1ESCA

The molecular mechanism of enantiorecognition by esterases
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
302
structure length
302
Chain Sequence
DPVPTVFFGDSYTANFGIAPVTNQDSERGWCFQAKENYPAVATRSLADKGITLDVQADVSCGGALIHHFWEKQELPFGAGELPPQQDALKQDTQLTVGSLGGNTLGFNRILKQCSDELRKPSLLPGDPVDGDEPAAKCGEFFGTGDGKQWLDDQFERVGAELEELLDRIGYFAPDAKRVLVGYPRLVPEDTTKCLTAAPGQTQLPFADIPQDALPVLDQIQKRLNDAMKKAAADGGADFVDLYAGTGANTACDGADRGIGGLLEDSQLELLGTKIPWYAHPNDKGRDIQAKQVADKIEEILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (serine esterase)
molecule keywords ESTERASE
publication title A novel variant of the catalytic triad in the Streptomyces scabies esterase.
pubmed doi rcsb
total genus 104
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 1994-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1escA00
4PPYA 3C1UA 1BWRA 4RW0A 1DEOA 3PT5A 4K7JA 2HSJA 2O14A 4JHLA 3KVNA 1YZFA 2WAOA 3BZWA 4Q9AA 5A4AA 2Q0QA 5HOEA 4JJ6A 4RSHA 5B5SA 3DC7A 2WABA 1K7CA 5CD9A 4HYQA 5JD3A 1VYHA 1PP4A 4JKOA 3DT6A 3HP4A 4JGGA 2Q0SA 5BN1A 1ES9A 4HF7A 3SLRA 4OAPA 1IVNA 1JRLA 1U8UA 3DT9A 3SKVA 4XVHA 1V2GA 3RJTA 4S1PA 3MILA 4DEVA 1VJGA 2APJA 4LHSA 3U37A 3DT8A 1ESEA 1FXWF 1BWQA 4NRDA 2W9XA 4TX1A 4H08A 1WABA 4K40A 4Q7QA 4K3UA 3DCIA 3W7VA 1ESCA 4IYJA 1ESDA 2VPTA 1DEXA 4OAOA 4I8IA 4K9SA 1J00A 4JJ4A 1FXWA 4M8KA 1BWPA 1ZMBA 2WAAA 3P94A 1Z8HA
chains in the Genus database with same CATH superfamily
2QMHA 4MIEA 3V8QA 3ZLTA 3JV7A 1CZHA 2B25A 1E94E 2PRYA 3HABA 3L7BA 2GKGA 3HUTA 2XUHA 3W2HA 3CVJA 3PR2B 1YE5A 3OEHA 2FLKA 3CPJB 3WB0A 4ZTUB 2FZ5A 4ARZB 4IHKA 2FU5C 3QPCA 2ZBGA 3F6EX 5IFKA 5DTJA 3FPJA 3A3KA 3JQ7A 4R1UA 4TUYB 2DFDA 4Q3CA 1RI4A 1NWCA 1Q1ZA 4QU5A 1ZNQO 2J3JA 2XMRA 5ALNA 5DSXA 1PVVA 3WMRA 3TH5A 2W22A 1Z9BA 3NBXX 1L0BA 3GLIE 1NI4A 3DZJA 3MWEA 3GJ0A 4FXPA 1N6OA 4JHLA 5KUTA 4JQSA 3FHCB 3FTQA 5DNUA 4H7FA 3NRJA 4ZCIA 2QTVA 4KE6A 4OXQA 4PAWA 3TK1A 3VPDA 4BU1A 2QDXA 4C4XA 1Y1TA 1YR3A 2P3SA 3LCVB 4AIIA 4ZDIA 3L46A 4U5XA 2IBTA 2WHXA 2INGX 2WIAA 3RAPR 1Z56C 5ARCA 2I4OA 1UBSB 2Z1DA 5LOVB 3M6XA 4B3DA 2A7XA 1S02A 3CB4A 1DFHA 2XGMA 1EXVA 2QM3A 1XRSB 2OZEA 3PU6A 1HRKA 2FUG1 5H68A 4JGGA 3L43A 4LWZA 3ELWA 2Q8NA 2EJUA 4TMZA 5JQGB 1WXHA 2BUAA 4ARBA 3NMUF 5DM1A 1WA5A 3SLRA 4EIWA 3BD8A 4IX9A 4TTTS 4DVJA 4XFDA 1HTWA 1IM5A 1NLUA 2OXRA 1Q0SA 4GMDA 4PR3A 2VJBA 5TJHA 4A2CA 4E6EA 1USIA 2FSGA 1XZQA 3V46A 2PXXA 2AJDA 5EJ5A 3ZWVA 1P3Y1 3OJWA 1OE0A 3PEWA 2YWXA 4XVHA 4E3ZA 1IEVA 4RS4A 2H63A 2JFQA 4A0RA 4EHDA 5B3KA 2OAEA 3F98A 3BWCA 1CF2O 1H5UA 3PWKA 4D57A 1J70A 1AM4D 3OCXA 4MVJF 4MYHA 3LPMA 3ICQB 3KWFA 1X0XA 5K6AC 5PGMA 3FNFA 5L6MB 1Z0FA 1LBIA 4MQMA 1CUFA 1I4LD 4BRSA 2O1WA 3KXKA 4KWIA 1S2IA 1T1IA 1ZNXA 2BFDA 4MLZA 3ORFA 3PVCA 3CF4G 4ZVNA 1ZM7A 2WT4A 1A5BB 4ZT2A 4XI9A 1VQ1A 1WKVA 2ZYDA 2VQEB 3EY4A 1W85A 2FQQA 2XF2A 3BXPA 5JG7A 5FTKA 1LRLA 3CY6A 2QT9A 3JYHA 4XTRA 3IXMA 2QR3A 3LIPA 1NP3A 3I1YA 3PENA 3FH0A 5A9RA 4OSEA 1OPRA 3NO4A 1H1LB 4QGAA 1JBEA 1ZG3A 3GLQA 4J7XA 1KOGA 3LVFO 2A1UA 3RYIA 2B8JA 3VOTA 1XZPA 1YQUA 1DBIA 1E61A 1K27A 1W2GA 3GJ8A 4KJXA 4OHUA 3UK7A 3WLKX 3CWZA 4DMGA 2OHFA 4PXYA 1Z5NA 1J8FA 3OPYA 3OMWA 2JLSA 2OOKA 1ST3A 1TCUA 3D2CA 1QDEA 3RYCB 2QX7A 1RKBA 4Q3OA 1XA3A 1YRWA 1Q11A 3H97A 4L7QA 4UAJA 3MCZA 5BT9A 4XKJA 3V4LA 4ZHSA 3EG5A 3HA2A 2FF7A 1II0A 2IL1A 2YXPX 4IHJF 4KIGA 3QUBA 4XWOA 1PJBA 3PTAA 4HNAB 2CBZA 4HO1X 1A4XA 2D1QA 3IVXA 1Z37A 1SC9A 2V3CC 1DJQA 1E98A 2VHJA 2GJ8A 3Q7RA 3IAFA 3EX7C 1HK7A 5BV0A 2C7QA 1IIBA 1Y7HA 5CX1A 3H11A 3UJ7A 1EFTA 5IC4A 3PLAE 3DHNA 1JW9B 5K3DA 3F47A 3R5TA 4JOCA 4BL5A 1Y8RB 3OURA 4DR4B 1NT4A 2GZRA 1U8TA 2Z8XA 4E4YA 3DTVA 4KRXA 5I7OA 4N1AA 5DYIA 