3DOEA

Complex of arl2 and bart, crystal form 1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
189
structure length
189
Chain Sequence
GLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTADLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
molecule keywords ADP-ribosylation factor-like protein 2
total genus 63
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3doeA00
3CB4A 2HT1A 3SFZA 4TL6A 1XZPA 1TQDA 1XTKA 1QHIA 1J8YF 2GNOA 3DO6A 3OIVA 2JLXA 4NCKA 1LVGA 2F1IA 1XEFA 4OHYA 2G88A 5FR1A 2ZAOA 3CRW1 2FOLA 3OEHD 2NO0A 1NJGA 2WOJA 1AS3A 3TNFA 3LXXA 1ZUHA 4M21A 4ACAA 5FTJA 2ORIA 2WWXA 2D4HA 1NG9A 1R5BA 2B8WA 2OSBA 2XZOA 4HDOB 4S2EA 5KDDA 2WZQA 1ESMA 3CR7A 4QGGA 2IXGA 1FUUA 1WB9A 2BWJA 3VKHA 2YWFA 2FWRA 3IKJA 4LJ9A 1E2GA 1E2IA 1N0VC 4A8JC 3CO5A 3TIFA 2ZI5A 1E2HA 3P32A 4EJSB 3T61A 2G9NA 4BZXA 4Q4LA 4DLXA 2WKPA 1ZNXA 1AZTA 3KXKA 1HT2E 2BMDA 1QVRA 3TSWA 1W49A 2ZU6A 2ANBA 5JFGA 1ZNWA 2LKDA 4RD1A 1ZC3A 1MRSA 1LS6A 2JATA 3H0KA 3KXLA 3KDSE 2DBYA 4OI4A 2FZLA 3AP1A 1VHTA 5A4JA 1KO7A 4WZAE 2WWYA 1NF3A 2ZITA 1SULA 1GP2A 3DOFA 3K09A 2BM0A 2C9CA 4B48A 3K70C 1S4QA 4GOXA 4EJSC 1NIPA 4JLJA 4Z8YA 4RKFA 2J9RA 4EQ6B 1UBFA 4CEIA 4M2LA 3ZZTA 5C4MA 3PXGA 1MO3A 1UM8A 1FTSA 5EE3A 2QM8A 1GIAA 1OXVA 5KSZA 2CDNA 4YMSA 4ESVA 1OXTA 3KQKA 1NBMA 1PV4A 3CRVA 3DMNA 3L2OB 2OV2A 2C96A 1G8YA 4F92B 1EX7A 3GLGE 1YVDA 4FWTA 2B8TA 3ASYA 2PEZA 4EPRA 1P2SA 3VNVA 3CH5A 1II8A 2XEXA 5G3YA 2QEQA 1M7GA 2IW3A 4LDJA 3HR7A 3O8BA 2OCPA 1XMVA 2JLYA 1E2JA 4C0JA 5ANRB 3U7GA 3RHFA 3RNLA 4TTPA 4ARZB 3TSZA 2CK3D 1N6PA 3KQHA 5KOYA 1EG7A 3IIKA 1CR4A 1AGRA 3GJ4A 4U00A 2ORWA 2IUUA 3GLHA 4LI0A 4OBEA 3SBDA 2W6JD 2J0UA 4LOAA 1NBME 1FZQA 1BO6A 3X1XA 2HXYA 3A37A 4WW0A 1P2UA 4QRHA 4AI6A 1FX0B 1US8B 3AEZA 1NN1A 3AP3A 4A2QA 4ABYA 2B92A 2IEZA 1G7CA 5CYOA 3TAHA 2ODWA 2WPDD 1CEEA 3R7WA 3GLIB 2QRZA 2W6IA 5KSOA 1Q1EA 2BC9A 2UZIR 1ZW6A 2VP6A 1F2TB 1SXJC 1ANKA 2H16A 4JBYA 4MITA 3LXRA 4DCNA 821PA 1MH1A 4PPNA 4ZIRA 4XWOA 4I1UA 3FFBA 3IPXA 4MYTA 4OHVA 2IS1A 1KJWA 5DI3B 1SXJA 4Y0AA 1SXJB 2IYXA 2F55A 2ODEA 4PZZA 1D6JA 4HAWA 2FPKA 2W6ID 3B82A 1E9AA 4R9UC 3LH5A 1ZIOA 3C4JA 4A8JB 1XCMA 2H7VA 1X6VA 2FE4A 2AL7A 1OKKA 2ZUCA 3LBIA 3HDTA 3MMPA 1W36D 3B9PA 2DWOA 1MRNA 2ODBA 5KUTA 2FFHA 4NONA 5K8UA 2D62A 2ZROA 3KQUA 4AY2A 1D9XA 1XJCA 4LJ8A 3VHXA 2DWQA 1W0KA 5EXSA 5DN6A 1KJYA 1F2UB 1HT1E 1LFDB 3HJNA 5L3QA 4DCSA 3AVOA 3GD7A 4FIDA 4TLBA 4LJ5A 2ZYWX 3TQCA 1NKTA 3R20A 1PLJA 2RGNA 5FUVA 1A2BA 3FGNA 3WMFA 4PC6A 4XD7D 2J0UB 4TT3D 1N6OA 5C4GB 1E9SA 2WVJA 2EFGA 3LQRA 1MOZA 4Q1BA 1RC8A 1Q0UA 4FCTA 2ZR0A 4I1OA 2ZJZA 5FTMA 2IYRA 4GFDA 4Q9LA 1HE8B 4YONB 3H2YA 3TQFA 1K6MA 2F1JA 2MMGA 1VIAA 2OO7A 2Z6VA 2ATVA 5FOSA 3GJ5A 4H9GA 1WF3A 1Q3TA 1K5DA 2AXNA 2H8KA 4HLDA 2VSOA 2X8AA 5HE8A 5FBQB 1RFLA 1IM2A 2ZETA 2ZTSA 3HWSA 1E2MA 3NHAA 4BFXA 4ZDIA 2WJIA 4HZUA 2VP2A 2HCJB 1KMHA 4B35A 2PZGA 2ZRNA 3OFND 5FPSA 5GJCA 2QT1A 2A5DA 3FTQA 2QP9X 1W0JD 2SHKA 4C2TA 3QSYA 2QM7A 2FEMA 3A4NA 3WHLA 3TKLA 4AIIA 2WM9B 3MGCA 2P65A 4W5WA 2CE7A 1TEXA 1Q57A 3NBFA 1DG1G 2BBTA 1XEXA 3EXAA 4MYCA 4UKDA 5BQ5A 1B0UA 2VHJA 3RS0A 3I8XA 1UDWA 1AKYA 4PHGA 1G7RA 1HEIA 1KDRA 5JHGB 1VCOA 2O52A 2W6JA 3KKMA 3Q5DA 2ZRLA 1Z22A 4HZUB 1S9HA 3BC1A 3W6NA 4CEHA 2IS6A 4LJ7A 1SVOA 2H57A 1HYQA 221PA 1D2MA 4X8HA 5FBWB 1NG1A 1E1QA 4I4LA 4JT2A 3TR5A 5F98A 1NSFA 5AUNB 1JNYA 3BS4A 1NNEA 2ERXA 2QU8A 1PLKA 1ZUNB 3FFAA 5B57C 3IDQA 2PEYA 1W36B 2ZRIA 2W2TA 5IDVA 1J90A 4UJ3A 3EPLA 3SQWA 2VPPA 4ZCLA 3VFDA 1G291 5J47A 4Q01A 1VDZA 2ZJAA 3RWMB 3TK1A 3BB3A 3MWYW 4DCVA 4GP6A 1RJ9B 2C03A 1G7TA 4RFSB 1F60A 4RFSA 2O8CA 3TR0A 1QDEA 2PL3A 4EFNA 4C0AC 3ICQB 2VP5A 4B3BA 1MABA 1XMIA 2XB2A 2QSYA 3GJ8A 1TQ4A 2EWVA 4L9SA 2BJVA 4MDFA 4BZPA 4QBHA 2RCNA 2LCFA 1COWD 2WMNB 5EXXA 2QTHA 4FMDB 4Q4HA 1DOAA 1EGAA 4OL0A 2FPLA 3ICEA 2WWWA 3WBJA 3ZVRA 1F2TA 1FFHA 1O3YA 2WBLC 4EPYA 2GBLC 1RVDA 3CWQA 4P0TA 3B13B 1Z0AA 1FQJA 1GILA 4NCHA 3V9PA 2Z0MA 2Z4RA 2DB3A 1KK0A 4QC2A 5TV2A 3QPVA 1J8MF 2R62A 1RRPA 4JL8A 1KSHA 5H68A 1FX0A 5K8TA 3B5JA 3N2IA 1EFTA 4PPFA 3G0HA 4DC9A 4MKFA 2EQBA 1IJEA 2QMUA 5FBRB 3SYLA 1KI1A 3VKWA 5EXTA 4Q4HB 2H5EA 4O3MA 1IOZA 4FMCF 3EW9A 1BYIA 1XMSA 5J4YA 5TDHA 1Q20A 2AHOA 1N6NA 2YJTD 3LW7A 3SI7A 2GILA 1AQYA 4C0LA 2ZE5A 3W6PA 4JLKA 1GUAA 1NSTA 3T06B 4DDUA 2GJ9A 3U7EB 2WKRA 1U0JA 3U6KA 2VRWA 3VU9A 4KHZA 3L0SA 3C7KA 1G9XA 3PV0A 4G5GA 3VR2A 3NDBB 2WHXA 4IXMA 5F9FA 3T5GA 1JEEA 3BAFA 5L8VA 1ETUA 3A1VA 5JS8A 3GLHB 1KJZA 1UF9A 4KFSA 4R7ZA 1JXMA 1IJFA 4MYHA 2EFCB 4EPWA 2ZSFA 1VECA 1ZC4A 4FWIB 2AN9A 3QI2A 4EKDA 1Z8FA 1ZRHA 1KZGB 2GESA 5C18A 2JLWA 3GFTA 2FN4A 1IXSB 1H8ED 1N6IA 4DB4A 3PUVA 2ZSBA 1Q1ZA 1N6RA 2J1LA 4PSVA 1VCIA 2Q9BA 4KV9A 2BKUA 1E0SA 3OF5A 5L3QB 4QG7A 1KI8A 4U7DA 3GEHA 3WMGA 5E3HA 2GJSA 1A7JA 5HTKA 4WXPA 1E2NA 3TRFA 1G16A 4B75A 3QY0A 3ZS9A 4OK6A 1UDXA 3ZZUA 1P7CA 5TB5A 4PC1A 2IYSA 4NYIQ 1DS6A 1BMFA 1ZJ6A 1OH6A 1EESA 3W8NA 4Q7MB 4BLTA 3KQLA 1NP6A 5EP1A 3TVTA 4CIDA 3RAPR 4V03A 1XB2A 2KBEA 3MJRA 4B6EA 2VSFA 5JBQA 1E6CA 4LBVA 3AVUA 4OQXA 3WHKA 1R8QA 4A0FA 4MQBA 1FTNA 3DHWC 3O8CA 1G18A 1L8QA 