3DOEA

Complex of arl2 and bart, crystal form 1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
189
structure length
189
Chain Sequence
GLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTADLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 2
publication title Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
total genus 63
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3doeA00
2F1HA 4POAA 4GI7A 4M1SA 1II9A 3F3YA 3RNLA 4ZCMA 2C03A 3A4NA 2Q6TA 2O0HA 2EWWA 2RGAA 1S3SA 1HT2E 5BN4A 4S35A 3RDPA 3VR1A 1M2OB 4OQFA 5EE9A 3CX6A 3RYTC 4PO9A 4B3XA 5K8TA 1D2EA 2XTMA 2JLZA 1Z0AA 4LHXA 3PEWA 1TF5A 4HLCA 2VHUA 4KSCA 1AZSC 2MMCA 4ZDIA 1QHSA 4KVAA 1P73A 3BFVA 3IO5A 4FMBB 2RGNA 2QGZA 2VEDA 5UKDA 3ICEA 5IK2A 2QBYB 1O3YA 4MITA 8OHMA 4LV6A 1NRJB 4FCTA 1P75A 3BIFA 5M04A 3O8BA 5FOSA 3A1SA 2GHIA 1KGDA 1UF9A 3S1AA 5JCZA 4MRSA 4OQNA 4PHHA 2H17A 2IS4A 1NLFA 1SVKA 4DLYA 1I4TD 4IFBA 3RS7A 4DVGA 4KO8A 2JJ2D 2HYDA 5GJWC 2WSSA 1YKSA 2ZPTX 4BLOA 2QU8A 1Z2CA 3TNFA 1W5TA 3HDTA 2ZJZA 2OFXA 1N5LA 4LCBA 2FPLA 2KWIA 5DO9A 3LQRA 2IEZA 4BRWA 2ZRBA 5KPJA 2F43B 3V9PA 3K09C 4LRWA 4D4KA 2G3YA 1CTQA 4Y0VA 2N46A 4ZDWA 1CKEA 2YC4C 2J9RA 5JJIA 1OFUX 3C14C 1S3GA 3TW4A 1R5OA 2AN9A 1U9IC 2FOLA 3WBJA 1UKEA 4LK2A 2IYTA 2JDID 4JLVA 1JXMA 2BMJA 2JLRA 1YVDA 3H4MA 3RRNA 2ZRCA 3WRXC 2W6IA 2VQSA 4QBGB 4XWOA 3CRVA 4JLNA 4LHWA 4JJZA 4TTQA 3GLHE 5FI0B 3Q7QA 3B78A 3I8XA 2PH1A 3CBQA 4NL4H 3T1OA 5TVKA 4RD6A 1IOZA 4M9XA 4CDGA 2CCJA 1E1QD 3LBNA 3SI7A 2A30A 1Q44A 4W9MC 2D62A 5FTLA 1MV5A 4EQ6A 4IOMA 1S1MA 1DOAA 3NBYC 4B33A 1W1WA 3Q5DA 2GILA 4DDTA 1IXZA 4RKFA 4PZYA 4NONA 2JLSA 2KI5A 2ONKA 2WJHA 2PLRA 2WPDA 3A4MA 3QPVA 1R5NA 2ORWA 4P3YA 5KNBA 3R8CA 4JBXA 1JEEA 5LBIA 1E2NA 1QVRA 4DSUA 2C95A 4A15A 3THWA 2OAQ1 2ZI9A 4R2IA 2XTNA 1A2KC 2NTYC 4PANA 1ZD9A 1W0KD 2HXSA 1MO5A 1B0UA 4TTRA 4ESHA 3I62A 4YMSA 4LPKA 1Q3HA 3IUYA 4V0NA 3SN6A 3R9WA 5JMTA 2HF9A 3EZ7A 4OQXA 1LF0A 2X77A 2CL6X 2V7QA 3KUCA 2OFWA 1H8EA 4TQUS 1E9FA 2PBRA 2A7QA 4Q4HB 721PA 3V4RA 1XFAA 2GA8A 4DLWA 4US1R 3U4QA 2NIPA 1U2RA 3QBVA 4KODA 4JYBA 1X8KA 3TSZA 2IL1A 2P3SA 2ZSDA 3TKLA 3MMPA 4NCKA 2PEYA 3P20A 1E98A 1M1YE 1P2TA 1W7AA 4M1WA 1PZNA 2FGJA 3FKQA 1II0A 2IYLD 4Q9JA 2J87A 3GFOA 2WJVA 1LVGA 3O8DA 2JA1A 1SXJC 2XNDD 3GEEA 2ZJ5A 2PX0A 2R6CA 1NVXQ 2AWOA 3QKUA 3CUEF 2YOHA 3VX4A 4TYYA 3KTAB 3CIOA 2W00A 1N6PA 1DE0A 1L2TA 4OI1A 4HB4A 1T5IA 1YJ5A 2ZR7A 4TMTA 3RWMB 2GAOA 4LJYA 3TMKA 3CRQA 1JR6A 1VHTA 3AKYA 3DM9B 1COWD 3F8TA 4M21A 4TWZA 1BMFA 1OSNA 3C8UA 1QHIA 3I5YA 1U0JA 1EFHA 2ZREA 1TF2A 3BXZA 1TU3A 4ACAA 1YR7A 621PA 4Q4AA 1FQKA 3H1TA 1E2KA 2V1XA 1A1VA 4NYIQ 5B2ZA 4QXAA 3ETLA 221PA 2D3WA 3HP1A 3RANA 4A4DA 4EQ6B 4BEBA 4C2UA 1JQLB 2X8AA 2QQEA 2NZ8A 4O0MA 5EP2A 1XMSA 3OF5A 1K5GA 3GJ6A 5DN6A 4GOJA 5ANRB 4D4MA 2OV2A 4KHZA 1WB9A 1W49A 3PUZA 4XD7D 1IBRA 1KSJA 3WNBA 4F4CA 3U6KA 1T0JB 2DY1A 2GNOA 3IPXA 1MH1A 1N6HA 1ESNA 4A9AA 1KI8A 2ZYVX 3W6PA 3EIHA 1IM2A 4OJKA 4BFWA 2H5EA 4P0TA 1N0VC 4RCYA 5AJYA 1WP9A 2D06A 5H1YA 1FW6A 5AUPB 2ANCA 3MJHA 2ODBA 2WOJA 3BGWA 3AF1A 1R0ZA 1P4SA 4WAUA 5J4YA 2ATXA 2VP4A 2A2ZA 4KYUA 3DDCA 4P33A 2QP3A 3CR8A 4WVFA 4B48A 5FOXA 4HZUA 3ZIAA 1JQJC 2B6HA 3W6OA 1KIMA 2W0MA 3AKDA 1F3OA 3AP3A 5DE3A 2ORIA 2EU8A 3OHMA 4MRRA 5EE3A 3U4QB 1FMJA 4CEIB 1G3RA 3NDBB 3K9LA 4NBSA 3Q7PA 4QNRA 1R2QA 3F0TA 3TR0A 4O2RA 2RGNC 2ZRAA 2V3CC 3B2EA 3VFDA 1S1CA 2BCGY 1TADA 1HQYE 1GZSA 5CIWA 1NY5A 2AKYA 1W36D 5C2JB 3T35A 2AHOA 1CU1A 4JLAA 5EP1A 1F60A 1KSHA 2FWRA 1XU4A 2PL3A 1RYHA 2B21A 3MAAC 4G5RA 1S0UA 2SHKA 5CYPA 4ZI2A 3LQQA 1WQ1R 5GVSA 5J4HA 2ZVPX 4MYHA 4B3DA 2VH5R 2QE7D 1N5KA 1HURA 2ZAOA 3MWKA 1OT3A 2G77B 3I3SR 1ANKA 1I2MA 1YZKA 3QXJA 4RJLA 1YQTA 2Q9CA 5KSPA 2G1JA 2ERYA 4OL0A 1GL7A 4CEHB 1AM4D 3QE0A 2KB0A 3MFYA 1TX4B 3QJYA 3R8FA 2C04A 2WICA 1US8A 5JRJA 1G8GA 3PR1A 1G7CA 2XSZD 5L3SB 2HDNB 3VTKA 1J7KA 3EARA 1E9BA 2QTHA 1CLUA 1IN7A 3CH5A 5AK0A 3PEYA 2ZRIA 2UKDA 4A0FA 3SOPA 1W44A 1SKYE 4QGHA 2OFOA 4B43A 4Q18A 5BN5A 1N5JA 2YYZA 3PVSA 3QKSA 3TUJC 1PLLA 4DCVA 4A8JA 1ZUHA 1I4LD 4UNSA 4V0KA 1WXQA 1UBCA 2H1LA 2WJGA 4GPTA 3K0FA 3OEHD 2C9YA 3AVUA 4EFLA 1G7SA 1NVVR 1C9KA 2DPXA 2IBMA 3EXAA 4Q1AA 3RS4A 3CB4A 1DAHA 1Z22A 2EYUA 3OZXA 4OYHA 3DMDA 4B2IA 3QNUA 1E4VA 1KK0A 4TMWA 4TMVA 4D25A 1P2SA 2O8CB 2FSFA 3T15A 5IK2D 3KDSE 1UPTA 4J0QA 1S9DA 4MRVA 5FFMA 4IW3B 4Q48A 5CJ2A 1DARA 1FTNA 3SBDA 5TV2A 2ZJYA 4R7ZA 1UEIA 2FSIA 2BKUA 3DO6A 1BOFA 5JWOA 4A0GA 2O8DB 2FZ4A 3GLGB 1VMAA 1HE8B 1KI9A 2DFNA 4QGFA 2ZRLA 4Q9IA 4RCZA 4C30A 4HZUB 5HTKA 5CDFA 1N0WA 4Q1EA 1U0HC 2PZFA 1XD2A 1G1MA 2HT6A 1FUUA 2QENA 1NMYA 3AEZA 4HLQB 2AR7A 4M22A 1Z8FA 3IQWA 3UIEA 3TJZA 4DBLC 5A5GA 2R6FA 5DI9A 4C0QC 4X8OA 1Q12A 4LJ6A 5JWHA 5SZHB 4HAVA 4NCHA 2AD1A 4D82A 1NNEA 2GXAA 4BUJA 1EG7A 3IQXA 4F4IA 1J99A 1Z6YA 1IXSB 4XTRA 4DSTA 5K8UA 2H7VA 5JEDA 2W6ID 3L82B 4IDHA 5BW8A 3X1WA 1P62B 1CRPA 2KJQA 1P61B 2Q3MA 4PC6A 3ZZUA 1MRNA 1FNMA 3EZ2A 3UWOA 3KQKA 3QG5A 3EPKA 2ZYUX 4ZIRA 4HB3A 2VP6A 1F2TA 3FKSA 1J2JA 1QHXA 1U98A 1P2UA 1MABB 3X1DA 2VA8A 1US8B 1R5BA 1YZLA 1NL3A 3WRYC 4WOPA 2J46A 3SFZA 2VPPA 