2IEYA 2JRCA 5D51S 2IUYA 2PKQO 3Q6NA 3AHEA 4NQZA 5HCUA 5KNBH 4LISA 1W5EA 1A9TA 3PRHA 2JIZA 5EGNA 2PFGA 3TN7A 4PHTA 1JWBB 1NV8A 3L7LA 5AO9A 2V5UA 1EJ0A 4KFSA 4RTMA 1T5IA 3FYUC 2WTNA 1UMCB 5C1OA 2VOJA 2EX1A 4ZYUA 3FETA 1E3QA 3O31A 2PHZA 3DEAA 1U0FA 3H0EA 1A82A 3I6BA 1SXJA 5C5CA 4BLVA 4EG6A 4O29A 1DBRA 5FL7D 3T4XA 1FP7A 1B3RA 3DBRB 1DDOA 5ULLA 1KNXA 1P5HA 4NABA 4TKMA 1C14A 2AQKA 2RGBA 3IEKA 1BW9B 1QDLB 1QCZA 2IXTA 2DBZA 1ZUIA 2ZRNA 1JKMA 1KEZA 2YRWA 3QYPA 4XJXA 1T15A 1Z2PX 2CLSA 2DHQA 4R8SA 4J4BA 4JSRA 4RO0A 3OX1A 4MW5A 4LQDA 3BG5A 1RWKA 1Y4AE 1CDZA 5EJFA 4MS4A 4X1OA 2H1WA 4GDMA 3HKDA 3ZUPA 2G67A 4DDKA 3HNOA 5EXTA 5FKJA 2Z8YM 2I33A 3EVGA 3MG9A 3LC1O 16PKA 2ANCA 3KAQA 1OBVA 2FR8C 3A9TA 1ND6A 3BCRA 3JRWA 1L7OA 3ZGLA 2YCBA 3MTBA 4RLFA 1PJLA 1DC5A 3PA8A 3QJGA 1A77A 2H2WA 3NC4A 1K5DA 1NP6A 4XE5A 1JQBA 1EINA 2FZCA 5FUWA 3UFBA 4WFQA 1NSTA 2ZQYA 2CMHA 2WC1A 1Q0UA 2IYXA 1H2RS 1LW7A 2H3HA 2ZSIA 4BO3A 2AUNA 4L5BA 3ZDZB 3OQOA 1F0KA 5F5NA 5KZMB 1ZNYA 3GOHA 4CFSA 1GGEA 1GZSA 1I01A 3R41A 5K4HA 1CJKC 2HEGA 1FNSA 4ZIRB 1CS0A 3BRWA 1ESDA 4K46A 2GTHA 4Q39A 4Q82A 5B1DA 1AGXA 4ZV4A 1O97D 3O75A 4DRXB 3IUYA 2XUAA 4UDXX 4CR8A 3GNTA 4BMVA 4X8LA 4KQCA 3CONA 4R1NA 2G1JA 1WHSB 2QTWB 3N2EA 5KSOA 4I50B 2R8BA 4NX2A 5KU7A 2VFAA 4QXPA 4ZI2A 1QBGA 3JW8A 1A98A 2GPNA 4QLAA 4JGIA 4PFSA 1WP4A 4GI1A 4CM7A 1U4OA 2O8BA 3DD1A 3I8SA 4Y2TA 2QD3A 7GPBA 5JS1A 5AXBA 2XOKD 2WFMA 4DXHA 1JKXA 3PR1A 1QYRA 4EKGA 1IY0A 4X20B 3M9WA 1PGOA 4AURA 5ADUS 1KRWA 2VQDA 2J30A 2WIBA 3TLBA 1LD3A 2AFHE 2ZJ5A 3LQRA 2VJCA 1MAHA 4DSZA 4DWVA 1JEYB 4AC9A 1G7CA 1RWVA 1OTXA 5FNVA 3TJZA 4NG5A 4RHUA 2UXCB 5CB4F 4N4AA 2FWMX 3CPHA 4LGMA 1WUHS 3R0QA 3IBSA 1SC6A 3OQIA 4O0LA 2MSNA 2O3JA 3QUAA 1JR4A 1P29A 4HUJA 1DG9A 4W1RA 1A2BA 2PUCA 1F2DA 3KPUA 2H5JA 3SE7A 1QFMA 3LC0A 3OEHD 3SHWA 4UBKA 4W1SA 1GL9B 3SYKA 1DO8A 3UT6A 5BN4B 1DEOA 4GOOD 1M54A 1E3MA 4H7JA 1EUCA 5D8DA 3CO5A 3WTBA 1YFLA 2NO4A 3ANYB 3VO9A 2GVDC 1YU9A 1JJAA 2W2OA 3G5LA 2XDQB 3CSDA 1W88B 1GPAA 3HVUA 3PXUA 3Q9SA 4FP9A 4HLQB 5FUVA 5T6BA 5DBGA 5HS6A 2JNWA 1SOMA 2OK7A 5TXGA 3W06A 3VPBA 3ZK8A 3VKGA 1JFRA 4YONB 2OBNA 4JUCA 3DE5X 3TVDA 5A3QA 2JD1A 3OLCX 3ZEIA 2GPAA 4NESA 4QTZA 1KZ7B 5KTSA 5AKHA 2CXNA 2NADA 4XB2A 3JAKB 2IU0A 3E2MA 2F1RA 2PGNA 1GCUA 1GNQA 1SJ9A 1P18A 2V7PA 3I6QA 1I13A 3IJRA 4QBFA 4V3BA 5DM0A 4CE6A 1EDOA 3SHQA 1T8SA 1RLMA 4YJKA 1FDOA 3DAPA 3QOWA 2VDWB 4A0HA 4Y6SA 4DB4A 3BL6A 1ODTC 1FB5A 1GUFA 1IXYA 4CKYA 1R6DA 1XU4A 4MXDA 2BEWB 1MMFB 4MP3A 4QOJA 4BX9A 2CDCA 3H5VA 3WL5A 5CFRA 3TRDA 3B7PA 1NDHA 1XD2B 3COVA 3JYLA 4RQAA 1K7SN 4YNBA 3ZWPA 4YRSA 5CFLA 3GI1A 5AKZA 1XNHA 3T5GA 4QD3A 4LF7B 2BMFA 2DQYA 1H2EA 5FYDA 2HQRA 4AY5A 1UBRS 3WLHA 3ZJVA 1CUDA 2QTBA 1MB4A 1K7EB 1YXMA 3LX5A 1FA9A 2K2WA 4N41A 3MELA 1U8XX 3VV2A 1CUEA 3K8QA 3CX8A 1DBVO 3N3AC 4N9WA 5BT8A 1WLSA 2QZ9A 4FFRA 5MFPA 1TMKA 3ZHVA 1H23A 1HYQA 4LRQA 3CMCO 3FCSB 3RVSA 3WJ1A 4FBMA 2OAQ1 5E2AA 1E1LA 3EZGA 3MXTA 4PR0A 1T5BA 3AERB 2Y0EA 1DKOA 1U8FO 1YS7A 3FHLA 1MORA 4BGIA 4ZAVA 1ECLA 3PXAA 5JZ9A 3IUNA 1C3EA 1WTCA 2FN4A 1JSLA 4IJUA 2ZP1A 3MTEA 2QRPA 5ANRB 3WYEA 2AX3A 5LNK1 1UT6A 2WVHA 3BICA 3SZUA 4M9SA 1E9BA 3RFTA 5C3MA 4OK6A 2CVPA 1UJNA 5CEJA 1Z28A 4PG4A 1SBCA 4U0JA 2QMQA 2V7QA 5EIHA 4EO9A 3IQDB 2GHRA 3NHJA 4G1EB 4HN9A 3UA4A 3ZXSA 5B57C 5J4HA 4FDMA 3FCUB 4A9AA 4BLRA 4IQ8A 1QGUA 5AFSA 1AVTA 4FQ7A 4XWAA 4IDEA 4G5RA 2FRDA 3PNYA 3VPGA 1SBZA 3VNUA 4HNGA 4GVPA 1GNPA 2AOTA 5JAZA 1RXYA 3WC4A 2ATEA 4EPYA 3PHIA 1GKLA 4F1JA 3C1UA 5EY5B 1OFGA 2EEPA 4DY6A 4WCFC 3A2MA 4L4UA 2AR7A 3K1ZA 4Q3EA 2JL1A 3N8DA 2ZM6B 2TMGA 3FDXA 3RVLA 4RHYA 1QX4A 2WAXA 4R6WA 1ZK1A 5AIBA 2D0PB 4PSDA 1YSCA 2XYPA 1JF8A 