2X1VA 4ZIRB 4V02A 4JS0A 4V0NA 3U3RA 1JQJC 2AK3A 4KSBA 5AJXA 3LWNA 3EA5A 4ARZA 1TUEA 1BMFD 5FOWA 1GKYA 4ZI3A 2ZSAA 3SJBA 4Q7LA 1S1MA 5GJBA 2QTVB 1HV8A 1VCMA 4LHVA 4B43A 4R98A 1FP7A 3VTKA 3A1WA 3MCAA 3RANA 1P9NA 4BASA 4BUJA 2NO1A 3ETLA 3OEEA 3REGA 1ZD1A 3RC3A 3U44B 1Q21A 3SJCA 3H4MA 2ZI4A 4L5BA 5KHOC 1WQ1R 3AKDA 4DIEA 4M22A 2QY9A 1IONA 4RCZA 4B47A 5GVRA 1W2HA 1K8RA 2CJWA 2VHQA 5EE9A 3B2EA 1AKEA 4D4LA 3RRNA 1Q22A 2ZS9A 5CK4A 5E7IA 2C98A 3ZH9B 3A6PC 3BORA 1W47A 3WYGA 4DUGD 2XOKA 4OQFA 2ZEJA 5GVSA 3KFXA 3THWA 3C15C 3GEIA 1GDDA 1YZUA 2HF8A 4DXAA 1UBGA 2HUPA 2VL7A 3IEUA 5DI3A 3SE0A 4C0SA 3FMIA 4JBXA 4JT4A 3EPJA 1X1SA 1SQ5A 1YR7A 2ZRBA 1W2GA 3MJHA 1P62B 2OILA 1CP2A 3U61B 1ODFA 4Z51A 3AVXA 1AK2A 2CL6X 4MRSA 4QGAA 3R9IA 2CVFA 1WRBA 4GZMA 4URZR 2XAUA 3ZVLA 1LF5A 2B21A 3C16C 4BFTA 1G3IA 1GWNA 3CNLA 5B30A 2J7PD 4ZCMA 3THYA 2ZRFA 3TMKA 1RRCA 2REXB 3SEAA 3A36A 4CT5A 1G5PA 2GVDC 4K8OA 1OIXA 2JAQA 3QF7A 1SKYB 3ND9A 1W46A 4IVPA 3Q5EA 4AYWA 2KE5A 1ZU4A 2J3EA 1T9HA 2OBNA 3PCRB 5G41A 2C9YA 4L8GA 1HY3A 1L4UA 2FZ4A 4W5HA 3TUIC 2RGXA 1SVLA 3IQXA 4KLNA 3U5ZB 2FH5B 4DLTA 5TARA 2F43B 1S8FA 2R6FA 1XD2A 2NZJA 5H8WA 3UWOA 2DR3A 2WWIA 1S96A 4YXWD 3I61A 4PSAA 1ZNZA 1U81A 3AF1A 3EPKA 1TADA 2IL1A 4TTQA 2HLDD 1CULC 1G20E 4O2LA 4WBSA 1JPJA 2W00A 3B8HA 3BBPA 1IN7A 1SHZA 3O8DA 4NH0A 3CF2A 4L16A 2ZE7A 1COWA 4LC1A 4QBIA 1OH5A 1Z06A 3WRXC 1E94E 4K81B 2VBCA 3HU1A 4A15A 3QXXA 4ZDWA 4PAOA 3NWJA 1QG4A 3SU8A 1TQ6A 4KYUA 1SGWA 1NN3A 2GBLA 2EYQA 4KVGA 4WVFA 4LJ6A 4URVR 5JCZA 2A78A 1FNNA 3OESA 2REOA 4LPKA 4E03A 1MKYA 3KX2A 2XOKD 3ASZA 2ZI3A 1NKSA 3ZQ6A 2P2LA 3RRMA 2A5GA 2IWRA 1XDBA 5BW8A 2OUKA 2FNAA 1MR3F 2A3RA 4WIAA 4NYJR 3EA0A 2GZDA 1G6HA 1E9EA 2IUSA 3QBTA 3THYB 4M4SA 2FG5A 3ONWA 3TH5A 1YQTA 3AVPA 5LPNA 2XX3A 2KWIA 3BFVA 4ITRC 3VR6A 4LCBA 2GA8A 4DSOA 1R5OA 4D80A 4QKQA 4QM7A 1MO5A 4TQ9A 2VSXA 4W7SA 3CM0A 3QKSB 4WOPA 4JSTA 2KSQA 4ASUD 2B7BA 1NMYA 4WZ6A 1DAHA 3VR1A 3V4FA 3WNBA 3ZD7A 1T3HA 3CF6R 3JVVA 4G5QA 4HB4A 4YMVA 4HAYA 5BN4A 1CRQA 1P9RA 3EC2A 1E2EA 2VP9A 3A1TA 1ZUIA 3OFNA 5TY0A 2F43A 1M74A 3CRRA 1DG3A 2F3TA 4ILEA 3CLVA 4UNPA 4KFUA 3WNCA 4C3ZA 1D8TA 1I2MA 1W48A 3M6AA 3HYTA 4AKIA 5DHFA 3SYNA 2QRNA 2ZS7A 1UBEA 4M0LA 5FUWA 5B2ZA 4C0QC 4IEEA 4DJTA 3LX8A 4TTRA 3KJIA 3U7HB 3KKQA 1P75A 1V43A 1Q44A 5JI2E 1Q3HA 2C99A 3D7MA 4IDPA 3NEYA 3RRYA 2ZJ5A 3JVUA 1CR2A 1YR8A 2PX3A 5FOXA 3SHWA 3WP1B 1JR6A 3OEED 3AVQA 3MFYA 2IYQA 1A2KC 4ZI2A 3CH4B 4LYFA 2PZEA 1VTKA 2NPIA 4RY2A 1YR6A 3D8BA 4DRZA 4QM6A 1VYUA 1R7RA 1W4BA 3P4XA 5JRZA 3B1YA 1ONBA 3O8RA 2ZXUA 1W0KD 2NOAA 3PJRA 5FI0B 4LBZA 2O8DA 2H17A 1JR3D 1YZQA 1N5KA 1G3QA 4TYYA 4NZYA 3HPRA 4GRAA 3QG5A 2RGCA 4DIDA 1AIPA 1VIYA 1DELA 2PBRA 3IBGA 2CLSA 2GXUA 2OBLA 2J0VA 4TYNA 3BWDD 1PZNA 2XTNA 1Z29A 2RMKA 1R0YA 4TQUS 1ZCBA 5AJWA 3WYFA 1KNXA 1OW3B 1TX4B 3KTAB 2JIZD 1KY2A 4QHYA 1G8HA 1Z83A 3C5HA 4UQOA 5JMTA 3LLUA 4A4DA 1OFIA 4S35A 1QF9A 5HCNA 1QHSA 2PZFA 1R6BX 3QPUA 4C9BA 4KODA 1OV4A 4A36A 4YQFA 2XITA 1E9FA 1G8PA 4HUQB 4TLAA 1G8GA 4ZDJA 3DOEA 1P2VA 1XBTA 2IYUA 2OG2A 3WMEA 3V00A 2QE7A 2GEDA 5SZHB 1OHHA 4JL5A 2WV9A 4TYPA 5EP2A 3GLGB 2O8FB 4D2IA 2BEKA 4D0NA 1OB2A 2CHVA 3I3SR 2IX3A 3GP8A 3N2EA 2QORA 3NBXX 3NKVA 3W6OA 3VAAA 1E79D 3UWKA 2MSEB 3QVUA 5AUPB 4BFVA 3K70B 2YOFA 2G3YA 3BRWD 2BM1A 3CRMA 3Q8XB 3IIJA 3U44A 2CMKA 3QE0A 1P5ZB 3IIMA 2CK3A 1OFUX 4OQMA 1PVOA 2PLFA 4QHSA 4KJZA 1CKEA 3TJZA 2G0TA 3WBKA 2UZ3A 3LBHA 3P4YA 5AJZA 3I73A 3ZVNA 4ZO4A 3EZ7A 2N1BA 3TVDA 4TL9A 1LW7A 4RZUA 1G41A 1JJ7A 5B58C 1ZINA 4I99A 2ZPTX 5JI3E 3ZDQA 5KPDA 5JEDA 3EG5A 2HF9A 2EU8A 2ZRCA 1AS0A 4DSNA 1NBMD 5FBVB 4XTCS 4GSYA 2G83A 3EX7C 1YRAA 4KO8A 4NE2A 1CS4C 3TUZC 3GLIE 4X8OA 4AK9A 3A8TA 4JBWA 2FV8A 1Z6TA 2R8RA 2Y8EA 3MWLA 2PJRA 3U6BA 3AVVA 4PSKA 4IJMA 4BZQA 4D0LB 2CL7X 3R9XA 3GLIA 4HLUA 1GZSA 1F48A 2PMDA 2R6CA 4NCIA 4RD3A 3ZQJA 4Q1FA 1U2RA 1DPFA 1Q12A 1SXJE 4YC7A 1XJQA 2GETA 2IA5A 5AK0A 1QVAA 2BKEA 2PT5A 2DYKA 4QFMA 1AZSC 3C14C 2GTPA 1RE0A 4MYUA 2EFDB 3CX8A 3QOFA 1IN8A 4PC3A 3T1TA 2FEOA 5KO2A 1ZM2A 4JMPA 4LV8B 1E96A 4WXRA 1IAQA 4PQRA 3AVTA 4TMVA 4Q4AB 5K8IA 1NVVQ 1R10A 1DAFA 5CDFE 4F38A 1YZNA 3MUFA 3MD0A 4QNMA 1T5LA 1EWRA 1F6BA 1W5SA 3U3MA 4EDHA 3UK6A 3KB1A 3FHTA 4QOSA 3A4LA 3PEYA 1G19A 4B73A 4MUBA 3TGPA 5E4FA 3E70C 2FSFA 4HZIA 4JJKA 4C30A 3ZGXA 5C1BA 1XMJA 2AFHE 4A2WA 1I4TD 1EWQA 1AQUA 4AWXA 3EAQA 3FKQA 3LNCA 2QROA 4B71A 1XTQA 1W1WA 2QMHA 4EQ6A 2GAAA 4JLBA 2O8BB 4PAQA 4DDTA 2VF8A 4BFSA 3FVQA 4GPTA 1PJRA 2W2XA 5LB4A 5G3ZA 2J41A 5E7JA 1KNQA 3FKSD 1OXSC 4EUNA 2QGZA 2A30A 3Q9LA 1OE0A 1L7VC 4V0KA 2C2HA 1NY6A 1JXOA 2AK2A 1NVXQ 2FSHA 2KB0A 4Q19A 1SVSA 1W0JA 5TVKA 1RRGA 4BLSA 3PFIA 1TPZA 4JZKA 3IHLA 2QAGB 1N6HA 1OFHA 2V8OA 1OKKD 3BH6A 1KY3A 4ZKEA 4IOJA 1VG0B 2QG6A 4D4MA 3NC0C 3RS5A 3PEVA 1GRQA 2IYTA 1UPTA 4AURA 1VPLA 3BIFA 3PEUA 2QPOA 3P20A 1E2PA 4EJSA 2OCYC 2YOHA 2ZI6A 4AKEA 4C2UA 2E87A 4HAVA 2FDCA 2NPFA 2OXRA 2HV8A 4TLEA 2XTMA 3A1SA 1V5WA 3BERA 1GM5A 1KI9A 1KSJA 4JLMA 1Z5ZA 4JVLA 4XVQA 2X2EA 2JJ2A 2P0EA 1E2FA 4BLQA 1I2DA 4Q4JA 5CIQA 2AD5A 1R0WA 1MO6A 4QNRA 3QKRA 2GEUA 5CB6A 