3DOEA

Complex of arl2 and bart, crystal form 1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
189
structure length
189
Chain Sequence
GLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTADLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
molecule keywords ADP-ribosylation factor-like protein 2
total genus 63
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3doeA00
3SU8A 3R9IA 4NU0A 4DSTA 2W6JA 5IRCD 4D0GA 2OXRA 3MJRA 2H17A 1E4VA 1G8GA 4URVR 1XEXB 1GILA 1Q20A 3GLHB 4TLBA 2PMDA 5J5CA 1JJVA 1G8YA 2GRJA 4BLOA 4F4IA 4O2RA 4DRZA 3FKQA 2IUTA 2QL6A 4ZI2A 2G77B 4HUTA 4BRWA 1KMHB 3CWQA 3IGFA 2AWOA 3AP1A 3L8ZA 2OHFA 2OUKA 2ZR9A 4M9SA 3GLGE 2ODEA 4A8JC 2W83A 1KMHA 4IXNA 1NKTA 2OFWA 2ZJOA 1V43A 4KFSA 2CNWA 1N3BA 2JA1A 2AHOA 5HTKA 4B74A 2R6DA 5KU1A 5CITA 1II9A 1W4RA 2QORA 2HUPA 4C0AC 4DWJA 2P6UA 3R7WB 1ONBA 2MSEB 4TLCA 4WXPA 2C9CA 4D4JA 1NN0A 5FBWB 4R2IA 3PIRA 2WSMA 1FX0B 2HT6A 3AGQA 5B64A 3O8CA 2GK6A 2QTHA 1KI1A 2YJTD 3DHWC 4H1UA 1JBKA 5LBIA 5FL3A 5B30A 5JJIA 2R62A 2K5UA 4S35A 3O8RA 4WIAA 4TQUS 4EIWA 1E99A 4LHZA 1TTTA 1XZQA 4A15A 2WIAA 5GJWC 5LD2C 4DIEA 4QKQA 4X8HA 2GBLC 4FMCB 2YOFA 4B34A 1NJFA 1LF0A 1KI2A 1WBBA 1ZVQA 2C99A 2R6FA 1YZNA 3C4JA 2OILA 4P31A 4Q1FA 1G8HA 5BN3A 1MR3F 1FTSA 3DVLA 2WPDA 1G3UA 1GTVA 1SKQA 4AURA 1TNDA 4YXWD 3PFIA 1B23P 4D0NA 1SULA 1UKZA 4MGIR 1VYUA 2R2AA 4TTPA 1IN8A 4HZUA 3TH5A 1Z0FA 4YQFA 5JSZB 3SQXA 3GLHA 2C03A 3MAAC 4MKGA 5E7JA 2IXEA 3SYKA 3U4QB 1KZ7B 2P67A 2HT1A 1CEEA 1Z6TA 1JQJC 3LVRE 4CDGA 1XRJA 4PHFA 2ZTSA 3THXB 1W48A 2RGAA 1QHNA 3BJIC 1NNEA 1Z6AA 1RC8A 2RKOA 521PA 1I2MA 4TSFD 4Z54A 1DAMA 2R65A 2VHCA 1NBMA 3KL4A 3SYNA 1VCNA 1NG1A 3OF5A 1T91A 1RJ9B 4Q4HB 1D9XA 1Z3IX 2YWFA 2O0JA 3JVVA 4IKEA 3IPYA 4IOMA 1W36B 1L8QA 221PA 2L0XA 4ZDJA 1XP8A 1FQJA 3UANA 1T9HA 3BK7A 3WYAA 1RJ9A 1E9AA 4Q4HA 2R6AA 4OHWA 4CEHA 1GVNB 1NSFA 3AVYA 1ETUA 3OIWA 2VBCA 1FUUA 2LCFA 2VP0A 1OSNA 5D3QA 1NMZA 1YQTA 2FA9A 2PL3A 2JGNA 3BD9A 4Q4JB 3TUZC 1ZM2A 3BC1A 4TL7A 1FPMA 1NN1A 5F9HA 3EXAA 5HCIA 1J7KA 5E4FA 1YR7A 2I1QA 2J45A 4PPGA 4TSFA 5JI2E 2IBMA 2BC9A 2EU8A 4MRVA 1HEIA 3D7MA 3CPHA 3A4MA 4LPKA 4US2R 3QUSA 4QJ3A 3GJ0A 3OFND 3CF0A 5J4HA 1W0JA 2QAGA 2WSSD 1M74A 2FSFA 5FTNA 4OJQA 3MSXA 3MCAA 5EXSA 1E2JA 4IJMA 5EE0A 3OAAA 5H68A 1L7VC 4BZQA 3K53A 4EPVA 4C2TA 1Q1QA 3TQCA 5FR1A 3RS0A 2V8OA 4RD3A 1Z28A 2ZR0A 5IDVA 3X1YA 1GSIA 1XPUA 3ONWA 1R7RA 4PC6A 4FD2A 1US8A 2BOVA 3P20A 4TYYA 2Z0MA 3ADDA 4F93B 4FMBB 2FFHA 4R2HA 3E5HA 4G1UC 3CX8A 2ZSBA 2WWHA 3DOEA 3SS8A 2V3CC 4BFSA 2BEJA 3LBIA 1OW3B 4UQOA 1CRPA 3EZ7A 2I4IA 2QBYB 3NXSA 3RWOA 3LVQE 3CONA 4EPYA 1HE8B 4AWXA 1ODFA 3FDIA 1IN5A 2JLRA 3QXSA 1KKMA 4POAA 3PR1A 1S8FA 1BO6A 3QOFA 2Z4SA 4HATA 4QHTA 2QT1A 3PUYA 2JJ1D 1GRQA 2OE2A 4LUCA 3U60B 2FEOA 4ZO4A 2BHRA 3KXIA 3CKLA 2IYTA 3EWSA 3MMPA 4NYIR 4PSVA 4MDEA 2ORIA 1G5PA 1IY0A 2R9VA 3TRFA 4F7WA 4OI0A 4LJAA 3RRZA 1OKKD 2HF9A 1N6HA 3HU3A 4LCBA 3B82A 4ZDWA 5LD2B 3EIHA 1UEIA 4QHYA 3PXGA 3UKDA 3VR3A 3THYA 3VNVA 3DMDA 5FUWA 1IN7A 3Q85A 2P5TB 3K09C 4XSGA 3FMIA 2Q6TA 2JDIA 4L8GA 4PAOA 2YV5A 1KI6B 3R20A 2QTFA 4IOLA 3A1VA 3T06B 1XTIA 4ZDIA 2ODNA 3KB1A 4AY2A 4Q9IA 1N0UA 1UBFA 2CL0X 2I3BA 3ADBA 1Q3HA 3QEOA 4JJKA 1COWA 4KBGA 1WQ1R 2W6JD 1P75A 4Q9KA 3RC3A 3GLFB 5BXQC 3Q9LA 1UKYA 4TTQA 4DCNA 1Z0DA 4Q9LA 4FWIB 2OSBA 1DG1G 1VKJA 2GXAA 4UXIA 3ZVRA 2XJ9A 3IIJA 2DFLA 3WNDA 4DUGD 1GOTA 5ELXA 5FBRB 2QROA 1Q44A 1R2QA 1OB2A 1QVRA 2G0TA 1SHKA 2GEUA 4JLDA 4MYHA 1XWIA 2VSXA 1AK2A 4ZIRB 2J7PA 4JT4A 2NZJA 4C0KA 1Z22A 2O5VA 4M8NE 3DOFA 3THWB 1AS2A 3CF6R 3CM0A 2ZAOA 5FTMA 3R8CA 1F2TA 2GCNA 3S1AB 1XPOA 2B8TA 2ZI4A 3BB1A 1Z6XA 1E1QA 1U90A 2QN6A 4JLMA 4BFTA 1L4YA 5JFGA 1CJUC 4QM7A 1XTSA 4ZKDA 4B47A 4C0HA 1MRNA 2NG1A 2RHDA 5KDLA 3SBEA 4NCIA 5JCPA 1W49A 1DAGA 3EPLA 1P5ZB 1XMIA 4PZZA 3U3OA 1KHTA 1RRFA 1E2LA 1ESNA 3UATA 4GRAA 4KYIB 4S2EA 2GAAA 3B60A 3WP0A 4DDVA 3KUCA 3HYTA 1E9EA 1G8PA 1HV8A 1VG9B 1DEKA 1P73A 3CRW1 4WOPA 4YMWA 1E1RA 2LKCA 4F38A 3K0FA 1FP7A 1XF9A 2AX4A 1GAJA 1E2PA 3BOSA 3MD0A 3HR8A 4HLUC 3OIYA 1P9NA 4JBWA 1OIVA 4RFSB 1AZTA 4A0RA 3GP8A 5H8WA 3K0FB 1XDBA 2J0SA 4PTLA 3QG5A 3THYB 2GESA 1SVIA 2OM2A 3GLFE 4Q01A 4GZLA 4E22A 4O0MA 2NQ2C 1IAQA 3CRMA 3BH6A 1KO4A 3GMTA 3DM5A 5FTKA 3UMFA 1SVKA 3U5ZB 2XITA 4HAWA 4BE7B 1BH2A 3MWJA 5HKKD 3WMFA 3TR0A 4W9MC 4MYCA 2ORWA 1KGDA 4P4SB 1E0SA 3MG9A 4YXWA 3OEHD 4Q21A 5G3ZA 4V02A 5BN5A 5FPTA 1SKYE 3LLMA 4I1OA 4PO1A 4GMDA 5FUVA 3SJZA 1EFRA 3IILA 1NVVR 2WWYA 2J46A 2Z6VA 2O8BB 3GCGA 2BMJA 2J0QA 1XXHA 2A5YB 4M53A 1XB2A 1E1QD 1VHLA 1YRBA 2OAQ1 3CRVA 4C7OA 2V4ZA 4JLPA 1IM2A 1MABB 2ZI5A 4TTRA 3ZJYA 5K8TA 1M7BA 1KNQA 4RFVA 4Q9JA 5F2EA 3U3RA 3GFOA 2QAJA 3UMSA 4CIDA 2D62A 4E09A 5FL7D 2B92A 1GUAA 1Q1BA 3NTUA 4GOXA 1UAAA 3P27A 2C77A 4GDFA 5HE9A 1KAOA 3T12A 2HYIC 1EWQA 3QPVA 1N2CE 3A37A 1ZAKA 1HQYE 1P61B 1CR0A 1NVVQ 5CB6A 3BRWD 2B7BA 3L8YA 3O8DA 2FGJA 3T35A 4YONB 3TQFA 4ARZA 2GK7A 2QSYA 1W2HA 1ZM4A 1JJ7A 3FHCB 3W6OA 3QNUA 3OIVA 1SGWA 1EFRD 1RYHA 1SXJD 4V0KA 4ARZB 5DN6A 1GRNA 4UNRA 2GVZC 3OEHA 3B6EA 1OXSC 1JB1A 3SDZA 4AC9A 2JDID 2VEDA 4I4LA 5HKKA 