3DOEA

Complex of arl2 and bart, crystal form 1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
189
structure length
189
Chain Sequence
b'GLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTADLEHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 2
publication title Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
total genus 63
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3doeA00
2VP6A 3LLUA 5SZIA 3RS3A 1PV4A 3TW4A 2OO7A 2F55A 2F1JA 2CLCX 3KL4A 2IXFA 3MFYA 2CK3D 3KJIA 4PPFA 5JI3E 3QPUA 4JVNA 2W0SA 4DEXA 2CCGA 1G21E 3M6AA 4JS0A 5G40A 4C3ZA 1NLZA 3KKPA 4UNNA 2CNWA 1H8ED 2YVUA 1PVOA 2FPMA 4WXRA 1SHKA 4Q4HB 1OFUX 3W8NA 1E2PA 3HU1A 1CLUA 3ZD7A 1CJVC 2BJVA 4IOJA 5IK2A 1PUIA 2BBWA 3K09A 3RDPA 3U6KA 1CEEA 1Z22A 3G82C 3U44B 4GOKA 2UZ3A 1KYIA 4TTQA 1EGAA 1KMHA 1E2MA 4HLUA 4IDQA 2BMDA 4Q00A 2XNSA 4JLDA 1CS4C 4K81B 3RNLA 4D81A 2F9LA 3FMFA 4BRUA 4Q5IA 2KWIA 4HUQA 3M0EA 4ZCMA 3U60B 3LAWA 2PLFA 4QBFA 2ZYTX 4WZAE 4PO9A 3FB4A 1YR8A 2XITA 1EFUA 1SVOA 4M9SA 2QRZA 5EXXA 4M53A 1U90A 5FI0B 4DLYA 2ZE8A 3EIEA 4LOAA 1FFHA 5F9FA 4M1WA 2ATXA 2XNDD 3MLEA 4RZ3A 4NDZA 3HR7A 2NO7A 4DKXA 1QG4A 4C0QC 4ZDIA 5LD2C 4B73A 1ZNYA 5DN6A 1FUKA 2CHGA 5JWRA 1AQUA 2IYYA 3ZVMA 1Y63A 2D7DA 2VQSA 3RVBA 3DKVA 3K8YA 4NHOA 4DIDA 2AXPA 1ZU5A 3UKDA 4IDOA 3W6NA 1XTJA 1JPJA 1ZU4A 3B1WA 3WHKA 3OF5A 4JSYA 4IXNA 4GL2A 1ZUHA 2GXQA 2ZYVX 1KI6A 1U8AA 4NCKA 4GZLA 4L5BA 4D80A 2WMNB 4MA4A 2GEDA 3A1UA 5CLLA 3GPLA 5J4VA 2EYUA 1YZNA 1Z08A 2CJWB 4XVRA 4P4SA 2C95A 4QNRA 3VTKA 1E9FA 2C03A 4KODA 1HY3A 3ADKA 4LJ4A 4Q21A 4UJ3A 3V4RA 3X1XA 4EPYA 2ZRKA 4M1TA 1O3YA 2IUTA 5JCPA 4A2PA 4NYMR 4OHVA 1YZTA 1CJTC 3D8BA 3MWJA 4AKEA 3B1ZA 4U5XA 3GFTA 4K46A 4DLTA 4KV9A 4KXFB 5KNBA 1RRPA 4L9WA 1XEFA 1U0LA 2ZJBA 4K8OA 5JZVA 3EPLA 3MWYW 1G5RA 5AJXA 1G3QA 4HAUA 4QJ5A 4POAA 4LK2A 2VL7A 1MO4A 3CX6A 3F5FA 1Z07A 2FFBA 3DVLA 4HB4A 4GP7A 4KFSA 1W49A 1OB2A 4JVLA 2F7SA 4AG5A 2V8OA 2ZPTX 4Z1MA 4KHZA 1KI3A 4XD7D 1E9CA 2ZJOA 3K0FB 4HUTA 3WYAA 2JLYA 4IHQA 1YZGA 4KI0A 1VPLA 4W5WA 4ZDKA 2ORWA 3IPYA 3GLHE 2WJVA 3QSYA 3NBYC 4CZ2A 2OXRA 4IEIA 5FPYA 1FX0B 4B35A 3CRQA 5UKDA 3FHOA 2Z43A 3T35A 3AGQA 3U3JA 5JJLA 2HUPA 3LO5A 4BZXA 4P4UA 5FBLB 3IGFA 1YR6A 2K5UA 2WWHA 1W0JD 3RLFA 4IW3B 1GSIA 5C4MA 4B76A 4QC2A 3GLIB 3U4QB 3GLHB 2IK8A 3K53A 4EFNA 5C46F 4GSYA 2RGBA 3SBDA 1DADA 1C4OA 1XEWY 3IHLA 5FBVB 3BE4A 2QT1A 1DELA 3GQBA 4RD3A 3FVQA 3G5UA 4A2WA 2C8VA 3C5HA 4D26A 4LUCA 1MRSA 1W2HA 4FMCF 3C41J 1MABB 5DYIA 1FL9A 3VHLB 4TSFA 3OIWA 2EWWA 2J41A 4TN1A 3QKRB 4F7WA 1SXJE 2CEAA 2W6JA 2CXXA 4LJ9A 5KNDA 4WVFA 5TV2A 821PA 2Q6TA 1G7SA 3KTAB 5F2EA 1XB2A 5D3MB 4BFVA 4IDPA 3FE2A 4BLRA 2D2FA 1NVVR 2RB4A 4LBWA 3QKUA 3BJIC 4N0EA 3VR1A 2GDJA 3W3AA 3IQXA 4FWTA 2C96A 3OHMA 2XOKA 1XTRA 4B3FX 2D06A 1E99A 1E0SA 3ICEA 4DHEA 4Q7MB 2WJYA 4G5SA 1NKSA 4LBVA 2ZU6A 1T8TA 1GOTA 1Z6GA 4II7A 1PJRA 4LV6A 4URVR 1QG2A 4FMDB 3H4MA 3MMPA 3REGA 4M22A 1P72A 2FU5C 5KOYA 4MUAA 5ANRB 3BB3A 3EIHA 4RJLA 4KVAA 2WTUA 2V55B 3WRYC 2GTPA 4EPRA 2NGRA 1L8QA 3BH7A 2RGCA 3FKSA 2ZI4A 3RS2A 1N6IA 5FUXA 1HT1E 3H2YA 5E4FA 3K0AA 2J0UA 4NH0A 2NOAA 3CF6R 1UF9A 2PEZA 3F0TA 1FW6A 3AVYA 3PV0A 4LHZA 4TMTA 1JEDA 2AFHE 4MYUA 1KNXA 4R71A 2IYRA 1MOZA 3LH5A 2JLWA 4C7OA 3AKYA 2BEKA 1ZM7A 3OEHA 3B5JA 1W4AA 2QI9C 4BZPA 1N0UA 3P26A 2ODNA 3WBJA 2H92A 1VCMA 2NPIA 3QY0A 1GL6A 5BWMA 4I4LA 3J81k 4DLXA 4F38A 2V9PA 1EXMA 4HLDA 1JQLB 4BFWA 2AL7A 1QDEA 2Q9AA 1F3OA 4ACAA 6Q21A 3ASYA 3CUEF 2GK6A 1GL7A 3Q5DA 1E1QD 2P6RA 2WWXA 2ZANA 3FHCB 4Z51A 1IN4A 1ZUNB 3VNUA 4DDTA 3L0SA 1RE0A 2IYVA 1N6NA 4G3XA 3S1AB 4I1SA 2A5DA 2IYSA 4US1R 5JFGA 4OYHA 1W7AA 1CP2A 1KKLA 4JBWA 4ZCLA 1P73A 2HF9A 3I92A 2NZ8A 1E2NA 4KU4A 1M74A 2GCOB 5AUNB 2GZDA 1XDBA 2HXYA 4HZUA 1EWQA 2MMGA 4AYXA 5KPDA 4DWJA 2AD1A 4GP6A 3VR2A 2X8AA 2ZE6A 3ADBA 2WOOA 2QSYA 1N6OA 5KSPA 1OW3B 1VHTA 3UWKA 3H0KA 1NBMA 3Q85A 3TSZA 1ZINA 3NEJA 2EU8A 4KFUA 1G8FA 4QHYA 4WOPA 4Z54A 4Q1EA 3EXAA 4JL8A 4Q1DA 3QNUA 1LW7A 1U94A 5HPYB 1HQCA 2XB2A 3KXLA 1Z2AA 5DI3B 4PHTA 2QPAA 1QHGA 5FTMA 4EPTA 1Z0KA 1RKBA 4LRWA 4IXMA 3PUZA 1QVRA 2BMFA 1N6PA 4OK6A 3RWOA 4A6XA 4C2TA 3CLVA 1P5ZB 1G7RA 3QQ5A 4GOJA 1G4AE 3ASZA 3FMIA 1DG3A 2YINC 4LX0A 4NCNA 5GADl 4YLGA 4FI3C 2AX4A 3D6TB 2A5GA 4YMSA 3SR0A 5KSOA 4F92B 2PZFA 4RY2A 3EZ2A 4ASUD 4P0TA 3T06B 4DCNA 1F2TA 3SYKA 3BD9A 2QE7A 1I2MA 1XCMA 2ZRLA 5DSZA 4B6FA 1T4GA 1MO5A 1XMIA 2GBLA 4WAUA 5L3SB 2P65A 3GEHA 1E0AA 1YZUA 2ERYA 3ZS8A 2QAGB 3NIBA 1L7VC 4BFXA 1E79A 1GNPA 3EW9A 5FUYA 2JLXA 521PA 1MO6A 2B7BA 2G0TA 4V02A 1XFAA 2QG6A 2JJ2D 3AF4A 2LKDA 2ZRIA 1Z8FA 3AKCA 3OIUA 4LYFA 5DHAA 5FOUA 1EFCA 5F98A 3R8FA 3NC0C 2JDID 3MUFA 1GP2A 1D9ZA 3CB4A 3O8CA 1G4UR 3CWZA 4QJ3A 1QRAA 1QHXA 3B82A 1OKKD 1Z06A 5JSZA 1Z6XA 4CW7A 1SXJD 3DKPA 2CL6X 3LBIA 3LQQA 1DPFA 1V5WA 2HJGA 1A82A 1NLFA 1ESMA 1NMZA 2XJ9A 2XEXA 1CJKC 1YE8A 3LY5A 2ZVPX 4CEHB 4DB2A 4LZZA 2FFAA 1E0KA 3I8SA 4UNRA 2DFKB 2GJKA 3AF2A 3RRZA 4MRRA 4RCZA 4GT1A 4X8OA 4X8LA 2OAP1 1KI2A 1OYWA 4M9XA 2ONJA 3NBZC 3VU9B 1EK0A 4UNQA 2CCJA 2P2LA 3K9NA 4DT1A 1ZM3A 2V7QA 1W0KA 1COWA 2WVJA 3MJHA 2O0JA 1DARA 