FH5B 3TSZA 3Q5EA 2WWFA 2QP3A 3QF4B 1HV8A 2HJVA 2OXRA 1U8YA 4OI4A 1KAGA 3W6NA 5B30A 1XPOA 3ZYCA 1D2NA 1DAKA 2ZRFA 3CF6R 4BLOA 3CW2A 4FXPA 2VF7A 2QTVB 1AS0A 1R8QA 4Z1MA 3UXMA 1VHLA 1QHHB 2QN6A 4M9ZA 4MGKR 3DKVA 5DI9A 1ODFA 2AR7A 1N6IA 3AKYA 3B9QA 5CJPA 1GM5A 3CM0A 3C8UA 4RJLA 3NEJA 4FCVA 5E7JA 1FX0B 2PMKA 4B6EA 2J3EA 1VCOA 1Q0UA 5DHAA 4S35A 3I3SR 3QPVA 4YLGA 3LDAA 1MR3F 4E07A 3QKRA 2FV8A 2WPDD 1KKLA 3NH6A 4RD2A 1BOFA 4Q4HB 3C7KA 2ZRAA 1HEIA 4RKFA 2CBZA 4PQYA 4PPGA 2R65A 5LDDC 2WKPA 4V0KA 4AIIA 3THWB 4GI7A 1P2UA 2G77B 1E9DA 1G8GA 2XB4A 4TN1A 5KU1A 1G3RA 3ZDQA 4AURA 3C41J 3MWYW 3K0CC 1R0YA 2VIIA 1I4LD 3WMGA 1UAAA 3RNLA 4RZ2A 1YZUA 3EXAA 1Z0AA 1NLZA 3GJ6A 3IHWA 1EFTA 3RS3A 1P9NA 2Q6TA 3CKLA 1H8EA 4K81B 3TLXA 1R7RA 2GRJA 2QG6A 3B1ZA 3CIOA 3ADKA 1YRAA 4HI0E 4NTZA 4DUGD 4OHVA 2QZ4A 5F9HA 2GJKA 4ASUD 3TQCA 4JLPA 4Q19A 4TL6A 1FX0A 2F55A 2GF0A 1A2BA 3AP1A 4GMDA 4D0GA 1UADA 2C9OA 1IXRC 2SHKA 2XAUA 4PPQA 5JEDA 3KQUA 3KJGA 2QPOA 3K70D 2RHMA 2ZSDA 3FKSA 2KWIA 1G8FA 2MSDB 2ZRJA 1JQLB 5H68A 3MSXA 1T8TA 3GLGB 3WYAA 2PCJA 3LVQE 3UK6A 1E9SA 3G0HA 4IRUB 3GMTA 3THWA 1U81A 4DC9A 4AYXA 1IBRA 3LQRA 1CR2A 4JBYA 2NMVA 1E9RA 4M0LA 3HDTA 1OFHA 4IDNA 4Q9LA 3UATA 2P6NA 3KTAB 1M6NA 3FMIA 3GEEA 3P1JA 2HYDA 1ZC4A 4Q47A 1XD2B 3AVXA 1IN4A 2Q3MA 5KUTA 4BRWA 2C8VA 2GXAA 4YMUA 4Q4AB 1Q44A 2AXNA 4UJ3A 5F9FA 1EX7A 1G8HA 5LPNA 4BLRA 3AUXA 1EFRA 3U3KA 2WWWA 4URVR 5HE8A 4TWZA 2I1VB 4BLSA 3EPHA 3GFPA 3NDPA 1WE2A 1KI1A 2DFLA 2BHRA 1ESNA 1AQYA 2ZREA 1GRRA 3PG5A 4L5BA 4R71A 3BH7A 1CEEA 2NZ8A 1OLOA 1II0A 4TTPA 4FMDB 2QSZA 1MKYA 4B3XA 4DWJA 4DT1B 1UBGA 1Y63A 3SHFA 1QVRA 1FNNA 2AK3A 4OHZA 1T3HA 1KK0A 2XEXA 4PTLA 5KTYA 4NDZA 1W4BA 4IEEA 3A1VA 2DB3A 4TL8A 5AUPB 3ND8A 2GEVA 4KODA 2A9KA 2ANCA 2FDCA 3VX3A 4M21A 2ZRMA 1GKUB 3IHLA 2QEQA 3KTAA 3MAAC 2NO1A 2GJAA 2JATA 2KE5A 4PHHA 2QE7A 4E09A 1YR8A 2REXB 1VDZA 1HQCA 1XD2A 1HT2E 2VRWA 3GCGA 3EZ6A 2OHFA 3LBIA 4LBVA 4B3DA 3IKJA 4LX0A 4TSFA 3WBKA 3ZZUA 4B76A 2ZETA 2NIPA 2PEZA 4MYCA 1E9BA 2AHOA 4R2IA 3MGCA 5GJCA 2GJ9A 5JS8A 1VYVA 1NI3A 2RGAA 3I32A 2ZUDA 1W4CA 2IYUA 3K0AB 1GRNA 2F1JA 3OIYA 2AKAB 4QL3A 3QVUA 3DL0A 3F5FA 1IONA 3Q9LA 5ANRB 5SZHB 3LA6A 1KI6A 1Z5ZA 1GUAA 2OSBA 4QNMA 2GCPA 3TUJC 4A36A 4KXFB 5GVSA 2PCLA 3DPUA 1YHNA 2QQEA 1JEDA 5FOSA 1E2DA 2AWNA 2ZE7A 3GJ0A 3FOZA 2X2FA 3RS0A 721PA 4EDHA 3VQTA 1UJ2A 3GD7A 3TW4A 5TB5A 2WMNB 2IEZA 3EPJA 2IF2A 4OHWA 2AFIE 1FL9A 4TMXA 2D7CA 5CLLA 3VX4A 2C98A 4KFRA 1U94A 1G21E 4MGIR 1V43A 2XGJA 1CLUA 1NF3A 2Z83A 4PZYA 2VQSA 4FINA 5FTJA 3KKOA 4QGGA 2CLCX 3SI7A 2VEDA 3OFNA 5C4MA 2Q3HA 1KO4A 4X8MA 4JBWA 5JWOA 5BYJA 5LD2B 4E5UA 4MDFA 4FMCF 4UNSA 2HCBA 2R6FA 3D3QA 3KKMA 2ODWA 5DO9A 2G9NA 3RVBA 4I1SA 4LJ7A 4D26A 4DLRA 2G83A 4QM7A 3BERA 3EW9A 1AJEA 2W6JD 2QA5A 3ZZTA 1R5BA 2A5JA 2B8TA 4M9SA 5EP3A 1NBMA 2GBLA 2JIZA 3OEEA 3RDPA 3BWDD 4XD7D 1HURA 4NL4H 1E2MA 1KDOA 5FOVA 1MABB 3SYNA 1D6JA 5J5CA 1RKBA 4Q1CA 3WYFA 4DCSA 4P32A 3TSWA 1DS6A 4M22A 1VYUA 2VF8A 5EP1A 1W4AA 1ZW6A 4M1SA 2RGEA 1MRNA 4HDOB 2ZVPX 3DZ8A 2IYLD 1JR3D 2VTKA 3DOEA 5G40A 2J7PA 2ZJZA 3KB2A 3U61B 4M1MA 1IN6A 4HUTA 2CVFA 5IF9A 2JGNA 4GOJA 4RKEA 4JT2A 3ZVRA 1W48A 3FVQA 2VSXA 4GBMA 2OT3B 2QQ0A 4HZIA 3TR5A 1Z6AA 4EFMA 5SZKB 1LF0A 2WSMA 2XJ4A 3H2YA 4PHTA 4OI1A 1ANKA 1MH1A 2VHQA 3CZQA 3X1XA 2QORA 5BN5A 2ZEJA 2FMXA 4IEIA 1P62B 1CR0A 3AKCA 3IBGA 3Q3JB 5DI3B 4B3CA 2REBA 1H8HD 2FA9A 3QXHA 4ACBA 5KYKA 1FMLA 3KUCA 3OIUA 2JLWA 2VO1A 2J9RA 1N5KA 3REFA 4FI3C 4FCTA 5DGXA 4Z54A 2X2EA 2ZU6A 2GZDA 3LFUA 4AWXA 4W5JA 4URUR 2D62A 1NLFA 4MYUA 3U3JA 3B5JA 1SVLA 3NC1C 2WICA 3ZH9B 3PITA 1KAOA 1S3GA 4WVFA 2ZI3A 4XTCS 4JKYA 3VNUA 1U9IA 4V0NA 4IDOA 1QG4A 3VU9B 2PX0A 3OAAD 3ZD6A 4PR0A 5JZVA 