2YHSA 3ADCA 3P4XA 4ZCMA 4B2PA 1PLKA 4URWR 1P2TA 4M22A 4FMDB 5FPHA 1KOFA 2IYLD 1XMSA 4Q9HA 2REBA 2WWIA 4V0LA 1KSGA 3BBPA 4B44A 1AZSC 3HDTA 1G3IA 2ONKA 3K0AA 5GJVC 3QF7A 4KAXA 4G0NA 1Z0KA 2CLDX 4IOJA 4LYJA 4Q7LA 1EWRA 1PV4A 4ESVA 1AGPA 4PXAA 3AP2A 4A82A 4DEXA 2O52A 4NKRA 5CDFA 3FWYA 4JBXA 1Z2CA 1GKYA 1QHYA 3U7FB 4TT3A 1YE8A 3KQHA 4G5QA 1OYWA 2AN9A 4XTRA 2EQBA 1AS3A 3I62A 5EUQB 1CRQA 1TQDA 3TAHA 2ZQ5A 4OJKA 5DYGA 2J0VA 2GETA 4PPNA 3SE0A 2EWVA 3PEUA 3EASA 4QHSA 3B9QA 1E79A 4MUAA 5JJLA 5FOUA 3H84A 4BFVA 3KQKA 3DKPA 2X2EA 1J70A 3A8TA 1NRJB 1GITA 2C78A 2QGNA 1FUKA 5JBQA 2YWEA 4FCTA 2CCJA 4MKFA 3U44A 2JJ2A 5CM8B 3GLIA 1UF9A 1OXUA 2VH5R 1XCPA 3L2OB 5D3MA 5HR5A 3OE7D 4Q66C 3RABA 4KJZA 2J0UB 3T61A 2RHMA 3AB3A 4DLYA 5D3MB 4R7ZA 3ND8A 2O8FA 5CK5A 2F1HA 3KFXA 1DG3A 2QP3A 2PX3A 5DGXA 3DEFA 2CHGA 3TJZA 2ZSEA 4GOKA 3TIFA 3U3MA 3B1ZA 3QKRA 1XEWX 2RGGA 3M1IA 1CIPA 2RCNA 1E9CA 1NY5A 4PFSA 4PHGA 3WRXC 2FJUA 1S4QA 1D2MA 4JLJA 2ZROA 4HLUA 2FGKA 1TPZA 2WAYA 3UG6A 1D2EA 2H16A 1E2QA 2A5FA 2QMOA 2A9KA 2EFHB 4LSGA 2WJHA 2Q9BA 1EXMA 1JEEA 1E2FA 2YWGA 5AWFC 3AF1A 4DSOA 1OH8A 4LWZA 4TL8A 3T1OA 3UPUA 2NO6A 2WWGA 3P26A 3Q7QA 3ICQB 3ZH9B 5A4JA 2A78A 1C4OA 2HLDA 1G7TA 3H1TA 4RZUA 2P6NA 1Z83A 1NP6A 2EFGA 3I72A 3N2IA 1M1YE 4OHXA 3KJGA 1VPLA 1W47A 2FFBA 1O87A 2HJGA 2CXXA 2BV3A 2OESA 4NONA 2YOHA 2PLRA 4C30A 3KQNA 1VYVA 3SBDA 1T8TA 3AM1A 3AF0A 1XTKA 3RRNA 1UADA 1OB5A 5KOYA 4QBHA 5HZKA 2FZ4A 4FINA 4JMPA 1KK3A 2FFQA 1KI9A 5FTLA 4Q7MB 1ZP6A 3U44B 4DHEA 2QRNA 4KU4A 2A2ZA 2F1JA 3QVUA 1FX0A 3IIMA 5JI3E 4URXR 4JL6A 4PC1A 2FSHA 5TXGA 2DFNA 1L4UA 4V03A 5J4YA 1U81A 1AA9A 2WAXA 2F55A 2ZYWX 1TAGA 1GL9B 3GLHE 3TSWA 1RRPA 3AP3A 1NMXA 3KQLA 1AM4D 3K1JA 2TMKA 2PEYA 4AG5A 1XTRA 1KJYA 1WRBA 4M4SA 2VF7A 3I1FA 2BKUA 1T3LA 2IYVA 1D9ZA 4B48A 3AUYA 4LHWA 1H8HD 3U7GA 4A36A 4XSHA 1D2NA 3IDQA 1DBSA 4QBFA 2FE4A 4Q00A 1HY3A 3GJ6A 2D06A 3NVAA 3LH5A 2BIFA 1D6JA 3RWMB 2FEMA 2DB3A 2LWIA 3KTAB 2DPXA 2EYUA 2BMDA 1RW4A 2JLYA 5SZKB 4QFMA 3BXZA 3L0OA 4AIIA 1YZUA 3IQXA 3RS5A 3SC3A 1N6KA 4Z8XA 1CP2A 4XWOA 3ZGXA 1Z06A 1II8A 1AKEA 1VMAA 2FMXA 2WBLC 1M8PA 4MUBA 1BKDR 2RMKA 4HZUB 4LJ8A 4U5XA 3B9PA 1X1RA 1VG8A 4BZPA 1R5NA 3DPUA 3EPJA 2DBYA 4CZ2A 4QXAA 1SHZA 2QBYA 1UKVY 2ZRPA 3AVWA 3IHLA 1WCV1 4L9SA 3VFDA 3THXA 1E2GA 3FMPB 2R8RA 4KITB 3FMOB 1U94A 1NF3A 3IUYA 5L3QA 2WWWA 5CIQA 4JS0A 1GP2A 4LV8B 1IOZA 1NVUQ 1LS6A 2O0KA 4DDTA 1A7JA 3V00A 4HI0E 4RKFA 3KKNA 1TEXA 1KSHA 3REFA 5K8LA 4L15A 4HAXA 2G83A 4FMDF 4HLQB 4N1AA 1Z0JA 1KO7A 3PJRA 4D81A 1TQ4A 2CK3D 1BIFA 2QAGC 4HAZA 1E2NA 4OHZA 3SOPA 3WNBA 2ZM5A 4HYYA 2UZ3A 4HDQB 3F0TA 4LRWA 5AJWA 3VAAA 3TAUA 4M1SA 3QG1A 3MUFA 2ZJ2A 4Q4LA 4BUJA 3A1SA 4JT2A 2FPKA 2GCOA 3K09A 3SZRA 3TE6A 2MMGA 5HZHA 2OCAA 1LNZA 4W5JA 2C98A 2QGZA 2XNDD 4XJXA 5A5GA 4A4DA 1J2JA 1OFHA 4MKHA 4ILEA 3LO5A 4XWKA 3VR4A 4KFUA 4DLZA 4U7DA 4E07A 1SVWA 4URZR 4LYFA 4IEEA 2A5JA 1CU1A 3CZPA 3B8HA 3KXKA 3GFPA 2AFIE 4RD0A 1PZNA 4UNNA 2IS6A 2GJ8A 4GP7A 3KTAA 1GIAA 3SEAA 3AVXA 3LRPA 2XZOA 3AVPA 4RZ2A 2GCPA 1UPTA 2PCJA 2RGDA 3N2EA 4F92B 1M34E 2DFTA 3VX4A 5LDDC 5G3YA 5L3RA 4DCSA 2E9SA 2W2XA 1II8B 2WKQA 1NBMD 3J81k 3LXRA 3Q72A 3U6KA 4PQYA 2KSQA 3WXMA 4DDWA 2FU5C 1X3SA 2ZSDA 1YU9A 2CE7A 3AVQA 3SQWA 4A0GA 3IEVA 1ZIPA 2QEQA 1EFUA 3OIUA 1N6RA 4AD8A 4HDCA 1KMQA 2UKDA 4L4UA 3A1UA 2H8KA 1ZC4A 2ZI6A 4QC2A 6Q21A 3NC0C 3AF2A 1EFCA 3VR6A 3ZLJA 5EP2A 4WA7A 1KY2A 3D6TB 4YDHB 3H4MA 4RJLA 1D5CA 3SN6A 3HPQA 2WOJA 3O47A 5LB2A 5FBLB 2JEOA 3EZ9A 4JLVA 2DYKA 1N6PA 2PZGA 4ZV4A 2ZRHA 2Z4RA 2YZ2A 1KYIA 2ZRAA 2X1VA 4Q4AA 4NYMQ 2YC2C 2H5EA 2WJVA 4Q4JA 4QG7A 2VL7A 3TBKA 3FYHA 1YZQA 3EIEA 3EA0A 2F1RA 3LX8A 5L8VA 2XOKA 1E69A 1QHGA 1U99A 2H7VA 4MH0R 2WOOA 2YNMA 3PG5A 1T4GA 1R4AA 4Q02A 4QL3A 2RGBA 4F4JA 4HB0A 1EG7A 1NN3A 4LV6A 3TVDA 2JLUA 1GG2A 4IHQA 2QSZA 1XBTA 2KE5A 3FVQA 3O8BA 4J0QA 3VR1A 3K9NA 4HAVA 3QXXA 3ZZUA 3WMEA 3B1YA 1FW6A 4CYMA 3W34A 1X1SA 4BRUA 1CS4C 4M9ZA 1F2UB 3F5FA 4Q1CA 3T34A 3ETLA 3SJCA 1P2UA 2WZQA 4OBEA 4IDNA 4AKEA 4BFUA 3VKGA 3X1ZA 3P4YA 5FOWA 3CZQA 5EE5B 2D2EA 4TZ0A 3A58B 1XJCA 1N0VC 1SKYB 3EA5A 2ZU0C 1KY3A 3L43A 2J59A 2JASA 3B78A 3ZZ0A 4JZKA 1BS1A 1A2BA 3U7HB 2ZVQX 2V9PA 3GLIE 5DNYB 1VHTA 1W4BA 5DI3B 1XNJA 2UZIR 5DIFA 1G19A 2QT0A 2WJJA 4BASA 3ZS9A 3FTQA 4MDFA 1QHIA 4GFDA 5DHFA 1IY2A 1P7CA 3B1WA 3IIKA 2XNSA 1EGAA 1NJGA 2AFHE 2F3TA 3LNCA 2BEKA 1T5IA 1Z07A 1LTQA 5KNDA 2IW3A 4NTZA 1ZJ6A 2YYZA 2JAQA 2LKDA 3GJ7A 5KUTA 4B3DA 4PPQA 4A6XA 1BMFD 2XJ4A 5FOXA 4JKIA 2WMNB 3JVUA 2E87A 2W2VA 4OHYA 1QBKC 5JS7A 1NSTA 1S0UA 2CVHA 4DLVA 2F9MA 2HV8A 3CO5A 4NZYA 2GWHA 2NO0A 4LHXA 2F3RA 3W3ZB 2O8CA 1WMSA 2NPIA 3L0SA 1Q1EA 4UXHA 3AVVA 1KNXA 1P60A 1AJEA 3K70D 3C5HA 1LVGA 3CPJB 4G01B 3CB4A 1KI6A 1HT1E 1QVAA 2NTYC 1KO8A 5BQ5A 2EWWA 3QJYA 1EFTA 3AUXA 1OE0A 2VHTA 4EPWA 3BH7A 3NHAA 1FFHA 1XZPA 5GJCA 1VDZA 2B8WA 2ZJ5A 3K0CC 3QXJA 5AUNB 1NBME 2W0SA 4YC7A 1CULC 1R8QA 3GEEA 4LJ6A 4XVUA 3U6BA 1CF4A 2GZHA 5L3SB 1G5TA 4A0HA 5BWMA 1XEFA 4B3GA 3K0EA 4P4SA 3ZYCA 1ZIOA 3CH5A 3D8BA 4A9AA 1VTKA 3FPAA 5FUYA 4D80A 1FMLA 1W5SA 1F60A 3AVOA 4RY2A 4MA4A 2R44A 