3DOEA

Complex of arl2 and bart, crystal form 1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
189
structure length
189
Chain Sequence
GLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTADLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/hydrolase
molecule keywords ADP-ribosylation factor-like protein 2
publication title Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3doeA00
3K0SA 1CR1A 3GCGA 2HT1A 3KX2A 1W4AA 3IPYA 2O8BA 4X8HA 3U4QA 4RCYA 1Z08A 1EXMA 1XRJA 3GEIA 2ZSEA 2F9LA 4UNQA 4V0OA 4D0LB 1B0UA 4M1KA 2A3RA 5H70A 2A2ZA 4QGHA 4Q5IA 4QBFA 1Z47A 3AVWA 1NJGA 3FPAA 2W83A 1PJRA 4OHWA 3W5IA 4CW7A 4UNSA 4N0EA 2VF8A 3AUYA 4PO1A 3AP3A 3EARA 4ZKDA 1ZIOA 3W3ZB 2AXPA 2D4HA 3SJBA 4Q1AA 1IOZA 1F2TA 3AF0A 1DAFA 4TYYA 4B33A 4KFTA 1A4RA 4L8GA 1NLZA 3ZQJA 1EX6A 4FCWA 1M2OB 2XNDA 1PV4A 2O8DA 3PG5A 2OM2A 4LJ8A 5GJWC 3OIYA 4JKYA 4TMKA 2FFBA 1NVXQ 5H8WA 1XD2A 1VIAA 4PHHA 4A92A 1E1RD 1NLYA 3LXXA 1YR8A 1YZNA 4QM6A 1FP6A 4QGGA 4HSEA 1SXJE 3FMFA 3MG9A 3EPHA 4HAWA 1G6HA 1P61B 5J4HA 3OE7A 5JRJA 3KB2A 1TMKA 2C5LA 4B3FX 2EFGA 4FW9A 4EFMA 1D5CA 3UPUA 2CVHA 2ZE6A 1DADA 1W2GA 4JJZA 1IN5A 1DO0A 3KJEA 2N1BA 3EPKA 1FFHA 3QSYA 4B75A 3B8HA 2WKPA 4G5OA 4TQUS 5IF9A 1QF9A 3NBZC 5KTYA 5CB6A 1E2NA 2GK7A 5BYKA 1UBFA 1KYIA 3WNDA 3A1UA 4UXJA 1GRNA 3O8RA 1HT1E 2YC4C 4TT3A 1U8ZA 4JLKA 2VHTA 2H92A 1G8FA 1D9XA 2XB2A 2A5JA 5FBQB 5FTNA 1TEXA 2DFLA 1TAGA 2ZI9A 1BKDR 1GILA 2WV9A 3BFXA 1M34E 3EG5A 4Q4AA 2ORIA 4QM7A 2J7PA 2OCBA 4NHOA 1N25A 2EYUA 2HV8A 3B2EA 1LY1A 4JBYA 2FNAA 4PPGA 2HJVA 2V1XA 4HAVA 1XMIA 3F5FA 4Q9JA 4RKEA 4DXAA 4LCBA 1G7RA 1SVKA 5DNYB 5CJ2A 5TDHA 1NL3A 4OHYA 1E96A 2CCJA 2G0TA 1G17A 3BB1A 2ZRHA 3W8NA 4NYJR 2XZOA 1TL7C 2ZRDA 2YJTD 4B3XA 4XD7D 2EQBA 2ERXA 1XPUA 3TNFA 3VQTA 1OFUX 1P9NA 2WBLC 3SBDA 1ZD1A 4ABYA 3AF2A 4M0LA 2CNWD 3AKCA 1U94A 5C2JB 5L3VA 3K70C 3AVOA 4U5XA 2I3BA 4I1UA 3NEYA 3KJGA 4FCTA 1X6VA 1Q0UA 5C46F 3IO3A 1IY0A 4WZBE 1OT3A 2IWHA 2X2FA 3FHTA 4LPSA 1CJMA 3ZZUA 4PR0A 4LV6A 1RYFA 3V00A 5JJKA 3QE0A 3R7WB 3QKSB 3QF4A 4N1AA 5BN4A 1G7CA 1T5IA 5KSZA 2ZUBA 1MV5A 5L3RA 5DLQC 3TR5A 1EFRA 1H8EA 1G8GA 2VEDA 3I1FA 4C30A 1TTTA 2IYQA 2BMDA 3QI2A 3FKQA 4IDOA 2RGDA 3X1XA 2WSMA 2NG1A 3WNCA 4TMZA 1EX7A 1YKSA 5BYJA 2QY9A 5AK0A 3DEFA 3UMFA 2OG2A 3THWB 4B48A 4B2LA 1KK1A 4QBIA 4W9MC 3RS2A 2L0XA 2UZ3A 3B1WA 2Q9BA 3ZIAA 2YOGA 1P6XA 1Z8FA 4NYMR 3HR8A 4EFNA 4GSYA 2IUUA 5CDFA 4POAA 2HEIA 5FPSA 3GLHB 3TUZC 3EIQA 1CXZA 1SVOA 1XJQA 4PPQA 1S2MA 3EA5A 3KTAA 4PC7A 5HPYB 2O8CB 4D4KA 4TL9A 5HR5A 2ZRMA 2HJGA 2PT5A 2ZJ5A 2GA8A 3PCRB 4CVNA 2QA5A 3QIAA 3AM1A 4LJAA 4O2RA 5A0FA 3BJIC 1VYVA 4OJKA 1YRBA 4HI0E 4QGAA 1EG7A 2W00A 3CF0A 1Z6AA 1J2JA 2NO6A 1IM2A 4CF7A 3P4XA 3K1JA 4Z8YA 3QKSA 1FTSA 1ZCBA 2JJ2A 4YXWA 1CR2A 4HUTA 1KI2A 3FB4A 3MD0A 4W7SA 3UMSA 3SZRA 2P67A 3L0OA 4ARZB 4RKFA 2WJYA 4FMCF 3WP1B 2VSFA 1G6OA 5KDDA 3C14C 3RS3A 3DKPA 4URYR 1N6HA 2FN4A 4AURA 3PEYA 1XMVA 4ZCMA 5CITA 4YDHB 3A58B 3NHBA 3WHLA 4I1OA 3CR7A 2PEZA 4JLJA 2OEPA 1N0WA 2O0HA 5HE8A 1R4AA 1TQ4A 1XTRA 1G8YA 4BEBA 2NZJA 1KO8A 1J70A 1MR3F 2Q0HA 4G5GA 1SHKA 4GP6A 4Q7JB 2AN9A 3KKOA 4PSAA 3QXSA 2B7BA 1A1VA 3GLHA 1CJKC 1VCNA 1KO5A 2O8CA 1HH4A 2J7PD 1E32A 5SZHB 3PQCA 4UNRA 2N42A 4H9GA 4Q7LA 2VO1A 2AKYA 3GLGB 1RRGA 2BMFA 4HDOB 2JLYA 1ZJ6A 5JZVA 1KNXA 4L5BA 2R65A 2UKDA 4G0NA 2ZM5A 4B71A 4DKXA 2REOA 4Q1EA 3U7GA 4QL3A 1DG1G 4A15A 3SJCA 5CYPA 5CDFE 3AVXA 1E94E 4GOJA 4IHQA 3RDPA 3CH5A 4PC1A 5DI3A 2ODEA 5AR1A 2XITA 3ONWA 1K5DA 1TNDA 1OHHA 3EPJA 2IA5A 2FX3A 1E0JA 4MRRA 1XF9A 1JPJA 4RZXA 3K09A 2FA9A 3EWAA 1BOFA 3LBNA 3OF5A 2FMXA 4UKDA 1NG9A 3QKTA 2ZE8A 1U98A 4HLCA 4TL6A 4RD4A 3NH9A 5M04A 2GHIA 1OB5A 3U7EB 1GKUB 1GZSA 2GBLA 2XTMA 4ZPXA 4WXRA 1MOZA 8OHMA 1R0XA 1H8ED 1RFLA 2ZI6A 1GNQA 3AP2A 1XCMA 4N0DA 1IXRC 1R5OA 1MH1A 3K8YA 1XMSA 2QN6A 2R44A 4MDEA 1GTVA 3PEVA 2GRJA 3GQBA 2H57A 3VX4A 1UEIA 1GNRA 4A36A 3GLGA 3VNVA 4L9WA 1GFIA 3UMRA 3AVPA 1KI4A 3CNNA 4LHVA 1R0ZA 2BHRA 2NOAA 1Z0IA 4ASUD 4LGMA 3TVTA 3UK6A 3WBJA 1S8FA 3AKYA 5SZJA 3TE6A 1EFCA 2WMNB 4AKGA 3GLHE 4LJ6A 1HQYE 3C7KA 1UJ2A 2QPOA 2MMGA 3VU9A 2OBLA 4MGYR 3ZQ6A 1YJ5A 2GZHA 3E1SA 4KO8A 4KI0A 3OIVA 1NSTA 4NCKA 3T5DA 2GJ9A 5EZ6B 1DTSA 2HT6A 1NBMA 1RZ3A 1FTNA 3FKSA 4AYTA 1M7HA 1XJ0A 3HWSA 4NCJA 4EQ6B 4R98A 1TF7A 3TKLA 4JL8A 1RRCA 1OXSC 3PXGA 3K0CA 4BUJA 2F7SA 4DSNA 5AUQA 1XZPA 4NDZA 1MT0A 4QFMA 1TEVA 4XWKA 2BCJQ 1ZRHA 3CRQA 4JL6A 5CIWA 2NZ8A 2ZUDA 4A6PA 1F60A 1Y63A 2O52A 3KDSE 3GLFB 2JLUA 2Q3FA 3HPRA 2NTYC 1U0HC 4MKGA 4OI1A 3ZS8A 5KDOA 1YZUA 1JQLB 4M53A 2ZJYA 3B1XA 1F6BA 1WBBA 3CX8A 1C1YA 1DAKA 3NKVA 1GVNB 5GJVC 4DLVA 1ZP6A 1G16A 1CJVC 2BJWA 4K46A 3PUVA 4KLNA 1XD9A 4EAQA 1IJEA 5JHGB 2IYTA 3DKVA 3KXKA 4MUAA 3BH0A 2ZTSA 2MSCB 3WP0A 2XSZA 3CPEA 3RWOA 2REXB 4PFSA 2JIZA 1FMLA 3C15C 3TJZA 3GJ0A 4ZIRB 3FHCB 3NIBA 1IN8A 3HJNA 4AC9A 2QAGC 3L2OB 5FPTA 1US8A 1JR3A 1YE8A 1GITA 2FWRA 1KAOA 5CYOA 1Z6GA 4DDUA 4XVUA 3AQ4A 2BC9A 2OAQ1 1UM8A 3UWKA 3L43A 1OFTA 2ZRFA 2ZI4A 1G64A 3LRPA 4TMXA 5FI0B 4EQ6A 4LX0A 3ZVLA 1RVDA 1SVSA 1AJEA 1YRAA 1Q12A 4QNMA 2H1LA 3ND8A 4UJ3A 2O8EA 5BXQC 1KSFX 