4DEXA 1W36B 3B78A 2ZJBA 4KLNA 1XX6A 4CW7A 2IYXA 1YE8A 2QY9A 3ADDA 2ZRIA 3ASYA 3OZXA 1OXXK 1G3UA 1ZCAA 1WMSA 2V7QA 2WIAA 4ITRC 3QI2A 4PANA 4B3FX 2GXQA 1D9XA 3A1SA 4C9BA 1XCGB 2E87A 3VR4A 3VHLB 3ECCA 1YJ5A 2OESA 1OXTA 4BFWA 2ATVA 2CLSA 4EPVA 2IA5A 3EZ7A 4RZXA 2ODNA 1RE0A 1JEEA 4WXPA 3T06B 4DDTA 1ONBA 1DG3A 3LNCA 4LV8B 4HEJA 4Q9HA 2D06A 2CLDX 2F6RA 1ZC3A 4PO9A 3VR1A 4JLJA 2IYQA 3U3RA 4C4PA 5FL3A 4EPXA 4FD2A 5A0FA 4ESVA 1OSNA 4IXMA 2QSYA 3B85A 2LCFA 1D5CA 3I1FA 4RY2A 4DXAA 1SVMA 2YC4C 4GP6A 1XB2A 3DEFA 3WNDA 1N3BA 2IYWA 2MMCA 2VP9A 1YU9A 4AK9A 5KNDA 4BPBA 3E2IA 1XRJA 3H86A 1Q22A 4DCNA 2BMDA 1W1WA 4IXNA 3TGPA 1IXSB 4KI0A 1OFTA 2YOHA 1GVNB 3A1TA 1DEKA 3A1UA 3RC8A 2P5SA 1P2SA 1WBDA 1R0WA 1ZUIA 2ZE6A 3RRYA 1G41A 1Z28A 2WWXA 2G88A 2H16A 1G20E 3B1YA 4K46A 4LY6A 4KITB 3P26A 5L3QB 5F98A 2JJ2A 1CIPA 1OF1A 1X6VA 2IXEA 3A36A 3RRMA 5IHPA 1X8LA 1YZLA 1XTRA 4TQUS 2DR3A 3M1IA 4DLWA 2HDNB 1VG8A 3C16C 4NCJA 1N0VC 2PBRA 5IDVA 4DCUA 2WWHA 2ZJ2A 5JJLA 2B6HA 4DRZA 4TMWA 2OCPA 4NH0A 3K9NA 2QT0A 2DCUA 4G01B 4QGHA 1UEJA 1ZNYA 3ZIAD 3GJ8A 2VYFA 4WOPA 4PAMA 4Q4JA 3NVAA 4PC6A 1N25A 1L4YA 4MRRA 4CT4B 2AXPA 4BRUA 4BFTA 1Z8FA 3Q5DA 4DLZA 3QKSB 3SHWA 1T91A 2CCJA 1IXZA 1R8SA 5CYOA 2QI9C 1IM2A 1YZKA 4PAQA 4RD6A 5LB2A 3F0TA 4HSEA 4OJQA 3BFXA 4QBIA 5J47A 1AS3A 3R7WB 2ZRHA 2PLFA 3WP1B 5B2ZA 4NHOA 4NP6A 3EARA 1US8A 3DZDA 4DIDA 4C7OB 3I8XA 3MCAA 4TMKA 1R10A 5CM9C 2A3RA 2VA8A 2R62A 5K8UA 4O3MA 2AWOA 1E94E 3T34A 1LNZA 4TQ9A 5DLQC 1HYQA 1Z08A 1NVVR 2H92A 2OAQ1 3IPYA 1J2JA 3UANA 3RWMB 2A78A 2ZE5A 2QTHA 4LBZA 4OKSA 1JPNA 2FSIA 2ANBA 2CK3D 3OEHD 1NMXA 2JLYA 3HPQA 1IJEA 3B60A 2ZJ8A 1T0JB 3TKLA 3AP2A 1XWIA 3I4LA 3T61A 4PSAA 1ZVQA 2FZLA 3EPKA 5D3MA 2ZM5A 3AKEA 3R9XA 2H5EA 4JLMA 5AWFC 1JXOA 4U7DA 2C78A 2WV9A 4NYJR 3B1VA 2R44A 2BVNA 2Q9AA 4F4JA 1NSTA 3FE2A 4LI0A 1HA3A 3P4XA 1JALA 5CB6A 4PSKA 3IO3A 1CKEA 3NHAA 3KXLA 3LLMA 1F5NA 4ZIRB 1SKYE 1E1QD 4TYNA 1TX4B 2CDNA 4IVQA 1QRAA 4TTRA 3TVTA 2CL7X 1E32A 1XCPA 1KK2A 2NQ2C 5UKDA 1G4AE 1QBKC 1JECA 1AK2A 1Z29A 1UEIA 3LH5A 1E0AA 2ODEA 4XSGA 1JAHA 3LRPA 4Q1BA 4LHZA 4BLPA 3H84A 4XSHA 4HUQB 2GEDA 3QJYA 3B6EA 4NCIA 3WP0A 2ZVQX 1IOZA 1G3IA 3SJBA 4EJSA 4BFZA 1OH5A 1KMHB 1W0KD 2F43B 3BK7A 5KSZA 1P7CA 2FFQA 1A4RA 1WA5A 4F4IA 2QGZA 1SGWA 3KX2A 1TU3A 4C3ZA 4EQ6A 1EGAA 1E1RD 4HB4A 2WWGA 3QF7A 1W44A 4JLOA 4LYHA 5K8TA 5TDHA 1Z07A 4TL7A 1FOEB 2Y8EA 4G1UC 3N5CA 4DVGA 1COWD 4OK6A 5FUVA 4D4JA 4QM6A 1GKIA 3WBJA 2CXXA 3F3YA 4LJAA 3ASZA 3QSYA 3A6PC 5L3SA 1G7CA 4M1WA 1U98A 1A1VA 2JLRA 5G41A 3QQ5A 1NN0A 4WZ6A 1DARA 2QAGB 4A2WA 2BBTA 3QBVA 4B2IA 5JSZB 2WZQA 2OE2A 2W0SA 1LS6A 4HLUA 2J0QA 3AVTA 3Q7QA 1G7RA 4MH0R 2QPTA 3K0FB 1GKYA 4HUQA 1OYYA 4EFNA 1JAIA 1XTIA 3U44B 3BB1A 1R4AA 1RVDA 4DUGA 1E9AA 1OW3B 4JVSB 2YWEA 4TTQA 1KMHA 2A2ZA 2F43A 3CONA 4BQSA 3KQKA 1NBME 5L8VA 1GP2A 3DMDA 1WF3A 3THYB 1QHNA 2ZQ5A 5C18A 1U99A 4C0LA 1RZ3A 2QPAA 3RLFA 1QHSA 2VHJA 2HT6A 3C15C 1T5IA 3GEIA 1MV5A 4LGMA 1AA9A 4PQFA 3HU1A 1FUKA 3GJXC 4FCWA 2QU8A 4MGZR 4KSBA 3CX6A 2BMFA 2DWOA 2DYKA 2PJZA 3W8NA 1MO3A 4JSTA 5FUXA 1U0LA 1XP8A 4H9GA 3LY5A 1Z6GA 2YOGA 4HAWA 4MRNA 1AZTA 4KYUA 3B8HA 4BFSA 1EFHA 621PA 3N70A 1D2EA 2W00A 4QOSA 2GF9A 4PC1A 3SN6A 2EW1A 1W2HA 5LD2C 4A6PA 3K0FA 3IILA 3KZ1E 5E4FA 3P20A 5TV2A 1NLYA 4BFXA 4EPTA 2NO6A 1E2QA 3CZPA 5BQ5A 2RKOA 2ZRNA 3U44A 4PZLA 4OYHA 3SYLA 4WA7A 2WKRA 3EZ9A 4KVGA 4TMVA 2H57A 1E2PA 5TARA 4C0JA 2IX3A 3GQBA 2UVQA 1VHTA 4FMBB 2A5FA 3VKHA 3V00A 2GDJA 2ZI9A 3PCRB 3QIAA 3K09C 2FWRA 2CCGA 3GLHA 3T1TA 1VCMA 2V8OA 2PZGA 1UKYA 3QG1A 4D4MA 1Z0IA 2BCJQ 4A0HA 1TQ6A 4FIDA 5SZIA 1OXVA 4I1VA 1P6XA 4Z8YA 3LX8A 3BB4A 3IEVA 1EX6A 1EWRA 3AKDA 3NKVA 1KJYA 2DFNA 2OCYC 3VFDA 2V6JA 