2V55B 3CW2A 3ASYA 3MLEA 3Q5DA 4WZAE 4AK9A 2O8EB 1KAGA 2GZAA 1S1CA 4CEIB 2XXAA 3E70C 4ZDKA 3X2SA 2IC5A 3A6PC 4W5HA 2ASEA 2IWRA 5HE8A 4URUR 5DLQC 4IFBA 4EQ6A 3VKHA 3PUVA 1R0XA 2AD1A 4EDHA 3EZFA 4LGMA 4LPSA 1MO5A 4BECA 1KK2A 1OYYA 2B6HA 4QBIA 2QA5A 1OLOA 3PUWA 2I1VB 1YJ5A 2XB2A 1TUEA 2X77A 1HA3A 2D2FA 3U2QA 5FOSA 2SHKA 5AJXA 4L9WA 4X8OA 5DSZA 2F9LA 1XXHE 4G5RA 1LV7A 4GPTA 3WHLA 4MRRA 4D4MA 2ZI9A 5TV2A 1OXVA 4JLAA 4I99A 4DCUA 1EX7A 3SR0A 3PITA 1W0KA 1P72A 4MRNA 2RH5A 3PUZA 3ZS8A 1JALA 4MYTA 3FGNA 1E1RD 1G7RA 3UG7A 3K9HA 4QGFA 1OJLA 2XB4A 1EFHA 5FI0B 1KO1A 4LJYA 5JHHB 1JPNA 3B13B 2QE7A 4PQRA 4IRUB 4K8OA 1N0WA 2IK8A 2A3RA 4TWZA 4B71A 2EW1A 2EYQA 3CBQA 4QJ4A 5B2ZA 4KHZA 3RSOA 1YR6A 2V6JA 1RFLA 2Z43A 1NLYA 3QQ5A 4M9QA 2O0HA 4P4TA 4KBFA 4OQFA 2IHBA 4C0QC 4OKSA 3QKTA 3OEEA 2W6IA 2XNDA 4DLUA 2QNRA 1AIPA 1IN6A 1XEXA 4RCZA 3LX5A 2GXSA 4LJ9A 1NN5A 1M7HA 2VO1A 1YZLA 3KJIA 121PA 5TDHA 5KPDA 1S3SA 2YKGA 3KFVA 4WZBE 3VHLB 2GJAA 4KI0A 5AK0A 4PO8A 1DOAA 2IYXA 4WXRA 2O8DB 2WKRA 3VR5A 3C8UA 1CR4A 1T3HA 3T15A 1SXJE 4FIDA 3L82B 4GBMA 4PX9A 1LB1B 3GLIB 3PENA 2N1BA 5EE3A 1ZINA 5FR2A 2GTPA 4B73A 2BDTA 1ZM7A 1ZD1A 1K5DA 2C04A 2CE2X 1GKIA 3NH9A 4NYIQ 3TR5A 4ASUD 3LQQA 1JQLB 1DARA 3TSOA 4GI7A 3JZMA 2PJZA 4O25A 2XX3A 1XCMA 5JWRA 4D4LA 1U8AA 4NP6A 3KJEA 1W2GA 5M04A 1R5OA 2IT1A 2W00A 3DMNA 1OKKA 2P65A 1NIPA 3LBNA 3VNUA 1G18A 1ZNYA 3AH8A 3EZ2A 2O8FB 4M0LA 4Q1DA 4TYPA 3A1WA 4EFLA 4TYNA 4DB2A 4MRPA 5AR1A 2ERYA 3U3JA 4XVRA 4A6PA 3CIOA 1FTNA 2YVUA 4RZXA 4QOSA 2X8AA 5JRZA 4C0BA 2QENA 1PLJA 1TEVA 4FI3C 1Y3AA 2ATVA 2V7QD 2CCKA 1XJ0A 2IA5A 2XTNA 1U8ZA 2CDNA 4Q03A 1H8HA 1GM5A 3I5XA 4RSGA 4JVLA 4FWTA 3F8TA 3V4RA 3I4LA 2AL7A 3HU1A 5JWOA 2RGXA 2A5GA 3W8RA 2WTUA 2GILA 3CF2A 4XH9B 2DCUA 3UMRA 1SXJC 2YINC 1T3SA 1AQYA 1W0JD 4M1MA 4C3ZA 1ZW6A 5SZJA 4CF7A 5J4VA 3BORA 1E96A 2YOGA 2C8VA 1DAHA 1Z6YA 4YDSA 3PUXA 4EJSB 2O8DA 1DADA 3CRQA 2XZLA 1RKBA 2RGNC 3C14C 3K8YA 3NIBA 4TLDA 2GF0A 1UDXA 1G8FA 1OIWA 4TLEA 1ZC3A 2ZPTX 1MO6A 4CEHB 2DR3A 5AJVB 2IYWA 2V54A 4GNKA 2GAOA 2JIZA 2VIIA 4DLWA 2OO7A 3FFAA 1G64A 4CEJA 4KFRA 4L16A 1T8UA 2CHQA 1Z5ZA 4KLNA 1P2SA 2GBLA 2DWOA 1NKSA 3LW8A 1K6MA 3KZ1E 2ZUDA 4JIMA 1XPRA 1OHHD 5GADl 3DL0A 3QKSB 4BLPA 5KNBA 1ZNZA 4G5SA 1GNRA 4R98A 4CRWB 3RANA 3QKSA 1RRCA 1IN4A 2ATXA 4Q7KA 4DLXA 1P2VA 1NIJA 1ZUIA 2J3EA 4BLRA 3SNHA 1RYFA 3MGCA 1NVWQ 3KDSE 4DCTA 4LC1A 3VHXA 2PCLA 1UEJA 4TMXA 4YLGA 4C0JA 1U9IA 2W58A 4AG6A 5DN6D 2QU8A 1G1MA 5JEDA 2WKPA 4I1VA 1Z0IA 1ZNXA 2G1JA 5DO9A 4TMWA 2AKYA 3U3KA 3RC8A 2FSIA 1H8EA 1TUIA 2FWRA 2D74A 2ZVPX 3ZZTA 3Q3JB 4TMVA 5IHPA 5KSZA 4TLAA 4B6EA 5UKDA 2NGRA 3B7GA 5L3QB 1P3JA 5FI1B 1A1VA 2BCGY 1J90A 1YR9A 4MGYR 2D7CA 3SFVA 4KVGA 2D4HA 4HLDA 5FUXA 3BS4A 2C96A 2HJVA 5EZ6B 5SZIA 3QI2A 1OPXA 1TF5A 3KXLA 4TQAA 3TK1A 1XX6A 1D8TA 1W7AA 3WMGA 3KJHA 2Q9AA 4BZXA 2IYRA 2JJ2D 3CH4B 1GDDA 1KI7A 1UBEA 2OT3B 3T5DA 1FL9A 2QMHA 2W6ID 1LY1A 3TMKA 3EC2A 3KKQA 1DS6A 5E3HA 3G5UA 1CLUA 2FH5B 1UFQA 4WVFA 1JNYA 2FSGA 4BEBA 4AYXA 3OZXA 1UM8A 3BB4A 4M2LA 2PH1A 3REGA 2XTZA 3ND9A 5JHGB 4XD7A 4Z51A 2UVQA 4M1TA 4V0ME 1SVMA 4CVNA 2FZLA 4G3XA 2W2TA 3RAPR 2ANBA 2JCSA 1R0WA 3EPHA 4LBYA 1G6HA 4TT3D 1OXTA 3LW7A 1P6XA 4JYCA 4HUQB 1RZ3A 2CBZA 5H1YA 1F5NA 2EFEB 4MRSA 1H8ED 4OI1A 1E6CA 2G88A 1LS1A 1FNNA 3BIFA 1W0KD 4DEYA 4HUQA 2IUSA 2ZRJA 1N6OA 4JYBA 4EFMA 5C4GB 2ZE8A 4WZ6A 1HQCA 2IXFA 4BGDA 1YVDA 4V0OA 4B43A 5JCZA 2OV2A 3B5JA 5IF9A 4II7A 1E9BA 1K8RA 2F1IA 4LHYA 3LLUA 2IL1A 3HP1A 2H1LA 1OT3A 2FNAA 3CX7A 2HXSA 3HU2A 1KSFX 2Q3MA 2GJKA 2BVNA 5JSZA 1IHUA 2CHVA 2EFCB 2R6CA 3I8XA 2N46A 5C1BA 4PO9A 3RSLA 1CBUA 1W44A 1Y63A 4LOAA 5DI3A 4HB4A 4UJ3A 5EP1A 1A4RA 3K70C 1Q22A 3H0KA 1KI8A 1IY1A 1QDEA 2H18A 3VMFA 1W36C 4IXMA 3W5IA 1J8YF 2XEXA 4FN5A 1N5KA 3THOA 1C9KA 1G17A 4U00A 3ZQ6A 1IJFA 1TL7C 4OI4A 3WBKA 4MGKR 3BB3A 3ZDQA 2KI5A 1Q21A 1F48A 5DH9A 3TW4A 2OLKA 2ZJ8A 2ZIAA 1QG2A 5C18A 2NO9A 3SFZA 2F43A 2MSCB 4DXAA 3QPWA 1KIMA 4KV9A 5FOTA 3QF4B 4A2PA 4LK2A 5AJYA 5CLQA 4R71A 1CR1A 3CNOA 4ZKEA 2QZ4A 1JR6A 2ONJA 3RS4A 4HB2A 5JEEA 1ZM9A 2XTMA 5JS8A 4D6PA 5KTYA 4D2IA 4NYJR 3AQ4A 4QRHA 5EZ5A 4DLSA 3IQWA 3IO5A 1F6BA 1GL7A 2J7PD 4B3BA 4Q1EA 4N0DA 2WHXA 4NYMR 4DUGA 4OI2A 2QRZA 3GLFA 3TVTA 5C46F 3GJ4A 3T1VA 2YC4C 1M7GA 1BMFA 3NEJA 1CJVC 3W9YA 4M1KA 3NDBB 4BLTA 4B33A 5HPYB 1E0KA 1WB9A 4CGZA 4D4KA 4PQFA 3PEVA 1COWD 4A8JB 2ZS7A 2QPTA 3B2EA 4M1WA 2OG2A 3RLFA 5B58C 4IVQA 1T0HB 4OQXA 3K70B 2JJ1A 5TY0A 1JEDA 3AVUA 2GF9A 5JRJA 4RCYA 2H92A 3GJ3A 4LYHA 2ZRGA 3JZAA 2DHRA 5CB8A 3GQBA 3ICEA 1F3OA 4EKDA 1XTJA 2YWHA 3NBXX 1O3YA 2C95A 2NMVA 3AEZA 1GNQA 1HE1C 2KWIA 3OESA 3NWJA 1KO5A 1VCOA 3THWA 1QZXA 3IO3A 1XU4A 1KJZA 2OCBA 4CT4B 1XMJA 3EC1A 2AWNA 3AGPA 421PA 2V1UA 4TMTA 4N3NA 2ZJAA 4QGHA 3UWKA 5J4LA 5G41A 2HXYA 3AKEA 2FDCA 1W4AA 2GEVA 2QY9A 2FG5A 4DDUA 1MT0A 2VP2A 4DKXA 1E9DA 1OF1A 3PCRB 4PHHA 3T1TA 3R9WA 2OBMA 1SVSA 5EP4A 4Q18A 2ZSFA 2REOA 3KKPA 3LDAA 2FN4A 2XZPA 5KO2A 2G9NA 2ZRFA 2CK3A 2IYYA 2P3SA 1M6NA 4JL5A 3PV0A 1NVXQ 4OQMA 2PJRA 4EAQA 3G0HA 4V0MA 2BCJQ 4XTCS 3M0EA 3GEIA 2ZE5A 5IK2D 4L5BA 1UKEA 4BLQA 