2G1JA 4V0MA 4FMDF 3GLFE 3JZMA 2ZVPX 1QRAA 5JLJA 4LV5B 4AG6A 3EIHA 1WA5A 1C1YA 4WAUA 1U9IC 3EWSA 3G5UA 4D6PA 1E1RD 1JPNA 4DHEA 1W4AA 3X2SA 3E5HA 5DH9A 4IOLA 1NVVR 4GNKA 4IVRA 1G64A 3B60A 2IF2A 5JHHB 1DEKA 5GJVC 5G40A 4X8LA 2UVQA 2VP4A 5CB8A 1CR1A 1TF7A 4KAXA 3LX5A 5AJVB 1Z6GA 3N70A 2RAPA 3CPHA 4Q9KA 3BXZA 1M7BA 2ZYTX 3ZYCA 2V1XA 4TL8A 5DE3A 2K5UA 1P2TA 5JEEA 1ZAKA 1GVNB 5FUXA 1IN4A 1NRJB 2OHFA 1DAKA 5FPYA 4LGMA 3CW2A 4Q9JA 5EP4A 1E4VA 4LHZA 5J5CA 5SZJA 2O5VA 1MT0A 3FMPB 2HXSA 2CCJA 1O87A 4DDWA 1E2KA 2IT1A 4DZZA 2RHMA 4DDVA 2J0SA 3DZ8A 4Q02A 4TQAA 1WBDA 1NI3A 2G0NA 3DZDA 1KO5A 2CHQA 5FH9A 2X77A 5JWHA 1SVMA 2WJYA 1IBRA 1UJ2A 2D06A 2GCOA 3QXJA 4YMUA 2EYUA 1KHTA 5CLLA 5CYPA 5SZKB 2J87A 1CXZA 1OHHD 3ZZ0A 1T6NA 3IHWA 1CIPA 3K0CA 2H92A 4B76A 1BS1A 2ZRMA 2ZQ5A 2CBZA 4B2IA 1K5GA 1OXXK 3KXIA 5HPYB 2BBWA 4PO9A 1XD2B 5BYKA 4J0QA 4A8JA 2EFEB 2HJVA 3BFXA 3MWJA 1BOFA 1JAIA 1E9CA 2BOVA 4ZV4A 3AF2A 1Z47A 1NLFA 4IDHA 4KU4A 3D3QA 1KSGA 2JLQA 1KI2A 2O0HA 2V4ZA 4NKRA 1ZCAA 3REFA 4CDGA 1E4YA 4JLVA 3W5JA 1Z28A 2OFOA 3F0TA 3QVVA 4O2RA 3F8TA 4IFBA 3L43A 1I4LD 5BYJA 1ESNA 3B78A 3K0FB 1AM4D 4OHXA 3U3JA 1EX6A 2IYVA 3SOPA 3NC1C 2IYZA 1Q1BA 2L0XA 2YYZA 2JLVA 2JJ8A 2BHRA 4TZ6A 2RH5A 3EASA 5EE1A 5EZ6B 4C4PA 3DPUA 1XTSA 3THOA 1TU3A 1D9ZA 3SS8A 3M1IA 5BN3A 3L0IB 2P3SA 4LK2A 1F5NA 5IK2A 2EVWX 1SZPA 2IXEA 4TYWA 1C9KA 3TBKA 1FW6A 3VR4A 3AF3A 4W5JA 4HYYA 4LJYA 4M1MA 3LLMA 2CXXA 5LD2C 1JR3E 2JCSA 2IK8A 2I1QA 4G5RA 1KO8A 4CYMA 1H65A 1KI7A 3D6TB 3HPQA 5JRJA 1ZP6A 1NLZA 3MG9A 1DO2A 2Q3MA 2PT7A 3PVSA 4IDQA 1Z2CA 2IHYA 1N6LA 5CM9C 3WY9A 4UNNA 1Z6AA 1CTQA 2ZRGA 3EIQA 1XZQA 4XVUA 1U8ZA 2ZR7A 5SZIA 3NHBA 4L9WA 4C0KA 4NU0A 5JCPA 4M8NE 5DISB 3M4YA 2XGJA 4TMTA 4OYHA 3WXMA 4P32A 5FL3A 4EPTA 4FINA 3J81k 5L3SB 2GRJA 4NCJA 5F2EA 1E2DA 4MKHA 4KCGA 2FX3A 2DY1A 5F9HA 3LDAA 2F6RA 5HE9A 4Q7JB 2GF9A 3GLFB 3R8CA 2GHIA 1IQPA 2FMXA 1XPUA 1XX6A 2ANCA 2VHCA 3KJGA 2IHBA 4DCUA 4M9ZA 3W34A 1PUJA 2F9LA 1R0ZA 3KL4A 4IOKA 4N1AA 3AKEA 1W36C 3DEFA 3ZS8A 4R71A 3FYHA 2AKYA 4QBFA 1F2UA 3AV0B 4BLOA 2CLCX 2OFXA 4BFWA 4GP7A 2W58A 4RSGA 4F4IA 3OIWA 4WA7A 2ZRHA 2ZYVX 4A0RA 4BGDA 1KDTA 2PX0A 1Z0IA 3CZQA 2WMOB 3Q7PA 3EPHA 4TLDA 3DDCA 1P61B 1NN5A 2JLZA 4U02A 1JBKA 2BVNA 2DFNA 2VQSA 3W90A 3UANA 2O8EB 4UXIA 3QKTA 4Y0VA 4NBSA 2CCGA 2GAOA 4B33A 4PXAA 1W5TA 2WWFA 1OSNA 3I4LA 5KSYA 3GJ0A 2OT3B 4H1VA 5DLQC 1T8UA 4G1UC 2A2ZA 2QPTA 4RZXA 3I92A 1AN0A 1KKLA 3EZ9A 1YZLA 3IUYA 4CGZA 1VYVA 1N3BA 2ECKA 2C77A 3SJZA 4LBYA 1TU4A 1RIFA 2AWNA 1R5NA 4CT4B 3OIYA 2XZLA 2VLIA 2VH5R 4MGKR 1VG1A 4C7OB 4PFSA 5GJWC 1AGPA 2YWEA 3EARA 1GNRA 4JL6A 1T91A 3SC3A 5JWRA 4G5SA 4P4SB 4HDCA 3QF4B 1ELOA 1GFIA 4HB2A 4OHWA 4LZZA 4D4KA 1US8A 4OHZA 5L3SA 3PUXA 1DAEA 1L4YA 1XNJA 1SKYE 1GKIA 2O0JA 1TF5A 4LHYA 2JDID 5FOVA 1LS1A 4D25A 2BDTA 2DWPA 2QAJA 1TMKA 2QGNA 4CEHB 2P5TB 3BH7A 1U9IA 1JJVA 2IUTA 5D3MB 4ZDKA 1GRRA 4HAZA 2H18A 3IPYA 1TEVA 4EPXA 1PUIA 3SHFA 1XTJA 4UJ5A 3T15A 1YRBA 2TMKA 4P4SA 5EQTA 4B6FA 3FPAA 1G7SA 2Z4SA 1KMQA 4D4JA 3CNNA 3BGWA 1UEIA 2R6GA 2GVZC 3GLFA 4DVGA 3A1UA 3RS3A 3ZVMA 4M53A 4M1TA 1LV7A 5GADl 3U4QB 4E09A 5AUOB 2F7SA 4MRVA 4LYAA 2J7PA 1XJ0A 2V1UA 2ASEA 1ZD9A 5TMPA 1ZVQA 2MSCB 2IF0A 1Z0JA 1E2QA 4DLYA 4D81A 3QIAA 1JAHA 1NVUQ 4KLZA 3B6EA 1DARA 3I72A 4MGIR 3H1TA 3HR8A 3QNUA 2JLSA 1U98A 1HURA 4HAUA 4MH0R 1OYYA 3K0FA 4Q21A 2YWGA 2IS2A 2DFLA 3K8YA 4AD8A 4CEIB 1IN6A 3L8ZA 3FWYA 3PUZA 4E22A 1KI6B 1VG8A 2CLDX 2GWHA 3B7GA 2FFAA 5AJYA 1KO1A 2GEVA 5FTLA 4MDEA 4IEIA 4PANA 4JVSB 2QSZA 1CBUA 3GPLA 3SBEA 3EZFA 4BFYA 1EFRA 4LPSA 5LB2A 4ON9A 2JASA 2XZPA 3LD9A 3CF0A 1HQYE 3OE7D 3T5DA 1CJMA 3OAAA 4CW7A 1NLYA 4GMDA 3Q85A 2J45A 2J5XA 2W2VA 5FL7A 4A6PA 1OH7A 4Q18A 2DHRA 1OT3A 4LWZA 3THXB 3R7WB 4OQNA 1XPOA 1EFUA 5DI9A 3DKPA 1DTSA 1GITA 4A1FA 4QL3A 1HH4A 3IQWA 4ZCIA 2R9VA 2VP0A 5A5GA 1OJLA 1T0JB 5IRCD 2NO9A 1QHNA 3OEHA 4OQLA 3ADCA 3FOZA 4PQFA 3LQQA 2VIIA 2OFWA 2Z43A 3MAAC 1E1QD 2AKAB 5DSZA 8OHMA 1IY1A 4TMZA 1KGDA 4Q1AA 1R0XA 4B3DA 4PZLA 2C8VA 1OPXA 3L82B 1TQ2A 2ZI9A 1Z63A 2ORVA 3EZ2A 2V9PA 3QEJA 1CJTC 4GOJA 4D0GA 1JEDA 4HI0E 2P67A 4OI1A 3SQXA 4JLPA 2IC5A 4P4TA 1UKZA 2EFHB 2Q3FA 3AM1A 2BMFA 2YHSA 1E2LA 1QBKC 3LBNA 4URWR 4F93B 2A9KA 3DVLA 3QF4A 1U94A 4JVNA 5IK2D 2YKGA 5EE0A 2WAYA 4DWJA 4XVRA 1E3MA 4Z54A 2VO1A 2RGEA 2V7QA 3I5YA 1P60A 4NCNA 5A0FA 4L15A 5UKDA 4EPVA 2ZUBA 4D26A 3AGPA 5JJKA 3FE2A 3QQ5A 3T1OA 2C95A 1N0UA 3PIRA 3C8UA 3VHLB 1S9DA 3I32A 2ZAMA 4N0EA 3VX3A 1AS2A 1KTVA 5IHPA 4NDZA 4DT1A 4NHOA 3D31A 4LBWA 2JGNA 3F5FA 1JALA 4DEYA 4AC9A 2O8DB 1BYUA 1OXUA 2CCKA 4DLUA 4Q1DA 3CNOA 3RS4A 1N5LA 4CZ2A 1CLUA 4V0ME 1XTIA 5J4HA 4TT3A 1XXHB 1VYTA 3QEOA 3CZPA 5FR2A 2WAXA 2O0KA 2C78A 4QBGB 4EIWA 2BCGY 3GFOA 2WIBA 4ASUA 3CBQA 5FUYA 1EFHA 4KVAA 2JDIA 3UIEA 5J4KA 4M9QA 5KDOA 1YZKA 4TSFD 4TMXA 1P6XA 3QENA 3PR1A 3AUYA 4I81A 2JJ1D 3BB4A 4EFMA 1A5TA 4JLDA 5B64A 4R2HA 3IO5A 4LY6A 3RRZA 2IYLD 3K0EA 1IHUA 1G3RA 4G01B 4OK5A 4R2IA 2WOOA 1WBBA 2F3RA 2WSSA 3PITA 4MRNA 3K0AB 4AKHA 1IY2A 2QQEA 4G3XA 1YU9A 2IXFA 3AH8A 2CL0X 2RGGA 3B85A 4OJQA 3K53A 2D7CA 1S3SA 4RD2A 1VCNA 