3IDQA 5H68A 4HI0E 3QVUA 5AJZA 4O2RA 2ODWA 2EFEB 4NBSA 3DL0A 1QF9A 1E2LA 1R10A 5IHPA 3PITA 3NDBB 1OLOA 2ZYWX 1UBEA 4JBXA 4XH9B 1G8YA 1XMVA 4MRSA 3NVAA 1BKDR 1OHHD 4B34A 2VBCA 3K70B 1R0ZA 1E9AA 3CRVA 4LC0A 4A2QA 2OE2A 1UPTA 1Z0JA 4KFTA 4NMMA 5B57C 3UMRA 2W58A 4IVPA 1RC8A 4IFEA 4DLVA 2B8WA 3TAHA 3IPXA 3U6BA 4NZYA 1XD2B 1P62B 4LGMA 5HCNA 2HLDD 2PX3A 4N0DA 1D2NA 1GRRA 2ZREA 3AM1A 1TUIA 4W5JA 2B92A 5G3ZA 3TH5A 3GEEA 2YJTD 3QEJA 3TUZC 3B9QA 3TNFA 2R65A 2FDCA 3CO5A 2XTMA 5DNYB 2YNMA 4JLOA 4LV5B 5CJ2A 3BAFA 1E9DA 3EAQA 3MCAA 1VYUA 5H1YA 2FFHA 2QL6A 2ZI6A 2O8CB 1ZBDA 1M34E 3SJAA 3Q72A 4RVCA 4I1UA 4US2R 2WOJA 3C5CA 3AH8A 1QHNA 4S35A 1II0A 2RMKA 4TL6A 1E32A 3TVDA 2QBYA 1OJLA 4Q7LA 2O8EB 1TF5A 4LYAA 3ND8A 221PA 4WZBE 2BHRA 2YWGA 3QXCA 3W9YA 3I5XA 4U02A 2YOFA 1ZAKA 4D0NA 3P32A 1JXMA 3SEAA 1P9NA 2NPFA 1S3SA 3HYRA 5G3YA 4KSBA 3W90A 4C0HA 1ZIOA 4W7SA 4KBGA 3ZZUA 4OJKA 3AB3A 4EJSB 2ANBA 1E96A 4AYWA 1G6HA 4Q4AB 3KUCA 4A0GA 4CEIA 4PHHA 2KBEA 3RWMB 3FKQA 2GXAA 3GLGE 1II8B 1NSTA 4JZKA 4CEJA 2R8RA 4Q9LA 1NF3A 4URZR 3ZQ6A 3T15A 1DO0A 1EFRD 3EPJA 5JS8A 1RVDA 2QMEA 2VHJA 2REBA 3CPJB 1DAHA 3C7KA 1EG7A 3IKJA 1UJ2A 4HLQB 4KSCA 1ANKA 4TMZA 4E09A 4OBEA 4ZKDA 3B9PA 5CIWA 4Q7KA 3K9LA 1PLKA 1N5JA 3IEVA 1GITA 1I4DD 3DOEA 1UBGA 1D2MA 3AP1A 5JWOA 3KXKA 4TTRA 4BASA 2P0EA 4DIEA 3TVTA 4DLRA 1NIPA 4F4JA 5JJKA 1B0UA 2V1UA 2O8DB 1ZYUA 2FZLA 1YU9A 2G0NA 2LCFA 5J4YA 1RPZA 3NBXX 1GKUB 4A8JB 2PCLA 5KU1A 2GCNA 1C9KA 1TPZA 1PLJA 3CR7A 3I1FA 5EE5B 5AJVB 3ZVLA 1KNQA 5FBWB 3SN6A 2I1QA 3LA6A 5G53C 1YZLA 1Z29A 2D3WA 1MH1A 3T1QA 4URWR 2DFLA 1T0HB 2Z4RA 3W8RA 2CDNA 4BPBA 4US0R 3EZFA 4BUJA 4H9GA 1US8B 2F9MA 1JB1A 4RKFA 4QRHA 1Q44A 2VA8A 4TQAA 2AHOA 2WWWA 4M21A 4P4TA 2E9SA 1HT2E 3GP8A 4DDWA 2WPDD 4HB0A 2ZVQX 1P4SA 1L4UA 1P60A 1X86B 2R6DA 4DVGA 3O8RA 1E2QA 4KLNA 1VCNA 3ZH9B 4DSNA 4DJTA 4QBHA 3SQWA 4R2HA 1ZCAA 4FD2A 2LKCA 4BZQA 2GAAA 4JYCA 1VHLA 2PBRA 4Z8YA 2H8KA 4BFUA 1KAGA 1QZXA 3CBQA 2VHTA 3QVVA 1G8PA 2R6AA 1HV8A 2OCAA 2GKSA 3P20A 3GCGA 1G3IA 121PA 2KSQA 3LWNA 1G1MA 4ESHA 2J0VA 2BM0A 5F9HA 3LW8A 1SULA 1BYUA 3AVPA 3EA5A 3P1JA 4L16A 3R7WB 3U5ZB 1NG9A 2EFCB 2J3EA 2QMOA 3K70D 4AC9A 3VKGA 2OG2A 4TWZA 2AK3A 5CJPA 1XXHA 1KI8A 1XP8A 4V03A 3NTUA 2QMHA 2CMKA 3D3QA 2FZ4A 3VKWA 1AS0A 3WRXC 1HYQA 3GD7A 4PAQA 2C98A 4B2IA 4BFZA 2XZLA 2XSZA 2H1LA 5GJVC 3SU8A 4OQMA 1TADA 1P7CA 2YWFA 5CK4A 1X8LA 4X8MA 4B3BA 1YRBA 2N1BA 1LS6A 1Q1EA 1KAOA 4PANA 5HE9A 2J87A 3AP3A 2GF9A 3BORA 4XVUA 5JEDA 4UQOA 1AM4D 2ZJZA 1TF7A 4QHSA 4WBSA 2NO0A 2RGAA 3CW2A 3RS0A 4M9QA 4MDEA 1SVMA 1OFIA 4M1MA 4IJMA 4EFMA 2BBTA 2G77B 1ZC3A 2FA9A 3CRRA 4ITRC 3N2IA 1A4RA 3BBPA 2R9VA 3CPHA 3OE7D 3RS7A 3W3ZB 3THWA 2C04A 2VP5A 2ZTSA 3QKSA 1ZD8A 3T12A 3EWSA 3CRW1 1KZGB 1Q22A 4AK9A 1TAGA 4YQFA 4RKEA 5KDLA 4AURA 2A9KA 5BN5A 2F43B 2OILA 1JJ7A 4Q9HA 1TTTA 1UDWA 2E1RA 1XEXB 2P67A 3SC3A 4ZKEA 1E9EA 4HUQB 1SVWA 4L8GA 2Z6VA 2ECKA 2J9RA 5FOSA 3L0OA 1BIFA 1IXRC 4DEYA 2Q3MA 1W4RA 2VRWA 2QTVB 2OEPA 2QORA 2BEJA 2QUZA 3A1SA 4Q4JA 4Y0VA 1OXSC 1JPNA 1JXOA 1A7JA 2H16A 2IYTA 2VHUA 4XD7A 4DXAA 4E07A 3V9PA 2HEIA 4A0RA 3W6OA 5E3HA 1OH6A 1AJEA 3GJ4A 3B6EA 4DSUA 3WP1B 4M4SA 4FCTA 3WHLA 2C9YA 1G41A 2OUKA 4FMDF 1T6NA 2WAYA 3H1TA 3DMNA 1FTNA 2DFNA 3KFVA 3PUYA 4JJZA 2JLQA 1J90A 1JALA 5FUVA 4LJ8A 4RFSB 4XTCS 1JNYA 1OV4A 4UKDA 5K8LA 2W6ID 3QJYA 4FINA 3K0EA 1W0JA 4ZPXA 3PQCA 3THYA 2QM7A 5FTKA 3B13B 3JVVA 3RRMA 2JIZD 1ESNA 1ZJ6A 4AIIA 2Q21A 2ZS8A 2WSMA 1R8QA 4OI2A 1JJVA 4JVSB 4TYPA 1J8YF 1E9BA 1ZIPA 4LJYA 2PJZA 4TQUS 4M2LA 1SQ5A 2ZXUA 1S9DA 2P6UA 3SQXA 2ZUCA 4EDHA 4JBYA 5CB8A 2JCSA 2BOVA 2XX3A 4A1FA 3CONA 3CPEA 3O47A 3ZVNA 3ADDA 3SFZA 3IIMA 3TR5A 4LY6A 4CT4B 1GTVA 4Q4HA 3UATA 4GRAA 3WNCA 4QG7A 4BRWA 2Q3HA 1RW4A 2PMKA 3GJXC 2NZJA 3TKLA 3L0PA 3U44A 1Z3IX 5BQ5A 2V3CC 1WA5A 4MRNA 2C77A 2JLZA 1MO3A 1NRJB 1W2GA 1F2UB 3QXJA 3VR6A 1E2EA 2VEDA 4PSAA 3E1SA 1UAAA 1W48A 5J40A 1P61B 4TL8A 2GJ9A 3O8BA 1U8ZA 1TF2A 3UWOA 4KVGA 2FSFA 3IBYA 1AKYA 1L4YA 4PHGA 3U7HB 1ZVQA 2WWYA 1N3BA 2A30A 1X1RA 3IIJA 2WWGA 2BC9A 2RAPA 1J99A 4I1VA 4OHXA 2FSGA 5AJYA 4BEBA 4D0LB 4NCJA 5H70A 1HE1C 2VHQA 3ZIAD 3LDAA 3OIVA 1NSFA 2IS2A 2P5TB 3MAAC 3PEVA 1Z0AA 4V0ME 5JS7A 4PQRA 3GJ8A 5FBRB 4YDSA 3C8UA 4ON9A 5CM8B 2IBMA 3PUXA 3AVVA 2O0KA 4XTRA 4GDFA 1KSJA 1BMFD 3EA0A 1G5PA 2J7KA 4P3YA 1YKSA 4HLCA 4Z8XA 4RCYA 4C0SA 2QU8A 1JR3A 2OXCA 4Q1AA 3E70C 4JJKA 5J5CA 5C1BA 4Q19A 5HKKA 3EC2A 5DLQC 4LC1A 1B23P 2CJWA 1G19A 1G8GA 1KDRA 3TUJC 1NI3A 1K6MA 4TL9A 2JLUA 2OV2A 3BFKA 4B48A 1E1QA 4A9AA 2X2EA 1Z47A 3VMFA 3PR1A 1QBKC 3LBHA 5A4JA 2ZQ5A 1F48A 3C15C 3WYFA 3KQHA 2ZRCA 2BCGY 5K8IA 2WKRA 1QHIA 5P21A 1WXQA 1GFIA 1TQ4A 2VSOA 1KO5A 1E9RA 4KLZA 2JATA 4Q1CA 2QPOA 1NN0A 4G5QA 5FTNA 1NN3A 1SKYE 2QTHA 1RJ9B 5L8VA 3LX5A 4QJ4A 1JQJC 2VP9A 1NVXQ 3ONWA 4B3GA 4LBZA 1XPOA 1YZKA 1E1RD 4B2PA 2DR3A 3CF0A 1NMXA 1OFTA 1RRGA 2XAUA 1IM2A 2NO6A 4RD2A 4ZV4A 3WMGA 4V0NA 1CJMA 5HZKA 4AYTA 4NCHA 3X1ZA 3K0FA 1UKYA 2FE4A 4EPXA 1HE8B 4Q47A 1WQ1R 1SXJB 4QKQA 5EQTA 1EFHA 3F8TA 3C4JA 1DE0A 1T3LA 1FX0A 4O25A 1AKEA 3U7GA 3NKVA 1Q21A 3P27A 2HYDA 1XEWX 