1EX6A 4LJ4A 3AKYA 1U0JA 3TNFA 3AF4A 4TMZA 2RB4A 3WNCA 3Q7PA 4I1UA 4MKIA 3HR7A 3GJ5A 4AKGA 3DZ8A 2ZITA 4D25A 2AKAB 1DELA 2P2LA 1A2KC 4IDHA 2ZRMA 3D31A 2O8BA 1UBGA 2H57A 3FB4A 4QBGB 1Z63A 3CNNA 8OHMA 1DAEA 1WA5A 4AKHA 3BH0A 4P32A 4A0FA 4B3CA 1YZKA 5KPJA 3M6AA 3GFTA 1RVDA 3W8NA 5BN4A 4CEIA 2XXAB 1MH1A 2BBOA 4EUNA 3BE4A 1LFDB 4PZYA 1PLLA 2IYUA 4OK3A 2GXQA 4MGZR 3OFNA 1OHHA 2Q9CA 2IHYA 1P4SA 1N25A 3DZDA 4C4PA 2D7DA 2VYFA 3TUJC 3NH6A 4HZIA 3U7EB 1XFAA 3S1AA 3VQTA 1II0A 2BJVA 1PUJA 4EQ6B 3EARA 1KDOA 4FCVA 3WYGA 1Z0AA 5IT5A 2IF0A 4ZCIA 1OXXK 2QM8A 5JMTA 2J9RA 3EZ6A 4ON9A 5KDDA 2ZRCA 4B2LA 1E2KA 2ZRBA 2HLDD 2WV9A 4NCHA 1WBDA 4KO8A 3MJHA 4LHVA 4LZZA 1E2EA 3U61B 2OCYC 3Q5EA 1CTQA 1HTWA 4LI0A 1LF5A 1VG0B 3FMFA 1U98A 4ITRC 5K8IA 2ZYTX 2ZYUX 4JVNA 2JLWA 1VECA 2WJGA 4HAUA 4BLSA 4EFNA 3A1TA 1ZRHA 4K81B 1KSJA 2GEDA 4R9UC 5FBVB 4U02A 2IYQA 3CRRA 1G3RA 2D3WA 3N5CA 2ZE7A 3BWDD 3RRMA 1R6BX 1Z8FA 1G3QA 2G0NA 2C2HA 2VP4A 3X1WA 5EE9A 2FF7A 2ODWA 4AKIA 1R0ZA 1OIXA 3IKJA 1KK1A 1TF7A 2JATA 3TSZA 2OXCA 1VCMA 4OHVA 5G40A 4LBWA 3IBGA 4LX0A 3SHWA 2HCBA 4PHTA 3EX7C 2PMKA 3CUEF 2C9YA 4X8LA 2ZREA 4EJSC 4GP6A 2HYDA 1ZNWA 2HDNB 2ZS9A 2WSSA 1CJTC 1NL3A 3ZIAD 4NCNA 1Z2AA 2G6BA 2QE7D 3ZD7A 2A7QA 5CJPA 2OFXA 2FV8A 2WPDD 3QKUA 4AYTA 5EP3A 4UNPA 4X8MA 4WAUA 1DTSA 3K9GA 4XIGS 1TQ2A 1L2TA 4PC2A 2ZJYA 3VR2A 3FE2A 3R9XA 5CM9C 5JWHA 1NLFA 1G4AE 4KLZA 3C15C 2N42A 3C5CA 2ANCA 1MABA 5EXXA 4Q1BA 2BMFA 4US0R 1QHSA 2NIPA 4RD6A 3EIQA 3P1JA 4KYUA 4UNSA 3QBVA 2FOLA 4Q48A 5H70A 2ZRDA 1DVRA 1U0LA 4JLOA 4JBYA 4C9BA 3V9PA 2GXUA 2J1LA 2ERXA 1T5LA 2QPAA 5G53C 2IEYA 4LDJA 2ORVA 2BMEA 1FOEB 2XSZD 1GKUB 3GLGA 1OH7A 5GVRA 4ACBA 3MWYW 2VQSA 3FKSA 4G5OA 4KVAA 3VKWA 2IUUA 3MRSA 2BBSA 4B6FA 5EXTA 2PLFA 1JI0A 2J41A 4A92A 4IDPA 4I1SA 3BFXA 1G16A 4TMKA 3TKLA 2QM7A 2Q21A 3QXHA 1OFTA 5IK2A 3NBZC 5DHAA 1CKEA 4HLCA 4IOKA 1J99A 1EK0A 1W46A 2CL6X 2DWQA 3SJBA 2WJIA 3RS2A 1TU3A 2GNOA 3QBTA 5KSPA 2AXPA 1E3MA 3HJNA 2BKEA 4ZCLA 3L0PA 1G4UR 1QF9A 3PVSA 5FFMA 2AK2A 2JLSA 1ZBDA 4TYWA 3OE7A 1MOZA 2QMEA 4XD7D 1SQ5A 3A4NA 2VA8A 3QIAA 5DISB 4EPXA 3F3YA 3ZVMA 1RRGA 2IX3A 4W5WA 2MSDB 3SJAA 2ZI3A 5GJBA 2QI9C 3RDPA 2QP9X 3P32A 3NC1C 4Q19A 1JR3A 5A0FA 3TW8B 2WMOB 3NEYA 4D26A 1SVOA 2QP4A 3U4QA 1A5TA 4TYQA 1W1WA 2IYZA 2J87A 4WBSA 4NCJA 2JLZA 2V6IA 4GSYA 3MFYA 4M1OA 3H2YA 1UDWA 2KBEA 1PJRA 1Q57A 2VPPA 1CR2A 2ZETA 5JLJA 2GA8A 4ABYA 4DSNA 2QUZA 1JAIA 1LW7A 5EXPA 4QJ5A 4EJSA 1S9DA 4RD1A 1X8LA 5EJEA 3MWKA 4YMVA 4IFEA 4BFWA 3AKDA 1DAKA 2CNWD 1TADA 2Q3HA 3IHWA 3QXCA 2WJYA 3E1SA 3BAFA 4OK6A 3EAQA 3GLGB 1XD8A 4JSYA 2VSOA 1ESMA 1FQKA 1QHHB 1NY6A 3GJ8A 1FP6A 1RE0A 3QEJA 2X2FA 1S3GA 1OFIA 2OAP1 4Z1MA 2IS4A 2J7KA 5CYOA 2VRWA 2IEZA 3UWOA 2NOAA 3BERA 2VP5A 4DT1B 3EWAA 2GJ9A 2VHJA 1U0HC 2ECKA 5AUPB 4FW9A 3ASZA 5CK4A 1QG4A 1G3MA 1I4TD 2AD5A 3QENA 2QAGB 1S96A 3I3SR 2OEPA 2Z5FA 4JLNA 4FMCF 3T5GA 4OYHA 4DZZA 1YRAA 1Z08A 2CJWA 3RYTC 5JJKA 2BBTA 4D0LB 2WICA 4M9XA 1VYTA 2RAPA 2Z83A 2JIZD 2DFKB 3QPUA 4MITA 4PZLA 3LWNA 4OQLA 3GJXC 1CXZA 4LYAA 4DC9A 4NHOA 2XAUA 3T1QA 3I5YA 1GFIA 2J5XA 4NH0A 4A2QA 4LBVA 3I8SA 1E32A 3NKVA 1ZM3A 1ZU5A 5CYPA 1JR3D 1Q3TA 1DPFA 4C0LA 4MYUA 1G5RA 2GZDA 3LA6A 1GL6A 3UXMA 5DI9A 5KSOA 4GMXA 3RVBA 4DVGA 1BOFA 2PT7A 4TN1A 3CX6A 1N5JA 3RRYA 2B21A 4XVQA 1WF3A 3I92A 1OV4A 4JKYA 4QNRA 1N5IA 1KTVA 3AKCA 1C1YA 4PANA 5AJZA 3B1XA 3PEYA 5F3WB 3LAWA 2VP6A 4OQNA 4HB3A 2VLIA 4B32A 3VTKA 4AI6A 4NCKA 1ZMXA 4NL4H 4XWAA 3W90A 1E4YA 2IXGA 4PAMA 4NYJQ 2HF8A 3CWZA 3KX2A 1QHHA 1R5BA 4LC0A 3KB2A 1WE2A 3X1XA 2V7QA 2ZJZA 3B1VA 2F43B 4IVRA 2OZEA 4FCWA 1G9XA 2VHUA 3QF4A 3I32A 4CEJB 5J4KA 2GCOB 3IPXA 4LJ5A 1DO0A 3EG5A 5TMPA 4RD4A 4UKDA 4C2UA 2XSZA 3Q8XB 3ZD6A 2IYSA 1AKYA 4H1VA 2P6RA 1E2HA 1J8MF 2DWPA 3HPRA 2PX0A 1P9WA 1W5TA 4KSBA 2ZXUA 5BYJA 3AVTA 821PA 3KKOA 1CJMA 2F6RA 1R0YA 2CJWB 1B0UA 1Q0UA 3FHOA 4JVSB 3NHBA 3C7KA 4PC7A 1IXRC 3DO6A 1AQUA 3RS3A 1HUQA 4RKEA 5JZVA 1OH6A 5GVSA 4PAQA 4Q1AA 2QMUA 1JXOA 4NDZA 4ERNA 3KUDA 1N6NA 4B3FX 2VF8A 1YHNA 5BW8A 4P0TA 2B7CA 2GJSA 3QVVA 4HEJA 4B76A 1JAHA 3GD7A 4K46A 2HCJB 1XJQA 1EESA 1G291 1KDPA 1US8B 2PBRA 3B85A 2GHIA 1SVLA 1Z6GA 1F2TB 2VSFA 3SHFA 5DE3A 4H9GA 4DB4A 1XD9A 1HT2E 4DLTA 1XMVA 1U2RA 2C5LA 2ZI7A 2G1KA 4JSTA 4P3YA 3AV0B 4JLKA 1KI3A 3X1DA 1MKYA 2KBFA 4Q7JB 1H65A 4JL8A 5KDOA 3HWSA 4TL9A 4Q4AB 4RVCA 3FKSD 3FHTA 4IW3B 4OK5A 3A36A 3QY0A 5ANRB 1TF2A 4Q47A 3VU9A 5EE1A 3VU9B 1M2OB 1E9FA 4TZ6A 4V0NA 2QQ0A 4KSCA 1QHXA 4YMUA 2AK3A 2JLVA 5HCNA 4DJTA 1RPZA 1FZQA 4IDQA 1MRSA 4EPTA 3BFKA 1GWNA 1Q1ZA 2PZFA 4LJ7A 4NPHA 2WM9B 2NO7A 2CVFA 1TX4B 4JJZA 1BYIA 1ZU4A 5KNCA 4WW0A 2ZRLA 3CPEA 3IBYA 1TQ6A 2BJWA 2RGEA 2ZANA 3W3AA 4IEIA 1YR8A 2ZSAA 3LBHA 3NBYC 4Z8YA 1FMJA 4BWYA 1I4DD 1F2UA 4QNMA 1AGRA 2P5SA 2W0MA 1KJWA 5BYKA 2PZEA 1N6IA 1ZUNB 1ZCAA 2Y8EA 4N0EA 2XGJA 1T6NA 5FBQB 3LD9A 2ODBA 2AXNA 5FTJA 2ZUBA 1VG1A 1GRRA 3E2IA 4HSEA 4XOIA 4A2WA 4PR0A 5AUOB 4EPRA 3R8FA 4TQ9A 3UK6A 4A8JA 1KKLA 2NPFA 4C7OB 5SZHB 3ADKA 1DAIA 4A1FA 1XEWY 4TL6A 5E7IA 4G5GA 2O8EA 2AR7A 2WWFA 4BFXA 1GNPA 3ZVLA 2IS2A 2PEZA 5KYKA 1N5LA 1YKSA 4FXPA 