1XNJA 1G7SA 2BMEA 5EE5B 1XTIA 1XEXB 3VR3A 3MUFA 1XD8A 5JJLA 3A4NA 3BXZA 1RW4A 2GEVA 1N6NA 2N46A 3HPQA 1GAJA 4G01B 2EFDB 2JJ8A 5A4JA 1T3SA 5BW8A 4TTQA 5HE9A 1GKIA 4QKQA 2GKSA 3QENA 4RZUA 5FBVB 5EP4A 1G18A 3WMFA 2HCJB 1I4DD 3CX7A 1RJ9A 2FOLA 5G53C 2GJ8A 2PL3A 1W5TA 2WJVA 4TQ9A 2Q3MA 4KITB 3LWNA 4B6FA 5HZHA 1HEIA 3TW8B 2D7CA 4DB4A 3SJZA 2D3WA 3GLIB 2QNRA 5JLJA 4O3MA 1NRJB 1N6KA 4O2LA 3A1SA 3FMIA 3PUXA 4QGFA 4LI0A 1DOAA 1NN5A 1CTQA 1MO6A 1VTKA 5FBRB 2PBRA 4PSVA 4AIIA 3GP8A 1IXSB 1ZUIA 1W48A 2RGCA 4L9SA 3P4YA 3RRZA 3EIHA 4WOPA 1E9CA 2ZAMA 3QPVA 4OYHA 1JR3E 3K53A 2WWHA 1U90A 5D3MB 1G4AE 4OK5A 4GL2A 1VECA 1CJTC 1EWRA 2PMKA 2CMKA 5HKKA 2XTNA 4LUCA 3LLUA 1JI0A 2GESA 1G5TA 3MCAA 3BFVA 1BS1A 2KBEA 2RGBA 2GCOB 2YWHA 3AUXA 4CDGA 4Q9KA 3RVBA 1RKBA 2EWVA 1ZBDA 2J59A 3ETLA 3L8ZA 1G3MA 2QM8A 2ZQ5A 1VDZA 4OHVA 2WWWA 3U61B 5GJBA 4M1SA 2HLDA 3CIOA 3RS4A 3GLFE 5AJZA 4AYWA 5L3QA 5AUNB 3NWJA 4KFSA 2IBMA 3X2SA 1VG0B 3GLIA 1FW6A 1ETUA 4TMVA 4HB0A 1XCPA 4EPTA 3CM0A 4A8JB 1EFUA 3GJ6A 2AD5A 3PUZA 3T1TA 2CVFA 4Q1BA 4DUGA 1QVAA 1EGAA 1JXMA 3GD7A 4RFSB 1RYHA 2XSZD 1SVMA 1OXXK 1G41A 3V4RA 2KI5A 3C5CA 2DYKA 1CIPA 2C95A 2VH5R 2VP9A 1KJYA 4NYMQ 4Q21A 3TW4A 1OH5A 1W36C 2OZEA 3LAWA 2QMHA 4GMDA 4BZPA 4HATA 1FNMA 1RIFA 4GOKA 4A0GA 4CEJA 2GTPA 3H0KA 4QRHA 1IJFA 3WY9A 1RE0A 1LS1A 4HB2A 4GT1A 4QXAA 5GJCA 1D6JA 2R9VA 1OKKD 2Q3HA 3UANA 1OH6A 2ORVA 4M21A 4JLNA 3CNOA 5B64A 3SS8A 3QUSA 4DZZA 3GPLA 2FPKA 3CX6A 3LW7A 2BJVA 4TLAA 4TQAA 3PV0A 3EZ9A 4N3NA 3FYHA 1Q1BA 3ADCA 1LS6A 1MO4A 1VHTA 2ZU0C 4IOMA 2P3SA 5FL7A 3W3AA 5JS7A 1IN6A 2R6AA 4IVPA 5GVRA 2VP5A 5EXPA 3QXHA 1MO5A 4G3XA 1XPOA 2P5SA 1AK2A 2JJ1A 3LD9A 4RCZA 1MRSA 1GL7A 2IS6A 2ZS9A 4A8JA 4JVMA 5CK5A 2HUPA 2XGJA 2PZEA 4HLDA 1FZQA 4M4SA 1LW7A 3MJRA 1OH8A 1IY1A 1N2CE 4URWR 2WTUA 3OZXA 2GAAA 1PLLA 1E2EA 1W36D 4GPTA 3N2EA 4FD2A 2ZE7A 4LHYA 1GM5A 4QJ3A 1EWQA 2VSXA 3E5HA 3GLIE 4D6PA 2Z4SA 3DL0A 3QKRA 2AL7A 1X8LA 5JCPA 1WDTA 4Z51A 3Q7PA 4TYPA 2ZYWX 2F3RA 3RWMB 4EPXA 2VIIA 3VAAA 3GJ8A 4DEXA 2LWIA 2GVDC 2IWRA 5KNCA 2VL7A 4XSHA 4LJYA 2V54A 2QUZA 1U9IA 4DCTA 4JL5A 1BH2A 2F1IA 3CF6R 1I4LD 2PT7A 4W5HA 3MWJA 3CWQA 3Q72A 3P20A 4R7ZA 3M1IA 1OYYA 3KQUA 2J5XA 1E0SA 2AXNA 4TLCA 1FX0A 4I81A 4J0QA 3M0EA 2WICA 3MJHA 2JLWA 3EASA 1KHTA 1HV8A 4HUQA 1XXHE 2EU8A 4FN5A 2GEUA 5DSZA 1C9KA 3SHFA 1RRPA 4D4MA 1CRQA 4EPRA 3IQXA 4P0TA 3IGFA 2QG6A 5J47A 2FPLA 2HLDD 2B8WA 3K70B 3A4MA 1N5JA 1DE0A 3F0TA 4XJXA 821PA 1NSFA 1T6NA 4PPNA 5FOWA 1KKMA 3B82A 1J90A 4RD2A 4ZCIA 4BLPA 1U2RA 1GRQA 1NY6A 1KSGA 3B6EA 1XMJA 4PC3A 5EXTA 2DFNA 4HDQB 4D80A 3OEED 4D2IA 3B78A 1F48A 3LO5A 4JT2A 1QG4A 3BWDD 1HA3A 3DO6A 2QP3A 3Q8XB 3HYTA 4Q4JB 2MMCA 2PJRA 4BRWA 4JLVA 2YKGA 3G5UA 4XIGS 1HURA 1TQ6A 3AV0B 1LTQA 2WSSD 5FPYA 1CKEA 3Q5EA 1E4YA 2W0SA 2BBWA 4EJSC 5EUQB 1Q3TA 1ZU5A 5KNBA 2C2HA 5CM8B 3SR0A 1ONBA 5B30A 2V3CC 1R5BA 4FI3C 3RRMA 2XXAB 1E2JA 1KZ7B 3M4YA 2UZIR 2V7QA 4IDHA 2YYZA 4BFZA 4D82A 1E9EA 1LFDB 2FEMA 1DBSA 2ZYVX 2B6HA 4BLQA 2O8FB 1IQPA 2IYSA 3K0EA 3RNLA 3U3OA 5JECA 5K8LA 5LPNA 5B58C 2XAUA 3RS7A 2QGNA 4HB3A 3AVTA 5EE0A 1R5NA 4CZ2A 1FQKA 2OV2A 3W90A 4BE7B 4NMMA 3ZJYA 2JDIA 4GRAA 1G5PA 3QF7A 2BBSA 2TMKA 4LJ7A 4HLUC 2IX3A 5EE3A 1W49A 2H8KA 2OILA 4IKEA 3VHLB 1P4SA 5IHPA 4CEIB 4R9UC 2FEOA 5B2ZA 1SXJC 2PCLA 5FL7D 1F2UB 2GK6A 2QRNA 4LOAA 4D81A 2YWEA 2IYYA 4GMXA 3AVYA 4BECA 3RLFA 3WMGA 1SVLA 2KSQA 5EP3A 3BH7A 1WRBA 3QKUA 1GKYA 2ZRJA 2JJ1D 3THYB 1KAGA 1LF0A 1PLKA 3AB3A 5H68A 2RKOA 3IKJA 1M6NA 2OUKA 2FF7A 4LRWA 2JASA 2NO1A 4Q4JA 4XVQA 5AUOB 721PA 3ZVMA 4C0KA 5TV2A 4DLSA 3FDIA 4KU4A 3KQHA 3CO5A 3IIMA 4OQNA 4TL8A 2ZUCA 3DHWC 5JS8A 3UG7A 2Q9AA 2ZRGA 3DOEA 4PHGA 4TMWA 4A9AA 2OO7A 4BLRA 4Y0VA 5JWHA 2WWXA 3BS4A 2ZSDA 1FL9A 2A7QA 3QPWA 3LQQA 4LHXA 2IW3A 2O8FA 2IEYA 1U99A 3O47A 2NO9A 3RS5A 1P60A 3TAHA 2GF0A 1S3GA 1P73A 1KY2A 3MMPA 3ZYCA 4K81B 2QE7A 4LYHA 4MDFA 2IYLD 3A37A 1YU9A 1P5ZB 3LY5A 3ZH9B 1DELA 2AHOA 2YWGA 3MLEA 3ADDA 3U3RA 3BE4A 5LDDC 1P62B 4HAXA 4OI2A 1ZM3A 2ZS8A 4CEIA 2ATVA 5J4VA 2WWYA 3R8FA 3IBYA 1KO4A 1SXJD 1G8HA 1WF3A 2I4IA 2QTFA 3B60A 3IBGA 4B3GA 1Z07A 2R6FA 5G40A 1GNPA 1ZNWA 4AYXA 1H8HD 1QG2A 4Q1DA 3SHWA 2DBYA 2VQSA 3ZS9A 4A4DA 4FXPA 4URXR 3THYA 5DYGA 4EPYA 1NG1A 5KHOC 5J4YA 3PEWA 4I1SA 1WP9A 2H16A 2MSDB 1FQJA 1VCIA 2PH1A 4M22A 5JEEA 3I62A 1X86B 3KFVA 3DDCA 2ZROA 4WZAE 3U3JA 2FFAA 1MABB 2R62A 3U3MA 2ZRIA 2V8OA 2ZYTX 2VP4A 3MGCA 4RD0A 3R9IA 121PA 3TMKA 3HYRA 1COWA 2V55B 3FFBA 4JIMA 3VR1A 1CR4A 2CHQA 3R8CA 4X8LA 1VCOA 3WYFA 1II0A 4MRSA 1P75A 4BFXA 1QVRA 1L7VC 1S9DA 2IEZA 3CKLA 3P32A 1ZD8A 2VHQA 4HZIA 5J4KA 1JAIA 1H65A 2OAP1 2HDNB 1ZU4A 1FP7A 3NDBB 3CPJB 4EKDA 4Y0AA 1BMFA 2V7QD 1Z0FA 2WJGA 2G3YA 3R20A 3N2IA 2FSFA 3I5YA 2RMKA 4AKHA 1YZQA 1P2SA 2FZLA 3UXMA 2XNDD 4ZV4A 4TZ0A 3C5HA 2W0MA 4H1UA 4GI7A 1WE2A 4LV5B 2GXAA 2Z83A 1NVVQ 1HUQA 5CLQA 4F91B 2ONKA 1GRRA 4TL7A 2W6IA 3R7WA 1AM4D 2A5DA 2ANCA 4ESVA 4C3ZA 2ZS7A 3D31A 3OAAA 3PITA 4Z1MA 4TN1A 1MABA 5FOXA 2QROA 1E99A 3CRRA 1MKYA 3OE7D 3W9YA 3LBIA 4URUR 3JVUA 4JVLA 3V9PA 4FWIB 5EUMA 3J81k 4G1UC 1S1CA 3QG5A 1OXUA 2AD1A 3K9NA 