1U0JA 3QE0A 2QN6A 4CGZA 3THXB 4HAXA 4D4KA 3GLIA 3GLHA 3U4QA 2JJ1D 1TNDA 1Q1QA 3RHFA 2QP3A 2RGXA 1G3UA 1XZQA 1QHHB 2ZJAA 1UEIA 4FW9A 1YZQA 2ATVA 1KJYA 3TSOA 4A4DA 3NC1C 3W5JA 1EWRA 5EZ5A 4CRWB 2ZIAA 2FGKA 4DUGD 1OIVA 3PG5A 4Q03A 4TMKA 5TXGA 1MABA 2WKPA 4U7DA 4TMVA 2JJ2A 3SZRA 3QKRA 4B47A 3UMFA 1S9HA 3KB2A 4JMPA 3MWKA 4AY2A 5JRZA 1M8PA 3KTAA 4ABYA 5D3MA 2PMDA 4H1VA 1I2DA 3BOSA 4LYHA 4NU0A 4PO8A 4MGYR 3BWDD 1E2HA 2DWQA 4RSGA 2VLIA 1KZ7B 1XMJA 2NIPA 2B8TA 3LQRA 2I3BA 2ZRDA 1OKKA 2N42A 2D62A 2BMJA 3AF1A 5L3RA 3DO6A 3LD9A 1NBME 3BFXA 4PPQA 3N5CA 2QTFA 1FTSA 3AQ4A 4FMBB 2UZIR 4F93B 1CRQA 3VFDA 2RGGA 4MDFA 2EVWX 4Q1FA 1JAHA 3PUWA 3RRYA 4C0KA 2V6JA 2GJSA 1AIPA 1TQDA 3KJGA 3DDCA 3HP1A 4PQYA 3KQLA 1HH4A 1KK1A 4XIGS 4GFDA 1WBBA 3X1DA 1IN8A 4Q66C 4NYJQ 4TLCA 4JL6A 4AI6A 3RSOA 2EWVA 2HV8A 1Z83A 3GMTA 3PFIA 4PR0A 3QXXA 2JA1A 5AUQA 1IY0A 2QAGC 1NIJA 2QEQA 2DB3A 3AVUA 3EIQA 2YOGA 2I1VB 4F91B 2ZETA 2MMCA 4JIMA 4LJ6A 4CVNA 2WJJA 4ERNA 1GDDA 2Q9BA 1AZSC 4A36A 2X77A 4MUBA 4V0KA 4LDJA 5FOXA 4JKIA 721PA 3WMEA 5FH9A 3TGPA 1UEJA 4WA7A 4JLNA 3IUYA 2VP0A 1OHHA 2ONKA 1G6OA 2XB4A 1G9XA 2RGDA 4PZYA 2FSIA 3EC1A 3JZAA 1E9SA 2WBLC 2W83A 2PZGA 4LI0A 3TSWA 3WBKA 1VTKA 1ELOA 1CTQA 4ESVA 1F6BA 4I1OA 3PVSA 3LVRE 2PH1A 2A78A 1R0WA 3TW8B 5JHGB 2HLDA 3DEFA 1W46A 5EUMA 3KQKA 4P32A 5JMTA 1ZP6A 5EJEA 4MYCA 1OSNA 1CULC 3UPUA 4URXR 4YMUA 3AKEA 5L3QB 4L4UA 2FEMA 4LWZA 3UXMA 1T91A 2F1IA 1U0HC 4KYUA 4MRVA 3S1AA 2GK7A 2RH5A 5IDVA 3ZLJA 4ZIRB 2C9CA 4UJ5A 3DOFA 2DY1A 4Q9KA 4X8HA 1OPXA 4CIDA 1JAIA 1OH8A 1N5IA 2XZPA 2HXSA 5EE0A 5GJWC 3KDSE 3ZVRA 2GCOA 5JWHA 4FIDA 3SI7A 1P9WA 1WDTA 3E5HA 4Q9JA 1Z6AA 4YMTA 2VHCA 4DRZA 1OXVA 2AD5A 1LTQA 5AR1A 3PIRA 1RYHA 1GL9B 5EUQB 4ZO4A 2BMEA 2O5VA 1E3MA 2IS1A 2O8FB 2VYFA 3BS4A 4AG6A 4UXIA 1XF9A 2Q3FA 3OEEA 4JLVA 5KNCA 1P3JA 1Q57A 1FOEB 2IEZA 3LNCA 2BV3A 3A1TA 2OBMA 3K70C 2F1RA 2IYQA 2IHBA 5HCIA 2G9NA 5DI3A 2FGJA 4PFSA 4ARZB 2VSFA 1N6RA 3KXIA 3Q7QA 4GNKA 3UIEA 4D82A 4M0LA 1M7HA 2WWIA 1IJEA 4PTLA 3FKSD 2FJUA 3SS8A 3X1WA 5FUWA 1G7TA 1V43A 4XSHA 3U3RA 3W6PA 5DI9A 2GCPA 2PT7A 4EQ6B 4OHYA 3X1YA 2XXAB 2HT1A 4BLSA 3EPKA 1NP6A 4M9ZA 5TB5A 4B43A 3DM5A 1Z5ZA 2BDTA 1SVKA 1AS3A 1ODFA 5JECA 4LHWA 5EXPA 1XMSA 2C5LA 3QPWA 4CYMA 1AS2A 2F1HA 3SFVA 2VF8A 1KJZA 1E4VA 4OI0A 1AZTA 1KO7A 3A1VA 1DAKA 4LV8B 3DZDA 3UANA 1K5GA 1X8KA 3VR3A 3AF0A 4BE7B 1E2GA 1P2SA 4S2EA 1W4CA 1WMSA 5IT5A 5L3SA 3NH9A 1E69A 4C4PA 2QAGA 2TMKA 3EWAA 3B1VA 1IN7A 1HUQA 5TVKA 1KHTA 3TE6A 3H86A 5A5GA 2EFDB 3KQNA 3KB1A 1YR9A 3PEUA 3B7GA 4B74A 2ZSEA 1GKIA 4O0MA 5KHOC 2PX0A 1SHZA 3MJRA 2GEUA 4C9BA 1VIYA 4HDOB 1N5KA 2DWPA 4EJSC 2D4HA 5HTKA 3U3KA 1E2DA 4HAZA 5KDDA 3HR8A 1H8HA 1FMLA 4YC7A 3WYGA 5CB6A 2AR7A 2REOA 3HWSA 4KBFA 4LJ5A 4TLDA 2CE7A 2YKGA 2ODBA 3SNHA 4CEHA 1Q12A 2B6HA 4FXPA 1R8SA 5LB4A 3ZD6A 4BLPA 1N25A 2RKOA 4MYHA 2WPDA 1NBMD 3KZ1E 3KJHA 3GJ0A 3VU9A 2UVQA 3BGWA 3IEUA 3OFNA 2V54A 3A36A 3CZPA 3IO5A 4MKFA 4OI4A 4B6EA 1JI0A 3EPHA 2J5XA 1GIAA 1GRQA 2J7PD 2ZSDA 4BEJA 4BQSA 4BFYA 2VTKA 4QBIA 3PXGA 3TUIC 5ELXA 4D2IA 5FOWA 4N3NA 3QKTA 3BC1A 3Q8XB 2ERXA 4OQFA 1VYTA 2JJ8A 2QAJA 3GJ5A 4LJAA 4MITA 4A8JC 4C2UA 2HCJB 2V6IA 4YXWD 3DHWC 1NN1A 1IAQA 3HJNA 4QFMA 2X19A 1K8RA 4URUR 4TT3D 3CH5A 1GG2A 2GZHA 5K8UA 2GA8A 3U7EB 2FNAA 3TQCA 2PL3A 1KI1A 3WNBA 2GVDC 3I8XA 5TARA 3LRPA 2VH5R 1XD2A 2QROA 3CF2A 1IJFA 2EYQA 1E79D 5EP4A 3FYHA 4NYJR 4ZI2A 2CVHA 3ZQJA 1DOAA 3U2QA 4M1SA 2ZM5A 5BXQC 3BB4A 3NG1A 4OK5A 1KO1A 1U99A 3A6PC 4W9MC 4V0OA 2AFIE 5TY0A 4UNSA 4G0NA 2R44A 4EKDA 3GLGB 2O8CA 1VCOA 1OXXK 4GMXA 3KKMA 2ZJ8A 4P31A 4Q48A 3W5IA 2OT3B 3OAAD 2O8EA 2FSHA 1R5NA 2W2XA 4OQNA 3ZZTA 4DDVA 1ZC4A 1W36B 1JBKA 3EG5A 5BYJA 2AWNA 4NONA 4R98A 2O8BB 1HTWA 2IYLD 3I3SR 4IOLA 5FL7D 5B58C 2B21A 1TMKA 1M1YE 4TLBA 3LX8A 1GKYA 1DVRA 2CK3A 4TMWA 2IS4A 2BBOA 2WIBA 5KYKA 1DAFA 4EJSA 4Q4AA 1CF4A 1COWD 1S3GA 1D9XA 2F3TA 4MKIA 2ZRHA 4D4MA 4XWOA 3D31A 3QENA 1II8A 1CJUC 1H8EA 3T1TA 1LF5A 5GJCA 1IN6A 1CKEA 2L0XA 3CX7A 3GLFE 4HAYA 1KKMA 2J59A 2ZRNA 4B3CA 4XSGA 1EX7A 3A1WA 1KDOA 1MKYA 3WNDA 3GJ3A 4JLBA 1W44A 1VKJA 4A92A 4Q18A 1NNEA 1ZNXA 4B3DA 4QM7A 4Q02A 3CRMA 3Q3JB 1KSHA 4JL5A 4M8NE 2RCNA 4TTPA 8OHMA 4NYMQ 5AWFC 5KDOA 3W34A 1HURA 1RIFA 2Q9CA 3SE0A 3GLFB 3TAUA 4B3XA 3A4NA 2BVNA 3A4MA 3NXSA 4I81A 3EZ6A 1W5SA 4PSKA 2ZR0A 4A0FA 1XTIA 5FFMA 1CU1A 3B78A 2ZI9A 2J45A 3ETLA 4PC3A 3FDIA 2O8DA 1IHUA 1KDPA 2JIZA 3JZMA 1G17A 1VCIA 2N46A 2V1XA 2FV8A 3DZ8A 2RHDA 3LXRA 4DLUA 3I73A 3SHWA 1TU3A 2XJ4A 4A8JA 4DCVA 2XNDA 4IKEA 2DYKA 3BK7A 2V4ZA 2IT1A 1WRBA 3HPQA 4JLJA 3THOA 3VX3A 1GAJA 4G5OA 2CBZA 3SYNA 3QF4B 2OCBA 1OE0A 5F3WB 2CCKA 3MGCA 5A0FA 4OQLA 1KTVA 4P33A 4C0BA 2HF8A 1US8A 2EW1A 1E2IA 2ZR7A 1FQKA 1OB5A 5DO9A 3BIFA 1LNZA 2NMVA 3RRNA 2WM9B 4R9UC 5CDFA 1OT3A 2CL7X 1WB9A 2BIFA 3WP0A 1XWIA 2H5EA 1BH2A 3AV0B 3AGPA 1UDXA 3SHFA 1PZNA 1J8MF 3EASA 3ZJYA 5M04A 4TZ6A 3R9IA 4LHYA 2OFXA 2ZROA 3QEOA 4PZZA 3QXSA 3NDPA 2Z83A 1YVDA 2VPPA 1NY5A 2ZU0C 1PUJA 1FMJA 2PLRA 1ZNZA 4MH0R 1X1SA 2GAOA 4IOKA 4DZZA 3K0CC 3REFA 2ZRMA 4ZDJA 2WMOB 2IYXA 5FL3A 2ZRAA 3B85A 1KK3A 2ZJ2A 2OBNA 