3NDPA 1GZSA 1ZD9A 3SI7A 3UIEA 2PT5A 2QG6A 4GL2A 2X19A 2OBNA 3ZIAA 4BFZA 2ZR7A 3OAAD 1VIYA 4O2LA 1E9RA 4DIDA 1SXJB 3WP1B 2RGCA 1G7SA 2CEAA 2EFDB 1X8JA 3EW9A 4W7SA 2ZRNA 1G6OA 3L0IB 3C41J 5F9FA 3SYLA 3ECCA 4E5UA 1E2MA 1WP9A 2JJ8A 1I4LD 1R10A 3H86A 2NO1A 3N70A 2BM1A 1KZGB 4KFTA 5K8UA 3DDCA 4RFSA 4YMSA 3WBJA 4M21A 4URYR 621PA 2IWHA 4IVPA 4PPFA 1IJEA 1YZGA 3A4LA 2BWJA 1IQPA 3LV8A 4IDOA 4O3MA 4E03A 5C4MA 2CMKA 3WHKA 1I2DA 3TLXA 4F4CA 3HYRA 3LXXA 5KHOC 2A5DA 5CIWA 1IXSB 5J40A 3QSYA 3CR8A 3IEUA 3FFBA 5EUMA 5TB5A 1HYQA 721PA 1XD2B 1P9RA 2MMCA 4PC3A 3VX3A 4ESHA 1IXZA 2FX3A 3LFUA 4LBZA 4CT5A 1G21E 4ASUA 3PQCA 3K0SA 1XXHB 4BEJA 3K9LA 5CJ2A 3V4FA 1FNMA 1U8YA 4F91B 4UXJA 1QRAA 4ZI3A 4DSUA 5L3VA 2WWXA 1ZYUA 2C9OA 2REXB 4ZIRA 1KI4A 4YMTA 1ZUHA 3RNLA 1CJKC 2FPMA 2VP9A 2WIBA 1K5GA 4DBLC 1XCGB 3K0CA 5FPYA 2ZYVX 3WYFA 3WRYC 1PUIA 4LY6A 3LY5A 1S9HA 3GEHA 5TARA 2BM0A 1SXJA 1UJ2A 5DYIA 4Y0AA 4JVMA 5FOVA 4P33A 3OEED 1X6VA 2JLXA 2CLCX 1KDRA 5J47A 2CL7X 4OL0A 2QPOA 4ACAA 2OBLA 2VTKA 1KK0A 2WVJA 1BYUA 2GVDC 2HEIA 5E95A 1YZTA 4KODA 4GT1A 2OFOA 1NI3A 3KQUA 2FPLA 1U9IC 2DY1A 5AUQA 1JPJA 3W6NA 4BPBA 1S1MA 5P21A 3OHMA 2ZU6A 4UNQA 2OLJA 1E94E 2Q3FA 4US1R 4B3XA 3TGPA 1E9SA 3D3QA 1ZD8A 2O8CB 2QQEA 1VIAA 1E98A 3K0AB 4KXFB 2CLSA 2JLQA 4RD2A 1AS0A 4NMMA 1Z47A 2FFAA 3BFVA 3C16C 1E0AA 1G20E 1G41A 1TU4A 2XOKD 2OCPA 4QGGA 2P0EA 5E7MA 4PSAA 2F7SA 5B57C 1MO4A 2EVWX 2QTVB 1HH4A 1WXQA 3WY9A 2KJQA 1IBRA 2ZS8A 5C2JB 1NG9A 5TVKA 4Q5IA 1P62B 1XD2A 3RS7A 4C0SA 1DE0A 1JR3E 4RZ3A 5L3SA 1OFUX 4ZPXA 4B35A 3KKMA 4Z1MD 5LPNA 2ZUCA 2BBWA 1TMKA 4MQBA 5FH9A 4GOJA 1MO3A 3ZQJA 4Y0VA 1G7CA 3DM9B 1Q12A 2CCGA 1ELOA 2KB0A 2ZAMA 4QGAA 4CW7A 1OH5A 4QM6A 2VHQA 1X8KA 3W5JA 2IS1A 1VCIA 1W36D 4P4UA 2RGNA 3W6PA 2ZEJA 5FPKA 2GKSA 3AF3A 4I81A 1KDTA 4NE2A 1DO2A 5CLLA 4B2IA 4UJ5A 5CDFE 2J0UA 4DLRA 5JECA 4GZMA 4KCGA 1NLZA 3I61A 5KSYA 5FPSA 1E2DA 3DKVA 4B75A 3BGWA 3CNLA 3G82C 2V1XA 2ZJBA 1PVOA 4D82A 4PSKA 1V5WA 3MWLA 5F98A 3NG1A 5FL7A 3R7WA 3ZVNA 3LQRA 2IF2A 4DCVA 1JXMA 4M1YA 1X86B 2NZ8A 3EPKA 1E2IA 1NMYA 2ZRIA 3I73A 2R6GA 1A82A 1ZCBA 3M4YA 2ZE6A 4DT1A 1IONA 4BQSA 1MV5A 1Z29A 1W4CA 1UBCA 3FOZA 1HURA 2ZRKA 3CLVA 2E1RA 5LB4A 1E79D 4HDOB 5EQTA 1N6LA 3QKRB 3PEWA 4LV5B 1ANKA 1S2MA 1WDTA 4BFYA 1T0JB 3RHFA 4HAYA 1AN0A 2A30A 1RIFA 3GPLA 1R8SA 3NBFA 3QE0A 2GDJA 2G3YA 1DAFA 1XTQA 2Q0HA 3CR7A 4JLBA 4NBSA 1E0JA 1SZPA 4AYWA 3TUIC 1JECA
chains in the Genus database with same CATH superfamily
2QX9A 3WS7A 2V74B 4D0GA 2NXWA 2VDMB 4CV3A 2CSXA 3C7DB 4F2WA 4UPVA 2B4KA 2ZSIA 2CEKA 2XUGA 3MERA 5C7YA 2HU7A 5ITSA 3KWLA 2DFPA 1GDTA 2XYHA 5KYGA 3DE2X 1U9ZA 2IUTA 2XE6A 3UAXA 3FBTA 2QL6A 1OLSA 2OB1A 4UCWA 2G77B 4BS9A 4HJRA 4AO7A 4HUTA 4KLRA 4JC4A 5AO9A 3MCTA 3PD0A 4L8FA 3DV0A 3W5VA 4BAUA 3B51X 3C3DA 2R1ZA 4KR7A 3DS8A 2V58A 1IM5A 3FRIA 4M9SA 2W83A 2MSNA 4A91A 1PJBA 2G8LA 2GN0A 1P5HA 2N75A 3GAZA 3IQHX 4LTDA 4FI3F 2Q27A 2R87A 3R41A 4PZPA 4O8CA 1NC3A 5E9AA 3N58A 1NT2A 1YL6A 4ZVOA 7REQA 2PDAA 4GWGA 4DWJA 2Y9MB 4Y7CA 1YCHA 1SG9A 3UUGA 4J4BA 3L7BA 3QQPA 1E6UA 3WQHA 3FFXA 4FJ2A 4II2A 2O07A 2FSVA 1MTOA 5K9ZA 3IDOA 2B2CA 4RF4A 4B4DA 1G8JA 3AGQA 4FLFA 1RLOA 2YJTD 3S0JA 4D42A 3IVMA 5JJIA 1J56A 4M37A 2EZTA 3FM9A 3RVRA 4OSPA 4O2BF 3O8RA 2I6UA 1A04A 2CXQA 1UFRA 1LI7A 1VB3A 2VNSA 4MINA 5AKXA 4EIWA 1AHNA 1J0CA 1WLSA 2Q5IA 2QN1A 1EHYA 4DIEA 1MJNA 4L9AA 5DHSA 5AI6A 2IYEA 2YOFA 4B34A 1LF0A 5BNZA 4HMQA 4YR7A 3BTUA 3BQNB 1CNEA 1MQAA 2Y76A 3M89A 1EVKA 4M87A 5BN3A 1G8HA 1KEEB 3BWXA 3E7PA 3DVLA 1L1FA 2I0FA 1G3UA 2GPJA 1L7NA 4AURA 1LTHR 2XBUA 3E4CA 1B23P 4OHUA 3AB7A 1FFWA 1WPQA 2DJIA 4I5IA 4D0NA 3OUTA 3S4YA 1SULA 4MGIR 5C8YB 3HCCA 4JP3A 3V8BA 3K71B 2W90A 4O4JB 1JDVA 2WTAA 3NRJA 4TTPA 4YQFA 2DPLA 3LWDA 4MKGA 5CH8A 4LYEA 4DBLE 3U4QB 2Z8YA 2OECA 1JJIA 3ESYA 4EG4A 1JQJC 4F4FA 2L18A 4CDGA 5HWSA 1XRJA 2G36A 2JB9A 5KHLB 5LDHA 3O3CA 2FRXA 4S2UA 4LS3A 5EY5B 3ZE8A 4IINA 3E6AA 3CTPA 1RC8A 2AFVA 1AMNA 4C3UA 4TSFD 2VHCA 1PP4A 1VCNA 1Z0ZA 1NG1A 1W75A 2RH8A 2XHZA 3OF5A 3QUAA 4EI2A 4Q4HB 1D9XA 3JVVA 2GUGA 2HU2A 1LLUA 2WRZA 4BE9A 4CM5A 1I7LA 2YASA 4NVRA 3LPNA 1Y6FA 4ZDJA 5AK3A 3UANA 3WMRA 1IVNA 2QVCA 1RJ9A 4RPKA 5FTLA 7MHTA 2IOQA 3OQVA 3ZCVA 1NSFA 4G84A 3DBOB 3GG2A 4DQUA 3QX3A 3OIWA 4ZZIA 4ZGGA 4JWKA 5HP4A 3L0YA 2LCFA 4GNRA 1OSNA 5D3QA 4PZ0A 2R60A 4G41A 2OFFA 2JGNA 1ZVMA 4IJWA 4QE3A 4ZI7B 5JOQA 3PGVA 5C53B 4PFJA 4TL7A 1VP3A 1FPMA 1YBVA 5I5GA 4YDQA 5F9HA 1HMPA 5IM5A 1QO9A 1V8FA 1WVGA 1X19A 5GV7A 5HCIA 4I2VA 4AL4A 1T3GA 3ZDEA 1AXGA 4G37A 4EB6A 4BBJA 3VI3B 5JFTA 4PPGA 4ARCA 2J45A 3FHLA 4TSFA 1XZHA 1NF2A 5JI2E 1QRUA 2EU8A 4ZZ3A 3AFIA 1HEIA 1MEJA 1V7CA 3A4MA 3D7MA 1YDFA 1N1GA 2F4NA 2PLNA 3DUFB 3FRJA 4MSUA 3SHQA 3SJUA 4MR9A 1P9LA 3CF0A 4IDEA 5J4HA 4L5CA 1W0JA 1UC5B 2ZPAA 2IKQA 1FVHA 2GR9A 3VISA 2WSSD 3BHNA 4QXPA 5ALNA 1M72A 3C6BA 3BULA 2YYAA 3NFRA 3WK6A 3M6IA 2OENG 4EJMA 1GCGA 2NN3C 2ZFUA 3AOEC 4FFOA 1XYVA 2B30A 5I8ZA 2JAUA 1T29A 2CT8A 1FC0A 3STUA 1DIAA 2P9EA 3I8OA 3K53A 5M34A 4BLUA 4BWGA 1C50A 1KHHA 1T9GS 2V8OA 3V6LA 4DM4A 5IDVA 3X1YA 2RD2A 1J42A 1GSIA 3KOUA 4NDNE 