5FL7A 5EXPA 5ELXA 2V54A 2GJ8A 4K81B 1G3MA 2CJWA 2VYFA 2JJ1A 4E07A 4G1UC 1UDXA 4TSFA 2E9SA 1TAGA 5E7JA 1GOTA 2QMUA 4KFRA 3IKJA 3QKSB 3AVWA 5J4VA 5CLQA 2QI9C 3P4XA 5CITA 2QP9X 3CX7A 1KJZA 1G6OA 1JPNA 1KJYA 2QTFA 3AVPA 3K0FB 3KKQA 4NCIA 1OKKD 1Q3TA 5JJKA 5JRZA 3GCGA 2UVQA 3X2SA 4FIDA 2RCNA 5IT5A 2X1VA 4XWKA 2ZI3A 4C0HA 3GLIE 1ZIPA 2FDCA 2JLQA 1JECA 3D6TB 2YWHA 1XEXA 1N2CE 5K8LA 3QI2A 2PEZA 4LDJA 3PXGA 1MKYA 1XEWY 1OFHA 3KB1A 2HJGA 4F93B 1XXHE 3E5HA 4EFNA 3I4LA 4CT5A 4JLBA 2F1IA 1WBBA 3UANA 3LX5A 3MG9A 4IOJA 1CBUA 3B85A 3V00A 4FINA 5SZIA 1DAGA 1DVRA 2VP0A 3WY9A 1KI6A 3TQFA 1XTJA 3KQHA 3GP8A 4B2PA 1JAIA 5K8IA 1XBTA 1ZIOA 2ZSAA 2Q21A 4LC1A 3N2IA 1R7RA 1TL7C 4OHXA 2ZS8A 1JALA 4JL6A 2GVDC 2OBMA 1E79D 1DBSA 2QAJA 4Z1MA 3U2QA 4B35A 4DT1B 2B8TA 2IYYA 4GP7A 4PSAA 2OT3B 1CR0A 4ACBA 1PV4A 2RGDA 3GJ5A 4UJ5A 5HPYB 4AG6A 4PR0A 3ZS9A 4KFUA 1KO1A 2ZEJA 2ZJ2A 4AKGA 3FOZA 521PA 4DLTA 2OLKA 4QBHA 1UADA 2VSOA 3LDAA 1NG9A 4RY2A 3AVOA 1T3LA 3G5UA 4M8NE 2WAXA 1AGRA 4LYHA 4N3NA 2Q3FA 4DDUA 1BMFD 5J40A 2JEOA 3SJCA 1OFTA 2FPKA 1ZNZA 3IIMA 2J41A 1YR6A 1PLJA 3SYNA 3I5XA 3VX3A 2ZANA 3R20A 1XMIA 3WNDA 3ZVMA 2JIZD 2BBOA 3WBKA 3RVBA 1NBME 1WE2A 2PZEA 4LUCA 2PMKA 3EWSA 3B13B 1Y63A 1NSTA 3MLEA 4NYMQ 2OILA 2OCYC 1OXTA 1OXVA 2ASEA 2C96A 3C7KA 4URWR 4PPQA 2RKOA 3ASYA 1ZM2A 3TQCA 1IHUA 3N5CA 2OLJA 4PAMA 2ZM5A 2F6RA 3AM1A 5EJEA 1NY6A 3TUIC 4M9SA 2RHMA 1XP8A 1E2HA 1VG0B 4X8LA 1DO0A 3C5CA 1F2UB 2CJWB 2HXYA 4F4JA 2R8RA 4P31A 4Z8XA 1A4RA 4OK6A 4QJ3A 1FL9A 4A0RA 4QJ5A 4A82A 2ZJ8A 2F9MA 4ZKDA 5FPTA 3OFNA 4YONB 2VO1A 4E22A 2E87A 3B1YA 3CWQA 3K0CA 4R98A 4R9UC 4B3GA 1TEVA 3ZZTA 4LV8B 3T12A 5BXQC 1VYTA 3OAAA 5FBWB 3U3RA 4JMPA 2VHTA 2WOOA 4GDFA 3KFVA 4RD3A 1XXHA 2OEPA 4KXFB 4Q47A 3WP1B 2J0UA 1EWRA 4GZMA 5KYKA 2F3TA 3W3AA 2IK8A 4A8JC 3K0AB 1IXRC 2G0TA 2EFCB 4IOLA 4PC3A 2JAQA 5DGXA 2G9NA 4JBYA 3LXRA 2OZEA 3ZJYA 2XJ4A 4HI0E 1G16A 4JVMA 1XPUA 1KI6B 4A6PA 5BN3A 4C3ZA 2YOGA 5G53C 1GIAA 4PX9A 2G1KA 1F5NA 4QHTA 3E1SA 4ZCLA 2V6IA 4A0HA 1Q1EA 1E69A 1ZINA 2NG1A 2C9CA 3N70A 3IEVA 3THXA 5KUTA 5JBQA 2WJIA 2AD5A 3KXKA 4KSBA 4D81A 4KITB 2CCKA 3RS3A 2J0VA 2IF0A 4HAXA 4M9ZA 4MRNA 5TDHA 3JZMA 3NC0C 1CJUC 1E9EA 2IXEA 2ZSEA 6Q21A 4EDHA 5D3MB 3THYB 1Z0IA 2FFAA 2XX3A 5DISB 4JSYA 1FOEB 2AWNA 5EP4A 2ECKA 5LDDC 1PUIA 1BKDR 1Z29A 2VP9A 1TU4A 4YMUA 1NKSA 3SBEA 2FMXA 3RRZA 3UG7A 4BFXA 1A5TA 1U8YA 5EE5B 1E0AA 2QT1A 2WKRA 4MQBA 3SR0A 4GRAA 1W4CA 1UEJA 1YZTA 5JI2E 3PEVA 1DAIA 3LNCA 1R0WA 4QNMA 3MD0A 4FI3C 4ZPXA 3BS4A 4HDQB 1Z2AA 1MO6A 2QTVB 1JR3E 4QC2A 4C0KA 2ZSBA 3Q9LA 1H8HA 4ABYA 3SQWA 5IF9A 4HSEA 3QKRB 2BBSA 1Q0UA 2EQBA 4TYQA 1ZP6A 1E2LA 4RKEA 2XTZA 2QAGA 3FHOA 4G3XA 1X8JA 4M9QA 4D0LB 3QF4A 5DI3A 2HF8A 3QF7A 4IDPA 2W6JD 2Z4RA 3MWYW 1HYQA 5L3QA 3OE7D 4DCSA 5E7IA 3QENA 1RVDA 4G5OA 4M2LA 5EXTA 3EC1A 1IN8A 2ANBA 1RJ9B 4Q7LA 5CK4A 4G5QA 4TT3D 4BLPA 1TPZA 1ZAKA 1S9HA 4GSYA 4E09A 4Z8YA 2WJYA 4KBFA 2UZIR 5CJPA 4W5JA 1LF5A 4C0LA 2YVUA 3AKCA 2QRNA 1ZJ6A 3B6EA 4Q21A 4DLUA 4JKYA 4DEXA 1N3BA 3SYKA 2R65A 1U8AA 2VHJA 3X1YA 4XH9B 2XB4A 3X1XA 2J0UB 1KI3A 5FTMA 1O87A 4AYWA 1FMLA 4ZI3A 1N6RA 4HB2A 4HZIA 1SXJB 3KJIA 3BBPA 4P32A 2FU5C 3L43A 4AKEA 1KTVA 3PENA 3K70D 2CEAA 2NPIA 3LY5A 4KJZA 3EG5A 4NE2A 4OI2A 4R71A 1XPRA 4TL9A 4TLCA 1A82A 1OIVA 4RFSB 3ZYCA 4LC0A 1U94A 2VRWA 2ZUCA 2ZRHA 3OIYA 1GNRA 1OH7A 4TL8A 4BLRA 3OIUA 1Q1BA 4L5BA 3RS0A 4QG7A 4C0JA 4ARZA 2O8EA 3HYRA 2MSEB 1OIWA 2R2AA 4HUQA 1PUJA 4O25A 4DDWA 2NOAA 3BORA 3ZQ6A 2Z0MA 3AUXA 1EXMA 3RC8A 4WXRA 4LJ9A 4XVUA 1IN4A 2FF7A 2XOKA 1PJRA 1II8A 1X8LA 3OEED 5EXXA 2JASA 2PCLA 3ZDQA 4B6EA 4JLPA 5JFGA 2QP4A 3PEUA 4DZZA 3ADKA 1D9ZA 1NP6A 3THOA 3NEYA 4BZQA 4N0DA 5C46F 4BFSA 2OESA 4U00A 3EASA 4EPXA 5BYJA 4D0NA 4TLBA 821PA 3SJZA 3FKSD 2IS1A 1JAHA 1G20E 3T61A 3IBYA 2WZQA 4IDNA 1JNYA 3FMPB 4QKQA 2FNAA 1G64A 4LOAA 1DAKA 2HUPA 1VG1A 1ZM3A 4Q9KA 1RRPA 4C0AC 1VIAA 2PX3A 1TNDA 2IW3A 1IJEA 4ASUD 1RRCA 1LS6A 1QZXA 2BHRA 1PLKA 2O5VA 1S4QA 4MGIR 3CW2A 2CLCX 1D9XA 3NDPA 3NHAA 1M7BA 2HLDA 1QDEA 4V0LA 4D4LA 1H65A 2B7BA 1XX6A 3UWKA 4OKSA 4US0R 1P60A 3DZDA 1KSFX 2RGCA 2IHBA 2IWRA 2GZDA 4B71A 5DHFA 3G82C 4FCWA 2J7PA 1FPMA 2AKAB 2ZRPA 3AGQA 1GTVA 4JIMA 1VDZA 2LKDA 2REBA 2FX3A 4EJSA 2ZR9A 4YXWA 5DYIA 2GTPA 1R0YA 1YE8A 2YNMA 3AF2A 4A36A 1Z07A 2G88A 4P4TA 4WXPA 4A2PA 4KI0A 1OH6A 1HV8A 3MSXA 4DIEA 5BYKA 1G3UA 5GADl 1MR3F 4Q1CA 2YOFA 1QHNA 3VQTA 1P6XA 3MGCA 2BWJA 3ICQB 2XNSA 4QM6A 4D80A 1TQ4A 3K0CC 2XJ9A 3EZ6A 4DCTA 4URXR 5KTYA 3EPHA 2X2FA 5FOVA 4C9BA 4M1KA 3S1AB 1OYWA 3HU3A 1E9RA 3LX8A 2ZE8A 1OHHA 1XMJA 1R4AA 1ZYUA 2X19A 5FUVA 3W6NA 1KI7A 3TE6A 5FOUA 3TR5A 4PPGA 5TXGA 2QPOA 1NVWQ 5AJXA 2CLSA 2BM1A 3AKEA 3EZ9A 1TUEA 2VIIA 3CPJB 1KMHA 1R10A 4LSGA 5SZKB 1XTIA 3SFVA 3U7FB 3LXXA 3GLFE 3SC3A 3EZFA 4L15A 4GT1A 2EFHB 5L8VA 2C99A 5HR5A 1VCOA 4QFMA 5H70A 5C1BA 4HUQB 4PTLA 2YZ2A 1GILA 1E3MA 1C1YA 5KU1A 2JLXA 1P72A 1IQPA 1GP2A 3GLHA 3T34A 5HKKA 2A5DA 2G0NA 2CNWD 1TF7A 3CM0A 3VR3A 1ZMXA 3PITA 2DWOA 3RRMA 1E6CA 3D31A 2Z83A 2LKCA 3H0KA 2AFIE 4PO1A 2QRZA 1D8TA 3PQCA 4FMCF 2GRJA 3TIFA 3IGFA 5JWRA 5H68A 1I2DA 1NN5A 