2ZS7A 3V4FA 1U98A 3ZIAA 3R7WA 2ZE7A 1G18A 1FNMA 3AVOA 1G291 1KMHB 4TYQA 1AK2A 1T5LA 5HZHA 1Q1ZA 2R6GA 1D2EA 4DC9A 2ORIA 3UG6A 2AKAB 4RD1A 3GEIA 3AUXA 1RFLA 2GNOA 2X2FA 5EXTA 3M1IA 3I62A 1UFQA 1N2CE 4Q7JB 2GXUA 3TJZA 1UKZA 1D5CA 1GILA 1Z6YA 2HCBA 4HEJA 5DH9A 1WP9A 1GVNB 1FNNA 1CRPA 4QBGB 1IONA 2H18A 1QHSA 3L2OB 1ZD1A 4GBMA 1YQTA 1XRJA 4A0HA 3CH4B 2BWJA 2OAQ1 1XJQA 4E22A 3KJEA 1R6BX 2C78A 4HATA 4DLWA 1DBSA 5FPKA 3CIOA 1U8YA 3U3MA 1X8JA 3U7FB 1NJFA 2DHRA 3UG7A 5JHHB 3T5GA 1Z6TA 3K1JA 3NHBA 3AEZA 2ODEA 1Z0FA 2QRNA 3QPVA 4QXAA 2ZAOA 3SJBA 1KJWA 5FTJA 1Z28A 4EAQA 3G0HA 3AVWA 2IC5A 2IXEA 2R6CA 2D2EA 4B33A 1G20E 3RS4A 1BS1A 1Z63A 4GMDA 2IXGA 3EZ7A 1KI6B 1W36D 2ZI7A 1VG9B 5FPHA 2ANCA 4C30A 2F3RA 4XOIA 3SDZA 2ZUBA 3JVUA 1KDTA 3N70A 1F60A 2QGNA 4V0LA 1CR0A 2BCJQ 2WSSD 3KX2A 1E1RA 3U3OA 4I99A 2F43A 1MRNA 4E5UA 3RSLA 3LVQE 3BXZA 3T61A 1XEXA 4FN5A 2ASEA 3R20A 1XCGB 4P4SB 1KOFA 2HDNB 2AKYA 3ND9A 4WIAA 4EPWA 1YR7A 2P3SA 3A8TA 1E0JA 2YHSA 3GJ7A 4YONB 2G83A 1GNRA 3KKQA 3TR0A 3I61A 1E2KA 2JLVA 3CNNA 5LB2A 1X6VA 4HDQB 3PEYA 1N0VC 4MRPA 1XPUA 1UM8A 3I72A 2IWRA 5EZ6B 2IUUA 5SZHB 2FMXA 2QMUA 4AWXA 1F5NA 1E98A 4W5HA 4LPKA 1NLYA 4NPHA 2Z0MA 4HSEA 5DIFA 4JLKA 4D4LA 1XJ0A 2FEOA 1VG8A 4B32A 1JR3E 1U9IC 3CR8A 2FF7A 1LVGA 2WIAA 3ICQB 3C16C 4RFSA 3H84A 4OJQA 5FOTA 4LBYA 3FFAA 4TZ0A 2ZI5A 2JJ1A 2ZAMA 2CLSA 2KE5A 4RZXA 5CLQA 5KSZA 2IUSA 2WWFA 3K0CA 2XSZD 1J2JA 4UNPA 2DWOA 4LPSA 1G64A 1IXSB 1W47A 5EE1A 3PCRB 2J46A 2WZQA 4DUGA 3T34A 1T9HA 4PAMA 4YDHB 3EX7C 1R4AA 3QUSA 4JYBA 4XWAA 5C2JB 1FPMA 4OQXA 2J0SA 1WE2A 1IXZA 2JASA 1M6NA 1C1YA 3F3YA 2QGZA 2ZS9A 3PENA 3K0SA 4EFLA 2VSXA 2KI5A 1IY1A 3AVTA 2FH5B 1MV5A 3SBEA 1YRAA 1ZD9A 3T1OA 4KAXA 2C99A 4KFRA 3CKLA 1HA3A 4PSVA 4JVMA 4QOSA 5AK0A 3VQTA 3FOZA 1N6KA 1XBTA 1Z0DA 1KY3A 2O0HA 4NTZA 2G88A 5E7JA 5KSYA 1SXJC 2W00A 1XTQA 4GI7A 1TUEA 2C9OA 1D8TA 1OYYA 3M4YA 4PAOA 5LD2B 5IRCD 1TX4B 2ZEJA 1F2UA 1ZM2A 2O52A 1KI4A 3LW7A 3V00A 4Q01A 2ZI3A 4TL7A 1N6HA 4O3MA 4M1YA 1DAGA 2Z5FA 1AN0A 2P6NA 1FP7A 4TLEA 1S8FA 4LHVA 3RC3A 4G5RA 4WZ6A 5JEEA 3GFOA 2CNWD 3I32A 3SJCA 3KQUA 2AXNA 2QQ0A 3VKHA 2ZITA 3MG9A 2RGEA 2IYZA 3FHTA 3WY9A 2HT6A 2FFQA 1A1VA 3B2EA 1JR6A 2GZAA 2YC2C 3OZXA 2VP4A 5IK2D 5KO2A 3EARA 4D25A 3GLIE 5J47A 2BKEA 4OHZA 3FPAA 4QM6A 2P5SA 4JSTA 4DSTA 3OESA 1T8UA 3NWJA 2ZRFA 1KMQA 2NG1A 1ZW6A 1SKYB 4KITB 3L43A 1IOZA 2GHIA 1CR1A 2PEYA 4EUNA 2JLSA 4EIWA 1O87A 4V0MA 3IQWA 5B2ZA 5GJBA 2GWHA 4BECA 2IX3A 1DAEA 1XJCA 4HDCA 2J0QA 2RGNC 3WMFA 1T3SA 3K0AB 5D3QA 5DN6D 2J0UB 3O8DA 1U9IA 2W2VA 4L9SA 4PQFA 2NTYC 5CYOA 2GF0A 4DLZA 1OIWA 2GRJA 2Z4SA 3FFBA 4H1UA 1PLLA 4C7OB 621PA 4RFVA 2YYZA 1NVWQ 1T0JB 2H7VA 5DHFA 3RAPR 2FN4A 2VIIA 4ASUA 1RYFA 5FPSA 2A2ZA 3BERA 3HU3A 5JLJA 2ZYUX 1ZNWA 3QG1A 1XCPA 1RJ9A 2H57A 5B64A 1UBFA 2SHKA 2OSBA 2QT0A 3D7MA 2NO9A 2UKDA 4TQ9A 1EESA 2IF2A 3Q7PA 2GILA 2GJ8A 2MSEB 1G5TA 1LS1A 3MSXA 2XZOA 1J7KA 2XGJA 3TK1A 4XWKA 2JDIA 5E7IA 4OI1A 3SJZA 5DE3A 4WW0A 4BGDA 3C14C 1OFHA 421PA 4B2LA 1DG1G 2KJQA 3FMOB 2I4IA 1GM5A 3IIKA 1SXJA 1WF3A 1ZMXA 1DS6A 3QF7A 2QA5A 4NYIQ 2GBLC 5EP3A 1VDZA 1R5BA 2ZSFA 2MSDB 4HZUB 5L3VA 4UXHA 3IHWA 2H17A 5FBQB 3NBFA 2WJGA 2ZUDA 4G01B 1FZQA 1VMAA 1XPRA 4URYR 3CM0A 4HAVA 4D0GA 5JCZA 3NH6A 4PX9A 3THXA 3P4YA 2JAQA 2MSCB 1YJ5A 4MGKR 5FOVA 4NE2A 4QGAA 5AJWA 5BW8A 1NKTA 1XU4A 2VO1A 3QBVA 1QHHA 1UBCA 2R2AA 4NKRA 1JR3D 1G16A 3LV8A 2CE2X 4NP6A 4Z1MD 2QY9A 5LPNA 5HKKD 1P2TA 4EPVA 4C0JA 4U00A 3AF3A 3HDTA 3WXMA 1VIAA 4DSOA 1KO8A 3VAAA 4Q1BA 1TQ2A 2XTNA 1P75A 1NN5A 1R0YA 4OL0A 4JT4A 1EX6A 1UKVY 4RD4A 4TMXA 3VHXA 1U81A 1LF0A 2G1KA 2ZE5A 1DAMA 1TL7C 4MGIR 2EFGA 2AK2A 1BYIA 2QPTA 2WHXA 3B1XA 2WJHA 4IFBA 5J4HA 2AWOA 1XD9A 2GEVA 1F2TB 4PC2A 3IBGA 1Y3AA 1IQPA 2CVFA 2RGNA 5SZKB 4R2IA 1OF1A 5E95A 3IO3A 4O2LA 3T5DA 1A5TA 1XZPA 2IW3A 5CYPA 5CK5A 5EXSA 1VG1A 3TQFA 3OIYA 4TSFD 1NL3A 1II9A 1W1WA 2DPXA 1ZM9A 4JLMA 4CF7A 1R7RA 2WAXA 2W6JD 4D4JA 2VP2A 4RZ2A 1N0WA 5DGXA 1CXZA 3LLMA 5HE8A 4B75A 4QHTA 2J7PA 2D74A 4XVQA 1P2UA 1LV7A 3BH0A 2IS6A 5C4GB 2ZJ5A 2XOKD 4IRUB 2F6RA 4TLAA 5IF9A 5JSZB 4QGFA 2OLJA 1SVIA 1S1MA 2R62A 1XTKA 2WV9A 3UK6A 3VX4A 4E03A 5C18A 2G1JA 1Z0IA 4BLTA 1GNQA 5H8WA 4HB2A 1ZCBA 2BKUA 4BLQA 1RRCA 1A2KC 1S0UA 1S1CA 4YXWA 2GJAA 4F4IA 4TYWA 1G3MA 4M1OA 5G41A 2FPKA 1IBRA 4IDNA 4TT3A 2A5FA 4LCBA 3BRWD 4DT1B 1JECA 1KSGA 2ZRJA 3L8YA 2OBLA 4NCIA 1SZPA 3KFXA 5JJIA 3L82B 3MWLA 5DYGA 5KPJA 3CX8A 2YZ2A 4IEEA 1W4BA 1P2VA 1EFRA 3AP2A 2IYWA 3IILA 1QVAA 3FWYA 4BWYA 4FMCB 1SGWA 5L3QA 3DM9B 4DB4A 1OIXA 2W0MA 3CWQA 3HYTA 3ZGXA 2IA5A 1I4LD 4ZIRA 3OEHD 3N2EA 4PPNA 2NO1A 4NL4H 5EP1A 5AUPB 1SVLA 5GVRA 1DTSA 5FPTA 1KI9A 1OXUA 1M7GA 1I4TD 3HPRA 4DCUA 1WBDA 2W2TA 1QHYA 3OAAA 1RRFA 4C0LA 2FPLA 2G6BA 3CZQA 1ZM4A 3K9HA 1T3HA 1OH7A 4KYIB 1S96A 1KO4A 2QM8A 3GFPA 2FOLA 4A6PA 1NJGA 3PEWA 2O8FA 1W5TA 3QOFA 1LFDB 3VNVA 1KK2A 4FCWA 2EFHB 5K8TA 5FL7A 5LDDC 3CNLA 3MRSA 5B30A 1IY2A 4IDHA 1R0XA 4B44A 5KTYA 3AVXA 4QL3A 1Z2CA 2KB0A 1CIPA 4ARZA 1KIMA 3TLXA 2OZEA 3KUDA 3TBKA 4AKIA 3A4LA 3BFVA 1E2FA 3TMKA 1IN5A 1VYVA 1E6CA 4EQ6A 2QBYB 2LWIA 2QQEA 