4RD0A 1A1VA 1G8FA 1E9RA 2MMCA 1N5JA 1OIVA 3NG1A 1W4RA 1Z0KA 3SDZA 1RRFA 1WDTA 1Y63A 2C9OA 2WPDA 1DAGA 1ZNYA 5CM8B 4YMWA 3S1AB 2ZS8A 4GDFA 3CPJB 2RGAA 3AP2A 1SVKA 3AVYA 1KI4A 1FP6A 1HA3A 1T3LA 2BEJA 4BLPA 4BQSA 1E1RA 1J2JA 4MGZR 4RJLA 2XJ4A 4LUCA 4CRWB 5FTNA 1XCPA 3GJXC 2UKDA 3BD9A 2VA8A 2QI9C 4RD6A 1E0KA 1SKQA 1KK1A 1YZTA 2AR7A 2MSDB 3HYRA 3U60B 3I62A 2QQ0A 1RZ3A 2H1LA 4M1YA 3QXCA 5DNYB 5K8LA 3UG7A 2DCUA 1Q1QA 4DLZA 4FW9A 3TW8B 5D3QA 1D2NA 1II8B 1HTWA 1KZ7B 1QHHA 3GLGA 2ZANA 1BKDR 2IS4A 2D74A 2O8FA 1U0LA 4LC0A 2ZE6A 1KK3A 1KO4A 1J70A 3SFVA 2OESA 3R8FA 3VKGA 3I8SA 1WE2A 1P3JA 2ZRKA 3BJIC 4AKGA 3QBVA 3AQ4A 2Q9CA 4XOIA 2WJHA 4P31A 4Q66C 3B1WA 4HUQA 3UPUA 1GTVA 3SYKA 1HUQA 1XFAA 2WJJA 2P6NA 3GQBA 3QJYA 4HLCA 2FPMA 2GXAA 4PO8A 1TUIA 3K0SA 5HR5A 1GNPA 5EE5B 1S3GA 1XEWX 1E98A 2ZJYA 2GJAA 3KFVA 2IYWA 4Z1MD 5M04A 1ZBDA 5KNCA 1E69A 5EUMA 3DL0A 5FPTA 4OI0A 3VX4A 4B3XA 1FUKA 4DLRA 4IXNA 4C7OA 1CR0A 4L4UA 3E2IA 2JLRA 2XNSA 2PH1A 3TSOA 4DSTA 4ESHA 1D2EA 4DUGA 2GCNA 1DAIA 3RC8A 3GJ3A 1X8JA 3T12A 3NBZC 2I4IA 5EP3A 5FI1B 3RDPA 2W0MA 1CU1A 2W0SA 2PCLA 4G5OA 5JJLA 3NVAA 4BE7B 1QZXA 1XXHE 2D3WA 2PLRA 5E95A 4I1VA 621PA 421PA 5FOTA 5JWOA 1KI6A 2BV3A 3KKOA 4JLAA 3BE4A 2ZRAA 4FN5A 3LY5A 1T8TA 2ERYA 2OZEA 1T3SA 1A4RA 3QUSA 1G21E 4LJ4A 3NEJA 4OKSA 4PTLA 2Q21A 3ECCA 1ZIPA 1ZM7A 1WCV1 1XPRA 5CDFA 3SJAA 2V6JA 2V6IA 1QHGA 3OE7A 5DN6D 4XTRA 4PX9A 1A82A 1LB1B 4DBLC 5JS7A 5DYIA 2PJZA 3ZLJA 2CNWD 2QPAA 2QENA 4A0HA 3ADDA 2GJKA 2VF7A 4QHTA 4V0LA 1XWIA 2OAQ1 2NQ2C 1I4DD 1XD8A 3QXSA 1NJFA 3E1SA 2QAGC 4URYR 1AA9A 1OLOA 1GAJA 1E0AA 1JECA 1MV5A 1E9DA 5FPHA 5JJIA 4Q4JB 4MA4A 1P72A 2I1VB 4A9AA 1DE0A 2QTFA 1LF0A 3LA6A 4DLVA 4JLNA 1S1CA 2V54A 3AF0A 1JI0A 1R4AA 2OE2A 1KK2A 4US1R 3UKDA 4OJKA 4QJ5A 3UATA 2C5LA 3WP0A 4GL2A 5E7MA 4RFVA 4TLCA 4JLOA 2RB4A 1ZYUA 4A82A 5ELXA 1LY1A 1R2QA 2J0QA 4RKEA 2Q9AA 1CJKC 3PENA 3M0EA 3X1YA 1FQKA 4NPHA 5FBLB 2Q6TA 3CWZA 4FCVA 1H8HD 2D2FA 3BOSA 1FL9A 1OIWA 3IEVA 4W9MC 1J99A 1P4SA 1VKJA 4X8MA 4LV6A 4ERNA 4Q1CA 3S1AA 4U5XA 4G0NA 4WZBE 1UEJA 5L3VA 4HATA 1OYWA 4IDNA 2RKOA 3FHOA 2V3CC 5TXGA 4DKXA 1CRPA 1JQLB 4Q9IA 3U7FB 1W4CA 2B7CA 1NIJA 3KB2A 4GZLA 1VMAA 3U3KA 3L0OA 5HKKA 2OM2A 1NL3A 2AD1A 4MKIA 1UFQA 4XWAA 3AKCA 4QJ3A 3SN6A 4LYJA 4JKYA 1HQCA 1VG9B 4A0GA 1SXJD 2G1KA 4HEJA 3ADKA 4ZPXA 3UMFA 3KJHA 1XP8A 2GZAA 1MABB 1CJVC 3GCGA 5HZHA 3EWAA 2QP3A 4N0DA 2GF0A 5KYKA 1UADA 5JECA 1RYFA 2E1RA 5H70A 1SHKA 1NN0A 3K1JA 4IKEA 1CJUC 1XEWY 2HEIA 1IY0A 4MUAA 4M1WA 2XTZA 1XU4A 2GCOB 121PA 3CIOA 1G1MA 1TF2A 3NH6A 2JJ1A 4MRRA 1KIMA 2FJUA 2J59A 3FDIA 2ZJOA 1QHHB 4LSGA 3L0PA 2A5JA 4B32A 3ZIAD 3VU9B 2OCAA 1ZM9A 2GKSA 1FMJA 3QXHA 1R8SA 5IT5A 2JEOA 3FHCB 4DT1B 5JSZB 5FOUA 3RLFA 5HKKD 3KTAA 3P26A 3UMSA 3LVQE 2WWGA 4XD7A 2KI5A 3FKSA 3NDPA 3Q3JB 4F7WA 2GJ8A 1G6OA 2RGNC 1GL9B 2LKCA 4MKGA 4KI0A 1XTRA 2A5FA 2NZ8A 2WSMA 4GOKA 4TMKA 4JVMA 3KQNA 4P3YA 2AXPA 4QJ4A 5C46F 4DSUA 3W9YA 4DLSA 3UMRA 4FI3C 3AUXA 2JLUA 2GDJA 3SR0A 2IBMA 3MLEA 1D5CA 3Q7QA 1UKVY 4UNQA 2ZRPA 3RS7A 4FCWA 4KITB 4C0HA 2PMKA 4PR0A 3X1ZA 1KI3A 3GFPA 4CVNA 2DPXA 1KAGA 4P4UA 4Q9HA 4YLGA 1DO0A 1U90A 4HSEA 3WNDA 2FGKA 2GXQA 2YC4C 5CIWA 3IBYA 5KSPA 5KNBA 1Z6XA 3RYTC 3GJ6A 5J4LA 3THXA 2F9MA 1UBCA 2V55B 5EXPA 1G3UA 1PLLA 4I1SA 5L3RA 2Q0HA 2QMEA 4JYCA 2F1RA 3KKPA 3HU3A 2X19A 2YOGA 4Q7KA 2GK6A 4LJAA 1NVWQ 1Y3AA 3T34A 2CNWA 1GL6A 1UKYA 3QKSA 4QXAA 4JJZA 4Z1MA 4XH9B 1II0A 1ZM3A 4M1SA 3VNUA 2ZRDA 3X1WA 3IO3A 1GG2A 4Z8XA 3I5XA 4POAA 3GMTA 2WIAA 1YE8A 3ADBA 3IILA 1G5TA 2BIFA 1N2CE 2REBA 1F3OA 2P6UA 4YDSA 3LVRE 4URUR 5BXQC 4CEJA 1IXZA 3LAWA 2QA5A 3U2QA 2ODNA 3MRSA 2VHTA 1YJ5A 4HLQB 2VHUA 3B1VA 2FFQA 3HU2A 2O8BA 3OAAD 1Z2AA 3T35A 3U3OA 2OLJA 4HAXA 5C2JB 1HE1C 2CVHA 1OFTA 2GK7A 2NTYC 5DYGA 3FB4A 1W7AA 1G3MA 2HYDA 1XRJA 4HUTA 1EK0A 4KSCA 3W8RA 4FMBB 2RHDA 2J7KA 4PO1A 2KBFA 4UNRA 3NBYC 3SNHA 2YC2C 1E79A 5FFMA 4M9SA 2ZJ2A 2FGJA 2ZSDA 2HJGA 2YNMA 2EW1A 3JZAA 1T0HB 2NGRA 3QG1A 4V0OA 2R65A 2HT6A 4EFLA 2G77B 3RS2A 5EZ5A 2IYYA 2J46A 2XSZA 1FNMA 2N46A 2VYFA 3F3YA 4GI7A 3V4RA 2KJQA 2HYIC 1AJEA 2BMEA 5BN5A 1GRNA 1G5RA 2ZUDA 2OLKA 1NMXA 3O47A 3THWB 3W3AA 3KUCA 2ONKA 2WWHA 4MRPA 1NY5A 5HCIA 1N0WA 2HCBA 1G17A 3MSXA 3KJEA 1SVWA 2X2FA 5D3MA 4PC2A 3L8YA 2P6RA 2R44A 1Z3IX 4US2R 1QG2A 2ZRJA 5DHAA 2QT0A 1H8EA 2CJWB 4XSHA 3NXSA 3IGFA 4F4JA 2C04A 4UNSA 5CITA 2DFTA 1GSIA 2JA1A 3GLHE 4XJXA 5DIFA 4Q47A 5KDLA 2Z5FA 3TUJC 1M8PA 4BPBA 3DKVA 5AWFC 4B3GA 2QBYA 2QZ4A 3UG6A 1KSFX 3LO5A 4TYQA 3CX7A 4BRWA 4B34A 4O0MA 5FPKA 4NMMA 3OZXA 1M1YE 2XXAB 2XXAA 1J7KA 3EZ6A 4TSFA 2IWHA 2HDNB 5AR1A 3VR5A 2G6BA 1N6KA 4UXJA 5J4VA 5KTYA 1GNQA 2AFIE 2JJ2D 1T5IA 4Q48A 5LBIA 1H8HA 4F4CA 1GOTA 5KNDA 3PUWA 2O8EA 5FL7D 5DO9A 1RYHA 3WYAA 5JZVA 1LTQA 1UAAA 5CLQA 1M6NA 2FU5C 1Z07A 1OB5A 4RZ2A 1FOEB 1RKBA 3K0AA 4HDQB 4LYHA 3T1VA 2OXCA 2ZSEA 1OH8A 4TMWA 2WSSD 4OI2A 3AVWA 4II7A 2QBYB 3CKLA 4YDHB 4AYXA 3T1QA 4EAQA 1GL7A 3AKYA 3K0CC 4F91B 1FMLA 3I1FA 4NYJQ 1WMSA 4B2LA 3G82C 2QN6A 2A7QA 1RJ9A 4NYMR 1U0HC 1YHNA 2F1HA 4B44A 1OF1A 5H1YA 4CF7A 1E9BA 721PA 3RSLA 1M2OB 3H84A 2ZJBA 