1ABEA 3DTVD 3GHHA 4D42A 3G7NA 4WJLA 1Z6GA 4CM9A 1LK5A 3HU3A 2IY9A 4JLJA 4W8GA 1T0JB 4HH4A 1CZLA 4G0VA 1KY2A 1KXZA 1RYNA 2JIZD 4EUKA 3DDWA 4JC0A 2BHTA 3VMMA 3AVYA 1I6KA 2GJ4A 4UM7A 2XCRB 2EP5A 4FR0A 3WP0A 4EKNB 4ASUA 1JSRA 1G21E 2GPSA 3A9CA 1IUNA 4ZAXA 2CHGA 3ABOB 2K87A 1SXJD 4NH0A 3QU5A 5DOZA 5LQMA 3O92A 5LBTA 4DV0B 4G25A 5A5GA 5JZVA 2Z3VA 5DIFA 3TSCA 2I3GA 3VISA 3WNVA 4ER7A 2CD9A 4P3OA 5TGDA 2ISCA 5TPZA 5IT9A 2MT9A 3FVWA 5D2CA 1GDDA 5LNK6 5D01A 3RS4A 4C21A 4D4LA 1UCFA 1P8JA 3IRVA 5ISMA 1FMFA 1EVLA 2B82A 2I1VB 3EVDA 2J4FA 5AJWA 4YROA 1KJQA 1NU6A 1ZD5A 4JXKA 3SIPA 3HRIA 5EEHA 2O48X 3CN7A 3B52X 1Z5ZA 1J0AA 4UOZA 5K8TA 2Q3HA 1GFIA 2II6A 4HHEA 4OA8A 5CVCA 4JQCA 2DQ4A 4I4LA 4KBYA 3G2OA 2HRCA 4WXPA 1T9ZA 1XZNA 3AJAA 4B73A 4F5EA 1OQAA 4CV0A 4YJ3B 2LPMA 4RA9B 3R7SA 3SYTA 1V8PA 2UUBB 3GZNA 3DVAA 4PYOA 2X2EA 3ZCXA 4CL3A 4YPVA 1A9XA 1DIHA 1VTKA 2X9GA 4C4AA 1RR6A 4CI9A 3AIIA 9GPBA 1MZPA 3GDGA 4TKUB 4C0AC 5HK8A 3MTGA 1R8JA 1TYZA 4WLOA 1H8HA 3PTLA 4ER0A 2XMZA 1O8BA 5AW9A 2RDMA 4KN8A 1WDLA 1QRDA 5KYYB 3ANMA 2B98A 1N3LA 1T2EA 2QN8A 4AP9A 4AYWA 1B43A 3LCJA 5IH7A 3BRWD 1DC4A 1DHTA 3LHFA 4AI6A 1G21A 3MWLA 5ADHA 4FZJA 5KSZA 2AEEA 3PQ5A 6AT1A 1CBUA 3UMJA 1QZXA 1LS1A 1V39A 5AJHA 4KPFC 1HTBA 3T38A 2AXQA 1ZWLA 5EUCA 4H0CA 5THXA 4UM8B 3X44A 5KKCA 2ZJ0A 3UK0A 2WJIA 3UGQA 3B13B 5KX5F 2QR2A 3GRKA 1AURA 2WD7A 4GI7A 4E1BA 1TQ2A 1FXUA 2C2KA 4FMCF 4O4LA 4ZZ1A 1UEIA 5DYTA 3EGCA 1K2WA 1FQWA 1GHTA 4G8DA 3KKKA 4CTMA 4F11A 5KWIA 5FUMA 3I62A 3HJUA 2IEAA 5GMOA 5DNWA 3ZHZA 4F4HA 3H17A 4ZT3A 3HHEA 4DN6A 5E2IA 1NLMA 3DOIA 2X8WA 2C8VA 1NXQA 4WKOA 2VSNA 4ND6A 5DBIA 2J9FA 3WGLA 5C7OO 1PL6A 4ZEXA 3AUKA 2QRNA 4IIJF 1L5OA 4JU9A 1PEYA 1E2DA 1SCKA 2X0IA 1U2RA 1IHYA 2MSEB 1KMNA 3VVLA 3FFTA 4B4OA 4V0NA 4TL7A 1E0KA 1C80A 1XRLA 5C32A 3CEAA 3OCWA 4ZFNA 2PU5A 4LNAA 1TLTA 5EHGA 3EAGA 3O47A 4FNMA 2QY9A 5F3DA 1PBNA 1BD4A 3PWTA 3ELBA 1QIFA 3WRXC 1QSGA 2X5NA 3OQ6A 2HRQA 2JPDA 4LJRA 1A9RA 1TQ8A 3CX7A 1JQJC 4CIAA 3CURA 3ETGA 3T0IA 2OZLA 3PC2A 5KHLB 3D5TA 2WFLB 2IWRA 1S7CA 2GAAA 2CV0A 2NTVA 1G64A 2V5VA 5E95A 4I9FA 1RRVA 4IWYA 3HK2A 3CVVA 4LF6B 1JFLA 3WB2A 4L2IA 1MFZA 1PR9A 5ER6A 3HJNA 2IVFA 1FFCA 1NKVA 1FMLA 2AMYA 2YVQA 1OGYA 4D0LB 1HLPA 1R6XA 1PYOA 1R8QA 2J3IA 1U04A 3AOEA 4PIMA 2FF5A 2BFNA 3CUYA 1ISRA 2BM0A 4OL0A 5CT8A 5D7BA 4BE4A 4DC1A 4ES6A 3MJDA 4F9EA 1QAOA 3B6ZA 4US1R 3IT1A 1D0IA 2NNLD 3NHUA 4B48A 4DEYA 1XK7A 5ABPA 3AFMA 2YN0A 5ALFA 2QVBA 4KXFB 1T4CB 2JGAA 5K3FB 2VDLB 3RE1A 1CWUA 3A9UA 1NVKA 3F96A 4U7WA 4KGVA 5K4GA 4BLUA 4A0QA 1F14A 1VJDA 4PC7A 4A27A 2H7XA 2MWMA 4YP9A 3E5NA 3PXDA 3TTSA 4BWGA 3N87A 3LQFA 4KYIB 3RTEA 3O26A 3IUEA 3TZLA 2WIKA 3ZXIA 5AUOB 1YQQA 3BB3A 3K20A 1IBSA 1JYEA 3JR7A 1XVAA 5CX4A 4TYWA 1XB2A 5AICA 1C7IA 2PWPA 2B35A 2FN3A 3KSUA 1KRXA 1I4OA 1KMCA 1U2ZA 2GDJA 1XKQA 2H1LA 5BSUA 1P2TA 4GBED 4CI0B 4AW9A 1S9HA 4FC7A 4BY9E 2QLMA 4R3UC 5CH8A 2Y1FA 2CVQA 2X23A 3N0WA 5LB4A 4BS9A 4PSVA 3ZE9A 5L3QA 5A4KA 1WVGA 2V96A 3DE1X 4Y2VA 3GV0A 4MINA 4BFUA 5KYXB 3FOBA 3MGBA 1B41A 1TJYA 4NCKA 5CHEA 5AJYA 5DBOA 5ITSA 4IXWA 4P4GA 3PNQA 3RCBA 1OI2A 4FLMA 3ROXA 4BFVA 3U9TA 4F6RB 1X9GA 3TZHA 1FRNA 4CLRB 4F8EA 4HLCA 5HCIA 2QVYX 2VWPA 3W2FA 1L7VC 3P9XA 2CFTA 2O0HA 5MF6A 1KZ1A 3GP3A 4A4DA 2V98A 1IIRA 1N6PA 3IHLA 4FYJA 4F86A 2O2GA 1L7DA 2PUHA 3HJRA 3HU5A 2OP0A 3WL3A 2V7QD 5B55A 5EMJA 5TT0A 5FPKA 4EY8A 2NYVA 2Q4RA 1N3YA 4GLJA 3PC4A 1OXBB 5CXSA 3VMFA 1ZCZA 2VUUA 4K9DA 3DV9A 2WBLC 2HA5A 2GRUA 2HDNB 2VDMB 2VHCA 3C3DA 4Q4AA 4EJ6A 3PQDA 5F73A 3RC9A 1ADGA 3AVPA 4GWGA 4B44A 5JARA 5T57A 1HL3A 4I55F 2BN4A 3F46A 3EVCA 4M1TA 3LG2A 4HEJA 3T3OA 5F2OA 3IODA 1XHLA 4PV7A 5B30A 3G0CA 1Q20A 2ZPTX 