3A58B 2XXAA 4Q9IA 1X3SA 4PPGA 1TQ6A 1XD8A 4UXJA 3ZYCA 4JLPA 3ZS9A 3QIAA 4FCVA 4RD0A 4AD8A 4JT2A 2IEYA 1ZRHA 1NVUQ 4QGGA 2ZR9A 3FTQA 3EZ9A 1SVSA 2YOHA 1CR2A 2PT5A 1HQYE 3QG5A 2KBFA 2OM2A 4A15A 1BOFA 3BB1A 3B8HA 4HYYA 4HZIA 4L15A 4MQBA 4CEIB 5JBQA 1XTSA 4KCGA 4Y0AA 1ONBA 1GRNA 1P6XA 2J1LA 2ZRPA 3AKDA 2A5JA 4IVQA 2IF0A 4CEJB 3QXHA 1W36C 3VR4A 4PC6A 1KY2A 1Q3TA 4NYIR 1DAIA 2OCPA 2QZ4A 2WJIA 5LBIA 2ZJYA 1N5LA 1HEIA 5J4LA 4JKYA 4ZI3A 3LFUA 1R5OA 2GETA 1ZUIA 2ORVA 2XTZA 5HR5A 4PO1A 1UKEA 3KKNA 3I4LA 2IL1A 3NHAA 3P4XA 4CT5A 1A2BA 2YV5A 1K5DA 2C2HA 4ACBA 2QE7D 4DDUA 4YMWA 5AUOB 1BO6A 4G5GA 1NG1A 3E2IA 2X1VA 5FR2A 1DO2A 4OK3A 1VG0B 1GUAA 2CHQA 1FQJA 1G8HA 1RZ3A 3OEED 2DCUA 3I5YA 3VR5A 3RS5A 1S2MA 2HYIC 5FR1A 4IVRA 4QNMA 3RABA 2QP9X 2AN9A 2OFWA 1AA9A 2R6FA 4PC1A 2RHMA 4MGZR 5EP2A 1FUUA 4DCSA 1MT0A 5KUTA 3MD0A 4M1KA 1E4YA 2CLDX 4D6PA 4A82A 1T5IA 1LY1A 3DMDA 3OE7A 1R2QA 1Q1BA 4BFSA 2BM1A 2OCYC 4B71A 2OLKA 4ZCIA 2DBYA 3AUYA 5BN3A 5EE3A 3B60A 1CBUA 3R8CA 2WKQA 3Q5EA 5BYKA 4CDGA 3Q9LA 3LBNA 2ZSAA 2V7QD 1W0KD 4PZLA 4WXPA 2GVZC 3R9XA 2WICA 3QBTA 2JLRA 4R7ZA 3FGNA 2A5YB 1M2OB 4OHWA 1MR3F 4DLSA 3RC8A 4MKGA 1D6JA 5GVSA 4YMVA 1UADA 5EE9A 2FG5A 3L8ZA 2ZRGA 1XXHE 3NEYA 1J70A 5J4KA 2YWEA 3A37A 4TYNA 3SOPA 3ADCA 3HU2A 2VF7A 1KK0A 5CM9C 2YWHA 3ZDQA 2BJWA 3PUVA 1OXTA 1CR4A 1LB1B 1Q0UA 3GLGA 3UMSA 4AKGA 4HB3A 1E94E 2QENA 4PXAA 4BLOA 1H65A 1XX6A 2BBSA 5JI2E 4QGHA 3T1VA 5CDFE 4DCTA 1XXHB 2W6IA 4RZUA 1Q20A 1H8HD 3B1YA 1ETUA 2OESA 5CIQA 4LHXA 1P9RA 3RANA 1OH5A 2DFTA 4GOXA 3U61B 1DEKA 4OKSA 2O8BA 3AVQA 2PZEA 1TEVA 3K09C 2WSSA 3K9GA 3ZZ0A 1KI7A 2GESA 5TDHA 4TYYA 1TU4A 2IHYA 4BFTA 2QNRA 1L2TA 4GPTA 4MKHA 4G1UC 4HLUC 3OFND 1AGRA 2CHVA 3TIFA 4GZMA 1NY6A 4KO8A 5CITA 2D7CA 2ZRBA 4DBLC 3QI2A 3L0IB 5JRJA 2PJRA 5E7MA 3FMPB 2G3YA 3DPUA 5SZJA 2HJVA 2QSZA 1WCV1 2Q0HA 3R9WA 2PCJA 3CNOA 5FTLA 5BN4A 4C0AC 1GWNA 2B7CA 2YC4C 2JGNA 3ECCA 3THWB 2Y8EA 3QKSB 1NMYA 1U2RA 2A3RA 1N6LA 3BH6A 4MYTA 3GLFA 1M7BA 4LJ7A 2REXB 2CL0X 2FWRA 3KKOA 3RYTC 1SKQA 2IWHA 4PC7A 1KSFX 4F4CA 1KGDA 1AQYA 2NQ2C 2IYUA 4ILEA 5FI1B 2JEOA 4RD6A 4Q4JB 3LXXA 2FX3A 1JEEA 3X2SA 4FWIB 3PJRA 2A7QA 1G7CA 4KJZA 5TMPA 4HAWA 3GJ6A 5DISB 2E87A 2ZSBA 4IOMA 4J0QA 4AKHA 3QF4A 4LSGA 1NVVQ 4ZDWA 1EFTA 1E2JA 4LYJA 1FP6A 1Q3HA 2OHFA 1AGPA 2EQBA 4N1AA 4Q4LA 1XNJA 1G3RA 3SYLA 1S4QA 1YHNA 4JLAA 4XJXA 1VECA 4PHFA 1BMFA 2QP4A 1TEXA 2OFOA 2GXSA 3THYB 1GZSA 3TRFA
chains in the Genus database with same CATH superfamily
5BVHA 2KW5A 4R2LA 2VP6A 1CK4A 5BR4A 4C89A 4GMKA 1OC2A 5BSHA 1KS2A 1HZZA 3MTIA 3HUDA 3PHIA 1W9HA 5AW2A 2IXFA 3B3JA 2C8JA 4LMAA 2CK3D 4WTOA 5EQFA 1ZN8A 5DWVA 5E9AA 5TS3A 3TLKA 4HEQA 4PPFA 4JHXA 3QPUA 1GTG1 2YS7A 5EIEA 4NNJA 3M6AA 4C3ZA 5FHQA 1NLZA 2BELA 4UNNA 1EFVB 4DV2B 1H8ED 4OD0A 1XR3A 3DMGA 4NZ9A 4RTSA 2YVUA 1PVOA 5HBGA 1AXEA 4Q4HB 3W8NA 3T52A 3ZHUA 4CN8A 4DVJA 1CLUA 1WMBA 4ENQA 2IOYA 3V8VA 4HJXA 5KZMB 4CM9D 1PUIA 2BBWA 3U6KA 5CT9A 1KDZA 2PAAA 1DOZA 5JO0A 2Y2VA 1KYIA 2OFFA 4R0VA 4TTQA 2Y1CA 5CDTA 4IDQA 1KXZA 4WGFA 1OZ0A 1ZSYA 2XMZA 3LY8A 4O59O 2XT9A 4BNFA 5ETJA 4D81A 2F9LA 3FMFA 2R2GA 4Y2SA 5EMKA 4Q5IA 4E5PA 3H13A 2WUDA 3I2JA 3M0EA 2VAWA 1NUQA 2C3OA 2R84A 3LAWA 3QZUA 1Y33E 1RYMA 4KMRA 3UT5A 4UUAA 2XITA 4OJNA 3RIHA 1EFUA 1DCTA 3GAAA 3NEPX 3QP9A 5K3DA 1IHXA 3V8PA 4LOAA 3T1NA 3JYPA 3UYLA 3VAYA 2YQ4A 3BFPA 3PD0A 4RZ3A 4G8JA 4NDZA 4PG5A 1Z26A 1U7ZA 2O0LA 3Q3VA 3ZGLA 5DN6A 1F8FA 1B73A 2O3UA 4P9NA 1AQUA 2OORA 5HMMA 4B82A 1YRHA 1YTLA 1DBPA 1Y63A 4ZU6X 4NXMB 3WA6A 4J0KA 2VPQA 3KJNA 5H3CA 3RVBA 2H2GA 2YIVX 1M6HA 2AXPA 4IL5A 4HNUA 5DW3A 1MORA 5DNVA 3UKDA 1BX1A 5IAAA 2DZDA 2OZPA 4HRAA 2C7PA 3RBAA 1PBNA 3B1WA 1N5DA 3MHTA 3WHKA 1ZOOA 4L74A 3A9WA 4JSYA 4GL2A 2GXQA 4WBXC 4D8TA 3CLHA 2H63A 5HQ3B 4GZLA 3MSCA 3N9IA 1R15A 4BAGA 1TJPB 2QYHA 4HFNA 3H5WA 3A1UA 4UTNA 1KH3A 1NF2A 1QRRA 3DO8A 1Y1KE 3RHTA 3GPLA 1OAKA 5TJ9A 1MA0A 3P2KA 3V46A 1Y6GA 2EYUA 5IU6A 2CJWB 2O3JA 4QT4A 2NQ8A 1HETA 2ZK7A 3VKUA 3ZW7A 4BVJA 1XCOA 4E5VA 5K3EA 4IG9A 3PUKA 4INOA 5KC8A 3N1UA 3WLFA 1HY3A 2IE8A 2KQUA 4LJ4A 4Q21A 4UJ3A 1J0EA 1OI3A 4EPYA 5KBYA 4KQEA 1JU3A 3H3JA 4YRAA 3SZOA 2PM8A 3EOZA 5A1TA 5JCPA 5CM2Z 4ARVA 3V5NA 1ZL2A 2X0FA 1CJTC 4WXHA 1QIMA 2O2DA 4AKEA 4MQMA 3B1ZA 4MV7A 3LJKA 1M0SA 2G1AA 4GO1A 4K9KA 5ED0A 1CDZA 2ZJBA 2GEBA 5H9VA 3AT1A 4BRSA 4QAQA 5A6SB 4CQLB 1YF3A 3MWYW 3NWBA 4J76A 4QPZA 3CBGA 2PV0A 3M2TA 1EK5A 4JR2A 2VL7A 1MP0A 1TUBA 4KXXA 1C9JA 4XWGA 1J23A 5AO9A 1MO4A 3BGDA 4HB4A 5JMOA 2X8LA 1UMCB 3DVLA 4GP7A 5EFZA 4KFSA 3I9V1 3UFXA 3QX9A 2IPAB 3LSTA 3TGWA 4JJFA 4PG8A 1LBHA 3OX4A 3CISA 5IM4F 2F7SA 4WKCA 4AG5A 5JYCA 5L95A 3SCZA 1I7SB 2KYRA 1E1YA 1E9CA 2GZMA 1CFJA 2ZJOA 3S2EA 4I8XA 4BKQA 2JLYA 1VL1A 1YZGA 3SLRA 1GZVA 1Z4JA 2Z8YA 1Y9EA 2FUNB 3ICVA 4TPKA 3HYNA 5MN4A 2WJVA 1IDN1 4IEIA 3MUNA 3NHSA 3G88A 5FPYA 4FHGA 4V2UA 1KOLA 3FHOA 2Z43A 2P41A 3BJMA 1I2CA 2ZR8A 3LO5A 4BMCA 5HFJA 3RSGA 5FBLB 3ZV5A 3IGFA 3L9XA 1B6TA 3LU1A 1EU1A 1VRCA 4K40A 3UXEA 5JJIA 1WY5A 4E4YA 4B76A 3TDKA 4TRNA 3ODPA 4CM1A 5FBZA 1T29A 2RGBA 3VYSB 1PD0A 3P9RA 3DCIA 5B7GA 1D2AA 1I2BA 