4HLUC 1ZD8A 1DADA 4PHFA 3Q72A 2FSIA 2ZYUX 4IVQA 3TLXA 1YKSA 3KKNA 1Z0FA 2OAP1 3CX6A 3A58B 3VMFA 4US0R 4E5UA 3NIBA 4M1KA 4RD4A 1E0JA 4PQYA 1E99A 1G4UR 1W44A 1N5IA 4FD2A 2QAGA 1SVIA 4QGFA 2WKQA 1X86B 4AYTA 1IN5A 3KZ1E 4YMTA 1EXMA 2VTKA 1DAMA 2D2EA 4BECA 1LNZA 2DFKB 3AB3A 1T4GA 1DBSA 3K9GA 521PA 5J40A 1XD9A 1QHXA 1MO4A 3W3ZB 1G4AE 3ZD6A 3R9WA 2BBSA 4O25A 3CRQA 2ZIAA 4TZ0A 4RVCA 3VR3A 2CEAA 1RW4A 4JKIA 3B1ZA 4TL7A 4BEJA 3MWKA 2V7QD 4IDOA 2O8CB 1U8AA 3HP1A 3EC1A 2OCBA 4DB2A 5G53C 1KMHB 2YZ2A 3AGQA 3QKUA 4GT1A 4RCYA 4C0BA 4P33A 4QGHA 3VQTA 4A92A 4AG5A 2Q3HA 3C41J 4BWYA 5CK5A 3WRYC 5KU1A 3C5CA 4GMXA 1CF4A 1BIFA 4FXPA 4A2PA 1UKEA 2A5YB 2YINC 4KFTA 4MGYR 3K70D 4NTZA 3GJ7A 3N5CA 5EJEA 4KBFA 2AWOA 5CJ2A 1YZGA 2PCJA 2D7DA 4Q4AA 1KAOA 2FF7A 2HLDA 2R6DA 4UXHA 3TW4A 2ZVQX 4E07A 1N25A 4NP6A 1P73A 2R6AA 3K09C 2BBOA 4YXWA 4Q1EA 1WXQA 2RGBA 4XIGS 3SZRA 2YV5A 2QNRA 4BEBA 1S2MA 1FPMA 2GZHA 3NH9A 2FSGA 4LHWA 3OHMA 1XEXB 3A4MA 4IW3B 3PQCA 1BH2A 1X1RA 2ATXA 2XNDD 5EUQB 2LWIA 2B6HA 3BB1A 2ZU0C 2XJ9A 4XSGA 1ZU5A 2NO6A 2ONJA 2CE2X 2R2AA 4JIMA 4BRUA 2QP4A 1ZM4A 4N3NA 1U8YA 1IXRC 2N42A 2NO7A 2WTUA 4PC7A 4PAMA 5P21A 5HZKA 2WICA 1TAGA 2QL6A 2QMOA 2VEDA 5LD2B 3H86A 2Z83A 3BFKA 3P27A 3CUEF 1KDOA 2XB4A 2XNDA 5LDDC 1EFRD 2GXSA 2NIPA 1E32A 3B1XA 1WP9A 3EIEA 3NTUA 3P1JA 3PEWA 5JSZA 3LRPA 1M34E 5DGXA 1U99A 3DMDA 1XCGB 3TE6A 2WJVA 1RPZA 3RABA 4LRWA 3RSOA 4LX0A 3CONA 4BFUA 3QKRB 1QHYA 4URXR 2QE7D 4KFRA 3K9NA 1X8KA 3ZIAA 3QPWA 4PHHA 4IOMA 5IF9A 2RGDA 4IHQA 4LHXA 4HB3A 3FMFA 2ZJ8A 5CJPA 3LW8A 4KXFB 1X3SA 1C4OA 4NYIR 3TAUA 4DLWA 1VHLA 2FA9A 2WJGA 4KYIB 1TNDA 4OK3A 4DCTA 2BJWA 1XF9A 4IRUB 1TTTA 1KYIA 1II9A 5AUQA 2GCPA 3LV8A 2JIZA 2BMJA 2QUZA 3ND8A 1Z6YA 2CHGA 2FFBA 4Q03A 3K9HA 1EFCA 4FMCB 4PPQA 1Z0DA 4KBGA 4ZKDA 4B74A 1KKMA 5BWMA 3DM5A 4A6XA 5KPJA 1X8LA 2BCJQ 2ZI7A 4B2PA 4BFZA 3BH0A 3CPEA 1ZMXA 3ZJYA 4GBMA 4JSYA 3W5IA 4RZ3A 3RWOA 4H1UA 1JB1A 3DM9B 2W83A 1Z08A 1DVRA 1JR3A 2EWWA 4M1OA 3X1DA 5F3WB 1XXHA 3K9LA 2NG1A 4B3FX 4HB0A 3RVBA 2E9SA 6Q21A 3OIUA 1NMZA 4XWKA 3LFUA 4Q5IA 4PPGA 4DEXA 2I3BA 4TWZA 1KDPA 4Q00A 4JYBA 3UXMA 2NMVA 5FTKA 4PZYA 1M7HA 1P9WA 2ZR9A 2ZREA 2OBMA 4BLRA 1S0UA 3PUYA 2YWHA 3U4QA 1YR9A 4ACBA 2ZM5A 1GKUB 3PG5A 4CEJB 3FMOB 1L2TA 3AF4A 4IFEA 4NYMQ 4B3CA 2IEYA 2XSZD 4PHTA 3CR8A 3KUDA 3GEEA 1KOFA 2P5SA 4TN1A 1B23P 4M9XA 2YVUA 3B9QA 2OEPA 1TL7C 2ZE8A 3BK7A 4NL4H 4D82A 4K46A 2AX4A
chains in the Genus database with same CATH superfamily
1QIDA 4LK3A 3Q87B 4YRQA 5FBZA 3SFZA 2HT1A 4TL6A 1EK6A 5I01A 1XTKA 3KELA 4J0JA 2XMBA 3ENNA 3O5AA 4FEGA 5KOJA 4YAOA 3DO6A 4I50F 1IL0A 2AJBA 4JC8A 4NCKA 2AYXA 2YYAA 1JDTA 2F1IA 4H35A 3HV2A 4OYRA 1FFYA 1BHSA 3EFHA 5KU7A 1P4RA 2ZAOA 2ARKA 2PD4A 3CRW1 4C06A 2R3SA 3V1KA 1STOA 4YJGA 2C00A 2G04A 4DM3A 5KYWA 5FNVA 1F9AA 2NO0A 1KMCA 3RU7A 3QUTA 4OU5A 2YMQA 1AS3A 4WASA 1VPTA 5B7GA 3PNSA 3ITEA 1U5BA 3EAGA 4CR7A 4V1CB 1VI6A 3WL8A 5ICSA 2OSBA 4KAFA 3T7TA 1CUXA 2XYQA 4ZT6A 4C14A 3IL2A 1MORA 4MV8A 4U7HA 4E5DA 2A9RA 3CR7A 1D0VA 2IXGA 3W8EA 5KS2A 3VSBA 1FUUA 4KC0A 2FLKA 4RACA 3RWBA 1WB9A 1J39A 4INJA 3EIOA 1IOWA 1MP0A 1XI2A 3WL5A 3ZE6A 3BUSA 3KVRA 2ZI5A 3LX6A 3EVCA 1VJDA 4BIMA 4A03A 4BAZA 5FYDA 4RM3A 2G9NA 5FX2A 2WKPA 3GP3A 3IJPA 4QVGA 2XWPA 4LE1A 5FWYB 1KE2A 4DIMA 2UXBB 4AMGA 1YC5A 3I30X 3AUTA 3MINA 1CQIB 3QQPA 4YP7A 1Q6ZA 3OWOA 1ZC3A 2JATA 2HWKA 4Q9DA 3KDSE 1NDHA 2F3QA 2GHRA 4EHHA 1ESZA 1N2IA 2IUFA 3F47A 2CHFA 5KC8A 4KRGA 3IYLW 4CL2A 3K6KA 1XZIA 4B9EA 1PF7E 4W4TA 5JYCA 3ZXIA 1GP2A 1NV8A 5IUKC 2C9CA 4B48A 3X2FA 1RAIA 1B6SA 2VOEA 4GOXA 4FI3F 4EJSC 2WIGA 1U7OA 4RMHA 2AZDA 3RAFC 2W5UA 4EQ6B 5CLFA 5CFOA 2H9IA 4RA9A 1JW9B 4D8WA 2W2LA 3IOCA 5BNFA 4PYRA 4F2GA 2H0RA 3WDMA 3PXGA 4KIUA 4TXJA 3RVOA 1NE2A 4MW2A 1JE0A 1FTSA 1R0BA 2Q62A 4PBRA 2QM8A 3FJ1A 1CDDA 1X2EA 2GRAA 2Q3LA 4ESVA 4ZMBA 4G0YA 1SRRA 1UK9A 1OXTA 2O50A 3IA7A 3KQKA 1ADJA 1Y80A 3ZW9A 2FQQA 4DIUA 1CF2O 2REQA 4KQGA 3EBLA 1KQPA 1ONSA 2IU4A 1ZN8A 4HSGA 3P9SA 1MJ5A 2UVPB 1DKQA 1EIZA 3ASYA 2XMGA 1P2SA 1FY2A 3KWJA 4P80A 2IZ7A 2XEXA 5G3YA 5D5PA 5DOVA 3V4SA 4MZDA 2PGLA 4ZTZB 1M7GA 2IW3A 4YRSA 2XVXA 3U7GA 1IEWA 1E2JA 1NW3A 1IUPA 2IKSA 3LY9A 5LC1A 4C0JA 3RNLA 2KX7A 4WGFA 2B3TA 4TTPA 4ARZB 1LVUA 4O5OA 1C7QA 1E6EA 1E7YA 4UHEA 1LC3A 2YV3A 1VKNA 2EHDA 1EG7A 3PDCA 4LSWA 2PXHA 4U00A 2IUUA 2PGAA 3FVWA 4OBEA 4B3RB 1NBME 3KEOA 5KQLA 3X1XA 1A9XA 3DJFA 1PJ3A 3OM8A 3ZJ4A 2Y05A 3D0OA 1NLMA 1A77A 2CMHA 3EB9A 1IFXA 3GAAA 1ADYA 4I08A 1W35A 2B99A 3QWIA 1G2IA 3CN7A 4LSZA 1UPUA 1H9CA 3M81A 4LJRA 3WX0A 3CNEA 3NWEA 1QHFA 4PTZA 3EFOA 3C1AA 3PHLA 1CUAA 1QFZA 4ABYA 4UQLA 2IEZA 3NB0A 4HCJA 5CYOA 1CEEA 2WPDD 3EZLA 3O4RA 5JAHA 1I7PA 3EJ6A 3PFFA 2CNBA 3KIPA 5KSOA 2YWJA 2VI5A 2VP6A 3K0BA 2H16A 4JBYA 4Z7JA 5KYYA 2NPOA 1BE8A 2IGBA 821PA 3WAGA 4OIMA 4H7FA 2A0UA 4CM4B 1MH1A 4PPNA 4ZIRA 3ESZA 2IS1A 2IXDA 5IW8A 3TNYA 2H5LA 3EGWA 5JZSA 2GT1A 2F55A 1TMYA 3OOSA 3N7TA 4FQ7A 2R4TA 1Q16A 5G4KB 1EWVA 1FTWA 4NATA 1JDBC 1PV1A 4S0XA 4Z0TA 3B82A 5T67A 4K9PA 3LH5A 4YCSA 2CLKB 1X6VA 2CVPA 1NBAA 2C4TA 2Z56A 2IIQA 3H2ZA 1JIQA 2AFHA 3IULA 3MMPA 