5EQDA 4AJ1A 4YPFA 1TM4E 2QVXX 4LZOA 1KDVA 5G1NA 4DR5B 4MQ5A 2O3UA 1I6WA 2GI4A 1PL8A 3AEKA 3H9GA 1SUDA 2RH5A 2BM9A 3M9LA 4UE6A 4YJ2B 3S5JA 1Q7GA 1AUXA 3C70A 4GX1A 4PLFA 2HREA 4QDJA 4AJLA 4UU0A 4XJVA 3RODA 4CM9D 1QK5A 3TECE 1XPUA 3J81k 3VHRA 2OG2A 2HHJA 4FYHA 2MCFA 3WLSA 4PG8A 3AHCA 5JNWA 4F7DA 3QNMA 2FTKE 2QX9A 4TV9B 4DSUA 5TJ9A 4L74A 4JYAB 1Z06A 3E3OA 2Q49A 2WYIA 1Z15A 2HCBA 3BK2A 3CLTD 5EOVA 4ZYTA 3GHYA 4O8ZA 1Y6GA 1SPBS 1MT3A 1PG5A 3ZHQA 5DHQA 5ECGC 5ELLA 5I4BA 1WUJS 2DKFA 3V6MA 1RYYA 4EGAA 3V4ZA 1T13A 3K0EA 5TPZD 1GSOA 3F5QA 4ZAFA 2J3QA 4XX1A 1JXOA 2VDQB 5F3RA 3PYMA 1W8IA 4CIVA 4DBLE 1VE5A 3VKFA 4J3FA 3CW9A 3KPJA 4GDFA 4YJGA 4YT8A 2C61A 4RHXA 4E94A 5HK9A 3W8NA 1WP9A 1AKEA 2ZI7A 2P65A 5IBCA 4AS3A 1DP4A 2B4TO 2VPPA 5LQSA 5ELMA 5C1DA 3DMFA 4I4TF 1JSCA 1BU5A 5IKXA 1N92A 3O4HA 5H3HA 1NNUA 3JRNA 4PZYA 3SPXA 5EUQB 5BR7A 1ZY2A 3CA8A 3FUUA 3HYLA 3LC7O 3MHPA 3QA3E 2WG0A 1C4OA 4L27A 2FK8A 1XU9A 4MTCA 1A7AA 3VH1A 2PLWA 1IU9A 1CZUA 4G84A 1MKYA 3CEHA 4K81B 5CJPA 1TVKB 1EGHA 4JBWA 2JI6A 4LXGA 1DQRA 4PFQA 2FN8A 4GT1A 5TS2A 3D4PA 4AMBA 3DWFA 5TEVA 5AM0A 1KVTA 4JVMA 1BGXT 4HNSA 3V1YA 3V7WA 4U2CA 4GO1A 1H8HD 1PWXA 1RLUA 1GZUA 3TQIA 3ZCQA 1JHXA 1XVVA 1CY2A 2A5DA 2QD1A 3BMQA 4GGOA 1R18A 1GLGA 4XWWA 4EA6A 1M1NA 3GLHA 5DX0A 4KUEA 1T5HX 4P7KA 2UVPA 3IPYA 3IYLW 2I2DA 2VHYA 4HAWA 13PKA 3SLKA 4FW8A 2QBYB 2OORA 3HLYA 1DZ3A 3LC2O 3E48A 3L4SO 1PQYA 3S29A 3DE4X 1C0PA 3T41A 5LLTA 3Q7TA 1PT7A 1V6CA 1OZHA 3GB9A 4INZA 4GSYA 4MQFA 4TQGA 1FUUA 4MUXA 3A6EA 5L8VA 2FPRA 2V4ZA 1VGVA 1JE1A 5EMLA 3TRKA 4LQLA 4D79A 1CXZA 2NUTA 1UJMA 2JJ1A 4MB2A 2RGWA 3PQ6A 4NMLA 4JJ7A 4YAGA 4F4UA 3AKZA 4AROA 3EMDA 2YICA 2GLUA 4LXXA 4N8DA 5EP2A 4PZ9A 1LH0A 3UHFA 1QVVA 2YR0A 4CKZA 1WEKA 2YIJA 1VYUA 1XIVA 4LYDA 5FHQA 4XH9B 4LF4B 4QUIA 3S68A 4DZTA 3T7DA 1QQ5A 3AEUB 4KO8A 3WGIA 2RC5A 1DUIA 1WBJB 3T0FA 3IQHX 1GAQA 3E7FA 1MC4A 4HLNA 1WW3A 1FRVA 3A36A 5I7SA 3RT7A 1UKZA 3N39C 4AKSA 1E2QA 5LN1A 1OILA 2DQKA 3V2IA 2P2NA 2QTNA 5JCPA 4MTLA 2BFOA 1DQZA 3D3WB 4OGLA 4ZMBA 2H1CA 3HVRA 1SN7A 4MV7A 4X97A 5DXFA 2ONZA 2J5RA 2QP3A 3BFPA 3WBJA 2QM8A 1CHDA 3DE6X 3H19A 1DRWA 3RSLA 5FTLA 2C9YA 3KJGA 3UN1A 4GMKA 3X3HA 1HWYA 3HDJA 2CDNA 4HRAA 3KD3A 2ZRQA 4LSWA 1IZYA 3ZHXA 5JH7F 3BXZA 2GUWA 3SQLA 2ZTSA 3HCAA 4WLVA 1WCIA 2ZBUA 2VAMA 2YJ3A 3SSNA 3OU7A 1V35A 3PJDA 4O1MA 4W9RA 4OHOA 4ENPA 4NCAA 4KAFA 1JIKA 3KQWA 2WVJA 4H31A 1N2JA 5CGQB 4BEJA 2D62A 1NVWQ 2FPXA 3EA5A 1JX6A 1G5FA 1KOLA 3UFXB 3VQTA 5DE3A 4X9XA 5BURA 3SNHA 1IHPA 1L8AA 3GARA 1Q1EA 5E6SB 1PYDA 2WK1A 4LRXA 1IPHA 5K8JB 4NV1A 1AQNA 1X7WB 4MR8A 4QHTA 5DM4A 1NFQA 3D8RA 1S4QA 2VYNA 3KJQA 1DWQA 3QUCA 4E30A 3W5CA 5A06A 2IY8A 2EQBA 5BN5B 5BSEA 2JGRA 2RBKA 4ND4A 2P77A 1CETA 4UMVA 1P1JA 1TA0A 5EKTA 4JP2A 2ABWA 4MEBA 1MAVA 3Q3IA 4M55A 5KKAA 3ZGYA 4RYDA 1OR8A 1OYVA 1OZGA 1SUPA 4IV0A 5ALGA 5KTMA 3KT3A 3MJRA 4EL0A 4L3VA 1S3IA 4LOHA 1AS2A 2OD2A 3OHSX 5EJ8A 4M21A 1T2UA 5DX8A 3VR6A 2VF7A 3EXHA 1FDUA 2OBYA 2FZ4A 1V1RB 4JJEA 3AY6A 2VQ6A 3JWPA 3T99A 3UWSA 2D7DA 1II8B 2YXEA 4CM1A 5AVUA 5KC9A 3CZPA 2UDPA 4HATA 1K4KA 3PCXA 4B35A 5EPUA 5F3WB 3HUFA 2PS3A 4B3JA 3U9SA 3VNSA 1T43A 3ENQA 3DOEA 3FMGA 3H7AA 3LY7A 2NZJA 3INRA 4ZO6A 5FNZA 1Y89A 3IX7A 2J9YB 1RM3A 2OCGA 3AJ8A 3FF4A 2FKNA 3EGVA 4L75A 4OXIA 3IMCA 2XWBF 4Y8VA 1TT7A 1AS0A 2XTMA 3BJZA 1DIAA 2WTAA 3TUJC 4MQ6A 3TLCA 2I4MA 1PT5A 5HDQA 2QW1A 1BDBA 2NZ2A 1PKEA 3FI0A 1T2CA 1Y98A 1GTVA 1G6OA 1SMKA 2HNKA 3JPYA 4OHVA 1BWPA 3I9FA 4EJSB 3NCTA 3NS7A 4Z7OB 1RIIA 1MRSA 4I4IA 3O8OA 2MOKA 5IKPA 2BE7A 2NSJA 5DI3B 3KWLA 4C7XA 4BEBA 1RYZA 5J5CA 1V47A 3HB4X 3W4IA 1GPNA 4CQLB 3LA8A 4PLPA 4GOMD 2OY0A 2XXAA 4Z0NA 3GPCA 1TAGA 3ZK9A 