3TDNA 4MW9A 1Q92A 4OSPA 3UBTA 5CP8A 2FZVA 4EJ2A 4A2WA 1WEHA 4QTUB 1DBWA 3PC3A 3AIMA 2Y1WA 2HSGA 1LNQA 3K2BA 3KT0A 3C41J 1MABB 4FTWA 1FL9A 4NFHA 4TSFA 5EHZA 1GQRA 3A6FA 3R5HA 4YCCA 2QQGA 4O08A 1SXJE 4EBBA 2Q6OA 4OLAA 2W6JA 2CXXA 4JR0A 5HQJA 5KNDA 3JPWA 2C5AA 4WVFA 3UOWA 3KTAB 1XB2A 3RSFA 2Z6UA 1PVVA 5M5BA 4AUKA 3A0UA 1NVVR 4FCCA 1CRZA 3QKUA 4LBWA 4N0EA 4YCLA 1IBMB 2Y4NA 3WGIA 1I0ZA 1MQAA 1Q0LA 3W3AA 1N2IA 1TK3A 1MOSA 1CLEA 3DO5A 2XOKA 1XTRA 3OHMA 1W36B 2HF7A 4FNMA 4EP1A 3CSUA 4EY3A 4YJDA 3URMA 1SEVA 4Q7MB 2WJYA 1Y4SA 2OBFA 4UM5A 4LBVA 2OZKA 2M98A 4KK4A 2BKXA 3LF1A 4XW2A 4LV6A 4CF3A 2D1SA 2DBVO 2YWCA 2RHCA 3E7WA 3HU5A 2GARA 3KVYA 2V7UA 2WUEA 4UMDA 3PXXA 5DW0A 1GZHB 3TEFA 4M22A 3W2FA 5IVKA 4MUAA 4E5YA 2F1KA 4BVLA 1B26A 4D0SA 4CUKA 3L8CA 3UUEA 2WTUA 3FKJA 3EBPA 1YBAA 4Z4EA 3GDFA 1SAYA 4HDRA 2VK8A 4FSHA 4Y9TA 3PDIB 4AMUA 4EVSA 1EBFA 2GN0A 4B3IA 1EP3B 2ZBUA 1N6IA 3PXAA 5TGTA 5F7XA 2XE8A 5E4FA 4ZZ3A 4I66A 1WVGA 2PL1A 2P6MA 1GT6A 2VH2A 3F0TA 4UPVA 4WOBA 3PV0A 1F0PA 1Q15A 1U4OA 1K1EA 2EBHX 3OCJA 3QJGA 4RYDA 4KXYA 2PD4A 3C45A 2X42A 1H2ZA 1K0UA 1RJFA 2IYRA 2VA9A 3N05A 1VBKA 3VHXB 2JLWA 5B3JA 4BEWA 1EPUA 3JTMA 1ZM7A 2ZP1A 2R8BA 3D1VA 5L7WA 3G5TA 2C4KA 3ESYA 4OM7A 5HVNA 3PC4A 4GPD1 4Q7QA 2NPIA 2HLHA 3MJ4A 4EHKA 3VJKA 2BPOA 2D0OB 3TO5A 4DLXA 3J81k 1T43A 4F38A 5CDHA 2VXOA 3PKJA 3TKYA 2V7TA 5F7ZA 4G86A 2DUJA 3G2NA 3AOEC 4AO8A 1HC7A 1QDEA 1EVQA 1F3OA 3WZ2A 4IY1A 1NJ1A 3HG7A 2GK6A 4AL4A 4HVTA 3K35A 3IEPA 1V4VA 2OQRA 4KNWA 1HZJA 1UJCA 2YICA 4DDTA 1N78A 5FA6A 1N6NA 1H3EA 4MR8A 4OYHA 2VDOB 4PBSA 1KKLA 4GR4A 2ZYGA 1LDNA 2C5BA 3A28A 3KNZA 3O1IC 3ZEAA 4ZHQA 1GV1A 1W52X 3AI2A 4F71A 1E2NA 1F6DA 4INJA 1DCFA 2GZDA 2AXEA 1XDBA 4CCAA 4AYXA 2GK3A 2QNIA 4G0OA 1WHTA 3ADBA 2QRGA 2ZE6A 4IQFA 3BZUA 2WOOA 4ZQHA 3RRXA 1BHO1 1FZTA 1FPQA 3UWKA 1X2EA 3MMXA 3PGKA 1JQ3A 1XI2A 4JUBA 4Q3EA 1NW7A 1Z6ZA 1A9RA 4KFUA 4QHYA 3L0BA 2GPSA 3ZQKA 4IHJB 1H5NA 3EXAA 4TTVA 4MVJP 1U7TA 5CFZA 5J1TB 1UINA 5JV5A 1XE3A 3N8KA 2XF2A 1AGXA 1BKYA 4PHTA 4Q6WA 5DI3B 1IFXA 2HJHA 2VWGA 5EQJB 5IJXA 3S7TA 4V1CI 3C7DB 1RKBA 3T4XA 1BXRB 4LRWA 4AJKA 3A3KA 3PLNA 1NA5A 3QU2A 4R2WA 5DB4A 3BHMA 1DHTA 5GONF 5REQB 4QYXA 4L75A 1G7RA 2JFUA 5TX7A 1G4AE 1XZAA 4I4TF 1SKAA 4LX0A 2UUPA 3JR7A 2FPGA 3EVGA 1WZUA 4TTTS 4FI3C 2REQA 3VA7A 4FBGA 3R77A 5IEBA 3D6TB 3BZBA 1DKRA 3NP7A 5BT9A 2GH1A 2AA3A 4RY2A 1Z62A 1CV2A 3OMXA 3WRYA 4HF7A 1EK2A 1F14A 1WSDA 1F2TA 1ZQ1A 3TJRA 4DCNA 3NDIA 4WUVA 5A3RA 9LDBA 4B6FA 3EFOA 3I0NA 2GBLA 3OZIA 5L3SB 2P65A 3GEHA 1W88A 3FAKA 4NOLA 4TVOA 3ZS8A 4LYEA 4BFXA 2FUCA 1ISFA 3NNDA 3P2MA 3EC7A 4V02A 1MJFA 2V6BA 3N7TA 2PZMA 3QX3A 4PX3A 2G67A 1V0JA 1SCAA 1CY6A 5JOQA 2XDYA 3PYLA 5A4IS 2NXJA 3A6KA 2E3JA 2BT4A 3N0RA 4F3RA 4HT3B 1EFCA 2QLJA 3JS5A 3NC0C 2JDID 4OBBA 5LM3A 4YASA 3JV7A 1GP2A 1PT9A 1W75A 1D9ZA 2F59A 2LPMA 3D3WB 3DOHA 4NOJA 3WI7A 5IM4A 1HX7A 2OCKA 3WKAA 2O05A 3GT0A 3HKDB 4IGFA 4WESB 1CW2B 1OKKD 1OBFO 3O8QA 1XVUA 3GLVA 4CW7A 3UT0A 3LBIA 2CL6X 3WV4A 2XRFA 1BX0A 1YK1A 1QLHA 1V5WA 2G5PA 1ESMA 2P9YA 2QUBA 2I99A 2PSDA 3DSRA 4KO1S 4UTOA 3A4VA 3RC9A 3UM9A 5LSAA 1EI9A 1J09A 1YE8A 2LZ0A 3FZYA 3LC0A 3WO0A 3LY5A 2QTRA 2XLBA 2IXAA 4FYMA 4KXMA 4KW7A 1A9TA 3QLTA 5LZ5A 2GPAA 4K9RA 2RD2A 5LP6F 3WTCA 2BGJA 4RCZA 2X0RA 2HU5A 2OAP1 4Q1VA 1GARA 1JJFA 1LSSA 3QUQA 4D98A 4NC9A 4O02B 3A2NA 2V7QA 1COWA 4GI2A 1SBNE 1U2GC 1ZEMA 3MJHA 4KN5A 2O0JA 4M99A 1WO8A 3R0QA 4LWQA 2QW8A 5H68A 5HJ5A 2QVXX 3I2FA 3LS2A 3QVUA 1QGAA 5AJZA 3RNOA 3VSEA 2BGRA 2ODWA 4HXGA 1VZ3A 1P7VA 3AY6A 1MAWA 1X42A 2CXRA 3CHYA 4UE3S 1M6EX 3DL0A 2J08A 3QVMA 4EW3A 3KKLA 2BISA 1WMEA 1UANA 2DGDA 2I55A 1WXGA 1U8UA 2NT3A 3PITA 1IU9A 3VH4A 4ZZIA 2WJPA 3NDBB 5AVKA 5BPFA 4XX0B 4JBXA 1QWSA 4XH9B 2YJNA 1ADYA 3IT1A 1NX9A 2PAFA 3N76A 3WBKA 1GPLA 1N2BA 2ECFA 2VBCA 3FYDA 3NANA 1G98A 4JFAA 1SIBE 5EIHA 2NUTA 1I5OA 1R0ZA 3FY4A 4C6TA 2ZCJA 4ZCQA 4RXMA 2H1FA 2OE2A 3OQ1A 1UPTA 4NMMA 3B36A 5FNVA 3UMRA 3SSOA 5B57C 4FYKA 5DULA 4IVPA 4E11A 2ZJ3A 1X74A 1MB2A 4IFEA 3U80A 1PZXA 4P2BA 3ZCUA 4DLVA 4KQKA 2BTQA 3WADA 3CZ9A 3SEFA 3U6BA 3BE8A 1EXVA 1XD2B 2R7LA 1QAOA 3O0DA 2B92A 1D0SA 5EZSA 5G3ZA 4N8EA 3QEJA 2A9QA 3TUZC 2OV3A 3RCBA 2VRCA 1KY5A 2R65A 3RKUA 4YRKA 2XTMA 1ACJA 5BOSA 3ZGYA 5DNYB 2M6LA 2ZLBA 1TGVA 2M6SA 4K0RA 3FSGA 2SCUA 4RC9A 4DM7A 1T9AA 2FFHA 2OWDA 2DX7A 1HE3A 1H2XA 1M34E 3LXMA 1C8BA 3K30A 4I1UA 1Q0QA 2QQFA 3LUCA 3IE1A 5LZ8A 2PNFA 2FQXA 3F47A 3TVDA 3AEUA 2ISSD 3TF5A 2JBAA 1OJLA 4Q7LA 3RHZA 5CEFA 1HRDA 4LYAA 1NHWA 1WM1A 3LQYA 5FLEX 1S6YA 221PA 5HQTA 4U7HA 4U02A 2XCOA 1SMKA 2ZBVA 1M34B 1ZN9A 4D0NA 2GJ4A 3P32A 1JXMA 1PQPA 2J6BA 3ICQB 4CKCB 3H2SA 1ZSNA 3L93A 4M88A 4YR7A 5A7FA 5KNCD 3AKZA 2X6QA 1K8ZB 3S28A 4IIJF 4KSBA 4RJJA 3PC8A 1ZIOA 1PFGA 2FW1A 2MHCA 3HZZA 3QVOA 4PZDA 3TOVA 3V1KA 3ZZUA 3T54A 1K68A 4EL5A 3OQMA 1E96A 2H0AA 1G6HA 4Q4AB 1JSRA 1SCIA 1GPH1 1UIRA 2BMWA 3KUCA 4ZYZA 3G1WA 4KQGA 3NVKI 2C5GA 2OB1A 3IP1A 3RWMB 3AVWA 2GXAA 3GLGE 4LJLA 4EFDA 4CEJA 1AQ6A 1JQDA 3ONVA 5JXGA 1BD3A 2C31A 2HX1A 4URZR 1Z18A 2XWQA 3ZQ6A 4D3FA 1Z2EA 4F5ZA 3JQFC 4TS1A 4KXNA 4YCBA 3BMCB 1RVDA 