7AT1A 2HA7A 3IUSA 5JZSA 2BOVA 2RHHA 5CFLA 3OECA 4N8EA 3PC8A 2AN5A 2GRUA 1U0SY 3ADDA 3HCDA 5G1OA 4TV8B 2ZJ0A 1JU4A 1F8XA 3O0DA 2FETA 4J16C 2W11A 3CX8A 2ZSBA 1QP8A 5EEHA 3MQFA 2BEJA 1TT7A 1C3JA 4GM0A 1Y8CA 1GGHA 1RLMA 1OW3B 2D5LA 2I2XB 2R11A 3A06A 4DPMA 1ZGJA 1JIJA 1ZVVA 3KBOA 3RWOA 3H11A 4KQKA 3JQFA 2LVBA 3ITDA 3UFBA 4DCPA 2BSQA 5HA5A 3KJZA 4AWXA 2OHVA 1ODFA 1FDOA 3FNQA 4RF5A 1R6TA 5DHRA 3RF6A 3DMGA 4N47A 1IQRA 2HH9A 5C5DA 3ILYA 1M66A 1IH8A 2V4UA 4I5FA 4AKTA 1BO6A 5ICEA 3HKBA 4DIMA 3WKEA 2O2DA 2OE2A 4H7PA 4P53A 4WXEA 1Y98A 4N39A 3WK9A 2HJRA 2W2LA 3OZTA 4NYIR 4ZQBA 3T3PB 2IYTA 3OLXA 3H7IA 3VHQA 5AVJA 2EBUA 1L8LA 2ORIA 3KR0A 3HMKA 4BKOA 4DR2B 3NR2A 3WV5A 5H9WA 4LJAA 1RI2A 2VWQA 1U2PA 3AJAA 1ULHA 4DWVA 4ZDWA 4L72A 3TOSA 1A7UA 3CSDA 1FS5A 4FSHA 3ZCQA 1OQAA 3TG2A 3UKDA 2Y0PA 3PDHA 2R4QA 4UM7A 4LNUB 5BRAA 2P5TB 2IEAA 3K09C 2Q49A 3AJEA 2Q6TA 4PAOA 1ZBQA 2NV2B 2RK3A 4C4AA 1E77A 3CF4A 3DOJA 3R20A 1EZZA 2NVUA 3OKAA 3OPVA 4P2GA 1KQGA 3A1VA 1MLDA 3GDGA 1XTIA 4IUDS 1ZOIA 1CIVA 2QIOA 1ZH4A 2CVPA 2NXEA 3DT6A 3KB1A 1IUNA 4ILKA 2WF9A 5AW2A 5JPCA 3KQOA 4AY2A 4YAWA 2I3BA 1UBFA 2VH2A 3L02A 4JJKA 4DUPA 2PWBA 4UEKA 4BO8A 3KEOA 4KBGA 2W6JD 3WVNA 4BOYA 4CL3A 3Q9LA 3WZLA 1N3IA 3U0BA 1XTVA 2BRUA 1HRKA 4MB0A 4D9CA 1Z0DA 2QHXA 2W71A 4FWIB 4Q9LA 5JV5A 4PFQA 1VKJA 5A02A 1KAQA 4HTFB 5DEOA 4UXIA 3WL4A 2GAFA 3DOIA 3ZVRA 1IY8A 2GXAA 2DFLA 2XCTB 2GPWA 5FLKA 2QROA 2DQZA 3EXFA 3QFCA 4HWTA 2G0TA 4LQ4A 4JLDA 3VDMA 5HIAA 1XWIA 4Q9DA 2VSXA 3R6WA 4ZIRB 4HRYA 4J1TC 4HFMA 2VCEA 2V7VA 4YN3A 5E1DA 2PH3A 2O5VA 5DCUA 1Q11A 1C9NA 4WNIA 1TO2E 3RVDA 5DWVA 1F2TA 4RQAA 3PQ8A 1H5QA 3S1AB 2GEJA 3LRTA 3WLJA 4AZ3B 5KX5F 1OFUA 1YCDA 4AW9A 1KFEB 2YFQA 1L4YA 2NVOA 5JFGA 4DUYB 4FJ0A 1EIWA 4Y2GA 4ZKDA 4DAEA 1MRNA 4BL5A 1EXNA 5KDLA 3SBEA 1CSEE 4BVAA 4OYYA 4A0GA 1ULZA 1P5ZB 4PCVA 3U3OA 2JLCA 3IEVA 1RRFA 3E84A 4OBWA 3UATA 3FROA 4L2IB 3C8MA 3IRVA 1L4FA 4TOIA 4QSHA 2DSNA 3DA8A 5EIWA 2QVGA 1RRVA 3O83A 4Y2TA 1HV8A 1DEKA 1P73A 2VPYA 1QGED 1FTYA 4XUEA 5B36A 3CLRC 2LKCA 4XJSA 3TWOA 3K0FA 2AJBA 1OTHA 3D1LA 3LNTA 4PHCA 3BOSA 2AX4A 2VK1A 3GJYA 2I67A 2Y27A 4LRYA 4WLOA 5KOJA 4PRKA 2KHZA 4YV1A 1P9NA 3WRXA 2D1QA 2H8GA 1OIVA 4RFSB 1AZTA 3U9SA 1Y8QB 1XDBA 4N0QA 4YCBA 3JQGA 2DBQA 2WIFA 3KK0A 5BSUA 3GLFE 1RS0A 4GZLA 1J5XA 3W4JA 4BNKA 4O0MA 2PKQO 3IT1A 1IAQA 3CRMA 2PVPA 3BH6A 4YRQA 3GMTA 1QH1B 4TKLA 3UMFA 4PCLA 3LKZA 4RJTA 2HSWA 1FSFA 3L7DA 4HAWA 2GNAA 3D8TA 5CPFA 3G9QA 4KYVA 3WO1A 3MWJA 4NG4A 3KBBA 5HKKD 3TR0A 4W9MC 2Z2YA 3O93A 1UOPA 3RRFA 2FRVA 3IODA 3OEHD 3VPDA 1SQ6A 4GVXA 3BK2A 5BN5A 1SKYE 3LLMA 1BXZA 2H51A 3CF4G 3MOSA 4GMDA 3SJZA 3W9BA 3QW2A 3DKRA 3IDZA 3SEZA 2WWYA 2Z6VA 3GCGA 2HU5A 1X7XB 4DC0A 4ZT5A 4YT5A 2BMJA 3LA8A 3TX6A 4KN8A 1VHLA 4KQFA 3Q3EA 3A3OA 3ZX4A 1ECJA 3GW8A 3OLYA 3GVIA 4WD3A 5LYYA 3LVFO 4COOA 2I7VA 3IHTA 5CYGA 3OY2A 1KNQA 1XV5A 5AIBA 5MN4A 2IIQA 3ZLVA 4AY6A 3EF1A 1LFAA 3U3RA 3GFOA 2QAJA 5SYNA 5JZMA 4NEHB 4GXTA 2A1UA 2D62A 1NBOA 2WTXA 2Q2QA 1L6IA 2QSJA 3A0RB 3I2GA 4R8MA 1GUAA 4E09A 1Q1BA 5DHUA 1LSJA 5BW4A 5LZ8A 3PA6A 2WNHA 3VZBA 3ZC3A 1OZGA 3QFTA 2OQVA 4GDFA 1HE4A 4H7KA 1HL7A 1IZ8A 1N2CE 2A5LA 2H08A 1ZAKA 3LP6A 4MW7A 1EWQA 2CKMA 1CR0A 2FY8A 1E1YA 1H4VB 1B43A 4I4TB 4F56A 3OP1A 2FMKA 2GK7A 2CJPA 5HF6A 2D13A 4MW2A 1ZM4A 3GGCA 2WF5A 2JAHA 3WWOA 2OAEA 3OOEA 3L79A 1NLMA 2R96A 1SR8A 3KQWA 3FPBA 4UNRA 5HUJA 3ZGLA 3DONA 3OEHA 4L5YA 2JDID 4I4LA 3LC7O 3DBRA 4I9NA 5HKKA 1PWXA 3RYCB 4NECA 6REQA 1BE6A 3L4BC 1P2TA 1QVWA 3F47A 1TVKA 1XQ6A 4FMDB 4YK7A 4A16A 4KUGA 1ZWLA 1KOFA 1OR8A 4QTTB 4Q9HA 5ALHA 4EY5A 3MT0A 4V0LA 1KDYA 3BBPA 2PVCA 4K9LA 2H4WA 1CPYA 5JDCA 1QE3A 3VGPA 2OM6A 2ONKA 4KIJA 1YB6A 3ZWOA 2H4FA 2DUJA 4KI7A 3OJEA 5CPBA 3GN2A 1WWKA 3E7XA 2C7GA 2FZGA 2NZWA 1BXGA 3D8SA 3WGGA 1QVZA 4J1QA 2O48X 1WOYA 3L6OO 1RQPA 4A82A 2O52A 1WHTB 2NP6A 4QQ8A 5ALOA 4G4IA 4JBXA 5I48A 1Q1GA 4CFZA 3U7FB 3KQHA 3RUIA 2JIBA 3WRVA 3E35A 4RYLA 4XTRA 3F90A 1C3OB 3WLEA 5EUQB 4IIDA 3C7CB 3EGDB 1ABBA 1IZYA 3EQ9A 4OJKA 3G5LA 5DYGA 4BO7A 4XQEA 5JBIA 2H0QA 1TYDE 3SE0A 5M7EA 1TZ2A 3EASA 4YA6A 4DA0A 3TZKA 3ANYB 3L07A 4QDJA 2RHBA 1YVRA 4G85A 1T5BA 1ND6A 4WL0A 4BFVA 3MLBA 2YJ4A 4D3XA 4HR7A 5EN4A 4X1KA 5HGXA 5FBZA 4AZ0A 5JD5A 4IHJF 1DAOA 3FSGD 3G8BA 4G63A 5GV8A 1REQA 3HCEA 2YWEA 4GWLA 2QM3A 2XDYA 4C07A 3B1FA 1G2IA 3OICA 4P7FA 3L0BA 3CEAA 1XCPA 3PJFA 5D3MA 4B45A 3I2IA 3PTZA 5HR5A 1B0ZA 3RABA 2A1TR 2VT7A 4I50F 4V2IA 4ZRMA 3T61A 3IVXA 4KREA 3HGTA 4IJQA 4F6RB 2O6LA 3IMFA 3PSAA 1PL6A 4DLYA 3RAJA 5M29A 3U17A 5T5QA 4XJTA 2FEAA 2PX3A 3B3JA 3DEFA 4IDDA 3U3MA 4X3OA 4TLMB 1XEWX 3M1IA 5BWOA 2FSSA 3VKVA 3Q2IA 1K7FB 1NY5A 1DC5A 2ENUA 2ZPUA 3E05A 2EGUA 2FJUA 1S4QA 1D2MA 3M6VA 3QX9A 4ME6A 2FGKA 4GGMX 2PT9A 1D2EA 1TXGA 3LTEA 4X85A 4EF4A 5GZ6A 5B7QA 4V1CA 5K2OA 1U3CA 5AXBA 5LZ5A 4B84A 4GBJA 3DGEC 4OHRA 4WECA 2WJHA 2Q9BA 2ZWMA 3GNLA 3KZOA 4D74A 5BN3B 2QLNA 4KQXA 1JEEA 1E2FA 2XIQA 2G08A 4NE9A 5A3QA 1D09A 1TK2A 2INGX 4UVEA 1RZUA 3VPHA 4R16A 3D6JA 4EG5A 2JBWA 1UFOA 4EUKA 2BCEA 1SUAA 1PL8A 1MB3A 2PXXA 3SK0A 3ZH9B 5HJEA 3AHGA 2NZ2A 3A6DA 4UPDA 3H1TA 