3TE6A 1CF4A 2D3WA 4LJ8A 2ASEA 1CR4A 2HLDA 4GDFA 1QHIA 3K53A 4A15A 5CITA 3PXGA 3UWKA 1E79A 2OAP1 5HKKA 3IIMA 4LZZA 4M9XA 2RGGA 4QGAA 1DPFA 1GILA 4GZLA 3L2OB 3PV0A 1GWNA 1VCIA 2JAQA 4DIEA 1Z63A 4RD0A 2NO9A 3PEVA 2AFHE 2CNWD 2J0UA 2WBLC 2VH5R 2PZFA 4KU4A 2C9CA 1NKSA 1WBBA 3BGWA 4W7SA 4C0BA 2BV3A 3M0EA 4W5HA 3E1SA 4B44A 3LV8A 1AGPA 3DOFA 3OIWA 4KCGA 4M1OA 5FUWA 4KLZA 2A5YB 4DDUA 1L7VC 1O87A 4OBEA 1J99A 1ETUA 3AGPA 1E96A 3QG5A 4DBLC 1Z47A 3FHOA 2G1KA 4PC7A 5KNBA 4LJYA 1W7AA 1EG7A 1W0JA 2VP0A 2XNSA 2VLIA 2WOJA 5FOUA 1S3SA 2IL1A 1PV4A 4YQFA 3X2SA 3VR5A 1F6BA 2IS4A 1U90A 4DSNA 1W36C 3EIEA 4TLEA 5EXXA 3I92A 1PVOA 4C0HA 4AKIA 4LPKA 2EWVA 3ZVMA 3PUWA 2YINC 1J90A 4IW3B 5FTKA 3SYKA 2BM1A 2ORVA 1RPZA 4G3XA 2OEPA 3WMEA 5DNYB 1DBSA 1M7BA 3BE4A 4NE2A 3HR8A 1SXJA 3MD0A 1E2KA 4O2RA 4DB4A 2B7CA 4LC0A 3O8BA 1DOAA 4EPRA 2JJ1A 1WB9A 4I4LA 1MO6A 3B9PA 4UXIA 1XEXB 2EFCB 4L8GA 1P3JA 4L4UA 4A1FA 3CH4B 2FU5C 2VL7A 4PO8A 1TADA 2OBNA 3QXXA 1XTKA 3M4YA 5AUNB 2RHDA 1GAJA 1UDWA 4V0MA 3KL4A 2YOFA 1KI3A 4L15A 3RHFA 4HATA 2CCKA 1P2TA 3MLEA 2DFKB 1ELOA 2XNDA 1P5ZB 4ZDWA 4JMPA 5CYPA 4KVAA 4HAUA 1CTQA 1KO7A 3WXMA 5DE3A 4NYMR 1OJLA 2BEKA 1YZQA 4BWYA 3T1OA 3LBHA 3AVWA 1SVOA 1E4YA 3MWKA 1CU1A 4TLCA 4NYIQ 2KBEA 1OH8A 3CPEA 1PJRA 3QPWA 1ZCBA 2Z5FA 1JPJA 1Q57A 4UNNA 4US0R 4Q18A 4KBGA 1RRFA 3R9IA 5J4YA 3GPLA 5GJBA 2OCAA 1PLKA 1XJQA 2R8RA 2BIFA 1SKYB 4TQAA 3OE7D 4I1UA 4C2UA 3AH8A 2JEOA 1TAGA 3BOSA 5CJ2A 1XEXA 2WKQA 4JLBA 3QXSA 2X77A 5EP4A 1OPXA 2RGNA 1N2CE 1Z2AA 1X8KA 1JR6A 4NPHA 2DFTA 5JCPA 5J4VA 3EAQA 4ZCMA 1L2TA 4YDHB 4HLQB 4N1AA 2ORWA 1KI6B 4QJ5A 1H8HA 2WAYA 4PX9A 4UNQA 3DVLA 1KI9A 4MUBA 4GL2A 1QZXA 4B2PA 3IQWA 4PAOA 2NPFA 5KNCA 4JYCA 4F92B 2QGNA 3FWYA 4B48A 2O0KA 4HLDA 2VHUA 4LYAA 3LVRE 3PENA 3UMSA 4M1YA 4S2EA 3W3ZB 1Y3AA 4AG5A 3U3OA 1P9RA 3RWOA 2G6BA 1HE8B 1MO4A 4LBWA 4C0KA 2F1HA 3FPAA 3DDCA 4Q01A 3UG7A 2F3TA 1S8FA 1UKVY 3RABA 4CIDA 4F7WA 3OAAA 1G4UR 3CRRA 1NMZA 3BB3A 4M2LA 3THXA 2EFDB 5CLQA 1G5TA 1IY1A 4C0QC 2REOA 3P4YA 2GA8A 1DELA 4D80A 4DKXA 3DM9B 5B57C 2HV8A 4EJSC 2AK2A 2PX3A 1KIMA 1Q1EA 2QROA 4A2PA 2Q0HA 2V55B 5KSYA 1UDXA 2V1UA 1Z0KA 2YYZA 3LW8A 3PUYA 3R20A 4Z1MD 5JHHB 2PZEA 1XD8A 5JWRA 2BJWA 3CR7A 1HQYE 4RVCA 1JNYA 2GJSA 3VAAA 1WP9A 1GFIA 2WAXA 3ZLJA 4M8NE 2FE4A 5E7IA 1Z3IX 2GZAA 1G9XA 2ZAMA 4EPYA 2FGKA 1NJGA 1XDBA 2FOLA 1W46A 4C2TA 1P75A 1KSGA 4BZPA 1CJMA 1VCNA 4DLYA 1OIVA 3U6KA 1NIJA 2EYUA 2GJ8A 2AD5A 2J45A 2X8AA 3W6OA 4M4SA 4LJ5A 2B8WA 1RRPA 2OBMA 5KDOA 2ZI5A 2W2VA 1KZ7B 3QKTA 5J40A 1XJ0A 2GAAA 1CRPA 1Z2CA 2P6RA 3FMFA 1GRQA 5HR5A 2WJGA 3CRVA 5KHOC 2FG5A 5BYKA 1BS1A 1Q1ZA 1S96A 1Q1BA 1FMJA 1OHHD 2JLXA 2F1RA 2ERXA 1FFHA 2UKDA 3T1VA 3B13B 3AVQA 4RSGA 4CVNA 1H8ED 5IK2A 4QHYA 1UBFA 2C95A 1O3YA 1GL9B 2CVHA 1TF5A 2BBOA 2PMDA 1RIFA 1U2RA 3MUFA 3FTQA 2W2TA 1G291 2ECKA 5EE3A 1QG2A 4NONA 3F8TA 4G5OA 3QBTA 1JJVA 2Q9CA 1OE0A 5HPYB 2VBCA 1KKMA 3KQLA 1RRGA 2IYYA 5D3QA 2XOKA 4FWIB 1M2OB 3ZIAA 4PHFA 1OH7A 5AJXA 3AF1A 1DAEA 3UKDA 2QAGC 3CWZA 1E2GA 3FKSD 4Q00A 2BMEA 3OF5A 2ZRDA 3ZGXA 1GIAA 1S1MA 1E2JA 2O0JA 1GOTA 3EASA 4P33A 2A5GA 4HYYA 4QNRA 8OHMA 5JEEA 2LKCA 2ODBA 5M04A 1NIPA 1TF2A 3W3AA 3BD9A 3U7EB 3BS4A 4GNKA 1GDDA 4IFEA 1VECA 3AVVA 1D8TA 4FMCB 2HJGA 5G3ZA 2A7QA 2N42A 3A4NA 3E5HA 5CK5A 2ATXA 1ZM9A 4GOXA 4GRAA 3VKWA 2LWIA 2QRZA 3GLHE 1X1RA 3H0KA 5KPDA 2OFWA 5CK4A 3IIJA 1NSFA 3N2EA 4Y0VA 3PEWA 1ZM2A 5EXSA 4DSUA 3ZD7A 5AK0A 2O0HA 1L8QA 1AKEA 1KSHA 2CK3A 1TEVA 4URZR 3OEHA 4GMXA 4BASA 2G0TA 4XWOA 1GL7A 2UZIR 1EFRD 2XTNA 3U7HB 3CX8A 4KYIB 1UPTA 1UBEA 3Q72A 3SNHA 1YQTA 3ZQ6A 2IS1A 5J4KA 2V3CC 1XFAA 4PFSA 3WNBA 2WM9B 1BMFD 1N5LA 4MUAA 5EE9A 1LTQA 2XSZD 1W49A 1G6OA 2FPMA 5CB8A 4JZKA 