3Q9LA 1TX4B 1W44A 3WRXC 5FFMA 1KMHB 3HU1A 4JLAA 4PAQA 2PX3A 2ZSFA 2CCGA 3I73A 1ZIPA 4MH0R 3THWA 2QORA 2X1VA 1SKYB 3A1TA 1YQTA 4TT3D 1T8TA 5HCNA 1XEWX 3LX8A 3PEUA 5DIFA 4MYTA 1KI6B 1ELOA 3EIEA 2QMUA 4NZYA 5DHAA 4F4CA 1X8JA 5K8IA 2AFIE 3VR5A 4OQMA 3L0PA 4DLXA 2IF0A 2X19A 3WXMA 1WQ1R 2JLQA 2QU8A 4ZI3A 5BQ5A 1OXTA 5JSZB 3THXB 1Z28A 4LPKA 5P21A 1D2NA 1T9HA 4RZ2A 2P2LA 2ASEA 4JMPA 2GAOA 1IN4A 2OFXA 4D0GA 3R9XA 1J8MF 2QE7D 1ZC3A 1T8UA 3T35A 1OJLA 3SQXA 2D2EA 3DMNA 1BO6A 2C78A 3HU3A 4RD1A 2BBTA 5L8VA 4LSGA 2WAYA 2HYIC 4IW3B 4ZDJA 1L4YA 1VYUA 1YZGA 2BKUA 1W47A 3ADBA 4BFSA 1R0YA 1RRFA 1EFTA 1VCMA 2CE7A 4ARZA 2UVQA 2ZVPX 4DDVA 1M1YE 3BB3A 2EFCB 4NKRA 5LBIA 5JEDA 4NYIQ 4XTRA 2W2TA 2GILA 2D2FA 2RHDA 1WB9A 2PMDA 3NC1C 3KQKA 3AGPA 4OK3A 2C77A 4JZKA 1W7AA 5LD2C 1KMHA 3CW2A 1E69A 1KK2A 1XTJA 1AS0A 1HTWA 1EK0A 3A1VA 1T3HA 3DM5A 3U3KA 1WBDA 1JAHA 4M9ZA 1RPZA 3IEUA 4M9SA 2ZRLA 1EFRD 5KSYA 5D3QA 5AJYA 1KI7A 1FUKA 2FJUA 2KJQA 4JT4A 3PUYA 1A82A 5JCZA 2NMVA 4FWTA 1E0KA 4UJ5A 1UKVY 1Z6YA 2VHCA 3NHAA 3K0FB 3K9HA 2O0JA 3GMTA 1W1WA 4L4UA 3D8BA 5JSZA 2ODWA 3Q7QA 3I5XA 1NNEA 2V6IA 1GDDA 1SHZA 1ESNA 1E2KA 3PENA 3VKHA 1E2QA 2ERYA 5KSPA 4GZMA 4F93B 2V6JA 3BBPA 4TTPA 4FIDA 2J7KA 3EZ6A 3ZIAD 2ZIAA 1KO7A 5ANRB 1JBKA 3RANA 1FNNA 2P65A 4DCNA 1KDTA 5E4FA 3IDQA 1BMFD 4Q47A 3IILA 1UDWA 1OYWA 2WZQA 4JLMA 3C16C 5EE9A 1Z0JA 2FG5A 4HAYA 1JJVA 4IXNA 2YINC 1YZKA 2VP2A 3VR2A 2RH5A 1N6IA 1AKEA 4BASA 4MQBA 3THOA 4DEYA 2W6ID 3BIFA 4GOXA 3FVQA 4AY2A 2ZSBA 5JRZA 4ZCLA 2J45A 3ZVNA 4PQFA 2JJ2D 4B6EA 4YXWD 2FDCA 4G5QA 1JPNA 1CLUA 2F1RA 4DB2A 3CRW1 4Q1CA 1YVDA 3NXSA 2I1QA 3RABA 2GWHA 2J3EA 2BM1A 1ZNXA 4C0AC 1T91A 3K0FA 4JLBA 3VMFA 3T12A 2J0VA 2Z43A 3L82B 2WAXA 3K09C 4KFUA 4DDWA 1D2EA 4NCHA 4XOIA 4BGDA 1W4CA 3IIKA 1Z2AA 4DCSA 4Q02A 2JAQA 4L16A 1SKYE 1JB1A 5DN6A 4DLYA 2F1JA 2VHUA 3BERA 4PAMA 2ONJA 1UKYA 1SULA 5FBLB 3IEVA 2FE4A 5TARA 4Q9HA 2GBLC 4IDPA 5J40A 1L8QA 2C98A 1SKQA 3DPUA 1Z6TA 1GWNA 4ZDKA 1FUUA 1DAEA 2JCSA 2WOJA 3KJHA 4A0RA 5FH9A 2ODBA 3CONA 1TUIA 2ZVQX 1ZW6A 4LYFA 2VLIA 4PPFA 1A2KC 2WOOA 2IUTA 3QNUA 4Q7KA 4JYCA 1NMZA 4WXPA 2OESA 1XJCA 2GETA 3KKNA 4JSTA 1II9A 3C8UA 4LC1A 4LJ5A 5FTMA 4C4PA 2OCPA 5J4LA 2YV5A 1VMAA 2ZI7A 2Q9CA 3LQRA 2D62A 3PVSA 2OE2A 4TYQA 4RFVA 2NPIA 3BK7A 3W6NA 2XTZA 4FCVA 1S9HA 4A0FA 3NVAA 2Q6TA 3GJ5A 3TK1A 4YQFA 1P2UA 2C9OA 2PX0A 4AWXA 4ZDWA 4GP7A 1X8KA 3LFUA 3REFA 3GLFA 4E03A 2C8VA 4OL0A 4DCVA 1QHGA 1DARA 1OHHD 2FPMA 4MITA 4EPWA 1PVOA 4M9XA 3QG1A 4Q4LA 1AA9A 4LY6A 5JBQA 2ZPTX 5HTKA 1GIAA 3U5ZB 1AZTA 4MYUA 3VKGA 4II7A 3JZMA 4V0NA 2W6JA 3T1OA 2JLSA 5DE3A 4V0ME 1KDOA 3N70A 2IT1A 4D4JA 2ZITA 5K8TA 3K0CC 4GDFA 1CRPA 3REGA 3I4LA 4ESHA 2CDNA 4ZIRA 3GJ7A 1S3SA 1NMYA 2Q21A 3H2YA 3GJ3A 1DPFA 3RRYA 3ZZTA 1SVIA 3Q85A 2IUSA 4GZLA 1E4VA 1K8RA 2HXSA 3U60B 3CPHA 4QHTA 3AF3A 1XX6A 4TTRA 2V4ZA 1AKYA 3ICQB 1R10A 2BBOA 5FUVA 5KSOA 4PZZA 2V1UA 4RJLA 4B35A 1S96A 3W5JA 5EZ5A 3I32A 4K8OA 5F3WB 1E1QA 4YMSA 2FV8A 1UBEA 2IYXA 5C4MA 2IXGA 4WIAA 4X8MA 2G6BA 5JI2E 3X1DA 3B9QA 4NYJQ 2FGJA 2K5UA 4RVCA 3A4LA 3AVQA 1XEXA 2G0NA 1HQCA 1ZYUA 4B34A 5FPHA 3I92A 4G5SA 5JI3E 1HT2E 1NLFA 1OLOA 3IHWA 4FMDB 3T5GA 3X1WA 2HCBA 1U0LA 1DAIA 2Z4RA 2YC2C 1C4OA 1ZM4A 1NBMD 5EQTA 2P6UA 3P27A 2ANBA 3VR4A 3HDTA 3FKSD 2YZ2A 4YMWA 1XXHB 2Z0MA 3LH5A 4DC9A 4US1R 5FOTA 3LW8A 1E2MA 1U0JA 4URZR 4KJZA 2ATXA 3BB4A 4P33A 2OBMA 1V43A 1U8AA 2IYRA 5KPDA 2FGKA 2BOVA 2FSGA 4M2LA 1G5RA 2ZETA 1ANKA 2AKAB 2DY1A 4LWZA 4IXMA 4BFVA 1X1SA 1BIFA 3SNHA 3ZZ0A 1J99A 1CEEA 1E9SA 4Q01A 3NTUA 2J46A 2IYVA 3QVVA 5DN6D 1DEKA 1TQDA 3X1YA 2AK3A 3CR8A 2GJSA 4P4TA 2JIZD 2QT0A 4IEEA 3EXAA 4R2HA 2F6RA 5D3MA 1VIYA 3K9GA 1R0WA 4PC6A 1JR3D 4JLDA 1T0HB 3CUEF 1JNYA 4CGZA 3AVUA 3CZQA 3MFYA 1G3QA 3OESA 3IUYA 4HLQB 3BORA 3KXLA 5EJEA 5DI9A 5FOSA 1N5IA 4W5WA 2GCOA 4M9QA 5AWFC 4QJ4A 4ON9A 2E87A 2CJWB 3WYAA 2GVZC 4IJMA 1Z63A 3NBFA 4LBZA 4BFYA 1XXHA 4Q48A 3W34A 2G83A 3CBQA 4KV9A 3NG1A 3L0IB 2DPXA 2P5TB 3TRFA 3UIEA 3RC8A 4YLGA 3OHMA 2ZYUX 4ZI2A 1NN0A 4Q9IA 4PSKA 4EFLA 3B9PA 1FMJA 1GL6A 1Z3IX 1QDEA 1NN1A 3OFNA 2BMJA 5GADl 4PHFA 2JLZA 4KLZA 2C99A 4LK2A 1GOTA 5FTJA 3U44B 4JLPA 3DMDA 4B76A 1NVUQ 221PA 5KO2A 5JFGA 3LX5A 2Z5FA 1P2TA 4I4LA 2HYDA 1P3JA 4Q03A 5KNDA 4IFEA 5E7JA 3E2IA 1OB2A 1KIMA 3WMEA 5FI1B 4C7OB 2G1KA 3ECCA 3PUWA 2NIPA 1W5SA 2ZJAA 4IRUB 4KODA 4RFSA 2RHMA 4S35A 4PXAA 1GUAA 3U2QA 4TLDA 4NCNA 2RGNC 4XH9B 3AEZA 3U7FB 2AWOA 1UEJA 4BZQA 3BH6A 3MRSA 4BZXA 1DO2A 4MGIR 4UXIA 2OXCA 2WWIA 5AJVB 4DLZA 1NIPA 2ZI5A 1E98A 4D0NA 2C03A 2P6RA 1K5GA 3PJRA 1G19A 2BEJA 2F55A 1OH7A 2BEKA 4XTCS 2LKDA 4TZ6A 1KK3A 5JMTA 1G1MA 2H5EA 2OCAA 5K8UA 2CJWA 2HXYA 4IDNA 4LDJA 1JQJC 1ODFA 4YC7A 3BC1A 4ZKEA 2OT3B 1E1QD 3HR7A 2PLFA 3IHLA 4OI4A 3K0AB 2WWFA 2ZRAA 3QVUA 4BQSA 1E2FA 1A5TA 1N5KA 2NPFA 3DZ8A 2R6CA 4JVNA 4UQOA 4ERNA 1N0VC 1XWIA 4WA7A 2KBFA 1P72A 3SN6A 1Z6XA 4F92B 4C0BA 2O8BB 2IYZA 2GZAA 5HKKD 4B3DA 1Z0KA 3T61A 1WXQA 1KJWA 1TU4A 3D7MA 4BPBA 1QZXA 2CL6X 1R6BX 4KSBA 3U7HB 4US2R 2ZRKA 4PANA 4IFBA 3HP1A 4PO8A 1T0JB 4C7OA 2XOKA 4TLBA 2QENA 4XD7A 1BYUA 1ZC4A 4XWAA 4NP6A 