2XB6A 3MXTA 2A0XA 1WQ3A 2YRFA 5JBNA 1Z83A 1TKBA 1QG6A 1EINA 1NP6A 2A9OA 2EFGA 2FZEA 5A4KA 3N2IA 1RBQA 1EAYA 3MWEB 4BB0A 1QF6A 3VZRA 2GN1A 3DLTA 5ARCA 2X40A 1W47A 4EY6A 1O87A 1R4MA 1R66A 3JVIA 2XPCA 3U39A 1T24A 4RULA 3RYIA 2B82A 1O9GA 1ZD4A 4NONA 4AY3A 2PLRA 3G17A 3O92A 1EVJA 1Z5WA 2O7QA 3FTFA 1L3BA 2R8PA 1ISRA 3NTXA 5AFSA 5DXFA 3AM1A 3C4VA 3AF0A 3AOEA 1M2NA 1XTKA 3FCSB 2QNBA 1OB5A 1HLPA 1UK8A 2XRMA 4KRGA 5HZKA 4Z2AA 1KI9A 1EAMA 5K0EA 1TZKA 1ZP6A 1XMXA 2HIHA 1UBLS 3MTJA 2O7RA 3QFRA 4KX5A 4DHEA 2A2ZA 4FOOA 1CZNA 4DF3A 3C3PA 3NO4A 1FX0A 4IG9A 5DGCA 3RJ9A 1P1JA 3W2HA 5IX8A 5JI3E 1I3MA 4PC1A 5TXGA 2R47A 1XZ8A 2DFNA 1U0GA 1NVGA 2E5FA 4HX2A 3W5UA 5J4YA 1NMQA 3SMQA 5IAKA 3UB4A 2JGJA 3DZIA 4WEOA 5DZSA 2QU7A 5G4KA 1WY5A 2ZYWX 1KOJA 2OCDA 4CTOA 1SPBS 3D2CA 4JYMA 3ROXA 4PN3A 1NMSA 1FDWA 2AUMA 2DHEA 2TMKA 4BJ6A 3IB3A 1WJGA 1XTRA 1ZR4A 3K92A 5DNAA 1ZFNA 2VF7A 1PEAA 4WH0A 4BJHB 5E3JA 2QTNA 1NXQA 1T3LA 5I7VA 3G0GA 3T1YB 1PSZA 3F5MA 3ZY3A 1TCVA 4CTMA 4OG2A 3GVCA 4ZAZA 3OJLA 4JJ7A 4KE6A 4DR6B 1M2HA 1HY3A 2QUHA 3NVAA 1VJCA 1JSLA 2BIFA 3OLVA 3IMGA 1NXSA 2PIAA 2DB3A 4C7KA 2XMQA 1I33A 3AHCA 3KTAB 4CLOA 2EJBA 4Y2XA 1PZGA 3UV7A 1R0BA 3FRHA 4DCJA 2JFBA 1JLRA 5SZKB 4AIIA 4EY3A 4DIBA 2GZ3A 4IHKA 3IQXA 5U9CA 1CNFA 2JRCA 4N03A 3I2JA 4Z8XA 2XNJA 4ZYUA 3ORRA 1TAHA 1Z33A 1NTRA 3BHMA 3GXBA 5AOAA 4V0RA 2QR3A 2WBLC 3JALA 4I08A 1M8PA 1H6CA 4IBOA 4MUBA 1LGYA 3K5WA 2FW8A 3VYVA 5IT0A 4FMPA 3ZHCA 4UW9A 2R7NA 2VVTA 2EP5A 5AXDA 3E7WA 4E6EA 4HL6A 4YFVA 1FRNA 1R5NA 3N2KA 5D2CA 1AY0A 3GJSA 2DBYA 5JXHA 2X5OA 4BV9A 1SHZA 5B55A 3IQEA 2ZRPA 5C37A 4QO8A 4L9SA 3CW9A 4JH0A 1NKVA 1H4SA 1ZY2A 5L3QA 3IUYA 3P2KA 4L6IA 1T25A 4LI3X 1EHIA 2VYQA 3QM1A 4KQ6A 1GP2A 3LBAA 1IOZA 2IE8A 2P9GA 1LS6A 2VG8A 4MV3A 3OX1A 3ZNOA 4E70A 5C3MA 4R9VA 1A7JA 4RKFA 1CQZA 5CYOA 1YJXA 3HG7A 1WIWA 2BZGA 3HA7A 1G1AA 5KWSA 2XMDA 1U1EA 1BFUA 2YVKA 3KLOA 1PFGA 2RKWA 4N1AA 3WWZA 2P2GA 2BGKA 1GAEO 4QUDA 2Z2XA 1KQNA 1TQ4A 5LQKA 1BIFA 1GO2A 1XJWA 2W6CX 3AILA 4HAZA 5EFOA 4RV5A 4HYYA 3AR5A 1X15A 1GLVA 4OGGA 3F0TA 1F9EA 5AJWA 3WIVA 3TEJA 3N0XA 3QG1A 3NGMA 2WU4A 3GRUA 4DJEC 4JASB 1ZGGA 2FPKA 4JT2A 4PF1A 3SZRA 2ZQYA 3JCZA 3K5IA 4MULA 4TRJA 3VZSA 2O3RA 5HK8A 4DV6B 2Q5FA 2C98A 2XNDD 1LKZA 2F67A 3O95A 4A4DA 3NMUF 3ILSA 4S12A 1OFHA 1Z25A 3PQ5A 4W99A 4WFIA 4CMAA 3FOCA 5BWLA 1FJXA 3LO5A 4GYKA 1EFDN 4UHCA 3GHYA 3OU6A 5ESWA 4U7DA 4LGCA 3C3MA 2G8NA 4E07A 4URZR 2ZYHA 2VATA 4LYFA 3CZPA 3B8HA 5A1JA 3D7SA 4MP6A 1FSZA 1PZNA 2GJ8A 3HJCA 3W4KA 1Z6QA 4BZWA 2VYCA 2XZOA 4LXHA 4RZ2A 1V5GA 1UPTA 2BFBA 4JOQA 2X0KA 3N2EA 3PWKA 2AC7A 4UUPA 1TW2A 3A9UA 5LYJA 1U7ZA 2DOKA 4DCSA 2W2XA 1II8B 5E8RA 1P33A 5CLFA 1HG1A 1NBMD 1VYHA 2Z1DA 4I5GA 3O90A 3Q72A 5DW0A 3PI6A 2KM1A 1BA2A 3WNVA 2A9VA 4DDWA 5F52A 4J1SA 1X3SA 3MTIA 1YSCA 3UK7A 3TLCA 1YU9A 4MUHA 3G59A 1QB8A 3C3YA 1DKQA 5JCXA 3T5PA 4EO7A 3DJFA 3OM9A 1N6RA 1XU9A 2XWPA 3FVRA 5KINB 3IHLA 4QQKA 3UCFA 2H8KA 3PJGA 2FRDA 3X1JA 1C8KA 1W35A 2P6MA 3GT3A 3MIZA 5B58T 4L75A 1ISSA 1EFCA 4BO6A 2MU1A 2OR3A 4W5OA 3D2BA 1WU8A 3SN6A 1KY2A 4YGYA 5JRDS 2HRRA 1D5CA 2RI1A 3MM4A 3O47A 3WB1A 4J1TA 2JEOA 5FBLB 3EZ9A 3H2JA 4U39A 3UOWA 3MJSA 2ZRHA 3QMWA 4FE3A 3D8RA 4QG7A 2OAGA 2YC2C 2WJVA 4Q4JA 4DIUA 4CIYA 3TBKA 4N82A 1GFZA 1RSZA 3JASB 2BKXA 3FGPA 1YZQA 5HS4A 4W5TA 2AOUA 4B4OA 3L1HA 4YJHB 1OJ7A 1EIZA 3ZCRA 1PRYA 1PNQA 1I6MA 1OWPA 2H7VA 3DD5A 3EGXA 3PG5A 4BC0A 4CU2A 4PTZA 2YBEA 1PS8A 1IQUA 1ECLA 3JQGB 4Q02A 4QL3A 3DBIA 4EHDA 3L8DA 3PIDA 4HB0A 1NN3A 1P1RA 4LV6A 2JLUA 2WB2A 1GG2A 5IPFA 1Z7BA 4IHQA 2P2ZA 3WX0A 4DANA 4EF5A 1UMBA 3W5AA 4J0QA 1D6MA 2Y2VA 3K9NA 4LDQA 3ZZUA 3TL3A 3THSA 4P86A 1FW6A 1I4OA 3INYA 3FGZA 3SP1A 4LY0A 4NU5A 4W6QA 1HDRA 3ZWWA 3CR3C 4RM3A 4MV5A 4M9ZA 4B5LA 2WHRA 4BFUA 4IDNA 3TLZA 4GQBA 4AKEA 3K8QA 3VKGA 5CNIA 4BO9A 3X1ZA 1YJBA 2WUEA 2XF8A 2XUIA 2FWIA 5FOWA 3QOYA 5CDGA 3A58B 4LTNA 1SU6A 1N0VC 1R8YA 4X62B 1DJOA 1SKYB 4OB6A 5BMVA 4PSDA 2J59A 4JENA 3MHTA 1I51A 1BX3A 1M0TA 2J32A 3L1JA 3LY8A 4WVLA 2B3DA 2I6FA 2ZKLA 3R3YA 4OF4A 1DRUA 1A2BA 2V9PA 3F6BX 2JEZA 1WUJS 2GNPA 1W4BA 1DBPA 2QIPA 2ZCUA 5DIFA 1R0RE 4HN2A 1FU7A 2VH1A 2O7VA 3AZPA 3DQPA 4BASA 1CFZA 2CBXA 3IIIA 5ADUS 3EXHC 4QOEA 1Z34A 2PGIA 2QSUA 4EP1A 1PNVA 5BOSA 2B0CA 4I4TA 1VFPA 5FUQA 2AFHE 2PK3A 4O4LB 1BRTA 4P6VF 3ZV4A 1RMTA 1Z07A 3RBVA 4WKNA 1IEXA 2IDZA 3SS9X 2AQKA 1WDKA 4NTZA 2LKDA 3KHUA 3E03A 2HBQA 1DC7A 3GJ7A 4HPXB 3TW0A 2G67A 2X23A 5I7SA 2C82A 1CQWA 3P5SA 1E63A 2P4HX 2BEWB 3A31A 3BXPA 3JVUA 3LUGA 3S1LA 3VAZA 3MYRA 4L28A 1NSTA 1ORVA 1NM5A 3IMKA 3DBRB 2RHRA 4OIFA 6REQB 2GWHA 3X43A 4I46A 2EKQA 1TVKB 4PGAA 2O8CA 5E38A 1Q1EA 5AICA 2H65A 7MDHA 2IXTA 4ZGWA 4XR9A 4MPJA 1YJQA 2VSYA 4D9NA 1KNXA 4F6LA 1AJEA 2BEUB 2WTEA 1XRNA 4WESB 1YUNA 1SO8A 1PQUA 5EWMA 1KI6A 1HT1E 1QVAA 5BNFA 1CYDA 3ZV7A 2EGGA 2EWWA 3R44A 4WGGA 2OCLA 1HL3A 3FVVA 3CXUA 1A7AA 1P77A 3F96A 4LXUA 1H2YA 1XZPA 5GJCA 2CFIA 3QXJA 5C3UA 1QH1A 1NBME 2W0SA 5IZ4A 1CULC 3CHYA 4MO9A 4MUJA 5K6RA 2F1OA 3LCUA 5CCEA 2GZHA 4BU0A 5INTA 4FFMA 4A0HA 5BWMA 2D59A 2WM8A 1XEFA 3ESZA 4JP1A 1D2GA 3UYKA 1UJ6A 5JW6A 