1ULTA 3SJ7A 1W36D 1QQ7A 1F8XA 1EM6A 1NJSA 2ODBA 4MUFA 5EHIA 4R1SA 1E3EA 5LQCA 3J7TA 5MN6A 2FFHA 3FCSB 4ZHQA 4CQNA 5LOVA 3G88A 3I09A 4YJGB 4CQMB 2D62A 1LV8A 5K8UA 3FPJA 1D9XA 1T9KA 4CWAA 4QQNA 1WSWA 2QRVA 5EXSA 5DN6A 2G0AA 4BJ5A 1DC5A 1LFDB 4JJGA 4YCNA 5L3QA 2UU9B 3OZAA 3ST7A 3AVOA 1XTUA 2P11A 4B8YA 2IU6A 4DCSA 2GTHA 1V1MB 2HF7A 4TLBA 5BVGA 2VYVA 2Y68A 3BRCA 2ISCA 2C7VA 2P40A 3GA5A 3R20A 4N01A 3UHJA 4DC0A 5FUVA 1A2BA 3ZIDA 5KOJB 3RYCA 2QM0A 4PC6A 4YUXA 4MR8B 4P83A 4U6NA 1Z6PA 1S2LA 5C4GB 3PL5A 4J2TA 5ICGA 2OQRA 3RFVA 4CKWB 3ZBTA 3E58A 3QFTA 1U1EA 3TOSA 2WHRA 4A6DA 1DCKA 3HYNA 2TS1A 1K6IA 3SIPA 1K06A 2VWHA 1NMEA 1AX9A 1ICEA 4J7UA 4OQYA 3VNSA 3MHTA 3H2YA 5LKAA 2F1JA 4N5MA 4WZAB 3G85A 3NBAA 3OMWA 1T8SA 3GJ5A 1X74A 2BGWA 3E7XA 2H8KA 4RLQA 4HLDA 3H9BA 5A6SB 2PWAA 3VOTA 1VRWA 2X8AA 3DOJA 3E2PA 3EGIA 3L6UA 2ZTSA 3E3NA 4HFJA 1ZCFA 1Y8AA 4G56A 5LIRA 4Z4QA 3K4HA 1VLJA 1HDOA 4QDKA 5DNUA 2I22A 1JGTA 2VP2A 1PS9A 2GVNA 2HCJB 4EKEA 5KYTA 1GQOA 4L7VA 2PZGA 1FJ2A 5FPSA 2O57A 2HQSA 1MFZA 1MJNA 4PX5A 3T9DA 3HKBB 5JSYA 1XG5A 3A4NA 3FR8A 2JBWA 4PX2A 1JIXA 2WU8A 1XVIA 3E9CA 1GPLA 1M8FA 3MGCA 4O59O 5T64A 3FMGA 3M82A 4BNYA 1TEXA 1W0CA 1Q57A 3NBFA 4MWZA 2YJ4A 1AD2A 3RS0A 1B0UA 1IULA 4BVFA 2V58A 4XD2A 3P9RA 3K4PA 3EZGA 2O52A 2C7GA 4KQJA 4HZUB 4PZ0A 4D9NA 4OLAA 1DT5A 2ZYAA 3A11A 1XTVA 3W6NA 2Q1UA 3MUNA 1BVUA 3JQGB 4LJ7A 4MVXA 4FPXA 4XUGB 4XYBA 2W8BB 4D8YA 1T2DA 2CUKA 3AJ9A 3N39C 3ORRA 5I45A 3GZNA 5FBWB 3WGTA 1OQAA 3ICWA 1NG1A 1VKRA 4CCWA 1ZBQA 1MTOA 3B3GA 2ZJFA 4UCQA 1NSFA 3BS4A 4MI6A 3K1AA 1NNEA 1DMRA 3W5BA 2QU8A 1PLKA 1ZUNB 3FFAA 4GHWA 1TECE 1E4EB 2XKBA 3IDQA 5KKAA 2CNLA 2PEYA 1W36B 3MTBA 3BSFA 5HYVA 4UJ3A 3ER9A 3SQWA 5JS1A 2QK4A 1FVXA 4Q01A 1VDZA 3RWMB 3IDFA 4JC4A 3BB3A 5DSXA 1DU4A 2PXCA 2O1WA 4DCVA 4D9KA 3ML1A 1T15A 2C03A 2BAGA 4BBJA 1G7TA 1NBIA 1FS4A 2DHDA 1W5EA 4RFSA 4TVSA 5BV1A 4EFNA 4KQ1A 5KTRA 1SC9A 5CPFA 2XB2A 1OBCA 1U8TA 4L78A 5TEVA 1U5BB 3ZU6A 4GOMD 4BZPA 2G82A 1B73A 2LCFA 4WXMA 2AEJA 1R0RE 2EDAA 1WZEA 2TMGA 5EHGA 1PT7A 2QTHA 3EVNA 2GBPA 2X4DA 4FMDB 3M9XA 1IQRA 1DOAA 3FI0A 5COQA 4AZTA 2RBEA 3M3HA 4DQXA 1ATZA 5F64A 1IZ0A 3WOHA 1TE2A 1YACA 1F2TA 1TFUA 2GK3A 3FROA 4EPYA 3H5LA 4XLTA 3ZNOA 3AESA 3DVSX 4II3A 4MMZB 1PYOA 2IDKA 3MELA 4P0TA 3THRA 4F6CA 1KYZA 1FQJA 3IUSA 3D81A 3RC7A 2Z4RA 3DOHA 1BGXT 4QC2A 1P3Y1 2FDXA 1QS0A 1ACLA 3TLCA 2R62A 3TD2A 3D7RA 1FX0A 1A88A 3DZBA 1DX4A 3IQZA 4B31A 1M6EX 3L7DA 5CBKA 4MKFA 1C3OA 2F00A 4G37A 5FBRB 1VE3A 3OCUA 5EXTA 1GV1A 1PEKE 2F3SA 2P0YA 2XNHA 1M1XB 3KEMA 1IOZA 3OE1A 3EW9A 4E1BA 3WKBA 4L6CA 1BWPA 4NJMB 1U1IA 4BV2A 1K66A 2QJRA 1Z13A 2CLMB 2DBQA 3C6XA 2NU9B 3LW7A 2DPYA 5JT1A 3COZA 1AG9A 3IRUA 2FAXA 2GILA 4LECA 4CU2A 5HUHA 2QHXA 2XLBA 4YCDA 3W6PA 2D5CA 2G06A 1GUAA 3TYXA 5K5EA 3EZNA 4R1PA 2GJ9A 3VH1A 5B5SA 1EINA 3DWFA 4YRZA 4QXMA 3GRKA 4RTRA 3L0SA 1G21A 1V16A 2PUDA 1G9XA 2G4CA 4EATA 3NDBB 4IXMA 3LMKA 1X3LA 4HWPA 1GZ3A 1ETUA 2DKNA 4RPIA 3GLHB 4XQ0A 1KJZA 4KFSA 2ETXA 2HJ9A 5THQA 2NQ8A 1J49A 2DU8A 4N7MA 2G25A 1IJFA 1OAOA 2GPNA 3RD5A 4JI6B 4QXRA 5C4IA 1JG7A 2AN9A 3QI2A 2E4ZA 3UOWA 5I9IA 3SZ3A 3K71B 4XEHA 2FN4A 5IM5A 4PZCA 2PLWA 4O5AA 3OOEA 2JFUA 1H8ED 5IABA 2QZPA 2WPNA 4ZWNA 1O97D 4PSVA 4UTOA 1LUAA 2BKUA 1W30A 3BFPA 4R9SA 2P91A 4U7DA 2XY4A 1PHPA 3G8CA 2LNDA 1CY4A 1LQTA 4ZOAA 5LXTF 3SPXA 2GJSA 2B37A 1NASA 3EVDA 4MWGA 4UHDA 4DA6A 4WBNF 4B75A 4CLHA 2HPHA 2XA1A 4WNIA 2H2IA 3QBEA 1BCSA 4UDYX 4IHJA 3B20A 5A4FS 1ZH0A 5DV9A 3RB8A 4WLFA 1M6VA 4NYIQ 1DS6A 2YYSA 1K98A 1OH6A 3W8NA 1AK9A 4BLTA 2YN4A 3W4JA 4HJXA 1D4OA 3GUHA 1ZD4A 1KFKB 2FSVA 4FDAA 1AO3A 3D5TA 5EP1A 3TVTA 3IT2A 3I39X 4TKZA 4H6PA 3OOYA 5G0UA 4YRKA 1MBZA 1CQXA 2O4CA 2VSFA 3WHIA 1CEXA 2F90A 1R8QA 3R40A 2B20A 3LIIA 1SOMA 5K3FB 1A96A 5DASA 2INGX 3OO1A 1G18A 5C8XA 1J0DA 3PQ6A 2JS7A 2FETA 2MSKA 3E82A 3VYSB 5JCOC 1XZMA 1KQNA 2J85A 5BNTA 2WDZA 4PZ9A 4E11A 4GGOA 3VU1A 3UB3A 3NV9A 2QTVB 4UMVA 3QX3A 2G67A 4LHVA 5BV7A 5DNWA 5H9VA 4FYKA 5JCOA 4BUJA 3DVAB 2NO1A 3KJQA 3IHKA 3REGA 4N39A 1X80A 3U44B 2BLNA 3JATA 3BWVA 3SJCA 3H4MA 2XUAA 2ZI4A 3SX0A 1PBTA 3WTBA 3ENQA 1MQ9A 4D3SA 3AKDA 4OP2A 1WUYA 1E1YA 2CKMA 1RXCA 4KB5A 4M22A 2WHQA 3V8EA 4DIEA 3G2JA 3EIXA 1K8RA 3SZUA 2VHQA 2P6OA 1MAVA 5JS2A 4D4LA 3IAS1 2B94A 5G02A 3HL0A 1KAQA 3GIDA 4N3CA 2R1TA 1CJSA 5CK4A 5E7IA 1FYXA 3CG4A 1PWYE 3BORA 4UTZA 3WYGA 1D2HA 3A27A 3HVIA 2ILVA 4U9UA 4DUGD 1FJXA 2XOKA 2WUWE 1N3YA 4DG8A 3AUSA 2WT9A 3EWNA 1ATIA 2GA9A 1DEOA 4PR3A 4YASA 2YJNA 4ALNA 1E3QA 2HF8A 1T2NA 2FWJA 3I2FA 2GLUA 2ZYSA 2HBRA 3U4MA 3AYXB 4XLZA 2YL2A 2Z4TA 2VP3A 4GYWA 5DI3A 1HFWA 4R8LA 2D1QA 3UH0A 1QRDA 3EPJA 3OQIB 1W2GA 1B2LA 3MJHA 4F8JA 2EZ9A 2OILA 5KKCA 5AVWA 1CP2A 3SVTA 3G8BA 4O1MA 1DKOA 1JH8A 1ODFA 2C3PA 3MTQA 2CL6X 4FHFA 3SR4A 1SXHA 4ARUA 4WCFA 3KJNA 5H9WA 4OSOA 1J6UA 4D8UA 4A23A 1TC1A 2I7VA 3FG9A 2YHIB 4WZBA 1KRXA 3ZVLA 1LF5A 3C16C 4IV5A 4PYNA 1YBMA 5B30A 4HHEA 3V9AA 3W78A 4ZCMA 1VB5A 2REXB 3FOAA 3DMHA 1G5PA 3GFRA 4EB6B 2QD5A 1M76A 4K8OA 4Y2RA 3BBLA 1SKYB 1T8WA 1GRCA 1UK8A 2BKXA 5HK8A 4XWWA 1XC7A 2AGVA 4AYWA 1YJAA 4BQQA 2RHTA 