2IYXA 2GXUA 2ZR0A 1Z06A 5HZKA 2W2TA 3NC1C 4RSGA 3PFIA 5FI1B 2YWFA 3TVTA 2OBNA 1T9HA 3CKLA 2YWEA 1E1RD 4A6XA 4AKIA 2V4ZA 4ESVA 4Q9HA 4HDCA 1SVWA 2BEJA 3OFND 3O8RA 1DS6A 3HWSA 4JLDA 2F9LA 4Q7JB 2ODNA 2GCNA 5G40A 3JVUA 4OI4A 2ZI7A 4IRUB 1QHGA 3K9NA 3RS2A 3THWB 5FOWA 4KCGA 1GL9B 4PC2A 2QAGC 1Q1ZA 1Z0JA 4O2LA 5HCNA 3KKNA 3I72A 2J0QA 2ODEA 4EIWA 1SXJD 3C4JA 2IXGA 3O8CA 3B7GA 2CVHA 1E2QA 4MH0R 3FFAA 4PQFA 4AYTA 1G17A 1SGWA 4L16A 4OK5A 1ZRHA 4EFMA 3QVVA 2B8WA 1BO6A 4NMMA 5HE8A 5SZJA 1IY0A 2A5FA 4FWTA 1G3IA 1SHKA 1QHHA 1FUKA 1GDDA 3BE4A 1T8TA 1KKMA 4LX0A 3ZZ0A 1FP7A 4I99A 5FPKA 5IRCD 3AVVA 1TQDA 4MDFA 4XSHA 2WM9B 5DSZA 4IOKA 1G18A 2VTKA 3EC2A 1KO5A 3ZD6A 1HA3A 4RFVA 1ELOA 3VR4A 4QBFA 3GLFA 3NBFA 2F1JA 1E9DA 1CJVC 1VCIA 3LLUA 5TARA 2MSCB 4YDSA 5L3RA 2A5JA 5E7MA 4G5GA 2IYRA 5FTJA 5IHPA 3TBKA 1KMHB 3R7WA 1YHNA 4Q1BA 4DCNA 2H92A 1G5PA 2ZRNA 4HLUC 3WHLA 2C77A 2LCFA 1GFIA 4GL2A 1OIXA 1AKYA 3EIEA 3B9PA 3GFTA 4WIAA 4LYJA 3SJBA 2JATA 5B64A 1E2PA 4X8HA 1GKUB 3HR7A 3GLHB 1ZC4A 3RRYA 3RC3A 1KK2A 1ZW6A 4B3FX 4C2TA 1ZBDA 2QQ0A 1G3QA 2DFKB 4NCNA 4NU0A 1GNPA 4JT4A 1G19A 3BB1A 3QXHA 2DBYA 5D3QA 4BGDA 1JXOA 4Q4AB 4II7A 2QZ4A 5FPYA 3U7GA 2ZU0C 1NIJA 2IYWA 4JL8A 2GZHA 2ZI4A 2IT1A 2XZOA 4EPTA 1RFLA 4JVSB 3EPLA 1KI4A 1AGPA 2GK6A 4B2LA 1ETUA 3U7EB 1OXSC 1T3SA 1ZU5A 2ZQ5A 3TW8B 5L3VA 2OG2A 3ZGXA 1EFRA 2CK3A 2JLWA 2IEYA 2ZU6A 4QHYA 2EWVA 3HU2A 3G0HA 1W5SA 4TZ0A 1VCMA 4AK9A 2LWIA 3GD7A 4KU4A 4U02A 4BRUA 2V1UA 1G8FA 2R62A 4WBSA 4AIIA 4ILEA 5B30A 1N6KA 1NIPA 1Z6XA 2HJVA 4KV9A 5JHGB 3NG1A 4B74A 1U81A 4HAZA 2KBFA 1NN1A 4DC9A 2R44A 2OXRA 1ZUNB 2FG5A 4KLZA 5BQ5A 2BJVA 3AVYA 4DUGA 2Y8EA 5F98A 3IILA 2J59A 5KDDA 1Z0DA 1JPJA 2OBLA 3WYAA 2R6DA 4U5XA 3CX8A 3LW8A 3MCAA 1SVIA 4LHZA 1DELA 2WHXA 1E9CA 5EXSA 2OCBA 1GRQA 2I1QA 4PHGA 2GJ9A 1TEXA 2WBLC 4EUNA 3CNLA 3UMSA 1IONA 2RGBA 2P5SA 2WSSD 3QSYA 1QHHB 4ITRC 4M53A 4EJSC 1XTRA 1ONBA 2YKGA 2F1RA 3FMOB 5TB5A 4Q9LA 5KNDA 1UBFA 1E2FA 3ADCA 1G5TA 4MYCA 3DKPA 4BE7B 3FMFA 3RSLA 1TQ2A 3GJXC 3LO5A 5E95A 4AI6A 4ON9A 1W2GA 2RGGA 4I4LA 5B57C 2ZYTX 1FX0A 2EFDB 3PUYA 2F3RA 3DZ8A 1BYUA 3KXLA 2CE2X 3KUDA 1Y3AA 2JJ2A 3N2EA 3Q5EA 1XD9A 1XEFA 4JLOA 4XIGS 1CEEA 1M7HA 3FTQA 4IXNA 4RVCA 1N25A 4N0EA 1QVAA 4BPBA 2O8FA 1VYUA 3AUYA 2R6GA 2I3BA 4H1VA 4LHVA 1AN0A 1P7CA 3P32A 3EIQA 4AURA 1Z47A 4MKIA 3E70C 3HR8A 4HAYA 1NMXA 3GJ4A 2BIFA 1G9XA 1L4UA 5JLJA 4UJ3A 5JJLA 4UNPA 1T4GA 1ZD1A 1Z6GA 3HYTA 2JDIA 4NH0A 5FL3A 1ZM7A 2VHCA 4JJKA 2QL6A 2WPDD 1T6NA 2A5YB 1AZTA 2Z6VA 2Z43A 1R8SA 2BKEA 4JS0A 1E2JA 1EK0A 1LTQA 2IWHA 4UNRA 4A8JB 2OSBA 3AB3A 4TLEA 4DB2A 2NO7A 1CJTC 4GOXA 1T8UA 4YQFA 2B92A 4QGAA 2P5TB 3MWJA 1NG1A 2ODWA 4Q01A 4FN5A 4TZ6A 4O3MA 2BMEA 2FV8A 3ZQJA 4RD4A 5CIQA 4ERNA 3B82A 2J1LA 1Z0FA 2V7QD 1GRRA 5FR1A 1H8ED 4ZKEA 3T5DA 2ZAMA 2ZTSA 4DJTA 2CLDX 3SZRA 3QXXA 2HEIA 3IDQA 2Q9AA 4URYR 1IY1A 1TQ6A 5CYOA 2CHGA 3DEFA 3M0EA 4V02A 4EAQA 3B1ZA 5C4MA 5F2EA 1DPFA 1UM8A 4PHFA 4XVQA 3KJEA 1R8QA 4XOIA 2ZUBA 1AJEA 3CRW1 2GAAA 1NN0A 2AFHE 1OHHD 4KYIB 3HU1A 3GQBA 1D6JA 1E2EA 3I92A 1W0KA 4RD1A 3DOEA 4IVRA 1ZNWA 3H84A 1XD2B 1LFDB 2VBCA 4CF7A 1ZD8A 4PAOA 4D4JA 1E0SA 2ZJOA 2KSQA 1AQYA 2OO7A 3Q8XB 4NP6A 4CEJA 1CULC 4BEJA 3D3QA 3KKMA 3HJNA 3GJ7A 4BQSA 1EFUA 3AVTA 1OB2A 4GP6A 4PC7A 2NO1A 4AYXA 5CLLA 3DKVA 3RHFA 4C7OA 1RYFA 3VMFA 4CRWB 3LFUA 3HPRA 4NHOA 2WMNB 2Q3HA 2J3EA 1CJMA 2REXB 4LYFA 1RW4A 4NYIR 5P21A 1OXXK 3KKPA 1FZQA 2XNDA 3AP1A 4FCVA 1G8YA 2NQ2C 1K6MA 3IPYA 3L8YA 5E4FA 1JJ7A 3I32A 1UKZA 4HB0A 4WW0A 4ZIRB 1F2TB 1D2NA 4TMKA 2JLYA 4DLSA 5GJCA 1YRBA 1LS1A 1XJQA 3VU9A 3ADBA 5FTKA 1XTQA 4WZ6A 1LNZA 1M34E 1JJVA 2JGNA 1SKYB 3CPEA 4CW7A 4B47A 4NCJA 4I1VA 5DN6D 1COWA 1KAGA 4IXMA 4L9SA 1NVUQ 3RS5A 4TL6A 1JI0A 1J90A 1XNJA 2QORA 2QG6A 1YZQA 4JSTA 4MKGA 3TUZC 2GCPA 1W47A 3Q3JB 4DCUA 2BCJQ 3BFXA 1MO3A 4IDQA 4MKFA 2VP5A 3D8BA 3UXMA 2IA5A 3GLIA 1M6NA 1Z63A 3AF4A 4WZBE 1NKTA 3I61A 3ECCA 2CL0X 2GWHA 2R6AA 2IS6A 1QG2A 3A1VA 2HT1A 2Z4SA 4B6FA 1B23P 1W2HA 5TY0A 2N42A 1G41A 3CZQA 4G01B 3KJHA 1QF9A 4TLDA 1HTWA 1KY3A 1XEXB 2DWQA 2CHVA 1DG3A 3MRSA 4PO8A 5FBLB 2RB4A 1XB2A 2QNRA 1RPZA 3ZIAD 4PQRA 4FMDF 1X1RA 2QPAA 3TGPA 2A5GA 2BDTA 4XD7A 3KQNA 1GWNA 4UNQA 2BVNA 4KVGA 5FUYA 3PV0A 3LWNA 4YMVA 2FSGA 4PXAA 1SKQA 4OJQA 4AKHA 2QMHA 2A78A 3C5HA 3P1JA 5GJVC 2NGRA 3AGPA 3LLMA 3CF0A 4DKXA 5H8WA 1Q1QA 1AS2A 5CM8B 1RE0A 1TMKA 2FH5B 5FPHA 1AK2A 5JS8A 3WMEA 3WP0A 2XXAA 4ZV4A 4RD0A 3M6AA 3RABA 5EZ5A 2BBTA 2NO0A 3D7MA 5EE1A 1XMVA 2JCSA 3CZPA 3HPQA 4MGKR 3UK6A 4IKEA 1HT1E 1SQ5A 2D7DA 5KOYA 1RRGA 3AH8A 2PT7A 3QXCA 5FBQB 3QY0A 2IS2A 5LD2C 4CEJB 4BFUA 3CONA 4OK3A 4EKDA 5KO2A 1YU9A 5FUXA 2F43A 1V43A 3ZD7A 4MUAA 5DIFA 2D7CA 2IYZA 3DVLA 4KFTA 4LJ7A 2O0JA 5G3YA 2EVWX 4PC1A 1HH4A 2QUZA 2AX4A 1JBKA 2ZI5A 3VKWA 4M0LA 1U99A 5LB4A 1NBMA 4CIDA 3JZAA 1NF3A 1IAQA 2QMEA 3KQLA 4FWIB 4Q4LA 1A7JA 1EESA 3CPHA 4D6PA 3T1TA 2DFLA 5F9FA 4GMDA 2P6UA 4B44A 2RGXA 3K70C 4FMCB 2MSDB 2GZAA 2W2VA 4DEYA 3PUVA 1J8MF 4P4SA 3FMIA 5EQTA 3VU9B 2CL7X 1I4DD 2QSYA 3CF2A 1KDPA 4HATA 2CK3D 2A9KA 2QA5A 3UATA 1XJCA 2UZ3A 1SZPA 3BC1A 1FQJA 4S2EA 