3B1ZA 4DVGA 2B21A 3ZD6A 3TSOA 2IS1A 2CNWA 3FMPB 5E7IA 4LBVA 5L3SB 1UBCA 3SFVA 4NONA 1OE0A 3NDPA 4IOKA 2O8DB 1KDRA 1Z2CA 2OXRA 3QEJA 3WBKA 4HAUA 5KPJA 4BLSA 1LV7A 2G1JA 1NJFA 1CJUC 4LYAA 3NEJA 4WZ6A 1UPTA 3FWYA 4LZZA 4A8JC 4DUGD 1OV4A 3CRMA 4BEJA 3KKMA 2JEOA 4R71A 1OXVA 3T34A 3CB4A 1R8SA 4AKIA 1KZGB 3O8CA 1MRNA 2OBNA 1Z06A 3RAPR 4IVRA 4PX9A 1GP2A 1N0UA 3LLMA 5EE1A 3SJAA 4DSTA 5SZIA 3IQWA 5FL3A 1N6RA 2YOHA 4MGKR 3E70C 3KB1A 4CYMA 1KTVA 1F3OA 1QBKC 2D06A 2OFOA 1JALA 2QAJA 3L0SA 4LHWA 5J5CA 3KFXA 3DOFA 3NH6A 1CU1A 2CXXA 5JJIA 4PO9A 2A30A 4Q1FA 2OCYC 3TQFA 1U9IC 1O87A 1UBGA 2FZ4A 2G77B 2G88A 4NBSA 4Q00A 4IOLA 1G21E 1Z29A 4C0HA 1ZM9A 421PA 5L3SA 1GSIA 1G8PA 3BD9A 4LV8B 4Q4AB 3OFND 5G41A 1AZSC 2QTVB 5KOYA 4MA4A 4NPHA 4PZYA 5G3YA 1VG1A 1W0KA 2IK8A 2A5YB 3G82C 1ZD9A 3MSXA 4GBMA 3GEEA 1PLJA 3QEOA 2QMOA 4NCIA 3SYKA 4B2PA 4P4SB 1G9XA 1GG2A 2CE2X 5FR1A 5TVKA 1OIWA 4DSUA 2VRWA 2ZRPA 1CBUA 3NBXX 2VTKA 3EX7C 4D4LA 2PLRA 4EIWA 2CBZA 1TUEA 1YZTA 4HZUB 3ZGXA 3TUIC 1Q21A 3RYTC 1W46A 2R6GA 3WRYC 2XXAA 4ZO4A 3HU2A 3QBTA 5DH9A 1OIXA 5EXSA 4RY2A 5CIQA 2RGEA 1R7RA 2SHKA 3B5JA 5FTKA 4M1OA 2DFKB 3B1VA 1KI9A 4XWOA 2WKQA 2QBYB 1II8B 3EWSA 4QC2A 3CRVA 2ZEJA 4I99A 1P9WA 3QF4B 4V0KA 1IN7A 2QTHA 4E5UA 4MRNA 1CF4A 2KB0A 1D9ZA 1LNZA 1DAGA 4OQFA 3VKWA 4A2WA 2X8AA 1E2LA 5FUYA 3EPLA 5LB2A 2DWQA 2BV3A 1AIPA 3RRNA 4OI0A 2BWJA 4QJ5A 5BWMA 4Q18A 3QJYA 4OK6A 4CRWB 1F2UA 2A5GA 4LBYA 4YDSA 4B44A 1QRAA 1VKJA 1LF5A 5H1YA 2W2XA 2Z6VA 3DVLA 4KYUA 4MKIA 1Z0DA 1UKZA 4FMBB 2WVJA 4P4SA 3B85A 2IYWA 2CCKA 3N5CA 2H7VA 3QXJA 4TMTA 2XOKD 5EP2A 3RSOA 2B7CA 1P7CA 2P6NA 4DBLC 1E9DA 5KYKA 1QHXA 4HZUA 3KTAB 4F4IA 1Q1EA 2EFHB 1G3UA 3LVRE 2ZR0A 3AF4A 3H1TA 4KVAA 1OIVA 2JLRA 3UKDA 4KFRA 1QHSA 1XFAA 2R8RA 3I72A 2G9NA 3KXIA 4KVGA 1ZAKA 5LD2B 1RC8A 1Q44A 4OQXA 3JZAA 2IC5A 3WYGA 3A8TA 4DHEA 4IEIA 2VP0A 3O8DA 3NBYC 3EA0A 2E9SA 2QBYA 1II8A 1E9AA 2J0QA 1KO1A 3GFTA 3SFZA 4KBFA 3V4FA 1KKLA 2E1RA 4RSGA 4C0SA 4C0LA 5F98A 3AH8A 2NQ2C 2BVNA 1KI1A 2LCFA 2VSOA 3MAAC 3DZDA 4RZ3A 4PQYA 1PZNA 4V0LA 1Z0AA 5FUWA 2NO0A 3SC3A 3FFAA 1E79A 4A0HA 2WJHA 2XNSA 3SYNA 4DLRA 1X1RA 4TYWA 3VTKA 2QP4A 2ZRCA 4ASUA 2AX4A 3F3YA 4JVSB 3SEAA 1LB1B 3Q3JB 5GVSA 2YVUA 2FFQA 4JLOA 1I4TD 4OHZA 2JDID 4A1FA 2CL0X 4B32A 3FHOA 4Q4HB 1KMQA 3K70D 2GDJA 1D2MA 4XSGA 1XDBA 1S1MA 2WJJA 1Q22A 4MKHA 1N6OA 1IHUA 1XCGB 3AP1A 4MGZR 4B2IA 2BDTA 1ZM7A 1XP8A 5BN3A 4PC2A 4MYCA 1JXOA 4BRUA 4KAXA 4FMCB 4ILEA 4JYBA 1XPRA 1W0KD 3KQNA 4YMTA 2ECKA 1OFHA 4PQRA 2ZU6A 4B74A 4B73A 3B1YA 3ADKA 2D7DA 4NH0A 3B7GA 4QNRA 3FTQA 4PTLA 2GEDA 1G291 1NY5A 4CT4B 1CS4C 1NIJA 1QHIA 5DI3B 3SQWA 1T3LA 1ZNYA 3P26A 3IO5A 4HDCA 2WPDA 4US0R 1E2PA 2QSYA 1R8QA 2XEXA 3FMOB 2H18A 3F8TA 1SZPA 4E09A 2NGRA 2ZSAA 2VA8A 1I2MA 4QHYA 4BFUA 2ORWA 2RGGA 1HY3A 2AWNA 1N6LA 2AFHE 2ZRBA 2EWWA 3Q5DA 2OFWA 1IONA 1G3RA 4OHXA 3UWOA 4BLOA 4YMVA 1PUJA 4NTZA 3CNLA 3GJXC 3H84A 3ZVRA 2XX3A 5JHHB 3LXRA 2J0SA 2QAGB 3AGQA 1Z83A 1XEWY 1NP6A 4Q4HA 3BAFA 1TQ2A 2RGXA 4AKEA 3C4JA 2YHSA 2FSHA 2GXSA 3OIWA 2IS2A 4IOJA 2O0KA 1DG3A 3M6AA 5LB4A 2IXFA 1K6MA 4KCGA 2WWGA 1A7JA 2WMOB 1KK0A 3EAQA 4NU0A 4UXHA 3EZ7A 5SZKB 4JSYA 1EESA 1G4UR 5IT5A 1AN0A 2YOFA 3TQCA 2JLXA 1OFIA 1AQYA 4L15A 4WAUA 1DVRA 4C2TA 4NL4H 4M1MA 3TGPA 4ITRC 4U00A 4IVQA 4DLTA 1ZMXA 2VHJA 4HAZA 3VU9B 2J1LA 5F2EA 3U6KA 1KI6A 1KGDA 1TADA 2V9PA 3ZDQA 2RB4A 2JGNA 621PA 2CHGA 4V02A 1E9RA 2X77A 2GCPA 4MRPA 4DSOA 3KZ1E 4B47A 2DR3A 4IDQA 1B23P 2OLKA 4PAOA 2CHVA 1COWD 3THXA 4JS0A 1GL9B 1E6CA 3JVVA 2QRZA 3LDAA 4AG6A 2OSBA 2QQ0A 4GFDA 1XEFA 1QHNA 1XBTA 3RHFA 2MSEB 2XJ4A 3TUJC 4S2EA 4AG5A 2QAGA 2IYUA 2QL6A 4V03A 5E7MA 3W8RA 4CIDA 2EFEB 4KYIB 4DT1B 5B57C 2XZLA 4OBEA 4M1WA 4WW0A 1E2IA 1WA5A 1Z22A 1HE8B 5A5GA 5FOVA 2FH5B 1G3IA 2WHXA 3I3SR 1E79D 3SU8A 1TF5A 1NMXA 1XB2A 3BOSA 5FOUA 3AVVA 2CK3A 3MWYW 4B3BA 5FPKA 2GXQA 3RC3A 4W5JA 3TIFA 1XTKA 2XJ9A 4RD6A 3A36A 2D74A 2CLDX 1XTSA 1CULC 2BM0A 2QSZA 3IPXA 3OEHA 4ACAA 1UAAA 3A6PC 2A78A 2CEAA 4U7DA 4KHZA 1KJZA 3KJIA 2QPTA 4P31A 4V0MA 3CH4B 1VHLA 3UATA 2C9YA 2QP9X 3LBHA 4QBGB 3KL4A 3OAAD 1US8B 1Y3AA 5TXGA 4F4JA 4Z1MD 4MRVA 5EXXA 1Q1QA 1ZUHA 2VPPA 1NF3A 5JWRA 1Q57A 1KSJA 5CLLA 1W4RA 2F43B 2FSIA 4E22A 1UFQA 3AKEA 3RS0A 1U81A 4DCUA 2ZAOA 3A1WA 1U8YA 3SE0A 5C18A 3KQLA 2O8EB 3CWZA 1XU4A 5C1BA 1ZCAA 5E95A 3VR6A 5E3HA 1UDXA 5AJXA 4A6XA 5IRCD 1JEEA 2LKCA 2QT1A 4U02A 4OQLA 5CM9C 3EC2A 2I1VB 5DYIA 1QHHB 3UG6A 4DT1A 1KOFA 5DISB 4P32A 4Z54A 2ZR7A 5TY0A 4M1TA 3IIJA 2JATA 2WPDD 2CL7X 1Z5ZA 1UF9A 3TBKA 2ZJOA 3BGWA 2ZJBA 1L4UA 3DM9B 3VNUA 2F1HA 4G5RA 1M7BA 3ND9A 4JBWA 3SBEA 4I1VA 2JLVA 1OSNA 2GJAA 1JECA 2WIBA 3PFIA 2W2VA 2F9MA 1V5WA 1FOEB 1RJ9B 1WMSA 1A2BA 1XZQA 1W36B 2AR7A 2W58A 2PEYA 4P3YA 4H1VA 4JJKA 1IXZA 2QZ4A 5IDVA 1DAHA 3EZFA 1I2DA 2VP6A 1L2TA 3CLVA 1M7GA 2B8TA 1FPMA 2ODNA 4YONB 2F43A 1JJ7A 2IF2A 3GLGE 3LV8A 3ICEA 2HF9A 1SVWA 1OKKA 1E0AA 2RGAA 5KUTA 2OHFA 2GZDA 4D26A 2GCNA 5KU1A 1N3BA 5TB5A 1ZUNB 2Y8EA 3S1AB 4BFWA 1MO3A 4M1YA 4ZDIA 3VHXA 4KXFB 3KKQA 4NE2A 3FOZA 1QHHA 5IK2A 1VPLA 1YHNA 3PR1A 3ZD7A 2WM9B 3I61A 1Q20A 4C0QC 4O0MA 2X2EA 