1GSIA 5FTLA 4YONB 4DB2A 1RJ9B 4OQNA 3TJZA 3IGFA 1XMVA 4XJXA 4BFUA 1KJWA 4A0FA 2V9PA 3EA5A 1IN5A 3L8YA 2ZYTX 1XJCA 2PLRA 4ZI2A 4Q7LA 3LD9A 4A6XA 3J81k 1ZNZA 4UQOA 1GG2A 4Q1DA 4JL6A 2FFAA 3EWSA 3KXIA 5H70A 2P3SA 5AJYA 4PSVA 3ZVNA 4DLTA 1NRJB 1AIPA 4B33A 5FBVB 4IDHA 4R7ZA 1SHZA 3GJ3A 5F2EA 5H8WA 3PVSA 1J8YF 2J5XA 2JLSA 1T3SA 1OKKA 3AVPA 1KZGB 3RANA 5A5GA 4CGZA 1E3MA 2PJRA 1R0XA 2YC2C 2ZYUX 4DCVA 1W0KA 3A37A 3QEOA 4TSFD 1T0HB 3GLFB 3U7GA 4AKGA 1K5DA 5GVRA 3PFIA 3KDSE 1IN8A 4WZBE 4Q5IA 1BO6A 4X8HA 5H1YA 3TIFA 1XU4A 4Q4JB 4KJZA 4W9MC 3U6BA 2RAPA 2B7BA 4B32A
chains in the Genus database with same CATH superfamily
2PL9A 1Z62A 1Z0FA 4XVQA 2DE0X 4IQGA 3CH5A 1CXZA 4BGVA 1IIRA 1I7DA 4MICA 3EXIB 3KKLA 4DRXB 1I2MA 1ULAA 2ZYRA 3H2SA 1CP2A 1SXJE 4GIBA 3LQFA 4I3HA 3U0BA 4JVOA 1UT5A 1YVEI 3KR0A 1TA9A 5DYYA 2VJDA 1SXJC 1AUXA 1DAHA 5JLJA 3NG1A 1L6RA 1L5VA 4OB6A 2KPOA 4PZ0A 2Y05A 2X14A 3COYA 3K6KA 3D6HA 5GJVC 2V97A 5B1SA 1K3FA 4BVGA 3GLQA 2WWIA 1ZZEA 3G0GA 5B12A 5KKAA 4OQYA 2HT1A 5CD9A 4EK9A 3HRHA 4WZAB 3HM9A 4RUKA 4K05A 3KJIA 2H18A 4ZMRA 5FBRB 1F1JA 4LOAA 2YWFA 4KGZA 4NU8X 5MHTA 4KQ1A 4V0ME 4BNYA 3U26A 1N2BA 4ZFNA 1YC5A 3F6BX 5F1YA 3LRXA 3O21A 3IVGA 3FVWA 3R3HA 4Z9AA 5K0TA 2IBTA 3P71T 4U3JA 2AG0A 3KB1A 3NU1A 2QAIA 4WOKA 1PLJA 2O4UX 1GAEO 3TTSA 4J1TA 4RLFA 4AZTA 4BZZA 2VAVA 3CJQA 4OKIA 4EUNA 1JWAB 3PDIA 1YJ8A 3T6KA 2H0AA 3WWYA 4N0DA 1EBBA 3C7CB 5KQRA 3R9XB 3ZHTA 4WTOA 1BG6A 1Z6QA 5G53C 1RKUA 3D3NA 3FZGA 1A1SA 3SGLA 3M5DA 3UIEA 3GEGA 3H75A 4L8YA 2V59A 4Z0TA 5G0TA 3TDKA 1YS6A 3BMNB 3DTVA 2P2GA 3KPWA 1NBMD 4QVGA 2JIZD 2RGXA 3B8EA 3OEED 1CEXA 1FXWF 1DBWA 4P1ZA 4UXJA 2JGFA 2QLTA 3RYHA 4XRGA 2Z8XA 3JQ6A 1DTWB 2H06A 5KWJA 4B4VA 4RA6B 5JZOA 3GFGA 4JOCA 4Y1RA 5CHYA 4Q1EA 4V2IA 5K8LA 1LEHA 1L7AA 5ITSA 3NO4A 1RHUA 2WFZA 4BMOB 1Q17A 3FTCA 4CR7A 2P62A 3GJZA 2AN3A 5KOJB 4LSWA 4MW7A 4P86A 1ITZA 1MRSA 5IKPA 1ZGZA 4MRMA 3W9SA 3R7AA 1IK6A 1DAGA 3Q7PA 5T41A 2C96A 3OPQA 4HZUA 4PM4A 1QYDA 4ZZ1A 4U2BA 1HK7A 4F86A 2BHTA 1IUPA 5AHRA 1VHDA 3GGJA 4KLCA 2QK4A 3WQSB 2OBLA 1GSHA 4KNWA 4LF8B 4EQ6B 3L7DA 4WOJA 4XWAA 4WPGA 5FPSA 4ZKDA 4OMFG 2PXAA 3OJOA 3UF0A 3BEDA 1Z9BA 2IW3A 3RSSA 1G0OA 2MR6A 2PVCA 3EZFA 4L07A 3T15A 3MW8A 3WIBA 5DM60 4BWGA 1FW6A 1IUNA 1WUTA 4MHOA 4EKYA 3GK3A 3NAQA 3MC1A 5DN6A 2KHZA 3HY6A 3JQ8B 1XPUA 3MMSA 4DHEA 1F4PA 2X0RA 5HZHA 1PFWA 4IYRA 1PQWA 3JZAA 3ABSB 3FMPB 4TLAA 1FTQA 4GPZA 2OK8A 3NBYC 3WGUA 2F8TA 2OV2A 2XGGA 3E9QA 5DT2A 5FTMA 3TM4A 5BXYA 2Z6UA 1PGNA 2O8BB 4QQRA 2NZ2A 1SRQA 1QQTA 4RHCA 5F73A 3VC3A 2X4GA 3MGGA 1QOQB 3U4AA 5EE0A 3A6KA 2XMCA 3PT5A 3WNCA 1T4GA 3RYTC 3EIQA 4YVFA 1LSJA 4CKBA 1JEJA 2CJWA 2PZBA 3EK2A 5IJZA 4YIKA 5A9SB 2HBZA 1PQUA 1VE7A 2YMLA 4J3JA 1FUEA 3ZR4B 2NPIA 3FUUA 1D2MA 4WESB 1JEOA 3UCFA 4KR3A 3MBKA 3N3AC 2IE0A 3MILA 4LJRA 4TZ0A 5BNFA 3T3HA 1HDGO 4S12A 5F35A 2XMBA 1SC3A 1Y9JA 2H4YA 2IT1A 3G79A 4W8GA 4MRAA 5E3IA 4N41A 1TK2A 1UF9A 2C03A 3CSDA 4V0QA 5GM1A 2C2YA 1B76A 1VGVA 3M2PA 5HZKA 1UIRA 1TC2A 3DEZA 3TL6A 2NUBA 4F04A 4HNTA 2PKEA 3DYVA 3SJ7A 3QENA 3ZWMA 4YJ2F 2BEJA 1BS2A 1Z4QA 2WPDA 3X1ZA 3D0KA 2J0SA 2FN4A 1DHTA 2B92A 2J9ZB 4FHCA 4AJIA 3D2LA 4B35A 4WLUA 2RKBA 4LHWA 3DXYA 1X1CA 4GLLA 2PX8A 3IOYA 2X5NA 4FKBA 4KZKA 2P9ZA 5C5EA 3FGZA 3VR6A 2H1CA 1H2HA 1MJ5A 3GO4A 4BP1A 4DQVA 2QL6A 1YE5A 4DDKA 2O3RA 4RTPA 3NWJA 3VTZA 4DNPA 5JZBA 4FB5A 5CX1B 5KREA 1QB8A 1SAYA 1KI8A 2Q1TA 4ESOA 2GKOA 4NENA 2E4YA 2J59A 1P1CA 4EGCB 2LUOA 3V2UA 3A0UA 4QEDA 3LXRA 1G0NA 4RQBA 5A7HA 1GZ5A 4JVMA 1N8SA 4FILA 2X1MA 2CZGA 4O4HF 1EM8A 1OFUX 3HZOA 4CE6A 1CJTC 2RHWA 3V8EA 2Z09A 4HP8A 1UBMS 2O14A 3N2IA 4ARZA 1ONSA 1QHFA 2AI3A 3JD0A 4BNTA 3OFJA 4GZ5A 1W36D 2RI6A 4HB0A 4PLVA 4PC3A 