3S1SA 1WDLA 2Q8NA 1WPXA 1V9CA 5D51S 1S2LA 2CFCA 1B93A 3SS9X 1I24A 4KSCA 1OWLA 1ZRSA 3VR5H 5KJ6A 4WKOA 4GVLA 3VYRB 2HW8A 4PV7A 4HQFA 3IJ5A 4X92A 3CUVA 4R7GA 4D6XA 3PXDA 5TMBA 4TV8B 4IRXA 4I3HA 4YRCA 1CR6A 1I30A 4EOGA 1VPDA 2B9EA 3K9LA 2KLBA 2Q5CA 4M0DA 2FFJA 2VZLA 2OXEA 2XB6A 1UBGA 1ISRA 5JWOA 4TTRA 4DIEA 3MHPA 3TVTA 3BMNB 1V35A 2MYTA 2DHEA 1RYNA 1RKXA 2I22A 3D2AA 5EJIA 3UPDA 4C21A 5C32A 1CHNA 1YU9A 2IVZA 2J3IA 3P0RA 4OXNA 3RYFB 2CBXA 3KQVA 4ZI7A 2XD4A 2C57A 2PCLA 1C9KA 2LRHA 3D6NB 3IB6A 2GBFA 1Y6QA 3GGSA 2UU9B 3I1FA 5EE5B 5DRYA 2LTAA 4BKOA 3SN6A 3IVXA 2YMPA 3KUKA 3LA6A 1YZLA 2D3WA 2UV8A 4M7WA 3T1QA 2HBRA 4HQRA 1FU4A 2HSWA 2HY7A 3W8RA 2H31A 3ZHVA 3N0WA 4BPBA 4LKOA 5GGXA 3RJ5A 4US0R 5CW1A 3WGOA 1QFYA 2R68A 3EZFA 3HXLA 3WWOA 3DT6A 1YDFA 4HPXB 1US8B 3JQ8A 2F9MA 4ZMRA 4J0JA 4XFDA 4EARA 3EMVA 5GONA 1Q44A 2VOEA 1WV0A 2BGUA 1MX3A 3MT9A 4BUZA 3HYCA 1CJSA 5JYBA 5EGNA 2WWWA 2YX1A 3OCUA 4I4TA 5EKDA 4D99A 1HT2E 4DDWA 3F6CA 2WPDD 3OC0A 3N7AA 5DGDA 1W7AA 1JIXA 2WEKA 3TI9A 2R6DA 4G81A 1E2QA 2PZAA 3PTLA 4BNVA 1BA2A 5AXCA 1N75A 1MAAA 1VCNA 3ZH9B 1CB7A 4M7RA 4ZO6A 4BHTA 3EG9B 5JALA 1D4OA 1M2OA 5G0WA 1AKUA 2GAAA 4JYCA 4WK6A 2Y0PA 3BULA 3GGDA 3DCNA 4FDLA 3WZMA 1NBEA 2PBRA 5CB0A 4LF8B 2C2KA 4BFUA 1QIDA 1MUUA 1QZXA 4F3CA 1T0UA 3KEGA 2A33A 3QVVA 3WGJA 1HV8A 3N58A 3T3MB 3OTGA 3UFBA 1BJRE 1UJMA 2OCAA 3BWXA 1R00A 2EKLA 3MF4A 1R4NA 3O90A 5PGMA 2J6IA 2KSQA 3LWNA 3SXJA 3COYA 4C20A 4XYLA 2J0VA 5IAGA 5KMGA 4NPAA 2NLOA 2ZBRA 1BYUA 2FX2A 4WLOA 5TEWA 3L6DA 2GPBA 1EXNA 3K70D 2J85A 2OG2A 1CF9A 3PVZA 1R1DA 2P9JA 2FWBA 1WB6A 1USWA 1KF0A 2GHRA 5IH3A 3VKWA 1O1YA 3NR2A 3OTOB 5C8ZA 1M1NA 2CT8A 3LP8A 4PCLA 4JI6B 2PGXA 1A1SA 2XZLA 2QJOA 3AHGA 4GR5A 1THZA 1NMQA 3O94A 5GJVC 1KEVA 2YFQA 5D3KA 3WR5A 4CMAA 1P7CA 3TLAA 2EGUA 1J42A 4RA9B 5CK4A 3GAZA 1FC0A 4LDRA 5FWAA 4MWCA 1LJ8A 3CLSD 1DAPA 3F7MA 4PANA 3RU9A 3BORA 3SIRA 1OLUA 3EGXA 1MQSA 5JEDA 2XOEA 1AM4D 1RXEA 2HU8A 3N07A 4WBSA 4REQA 3CW2A 3DBOB 4AN4A 4DMGA 5E1MA 3DD1A 1UOQA 1WB5A 1RWVA 5BW4A 1I6MA 2FA9A 1KMIY 3D9QX 3OTQA 2RJ3A 5JG7A 1DC4A 1N2JA 1A4RA 3NTXA 5LQUA 2R9VA 4P7FA 1XZKA 2AGVA 3T12A 1HEUA 3EWSA 1Q22A 2E4YA 4RKEA 3AUJB 1IZ0A 2A9KA 3MC1A 5DNUA 2VNHA 3GAMA 2F43B 5A4DA 2PLAA 1O08A 2A1TR 2H29A 1ODIA 4MW6A 4KIJA 4AY3A 1XEXB 3U5TA 1K2WA 5T5QA 5K6AC 2WU0A 4KE6A 3PE6A 2ZJ1A 5FFFA 1IBCA 2J9RA 5FOSA 4LRTB 4MULA 3JRNA 4RF3A 1W4RA 2VRWA 4A6EA 2VHWA 2ZYRA 2VPYA 5KU7A 1BZYA 4E07A 1TJYA 4W1SA 3V9PA 3KU1A 2UVPA 4A0RA 4WOJA 1U2EA 2BZ0A 3H1AA 4GX2A 3I4FA 5BUZA 2GZ2A 4RVGA 2JVKA 4HX5A 4DSUA 4FCTA 4H17A 3QJ5A 2Q41A 3WHLA 3HJHA 1Z35A 2OUKA 4Y9SA 3H1TA 3KFVA 1MW8X 2DFNA 5CNIA 2W4QA 1JALA 1SUSA 4IHAA 4RUKA 4ZU1X 2C7OA 2CUKA 3NATA 1JNYA 4UKDA 1VP3A 2J9XB 1VPVA 2W6ID 4YAIA 2YV4A 3K0EA 4IUDS 3F2VA 4NAHA 2VZEA 2ZB8A 3QBJA 2D4AA 5FTKA 4ZAGA 4LZLA 4E1BA 5ALJA 4AIIA 1ZCZA 4FNGA 2FWMX 4P3PA 1K8QA 4L72A 4CGYA 4GLJA 4YP0A 3CNHA 4K2AA 1E6KA 1J2UA 1SQ5A 2AOUB 1CQWA 4MI6A 1SKMA 1N36B 1UP4A 1Z4IA 1ZXBA 1FUYB 3RIMA 2AEJA 1MIOA 4DJAA 1EFDN 2JCSA 2XX3A 4R1QA 5DWQA 5LLSA 4FQ8A 3PD1A 3CPEA 4KXLA 3CNEA 3CN7A 1MLDA 1Y6ZA 2FZEA 3O47A 5AVYA 3WAJA 3ZN2A 1Z38A 2V0CA 1P6QA 3WRXA 2KS6A 4BMDA 1DIOB 4NLLA 4YP1A 3KJXA 4EUFA 4YHHB 2G9VA 2JF0A 2Q3HA 2OVFA 3UOGA 2QW0X 1D6NA 1RYYA 3KS9A 3LL7A 1G21A 3U44A 1ECJA 2Q5LA 1M67A 1UFVA 3NBKA 2IBSA 5ES3A 3LHKA 1WA5A 1QF6A 2PT9A 3W7AA 4BNDB 2WYIA 4K1XA 1G20A 1MO3A 3VR0A 1NRJB 1W2GA 1F2UB 3VR6A 1E2EA 1HKHA 1TFUA 1TO2E 4GXQA 5J40A 1UAAA 4ZMSA 1U3FA 3RREA 1TF2A 4PHGA 1AKYA 3GN2A 2WWYA 1G60A 3Q1LA 4KLRA 2WD7A 3LQ4A 3DT8A 3MS4A 4BNJA 1X1RA 1A98A 1NULA 2D2IA 1S02A 2GS9A 3FOCA 3I9LA 3IIJA 4MWBA 4BUCA 4D8YA 4OHXA 1L5HA 3C3WA 1ZGCA 4M0UA 3F9CA 4Q82A 5H70A 5K8CA 2RH4A 2VHQA 4DUPA 3QLVA 4QDUA 3BRCA 4YEDA 4NXNB 2WD9A 1LRJA 2XGMA 4WOCA 2ODQA 4JX8A 1E18A 5H82A 2P5TB 3MAAC 3PEVA 2NV0A 1EJ6A 3NBMA 3GJ8A 5EPOA 5FBRB 4RA6A 4GLOA 3WOVA 3HXMA 4I1IA 4MROA 3U40A 3AVVA 4AJPA 1KEPA 4LJSA 4XGKA 3WK4A 1CZLA 3MCVA 4NE9A 1YJXA 3S81A 4KPYA 2CXQA 3LUPA 4NNPA 4Z8XA 4HLCA 4UUNA 4BO9A 5ESDA 2X13A 4L95C 3RT1A 1LZKA 2XQGA 4Q19A 3T3GA 2RI1A 3DVAA 4J9UE 5DLQC 4CMKA 1K08A 3EX7C 1EA5A 1XQWA 2HWWA 3PQ8A 1RWXA 2P9CA 2Y93A 4NOMA 4ZYYA 5BVGA 1G8GA 2VVTA 2VI5A 3Q7RA 3L8EA 2VJMA 2C5FA 3H6HA 1L4BA 1UKBA 2OV2A 4IV0A 1PJ4A 4RTQA 4KAAA 4A9AA 1E92A 1UC9A 1BQ3A 2X2EA 3BWMA 3PQDA 1FE8A 1J2EA 1TZ2A 5IUKC 3LBHA 3VPCA 3W06A 4D4HA 4OX9B 1Z8NA 2QR2A 5F12A 3KQHA 3P52A 1DKUA 2W4IA 2WKRA 3WB0A 2UUOA 5DGIA 1R0SA 2HFJA 1SQ0A 1TQ4A 2JANA 4KLZA 3MWFA 1E63A 5BV7A 2QX4A 2QPOA 4HX2A 3Q8WA 1XQ1A 3ENWA 3IR7A 1NN3A 1SKYE 1MPXA 1M2NA 1U1FA 2QTHA 3OCVA 4K6GA 4W5TA 4KQJA 2OD7A 2UXCB 1SY7A 1YO6A 2FXIA 2XYHA 3PT5A 4LBZA 2WWVD 4BO8A 4B3GA 5CLGA 1RM0A 3B3FA 2DR3A 3M81A 3VISA 1IIBA 1CCWA 1KJ9A 5CCXA 1OFTA 1RRGA 4KO4S 4M8KA 3CS3A 3RC7A 4OHRA 4QVIA 1RPNA 1U9ZA 4ZQCB 3V8BA 3WYEA 4QZVA 1PWYE 2R6JA 2WZDA 1QC5A 3AUFA 3PHLA 1NF8A 4LNUB 4QYTA 2QRPA 4R8KA 5J2TF 4Q47A 3K4PA 3T5BA 1NW9B 1SQFA 2XUZA 1SK9A 1ST2A 2VEOA 1YC2A 4DV5B 3OZVA 3ZIDA 1WXFA 1EFHA 1GO2A 2PX4A 5BO5A 4X7MA 3K4HA 3C4JA 3DXYA 4I0WB 4Z9XA 