2REBA 1NBME 5EP1A 1IAQA 2F3TA 1ZM2A 2NO7A 2FFHA 1WCV1 4P4UA 2PZFA 3TLXA 1CP2A 1NKSA 5AJWA 3O8BA 3FGNA 2O5VA 1ESMA 2QPAA 1J8YF 5TMPA 2RCNA 4X8OA 2C9CA 1P2VA 2VBCA 2ZANA 3SOPA 1E2DA 2WKRA 1YZLA 1T4GA 4MKFA 2DWOA 5L3QB 1E9BA 3VFDA 2XB4A 1G7TA 5CJPA 2AK2A 4F7WA 3KKPA 5HCIA 2QEQA 2QI9C 2VF7A 5FR2A 521PA 4D25A 1Q1ZA 3ASYA 1W2HA 4LJ9A 2EVWX 1DAMA 1CR0A 3QBVA 4A2QA 3C41J 3BFKA 2QMEA 2BCGY 2CK3D 4DJTA 4Q19A 4DIEA 3ASZA 4EUNA 2C04A 3S1AA 5F9HA 3OEHD 5FBWB 4LYJA 3TVDA 2QQEA 4FMDF 1Q3HA 3K9LA 3VX3A 2VYFA 3L8YA 1N6PA 4TYNA 2J87A 4A2PA 2WIAA 1TPZA 3SDZA 4KBGA 1IY2A 4C9BA 1E3MA 4PHTA 2DCUA 1O3YA 2OLJA 4CEJB 1ZVQA 3GJ4A 5DGXA 1NN3A 1NVWQ 4CT5A 3PIRA 4WBSA 4TSFA 4JKIA 4BWYA 1NVVR 5DO9A 3WNBA 2B92A 2EW1A 3LA6A 1SQ5A 5ELXA 4QBHA 1E9FA 2JA1A 2RGNA 4GNKA 2PCJA 4RD3A 3TR0A 1NI3A 2BKEA 3KUCA 1P9RA 4QOSA 5CK4A 3QY0A 2YWFA 2ZR9A 4WVFA 4EDHA 2A5FA 3B13B 3GEHA 3QOFA 1W0JA 3QQ5A 3SYLA 3MWKA 4URVR 2ZJ2A 3QXCA 1W4BA 2WJIA 2P0EA 1AGPA 1X3SA 3OEEA 2C96A 3TH5A 1JR6A 4MUBA 1AS2A 3CZPA 1VYTA 1VG8A 3EW9A 5FTLA 3QPUA 1S0UA 2IHBA 2ZXUA 2WSSA 5AUPB 3D3QA 4DWJA 4EJSB 4QG7A 4E07A 2A9KA 3LNCA 3LVQE 4AI6A 4KSCA 2GXUA 3BRWD 2KWIA 4DRZA 2PZGA 1KNQA 1ZNZA 1AGRA 1JEDA 3QKRB 2R2AA 4B3CA 3GFPA 2XZPA 2ZJ8A 1M74A 3I8XA 4DIDA 2J0UB 1J7KA 2PJZA 1TF2A 4XVRA 1KI3A 2FU5C 3NC0C 5KDLA 2IS4A 3WHKA 1EFHA 2W6JD 1HYQA 1SGWA 1E1RA 4JBXA 4AK9A 3OIUA 4R2IA 2GNOA 1BYIA 3RSLA 4EPVA 1SXJB 5IK2D 2QGZA 3KUDA 4NYIR 3EZ2A 5UKDA 4FINA 1DS6A 2YNMA 6Q21A 1FX0B 3R9WA 1D8TA 2IHYA 4UNNA 5BN5A 5DHFA 5C4GB 1IBRA 4CEHB 4HUQB 1S4QA 1OW3B 4HYYA 3QXXA 4PZLA 4C2UA 2RAPA 4OKSA 4DLWA 4DDTA 3ZLJA 2DB3A 1KY3A 1AQUA 1N5LA 1PUIA 4LHZA 3TAUA 3EC1A 5F9FA 4EJSA 3I8SA 4M8NE 2EYQA 1E2GA 1QHYA 2CLCX 2J41A 2ZJZA 4OJQA 3SI7A 3T15A 1AS3A 4TLEA 4Q66C 3GFOA 1G20E 5CB8A 1OF1A 3U6BA 3AKDA 3FE2A 4LC0A 3T06B 1YR6A 4BLTA 3U4QB 1ZINA 3W6PA 3T1QA 2J0UA 4C0JA 3TSWA 3U44A 5G3ZA 2IL1A 2DHRA 1YR7A 3AF1A 2R6DA 4F38A 2ZI3A 1E2HA 4MYHA 2ZRNA 3MWLA 4HLUA 4Q7MB 3X1ZA 1VG9B 1M8PA 3H4MA 4TWZA 4YMUA 4LBWA 1SXJA 5HZKA 3H86A 1F2TB 4AD8A 1KSHA 2CLSA 4O25A 2GJKA 2IXEA 2BIFA 4BFTA 2ZREA 2GF9A 3D6TB 1TU3A 3CF2A 2ZE5A 1NKTA 3P1JA 4Q9LA 1H8HA 4CEHA 5FUXA 1KI8A 4UNPA 2KE5A 1UADA 1OPXA 3T1VA 3W6OA 4A82A 2QM7A 4TSFD 4DLUA 4B43A 1HE1C 1R2QA 1UKEA 3TSZA 1XD2B 1KDPA 1F5NA 2J9RA 4LJ4A 1T5LA 1LVGA 1YR9A 4QHSA 3K0AA 2DFTA 1XTQA 2HF8A 4HEJA 3G0HA 4HB4A 4Z8XA 2H17A 5JWOA 2DWPA 4ACBA 1W0JD
chains in the Genus database with same CATH superfamily
3K0SA 2HT1A 5INTA 3KX2A 3QHAA 1W0CA 4MIKA 1LQ2A 2TYSB 2O8BA 3BSYA 3U4QA 4UUOA 1ZGBA 1KQ3A 2ZSEA 2F9LA 3M6VA 1LX6A 4KUHA 4UNQA 4V0OA 5D2CA 4EHNA 5C9ZA 3EFOB 4OJMX 4Z9YA 2O9JA 3NHLA 4UAGA 3R9KA 2RK3A 3ZDDA 4IG9A 4PBTA 4TXHA 3OUTA 1Z47A 1AZLA 1ACJA 3GA0A 1M0TA 3SICE 3VAYA 3W5IA 2C0CA 4TM7A 5BSFA 4N0EA 1V6CA 3AUYA 4PO1A 3IV6A 4G0ZA 4O4LB 3G1UA 1ZIOA 4FX5A 4F11A 3SPXA 4ZKDA 2Z8XA 6LDHA 2VP3A 5K3FA 2P2DA 2P9BA 4Y2RA 1DAFA 4TYYA 1A4RA 5J58A 3ZQJA 4GWLA 1N4AA 4PYRA 2XNDA 4EY6A 3GXOA 2ZRQA 3H2JA 3I83A 2JC3A 4RA6B 2H48A 3QI7A 4QUJA 1L5MA 1FYEA 1Q7TA 4QDXA 2FB9A 1GY8A 2EJWA 3DH0A 3RJZA 5A3RA 3O90A 1NLYA 1P2DA 1FYVA 2IP4A 2XE8A 3GRAA 3LXXA 2HD4A 1FP6A 5K3BA 1DHRA 2VNKA 3ZNNA 3FMFA 3MG9A 3EPHA 1G6HA 2EGHA 1IN1A 2PYZA 4P7KA 1C30B 2C5LA 3KB2A 2AX3A 2EFGA 5CMLA 4YBZA 5FUBA 3WK8A 3Q7EA 4FW9A 2Q3EA 4X95A 5JQWA 5JSUA 2VK1A 1DADA 1W2GA 1NUHA 2QW8A 2CL5A 2Q4EA 1GARA 2ZWOA 2YNMD 3M9XA 3QBEA 2N1BA 1IQ0A 3EPKA 1FFHA 4IG4A 2MOKA 3TYXA 1N92A 2M6LA 3T9EA 1UZLA 1O57A 3ZX4A 2D13A 2GZ1A 2C20A 4UHJA 4IPTA 3RC9A 3RVNA 4BQRA 5I8WA 5KTYA 1IBMB 1X9HA 3EFOA 2H1RA 5BYKA 3OZUA 3IAFA 5KYXB 1NBHA 2CVZA 4J0JA 4BCDA 2Q8PA 2II6A 3K3PA 1OZAA 3O8RA 3FYUB 1HKUA 2YC4C 2YN0A 3DWEX 4JASB 3JALB 4MPPA 2VHTA 3C3YA 3ZDAA 2H4FA 1TLLA 2O2IA 2B5OA 4DJFC 1JHYA 1W85A 5FTNA 4FC7A 1TEXA 3CNHA 1GILA 3LHDA 4PCLA 2ORIA 5EWMA 1O4WA 3N6XA 3P2KA 4NHOA 2HV8A 2DSNA 2PR7A 3B2EA 4XGRA 4Y9UA 2FNAA 3SQNA 1PJZA 3A11A 1FSPA 4Q9JA 4RA6A 4IDDA 4QJBA 4EGQA 1BWSA 4I50A 1G7RA 4JI0B 1SVKA 2VZLA 2QF7A 5CJ2A 4NAHA 1NL3A 5TDHA 3UUFA 3V32A 1T6BY 2CCJA 3RM3A 2G0TA 1YKGA 3H04A 2ZRHA 1POXA 1AMNA 1RJWA 3VYUB 5L7WA 2HPHA 2R8EA 3PDJA 4R7TA 8AT1A 2PZLA 3AXSA 4U7FA 5LYJF 2A4KA 1PSWA 1ZG3A 1BRMA 3KR9A 2EKQA 4BZZA 3CVJA 3HHPA 1L7MA 2RJOA 3VVBA 4G9EA 2CNWD 4ABYA 3IEXA 1MC1A 1NE7A 4U2FA 4OJNA 4U5XA 2GMWA 5KOIA 1ILEA 1NVAA 5ESDA 4K9KA 3VO9A 1X6VA 1Y37A 1U5BB 4GM0A 5JXWA 4MX8A 3T3IA 4BP3A 4EMTA 2IE8A 1ORWA 1JMVA 2IU4A 1RWQA 2IWHA 4E21A 3GK3A 3BHMA 1CJMA 5K3SA 5A5VA 2G25A 3I5UA 7ADHA 1RYFA 3SQMA 3T5CA 3OKFA 1AB6A 3NDJA 4FT2A 4F21A 5IXYA 4F0JA 4GXQA 1MB4A 4NEQA 3FYUA 1RQXA 4HDSA 5BN4A 1T5IA 3JALA 1SC1A 3VPGA 4KQCA 3COPA 3I9NA 3MIZA 1SBCA 3M81A 3VBEA 4RANA 3AJDA 4MPTA 3W77A 3WGNA 3ZLBA 2PUAA 3CISA 2JHGA 3ZWOA 3TSCA 5G1PA 1JJFA 2NG1A 1NZJA 1EWKA 4ENSA 5C5CA 4DV1B 1ZH2A 3IP5A 4TMZA 3UJHA 1T8SA 2XEDA 3TOXA 1EX7A 4BO3A 5KVCA 4Y6RA 3V8MA 1G0NA 5BYJA 2F3QA 2QY9A 3H4TA 5AK0A 1HMPA 3M6MD 3S8YA 5CVJA 4WFQA 4JN6B 2NO5A 2Q49A 2FEAA 1RNLA 2FMKA 1R9NA 1A2OA 4QBIA 4JJ7A 4WKCA 3V1TC 1VZ3A 2QDKA 4BQQA 4E4RA 1KTIA 1WMDA 1TVKB 