2PJRA 3U3KA 1KSGA 3AF3A 2QN6A 5G41A 3CWZA 2ATVA 2FFHA 3QEJA 3IIJA 2OM2A 3DOFA 4MUBA 4W7SA 1YZUA 5G3ZA 1UFQA 1HQCA 2XSZA 3KXIA 4IVQA 1ZM4A 4PSKA 1IN5A 4IJMA 4C4PA 1AKEA 3V4FA 3LV8A 2IX3A 2BOVA 1E2DA 2PT5A 2ZETA 3CO5A 2WV9A 2YWGA 4DLXA 3VR2A 4Q4JA 2G6BA 1IN6A 2BM0A 1XXHB 1ZC3A 4CVNA 1RZ3A 3IBGA 4OHYA 2C2HA 1NJGA 3RAPR 5KDOA 1OXUA 4QBIA 2AXPA 3OEHA 5HCIA 4BFZA 4QJ4A 2ZRGA 4XVRA 4HLUA 2D2EA 3REFA 4XSGA 2BV3A 4F7WA 5B58C 4BASA 1CP2A 2NMVA 1BS1A 5DH9A 1NVVQ 2DCUA 2ZRMA 3LW7A 3K53A 1OV4A 3DHWC 4Q7MB 1K5DA 4Q4HA 3RLFA 3THXB 2WTUA 1X6VA 4HUTA 2W0SA 5A0FA 1UBEA 1E4YA 3L0OA 4A92A 4EPYA 3W34A 1YZGA 2XXAB 3ONWA 2C8VA 5KPDA 4BZPA 2XITA 1OH8A 3ASZA 3OIWA 4I1SA 4NZYA 1T91A 4Q5IA 3FYHA 1ZNXA 2EW1A 3I73A 2FZLA 4M1OA 3Q85A 2X2EA 2IYVA 3SE0A 2IUUA 3KX2A 4M4SA 1NLYA 4IDOA 2O0KA 1XF9A 2MMGA 4V03A 1GL6A 4QGGA 2YC2C 5J4KA 3W3ZB 1P9RA 1FFHA 1KZGB 1XTSA 1JR3A 3KTAA 4LBVA 4OHZA 3ZH9B 2P67A 1TUIA 3K8YA 1UDWA 4KBGA 5DYGA 1XEWX 1Q20A 4EPRA 1E9AA 3GPLA 5FL7D 2GEUA 1KI1A 4XWAA 1W36B 4RZXA 4NTZA 2JJ1D 2GEDA 1CIPA 2WKQA 4TSFD 1FP6A 2V6JA 5AUOB 3VR6A 4YMTA 2QAGB 2KBEA 4P4SB 2ORVA 1WCV1 3QF4B 4M1YA 2D4HA 2VP2A 3PIRA 5DI3B 2GF0A 3T5GA 4BFVA 1DAFA 4UNNA 1OE0A 4D2IA 1VKJA 1S2MA 4PZZA 4KFSA 1ZVQA 4TMXA 1KO8A 4B76A 5L3QB 1W0JA 1OH5A 4IVPA 4WZAE 2BBWA 4Z51A 3GMTA 2WWFA 1ZUIA 2W2XA 2ZUDA 2W58A 4A2QA 3KZ1E 2P6NA 1XZQA 3P4YA 1E0JA 1VCNA 4PZLA 4QL3A 4QOSA 1FNNA 4Z54A 1NLZA 2QT0A 4Q4JB 4JYCA 3A36A 3SQXA 1R0XA 3U3JA 1PVOA 4A1FA 4OHVA 2HV8A 1LB1B 3BRWD 1N6LA 2W83A 2PCJA 1BYIA 2P65A 3PUWA 5LB2A 2HCBA 1OKKA 2VLIA 5DHAA 1Z5ZA 1UKVY 4Z1MD 1T3HA 1EGAA 2DHRA 1WDTA 2ZE7A 4H9GA 4NYJQ 3X1ZA 1OB5A 1F6BA 2WWGA 1RC8A 4GBMA 1MRSA 1GSIA 2Q0HA 3LD9A 1G4UR 5EZ6B 2P2LA 4JLMA 4LBZA 5AJVB 3SEAA 2WIAA 1IJFA 3EA0A 3FHCB 4B75A 3AVXA 4B73A 5C18A 2DYKA 2IYQA 2JLVA 1E0KA 2C5LA 2FFBA 1VYVA 2EYQA 4BLSA 3ND9A 1SHZA 2EFGA 3FGNA 3I8SA 3R9IA 4CEIA 4E03A 4ARZB 3GLGE 1CR2A 2I4IA 3KQUA 2O8EB 1OF1A 2J5XA 3B5JA 5JCPA 3QBTA 1Q22A 1VECA 3BOSA 3ZVNA 5EE0A 3H86A 1OYYA 4ZCIA 1XPOA 5IDVA 3WXMA 3IHLA 4BECA 1YRAA 5F3WB 2VL7A 1II8B 1Z08A 4LI0A 1E79A 4LY6A 1CF4A 1S8FA 121PA 4M1TA 1GNQA 2QY9A 3BD9A 1GM5A 4V0OA 4NYMR 2AK3A 1AS3A 3K0SA 4A2WA 5KSZA 1XCMA 3NH6A 2FSHA 2WWYA 2QM7A 1MO4A 3CH4B 2OHFA 3EW9A 3E2IA 3VKHA 5CB6A 5DNYB 1SVOA 4MRPA 5AWFC 4U7DA 4ZDKA 4Q7KA 1GKYA 2ZRDA 1SVMA 4MGYR 3GJ8A 1ESMA 2DFTA 4CEHA 1YZNA 4DLRA 2FN4A 4JBWA 5FOTA 3BB3A 5L3SA 3IEUA 2E1RA 3U7HB 2JIZA 2Q9BA 2ZE6A 3CNOA 4TYNA 5FH9A 1KKLA 5EUQB 1YR9A 3OAAD 2V55B 2GEVA 3W5IA 5A4JA 5JSZA 1W36C 1M7GA 3AQ4A 2RAPA 2FJUA 1D2MA 3MWLA 4OQLA 3B1WA 3ZVLA 2IXFA 3KJGA 3C41J 3ZVRA 4PHTA 1XWIA 3QUSA 4MKHA 3FFBA 2VSXA 1T0HB 2NO9A 4EJSB 1P2VA 1DO2A 1G7RA 1DEKA 2QMOA 4BFTA 3QEOA 3EX7C 1WBDA 3FE2A 2WJJA 2RMKA 3GJ0A 4LJ5A 3LVRE 2BMFA 2CMKA 2GCOA 5DLQC 4MYUA 2GDJA 3NWJA 4PSVA 1N0UA 1JEDA 4YDHB 4C0BA 3VHXA 1X1SA 4IHQA 4LPSA 2O8CA 1YR8A 4MDEA 1RKBA 1KK3A 4LZZA 1E9SA 1VG8A 2JLUA 3VNUA 4GNKA 4HLDA 3A1UA 421PA 3TK1A 3NXSA 3DL0A 4Q03A 2WMOB 1AA9A 4L8GA 1CR4A 4K46A 1KOFA 2O8DA 3KL4A 3VKGA 3GLGA 4BWYA 2ZJAA 1HEIA 5FR2A 1LW7A 3DPUA 2FEMA 4NPHA 4QHSA 4TN1A 2GXSA 1BIFA 1VHLA 1CJKC 4ZDJA 3LBIA 3LH5A 3BB4A 4LWZA 4DB4A 2D2FA 2ZIAA 5CDFE 1G4AE 3BK7A 2QGNA 5JZVA 2GF9A 1X3SA 3BH7A 3QOFA 4US2R 1C4OA 1NBMD 3LBHA 3QG1A 4Q1FA 1KY2A 4I1OA 1WRBA 1XD8A 1AIPA 3KFXA 4G5SA 5FBRB 2GJSA 2YINC 3R9XA 2YJTD 3BJIC 2GBLA 1ZU4A 1H8HD 1DADA 3ND8A 2QEQA 2VF7A 1D5CA 2ZE5A 3IO3A 2CVFA 4JKIA 1AQUA 3KB2A 3QPWA 5FBVB 4AWXA 1KDTA 3SHFA 3NH9A 1VTKA 5C4GB 2ZYWX 4F38A 4JLKA 1XCPA 4FXPA 4OQMA 2AXNA 4DRZA 4I81A 3BAFA 2CHQA 4EPVA 1M8PA 1P9NA 2B7CA 1GRNA 3C16C 4HEJA 1L7VC 3MUFA 4TYPA 5AJZA 4AG5A 1DG1G 2XEXA 1MABA 1Q57A 4CYMA 5J5CA 1QBKC 2C98A 5JS7A 4Q02A 1W4AA 3UMFA 1ODFA 4QRHA 4CZ2A 4HYYA 4PQYA 2XZPA 2H16A 4W5WA 4KAXA 3RSOA 1WA5A 2CE7A 5JSZB 2FGKA 1KO7A 2CBZA 4LV5B 4X8MA 4BZXA 3FVQA 4NDZA 4IEEA 2DWPA 1CS4C 2ZROA 2QM8A 3L8ZA 3IIKA 3K9HA 2W6JA 5J4LA 4PFSA 1SULA 1W48A 2RHDA 3M4YA 5FUWA 3SYLA 4CT4B 1KZ7B 1XTKA 2HCJB 3OE7A 3EWAA 4IFEA 3TAUA 2DB3A 2AK2A 3B9QA 5JI3E 1E94E 1EX6A 3QQ5A 3U61B 1L8QA 1UBGA 5AR1A 4TT3A 2GCOB 1WMSA 4RZ3A 2FE4A 3BFKA 2OAP1 4Q00A 5AUNB 5KSOA 5FTNA 3EA5A 4FMDB 4TMZA 4DWJA 3EAQA 2CXXA 3A37A 4B3CA 3LA6A 4Q19A 3GEHA 4GMXA 3ZLJA 1KDRA 3L2OB 2J0SA 2FPMA 5EP3A 3MJRA 2FFQA 3W5JA 3AF0A 3W9YA 4JVNA 1KI2A 3I1FA 1GITA 2NPFA 2JJ8A 4AC9A 4DSOA 4TQ9A 2ZSFA 3CNNA 3GLFB 2P0EA 3FDIA 3LVQE 3SU8A 1G291 3B60A 1J8YF 5EUMA 1BH2A 2N1BA 2XOKD 4UXJA 4LHYA 1GAJA 4F92B 3QPUA 3R7WB 4DT1A 2G83A 3ADDA 1EX7A 3BH0A 3SNHA 4Q66C 4YLGA 1SVLA 3FHTA 1HY3A 1U90A 5F9HA 1VPLA 4TTPA 3BERA 1W46A 3CF6R 1OPXA 4WA7A 4OI0A 1NI3A 1L4YA 3TVDA 2WSMA 3LAWA 4DLZA 1JR3D 1IY2A 3CRRA 3T06B 5TMPA 3BWDD 2PJZA 4KLNA 3SS8A 5KDLA 4FW9A 1XZPA 3GFPA 2VHQA 1UAAA 2IC5A 2R9VA 4K8OA 3B1VA 2ZITA 3SJAA 2ONJA 1GG2A 3U44A 2ZS7A 4DSNA 4URUR 3OEEA 1KHTA 1AS0A 3TSOA 3M1IA 3P27A 3EPJA 2RGEA 2PZGA 3O47A 2HLDD 1KK1A 1MOZA 1W0JD 3DM5A 2ZRKA 3CRMA 2GETA 3NBXX 4P4UA 3VNVA 1KO4A 3FB4A 1Z0KA 2NO6A 3AV0B 2J7PD 4GFDA 1OLOA 1P9WA 2ZJBA 1E1QA 4TQAA 2V9PA 2ZI6A 4N1AA 4BFYA 