1FX0A 3TZCA 2AG5A 3HN2A 3M6XA 4O25A 3U7GA 2C59A 1RLJA 2GCIA 3A31A 4M0FA 4ND1A 5H4HA 3TEMA 1PGNA 1NP7A 2CYAA 3HZOA 3PXUA 4CGZA 4Z4QA 2Q1YA 5LDDC 2CC2A 2Y1GA 5D3ZA 1Q1QA 2JGDB 2RGXA 3GEDA 2IU0A 1Z2OX 4WI1A 3H4VA 1XZQA 2NTVA 1Y9AA 2XRMA 2ZJAA 2ATVA 1M8FA 1KJYA 2ZB2A 1GPUA 3DLPX 1Q7TA 3NC1C 3W5JA 2HQBA 1KAHA 1E77A 4CRWB 1JP7A 4QJBA 1VMKA 2YJ3A 3DLTA 1X1DA 3GWGA 4DUGD 1OIVA 3PG5A 4NX2A 4MGHA 3KEFA 4TT8A 4E5DA 3TQTA 4IR7A 2OOKA 4EYEA 3MERA 3OKFA 1L9KA 8MHTA 2PS3A 3QKRA 2BEVB 2X76A 3E15A 1GAEO 1S9HA 2HIHA 4L3OA 3TQQA 2XHZA 1ZGBA 3Q2KA 5FADA 5K6TA 5FAKA 2J3KA 4TSKA 3OCZA 2PMDA 4LYHA 1KVQA 1QGDA 2Y66A 4P5DA 4OUKX 4MWEA 1E2HA 1QIGA 2DWQA 2JHPA 2PL5A 1QYDA 4X63A 3RVOA 2NIPA 3LQRA 4HXEB 1ZD5A 3LCJA 4F72A 1QV7A 1OKKA 3B6ZA 4BRZA 4DLPA 4ZAVA 1SWVA 1IATA 3DMTC 3N5CA 1JAZA 1KEKA 2UZIR 3DXZA 3IP6A 1GAWA 4QPCA 1A4UA 3RBZA 3I9NA 2ONYA 2PS1A 3CV3A 4H35A 5LIPA 1ZGZA 4Q1FA 5IABA 1H2AS 1SZJG 1UPBA 3OCXA 4O63O 3RRYA 4B40A 4C0KA 2G25A 4BQIA 1GTZA 2I8LA 5AHRA 2CYBA 2GJSA 1PQWA 3ABSB 4HNSA 5IVIA 5NLLA 4RTJA 4G0XA 2P9FA 4QFDA 1MF7A 2NXNA 3NV9A 3HP1A 4PQYA 2Y1KA 2EJCA 3MW8A 1OXKB 1FTWA 4IO0A 2VF4X 3GMDA 3WJ7A 5KYGA 5AJHA 2W9XA 2RGWA 1BFKA 3CCFA 3C6KA 6CHYA 4L3WA 3H2IA 4YAKA 4N82A 4AI6A 2ATEA 5AVQA 1HYEA 1PL8A 1B0ZA 1YRYE 2EWVA 2HV8A 1T9ZA 1H9AA 4PR0A 4CKYA 3QXXA 5AUQA 2LNDA 3KHSA 1NIJA 3JALA 5JQGB 1IEXA 3I05A 4JI5B 3F46A 4ENRA 2G17A 2JL1A 3HLYA 4V0QA 4CI9A 3FVVA 4ERNA 4QQRA 2PFSA 1UXJA 1ZGHA 2A4KA 3O1HB 5FOXA 3B53X 4GPAA 3ZNNA 1JTVA 3O9ZA 3K5HA 5K1ZA 4KK3A 5JVDB 1XZ8A 1JF8A 4C88A 4JC8A 4HDAA 4BV2A 4RU1A 3MAGA 1RWKA 3EQ2A 2BZSA 3IALA 4MO2A 1PJTA 2AEMA 2H2WA 4YJ3A 2GHTA 2Y4OA 3BSYA 4I5GA 1ELOA 4Q3LA 1EGMB 2G6TA 1OMOA 3H1GA 4GG1A 5DNWA 4EB6B 4ER6A 2D2XA 5JC8A 5EIXA 1O95C 3LVRE 1T10A 4WECA 1CF2O 2EGHA 3TW8B 1R0WA 4H7JA 5JHGB 3R3ZA 3DEFA 1FVXA 3KQKA 3RVMA 5HK8A 5JMTA 3ESBA 1HMPA 5EJEA 3CLTC 5ICSA 4MYCA 4P83A 1FTYA 4YBZA 3EY4A 3PTAA 1WR8A 4YMUA 4URXR 5L3QB 4L4UA 5LQMA 3KQOA 5LCXA 2IOHA 3RGWS 3JQ9A 1M3SA 4RJKA 3S1AA 1PEAA 2GK7A 2NUPB 3ZLJA 3L1JA 3OEWA 1PQ4A 3DOFA 1SURA 1WKCA 2YV1A 5A3VA 3ZE8A 4YXFA 1ZIXA 1KJNA 2HK7A 1N5IA 1PAUA 1LBIA 3KDSE 2GCOA 3FWPA 3ZVRA 3BCUA 2Q29A 1P9WA 3JWIA 4EG6A 1FK8A 1UP7A 4E13A 3PTZA 2NP6A 1LVHA 2MINA 1PSDA 2GTIA 3O73A 5CXQA 1LTQA 5AR1A 2VJBA 2FQWA 3DE0X 3FNFA 3PIRA 4I55F 4M7OA 1X0XA 4B4DA 4MV0A 1PX0A 4EDFA 2IS1A 2VYFA 2JFBA 3O4GA 1Y5NA 4AG6A 4D1YA 1JWBB 3E3AA 2Q3FA 5KNCA 1VM6A 1QXSA 4H7PA 3ZE9A 3WIOA 1ZWLA 4EHFA 5I7FA 3TGLA 1FUEA 3FI0A 1W2WB 2IHBA 1PJ2A 5EFOA 2C83A 4L6CA 1JIKA 5HCIA 2G9NA 4ARZB 5H3HA 5T8KC 2H65A 2PWPA 1JG3A 4GNKA 5CLFA 1C7JA 1M7HA 2IEAA 2WWIA 3JQBA 3FKSD 5SY4A 3SS8A 3TTTA 3V4OA 1SU7A 4OH1A 5FPPA 4KN8A 3W6PA 5KJCA 3V2UA 4ND2A 4OO3A 3B3GA 2HT1A 3EPKA 2CD9A 5C31A 2G70A 5BP7A 3KT8A 5AIAA 4E4TA 2HWUA 1KERA 4GOND 4J8PA 3RC2A 3DM5A 2VZ9A 3CX3A 3K0HA 1Z5ZA 1MENA 2DH5A 3DZGA 1YE3A 3KPUA 1TVEA 4ZA2A 4AMYA 5JECA 2VPWA 2ENWA 1XMSA 4EA7A 4UOQA 3TSAA 3OHPA 3QPWA 1YZFA 1HO3A 3OG9A 2E2WA 1KJZA 2ZWAA 5FEUA 1E4VA 1AZTA 1BEUB 1O94D 1SZDA 2VHVA 1DAKA 2VTEA 3A1VA 3G9ZA 3HLTA 5C34B 3V1TC 4FYVA 4CMGA 1P31A 4FHZA 1P2SA 4QASA 4X3CA 3EXHB 4FBMA 3DDHA 2Y9PB 2VKTA 2FUKA 1VBFA 5AKLA 1VGQA 3A9CA 2QAGA 3OFVA 5FV4A 4LGVA 2P90A 5A5GA 3QEMA 3MXOA 2JGRA 2X15A 5H59A 3NAZA 2QUHA 4YUYA 5C5EA 3PR2B 2HBQA 3HJAA 1EEXB 4FE4A 5DM1A 5KHOC 3LC1O 4LSZA 4ZYVA 1ZDMA 4U2EA 4W9RA 1YI0A 2GEUA 2HA5A 1GKKA 4HDOB 3OA2A 1Z2NX 2B1QA 3NALA 1RAEA 3CUUA 3OKCA 4W5QA 2Q4OA 5EXDA 1A50B 4EJSC 4YH1A 2E5WA 3RYIB 5HTKA 2II6A 3U3KA 5J2UF 1H8HA 1YA4A 2XUKA 5JDCA 3R0XA 4WBNB 2HWYA 2OHOA 3HWSA 4LJ5A 1KFKB 4RK5A 3RS9A 4JI8B 4POOA 1PQYA 1T8WA 5A3QA 3SNHA 4CEHA 4ISCA 3NPAA 4FXPA 4DBZA 2DT5A 5LB4A 3BF8A 5ITSA 3ZD6A 1SBZA 4RTNA 4XJSA 1I4WA 3WDSA 1N25A 2BTOA 3HJUA 3SE7A 4BAZA 2WPDA 4Z2AA 1FMFA 5E9JA 4FFOA 2UVQA 3FZGA 3IEUA 3CZPA 1OI7A 3LUGA 1R6VA 2G9RA 4OA8A 4RVSA 1JHPA 2QUJA 3MINA 2J7PD 2XMGA 2C7VA 1UZMA 3PSAA 1XAGA 3TUIC 3FUXA 3MOSA 3INYA 3JARA 4G23A 3ZG6A 4D2IA 2CJYA 1FIUA 4U8HA 5HSGA 1JYSA 4QIHA 2HRDA 2HA7A 4WFQA 3KHKA 4A8JC 3HXPA 3GJ5A 4LJAA 2V8BA 4MITA 4GX5A 4C2UA 3VSAA 3THSA 2OSVA 3F7TA 2XGOA 2Q1TA 1Y7IA 1M73E 1RYBA 3EXG2 5E2BA 4CKEA 2AJ8A 5IEJA 1AF7A 3G9TA 4D8UA 4FILA 4QFMA 2X19A 1RTKA 4TT3D 1VRVA 1E7MA 3CH5A 3VV2A 3HVJA 1D1QA 2GZHA 1BWSA 2B20A 3GHYA 2GA8A 4OYRA 3GQVA 4KLAA 4QBKA 2AR9A 2PL3A 3ZWDA 3BIOA 2AT1A 1VDMA 3A3NA 1U1DA 3EGEA 3DD5A 2G4CA 1EFPA 2AMFA 3N6VA 1XOIA 2CKMA 3K8OE 3FYHA 3STXA 2HZ7A 1U3WA 4TV9F 3OX1A 4YPFA 1SUPA 2EC5A 5TF4A 3ZTWA 4B6SA 5T4HA 5BXQC 5AQEA 3BB4A 4EGQA 2J31A 4TTAA 5LP6C 4V0OA 2AFIE 2PX5A 5TY0A 4W9MC 2EAUA 5AW8A 2R44A 5LOVB 1A77A 2O8CA 4XCVA 1VCOA 3O7MA 5D5PA 5CNMA 3ECAA 1L8AA 3KKMA 4LQCA 4YQYA 5K0FA 3BICA 3WC4A 4Q48A 3JWEA 1AHHA 1G5QA 1ORDA 2OT3B 1ZKDA 2PYDA 2ZWIA 2PD3A 3G5AA 3A1DA 4LDZA 3OAAD 3N8NA 1V9SA 1SVNA 3CSDA 3H1FA 3QK7A 1R5NA 4EJMA 3RFUA 5AKKA 3GCDA 3OT1B 1TA0A 1N5MA 4MWOA 2RHRA 4KR0A 4RLSA 2B82A 1M8JA 2O2JA 4UFOA 4E94A 4R98A 5EHIA 3Q8KA 3OURA 5FDFA 3OBIA 4GKAA 4HUJA 4QOGA 1D8AA 1XYVA 4IOLA 3U4CA 1OT5A 5B58C 1LDGA 1TMKA 1M1YE 2JFOA 2VDKB