1CP3A 4CF4A 4HVAA 1LC0A 3GG2A 2GYWA 4H7HA 4AQ7A 3F6RA 2FFQA 3OOYA 3QHQA 5CNIA 4MWGA 1B8NA 5TS3A 1YZLA 2C3YA 1G63A 3II6X 3V5NA 1L8LA 1XRNA 1KJIA 2ZB2A 1TXGA 3CW8X 3JQBA 1I5OA 1E0AA 1TE2A 1Y48E 1RQLA 1CUCA 2JK0A 2VS1A 3SFZA 5HVNA 2B9VA 2PXAA 1WM1A 2DUUA 1Z2NX 4BLOA 2C7PA 4CW7A 3VZRA 1YZVA 2ZUBA 4MS3A 1DWPA 2XXJA 5E9QA 1VKJA 1EPUA 1KP3A 5T6MA 4X8MA 4M1YA 3NIDB 3OIVA 3WO1A 1FTWA 2BP7A 2WJYA 1H65A 4X63A 3AR3A 4HZUB 2LP4Y 2H2FA 5KNDA 1QHHB 2CT8A 3OX3A 1VKOA 2VP5A 3BAFA 5CM8B 3PFGA 4TYNA 1YCHA 4G1CA 2ZDHA 3KVOA 4H3HB 4TWJA 1VYHA 2Z09A 5AKJA 4P9NA 1L4FA 4FLFA 3WI7A 2ATVA 4O2AA 5BSVA 1KZ4A 3QNUA 3UHJA 2R8ZA 1Z34A 3AVUA 2FWJA 2NM0A 3O0TA 2CEAA 2RHLA 4RVUA 2PFSA 3A32A 1NUQA 2IUFA 3GA7A 3HGQA 4LHYA 3KOWA 5IEBA 3V1TC 1V5WA 3ETLA 3ZHBA 1LQTA 4Q6BA 1CUAA 1Y3IA 5A3JA 3CINA 3RT1A 1RPNA 2H18A 2ZSEA 4OB7A 1XXHE 3LGAA 4YRCA 1OBOA 3MFYA 5DM2A 3WRWA 1TU3A 4Q4JA 4B6SA 4BO5A 4ABTA 1OW3B 2M1ZA 2O7NA 4ZZ2A 3SYNA 4FE7A 3WQSB 4ZMSA 5KMGB 1CYEA 1GQFA 4TWZA 3UJDA 2ZR7A 2IP2A 5NLLA 3T1YB 4PC3A 5EZYF 3NGXA 4IF6A 1N9GB 2QN1A 3OZEA 2REQB 2OGTA 2BKVA 3R6WA 1WIWA 4RZIA 5C8ZA 4GQIA 3S2UA 3GFVA 1U0OC 3MS7A 3Q3EA 5H1YA 1ISSA 1Q2UA 4EVIA 3GLGB 3PPYA 4ZHQA 1JEEA 1H9CA 2JCXA 3AY7A 2C0CA 4H08A 4HQRA 4LE1A 4Q7QA 5FUXA 4JKIA 1XTBA 3UH0A 3NP9A 2AXEA 2JZNA 1XJ0A 3AB7A 3MGCA 4GPZA 3AXTA 1CUYA 1NE2A 2IU4A 1C1XA 1FUYB 1GDTA 3RRYA 3KYCA 5ICMA 1WPRA 3HA3A 3HBLA 4A5SA 5GOZA 2QM7A 3PRYA 4XSVA 1M7HA 2FN9A 2G7MC 2ZS8A 3H2GA 4P7FA 5JWOA 4G1VA 4YCDA 2GNOA 2A3RA 3OP1A 5IK2A 4ARCA 1UIRA 2VHEA 3QEJA 4KFUA 3SEAA 1RDFA 4HTFB 2V7TA 3L40A 2R8RA 4BVGA 3KZNA 3AHDA 1NMSA 1YGPA 5D86A 4GBJA 4PGAA 4RD3A 2PVCA 3F3SA 4C03A 3H5OA 1YB5A 2AUTA 4NG4A 1PFUA 1KC1A 3KJHA 4M53A 3I8XA 3OTQA 2ZB4A 5ALYA 3RUEA 1Z0JA 2NO7A 4ER6A 5KVVA 1XXHA 2X19A 2PUVA 4ABYA 4MRAA 1NOIA 4FCTA 3IPCA 3UUFA 1VG0B 4QAJA 1BE6A 5LOVF 5CEEA 3GGPA 2JJ1D 1CE8B 2IYQA 3R3ZA 5ESWA 4LVNA 4RZUA 1P9WA 4JCOA 2COEA 2J59A 3P9RA 1EB8A 5IUKC 4UHFA 1G8KA 1I4DD 1ZI6A 4GHWA 2Q6IA 4I0WB 4KWHA 4S3MA 4YAOA 2PUGA 1ECBA 2Q1WA 2P9ZA 4I5GA 3RVBA 5AK4A 3DBOB 3BE6A 1RYFA 3T3NA 1XC7A 4NBSA 3OZGA 2ADFA 4C2TA 4KXWA 4DYHA 3CUVA 1XBTA 3T5CA 5MN4A 3F73A 4IM7A 2RB4A 3MJEA 5I9TA 1SBIA 6PFKA 3QQPA 2X9NA 5JS6A 3D6FA 3B53X 3OZWA 4FBLA 5IBPA 1MNAA 1PTJC 1RKUA 3OHPA 3Q7EA 1C3OA 3S1AA 1NN1A 1R4NB 4XWYA 1VL8A 3BXOA 2RG1A 3QFSA 4RK5A 2R2GA 3IP1A 1KGDA 1KNQA 1LSJA 2RB5A 3E8MA 5I48A 1ZUWA 1CR4A 2ZB3A 4N0DA 5FO1A 1RE0A 1Q1AA 4I2VA 1SC1A 4X66B 2HAEA 1MO3A 2BY4A 1BQ3A 2VF2A 3GUUA 3N2LA 4KYUA 4CT5A 1NZDA 4WUVA 5CLIA 3PI6A 4WFJA 3Q15C 4QVGA 2UZ3A 2BHLA 2WNSA 1CRLA 4M3NA 5EZSA 1XVIA 2ZUSA 4EFKA 3ZEAA 1U7ZA 4DXDA 3PWZA 2ONCA 2I4RA 2XB8A 1MX5A 3P0FA 4TXNA 1PTKA 1N2BA 3AJRA 5JXJA 1Z8DA 2FEMA 3G02A 1GUDA 3K6KA 2WG1A 2QAIA 1KKUA 4FJ0A 4HB0A 5GONB 1RHJA 1CR0A 1OU0A 4A1FA 4BMCA 5C5IA 3AEXA 3JWJA 3AINA 3L8EA 4OREX 1T6NA 2VTBB 1SIUA 3CKKA 2NU8B 2JCBA 2VYND 1KK2A 2H57A 3F90A 2Q5FA 1UBEA 2OPHA 4JI5B 3VC3A 3VJKA 1KU6A 4CCSA 4PZPA 5KKNB 3HSKA 2O7SA 1SC3A 4F1KA 1K9VF 3OQVA 3AHIA 1A9PA 2OO5C 2R6HA 3Q2KA 4MPJA 3PJGA 2CLHB 2ZIEA 2ZSBA 4NIMA 5BQOA 4D9HA 2HW8A 3HDTA 5DNYB 1TF2A 4R98A 5ARBA 3Q1LA 1Y9ZA 3K4PA 3ZY3A 5LD2B 5A2GA 4NQRA 2ZM5A 3ENZA 1E2GA 3CVXA 3DCIA 2WF6A 3VR6D 2EXXA 4HQ0A 2FE1A 2ZIUB 1PKXA 4IDNA 4FD2A 3ZXUB 1VJ1A 4BLTA 1DMSA 1XQ6A 2FG5A 1SAYA 2GSDA 2Z30A 1J90A 3CNLA 4ZEVA 3QWAA 1QH8B 4AO7A 4RVCA 4IVQA 5KU1A 3D6HA 1RBMA 4YQYA 1FBNA 1T1RA 2HMVA 5C53B 2GO7A 3A1FA 4RM3A 4CN8A 3EAQA 2X5OA 5IJZA 3DXFA 3MXOA 3UUGA 5I7FA 5KTOA 3IOYA 3PX3A 4G4SP 3DTNA 4PCUA 4BO1A 3FPCA 1S8FA 3LNCA 3WDLA 1UK6A 3TJMA 3ZU6A 2YVUA 3Q98A 1ZXXA 4EZBA 3I9KA 2E3JA 2VH2A 4F3YA 2AEJA 2CLOB 1CEYA 4RE5A 