1YNOA 3D8BA 1VTKA 1ZG3A 1T2CA 3S2YA 4P93A 1FMLA 3W5HA 2PLWA 4RY2A 4ZMSA 4MA4A 2R44A 1Q5PA 2V55B 3CW2A 3Q5DA 5CCDA 4DAOA 1KAGA 2GZAA 2CHEA 3GUHA 3HABA 3MRXA 4MQ5A 4RWZA 2FX5A 5BN4B 5LZ7A 5IXYA 2IC5A 3GA7A 1B2LA 1W1UA 4MQEA 4W5HA 4AXXA 3A6PC 4G0XA 1E6MA 1SKAA 1KPIA 3M6WA 3PUVA 4OXRA 5HIJA 2WT4A 3R75A 2ECFA 2AD1A 1NULA 1TO6A 4LGMA 3OZBA 1LRLA 4BECA 5ES3A 3PFFA 2B6HA 3V8EA 4BQOA 3FPKA 5HEKA 1K7XB 4H08A 1B1CA 1LJUA 2NU7B 2PX4A 3MTEA 2HPVA 4OIMA 1CJBA 2X77A 1T0BA 2R97A 2I1LA 1KARA 2B5WA 2WMYA 3KYBA 4G5RA 5DP1A 4WZAB 3WHLA 3O38A 4H18A 4YECA 2F8TA 4REQA 2P0AA 1SBYA 4F3TA 1XALA 4DABA 4I99A 3T0IA 3VPBA 2JHCA 2DLNA 3KIPA 4R1OA 5CDYA 4CCYA 4DVJA 4MRNA 1JALA 4ZYZA 3ZUPA 4W82A 4K6OA 1AVTA 3LT2A 1G7RA 4QGFA 3HCAA 1L8XA 1EFHA 1ZEMA 1E6WA 4HVAA 1KO1A 5JY1A 2P30A 2PSDA 5JHHB 3FOFC 1YA6A 2FR8A 4LOKA 4PQRA 2PFKA 1RCUA 2WMDA 3EGOA 2I9KA 1QTNA 1TJ3A 1XSEA 4KACA 5LQMA 4R0VA 1DBWA 4RW0A 2Z43A 1W25A 4B9AA 1EK6A 1NLYA 1T5SA 2VTBA 5EZYB 2R5NA 2CJXA 2WYHA 1KZYC 3ETCA 5ALZA 4OQFA 4RAOA 4UOZA 1I2CA 3D4OA 3EOBI 2BFDA 1LBEA 4RY0A 3K8ZA 4DILA 5GIOE 3L7YA 2QY6A 3E5NA 4OHCA 5GMOA 2DP4E 2QNRA 4EKYA 1IN6A 1XEXA 4U7WA 4W5RA 1RPTA 2HBRA 2GXSA 3LX5A 3QE4A 4RV4A 4BO1A 1ZX1A 2BGJA 1L5MA 1F6DA 1WO8A 3AIKA 1NN5A 3DF7A 2VO1A 4MTCA 1FFSA 1VA5A 4HDKA 4I5DA 4RZQA 1NBWB 1KIAA 1VKRA 1S3SA 2YW2A 4LRSB 4WZBE 5ILQA 1S6YA 3VR5D 1WKVA 2HF7A 1S2DA 3Q41A 4WXRA 2W8BA 5BW5A 1CR4A 2P5YA 4R8KA 2PRKA 3JQ7A 1SXJE 3GLIB 4GBMA 5EE3A 4AF6A 1U6JA 3RFTA 1TU0A 2HFKA 4RMGA 1IMJA 1SC3A 1RKUA 4R1PA 3WDSA 2CE2X 4AZ0B 1V7ZA 3CGGA 3O21A 1XZAA 3HYSA 1U5AA 1ND5A 1JYFA 3P8ZA 1GA6A 2G9RA 2NTNA 4DS3A 1DARA 2JK0A 1IB6A 2I3DA 3W04A 4ARBA 2V45A 4O5AA 1HLGA 2PJZA 4FYJA 4HDMB 2XX3A 1DQPA 4QYMA 1O0CA 5JD3A 2OYCA 4QATA 1U0RA 4DJDC 4XRRA 5JWRA 1VSVA 2AZDA 1YS7A 2LDXA 4HRVA 2QL5A 4UFPA 1E7YA 3MW8A 3C5VA 4N7MA 4Y6SA 5NULA 3AHEA 4KR9A 3W6ZA 1R5OA 2IT1A 4OQQA 2GH1A 1G5HA 4N3AA 3IUNA 3DFMA 4C22A 3IV9A 1NASA 3OT5A 4DR1B 4LA4A 3GYGA 1L4NA 1ZLYA 3DH0A 4TYPA 1JZTA 3A1WA 4JEIA 1GTJ1 1LPAB 4TYNA 2WM2A 2VF5X 4DB2A 3IQZA 1SQSA 1MAHA 4HH0A 3EVDA 4ETMA 3WIOA 3K9WA 4O4IB 4DFDA 1YTUA 1YIOA 2QENA 5CFRA 1XNRB 2QM0A 4J0IA 4RO0A 4ETNA 2ATVA 2CCKA 1PYGA 3JQ9A 3BRSA 1XAGA 2WUWE 1U8ZA 2WIDA 10MHA 1K3UB 1H8HA 3WDLA 1L5LA 3I5XA 3KAKA 4XLLA 3WB0A 2OGUA 4QXQA 3CC8A 5TRTA 1Y1RA 2H1OA 1N9ZA 3PHJA 1CY2A 2AL7A 5JWOA 2RGXA 3EVAA 3W8RA 2WTUA 1V5IA 3BK1A 3O4RA 2AW5A 2O14A 2PZKA 3A7EA 4EG3A 5JIBA 5IFKA 1JAZA 1EZ1A 4UAUA 3GROA 3WIBA 3DV0B 1AQYA 2X0NA 2X9GA 5SZJA 4E88A 2DMRA 5BQOA 1N3YA 1S2GA 1JB9A 2SKEA 2OVFA 3L84A 3EMKA 1N2JA 4EFDA 1XHLA 4YDSA 1Z6YA 2OXIA 4EJSB 1U8XX 4ZZ1A 4ONEA 4QDTA 4J7CA 4BMSA 3O3NB 1ODKA 5BQPA 1F0YA 1JLLA 1K3TA 4CWAA 2HGZA 2PGOA 4CE6A 1ETHA 4CKYA 2X5JO 3C14C 2XZLA 4GR5A 2AE2A 4HEQA 3H3JA 5ALWA 2DPYA 3S2SA 1N5OX 2JI7A 2POQX 3M4XA 1KQOA 1EGMB 1VRCA 2WILA 1WTCA 1E5LA 3NAZA 4QGSA 4TUYA 4UHBA 4WNAB 4Y2HA 2GAOA 3PS9A 1QH8B 2O1WA 3EDCA 4RJJA 3TIXB 3QNWA 4CEJA 4F1KA 1NHWA 3P0EA 2VQEB 3BBLA 1Y8RA 4KPGA 5AXAA 1RNLA 5HF9A 3RUCA 1OLUB 4JJ8A 1Z5ZA 4KLNA 4TRNA 1P2SA 2Q1WA 3RTGA 4R54A 1LW6E 4LRUA 2GBLA 5DLPA 3H9UA 2PWYA 3NOVA 4TPKA 1XPRA 4OX9Y 1VJ1A 2E4AA 4MVJH 1OAKA 4BMOB 1FYEA 4H6XA 2B36A 1UBTS 4R98A 4CRWB 2VHEA 1WCWA 3RANA 4GLFA 2QD3A 1IN4A 4DPLA 1RRCA 4Q7KA 3AEXA 2HMWA 4Z1OA 1LLQA 1ECBA 3ULKA 3VZQA 4R3NA 3PJEA 3RGGA 4DCMA 4R9RA 1OLXB 5IDXA 5GPBA 4YAKA 1MORA 2JPDA 2YQ5A 2QTAA 2YIVX 4DARA 3RSZA 1G1MA 1NW8A 3IVRA 5JEDA 3A4YA 1CQIB 3L1UA 3LT5A 3GLVA 4I3HA 4I1VA 4MGHA 3RU3A 2X15A 2G1JA 3FJOA 2QUKA 4NMXB 3GC6A 1OX6A 1DXHA 4LY9A 3R9KA 5IUKC 1N34B 2FCRA 4IO1A 1F38A 3Q3JB 4TMVA 5CNMA 3Q7SA 4IWNA 3PC4A 4IZOA 4TLAA 5G02A 1I1NA 2RBKA 4X84A 5UKDA 3B7GA 3KB8A 1C81A 2JIDA 4GGPA 4LZPA 4GQIA 3U5ZB 4WE3A 3F9RA 1IBKB 5SZIA 2D5BA 4IX1A 1WVMA 5EC8A 2CDBA 2NLOA 4NFSA 4FBMA 2UVPA 1H2FA 2VTVA 3WMGA 3TQIA 1W7AA 5EIEA 3UKOA 2WC1A 1MAAA 2QMHA 1PWHA 5BV0A 3K4PA 3MTQA 4H77A 3EC2A 1PW7A 4N8SA 2B1GA 2WI8A 3RBXA 4MI3A 5E3HA 3G0IA 2WF6A 3BRCA 2FSGA 4BEBA 4R8SA 3T4PA 1FRZA 4X1IB 4X92A 3LHIA 3QOWA 1XZLA 2PGXA 4ALNA 4MTLA 3D54D 4MWCA 4YNBA 1MIOA 4RJIA 5JHGB 1U0OC 4YJHA 5A2QA 2UVQA 2JFGA 3OUZA 1SVMA 4MWSA 4TWJA 4RF3A 2FZLA 4V0ME 5SV2A 2XGGA 2WUVA 1THMA 5D5PA 3RAPR 1OBFO 5IVDA 1HORA 4EVIA 4X95A 1D07A 1G6HA 4TT3D 1OXTA 2E6KA 3FZEA 4MQUA 5A6SB 1AG9A 1JHPA 1GGFA 3TN7A 4HUQB 1RZ3A 5H1YA 3OKCA 4MRSA 5F2KA 2FPGB 3K30A 1MOQA 1U2SA 4P7JA 2BYTA 3D8NA 4ZI5A 2ZCJA 1AXRA 3EVCA 1U9YA 1UXHA 1UWCA 1L5FA 2AOVA 2VHXA 4EFMA 5C4GB 5JSQA 4YS6A 3HKDB 4YT8A 2K2WA 5BOVA 3L77A 3ZWMA 4V0OA 1O1YA 2ZGVA 5CIQA 2H3EA 2OV2A 2VJMA 3B5JA 3WWCA 3K1AB 4B43A 4DQVA 1RZRD 3Q2KA 1K8RA 2IL1A 3HP1A 5ALJA 2H1LA 2HIAA 3D3EA 3HCRA 1XQYA 2AEJA 3BIJA 3NGLA 4RPLA 5TS3A 3Q3HA 3H97A 4GX2A 1LDEA 3AL0C 2BVNA 4L0CA 3I04M 5EEGA 2EFCB 2IEBA 3WGKA 4F2DA 3EE6A 5BMVB 1FK8A 3GCZA 3ZG6A 2JD2A 2D1FA 4CLEA 4Z9YA 3OZEA 1N2GA 1YK0A 1W44A 4HVTA 4PLZA 4DLNA 1R64A 2G4VA 2B20A 1TVCA 4BZZA 3GRKA 4UJ3A 3TLMA 3G7NA 1Q22A 4FONA 2QTRA 3OF2A 4H6VA 2O1EA 7ABPA 2XRFA 2XMBA 2H18A 3RVQA 3VMFA 5HXAA 4IXMA 2WDZA 2GWRA 3SNKA 3UPDA 3GRRA