3QFRA 3WLQA 4JYAB 1JQDA 4RTMA 1CQXA 3OTWA 2BF7A 2HEIA 1AF7A 3BF7A 3GLHB 5BOVA 1EFPB 1SVOA 1XJQA 4Q6WA 1S2MA 3KTAA 4JP3A 4X1OA 5D1HA 4MS3B 2X41A 3OZGA 3WQRA 4CF3A 1GPDG 1UODA 1U3UA 2QYTA 3DFMA 2HTEA 3N7AA 5HIMA 1I3NA 2A8YA 3HDHA 1UOOA 4KVZA 1U5BA 5CFRA 1UMCA 4XASA 3NGMA 3IAUA 1M1UA 2X0FA 4OJKA 2JH8A 2VPIA 4NJOA 1WDKA 5FFNA 1WVGA 1UIRA 2NYAA 1C0PA 1H2AS 2AE2A 2Z95A 3C1TA 1OJ7A 1ZJ4A 2EX4A 3IPAA 5CRIA 4HGZA 2FPXA 5K2MA 3M82A 1ZCBA 2JJ2A 4O6VA 4AROA 1O0BA 2D5LA 5F1PA 2R5WA 2GBFA 4EMSA 3AIMA 4KN5A 2Q2WA 4EF5A 3FJYA 1WNTA 3H1FA 5KDDA 1J9EA 4UE3S 1XR3A 1A5BB 4URYR 1N6HA 3FNHA 4BVBA 4DLPA 5KJCA 3VPXA 4KSYA 3A58B 3NHBA 5KWEA 1DC5A 1LCIA 2E1PA 3CR7A 1VI2A 4JLJA 4BNDB 4D8TA 3UT5B 5HE8A 2O0HA 2FZ5A 1P7VA 4RZHA 1R4AA 1GZ7A 1TQ4A 5E6UB 3E7WA 4BEBA 3QQPA 1MR3F 3GW8A 1WG8A 3X1MA 2OKGA 2Q0HA 3CW8X 3GVIA 4IIYA 1FP1D 3CR3C 3D1VA 1RU3A 1XROA 4R1QA 4Q7JB 3ZU5A 3R75A 1DC4A 2XVZA 1QTIA 4FBMA 2W2NA 2AEFA 1KVRA 3L7JA 2OOKA 2A5LA 3GLHA 4V2IA 1EFPA 4DL9A 4BKMA 3VDRA 1EYZA 4JBIA 1KO5A 3LPAA 1O03A 1PNOA 4KQMA 2ZT6A 3INNA 4EEXA 4PFKA 4K0KB 4MVJP 3P52A 1V3TA 2RI0A 1KGSA 2XH8A 2MT9A 1K3UB 2WJ6A 1FXSA 2N42A 1GZ4A 4H9GA 5DNWA 2VO1A 5FT9A 3ULKA 3S1SA 2HW8A 1ZVVA 1O95D 2G4LA 3SX2A 1Y1QA 5CXXA 4DYDA 1ZJ6A 4B46A 1DOHA 4ODIA 4B71A 4HSGA 4J16C 4RDXA 4RS4A 1TMGE 4MVJH 5BYBA 1UCFA 4FLMA 3WK6A 1N1DA 2AYYA 4D57A 4FHCA 4ECEA 2RSLA 1KYYA 2WSIA 1E94E 4LDRA 3CH5A 3QOYA 1RD4A 3B70A 2OPBA 1K5DA 2XKKA 2LCQA 1TNDA 4QJIA 5HNKA 3EPJA 2YUTA 2JEYA 1E0JA 1OAOA 4U1RA 1JPJA 1Y42X 3JARA 1WW8A 5AP9A 1QB7A 1BOFA 1XAGA 2H0AA 3LBNA 4JXJA 4BGEA 2P79A 4BNDA 1E7RA 3KPWA 2OZPA 3GNQA 1IQUA 3KSDO 3OH8A 2O2HA 4G8DA 4J1TC 4KH1A 5FWXB 3KLOA 4Y1GA 5FHRA 1ZH6A 3PUIA 1YBFA 2QUBA 3KSBC 2F8SA 3GWZA 3ADPA 3PA6A 3NBKA 3U7EB 5L53A 2AJDA 1QYIA 2GBLA 3H6HA 3OCJA 2X58A 2CLFB 1O6GA 1MOZA 3D81A 4WXRA 1E3TA 5EIBD 4TKMA 1RFLA 1H8ED 2ZI6A 2Y4NA 1PVOA 1MCZA 3S70A 1VE9A 1XCMA 3LC1O 5AMXA 5FBKA 1I3MA 4B3SB 3E27A 3GAAA 3K8YA 4NE7A 3NR2A 3OC6A 1UXIA 5F3RA 3PEVA 5ALSA 3W5BA 4ZYZA 1M2KA 2GRUA 1FY2A 4G41A 5DTJA 3VX4A 4ERXA 4QU5A 1GFIA 2CDRA 3GFSA 3EQ2A 3H13A 3O8OB 3L79A 3UMRA 5I47A 2HWYA 3TG2A 1KI4A 2X3FA 1FFAA 4LHVA 5HIAA 5I3CA 5JS1A 1R0ZA 4QTTB 2QN3A 3FN4A 3PVZA 1AMUA 4R1MA 4RZIA 4BO6A 2ZUEA 3RR2A 3EJ6A 4D8VA 4W99A 4AKSA 2OCXA 3DQQA 2QTLA 3H8VA 1I7PA 2QX4A 3UKOA 3VZSA 9LDTA 3FOEC 4AKGA 3FDZB 4K87A 2NTJA 2VCHA 3C7KA 4O63O 4UOQA 3ZV3A 1BS2A 3ZQ6A 4TROA 4F2HA 1QYXA 5J5VA 2ILTA 4XLTA 3TD2A 3JCZA 3OIVA 3T99A 1VCHA 3IUPA 4G1BA 2D54A 4FWBA 3IQIX 5EZ6B 3V1YA 4XVCA 4MQLA 4YJ3F 1P4AA 4RY9A 4MVCA 3AHCA 4GE0A 4NCJA 4DA0A 4JLUA 2GYYA 1YDGA 3AF5A 1GD1O 2PKWA 4JL8A 1OXSC 3L7AA 1ND6A 3SLRA 1VLMA 3TLEA 1Y80A 1RLUA 4XWKA 5AW3A 3RT1A 1GUFA 2BCJQ 2WFMA 1ZRHA 2OHIA 3CRQA 3QW2A 2XF8A 2REQB 2XYGA 4HBZA 4KQ6A 3UGTA 4YRSA 2K6GA 2G9UA 1NMSA 1Y63A 3GLFB 3LYAA 1FFYA 3HPRA 2NTYC 2AN1A 3ACBA 3N2GB 4ND1A 4NQRA 3P9KA 3ORRA 1JQLB 1RC1A 3WRVA 3RIXA 5U9CA 4XM2A 3T8YA 3WGGA 4I55F 4OMCA 5E4YA 5GJVC 4QTYA 1WBBA 2OV4A 2GEFA 2AQ8A 1G16A 1LDBA 2VH2A 1WCIB 2ATIA 2GHRA 3A26A 3O8OA 4K46A 4CF6A 4M55A 1XD9A 4HJRA 1IJEA 1DUVG 5JHGB 2IYTA 4KGVA 4WCFC 3KXKA 3I9OA 4RQAA 2BZSA 1UT6A 4UHHA 4AMVA 4B0PA 4DA7A 3DGFC 3MS7A 1FB5A 3CPEA 4DIBA 3RWOA 1Z4IA 5KKAA 2JIZA 3C15C 4BNXA 3UXEA 2P2CA 4AC9A 1M1ZA 2R1VB 1US8A 5JY6A 1YE8A 3D6MA 3DNFA 1C7JA 2GUGA 1RQGA 2R1ZA 3AUUA 3PPVA 5CYOA 1JV2B 2EWMA 1MNAA 3RBAA 5BSUA 3E1GA 1YAHA 3AQ4A 2BC9A 1I24A 2RAFA 4DJEC 3L43A 2ZRFA 2ZI4A 5AHRA 1K6JA 1G64A 1T4DA 2EZUA 3I04A 4FFOA 4X7BA 3WMWA 3PQ2A 4QSMA 4RORA 4CLXA 5AW0A 1IWOA 3ZWXA 3P2OA 1AJEA 1YRAA 4QNMA 3OTOB 3G5LA 3A0RB 3GCWA 1XNJA 3VO2A 1R8YA 4HN9A 3WG9A 1XTVA 1QG6A 1PK9A 3KK0A 3VR3A 2IBTA 3F9CA 5JJLA 3AMVA 2ZAYA 2VQFB 1VHDA 5T8KA 3JYHA 2DWUA 2QTWB 3ROTA 1U2EA 1IUNA 2FQQA 1KKUA 1Z0ZA 3OQVA 2V7PA 1GAJA 3BULA 4G01B 4MW5A 4OG2A 1TD9A 1QDLB 4OOEA 2EFDB 1N4DA 2AG8A 4AJIA 4IIVA 4BX8A 1Q6ZA 1WCIA 4HGNA 1C9EA 5AI6A 3JTEA 2PFSA 2EV9A 5HE9A 4GM1A 1GKIA 1T36B 2DM6A 1RAEA 4MULA 4F2PA 3CLTD 1W6RA 3F3KA 1TYBE 2ZJ7A 3C7TA 5B7NA 3FWNA 2DKNA 1Y9JA 2E5WA 2GEJA 3WMFA 3L4JA 1DTWA 4EY7A 2NO4A 1I4DD 2E89A 2NSDA 2Z2IA 2GJ8A 3CEPB 3G2PA 2Y68A 4YT4A 2Q62A 1W8DA 2I33A 1J0BA 2D7CA 3TQRA 1V8DA 1X2BA 4N65A 1Z82A 3BHJA 4NX2A 5DNAA 2QNRA 3GJSA 1NRJB 1K27A 2FLWA 3C3EA 5DTMA 3KP1A 5YASA 4LI0A 3NPAA 3QYPA 1MO6A 1KAHA 1NVKA 2CVPA 4PSVA 1PJ2A 2E6UX 4BVHA 3EQ7A 2ZB8A 5FHQA 2R7LA 5ESWA 3L07A 3OM8A 4UOZA 3EIHA 4HGYA 4B6OA 4F60A 2AW3A 3JTMA 4HGQA 4C22A 1L4LA 4YX9A 4QOFA 1UINA 3QMVA 1JR3E 2NXCA 1U90A 5IXSA 4KQIA 3U1TA 1ONNA 1HX7A 1E61A 1VGVA 4KDCA 1QPGA 1SUPA 3UJ3X 4WKNA 1KAMA 2XTNA 5DNEA 4LUCA 1K9SA 2GESA 5HZMA 2AHRA 3BFVA 1TZMA 4ZU1X 3WTCA 3SSMA 1ENOA 1OBVA 2GCOB 2PGXA 2YWHA 4GX1A 4MICA 4PSCA 1JN0A 4YWJA 1ACLA 1QP8A 3E7PA 2EWVA 2VUTA 1I2AA 3FKJA 1SUCA 4IV8A 2BGUA 3UEOA 3WZ2A 3UMJA 3H5TA 4AAYA 2XXBA 2VI5A 4UQPA 3U61B 1O6FA 4JHXA 2FN7A 5AJZA 2ZYGA 5L3QA 3UOWA 2C0PA 5AUNB 1PR5A 4LF6B 3GNLA 1DG9A 2Q5CA 1SBYA 3PC2A 2IBMA 2BDUA 4KFSA 1BEEA 4NBTA 3M70A 4RELA 3GFQA 1SQGA 3NKFA 8MHTA 1ETUA 3LWZA 4HB0A 4EPTA 1WB4A 1NR5A 1TT5B 