1A2BA 1TTTA 1E2IA 2VSFA 1NSFA 3L0SA 4YXWD 2WWXA 2J45A 4LJ8A 3VR5A 5LPNA 5JHHB 2PMDA 1F2UA 2FEOA 2YHSA 2QPTA 4RZ2A 1P5ZB 4ASUA 4DDVA 2ZRFA 2WVJA 4FD2A 4TLAA 2BJWA 3RWOA 2EFEB 5CB8A 4DLVA 1KJWA 1CRQA 4NYJR 1CXZA 2QROA 4E5UA 1E99A 3K1JA 4URVR 4EPWA 3T1QA 1Q21A 3TH5A 4UXHA 3U60B 2H57A 1N6NA 2I1VB 2TMKA 3TAHA 5LD2B 4QM7A 1N6IA 4Y0AA 4PAQA 4XJXA 4W5HA 4IEIA 2BMDA 3K0AA 3QIAA 1QHYA 3NBZC 1XJ0A 3W90A 3K09A 3QKTA 4PPFA 1VIYA 1J70A 4URZR 3L0PA 4JVLA 3AP2A 2L0XA 3PUXA 1G8HA 2ZXUA 1SXJE 3IHWA 1XDBA 1NJFA 1G8PA 2O52A 5JECA 3PJRA 2NZJA 4XTCS 4HDOB 1U9IA 2K5UA 3KKOA 4GOKA 4D0GA 1Z28A 4HAUA 3ZS8A 4BLQA 4V0ME 5HKKD 3VHLB 4ZO4A 1FX0B 3B1XA 3OIVA 4JL5A 1Z6TA 5GVRA 3K70B 2Z5FA 5J47A 1KMQA 4F91B 5D3MA 3THYA 1Z83A 1U8ZA 1E96A 3B8HA 2OCAA 1W4RA 2O8FB 3U3OA 1MT0A 1G7TA 2WKPA 4TL7A 4RD2A 2WWIA 1W4BA 3C15C 4MGZR 2CCGA 4YMWA 2OCPA 3NHBA 1OW3B 2RH5A 1DAEA 4I1UA 1DAMA 3WMGA 2IYSA 1EWQA 2YV5A 2ZRJA 3GJ3A 1KAOA 2OXCA 2WWWA 1UJ2A 1ZM9A 4JZKA 2QSZA 4RZUA 5KHOC 3U44B 4LYAA 4UQOA 2XB2A 1T5LA 4JT2A 2ZVQX 3BH6A 1SVSA 2XAUA 3K0EA 2OE2A 2CNWA 3NIBA 2F55A 5CK5A 3NEJA 4GZLA 3AVQA 3T1VA 3WYGA 1ZNYA 2GXQA 3A8TA 3U6BA 4CGZA 2GJAA 2GBLC 2REOA 3QKRA 3TSWA 2C9OA 4LJ4A 4DHEA 2D74A 5KSYA 1E32A 4UKDA 2O8BA 5AUQA 4LGMA 3CR7A 1KNXA 3W8RA 2WIBA 5AJWA 1XRJA 1QG4A 4NKRA 1E2MA 1VG9B 2WAYA 1EFTA 2F7SA 3NKVA 3NTUA 1NMZA 4G0NA 3CLVA 3GEIA 5BWMA 4HAWA 3SHWA 1RJ9A 1Z6AA 1Z3IX 1E1RA 4YC7A 4AY2A 3WNCA 5GJBA 1LV7A 3UKDA 1RIFA 3OESA 4R2HA 2DR3A 3A1WA 3FWYA 1P3JA 3FPAA 3K9GA 3A6PC 4C0SA 1V5WA 1KNQA 4D26A 1NN3A 4Q1DA 4AD8A 1CR1A 1E2GA 3PCRB 1GUAA 3A58B 4BLTA 2QBYA 3UG6A 1K8RA 1HE1C 2WWHA 1U0LA 1SXJA 4PPNA 4DIDA 2BC9A 3A4LA 5HZHA 5CM9C 2CDNA 1G6HA 3DMNA 3JVVA 4LBYA 2V8OA 1GVNB 2A3RA 4OBEA 4OHWA 2GKSA 1WF3A 2VF8A 1ZCBA 2IYUA 1R6BX 2OUKA 3WMFA 4RFSA 2GJKA 2XGJA 4V0MA 4B3BA 1FTSA 1N5IA 3SDZA 1JB1A 3L0IB 1S96A 5FPSA 2IHYA 4H1UA 2IUSA 4DXAA 5E3HA 4C7OB 4L9WA 1DTSA 1EFCA 2BEKA 2GVZC 3Q72A 4M1MA 5JEEA 2ZS9A 1KDOA 1ZCAA 2HYIC 2XZLA 2KE5A 1OFIA 1UKYA 1LY1A 1GKIA 4TYWA 1XCGB 2H8KA 2ERXA 4JLJA 1M74A 3UPUA 1G21E 2H18A 2P6RA 3U3MA 2GK7A 4L4UA 3LRPA 1G5RA 2C78A 3J81k 3TLXA 2QE7A 1EFRD 1F48A 3WHKA 2J7KA 3NVAA 4MYTA 1X86B 3P26A 2AL7A 3W8NA 4B32A 3H2YA 1KYIA 1QRAA 2IF2A 1HUQA 3QXSA 2PLFA 4LJAA 2GESA 1RRFA 5HE9A 4LBWA 3VAAA 3UMRA 4B34A 3QVUA 4UXIA 2IUTA 5KNCA 3F5FA 1OJLA 3TRFA 3A1TA 4DUGD 3U5ZB 2O8BB 3WYFA 3REGA 3GLIB 4MA4A 1N6OA 3PG5A 2FA9A
chains in the Genus database with same CATH superfamily
4JNCA 1MHPA 2F1HA 4POAA 4HJXA 1T4CB 3IULA 4Y0NA 3O8OA 3AR7A 1II9A 3RIYA 3BFJA 3F3YA 3ST7A 1D6SA 1MAAA 1EMDA 2OQ2A 2CEKA 3GO4A 3IV9A 3MGAA 5GZ6A 1U7HA 1HT2E 1MIOA 1YVRA 2FKAA 2YRXA 3EXHB 3R5SA 4S35A 3DE4X 3OUZA 5M34A 1AQJA 4OQFA 4ZVLA 5I9TA 3EPLA 4RLSA 1J23A 3T9FA 1OYVA 4WERA 4V3BA 1U9CA 1TF5A 2PH5A 2SKCA 3CZ4A 3QUQA 4DA8A 4MVCA 3VU1A 2LCQA 5CVJA 3THRA 4A27A 5ARDA 1K4YA 4KVAA 2XMBA 2YJGA 4FMBB 1PQUA 4PX2A 1KFEB 3DDZX 3F96A 1O3YA 2FEAA 5EUCA 4C4TA 4Z4QA 4LV6A 3VPDA 5DN9A 1P75A 2C4KA 4L73A 4MI9A 1U3VA 1QHFA 4X61A 4HQ6A 4W8OA 5JCZA 4OQNA 3MD9A 1ZOSA 2H17A 1MA3A 4DVGA 3AFGA 2L69A 5GONF 5KHLB 5KYUA 2JJ2D 1A3CA 2HYDA 4KMOA 3MXOA 3N1UA 4IF6A 3DOIA 4O1IA 1T2CA 2WSSA 1ISIA 3BZUA 2ZPTX 4UDOA 2NYRA 4WKGA 5AMXA 4AECA 1Y8RB 2QU8A 3WSTA 5EAIA 1JG1A 5REQA 1SXHA 3DCJA 3LPDA 2I03A 3F9CA 4LCBA 3TDMA 3LQRA 2IEZA 4YQYA 2ZRBA 3K09C 3KZVA 3ORRA 1NZDA 3LOUA 1YFKA 3H7AA 3FLMA 3QXGA 4Y0VA 2QMZA 3EBLA 3L49A 2OG1A 2N46A 4KGVA 5AK3A 3WGGA 4YECA 4LN1A 3ZY4A 1A9XB 3M7IA 4CTJA 3C14C 1E9VA 2XCLA 2B5OA 1AX9A 2WIDA 2J6HA 2GO1A 1UJ4A 3HKDB 1UK8A 3I6BA 3H16A 3REQA 3BWCA 1TIBA 4P9NA 3ORYA 4Y6QA 3WBJA 3ZLVA 2V5AA 2FUKA 4HX2A 4KIWA 5IC6A 2WQ7A 4HR7A 4A03A 1KAHA 1XAJA 2OFPA 4MS1A 3ZV6A 1LDBA 4ZJPA 1JXMA 1GO2A 3QLTA 5MN4A 2ZZNA 1D2HA 1UXHA 3QLEA 1D6NA 2XA9A 5KB3A 3R77A 2ID4A 3W0LB 2VQSA 5LM3A 4W1RA 4JLNA 3WZ2A 5F23A 3KOXA 4QFDA 2G72A 4PG5A 2A9PA 3CBQA 2P1DA 1TU0A 5TVKA 4ZVPA 3AONB 1U28C 2ORYA 1UIMA 2FZ5A 4M9XA 2GD1O 3ONVA 4PCAA 5I51A 2BUBA 2DTXA 1WZCA 3WB9A 4CDGA 3F73A 4FUQA 4W82A 5EJMA 3H5RA 1Q44A 2Q3EA 4JUDX 3QVJA 4R31A 2COKA 2D62A 3COWA 3TSYA 1S1MA 1UOOA 2WUEA 2O7SA 1DOAA 8MHTA 5A2GA 1Z2NX 2DBQA 5KOIA 3V6MA 3HCEA 2GILA 5LZ2A 4XVHA 1R4NB 1KKUA 3WGTA 2WQZA 4EB6A 1H93A 4RKFA 2ILVA 2OA0A 1OILA 1RBQA 3A4MA 3ER6A 5F5LA 2N9UA 1U0EA 1R5NA 1TTPB 1XK6A 1ZW1A 1X1AA 3R8CA 2BONA 4MTCA 1ZA1A 1P4JA 1QYDA 4FYVA 4GMGA 3HL0A 1A9YA 3L06A 1NXPA 1YI1A 1UOPA 2IXDA 2Q5LA 2VQDA 2NTYC 3T5TA 4EUHA 1VE5A 1B0UA 4U8GA 5IZCA 1Q3HA 1FSPA 4OQQA 1M1ZA 3MGKA 3OTIA 4RJ2A 2E7ZA 3G9QA 3JQCA 3A1EA 3BWYA 4KLRA 1AKTA 2GPAA 3O31A 4NULA 2CL6X 2ZIXB 2HTEA 3JQ8A 4YPOA 1RLUA 2OFWA 2AJDA 3MHPA 3QVTA 5CVUA 1E9FA 3WGYA 2PBRA 4Q4HB 2D2XA 1ZD4A 2D4AA 2JFYA 3MS7A 4F3NA 1X70A 1XFAA 5A6SB 4DA7A 2Q28A 4H77A 5A04A 1A69A 3TPFA 2QX8A 2KX7A 4JB0A 4MV8A 1IOLA 1Z4PX 2P3SA 3TKLA 3EQ6A 4I8DA 5IH3A 2G1PA 3LGXA 2PEYA 1IMOA 3M5WA 3P20A 2IP4A 2D1SA 1Z5UA 3H4VA 3R3XA 1D1QA 3DE6X 3FKQA 4M1WA 3IXLA 3HJAA 3EW7A 3ZU6A 2GZSA 4L95C 1RI1A 1HM5A 2J87A 2WJVA 1LVGA 2UZ1B 4KYTA 4UVHA 1I3LA 1LV8A 1A4IA 4OATA 1P2DA 1PVDA 5DF1A 