2HA4A 4FFLA 3S44A 4EB3A 4A03A 4TRNA 1RXYA 2A8YA 3GOQA 1YA8A 3KCQA 1Q15A 1FLNA 1VL2A 2GBLC 1GA6A 3ELWA 1JSXA 2A5DA 2IYRA 3MJRA 4U2FA 5IKEA 4JKIA 3I05A 2FUNB 4ZU3A 5JAHA 5H3HA 3U9LA 2AL7A 1XROA 1W47A 2OORC 4KR2A 1K4KA 1XZIA 5F76A 5A2QA 4DDWA 5JRJA 5IZCA 2R4QA 4RLQA 1CHNA 1SULA 1RW4A 3D4BA 3NTRA 1ODTC 4Z9FA 2EGHA 5HEKA 3ZY5A 1VRWA 3RGGA 3U4QA 2C88A 4IFIA 3NOOA 1X7GA 5C35A 2CXUA 2G09A 3KWJA 4L08A 1DZIA 5FD8A 1F0PA 1Z06A 2VHCA 3LOUA 1GLVA 1EFLA 3NVDA 5EP2A 4B09A 1MAVA 4HQ0A 4KIUA 5CEJA 2MSCB 2WQ6A 1BD4A 1CRWG 1ORIA 1JG2A 3MG9A 4P81A 4WEOA 4IVRA 2UVPB 3N1UA 4BOYA 1IATA 4MR7B 5BT9A 2H08A 3FHJA 3EZLA 2VWHA 1JW9B 2JFOA 5C4IA 1M1YA 1KE1A 5JD4A 1PD1A 4HDNB 2J0UB 2EBHX 3S2GA 1Y1LA 1U28A 4OYLA 1JFFB 5AW0A 5FYQA 2XV1A 1H65A 3QFTA 3L8EA 1BH6A 3R41A 2HYIC 4X44A 4ZPJA 3HBLA 4BX3A 5AIAA 5AVYA 3FVVA 4MHTA 3HJCA 1JI0A 1HTWA 1OZ0A 3UY4A 4LV5B 2UUCB 5AICA 3KC2A 4PZPA 2EFHB 3MJHA 2IHUA 3L1JA 4UAGA 5E1DA 1HH4A 2GD0A 5FO0A 5SZJA 3RE1A 1PJ3A 3WRXA 3L0OA 3MB8A 1J00A 5FUBA 2IUYA 3CX7A 3OLZA 4EY5A 2IOFK 2NVOA 2AQ8A 2XT0A 3L46A 4XOIA 4C4XA 1BDHA 2OFPA 1FRVA 5KX5A 5L95A 1IVNA 5L3VA 3UH0A 5FUMA 1SN7A 4JBNA 4DMGA 3KYCB 2SICE 1B41A 4B4WA 1PHPA 1RAHA 5IM4F 1N34B 1E0KA 1PSZA 2ABWA 4LXGA 2RHLA 4J9UE 4N6NA 4G5QA 2LRHA 5BO5A 3ZE7A 1NL3A 3UT0A 2FLWA 4JL5A 3KCNA 3DMGA 1TM5E 5DCWA 3RAGA 4UEKA 5CTAA 1VHQA 3T0IA 1ZKDA 4Z5XA 5BPFA 2XUIA 2BKVA 2VZ9A 2PUTA 1UMCA 3WLSA 3PYMA 4C3OB 1MDFA 3A1FA 3CNBA 1IBCA 4YHHB 1YS1X 4AJ9A 4D4IA 5D6OA 3PXBA 1DMSA 2OCGA 4BQOA 1GITA 3EF1A 5C46F 4IIUA 1EQ2A 3B7GA 3QVGB 1RXWA 4KAXA 3SVZA 3MIIA 4GC5A 3ENZA 2R87A 4MVJE 3TTUA 2JAUA 3Q15C 2ES4A 3VTKA 4BO0A 4E4TA 3VZDA 1MX9A 3DTYA 2O8EB 1EUCA 1RI2A 5CDFA 2Z5LA 1N5IA 3LX5A 3Q2OA 1ZLYA 4BAZA 1IOWA 1M83A 2XQKA 1OVMA 2YRWA 1GTVA 1U2GC 3QELA 4X6XA 4D25A 2YHIA 3DDWA 1VA5A 1LJ8A 5K2MA 2BUCA 3S2SA 3T3MB 3WHKA 4ODIA 3V7WA 3WGMA 4XJTA 3BIWA 3DNPA 2C2BA 4K2AA 3PSHA 4FDMA 1OZFA 4LWPA 3SSNA 1F2TA 4IFBA 1SCUA 5DCLA 1UKAA 1MQSA 4D4GA 4DEYA 2ID4A 1M34E 3U2QA 3DAFA 1TUBA 1A9PA 1GGFA 2BHNA 2VPPA 4G65A 3KJZA 1P9OA 3P97A 4DV1B 4CQMB 1FP6A 4XA8A 4W8OA 2EV9A 4NKRA 1FQJA 1Q12A 4KLRA 1WXWA 1HMPA 1E3DA 2R6DA 4BGDA 3DDNA 3R2JA 3UUFA 4DYHA 1TEZA 2XMDA 1WUHS 4I5FA 2O8DA 3UYKA 1N6PA 1YKGA 2DBRA 3L4BC 3OJ0A 4GLJA 1ULZA 2JIBA 1LVGA 2GN8A 3DB2A 3K9QO 1VJ5A 2QUZA 1JQAA 2GWRA 3JYOA 3G0IA 3PWZA 2CDBA 3Q0TA 3FMVA 1OYWA 3CW8X 1RAIA 1UJ4A 4GQIA 1SD5A 4CDNA 4OJKA 2I6TA 3UICA 5C7YA 4WV3A 5G4KA 1C9KA 4AS1A 3SQOA 3K0KA 3TTYA 1E1YA 2BFNA 2CV0A 1BIFA 1HYGA 4I5EA 4ZOBA 1JDVA 4FFBA 3T7KA 2HJRA 1LSSA 1WPGA 4DEVA 2Z4SA 1CB7A 2BUAA 1UZNA 2Q21A 2Y0BA 3HN2A 1QANA 4CPDA 3D7LA 2VSYA 2C58A 3D6TB 2QV7A 2P77A 1MIOA 4BUJA 4EW3A 5C80A 4LK2A 3W1VA 2ZBDA 4WVLA 4D5GA 2ONCA 1OZHA 2JHAA 4UMFA 1OXUA 2VSFA 4POOA 4GEKA 1KHTA 2E48A 1NNSA 2PDAA 5ICFA 5CD1A 3ZNPA 1JH8A 3RC2A 4UBOA 4B31A 1FVOA 5KSWB 2C57A 4O6VA 4U00A 4G9BA 4OXNA 3RRJA 5TXGA 3DXXA 3HFSA 3ZW9A 1EZ1A 1Z2PX 2D4AA 4WGGA 3IMGA 2OGSA 1ZH6A 4WMLA 4P93A 2ZSBA 2CFRA 2KBFA 4ZOEA 1WCWA 4RJTA 3VPDA 3ADPA 1KDTA 4FMDF 2OPBA 5H02A 1U9ZA 4BAGA 2JIQA 3AFMA 3IDQA 3CBGA 4DCCA 1AE1A 3FTEA 2FCRA 1E3EA 4CF5A 4PLYA 3PNMA 4LJLA 3KPUA 3L6CA 5FAKA 1FTNA 3HK2A 2ZPTX 3KDPA 5FEMA 1DAMA 2P5YA 2C3MA 2ECPA 3PFHA 1ODCA 2R79A 5L7WA 1CUDA 1FPMA 4HGOA 4AO7A 5G02A 4B8WA 5IJWA 1NW8A 3BD6A 3CF0A 4LK3A 5AKKA 1M2KA 3URMA 1Z2NX 3TJMA 4WBSA 2GGSA 2IYTA 1Y8QA 4UM8B 2OXTA 4MS4B 5DHUA 5IYZF 4ZKEA 3K1TA 5JI3E 1NRWA 1NVXQ 2OHVA 1EKXA 4I4NA 4UHBA 4EYGA 2ZXUA 3CWCA 2PYDA 3EX7C 3E7FA 2BGJA 3N2GA 3W5CA 3D6VA 1VE5A 3SY8A 3USES 1LQ2A 2NUTB 2IHYA 2XKAA 1P5JA 2CLLB 5EZ5A 2BOVA 3T1NA 1LDMA 4RHEA 4DXHA 3DBVO 3DGEC 3L7LA 2VJAA 5B37A 1YK0A 2OO5A 3RYFA 2I66A 4W9NA 1EUZA 