4L9SA 1PO7A 1T10A 4ZOBA 2FAXA 3EG9A 5FADA 5EC8A 5EZ5A 4AZWA 3U4DA 4HBZA 3BIFA 3KVRA 4CT0A 1HM5A 2YYZA 3IDAA 1TZ2A 1JQ3A 1TZJA 1U02A 4Y6GB 1DTEA 3F8WA 2EFDB 2NV2B 3GJTA 1QGAA 3PNKA 1JPUA 3QVVA 3TQTA 2EG5A 5FTNA 4WOCA 3ABQB 3GUVA 1Z4PX 3LIIA 4JLSA 5BQXA 4S35A 5IC5A 1AA6A 3EGIA 1MBZA 3LOUA 3OHMA 3RIEA 2CCKA 5EYPB 1U8AA 1DFIA 3WE7A 5KNBA 2ROQA 4FYVA 2WZBA 4BNYA 1ZQ1A 1IZ0A 2CBGA 2OCXA 2ZRMA 3B1XA 3R3WA 4XGIA 4Y3UA 2ZIXB 1DINA 3R3VA 1H0HA 4N5NA 4NYIQ 1CW2B 5K6AA 2C0PA 4I8XA 3PDJA 5BPFA 2C9MA 3BWXA 4X3CA 1U6KA 3GJYA 5A1JA 4XA8A 2HIMA 3KT6A 2QXTA 3NHWA 4ZAWA 3TKLA 2QTRA 4EPVA 3N74A 5IJ9A 4Y0NA 3T34A 3U3RA 2WICA 1NONA 3LLVA 3ZVLA 1XMVA 5LMNB 3OKPA 3KB1A 4JJ6A 1F7VA 3EZ7A 3OH8A 4NENB 5JFGA 5D3MB 2P4QA 3L77A 2A59A 3MRVA 3UGTA 5KINB 2EZUA 5KNDD 3BGWA 4HV4A 1RXWA 2AI1A 1JQ5A 2B2XA 4OYHA 5EIBC 1C1DB 4CKBA 1B23P 3NTVA 3TNDA 4JV5B 1OFTA 3KV1A 1AZLA 1RYBA 3NIBA 1Q7CA 3BORA 3T3MB 3W1VA 3B9QA 2I0FA 2PLNA 3E4DA 1ZKMA 4M1OA 1BKDR 4C0WA 1NR7A 3N2NA 2JVJA 1X1TA 2ACKA 1TAHA 2M2IA 1YR6A 2H11A 2VSOA 2XCOA 4RJIA 4CN9A 5I45A 4DJJA 4WDRA 1AMOA 3IDFA 1PZXA 4LBZA 4HADA 4UPDA 4NJOA 3TNJA 5FPHA 1V11B 1CVIA 1J8QA 1GXSA 2B36A 2AV6A 4O3FA 5FJJA 4YP0A 3DFIA 5CA0A 1QHEA 5KYWA 4UUOA 3BGOS 4L4YA 4LY9A 3I2JA 3KBOA 4C7JA 4MMZB 4JQYA 4ESEA 4H18A 1ZO8A 1F7UA 1YVPA 3SZLA 1JHQA 4L0MA 5IH3A 5FWNA 2IKSA 4TX1A 4BAZA 5IKMA 4IAOA 2QG9A 1L3BA 3WZ2A 3HNRA 1R8XA 3HYCA 1X9HA 5A04A 5JJIA 4EW6A 1ZDMA 2IOFA 3P9YA 3WADA 1NYQA 2ZIVB 1SCQA 3V97A 4RWZA 1PNTA 1N5OX 5ITZB 1HO3A 4TWRA 2NIPA 5AW8A 4JXJA 1UADA 3DD5A 2D54A 5A6VA 4F4FA 1EUDA 4Z4CA 3QXJA 4GR9A 2BGIA 2JFHA 2W4MA 3TLAA 1K5HA 3ZV7A 4TTIA 4DMCA 1E1KA 2A0WA 4HD8A 4KQEA 2L19A 2Y76A 2R87A 4DA9A 1CZKA 3FYUA 3P2EA 4RVFA 5PNTA 1Q15A 2Q3FA 2RSLA 4FQ5A 1T3ZA 2C1ZA 3WLPA 4D4KA 2NQTA 2FEKA 3QELA 3GT0A 2Z04A 4OI4A 1IJEA 3WBBA 3TTVA 1XEWX 4CLXA 5AESA 1ZW6A 2BRUA 3IIEA 1CD5A 1U9JA 2GJ9A 4LMRA 2R84A 4PZAA 1CNFA 5I9SA 1QPZA 4AS2A 5IK2D 1E3SA 4GAEA 1N2CB 4BJ6A 3AESB 1CUHA 2I03A 4R3WA 3O1IC 3MN1A 4X7BA 2HA4A 2PUAA 3ZJ4A 3TG8A 1RRPA 1KZYC 3FFXA 5C8YF 3FTPA 1MAUA 1E0JA 1HTTA 4HPJB 1JQAA 2ZYWX 5AK3A 1S01A 1VPTA 3IBFA 1J1IA 3PUVA 2OM2A 4IJ5A 1TJ4A 3WRVA 1Z63A 1WUIS 5L4NA 2AHOA 4WRRA 4R71A 2IH5A 1WHTB 3S3TA 1LB1B 1RD4A 1MG5A 4PGMA 1T34A 3CW2A 4WBSA 3JQAA 4WQMA 4AP6A 4KXQA 1EBUA 3NAQA 1JDJA 4L51A 2EEZA 3LUPA 2WP8J 3NDJA 4Q21A 1WZIA 2CWDA 5FI5A 4F8YA 2NUPA 1QHIA 1OFUA 2VAWA 3I4LA 4BLSA 3LY8A 1DLJA 4ZP1A 1Z5GA 5IMBA 5B1EA 1KQOA 3KM0A 2AG0A 1Q19A 4LQ4A 1N5JA 1DTSA 3AWIA 2NYRA 1YZGA 3DHEA 4UBIA 4UTXA 3RUDA 3TSZA 5KWVA 3ER6A 3CC8A 4PN3A 3GEEA 5C0OE 2X1VA 2VWHA 5SYAA 4B33A 2OV2A 2HSJA 1KS2A 3K0AA 2O14A 2EF1A 3BCSA 1SOAA 4MVJH 5ENDA 4ZK2A 2P2LA 121PA 3RRFA 4RTNA 1TNDA 4AKGA 2IU6A 3E3AA 3QUTA 2QX8A 2AKYA 1RJFA 1FTSA 2YYAA 4UUMA 3AHHA 1MJGM 3QIVA 4RVSA 4ZQHA 3FUTA 3VSDA 1ZRHA 5KVCA 1CEXA 2Y0PA 2JZOA 2FG6C 5BUQA 4KQMA 3PHGA 5E2BA 2IY7A 3T12A 3T3EA 4JQOA 2H52A 1O03A 4Z0TA 3WKCA 4LRUA 3KUDA 4RDHA 3V1LA 3ONEA 1XO1A 1KZHA 5HBRA 4INOA 3SFVA 1TPZA 2GAFA 3UAYA 4CMKA 4CIYA 3T4PA 3K8OE 2HSGA 1EUYA 3E9MA 3H8SA 3THOA 2YZMA 3KKPA 4DR6B 5BW4A 1K89A 4MVXA 3DCJA 1YBMA 3EEOA 3QF7A 4BGUA 1WMFA 3RYTC 2QN3A 1M2VB 1KTIA 1MC8A 1FTYA 1TQHA 1NRIA 3MQFA 3QG1A 4O2BF 3SVZA 3TYXA 3W4JA 1HL7A 1OWPA 2BHRA 2JKZA 2I4TA 3B5JA 3WMGA 1KEEB 4C4SA 5DDIP 3MILA 4Y9DA 2F8SA 3QVLA 4P84A 3RS0A 3ACDA 1X2EA 3N0XA 2XVYA 4OK5A 4MLPA 3TLGA 1E6CA 3NTQA 3LBFA 3PC7A 4H60A 5BRJA 4QUEA 1L5FA 4UXIA 4EEKA 1QHSA 3UXMA 2FR0A 5KAPA 4NE9A 4K9NA 2J6BA 2Y2VA 1NXVA 2PZJA 4IGAA 1YOVA 1LXCA 2V0NA 4FZRA 4EUSA 5HJEA 2UUCB 3K5HA 4TKZA 1BJKA 2R5NA 1D2AA 3W79A 1E2EA 4COKA 2CKMA 5H83A 1Q7EA 1V8ZA 2MHCA 1CNEA 