2GKOA 5I7UA 3D6FA 1L4UA 5DXAA 1VOTA 1YA8A 2FZ4A 2LBPA 2H1VA 5MDHA 3TUIC 1XNGA 2RGXA 1SVLA 2POCA 3GJTA 4KLNA 5EJ6A 2EX1A 3U5ZB 3D0QA 3O92A 2A33A 1KAEA 2F43B 1JKXA 3MEQA 1WBJB 1S8FA 2NZJA 3BXGA 3D3JA 3H17A 3UWOA 1WO8A 4E4TA 1RKUA 1S96A 1Z35A 2OHJA 3DTTA 3LGXA 1SKAA 3PLRA 3R5SA 4H31A 1ZNZA 3PJGA 4K9QA 2ZBFA 2HLDD 4BN4A 4DQKA 1G20E 1T9CA 4LTMA 4O2LA 4OHMA 4ZHQF 1KZYC 3KKEA 3PGKA 3B8HA 1W2WB 4B79A 1IN7A 1SHZA 4NH0A 3ZIUA 1K63A 2IEGA 3KQQA 4QBIA 3KSUA 5D2CA 3AOGA 5DMHA 4NENB 3EH2A 3FFXA 1EDOA 4CKEA 3U49A 3WRXC 5EIAA 2YBEA 1NHGA 2YWDA 3H9JA 3L8DA 3RU2A 2FYTA 3C8DA 3PP8A 4YAKA 5KSZA 3OLCX 1YBVA 2H65A 4RKWA 4KZKA 3HJUA 4ZDWA 1EQUA 1NF2A 3EOBI 3QWHA 5KX5F 1X0XA 3BSYA 2ID8A 1SGWA 1NN3A 2Y1KA 4KVGA 4WVFA 4OH7A 2A78A 2C3UA 2Y3IA 3OESA 2ZUVA 2O2ZA 1M34A 2DH5A 3CNBA 3AHCA 3KX2A 1LPPA 3M5DA 4TTAA 5AKEA 4ARIA 3GUUA 1KJJA 1NUQA 4O1IA 5CVDA 5A1TA 2MYNA 4TXLA 1TLTA 4TKUA 1KKUA 3FIJA 3REOA 1XDBA 4DA8A 4IFTA 3RSZA 4U2GA 1RJFA 4QDOA 2EL9A 3OZVA 4ITVA 1Z7BA 4LHSA 1RWVA 2ZTMA 2W8ZA 3EA0A 4NYJR 4U6QA 1SQ0A 4OAPA 1DWQA 2OMKA 4M4SA 4X97A 5C0OE 4TS4A 3RFFA 5I8PA 1YA6A 4AS1A 2XE8A 4FFNA 4QJIA 2R68A 3TH5A 1YQTA 2PUCA 1EFAA 3NI2A 2D1SA 2KWIA 4QDUA 3DZIA 2AR0A 3VTAA 1MA3A 4XUDA 4F8EA 2GA8A 2NO4A 1R5OA 4DSOA 3JRXA 2PZJA 3DFIA 3QMWA 1RLTA 2VSXA 2DERA 2FQYA 4AU1A 3QKSB 3FZEA 1EFDN 2KSQA 3K4QA 4BPRA 1KL7A 5EGNA 4WZ6A 3VR1A 2HF2A 3ADOA 3ZCQA 4ZI7B 2VQEB 3ZD7A 1C3XA 4CN8A 1CF9A 2K87A 3VYRB 3JVVA 2QU7A 3E9DA 1GXSA 2WUEA 1NZFA 1QH9A 4OHFA 3QTTA 1I30A 5TQ0B 1EA7A 2H5JA 2IFTA 4HAYA 5ALIA 1P9RA 2P3LA 4UU7A 2QR2A 2VP9A 4IIBA 2FZVA 4BU1A 4CQLA 5HM8A 4JB2A 3OFNA 2EKPA 2R7LA 4HXFB 1NFFA 2PV0A 3GU3A 2F3TA 3RKRA 3WNCA 2DUWA 4KZPA 3QELB 1EKXA 4KFUA 4ZC8A 4BDTA 3Q3HA 3PEFA 1D8TA 1HE3A 4G0PA 1I2MA 4MS4A 4RNCA 3FTFA 3LDUA 1GQFA 2OGZA 4GEKA 5DM60 1BCRA 3KYDB 4LTNA 5FUWA 1UBEA 2X9NA 3WGHA 1F0KA 1B4DA 4ZZIA 1GZHB 1PSZA 1XK6A 3QLVC 3KJIA 3U7HB 1GTSA 3KKQA 1P75A 5JI2E 4AZSA 4WK6A 5LP6B 1Q3HA 2C99A 2GPBA 3D7MA 4IDPA 1QAQA 2HSDA 2EP8A 3PKJA 4J2HA 4WKOA 2G80A 4H1WA 1O4VA 2X42A 3PQ5A 3BRQA 3UO8B 2IP1A 4YCJA 1FVOA 4ZI2A 3CH4B 4LYFA 2J08A 3LC2O 3HNPA 2PZEA 2DBVO 3DEYX 3H87A 3D3NA 4RY2A 1DC6A 1V7CA 3FTCA 3KYIB 5JRZA 3GZNB 1GV0A 4BBPA 1ONBA 2O3TA 2ZXUA 3OLWA 4RUKA 3S27A 5HKBA 2P90A 2H17A 4B3IA 1N5KA 4W1PA 1RPNA 1QQTA 3BHIA 1UODA 1ZRMA 1JDVA 4YAGA 1TCCA 3JWHA 5I4BA 1EUYA 4Q0MA 3CA8A 3WB1A 3S1LA 4QG3A 1MC4A 1DELA 1O2DA 1MIHA 2X1LA 3EOZA 3IBGA 2QRLA 2XADA 3H8WA 3D2LA 5F21A 2GXUA 5EKDA 4BO5A 4DGSA 4BV3A 3EMVA 4P7BA 5A3QA 4YO7A 2J0VA 5A05A 4L08A 2IPXA 4TYNA 5HEKA 1B42A 1JLLB 3DMGA 1PK9A 4C6TB 2JC3A 1PZNA 4EF5A 2XTNA 4GOLD 4UHKA 4LQDA 4RMIA 3PFNA 2B2NA 4ZD6A 1ZCBA 3K9BA 3WYFA 4R40A 1KNXA 1OW3B 1TX4B 1D2CA 1GLGA 2E85A 1EAYA 1TIPA 2GUWA 3AUKA 1AUPA 4FYJA 3I12A 4KIFA 4D57A 5JSQA 5K0BA 2GD6A 4B3TB 1G8HA 4UQOA 3D4NA 2I6UA 1T9GR 4CKWA 4YRNA 2Q45A 5JMTA 3KR9A 3X0DA 1QF9A 1QHSA 1JU4A 4FGUA 2AIRA 3TAXA 1JG4A 1G66A 3R8XA 1O95C 1RSZA 1P0IA 3KOUA 4GI3A 4HUQB 2FW6A 3ZQUA 3CWCA 2PZKA 3DNMA 3V6MA 3EGDA 3WYBA 4R1TA 1SUDA 4BKMA 1ZMOA 2PK3A 4LDNA 5HSGA 1AQNA 3LHSA 1T2VA 3WMEA 4F4DA 2OWDA 3L1KA 4TRJA 2QE7A 3QOWA 3RVMA 2DG2A 1GU7A 1OHHA 3WZMA 1BXRA 3GRPA 5EP2A 3KVNA 1UM9B 2BGIA 3TX2A 4QE3A 4BO7A 3IUNA 4MR8A 4D2IA 4D0NA 5CBPA 5I4KA 3PD0A 4AJ9A 1OB2A 2DQZA 3I3SR 3P2KA 3N2EA 1OBHA 3VAAA 3W6OA 2HQ1A 3QVUA 2ACWA 3JXEA 1W25A 2O8VA 3NU1A 2CMKA 3QE0A 1Z17A 1PVOA 4JROA 4CQMA 2FK8A 2JLCA 5GM1A 2G0TA 3QFCA 1CZLA 5BWCA 2UZ3A 3JWJA 3Q15C 1KJIA 1EWYA 1ULZA 5AJZA 4QIHA 4ZO4A 1IEVA 3O2QB 1WXWA 3H99A 3EZ7A 3TVDA 3MWDB 4R2WA 1NW4A 3BICA 1JJ7A 3AQIA 3ZDQA 2B3DA 3GY0A 2QLTA 3LLCA 5JEDA 3EG5A 5JH7F 3JQAB 3NHZA 2ZRCA 1SUBA 5TC4A 2OK8A 4IJWA 3S5UA 3QJ5A 2EP5A 3O1IC 2NNLD 4Z2AA 4GSYA 2G83A 3WVNA 5BSVA 3OMXA 4U1RA 5GY7A 2P78A 3FI9A 4LRQA 1KAHA 1FYDA 1YASA 2R8PA 4NESA 1I4EB 5TPZD 3JVIA 3VTZA 3A05A 5MGNA 2R8RA 4R5HA 1NVMB 3MWLA 3PI6A 4L5CA 4JA2A 3MIZA 4PSKA 5AJTA 3OQ1A 1RZUA 1NXVA 1AKQA 1GPAA 1MTZA 3WKEA 3I4FA 5EMHA 2ZIVB 1GNLA 1GZSA 1CUJA 3ZNQA 3PU6A 2C4HA 2R6CA 3HKCA 4NCIA 3ZQJA 3H5VA 3UKJA 4K03A 1ZS9A 4ESEA 2Z2ZA 2CV0A 1Q77A 2G9QA 1KP3A 2DE0X 2PT5A 3WK5A 4DUZB 1Y8RB 4QFMA 1JAYA 1I2CA 2PDAA 3G0OA 4X20A 3C14C 5EPUA 1NP3A 3T3DA 5YASA 1FVHA 1DKNA 3MCTA 1B3BA 2VWPA 4FEYA 1IN8A 4C3VA 1H4QA 3WRXA 1XFDA 1BDIA 5REQB 4EG6A 1BQ3A 5FWNA 1DIRA 1FBTA 3TI7A 1NBEA 1PR4A 2GSWA 3G9TA 3AVTA 4TMVA 5K8IA 3AXSA 2BE9A 1U0FA 1FRVA 4LVNA 3JQ8A 4F38A 2REQB 5KQGA 2NP6A 2RHJA 1HOXA 1T5LA 2W2KA 1F6BA 3WGOA 3GFQA 2X5XA 4X92A 1EDBA 1QGYA 2GLXA 2JIOA 3QKIA 4OV6B 3A4LA 2P4SA 4R2XA 5FWXA 4E13A 4TKVB 3FHTA 4MUBA 4EUHA 3IEIA 2X8BA 3E70C 5DGCA 4JJKA 1JSXA 1XMJA 3DE7X 3DE0X 4B71A 2OZVA 3FKQA 3NGLA 2QROA 1XTQA 5F2NA 2QMHA 1QZTA 1Z4QA 4GW3A 4EQ6A 4ZVVA 2Q41A 4WJLA 4JD5A 3UPDA 3OTHA 1F06A 1PJRA 2W2XA 3B3QA 3QPAA 3GDFA 2QVZX 3ZY6A 1QK3A 1X7XA 2VDVE 5JYDA 2J41A 1F20A 1ZCZA 2ZRQA 4ZXFA 4P2BA 1KNQA 1NWHA 5IAKA 2VRCA 3VPSA 3Q8MA 4AX8A 1CUGA 2FUCA 2OL4A 1E2UA 1WDMA 3MYRA 2OM6A 2Z57A 1BA2A 4MR9B 4W8HA 5DXJA 3ZHSA 3BA1A 3Q41A 1GGNA 2C2HA 3UW3A 4UUPA 4HRYA 4MPJA 5HUQA 3DNPA 