3MZ0A 3GEEA 1O8CA 4WN3A 5FEMA 5HKAA 2R6CA 5AW1A 3CUEF 2A9OA 2IYAA 2YOHA 5K4GA 4TYYA 4EJMA 2FUNB 3I30X 3I9JA 1W9MA 1S89A 3KTAB 1EP3B 2W00A 3ZCTA 1L2TA 4HB4A 2I3AA 3CFYA 5IABA 1KQPA 2MR5A 1PX0A 4JODA 4DL9A 5F1PA 1YJ5A 2C5HA 4D8VA 1H3EA 3MBKA 3RWMB 4DGSA 1Z4KA 1TA0A 3F3KA 4JI6B 3F8TA 5ES3A 3C8UA 3ZGYA 2NTJA 2NACA 3MJSA 1U3WA 2IYPA 3C3JA 1RXVA 3KTOA 4YJGA 5DEIA 4RTSA 3ISTA 1U0JA 3ZJ4A 2ZREA 4JR2A 3HFGA 3DEJA 4NHEA 1E8MA 2C0QA 4MV5A 4A6DA 4QLBA 2ZCVA 3H1TA 1W34A 2D5CA 3FWNA 3IPRA 1UR5A 2DE0X 4M9RA 4FLFA 4BJ6A 1A5SB 1T0BA 3M70A 2GS9A 5CD1A 1E1MA 1P45A 2E49A 4BKPA 4NS1A 5C8XA 3C3BA 3PQDA 3TL3A 4DR6B 2IGBA 1FFSA 4A4DA 2NUTB 1N5OX 1JQLB 2VJYA 1T25A 1UBLS 2QQEA 4EHFA 2NZ8A 5ITVA 4M36A 2C97A 3F47A 3L18A 3OF5A 5EP2A 1R15A 2IIBA 3GV0A 4K40A 4KE7A 5ADWA 2Y6VA 1XMQB 4XGNA 5EIWA 4RH0A 4KHZA 5CHYA 3PA8A 4G1BA 4HWOA 5TPWA 4EFKA 1QLJA 3PUZA 4FKZA 3OHPA 1KEZA 4MZXA 4RNDB 4XD7D 4DNXA 5SY6A 3PNBA 3DXZA 3WNBA 1U02A 4M37A 4XGQA 3U6KA 3AOEC 1YCFA 4B6OA 4Z4GA 4G23A 2YWCA 3OQ6A 5ICCA 3K0HA 5AM2A 1V7ZA 2FP4A 4YB8A 4OJKA 2PZLA 4UUBA 4UUQA 2D06A 5H1YA 3GA5A 3TLEA 3FR8A 1H94A 2POQX 3OJLA 1FLVA 2AIRA 3MJHA 4Z53A 4E6PA 3BGWA 2YS7A 1R0ZA 4I19A 1UJMA 2OR3A 4LRSB 4UVIA 5COQA 2KYRA 3TNYA 2WP8J 1J56A 4ZVSA 4LFCB 3KVNA 4YCBA 5BO5A 3UT6A 3TMYA 3FCOA 5AW8A 3CR8A 5JQGB 3W5SA 2D0DA 5JNSA 3OTHA 2ZYIA 5FOXA 2AZXA 1KIMA 3LOPA 3DV2A 4OLJA 1I13A 3ED5A 5SYMA 2ONCA 2ZQZA 5DE3A 3FCUB 2I22A 2GD2A 1ZCJA 2EU8A 3AP3A 3OHMA 4YV1A 3FZEA 5DT9A 1G3RA 4EGCB 4NBSA 1YVPA 5AD1A 3IKVA 3O9ZA 3K4HA 1GPYA 3EXFB 5A62A 4WBNF 1SWVA 2TSYB 2C61A 1MNAA 3HH8A 5TMBA 3TR0A 2ZRAA 1T1IA 3IAS1 3EEYA 4ZCTA 2YXBA 3B2EA 2WE8A 4GC9A 2IXTA 1M54A 3C5WP 2AMVA 3ZG6A 2YCLA 5JNLA 2AKYA 4MYDA 4Q3EA 3TINA 1W36D 1IHPA 2CFRA 3T35A 4BQIA 4RE5A 4IZOA 5AVQA 4RADA 3T52A 3T38A 2Y67A 1XU4A 1Z8DA 3MAAC 4Y2JA 4B3RB 3UA3A 1E6KA 2J9YB 2RGWA 2VH1A 3ZV7A 3LQQA 1OBHA 1WQ1R 4EY3A 4F9EA 3PQ3A 2C2GA 4DMKA 2ZVPX 5GVSA 1LNQA 3AIOA 3BTVA 2VH5R 1ZI6A 2I2XB 2RKBA 4IM7A 4M6WB 4XDZA 5FA8A 1N5KA 4OEHA 4UM5A 3PD1A 3RK4A 1HURA 1OT3A 3QXJA 1N9GA 1GA6A 1I2MA 1ZGCA 1YZKA 4RJLA 2AR0A 4O4HF 5KSPA 2G1JA 1KE1A 1TJ5A 1GL7A 4UBMA 3ABZA 4JELA 3A3YA 3OI7A 3UJ9A 1CEYA 4OB7A 3Q2OA 2P4UA 5AHWA 3SC4A 3WS7A 4Z3OA 1T8YA 2A58A 3GZNA 2DLNA 3LHDA 4MR9A 5JRJA 3ZDAA 3LXMA 4IAOA 2IS4A 5JSQA 4LOKA 3VTKA 3FG9A 5I7WA 4PBTA 1FRZA 1EA5A 4ZAVA 3C98A 4JC8A 4P5PA 4I4TA 1BAPA 5K51A 4R8LA 2FSVA 5MDHA 4I55F 4FGUA 1PLLA 4I3FA 2FG6C 4MVWA 1ZUHA 5EMLA 3LX4A 4JDPA 1MVNA 1SD1A 3GRAA 1WXQA 4UNSA 2WJGA 5JMOA 2BHSA 2P3LA 2J9ZB 1RWQA 1L3BA 3JQFC 3GROA 4EFLA 2AQ8A 2KW5A 2J07A 1WKCA 4HDMB 3JYNA 5D3ZA 1T9GS 3JYOA 4L0MA 2AG1A 1L6RA 4H4DA 4F11A 3OO1A 1P5HA 2EYUA 2IY9A 1L5KA 5CEEA 2Y1GA 1Q84A 2E3JA 3O1JC 4NJEB 4OYHA 4E2ZA 4P3PA 1EQ2A 4LA4A 5GPBA 1KK0A 2XA2A 4ZYVA 2EKDA 4BXOA 4U2DA 2HB6A 2IHTA 1PQPA 2QL5A 3I0NA 4GPBA 2FSFA 4PINA 4N41A 4PEVA 2EOAA 3T15A 3KDSE 1XL0A 4J0QA 4U2FA 5ILGA 1TD9A 4IW3B 1RRKA 1DARA 1LK0A 5CJ2A 5EZYA 3UUGA 2DPLA 4KRYA 4F9FA 1UBTS 2ZIZA 3KYCA 5JH7F 2FSIA 5DTRA 1DU4A 4RTRA 1PHRA 3PT9A 4FOPA 2HSZA 3JQRA 4A0GA 4YAJA 2WJAA 2RHJA 1FU8A 3USCS 1HE8B 1KI9A 1T4DA 3PYMA 4QGFA 3SLRA 3R0XA 4HZUB 4WXHA 1CIJA 1JZSA 2BHNA 4FIZA 1U7OA 4ZXPA 5HTKA 5AIBA 1KYTA 5CDFA 3QEAZ 1LD3A 1U0HC 1XD2A 1G1MA 2QENA 3NUQA 4HLQB 1NMYA 2O2DA 1OU0A 4WL0A 1JP7A 4F2WA 4HRAA 1Z8FA 3CF4G 4ARIA 1L5RA 2FG7C 3CH7A 2VF4X 1XLTA 3LPLA 3M83A 3TJZA 5J9FA 4U0KA 5IWCA 3RRBA 4PICA 1A8QA 5DM0A 4WOKA 5AHOA 4YLYA 1LBIA 4X8OA 2HX1A 4LJ6A 3RFCA 1QNFA 2R6R1 3N6XA 2UXDB 4BUJA 5FNVA 2PRKA 3AF5A 1SOVA 1EFVB 3DD5A 3KQOA 3NPAA 4LMBA 1HWYA 4YFYA 2BRUC 2O48X 2PL5A 3EY9A 4MS4A 2J48A 1J2TA 2H7VA 2X8LA 5H3CA 3CC8A 5NULA 3R8XA 4R68A 3MWEA 3DVAA 1NYLA 4QODA 1Y7IA 3D4LA 4DMLA 1Z38A 1KEPA 3G2MA 4YK7A 4XIJA 1N75A 1TVEA 4UM9D 5CH3A 2HA7A 1NMEA 4IG9A 2HU5A 2XQJA 1QDLB 3S7ZA 2VUSA 1YR1A 1CG6A 4NDAA 2ZYUX 4R2KA 3W5CA 2VP6A 3Q3VA 1LPAB 4R2XA 2RG7A 4MPRA 2RI0A 3GMSA 2VA8A 1US8B 3KPYA 4WOPA 3QVLA 3V32A 2NVUB 2VPPA 5EXPA 5ELXA 1UPUA 5IAOA 4H7HA 3ONFA 2GJ8A 1X7GA 2CJWA 3CRZA 1GSHA 3N75A 4GW3A 3B36A 1JX6A 1XKTA 4WJZA 2I2AA 1I6LA 1GOTA 1S2IA 1UODA 1M10A 1YB7A 3IKJA 5EZQA 2C7VA 5J4VA 2ECQA 1GPKA 4E12A 3P4XA 4INZA 2QP9X 3OSZA 4C4YA 5K3FB 5L7YA 3A6DA 5GIOE 2XYVA 4R8RA 3IBTA 1Y8ZA 2IXBA 1JPNA 1NAHA 2QTFA 4TX1A 5KJ6A 1J00A 3EPRA 4NCIA 3HLYA 1Z9BA 5L9AA 1Q3TA 5JRZA 2NT4A 3H1AA 1QO0A 2X1VA 4JJIA 2ZI3A 4JJGA 1SHTX 2YQZA 1Z39A 2FPWA 3IODA 3MMNA 1O08A 3MIIA 2VPTA 4KXWA 1JECA 2FDCA 2X76A 1A7AA 1GARA 2YWHA 4XJVA 3V4LA 2YYSA 3IQHX 3PXGA 5JXJA 1MKYA 2RBEA 4KIUA 1XEWY 3EXEB 2W98A 4NG4A 1E1LA 1Z68A 4ZO9A 3EVEA 1XXHE 2QD4A 3I4LA 5T5QA 4CT5A 3MRXA 4XA8A 3LX5A 2C92A 3MG9A 3PRKE 5WRFA 1WO8A 3B85A 4MVXA 4FINA 1L7AA 3V00A 1DVRA 2VP0A 3S2UA 1FE8A 3GP8A 1QR6A 4REQA 4BVLA 1JAIA 1YV9A 2FFRA 5AP9A 3PWZA 1XBTA 3A11A 4X7BA 4ZRMA 1QUEA 2Q21A 3SXUA 1JFSA 2XGMA 3BJZA 4EG8A 1V25A 1OA0A 3Q3HA 3ZWXA 1B6RA 2IY7A 4OHXA 4OSEA 3UPTA 1JALA 4JL6A 3BWMA 3FUVA 4NF2A 2OBMA 4Z1MA 4GYWA 5CB4F 1BA3A 4DT1B 2B8TA 1FVHA 2CLIB 4PLYA 3O4HA 3TAXA 3U4HA 4H60A 4ACBA 4FM9A 2JAWA 3QVOA 2EC5A 