1TC1A 2C31A 2O57A 3EA4A 5KAMA 4OQNA 4G0NA 4ARSA 4CLOB 4BUJA 1KAEA 4P3PA 2CJFA 4TMVA 2CV1A 3WK8A 2DQSA 5EZ6B 4AN4A 1UZAA 4IINA 5L3SB 3L9WA 1N7GA 2AZ4A 3IGFA 1S7GA 3U26A 4BN0A 2WQ7A 1IQRA 4G89A 4DREA 3GN2A 1Y1SA 2GHTA 2GESA 2P1DA 4Q9IA 1VXRA 3LAWA 1E1RA 4X3OA 4M9RA 3UT0A 4CGZA 2G8NA 2FFJA 2R4UA 1FU7A 4PYIA 5BQPA 1E4OA 2JIBA 3FCXA 4ZCRA 1D1TA 4TROA 2XOXA 1WLYA 4TKLA 1H2YA 3NPMA 4HDSB 4Y30A 1SCNE 2ZFUA 3HB5X 1LJUA 4CR6A 4P08A 4CJXA 3UW1A 4QJ4A 1JT2A 1VLQA 2NNWB 2LTAA 2HCTA 1U1EA 3LX8A 4EK9A 3F1KA 3OZFA 1JG6A 1V45E 3KO8A 1R3DA 4ZWNA 3W2GA 3TF5A 3F2IA 3ADPA 4KQIA 1NBOA 2ZJ4A 3G7UA 2GUGA 4LI3X 4R69A 3IAS6 2C83A 1N0UA 5CRIA 4ENVA 3MT9A 4C76A 1VE3A 3DXXA 4Q6WA 4R01A 1QONA 1PNRA 5I5EA 3NR2A 1RKVA 1PF7E 4DLAA 3VYUB 2DBRA 5BVHA 1F2UB 1VM6A 2Z8ZA 5JJ5A 4OH1A 4AYTA 1VSVA 3KZCA 1A0OA 4CWAA 5KNBD 1GR1A 1JR3A 1PD0A 3H99A 3ZV5A 3HKBB 1O5OA 3ENKA 1KSJA 3AKYA 4KR9A 4BPBA 3QU4A 3V9AA 4D9CA 4EB6A 5K8VA 3R75A 4ALIA 1E99A 1SKUA 3SDZA 3E03A 4TMWA 2FE4A 5FEUA 5JSFA 1Z83A 3L41A 1ZD9A 4IL5A 5ALOA 2C5SA 5HCNA 4G5QA 4WNAA 3B3GA 5H02A 3AR5A 3M49A 4YJ3F 5FEMA 1U8YA 1VBNA 1YQWA 2X2FA 3I9V6 2WD9A 4Q01A 5GTDA 1QFJA 2FNAA 3K5IA 1QF6A 4QSHA 1SU7A 4CF6A 2GN6A 3HP4A 1AKWA 2D06A 2WJAA 1LBTA 5IVKA 1ZU4A 2EKLA 2WE8A 1MABA 1N32B 4D6PA 3Q9NA 4TRJA 2HSZA 5BO5A 3MAJA 2CFRA 1QIKA 2AWOA 3IURA 3EVZA 4TTQA 1PHPA 1QJCA 2WKRA 4FKBA 4NHEA 3PA6A 1RCUA 3DT9A 2IH2A 2NU9A 4RF2A 1JHUA 4OBEA 2GBFA 2EKPA 3AEQA 2B1QA 3MF4A 1NIJA 1QF9A 2CHVA 2WNHA 2ZWOA 4LHWA 5E1OA 1ZUNA 5CM2Z 1O94C 3OIDA 4FKZA 1I7DA 4P81A 3M6IA 3VJRA 1UINA 2ACVA 2YL2A 3F6CA 4JT9A 2PUDA 1W93A 2A7QA 2I78A 3DFZA 2W8BA 1GGMA 3AL0C 1RYEA 3B1WA 3DQPA 3WGJA 5K0BA 5KYNA 4DLTA 4M6WA 4PPFA 4ND2A 1EWTA 3ZGOA 4URXR 1EYZA 2BW0A 4YAWA 4BQSA 1H5QA 4UHDA 4C3UA 4C4PA 5HIMA 5DHFA 2QD5A 3BQNB 4XDZA 4ARVA 2VHZA 2Z5GA 4BB5A 3KSMA 3DMNA 2CUKA 3DOJA 4Y9RA 1PX2A 1UBOS 4X6XA 3W6ZA 1LBHA 3IMFA 5A4FS 3IVMA 1OSNA 5F1PA 3DH0A 2QLLA 3UAOA 1JMKC 3U3JA 4EVSA 3KQLA 5CTJA 4L5IA 4BX2A 1EBBA 1Y8QA 3B6IA 5C3UA 5HZKA 4QM6A 2WAYA 4UVIA 2HC9A 4MH0R 4M8SA 3L7KA 3SQMA 1XEAA 1EQ2A 1Y5IA 1WXXA 3ROPA 4AJ2A 3L7AA 4RJJA 1JJ7A 4MZDA 1I80A 5REQB 1JYFA 2I8AA 1J8YF 3E9ZA 1DIGA 1J0EA 3E9RA 5CVTA 2PRIA 4L4XA 3B12A 3K1AB 2P9BA 3HXQA 1PT9A 4R84A 821PA 1KYZA 5IM4A 4PAOA 3WQRA 4INJA 5LYYA 5DISB 3IIMA 3VVBA 4IZHA 5EAIA 4CM4A 5F4BA 2RCNA 3V3KA 2G28A 1EFVA 2OLJA 3VSBA 4OM8A 2ZGVA 4E15A 5IDWA 1NSYA 2P6OA 3TGLA 3E4CA 2H4XA 3PITA 3FWNA 1OTHA 3M6WA 4HKTA 5CTAA 1PU2A 2HEIA 3F6BX 1GGJA 2H4WA 3FA2A 4E5SA 3EFBA 3C85A 2CMGA 4DG5A 4MCHA 3AVVA 1NNI1 1JH8A 4F2GA 1MNQA 4C22A 2PH3A 1T5TA 3K30A 4B7UA 3DULA 4CDRA 4NWIA 3GNLA 3JQAD 5CLLA 1FSGA 1H2HA 1M2OB 1NVXQ 2QMYA 2XE8A 4RIEA 1VMDA 5BNIA 3KETA 4ANFA 1VHTA 5AHXA 1B6SA 3GUYA 4PYLA 2V9ZA 3P9SA 4DHEA 1AT1A 3GGSA 2ODPA 1P4GA 3P9ZA 4URZR 3OCYA 1UBMS 4KN6A 3H2YA 4YLYA 3A37A 1KO1A 4LMPA 2FP4B 4MKHA 4PQYA 5A4AA 1D3AA 2ECOA 5TVKA 3EH2A 2B83A 2QTVB 1X7ZB 4KQGA 1AK9A 3MRTA 1W59A 2I4LA 3AHJA 3ANSA 3Q3CA 1MXFA 2FFAA 3V1UA 3H9CA 5E3JA 1F8XA 2ADMA 5J2TF 3GJZA 5T8KA 4EBFA 4LDRA 5CMLA 4HYQA 1N8KA 2MYUA 3UMMA 3X1YA 1YDMA 3VPSA 3HCPA 3EQ7A 4KP7A 3SBDA 3L7JA 3U3DA 3EVBA 2X2OA 3FIUA 5LBIA 1JS1X 4FSHA 2QW8A 4R0MA 3L82B 4GYWA 1AY0A 3KB2A 5C8XA 4D25A 4PX2A 4PS1A 1KFCB 1BGVA 1UF9A 1SOVA 2PO5A 2DC1A 2GD2A 3BFJA 4I5FA 3VV3A 1A8HA 2Q8QA 1MRZA 3QU7A 4G4IA 1P1RA 2JI9A 4NBLA 3I61A 2BGWA 4NULA 1MO2A 1ADJA 4C4OA 2FZGA 2SKCA 1F17A 5LZ2A 2SHKA 1FP6A 1AXEA 2H65A 4RMHA 4OHRA 4QQRA 3CEPB 4JEHA 2AIRA 2H59A 3OZDA 2L69A 4NV3A 1YK1A 4R2LA 2VUSA 2O2YA 4WNIA 5JMOA 2PMCA 5KNLA 3T9BA 4F1WA 3V8PA 2X2PA 4ZRDA 3AO0B 4DARA 1N34B 4E11A 4FQ8A 1ONOA 2UVDA 2G5GX 2C9CA 4WZZA 