5F64A 5F3RA 4CBVA 5HA5A 3O93A 1YUBA 4B8YA 4NJOA 4GKVA 3MT7A 1HKHA 121PA 3OX3A 4JAVC 1C41A 4MVJI 1PL6A 2O7VA 2WQ7A 4UOQA 4B3HA 3NC0C 4RGYA 5K0LA 3TG2A 1JA0A 2AEJA 5ES3A 1CNEA 2WYHA 3MJFA 4LNUB 4XVRA 1JIVA 4M53A 4J4BA 1E3WA 4LXIA 4WK2B 1QCZA 1DKOA 3NBZC 3GN2A 4X0EA 1HT3A 1EK2A 2ZIAA 1XZHA 2PH1A 2QMUA 3ZTWA 1X14A 3EOAI 2B7LA 1QV7A 3SZOA 1MGPA 5AVSA 1C29B 5FWXB 2BMAA 5CM2Z 5E4JA 1OY1A 1L5WA 1T8WA 4F9GA 4Z51A 2XUFA 4MCJA 5IJ0B 1ECPA 1WCIA 2IPLA 3N8KA 3RAEC 3NR2A 1QQ5A 3CKKA 3AGQA 2XVYA 3C5CA 1RQPA 2EIHA 3CLVA 1MQ9A 2DLCX 4U7JA 5CURA 1GTL1 1XZBA 3EISA 3O84A 3WIVA 2JLQA 1I7QB 2YIVX 3UB3A 3WKAA 1FDVA 4CT5A 3ZGLA 3RTCA 3DF7A 1U31A 2G5CA 2Z57A 5EJ2A 3ZDRA 4BGEA 5DBOA 4YR7A 1XJWA 4IMIB 4G67A 4MJ7A 4A8JB 4E6PA 2J08A 3U37A 4DAEA 2GOYA 2B61A 3F46A 5CH3A 1D5WA 3G8CA 3NPMA 4LJ6A 3UAOA 4CIXA 2FX3A 3T35A 5C3UA 1P29A 2PS1A 1C3OB 3OQBA 4HNAB 1OFIA 1KBQA 2OBYA 2Y3IA 2ZJ1A 1WXXA 4MP6A 2PRIA 4QYXA 5AP9A 1S9HA 4UD6A 1ISHA 1V45E 3CT6A 1SUPA 2J4DA 1N6HA 1K6EA 3ZXUB 1WZIA 4IGIA 2DF8A 4AB1A 5HUQA 2VPIA 4DMCA 3FB4A 1Q1QA 2H4JA 3ZQJA 5EKXA 1BFKA 4HX2A 4EYOA 2H5JA 5DTJA 3GT0A 5ICEA 4ZV7A 4V24A 1W581 2VDNB 3WY9A 1J0DA 1E0JA 2QL5A 2D1FA 2OV4A 2P1ZA 3I04A 4W4TA 4PC2A 4TLDA 2YV3A 3TOXA 1RWVA 2VCHA 4M9QA 1D1TA 4BMSA 4INZA 3N75A 3Q7SA 1FUUA 1SXJD 1H2YA 3K70C 2HDWA 5IYZA 3VNBA 3L05A 3HH8A 1TK9A 2QLMA 3L1IA 1T6ZA 2B69A 4HDMB 3GRKA 1X7HA 3UBTA 1PUXA 3UJ3X 2FFBA 2LNDA 3LO5A 1RC8A 3JZIA 1MOZA 2NZWA 3HO6A 3O8OA 1ZK2A 3B5IA 3NIDB 2VP3A 3VZRA 3UAZA 4OTZA 1CF9A 3PEUA 4LF7B 4KE7A 3IV9A 3K0AA 3ABZA 1NVAA 3WB9A 4Q3NA 4BB6A 1JBEA 2YHUA 4B81A 1JKJA 4YT4A 3WX0A 3SSOA 1UC8A 1O0BA 4YAEA 5HIAA 2PSHA 3Q87B 1LW6E 4BLTA 4JGIA 3ZLVA 2EZ8A 2IYZA 1DO8A 3DLHA 4QDKA 1TB4A 1TU0A 2FHPA 3CB2A 3IVRA 3QVXA 2WJVA 4MI3A 1E0SA 1UFQA 3CEJA 4M99A 3VV3A 1NUUA 2ECOA 3NANA 2IOFA 4NYJQ 2AJTA 3KIPA 2HXYA 4IINA 5GIOE 2CKMA 5JCXA 3QIVA 2JIRA 1Q2XA 1I3NA 3BH0A 1U0SY 1TZMA 4NCXA 1A5TA 1G16A 3DTTA 1E4VA 3H17A 5E1OA 2VRBA 1S2MA 2ZRPA 4ABYA 5FA6A 1N5RA 2FF7A 3RVQA 2UUBB 1PQ4A 1WEKA 2BFOA 4I1OA 1ZJYA 5AM1A 5CB0A 1QAQA 2XCQA 3P27A 5K0GA 3W1EA 2D7JA 3EDYA 2IWHA 5B1IA 2FPLA 3PT9A 3PNSA 2JFQA 4D8TA 1J0XO 3A4LA 3B12A 1P60A 2A1TS 3NBAA 4JLAA 3JZDA 4ZJZA 2J0EA 5K0ZA 1NJ2A 1P61B 5AI9A 1SQGA 4D4LA 2DUWA 2TRSB 1ILWA 4F21A 2PPLA 4IHKA 2ON6A 2M2IA 4OB7A 1DG1G 4R1OA 4WASA 1VIVA 2YFHA 1U2QA 4ARBA 6NULA 1SKQA 2IZ0A 3AIOA 1E2IA 3I0NA 4HPWA 4R51A 5FTNA 3IDOA 2A33A 3O47A 3L7NA 4TX1A 2CVOA 2A84A 1ZD8A 4P4NA 3SQNA 3M9XA 4YAGA 4Y6QA 3BDAA 3CZ4A 1JJFA 1YU6A 3PC8C 4TZKA 5BP7A 5ES4B 3KM0A 1P5FA 4MV1A 2DM6A 1QK3A 5COQA 4C0WA 4C0AC 5A4FS 1OZAA 2AH5A 4O4IA 3SS8A 3HE3A 1LFDB 2G4VA 3PKIA 2QLBA 3TSAA 5B3AA 3OLWA 5ITZA 4PR3A 1JV2B 1BOOA 1IN7A 3K8ZA 4TXLA 4WDRA 1TVCA 4S2UA 3RJTA 5DT9A 4B71A 1JHXA 4MQBA 1W34A 5C0OE 1RCUA 1M8GA 4NYIR 4AULA 2R9VA 2XE4A 4JJ4A 1P74A 4HJRA 3WDSA 3GRRA 2QD4A 2EKDA 3H5NA 1PR6A 5K3OA 2AN9A 2CHGA 2GD6A 4L16A 1P1RA 4UDXX 5MDHA 2OK7A 1VM6A 4I4TB 4U2KA 3CNNA 2OXIA 5D8DA 3RJZA 3ZOZA 4CV3A 3PA6A 3KS9A 1G9TA 5AK3A 1MPXA 4MQFB 5IT5A 3EBOA 4QO8A 3ETEA 3GMIA 5TF4A 2ONYA 1S9DA 1FFYA 3TD2A 4DR3B 4JT4A 3B52X 1Y81A 1JWLA 1R5NA 4B6FA 1MB9A 4LYJA 4KP7A 4CMEC 2GKSA 1DC3A 1LUAA 2JJMA 3MPOA 1OQAA 2OHHA 2I9PA 3C6XA 2DQZA 4YRTA 5COBA 3SBOA 1Q7GA 4LOHA 2HDHA 1F8GA 3CF2A 1KOLA 1X80B 3EZNA 3FFXA 2JI4A 3EULA 4DLVA 1JPUA 2BONA 1NP7A 3OQ1A 3PE4A 1S01A 5JLAA 1WSAA 4TM8A 1U02A 5LWQA 4JC4A 3S55A 1NMEA 4MMZB 1N1GA 1Q6ZA 2XUJA 3HJTA 1Z6TA 3K0EA 4KQMA 2H31A 3I2FA 5ENZA 2F8LA 3GMSA 4HJXA 2QS9A 4RFLA 3IVCA 5FV4A 3AVYA 1PTJA 4AZWA 5J2UB 1MX5A 2VKTA 3C6MA 3DAOA 2P90A 4HXFB 4P3YA 4Q66C 4WEQA 3HXKA 5HCNA 2XKKA 4ACAA 3REGA 4EI8A 3A28A 3AL0C 1UDRA 1G5QA 1XCMA 