1T8RA 3ADOA 3KQTA 3KV3O 1M66A 2P4QA 2FZEA 4J76A 4XYMA 4Q3OA 4INZA 4D8YA 5HUQA 4KEAA 3GJ6A 2AD5A 4G0XA 3M8KA 4HQKA 2PS0A 4UC0A 1CQJB 1Y6ZA 1P1CA 3HB1A 1N9ZA 4ZEOA 1JXMA 1LSUA 1VL8A 4IHJF 1RYHA 4RQUA 1XK7A 5JSFA 2FUEA 4Y2JA 5ALOA 1P9LA 4DJJA 1UQTA 3SCZA 3GI1A 1KJYA 4Q21A 3DKRA 2VF4X 4TZKA 3OZAA 1OH5A 3LAWA 2QMHA 4GQAA 9GPBA 4ZAWA 1U0BB 2AQIA 2YZ7A 2E0IA 4FUTA 3QNWA 4MWGA 4OQYA 4RF3A 5GM2A 1FMTA 3E8XA 4GOKA 4A0GA 4CIVA 4CEJA 5A4IS 5C7LO 1F7VA 5IVHA 3EIXA 1IJFA 1OX4A 4Y2PA 5HQJA 4HB2A 4GT1A 2R9VA 1XEAA 1WXDA 2XTAA 4TRNA 1RPAA 1PNRA 1NR7A 3OUZA 1OH6A 2ORVA 5TPZA 4GICA 2Z57A 4ZQIA 1F0NA 3UUWA 1X8XA 3QUSA 4LMAA 1GPH1 4DZZA 1M2EA 1RC0A 3CX6A 4C4AA 3L4KA 1MIOA 1QJCA 2ZTUA 3LW7A 1RSZA 3O4GA 4HRYA 4TQAA 3AB8A 3NT2A 3NOXA 3PV0A 1JDTA 3R0ZA 4IDFA 3MUEA 2OPHA 4IYRA 2WLTA 4KMSA 3SQOA 3WLJA 5CB4F 3W6UA 1R4MB 3QUTA 5L4SA 3HJAA 1IN6A 1QGED 4IVPA 2CB0A 4M89A 5LBTA 4PGHA 2VP5A 3C3KA 1T9BA 4N7BA 5EXPA 1BEZA 1E2BA 3UW1A 4RCZA 3HXQA 1MRSA 1BH6A 2I22A 3ST7A 4JVMA 1WX1A 3JQFC 3FROA 2XGJA 1CQJA 3KYCB 5K6AC 5KEIA 4HLDA 2FZVA 2LR0A 1V48A 2RONA 3G0GA 4IH1A 3IRVA 1LW7A 3MJRA 4O02B 4N7RA 4PVDA 3EXHC 4OO3A 2B8JA 1PN3A 1RHUA 2BUCA 1ORDA 4FTWA 3THRA 3JYOA 2WTUA 1PLLA 2JKVA 3E9ZA 2HWXA 5AFSA 3N2EA 3HDVA 1L4GA 4QYMA 4C7MA 4FD2A 2ZE7A 1EWQA 2FXIA 4RKYA 2V7EA 2VSXA 2PXHA 1ZJYA 1RYYA 1C4KA 4YV1A 3SEZA 1KP3A 2OWDA 1MDFA 4Z51A 1Y81A 2CUNA 4TYPA 2Y1GA 3GELA 3HKEB 1KZ4A 1Q1GA 4DEXA 4KXQA 3ZDFA 1KFEB 1EP3B 1N2SA 2CW5A 1M2JA 4RV9A 2VL7A 5KNCA 4LXXA 3W0LB 2H63A 1H22A 3DCIA 3MILA 4RMHA 1THMA 4QREA 4DCTA 4YUYA 1BH2A 4M8LA 3TOSA 1I4LD 2J0EA 4B17A 1GGHA 4M8KA 2BHSA 2Y9PB 3H2HA 4NG4A 5BW6B 2O2YA 5JVDF 4ZYYA 3IYLW 5B1YA 3P20A 4R83A 5HFNA 2GRAA 3M1IA 1OYYA 1R4MA 2IUEA 1VYHA 2J5XA 1ZI6A 4TLCA 3DMPA 4I81A 3DEZA 4WADA 5IC4A 3C87A 3CX4A 3EASA 4KO2S 3DL7A 1XHEA 1EP1B 3DV0A 4WOCA 2XE6A 2FQYA 4MEBA 4FN5A 4XQCA 2GEUA 2OY0A 3I2IA 3SHFA 4I4TF 4D9KA 1RRPA 4E3ZA 1CRQA 1IHOA 2JAHA 3JQCA 3IDAA 4Q6BA 2A7XA 1A3CA 1V16B 4S0ZA 2HLDD 2IKSA 4Q39A 4NV1A 4CTMA 1LBIA 1N5JA 3F0TA 1RS0A 3O6VA 4G09A 4L57A 5DOVA 3WRYA 1AD2A 1T6NA 2X9GA 5AHWA 4DIUA 1WPGA 1BMDA 1CUBA 1PG5A 4R1OA 3V97A 5FWYB 3SZGA 2VOJA 3H2KA 2YNMC 1QWOA 3B6EA 4ISCA 2FP3A 3BEDA 4JOCA 5EXTA 1CNEA 3I30X 4HDQB 3OEED 4D79A 3T5AA 3B78A 3DHNA 3HKEA 3EOZA 4P7JA 5FWNA 1CUGA 1QG4A 3STYA 3DP7A 4HH1A 4BB0A 3GDWA 4REOA 1GPYA 1J1ZA 1Q0RA 2YKGA 1NVTA 5KOHA 5FPYA 1LTQA 2WSSD 1UC4B 2G0AA 4D4IA 1CKEA 1QTRA 1A5ZA 1E4YA 2C8LA 2MSKA 3GPCA 4J0CA 1Q3TA 3LLCA 1VMKA 4RF2A 3TLZA 2C2HA 2YXPX 1UDAA 3SR0A 2ZIZA 3QLVA 4UAVA 1L5FA 2FPOA 1R5BA 2QYHA 2WUEA 3BTOA 3GT3A 3SYMA 4K28A 1KZ7B 2UZIR 5AW5A 5AKIA 4BFZA 3A3PA 2C7RA 1LFDB 3A1DA 1DBSA 1CF2O 2B6HA 5B4UA 2VHWA 2IYSA 4YT2A 3K0EA 1UBMS 3I2FA 2H5JA 1P0FA 3OM9A 5K8LA 2HUNA 3ZHUA 5LKRA 4O4LF 1XXLA 1Y1SA 1U8FO 4EG7A 1N8SA 1GU7A 3RIMA 3RS7A 3C98A 1EHIA 3WYNA 2OM6A 3KUUA 1R5NA 3GG9A 2C2YA 1MOPA 1XKLA 2I7CA 2Y71A 3KM0A 4J6FA 4JI6B 4BE7B 4LGVA 1ZOOA 5GTDA 3F73A 4UBOA 1AN9A 1V16A 3R4CA 3TWOA 4OHPA 2OILA 3VI3B 4HLNA 4IKEA 2HRCA 1P4SA 1OBCA 2J48A 2N0SA 2VWGA 3GRYA 3ILSA 4KLRA 3VC7A 4CHTA 2FEOA 5B2ZA 1ISMA 3S99A 2PCLA 5IX8A 4OXXA 4HO1X 3WBFA 1F2UB 1NXQA 2GK6A 2X7HA 4LOAA 1QQ7A 3TI7A 1PNQA 4AP9A 2IYYA 3QTTA 5FWYA 3DTVD 1JDBB 3OZ7A 3TXAA 3WMGA 5BUZA 3GUYA 4TWBA 3BH7A 3QKUA 3E3LA 1ZN2A 3N6VA 4X62B 2VJCA 3S0JA 1S2NA 3AB3A 5H68A 1M6NA 2OUKA 4LRWA 4R4JA 5AUOB 2P8JA 4TV9B 4C0KA 3ZVMA 4DLSA 2ACEA 3TRKA 1B6SA 2F1KA 4ND8B 4JJ8A 3IIMA 4HEA6 5I7EA 1XZDA 2DPYA 2ZUCA 3JV7A 1PS0A 3HXLA 1UKCA 3OE5A 4IV5A 1L5WA 3UG7A 2KLHA 4X64B 2OO7A 4B40A 5KJ6A 4BLRA 4YRGA 4Y0VA 5LU8A 3BDAA 5JWHA 3TTXA 2ZSDA 5KYWB 1JKMA 3NPMA 1GG5A 2IW3A 4J4BA 3ZHZA 4N40A 1XCJA 3O47A 4LYEA 1M2OA 2SKEA 2NO9A 5E9AA 4G0YA 2H5IA 3TAHA 2GF0A 1S3GA 1P73A 2DUWA 2QKYA 2QUIA 3DXYA 3MMPA 4FDLA 3T9AA 3FTPA 2I55A 3HA7A 5FAKA 1JHRA 1M83A 1X7XB 2ZBDA 3D3EA 4J0KA 4LYHA 1ZPDA 1BMQA 1TYAE 3HFSA 5KTPA 1FYDA 3NM6B 3FCXA 1JMYA 1OC4A 1P5ZB 1DELA 2YWGA 2WU3A 4EHFA 3NHRA 2VTBB 4PFJA 4P4LA 1Y8QB 4I5GA 3U3RA 4R8LA 3KALA 5LDDC 1P62B 4HAXA 4OI2A 2WIGA 4YB8A 3W78A 4CEIA 2ATVA 3QPBA 1KO4A 2V3WA 3HDJA 1T9GR 3HXKA 4MRMB 3T5TA 2I4IA 1SG0A 3C1OA 4OHBA 2IQ5A 2YJZA 4ZOEA 4ALJA 4PU0A 2G36A 1V5GA 1FJGB 5A9RA 2B35A 4ER7A 1Q74A 2EDCA 1M2HA 2PX8A 3L7LA 1H8HD 1UMKA 4X20A 1NJ8A 2DBYA 4FK8A 3ZUPA 2X6TA 4JR1A 4ZZ1A 3HQ4O 5JCJD 2H0RA 3RD5A 3KYJB 4FNOA 5KHOC 1RTTA 4TV9A 5DK6A 4B5KA 4WLFA 3UK2A 5CUQA 3I6QA 2P0AA 3LNTA 3PCTA 2ZROA 3OZSA 5BSRA 2X0NA 5EJGA 5DEIA 4UCWA 1MABB 2E48A 1P5RA 2GM3A 2R62A 1UR5A 2ZRIA 2H7CA 3BL8A 3R5KA 2ZBPA 1PWEA 3JY6A 3FJ1A 3GUVA 4HNGA 5EJFA 4TRMA 5BN3B 2B4YA 5ALTA 4TTJA 2JGFA 3HYRA 1COWA 1V0JA 1KS9A 2B8NA 2NV6A 4JIMA 4K7JA 3VR1A 4JIGA 3DE6X 4X8LA 4XQGA 4F8YA 5K2OA 1B93A 4LYGA 1ZO8A 2P6MA 4BFXA 4D3ZA 1S9DA 4Q15A 3ZE7A 1N7GA 2JARA 1RWWA 4ICIA 3VDXA 3NWEA 2ZYAA 1H65A 2OAP1 5AHOA 5TT1A 1ULSA 3A9SA 5CT9A 4C6TB 3GGCA 1Y1TA 2HBRA 2XUPA 3NDBB 2A84A 3R8XA 4MRMA 1J2TA 2GZRA 1E3SA 4RKRA 3DE5X 2WJGA 3R20A 5DSXA 3N2IA 4MHTA 4AKHA 4MOWA 4IFTA 2IU0A 3EDCA 3KOWA 4GLBA 2AZXA 2W0MA 2IKQA 3Q3VA 4H1UA 4LV5B 