1H5UA 2AK2A 4RA9B 1NNSA 3GUYA 5IWAB 1TA9A 3CX4A 1LLCA 1QE3A 1PJ8A 1W0JA 4DPMA 1MX3A 2EKZA 3D8NA 4PZPA 5TMBA 4Q3DA 2QXTA 2P3OA 4GD3Q 3S2SA 2G08A 3G2QA 3OU2A 4M89A 2AC4A 1N6HA 2QVXX 3NC4A 2V8OA 1BXRB 1TJ5A 1P1FA 3HDYA 3F3MA 4ZKEA 2AV6A 1ZESA 2EKLA 4IOJA 3AEUA 1XRRA 1UCFA 3FRJA 4GSLA 4Q7EA 4V3CA 3C6KA 1PNOA 3AOEA 4LMAA 3VMMA 4EBBA 5K0FA 2XHEA 3N53A 3H5RA 1E1KA 4RK7A 2QX6A 4F56A 4EY8A 4TWJA 2X5OA 3FTEA 4BUCA 2YOHA 1Y6ZA 1XRNA 3DEAA 3FFTA 1W88B 4OEHA 1P19A 4AKEA 4EG5A 4C2UA 2E87A 3EXHB 4HAVA 4ZYLA 1JS1X 4PY2A 2NPFA 4JBNA 4JGIA 4TLEA 3A1SA 4ZRNA 1PS8A 1BVHA 4QEKA 4XVQA 3PGA1 5ILGA 2CXRA 2X2EA 2JIQA 3DCJA 4HUJA 3VPCA 4BLQA 1I2DA 4J9UE 4GPBA 4KYTA 4QLOA 2XYPA 2P1RA 3OSUA 4CIWA 1D6SA 2QD3A 1RLMA 2H2HA 1IZZA 2HK7A 4PFQA 3UAZA 1HZZC 3VR5D 4V0MA 3GLFE 1C0PA 2ZVPX 4RF3A 1P74A 1PGNA 3EDQA 1CC1S 5EUBA 1EXWA 4EX6A 5KMGA 2XTAA 3EWSA 3HZHA 4D6PA 4PG8A 1JPNA 4MV9A 4DHEA 4XYGA 3UJDA 5DTMA 4L8YA 3E5HA 3LPNA 3MCUA 3G9XA 3IDZA 3ZWQA 4EGSA 2JKVA 3WFZA 1H0SA 1G64A 2JI8A 1HZZA 4N03A 4W6QA 4INPA 5GJVC 1XMOB 2VP4A 1CR1A 3T7KA 3IUJA 3HXTA 4LWQA 4QEDA 2QTNA 3WZ2A 5CVTA 1MN6A 3ZYCA 4MULA 3VDNB 5DE3A 5ALUA 1ZAKA 2FJPA 3UGTA 2FP4B 1E58A 4XB1A 2ZCJA 2Z08A 3ECSA 5DGDA 1RDFA 4Q9AA 1RU3A 3QLJA 1AZWA 2O5VA 2QL7A 3UV7A 3AU9A 3FCYA 2CCJA 1PO7A 2NZXA 2YIJA 4GICA 1NXQA 4RL4A 1G0NA 3EZXA 3DZ8A 2LIPA 3O9MA 5CM2Z 3ILYA 4Q02A 4F84A 4CMGA 3TIXB 1JYSA 4BVLA 5DNDA 1IAVA 1VL0A 1C9YA 5JWHA 1SVMA 1ZJJA 1JEYB 1XVUA 2Y4OA 5EERA 1BHJA 3JWEA 4YMUA 5CLLA 3HY4A 1VL2A 5E6UA 2Q2QA 3VDMA 4P9NA 1KXJA 3QVJA 2J87A 1XHEA 1CXZA 1OHHD 3PFWO 4G89A 1RT9A 2D1RA 1CIPA 5KQRA 4H77A 1GGFA 1JYEA 1BS1A 4QYXA 3UFXB 3TJMA 4N76A 2E5LB 1KU0A 1REQB 4GKVA 3O3OB 3KAPA 3TOZA 4B2IA 1K5GA 1J0XO 3KXIA 4ZQHA 4BY9E 2BBWA 1N78A 4L3VA 1MH9A 1FNSA 5A7FA 1SOUA 2EFEB 2HJVA 1BOFA 1YT5A 2PUJA 4EJMA 2XRFA 1NJ8A 4CQJA 4JQOA 4ZCTA 3U19A 1FRQA 1NLFA 1K68A 3T3NA 3EEOA 4FQ8A 3S3TA 1KJ9A 1ZHFA 2JLQA 3P96A 1KSGA 2V4ZA 1PL7A 1ZCAA 3SY8A 5JAZA 3WQSB 1Z28A 4OBWA 1QYDA 3MOIA 5EEHA 2YXDA 4LZAA 3PDHA 4EK9A 2XBUA 1F8GA 3SQOA 5BYJA 1ESNA 3U3JA 3ZHBA 5J1SB 4CXMA 1Y4UA 3K9CA 2K7FA 4E1VA 3PHBE 1Q1BA 5AI4A 3RQIA 4LOKA 4TZ6A 3LPDA 3CVWA 1YB4A 3A0UA 3H11B 1HDCA 4JJEA 1U7ZA 2XECA 1THMA 1WKBA 3DC7A 4PAWA 1EGMB 1NURA 2ZXFA 3LQ1A 5L9AA 2XVAA 2OV4A 2EVWX 2J9ZB 1C9KA 4NECA 1WDLA 4EY3A 5EMMA 2AOTA 2XEDA 1FP1D 1WHTA 3AI2A 3AF3A 1T5SA 5L7YA 2WYWA 4H27A 1ODSA 2CXXA 2PXXA 1JR3E 3FDXA 3OFSA 3RVRA 3V4ZA 4NCBA 4D8TA 2I1QA 4PGGA 4KRYA 3LT4A 4G5RA 3QVXA 1C29B 1NOJA 1Q0PA 4GLJA 1KETA 5TQVA 3TDNA 1UC9A 3O8QB 4FYHA 4DZZA 1A69A 1GPKA 1DO2A 3PVSA 4H3KB 4XVHA 4DILA 1Z2CA 13PKA 3JQPA 1N6LA 1SAYA 4MPTA 1I0IA 4TV9F 1WPXA 2HO4A 1H0KA 1Z6AA 1CTQA 1WU7A 2IHZA 1NKVA 4L1KA 1D5WA 3GT0A 1QH1B 2NNWB 1N8TA 2XV1A 4Y9DA 2E1PA 1RQ2A 3A6HA 4OYHA 4RPKA 1R3DA 4TMTA 5DYTA 4F85A 3NWBA 3NT2A 1KYYA 2EQ5A 4NCJA 1KBOA 1ETHA 3W9BA 5FADA 4DNXA 4QDZA 5JCJD 3OQMA 2ZSHA 4MEJA 2I0FA 2NX2A 1RC1A 3T99A 2C4NA 2BGGA 3LDAA 4Y6SA 3GMIA 3DTVB 5FV4A 1J2RA 3KPVA 2OCIA 4DLNA 4IJUA 3EMDA 5D5HA 1KJ8A 3KJGA 3MGBA 2ZB8A 4WEQA 5ALMA 1J21A 3SXUB 1U0NA 4N1AA 4QUAA 1Z5VA 1ZGAA 3AKEA 3DEFA 3HU5A 3IVAA 3PPXA 5AH0A 3HBLA 3K6JA 3N8IA 5FB3A 2XT9A 3S8MA 2P6MA 1NRWA 2ZAYA 3G79A 4ATNA 2ZKIA 4IDFA 3RUCA 1F2UA 2QD1A 3AV0B 2OFXA 4Q3CA 5JJCA 1ZQ1A 2AQIA 4YPFA 4ER6A 2VRCD 2ZYVX 4A0RA 5L7WA 4YUWA 1KDTA 3D3EA 2VUTA 2VF5X 1QB7A 3CZQA 1K0FA 3ZGOA 5IASA 3QX7A 4YCBA 4BXOA 2WMOB 3Q7PA 2XVYA 2X0FA 1WOYA 2EZ8A 3DDCA 3KWFA 4G5XA 5JANA 2IE0A 1M5TA 3BMCA 3FNGA 1JBKA 2DFNA 4B7CA 2GYUA 4Z4GA 2WU0A 3O21A 2VAMA 4CKBB 2C5HA 3W90A 1RQGA 4OQDA 3F6RA 4QD3A 1CQPA 2R60A 5FI5A 3TBHA 3TIVA 3MSCA 2B4RO 3OCXA 1TZKA 3UV3A 2X23A 3KOWA 3I4LA 5HF8A 3E53A 1Z36A 5KSYA 3KZCA 3OCZA 3GJ0A 1IHYA 1YKGA 1T8UA 4G1UC 2AQHA 3LGAA 4H7EA 3HZOA 3IVCA 4YRDA 3VI3B 1F12A 1KKLA 2ZWVA 1U2SA 2IEAA 3EZ9A 3PFHA 5GTDA 5K99A 4AMZA 3UAWA 1ZKMA 5LOVF 3MMNA 1USVA 5DNAA 4H17A 3ZOKA 2AZTA 2C77A 2GBIA 3BQMB 1QJ4A 1TU4A 2BFWA 1M1YA 2ZB7A 3HB7A 4XQEA 1R5NA 4RDIA 3IMCA 4M60A 1UOQA 4IMRA 2XZLA 2X3FA 1CVIA 1VG1A 2VPXA 2YWCA 4IIJA 5GJWC 3UUFA 4YUZA 1JA9A 4C7OB 4JL6A 1GNRA 1PNQA 5JWRA 4EGAA 1R6TA 4D9GA 2QUHA 4XB6B 2V03A 4HDCA 3VSDA 1T4CA 2BEWA 1ELOA 3ZDBA 3DP9A 2AFIB 3W0LB 4DIKA 1IATA 4ZOLB 3QFHA 4ECAA 1A9SA 1QIGA 2CUTA 3W8FA 1DAEA 1SKYE 5AW8A 4D4HA 4IZOA 1AMOA 2J3HA 3ZWMA 1LS1A 4E08A 1GARA 2G4LA 5ESDA 6PFKA 4QQ8A 4U2BA 1I6MA 1TMKA 2HY7A 4PLCA 1Y3HA 4WESB 4INAA 4CEHB 2P5TB 1GYPA 4INOA 2IUTA 2X8JA 5D3MB 2PUEA 1GRRA 3JAWB 3PNLA 5FEUA 2C4WA 2VDJA 3N2YA 3UQYS 4P1ZA 4EPXA 2ZATA 1XTJA 4ED9A 4UJ5A 2H54A 3E6AA 4RZSA 1YRBA 1A8SA 3M1YA 3T15A 1HM5A 2XLCA 2XODA 3AM3A 3FPAA 1FMTA 1G7SA 1DP4A 3E23A 3NOOA 4I5IA 2JD2A 3T0IA 4BP8A 2DQ4A 2GPAA 1REQA 2OAGA 3BGWA 4NLLA 4DAEA 4JI7B 2AB0A 1H4VB 1E1CA 3GLFA 4RV5A 3A1UA 4NVRA 5ENZA 3RS3A 3NEPX 2CXOA 1TB4A 4PVCA 5AD1A 4GO1A 5FO1A 5KNCH 4DQUA 2P9HA 3U4QB 5AUOB 3GPDG 2BGTA 2QLJA 3U31A 1XJ0A 1UAGA 2V1UA 2WE8A 1YVUA 4U7TB 2FRDA 4DBVO 2MSCB 4N5IX 2QF7A 5ED0A 2XUIA 2Q5QA 3A7EA 4FKZA 3UMVA 3EIUA 4ZYVA 2RHRA 2WINI 1C4KA 1DARA 3B6EA 1N92A 2PTHA 1Y4SA 2BFAA