5DSZA 1PT8A 2GDZA 3IOMA 4JIGA 4ZK2A 5JVDF 4K26A 1N6OA 3TO5A 1WV0A 3G9UA 1U5BA 4X20A 1S8OA 1H4SA 3T8YA 3TOVA 3MWJA 1U2PA 1NVWQ 2WG2A 4QOFA 5AJVB 3QEKA 2N46A 3CTMA 4OPMA 4KVFA 2J5QA 4K87A 1PS0A 3I5XA 3OT1B 1P6UA 1NURA 1BDIA 4JYZA 2YVAA 3EGVA 4QULA 1LDBA 2C5HA 1UFVA 3OFND 4HDRA 1D9ZA 3CISA 4FN4A 4IWNA 2KYRA 1FFXA 1XZFA 3IAM1 1JSLA 2F9FA 3QV2A 1FW8A 4MEBA 3ZKWA 3V2IA 3Q41A 4RD3A 4U02A 3FUWA 3VHQA 3M5CA 2IZZA 1C1XB 3SJUA 3TXAA 1EEXB 1Z18A 1JR3E 2H7YA 5MN5A 2J41A 3GJQA 4LBYA 4JA0A 3V4SA 2MSWA 4I66A 3H5TA 4E88A 4EW6A 2VPWA 1WDWB 2Z2ZA 2FPIB 2AOWA 4MZXA 4PSCA 1O8CA 3P52A 3RS7A 3ANLA 3B6IA 3N28A 1J09A 3ESRA 4C4YA 1JXMA 4ETNA 1OBVA 4J03A 4JQSA 3TMKA 5BOSB 3NIWA 2ACKA 2OB1A 4IV5A 4WKPA 4AY5A 2DX7A 5C51B 4L3WA 4KIJA 4Z4FA 4DLUA 1CUBA 4B2LA 1J9EA 2PWPA 5SICE 2HBQA 1NG1A 1EDDA 2H8GA 4OQPA 4YJHA 3VR0A 4ALMA 4EF6A 3V3KA 1DJMA 3LUJA 4DPLA 4HGZA 2Z6VA 6LDHA 4DR2B 1O5TA 1XLTA 3ETGA 3EG5A 2ZJ5A 3E9DA 4LCBA 5FR2A 2V5AA 3QU9A 3GZNB 2HU8A 3MS7A 4RV9A 4EKIA 1KH3A 2VT2A 3U62A 3I62A 4KXWA 1Y8RA 3PQFA 2C92A 4PCLA 1WULS 2YZGA 4QRHA 3ZQ4A 2C4HA 2HMAA 3IP3A 3O1HB 1T43A 4UBIA 3E18A 5F78A 2IUUA 3LHDA 3A9RA 4EAAA 2MMGA 2WFLB 3RRNA 2CNNA 2FLKA 4I0WB 3O4VA 1M6WA 2WJAA 1E99A 5DBEX 3LWNA 2CLFB 1NU8A 1YULA 5I8WA 4UVDA 1W19A 1ZD1A 1ZD9A 1AO0A 4L9RA 5BR8B 4OL9A 4BO7A 2QRNA 4G5HA 2QRKA 1WLSA 3HUDA 5C9ZA 3NM5A 1PR4A 4DYDA 1DU4A 1CX9B 3T3OA 1EAMA 2AX4A 4M88A 4HYEA 4R98A 1P91A 4G07A 3LWZA 5IF3A 1KY2A 1F7UA 3LUDA 2OKGA 3DHEA 5EIFA 4CR6A 4ZJYA 1YZGA 4EG6A 1UPBA 3Q7TA 3Q1LA 3PEYA 4MA4A 4E11A 3I8SA 1DOZA 2FQQA 3OJWA 4KXQA 4M1TA 2H65A 2GM5A 2E0IA 2H7XA 5EMJA 3WYNA 3FDIA 3ZJVA 5LB4A 1TZCA 3WS7A 1YR9A 2O5VA 3DO6A 4AJKA 2IPNA 4XIIA 3FCXA 1U8AA 1Y89A 3PQ4A 5DOVA 4A92A 4F5ZA 1O96A 2RARA 3GELA 1PNOA 1NY5A 2DUUA 3DM5A 3OEWA 5B58C 1JZQA 5IEJA 4D6XA 5LLDA 3UMVA 1QLJA 1DDGA 4HN2A 2HA7A 4QGFA 4BPRA 4JIMA 1R8XA 1E5TA 2QZ9A 4QUGA 4QJ4A 2ZGVA 1A76A 2ZR0A 1BMQA 3F97A 3CJTA 5EZYB 4C7OA 4RFSA 1QH1B 1EYZA 4Z2YA 3UH1A 3UMGA 5HQ3A 4OFZA 1RYNA 1ZJ5A 3AM1A 3MCVA 4IUYA 5E6RA 4GX5A 2VP4A 4KO3S 5JDCC 1EGMB 1SC9A 5JAQA 1JIXA 4D46A 3ZHZA 1FVFA 4HDSB 2GK6A 4WIAA 4DTCA 2CF6A 2GH1A 3TVYA 2WUVA 4MVJD 4TSRA 1L9KA 2PV0A 3DE3X 1J8MF 1REQA 2PTHA 1YK1A 4IXWA 1T9ZA 3VPAA 5ERGB 3ZHRA 3HGTA 2Q4TA 1FTSA 1JJAA 1C81A 2VEOA 1BE1A 1HC7A 1P17A 3QKUA 4D98A 3GLVA 3O4GA 2DHRA 2R6JA 2QTCA 3KQHA 3HACA 3ANNA 1K8QA 3NIGB 3ISVA 1K27A 4JP3A 5CPFA 4X3CA 5I9SA 2PT6A 3MS4A 3SC6A 3LLCA 4H1UA 5F33A 4Z7QB 2CXOA 4GKBA 1P0CA 2NSHA 2SCUA 4RM2A 4BFYA 5I9NA 4CF7A 2D1YA 3AILA 5BXQC 5I6DA 2A0YA 1J5PA 3HP1A 3KHSA 1BEZA 3Q88A 2F90A 4POAA 1D7OA 4P7BA 3O3CA 2X19A 4EA9A 1M1ZA 1RACA 1TPZA 2AF4C 2PXHA 1QAMA 1BU5A 3CXUA 3IOBA 3QXCA 4KQ9A 3W6PA 1X74A 1KHHA 1PKEA 3WYEA 4DMKA 3BDIA 4OXXA 1C1DA 4JJEA 3RD5A 3ZHVA 4BX2A 5HVNA 2GCOA 1YCHA 4MYTA 3OESA 1N6RA 1ZUNB 4KLAA 4RF4A 3S1AA 1G1MA 4G24A 4MI1A 3I1JA 2EZ9A 2BWJA 4L2IA 1HKUA 2RB4A 1DIRA 5DTIA 1E4EB 1K0UA 3BCRA 2VXBA 4INOA 1XZMA 5ARBA 2WSSA 3VC7A 4ON9A 2WIKA 1LTHR 3C7AA 4NMLA 4S0XA 1MCZA 4ZVMA 1E1CB 4L74A 4LYDA 5FNVF 4XGKA 2DHEA 2P30A 4FKZA 3NDRA 5IM5A 3WK7A 2C7QA 2VNSA 4BXOB 1KO5A 1SUWA 1JB1A 5FA8A 1RYDA 3PHHA 5AH0A 1P1KA 2Y1WA 3PGJA 4HLCA 4L1KA 4N40A 1CUSA 4PZEA 5KYNA 2Q5CA 4XAQA 5E3HA 5LQJA 1O2DA 4LDRA 1TLLA 2HGSA 2V4UA 5BMVF 4FBGA 1XEWX 3ILXA 3GJ5A 3P2JA 4K8OA 5CM8B 4ZK6A 5AW7A 2G80A 3BAFA 4R9SA 3TTVA 4FNOA 3HP4A 3G9XA 3VJKA 1LXCA 1Q7RA 2QAGA 4IOKA 3CVVA 2C8LA 2GZ3A 4TT3D 4G5GA 5KDLA 1GL6A 3TLYA 5IXJA 5AVJA 2H6EA 3HC7A 2B1IA 4HXYA 3NEPX 5BT8A 1T9HA 2ZULA 1Y4ZA 4WT7A 4ZOLF 3HHPA 2L42A 1KP2A 5EZQA 1VMAA 3FMOB 3UOAB 5TGDA 5JH7B 2ZSJA 4MKXA 4DWVA 2XE8A 3OLYA 3ZCQA 2XVZA 3DMNA 2B3TA 2HMYB 2P67A 4PBRA 5G1OA 