2OOKA 4UW9A 1BGXT 1BD4A 1M76A 1I3CA 2AXQA 2WD7B 5I8ZA 4LMRA 3RF7A 4BVKA 1MB0A 2ZJ2A 2JL1A 2ZEJA 4DN6A 5GIPE 1YZFA 4AKGA 5CW2A 1MC8A 5CT5A 3FOZA 3P0EA 4FTWA 1DI0A 4DLTA 3GU3A 3NM4A 4D7AA 2VWPA 2WUFA 4XDHA 4LRUA 4LJLA 4LYHA 4J2TA 5DCLA 2ZJFA 3FTDA 4DDUA 1KRXA 1BMFD 1G38A 1OZGA 3SJCA 3T7IA 4BWFB 2RDMA 4CV1A 3IIMA 1QE3A 1YR6A 4ZTBA 1SK9A 2GM3A 3H5AA 4YRPA 3UB4A 3I5XA 3VX3A 2ZANA 6LDHA 3R20A 1XMIA 3F49S 4LMAA 3ECSA 2NU8A 1JV2B 4X8MA 5F2OA 4BO3A 2QTGA 4QGSA 2XT6A 3L1UA 2LTAA 3ELDA 3KHSA 3L46A 3C6QA 3JQPA 4QPPA 3EGXA 2WFZA 2Q2QA 3KLMX 5JEEA 1NSTA 3B20A 3MLEA 1J1ZA 5LXTF 1Y3IA 4Z3DA 1KAMA 3B70A 1JH8A 3ZLUA 2X86A 1GGHA 3AR4A 3M5CA 3JQDA 4O8ZA 4E5KA 3ASYA 5C5IA 5E1DA 1QRTA 2NXWA 2ICAA 2F6RA 5I7SA 1CC1S 4M9SA 4OAOA 5AIAA 5KCZA 1DC3A 1E2HA 1T6BY 2O7VA 1YA8A 1N8NA 1DO0A 1H85A 1QZZA 1SRRA 2XQGA 4GX1A 5AVVA 4B0PA 3PGKA 4P31A 4CF5A 1O77A 2P1RA 3FLBA 1FL9A 2E6UX 4BNIA 4QZVA 5J2TF 3LPNA 3B12A 3LRTA 1NVTA 4YONB 4R1MA 5ALUA 2OGZA 2E87A 3K0CA 4R98A 4H35A 3JQ9A 4B3GA 4ZZ0A 2AN5A 3A6LA 1U3GA 5A2QA 5F2NA 5HEKA 1T0IA 1I36A 3PGXA 3U3RA 2XCIA 4NH4A 3BE8A 3C74A 1C7QA 4HVLA 2QVGA 2H1HA 3KG2A 3DC7A 3BWXA 3DZBA 5EJFA 1EWRA 1SXIA 2PXHA 1Z4QA 3N8HA 4DE5A 3K0AB 2E55A 2G0TA 3TTSA 4IOLA 4PC3A 2JAQA 5B37A 3IERA 1H0HA 1T0UA 1GHTA 3ZJYA 2XF8A 2QXTA 5B6JA 1ESZA 1RAHA 3RREA 1G16A 2C3MA 2P27A 2Z2XA 1LLCA 2JIRA 3DG9A 3ROGA 2VTBB 3I64A 1KVRA 4LZOA 5BN3A 3RS8A 5I47A 4WRRA 1GIAA 4J7UA 4PX9A 5CW1A 4QHTA 3F7OA 5G53C 5AI8A 2V6IA 1ZVKA 3JWPA 3RR2A 1Q1EA 2NG1A 3AIKA 5T6MA 2C9CA 2R11A 1U65A 3N70A 5KUTA 2WJIA 2AD5A 1C3EA 3I4CA 4RF3A 2AE2A 5FBHA 3RS3A 1KJIA 5ALRA 1SAYA 4HAXA 1PFVA 4MRNA 4WBNA 2MJLA 2GK4A 3RKUA 4DXDA 3MXTA 1C3JA 4HQLA 6Q21A 1WW3A 4R41A 2OP0A 2H06A 4M0PA 3JD0A 2XYQA 5JO9A 4MJ3A 1MB2A 1F8UA 5IUNC 2PMWB 2PZ8A 4G89A 5LDDC 3C6MA 2VP9A 3DKIA 3EVAA 2GKGA 4RGQA 3SBEA 2FMXA 3RRZA 4DHWA 2CMFA 5K99A 2PUFA 3AJDA 4BFXA 4BMXA 1K5PA 2A59A 2QTRA 3GXBA 1LDGA 4JBGA 1C9MA 4MQBA 1GA1A 2CD9A 1I33A 2CD7A 4CMIB 1GEGA 3C1UA 3PEVA 4NARA 5BSHA 1REQA 2AW5A 2OZLA 4I66A 1MOSA 4ESOA 3TLJA 3VHQA 4O4HA 4Y7CA 1UPXA 3MD0A 2ZB4A 3BS4A 5C5EA 3OO0A 4CQNA 2CYCA 1MO6A 2QTVB 2D13A 3E7DA 2FPXA 2IDMA 1H8HA 4ML3A 3SQWA 1U6KA 3N53A 1OMOA 3F98A 1HOXA 3EPPA 2QVZX 5AXDA 5JMWA 2EQBA 5AUQA 5MF6A 2Y1KA 3FHOA 1ML3A 2PFSA 4Q7QA 5LLDA 4M9QA 1L4GA 1WTCA 1XHEA 3QF4A 5F2KA 4D0LB 3DEKA 1WUKS 1U0TA 3U9TA 1IBKB 5EJ7A 3QLUC 3H7IA 1P2BA 3IUQA 2W2KB 3SY8A 1XZHA 1SMKA 3ND7A 1E6EA 1A4UA 2IHNA 2UUOA 3LQ4A 2IH5A 5EXTA 4C6TB 3NXKA 4QAJA 4KPUA 1RJ9B 1KWKA 4Q7LA 4G5QA 1TPZA 1F20A 1RAFA 3I52A 1S9HA 4GSYA 4Z8YA 4TVBA 1XWWA 1V8OA 5A4MS 5IJ0A 1A77A 2EFYA 4WTOA 3C7AA 2XB8A 2X42A 3AM4A 5JYCA 1LPOA 4X94A 3DMTC 1ZJ6A 1C8KA 4Q21A 4UUAA 4DLUA 3PGLA 4OCZA 1N3BA 4KNYA 2IJGX 1UCFA 5DDIP 2YIVX 1OOEA 5GTDA 3KHKA 1PL8A 4TLLB 4XH9B 5HZGA 4XEUA 3GPCA 5E9AA 3TD9A 4CLHA 2MR6A 4AYWA 1QLWA 3N2KA 4CJXA 2BYTA 4ZI3A 2MWMA 2V7VA 5E1MA 2H07A 3FOCA 5ENZA 5C53B 3KJIA 5TS2A 4FR5A 4YVFA 5JH7A 1Q19A 2QX9A 2Y9MB 4MUMA 2X5XA 4P32A 3L43A 4RJIA 3D5EA 4AKEA 3O1HB 3I58A 4L5AA 2CEAA 4R71A 3K70D 4HAOA 4TXMA 1SBCA 1JF8A 4MVJA 4TLCA 1OIVA 2YJ4A 3HCCA 5CXXA 3LY9A 3ZYCA 1BFDA 3FVWA 1WSWA 2ZUCA 1DWQA 3SF8B 1RZRD 3DOOA 4ZOBA 2GM4A 1GNRA 1JBQA 3R6GA 3UXYA 5AI0A 5HBRA 4L4ZA 3Q8KA 2G6TA 4NQZA 1J25A 1B16A 3LUGA 3ICVA 4U5QA 1Y4SA 3RC7A 2AOUB 3HYRA 2MSEB 4WGFA 2Q3BA 1TT5A 4O2BF 4U9HS 1OLXA 3DV0A 5FIUA 3WLFA 3DZCA 2Z0MA 3HXTA 2I6TA 4WXRA 4LJ9A 2JAXA 1XTTA 2FF7A 2XOKA 2WHPA 2YTZA 3MHTA 2FEWB 3GDOA 1E1CA 5JU6A 2PCLA 3ZDQA 4B6EA 4LYEA 3ZTYA 4W99A 3ADKA 2OBXA 3VSBA 2QAIA 1NP6A 1RWBA 4JCOA 3RIHA 1ZAYA 1EYZA 5B3AA 3IP5A 2PV7A 3P0JA 5DRTA 4D0NA 2ZTHA 1D2CA 1NXQA 821PA 2BFOA 3FKSD 1QRSA 1A76A 1JAHA 1P0MA 3R7LA 3FFTA 5A4IS 3HDQA 2PYIA 1M6EX 5IFKA 2A1UB 2I6UA 2ZUVA 2FMHA 1A1SA 4CKEA 1GCUA 1P1HA 3FMPB 2WRZA 2FNAA 1SCBA 1PG2A 4LOAA 1R0SA 3G6KA 1F0KA 3PHGA 1IUNA 4EARA 1SUIA 3GT4A 3VI3B 5HUJA 2O2EA 1VIAA 2PX3A 1TNDA 1VSTA 2R5NA 3ECAA 5AYVA 3VRHA 2JC3A 5CDHA 1XMPA 1DQYA 4BP9A 3CW2A 1D9XA 1JLMA 2GBIA 3FRJA 3NDPA 2BUCA 3E4DA 1TZ2A 4XCVA 1Y1TA 5FULA 4BE4A 3D3KA 3K6KA 1PK9A 3ZY6A 2BLNA 2PRJA 4I0WB 2RGCA 3WO0A 3NS7A 2GZDA 7MDHA 3HR4A 5DHFA 3HYNA 2O2GA 1AO3A 1FPMA 2AKAB 2ZRPA 3JSAA 2J5RA 1Y3HA 3AGQA 4Q3AA 3RJZA 2Q5JA 2REBA 2QYSA 3TLZA 4MEJA 1JR2A 3UJHA 4C89A 3RVDA 3CN7A 1I32A 3F90A 4ND5A 4V1CA 3U9SA 1ZIDA 2C0CA 3QJGA 1QYWA 1P7YA 1G3UA 2Y6UA 3LBFA 4LDAA 4TKLA 2SKDA 4XM1A 2IEGA 4C22A 4Q1CA 2C7QA 1JS1X 1V1MA 3U4IA 2CUKA 4RS3A 3UB2A 5IP5A 4GOMD 1P6XA 1AKNA 2BWJA 3HP7A 4C4RA 5CBKA 3SS9X 1TMGE 5IG2A 1NVGA 4CI9A 5KTYA 2XJ9A 2C3YA 3JVIA 1SVNA 4MQFA 4DCTA 4C9BA 1NBIA 1JU4A 4WKNA 1E9RA 2PWAA 3GLKA 3R23A 1BX0A 2HMTA 2ZE8A 4MQEB 1YK1A 3W6NA 1SIWA 1ST3A 5PNTA 2JGDA 3ILVA 1E3WA 1HPLA 4UQPA 2C3PA 3TR5A 1KGSA 1Z8NA 1NVWQ 2ABWA 2CLSA 2BM1A 1YDHA 4GDMA 3TSAA 5BUQA 4MHTA 5KNCH 3USZA 4NZMA 2JK1A 4XX0B 3UKOA 4LSGA 3KYJB 4R5HA 2O5CA 3GLFE 4AG3A 1U7UA 2JIDA 1XZEA 1T3GA 1G2OA 2ACKA 3EZFA 4NG5A 1ULHA 3SQOA 3WMXA 4GT1A 4RKRA 5L8VA 2XBMA 2C99A 1VZ2A 1M1UA 2H5IA 4QFMA 3OZDA 4FHGA 5H70A 4PS0A 4UEOA 4PTLA 4DSZA 2ZOSA 