2CXNA 1O95C 1XZMA 2Z83A 3DZHA 2GXAA 1W34A 4ES6A 2QVGA 3EDYA 3B6MA 5CLQA 2ONKA 4RVGA 1FFWA 4N5IX 4QLAA 4TL7A 3E5RA 3R7WA 4Q05A 1AM4D 8ABPA 4EJ6A 4G4IA 5K3OA 2PIDA 5TGZA 1GDHA 2YJGA 4HR7A 1H05A 4YLYA 1DXYA 4TN1A 1MABA 4A2CA 2QROA 5K6TA 3JAMA 2C3OA 3CRRA 4B2YA 5KVVA 4EZBA 1L7OA 1QK3A 3LDFA 3ELYA 3W9YA 2IPLA 2OO5C 3R6GA 4URUR 3JVUA 3PRJA 5F77A 4UU8A 2JF0A 2RC6A 3J81k 4G1UC 2I4RA 1S1CA 1LWNA 4NNPA 4RTNA 3AJAA 4A23A 3OKCA 2WZDA 3PNVA 4I1PA 2AD1A 2QLFA 4UVIA 5KTMA 2PUBA 4KR6A 5KQLA 2ZJ3A 4HQLA 3WRXC 1Z13A 1I6KA 1XO1A 1GPLA 1TGVA 3I73A 3IE0A 1ZIPA 4RVDA 1RKXA 5I51A 4W5QA 3LYLA 1SKYB 1W88A 2CEKA 4MLZA 4JFAA 1PJAA 3O73A 4C6TA 2R8XA 2CXUA 4MYTA 2X15A 3GZ4A 5EMKA 4F4CA 5K8IA 2HL6A 2XYRA 1TLFA 3FUTA 5KTSA 1Q3KA 2EHJA 5CAEA 2IZOA 1ZRSA 3PD0A 3ELUA 2CFOA 2LXNA 5ECGC 1VXRA 5CEEA 4DM7A 1WUKS 4PZEA 1Z28A 2C82A 3FVWA 1HRKA 4LPKA 4W9NA 4XSVA 4UOEA 2F8LA 3DCNA 4MW9A 2J08A 5CG2A 4D0GA 4CIAA 2QE7D 2V9ZA 5A3QA 1TMOA 3K1AB 3WRWA 1FBNA 2CXOA 3E6AA 3T35A 4C6HA 7ABPA 3AI3A 3IAM6 1BO6A 4P0PB 3I6ZA 1EP2B 4IW3B 1L4YA 1VYUA 1ZGGA 3GP3A 3JQ7B 1NBIA 1AQNA 4DRXA 2CE7A 1V4BA 3W4JA 4ARZA 1CUIA 4AVYA 4DDVA 3BB3A 1R0RE 3RUDA 3W79A 5AJUA 4NKRA 5LBIA 2ATEA 2JRCA 2PUJA 2VUIB 2Q0QA 3HEBA 4XTRA 4UW9A 3UNXA 3WOHA 1S2DA 2GILA 2RG7A 2I5PO 4DN6A 1VSVA 2RHHA 1RAAA 3RS8A 4OK3A 5HIKA 1SZCA 4UEOA 5KU7A 4L6CA 3E9RA 1MA0A 4I66A 1DKRA 1VFNA 3EHEA 2OENG 1FVHA 4J75A 3UB3A 4JP8A 2UVPB 4AJKA 1ISSA 1E69A 1O96A 3BIXA 1KK2A 3KEOA 1UBSB 4AX8A 1M2FA 1SHLA 4UFNA 3H83A 1NWHA 1D6MA 2YJ4A 4UZSA 5ALFA 3JAKB 4FDAA 1JAHA 4M9ZA 3V7NA 1D4AA 3U7JA 3ZNQA 3OX2A 1EFRD 5B7PA 1BWQA 1HF3A 1C41A 2WA2A 3WXBA 1HE5A 5I7FA 4JT4A 2KJQA 3HY6A 5JH7B 1A82A 2HMWA 2AFVA 3CUUA 3UK0A 1X7DA 1FSSA 1UKVY 3W7BA 1YB6A 3NHAA 2O0JA 3GMTA 1G63A 4HEA1 4KX5A 4P7FA 1TQ8A 4F45A 1NNEA 1YTUA 3I5XA 1U2DC 3GFFA 2EHDA 2V6IA 1GDDA 3DE3X 3SEQA 5JSYA 1UBUS 4BTEA 4ESEA 1ZX1A 2ERYA 4ENUA 2HQOA 3K1AA 2HGZA 5ALWA 4EHAA 3BBPA 2M6RA 1FX1A 2CXHA 2ZTVA 4FIDA 4RTKA 3R3XA 2I6UA 3EZ6A 3G9XA 1IZ8A 3M5CA 1UZAA 3ZIAD 4WFIA 4PWYA 5K3AA 1SXGA 2FEXA 2O6HA 3NUQA 3L8CA 3QJGA 4IGKA 2P65A 1EAYA 5AIAA 5D6NA 3IDQA 4MR7A 4QVIA 1BMFD 1UDWA 1OYWA 4RHUA 1FDIA 1WXHA 2CFTA 3IKMB 2QTAA 2UYQA 5EE9A 4BN5A 1SD2A 4JI5B 3KWLA 3I9JA 4K9PA 3TIXB 3HYNA 4HRAA 1XAIA 1XZAA 1FQOA 2UVPA 3E0XA 5A4DA 1RI3A 1N6IA 4S1WA 4U9HS 4BASA 5A2GA 5LJLA 2UZAA 4GOXA 2PQ2A 3FVQA 2ZSBA 4MLDA 2J45A 4Y0NA 2FDCA 1EK1A 3JAKA 1RRVA 2XA1A 2XUAA 3KWFA 3NMUF 3CRW1 3AESB 3GP5A 2E4XA 3KOUA 4GXRA 4IDCA 2I1QA 3P96A 4PE5B 3LC0A 3OOEA 3L6CA 3RABA 3WIOA 5JAZA 1HNZB 4S12A 5LIPA 2XYPA 4C0AC 5F51A 4AU1A 5LZ7A 5BR8B 3C3PA 1T91A 2Q4DA 1H4VB 3CZRA 3R5TA 3TIIA 1V4VA 2WAXA 3K09C 4L85A 4Y1RB 4BUCA 4BGDA 4ZAXA 4YMHA 4ZVSA 4Q37A 4Q02A 3ZBUA 1HOXA 3A6EA 3RTDA 4EA8A 3IOEA 5EHIA 5GONB 1UIMA 5IVKA 2IXAA 1NQXA 4DCMA 2AF4C 3LL4A 1J49A 3CLTC 2QHXA 1YBVA 3F4BA 3UJ7A 3IOBA 3ZEAA 1JQKA 3NJRA 2XGOA 4Q9HA 1BOOA 1MEEA 4IDPA 4Q0MA 2FW9A 4LOLA 3FGOA 1WCXA 1BJKA 1NUAA 1SKQA 4RAOA 1QV6A 1KFKB 1AQ6A 1Z6TA 2PX4A 1RAHA 3QX7A 4JCCA 4KI7A 4DDHA 4A0RA 4B4UA 5K03A 1XRQA 3CONA 4QQ8A 4NZOA 3KZMA 1T2DA 1KPIA 3C97A 3PNPA 2IUTA 2QN1A 2YN2A 5SYNA 4AWAA 2G06A 1D1SA 4COOA 2OESA 5AI9A 2GETA 3E3NA 4C4PA 1II9A 5FTMA 3V8PA 3E48A 3L0CA 1ATIA 3MAJA 1VMAA 3PC6A 3DW3X 3S2GA 3PVSA 4E11A 1RM4A 1TZ2A 2OE2A 4TYQA 4RFVA 5KYUB 3W6NA 2P2GA 1QORA 2FX5A 3C8HA 4FCVA 2PK3A 3LS2A 2IP2A 4JEUA 4FQ8A 3Q7RA 3NVAA 5I9LA 2Y6VA 2EGUA 1MAVA 1PF7E 1QK4A 2XKJE 3D0RA 2QMYA 4UDOA 4RLQA 3AESA 1Y3BE 1NI5A 1LPBB 2BD0A 1X8KA 3JQBA 3KSRA 3NGXA 3PC8A 2C8VA 3GAMA 3R3SA 5B58T 5HWSA 3JWPA 2Q8NA 3QG1A 3EZXA 4F7DA 4AJHA 3IA7A 4JEMA 4LQDA 2ZPTX 1WS6A 3DNMA 4A0QA 4Y1RA 2PRYA 4EA7A 5HTKA 2J32A 2OOSA 1AUPA 4GR4A 3DCYA 4II7A 3M3DA 2FWJA 4ZD6A 2ZB7A 5FP0A 1A50B 3UAWA 3ILYA 5TQVA 3RUHA 3Q2KA 3WKAA 2H7YA 3DNPA 1DIRA 2HMYB 4V0ME 2FAXA 2IT1A 5TQJA 3E9QA 1KRWA 2BFDB 3K0CC 3REGA 1DRWA 3I4LA 4JZYA 1XA0A 1DXQA 4D9BA 4ZIRA 3GJ7A 1S3SA 2W8BB 2VYNA 3SXJA 4QTUB 3CBGA 4RJTA 4E14A 4P54A 4FZRA 1E4VA 3U60B 4TV8A 3AF3A 1XX6A 3HUDA 3OPMA 4KQXA 5A4KA 2V4ZA 1G0OA 4O4JB 2ID8A 1WXWA 1R10A 5FUVA 1Q7GA 4PZZA 1VPDA 4RJLA 1IRXA 1O77A 1FMFA 3DHVA 3EQ9A 3HVHA 3WAKA 3CEMA 1V7QA 2GD2A 2L19A 4G8BA 2NXWA 2H1VA 3PQDA 2LRHA 2QU7A 2QTZA 2XB9A 4KGZA 3X1DA 3B9QA 2R48A 4Z4GA 1D4OA 3GRCA 3U4IA 4PW0A 5A0FA 2ZCJA 2K5UA 3C6KA 5CTAA 3AVQA 1NQOA 3QBDA 3QOWA 1KDYA 5JY1A 4B81A 3I92A 3ZHXA 3KETA 3IAM1 5H4GA 1OLOA 2GF2A 1E66A 1T2UA 1U0LA 1V39A 4G0VA 3FTFA 4FONA 1JG1A 3ZCTA 2H07A 1ML4A 4HX5A 4HNVA 1ODKA 2P6UA 3CT4A 3P27A 3STWA 1JTFA 4KQGA 3FCYA 4ZC1A 2F3UA 3MF4A 4J1SA 5C8YA 2X9NA 3M9WA 5BR4A 3LH5A 4CDMA 4DC9A 4US1R 1EVLA 3LW8A 4RK1A 2BFDA 5LSAA 1P0MA 3OOSA 4LTMA 4P33A 1J9GA 2HHHB 1V43A 1K8ZB 2FOIA 2ZAGA 5EJ8A 2HAEA 2PZKA 2BGMA 2Y76A 2BOVA 2FSGA 3WB0A 4FEGA 1ANKA 2TECE 3MCTA 4P1ZA 5E3JA 5EUCA 1O5TA 3G0CA 3NO4A 3PCXA 4GZ3A 4IXMA 5T67A 1NBOA 1ZD3A 1BIFA 4LNAA 4X60A 1TPYA 3G88A 4O0LA 3O1HB 4N0QA 3ZCUA 1CEEA 1TD1A 3L93A 2XQFA 3UWDA 2O3UA 3E2PA 2D1QA 2J46A 3QVVA 4CMBA 3GYBA 2AK3A 1YUBA 3VGJA 1SM4A 3ZXUB 2P9YA 3G23A 4N4AA 2L42A 2VNAA 5K8JB 3GPBA