1ND5A 1I4TD 3AIMA 3PTZA 3THSA 1KVSA 4Q4LA 4RH3A 5ALYA 4D42A 4HYTA 4RK0A 3LTNC 3BC1A 3SJZA 2OILA 4Q3AA 4UBMA 1IPEA 4JLVA 3GOHA 3K9CA 3HFRA 3I2GA 3RSOA 1ORHA 4C01A 4BEWA 4IWXA 1Y0BA 4ALNA 1EPUA 3I9JA 4CEJA 1BHO1 1QF9A 2D0PB 3E3MA 3I5MA 2PMEA 5FRDA 2P6UA 1P73A 1XMSA 2PWZA 3ZEAA 4CG2A 2YNMA 2JFBA 3QKRB 5EIAA 4TPKA 4ZODA 1N57A 5C8YB 3THOA 1IHUA 2HWXA 4XGNA 2NZYA 1LRJA 1TMKA 2OFOA 3L0IB 1KMCA 1KXJA 1VIYA 3NTLA 4R69A 4ESEA 5HQTA 1OH6A 2QU7A 5M2QA 3ACBA 1C4OA 3SE0A 2J5BA 1CQIA 2CNKA 1TFUA 4EI7A 4H7PA 1YUNA 4LC9A 2WWFA 1A9XA 2DSTA 4NCBA 1ECBA 5HIIA 3PNOA 2HJVA 3B38A 4H08A 2NZVG 2Y0DA 1U8YA 3E8MA 3EG9B 1U11A 3KKKA 1KAGA 1OI3A 4G1VA 4OI4A 2P4HX 2XD4A 4DWWA 3DWGA 5KYWA 3GNLA 1Y3IA 1DQNA 4GPD1 1JQKA 4NLLA 5B30A 5C1OA 4KQHA 2QPLA 3ZYCA 1U0NA 4CUZA 3CF6R 3RFCA 4BLOA 3FR8A 3N07A 2QRMA 2C2WA 3LBFA 4DVJA 4QXRA 2Q5FA 1DV2A 1KYYA 2QN6A 2ZTVA 3LTEA 4MGKR 5DI9A 2WY2D 1ODFA 3UKOA 1N6IA 3ZK8A 1DV1A 5DGDA 4DA7A 3W7BA 3IQGX 4H1WA 5JSFA 2B4KA 3CM0A 4ZAZA 1IUKA 1GM5A 4G5FA 2A86A 5EXDA 3LCJA 3HDGA 1VIDA 5A4DA 1ZEMA 4CUKA 1Q0UA 3QNWA 3L0YA 1CB0A 4EUHA 3I3SR 4YX9A 1Z0SA 2CXSA 5ILOA 3FZQA 3E8SA 2W48A 2VT6A 2WWTA 1HDCA 2WUFA 4QU9A 4O1HA 3T5MA 1Z17A 3PD1A 2FV8A 4JZYA 2GBFA 3KZOA 2ZRAA 3CX3A 2CBZA 3RW9A 4FXOA 2EW2A 2F3PA 4V0KA 4L7QA 2V5UA 4AIIA 1CG6A 3U39A 5BMVA 3MLBA 4L6IA 2C4KA 1G8GA 4MUGA 1AN9A 4OM8A 1G3RA 5BQXA 1U0RA 3ZDQA 3C41J 2P4UA 2V9CA 2ZKLA 2G9VA 3CVOA 5DM0A 1AK9A 1R0YA 1I4LD 2PGAA 1C9JA 1MC8A 1U2TA 4K40A 5ALLA 4KPFC 3WMGA 1UAAA 1YZUA 4FHEA 3E9NA 2V6MA 1Z0AA 3BE6A 2R4TA 2PBZA 3D2AA 4J1TC 2XQGA 4XX1A 3D59A 5FJIA 3WMRA 3SLGA 1EFTA 2J48A 3P9YA 1P9NA 1RQXA 2Q6TA 2XDQB 5EYPA 3M3HA 1HTTA 1Z33A 5IJXA 3TZCA 1R7RA 4IUBS 1WPQA 4DNXA 1QC5A 3U4CA 4D9FA 4AZSA 4H7HA 4JI3B 2QZ4A 4LDNA 3FETA 5F9HA 5A0VA 4MV9A 1JIKA 4X95A 5DCUA 5TS3A 4ASUD 4K9MA 2GPSA 3D6UA 1A97A 1ZQ1A 1V1RA 4ISCA 4GMDA 4D0GA 1U7DA 1FB5A 1UADA 1IXRC 1USKA 3MOGA 3P19A 2X8BA 2FKAA 3K70D 2IBSA 1ISIA 4MUYA 1RI1A 1G20A 1QYVA 4RVNA 3JYLA 1VKNA 1CE8B 2IEBA 1BXGB 4PWZA 1ZVJA 5KYGA 3I9V6 3TL2A 3VKVA 3GLGB 1M2WA 2WIFA 3NHYA 3UK6A 5JMPA 2JGAA 1E9SA 4UHEA 3H5LA 4FDAA 1AB5A 1U81A 2OHJA 4I1IA 3THWA 1X39A 1UZLA 2CNBA 2PXCA 3LQRA 4ZAXA 4WRRA 3WWOA 5EJ8A 3TINA 2CLEB 9MHTA 1K88A 3KFLA 1E9RA 4PFJA 4GMGA 3PQDA 3UATA 3QLTA 3ZY4A 5DV9A 3FNRA 4DR5B 5KTRA 3LT2A 3CA8A 1MH9A 4RESA 4Q47A 2ZBRA 1VKRA 1Q16A 2WKWA 1L5NA 3E5RA 3EVGA 4PG7A 3RTDA 3NNSA 4YMUA 4Q4AB 1IHYA 1YNOA 3AY0A 4YJKA 5BWLA 2KW5A 2L17A 5DVZA 2GYUA 2F1KA 1G8HA 5CVCA 5H81A 5LPNA 1LWOA 1SKUA 3KWLA 3E05A 4URVR 2Y93A 2G4LA 4FR0A 4DNFA 3GFPA 2M6RA 1O95D 2DPMA 4KE6A 3NZEA 4JI5B 1FQWA 2EARA 1RWQA 4GECA 1QYWA 2JFVA 3FR7A 4GSLA 4UCQA 1CEEA 4TTPA 4UPDA 4Y1FA 1X1AA 1AHNA 3H18A 2NU9B 1J21A 1UBGA 4KK3A 1SQSA 3HNRA 4QDTA 2WI8A 2GS9A 3OZFA 1X87A 1JVNA 4ZJUA 5KNDH 4WFQA 3W7VA 4PTLA 2J67A 4CUJA 1SO8A 3I8OA 2FEKA 1ZEJA 5KTYA 5LDHA 4YP6A 4OBWA 1YV9A 4F7DA 2DBQA 3MTQA 3A1VA 3LOPA 1NJ1A 4KOAA 2GUWA 1DEOA 2CDRA 2FDCA 1C0EA 1BVUA 3KTAA 1HDYA 3M83A 2Q1SA 2NO1A 3MAAC 3ZJ4A 2JATA 1NW6A 2QE7A 3O75A 2H5LA 3G17A 1HT2E 5TNXA 2PUHA 2WFMA 4S1NA 3L79A 3IKTA 1IAVA 5IARA 4C7JA 4J91A 2JVJA 4HF7A 2QTNA 1L5QA 1HDRA 3R44A 3JQAB 5FLEX 4KR7A 1H05A 4P7KA 1SKBA 3T3PB 1E64A 4XFDA 3Q0EA 4GBED 4WBNF 1SBTA 5JS8A 1D2CA 3OZAA 4RIHA 4C6TA 3JWJA 4HAIA 2DG2A 5NLLA 2IQ5A 4CMIA 4YRSA 2AKAB 2FWAA 4WLEA 3X1MA 3JQ9A 4DDMA 1EVIA 2YX1A 2ZAGA 1X9HA 5SZHB 3LA6A 3DZFA 4Y2TA 3EGOA 1KI6A 1Z5ZA 4QNMA 5CPBA 3DBRA 3TUJC 2VYND 4N8SA 2JGIA 3G3EA 3NV9A 4A36A 3FY4A 2GN9A 2HPZA 4FYWA 5BW6B 4LSZA 4TS4A 4TKLA 4Y8VA 5CBPA 4Q34A 3ZCTA 3AC0A 1U5CA 1D6NA 3V1LA 1H6BA 3EQ2A 2X0FA 3GJ0A 5JNVA 3PGKA 5ESWA 3ZTYA 4YPVA 3E2PA 1Q7EA 3KALA 2X2FA 3NGLA 3SXUA