1GILA 1Q15A 1E3MA 4D79A 1NR7A 5I9IA 1J0XO 1IQPA 1GP2A 3IE0A 4MDHA 5LL6P 3TN7A 3LP6A 2A5DA 5EWMA 4AICA 2G5PA 2EARA 4TTJA 1KC1A 2EATA 1C1DB 1TF7A 1HNWB 1ZMXA 4JHXA 5CGZA 3LTEA 3PITA 2C4TA 3FCSB 3D31A 3VDRA 4OXRA 4CKBB 3H0KA 3CNBA 3GXOA 4YALA 3F4BA 1D8TA 2PWPA 3EOAI 1S01A 3SM3A 1QXSA 2Y68A 4C6HA 3IGFA 2VJCA 1SC9A 5H68A 3V46A 2VDWB 1C1HA 2ZR0A 4RZQA 5H16A 2CJPA 3NFRA 5IM4F 2CKDA 1BFKA 5IVPA 5DVZA 5LKAA 5LXTA 4ER0A 2XCUA 2CXPA 3GF4A 1GTSA 3PFIA 5BMOA 5LZ4A 2OBBA 1BJRE 3H0CA 3PQ8A 4E21A 4URHA 1QE5A 3CKLA 2C4UA 3KAKA 1T5SA 4OHKA 4QPJC 4AKIA 4HNRA 2P4QA 4D3YA 4MUGA 5GOZA 3UUWA 1QO7A 2BEJA 3OFND 3SYRA 4WNAA 3M8KA 3PYLA 3WHPA 3O8RA 1ETHA 2PN1A 1DS6A 3HWSA 4G81A 4JLDA 4Q7JB 4BJ1A 2CHUA 3DCNA 4HVCA 2ODNA 4QT4A 1A9OA 4XQCA 1YCGA 4KK3A 3JARB 1Q7RA 1LWNA 1UM9A 3C39A 4OI4A 1TC2A 1U8EA 2PKWA 3K9NA 1Q7TA 3DMRA 1IZYA 1VKNA 4KR2A 4GI1A 4PC2A 4WPGA 2QAGC 1Q1ZA 1AXGA 3AERB 4A0SA 1CZRA 3KKNA 3I72A 2ODEA 2VA9A 4WK2B 1ESDA 3MB8A 2FPIB 4BNMA 2VHWA 1GGJA 1YB4A 3FFAA 2I3ZA 3DL2A 4B9AA 3GEGA 5K3SA 4R2LA 2FEPA 2XUIA 3T7KA 2B8WA 4NMMA 5HE8A 3F6YA 3Q87B 5SZJA 4Z6KA 2A5FA 1JXAA 1G3IA 1SHKA 5CA1F 2OD7A 2QB5A 1R00A 1Y5MA 4MW4A 1QX3A 2X5NA 1HE4A 1FUKA 1RP7A 1ZJ5A 1T8TA 1KKMA 3BE4A 3IPAA 3OC6A 4LX0A 2H2GA 3VZBA 3WBFA 3BSFA 5DYWA 5FPKA 2HJWA 2EGUA 4XSHA 2Y77A 4RDXA 3D3JA 1RXUA 3F4KA 1DQSA 1G18A 1SURA 1H3NA 3AV3A 3E9NA 3GA7A 3NX4A 1KO5A 4FILA 1H2AS 4QREA 1ELOA 4QBFA 3DO5A 2MIIA 2VTVA 3EF1A 1JMKC 4OLHA 3KJNA 4Y3UA 3NBFA 2YIDA 3PCTA 2BGIA 2CNBA 2F1JA 2FLWA 4U2EA 1GRVA 4BQEA 5LOVA 2B2NA 4XARA 1MUUA 5E7MA 1O58A 4NJMA 4WESB 2IYRA 3CIFA 5FTJA 2D1FA 1OZAA 1KMHB 2PKQP 4UU7A 1AOXA 3B1FA 1YHNA 4O4IB 4DCNA 4EVQA 2UXBB 2YZ7A 2ZRNA 1WQ3A 3WDSA 3WGLA 5J23A 3VSAA 2LCFA 3TLMA 1GFIA 2BFDA 2XMGA 2W70A 1AKYA 1T6XA 3EIEA 1Y5RA 3K8ZA 3MF4A 4OLBA 4IX9A 1AKWA 4K9QA 4HH0A 3AETA 2JBWA 4WIAA 3SJBA 2JATA 4X8HA 1NW8A 4GC5A 1CNEA 1GKUB 3CEAA 2H2DA 3GLHB 3QOYA 1FA9A 3RRYA 4C21A 1KK2A 2RJNA 4FDLA 4YLEA 2QQ0A 3NWPA 4OVKA 1G3QA 3NWEA 4XQ0A 3U39A 2O3UA 3FPKA 2F8MA 1JDBC 4C01A 2C20A 4DC0A 1G19A 4HWRA 4K6FA 3ZWBA 4NATA 4GR9A 2VYND 2ZM6B 3OZEA 3KPJA 1EB8A 2R00A 2UVPA 1NC3A 5FPYA 2Z8YA 1XZ8A 1BFUA 1QAMA 4FN4A 3ROPA 5F4ZA 4JL8A 2GZHA 2V3WA 4PONA 1X7YB 8AT1A 3FF4A 4MGEA 2XZOA 3CINA 4B7XA 4P3OA 2O19A 1KI4A 3JU3A 2EJBA 4D97A 1YDMA 1ZU5A 4HGPA 3B7WA 1GQQA 3U7QA 1U5AA 1A8UA 4IX1A 3VNAA 5LQCA 2X8JA 2OO3A 2G63A 2PGNA 3TIIA 3WL6A 1RJFA 1TM2A 2H1SA 1Z6QA 4YN3A 4BY9E 3M6LA 2EWVA 4BU0A 3G0HA 1W5SA 2CLOB 2LWIA 4KU4A 4JYPA 1XQYA 2VI5A 3CURA 1FYWA 2R62A 2ZB3A 3ITKA 3VKFA 4AIIA 3KUUA 5B30A 1UC9A 4Z0HO 2HJVA 1I4OA 1O96A 4B74A 3TRDA 4LXUA 4HAZA 3LC0A 5INTA 2HW8A 2XUHA 1CY1A 1ZUNB 5AKHA 4P8RA 3AVYA 3IB6A 1ZJZA 2I8LA 2GLUA 5F98A 3IILA 5EIAA 2J59A 2FN9A 5ALKA 5KDDA 1RACA 2ZULA 3IJ5A 4U2CA 4E08A 2ZUEA 4NVRA 1ZOLA 2WHXA 4K28A 3A7DA 3VOAA 2DUJA 4GM0A 2CDCA 2I1QA 2G4CA 2HU8A 5FWDA 4E14A 5JDCA 2IUYA 4H18A 3WWZA 3HUUA 3K15A 3OUUA 2X40A 1IONA 4K3VA 2P5SA 3MRVA 2JGLA 1V6CA 2FB9A 3GRYA 4C5BA 4ITRC 3O4JA 3GLSA 2V6BA 1Q5PA 1JPVA 1ISHA 3SZ3A 4M54A 2F1RA 2GWRA 5AI4A 2P2ZA 2CXUA 4RACA 5KNDA 3MPOA 1UBFA 2IH2A 4LDQA 3KVVA 3RARA 3QZUA 3RLIA 5A4DA 5KMGA 4CLEA 3IC5A 3ZWNA 4ZZIA 3RSLA 2D59A 4ZI7B 1K7SN 1AU9A 2GRUA 1L4NA 4X97A 2PFKA 3WLRA 5IT0A 5BQFA 4ON9A 2IH4A 2RGGA 3ERCA 4I4LA 5KX5F 1FX0A 2FZKA 3ADPA 2EFDB 3WLTA 3UK7A 3PUYA 5AW0A 1R88A 4YRFA 3Q5EA 4FK8A 4X1KB 3L8CA 4QU0A 1RJDA 1M7HA 1YOVB 4K9PA 2VT2A 2F3SA 2H5JA 4WK4B 4AY4A 4BIIA 3TL6A 4ZVUA 5BT8A 1H6DA 5KNLA 1YC5A 4XKJA 2YXEA 3A1FA 3L4BC 2JD1A 5KYVA 4LFAB 2CF5A 3RUEA 1AN0A 1M1NB 1PNVA 2JFVA 4PZ9A 4F3YA 2C5GA 5LYJB 4AURA 5CJJA 4MKIA 2HM7A 1T1EA 3P19A 4EMBA 4HAYA 4M8KA 1DRUA 1NMXA 1ZMRA 4DC1A 1G9XA 3RVJA 1DFIA 2CXSA 2ZJ4A 1T43A 4I4CA 4PFQA 4J9VA 2ZIVB 3RC2A 4POOA 1WD5A 5JVDA 4FJ2A 5CH8A 3AKZA 2RHRA 3FGPA 1G55A 1GZ6A 2ZIEA 4BKQA 1Z6GA 2CMGA 4XCQA 1J8VA 4GZ3A 1QZTA 4E4TA 2K7ZA 2WUVA 2DCMA 3M3HA 3O5AA 4ISBA 4QPDA 5FL3A 4PLGA 3T4XA 4RGVA 3DXFA 1G5FA 3IP6A 3RFUA 3UNXA 3LY7A 2A5YB 2AEMA 3QKWA 3TYXA 3B1JA 5BN5B 2Z43A 3UAXA 2XVZA 3PQ5A 5DV9A 2ZGVA 4UNRA 3JQBA 3RE1A 4AMYA 3CJQA 1V5IA 5DNUA 9ATCA 5ALMA 4HADA 2OSBA 4ZODA 5DP2A 4N7MA 3SICE 1JZQA 2Y1FA 3ZZNA 2ZWAA 1CJTC 1PG0A 1T8UA 2BFFA 3D1LA 3B6ZA 4J0CA 4YQFA 5FT9A 1XELA 1S8NA 4Q01A 5AICA 1QMPA 2GAFA 4FN5A 4TZ6A 3ZI0A 4YJ2F 3WKDA 2FV8A 1JWLA 1FDIA 4ZU6X 1C8LA 1E3LA 2J1LA 3LU1A 3AHGA 1YL7A 2M6SA 2V7QD 1IOVA 4GG1A 4FCCA 2CBXA 3HKCB 4JEHA 2Q29A 4DJTA 1QRRA 5A3QA 1PGPA 2I99A 2FLVA 3QXXA 4URYR 5CYOA 3SZRA 1TK3A 3INYA 4V02A 1Z26A 2PS3A 1T2UA 1Y6QA 3PXEA 1ECBA 1BX1A 3ZKWB 4X65B 5F2EA 3QK7A 4PHFA 3EUFA 1K0FA 1VSVA 3FN4A 4OMFG 3BD6A 1E66A 2ZUBA 1H2BA 3LDFA 4X6UA 4BKUA 2XRZA 1WVGA 3HU1A 3QE4A 3ODGA 4IILA 3D2AA 4UASA 2H11A 2RH8A 4WXYB 2GFIA 4TQGA 1E2EA 3I92A 4HNHA 1MVOA 1W0KA 1Y48E 2BP7A 3O2NA 2JGAA 1WUTA 3CXRA 3DOEA 3I2JA 3SR4A 4L3VA 3L7IA 3R6DA 5K8LA 4R84A 1WAMA 4XUCA 3RROA 3FOWA 1C7RA 3KALA 1H6BA 1AQYA 1PIWA 2G8NA 4IJQA 5G1NA 4IQGA 2J3LA 2PH3A 3EEBA 3PRJA 4GKBA 4NP6A 4BMYA 2OCLA 1WM1A 2JFGA 2P69A 3D3QA 4FC6A 1Z15A 3EZLA 5LJIA 3R2JA 3L8GA 4PC7A 3PQFA