4AMVA 521PA 5IM5A 1KMQA 4LRWA 2FPKA 2BFDB 3VI3B 1CJUC 2V1XA 1FS6A 3VDQA 4DLNA 2OV1A 2QE6A 4IDAA 4L5CA 4LK2A 3SIWA 1BFUA 1YS9A 4EUEA 1VCHA 2C99A 4JJIA 3KJIA 3PC6A 1JA0A 4KX3A 3ZOKA 1TK2A 5AKLA 2DE0X 3IH5A 4CL8A 3O7WA 3TTYA 2DR0A 3GMSA 2FW8A 3CSUA 3AIOA 2WHPB 4CETA 1HE8B 4MW1A 2C5GA 4K6FA 4BWFB 5H8WA 1F06A 2CDBA 3FBWA 4JL8A 2HQBA 2IX9A 1OXTA 1T8UA 4HJRA 2KJQA 3CM0A 2QW0X 4P4UA 5C8DA 3OE5A 5ETJA 1W49A 3I45A 4H2DA 3RYHA 2O2XA 5CLHA 4Q4LA 2BC9A 5DW3A 3AUTA 3KZVA 4EY3A 4OBXA 1P2BA 1GPDG 5U4QA 3KQTA 1HT0A 3ANTA 5EQFA 5HFAA 2UZ1A 5L7TA 2GPWA 1Z4IA 1ZHOA 4F3TA 2RAFA 2WAAA 4JITA 5K20A 1YS4A 4B4WA 3COPA 5BXYA 1E1RD 4KHZA 1H1TA 1P72A 4WOKA 3UT5A 3WY9A 2OCKA 1Z2OX 1DGQA 4XSHA 3V34A 1PGPA 5ALKA 3BREA 2XXBA 4NYJQ 3HL0A 1ZJWA 1YWGO 3ILSA 4A6EA 4HRVA 1DFGA 3H11B 1P9NA 4UFOA 3U17A 1W5AA 4YIKA 4F3KA 3VPXA 4YCCA 5K3OA 1FBTA 1R4AA 1XKTA 4YFVA 3B2EA 4WFKA 1F6DA 1CIJA 4EJSC 1G8PA 3EUAA 3BMCA 4V03A 1N7HA 2HBRA 2LKDA 3MS4A 5TQ2B 5L3RA 3T7CA 2I8LA 2N46A 2JLZA 4KFCA 1XWIA 1YO6A 4DC0A 4DRYA 4AXBA 1PV4A 1BE1A 4HN4B 1LPPA 3MJCA 2M6KA 1N6NA 1S8OA 2AN4A 3H5WA 3HR8A 3LCRA 3B89A 4QRHA 4XB1A 4BWYA 1E3WA 1NTRA 1LSOA 1X42A 4WDQA 2PNFA 1W9HA 4L78A 5DGDA 3MNFA 1K1EA 1JR3D 3O4VA 5FBWB 1Y1KE 2BGMA 3DZFA 3NIFB 2ONJA 4JYMA 5K7SA 3KELA 4OHPA 2Z6VA 3JQ8A 2NV0A 3IAHA 3VGJA 1SXJB 2PT6A 4PN7A 2XH8A 1KE1A 4ZYWA 2ZUUA 4Z2AA 4GR5A 3OPYI 3X1ZA 1K6EA 1ZM3A 4Z3KA 1ECJA 2ECKA 2J9XB 4DNXA 5SV2A 2RC6A 4Z5XA 3PUXA 5JH7A 4L4RA 4WXMA 2F17A 2XECA 2VCYA 4D44A 2O8CA 3AGQA 3Q8LA 3J7TA 2E5LB 2C4UA 1VG1A 1ZD8A 3MWFA 4V0QA 5KWEA 1L7XA 1SUWA 1JDBB 4U7GA 3TXAA 1G3QA 1K97A 3JQCA 3V6LA 5AUNB 3INTA 3PFHA 2OXFA 4OB8A 1ZITA 4G63A 5FWXA 1RQRA 3MWGA 4G9BA 2MINA 1R4MA 3M3DA 4AUNA 4GQAA 3Q5EA 1V7PC 1YB1A 1NRJB 2BGGA 4RF3A 3UWMA 2DCMA 3C48A 3G9TA 4Q19A 3VFDA 3FZNA 1SOWA 3ZHYA 3TLKA 5IWAB 4DL9A 5I7UA 2VSYA 4EA8A 2HIAA 4PPGA 1EBFA 3V8NA 2C9OA 2G04A 3JX9A 4NCIA 1R5NA 2FA9A 4JBYA 1YR7A 4ZO8A 3WNBA 1EKXA 1P0CA 1TD9A 3JQ9C 4ZKEA 4ZT5A 3W6PA 4QBKA 4R2XA 2PSJA 3L04A 1FW8A 4E2YA 1O6GA 1VYVA 5EWJA 1W0JA 3BDVA 1FFAA 3PEEA 4ZANA 4C4ZA 1BNCA 1HYEA 2DPMA 3WL8A 4XDYA 5I7RA 2R6AA 1FYFA 3PD0A 2ZIZA 3GRAA 4TVOA 3OOJA 4NYJR 1D9XA 5KQGA 1MENA 1W2HA 1YKSA 1H42A 4E5YA 1DZIA 2AN5A 4RH0A 2IZ1A 5E6UB 4QX6A 3L7NA 3INGA 4FX2A 1P45A 3H3FA 4BO2A 3MIZA 1MV5A 2MSKA 1YS6A 3NG1A 1RLJA 1UDWA 1VI2A 4JUAA 5IT5A 3VNVA 5CDFE 3C8HA 2IP1A 1EWVA 2E4YA 3UHPA 4NFSA 4E22A 2VR1A 2QVZX 1XEWY 3D7MA 3MUNA 2GN8A 2V9CA 4J9VA 1NJSA 3GD5A 3SEFA 4DQLA 4HDCA 4DV1B 4PF1A 4Z9FA 2XE7A 2JFVA 5FPYA 5EJ4A 2BSQA 1XGKA 4JXXA 1SRQA 1KSGA 1I2BA 1L5QA 3ZH2A 1TMGE 2F62A 1PWEA 4Q3LA 1JUDA 1C2TA 3PKIA 1XNQB 2P91A 3DM9B 4FIZA 1GTZA 1KYVA 5AI8A 4YRPA 5FTJA 3THRA 3WL6A 3FHOA 5DOVA 3NYWA 1L4MA 3FMOB 1RJGA 1BVRA 4PPNA 5JWHA 2RARA 3UXEA 3CF0A 3TZQA 4C29A 2HFJA 1F8FA 2NO9A 5BWCA 2Y4OA 2P62A 1GZDA 4G3XA 4LNUA 1EIZA 1J0CA 3KE8A 2OL4A 3GDWA 3D81A 3OJLA 3QTLA 4O1HA 4WCVA 4X1YB 4V0OA 3V2HA 1LY1A 3LL7A 2VA8A 1EUCB 2GF2A 4YQEA 5ED0A 4R31A 1E79A 1Y5RA 1N25A 3EDOA 4KIUA 3I1IA 1L6IA 1SG9A 3A1EA 4NZ9A 1XALA 3EQ9A 2IS6A 3PPXA 2BF7A 1SHLA 4ZEOA 3DO6A 4YO7A 1YUMA 1Z0AA 1U5BB 5CD9A 2VA9A 2O23A 5LQDA 3SQNA 3C5CA 3QXGA 5TMEA 2D7CA 5JRZA 3W5DA 5H4GA 2Q0SA 4MGYR 1DXYA 2MYPA 4HWKA 1LU9A 4MR9A 3ONNA 3RIMA 3UIEA 2DU8A 1YAHA 2DBYA 2ZRFA 1T2VA 5CG2A 2AYZA 2YHIB 5D5QA 2QA5A 2X58A 4AX4A 1OU4A 3DYIA 4JBIA 1RZUA 3ZCRA 4D4IA 5GV7A 4EKIA 3EXG2 3D3NA 3PK0A 3VSAA 3MGGA 4V0KA 4IOKA 4MAMA 3SP1A 2P0YA 4YXFA 1JJVA 1W1UA 8ADHA 2D5BA 4Y2UA 4BQPA 3I9NA 2CD7A 2CHUA 3ZE7A 1W5TA 2ZRIA 3FZYA 2HYIC 1YCDA 3W1EA 2PIDA 1R12A 4ZZIA 4C5BA 1CRWG 2ZYTX 2QXYA 2AFVA 2ZWMA 4WERA 3S6JA 1EXDA 2P4SA 5DHUA 3C6ZA 2NVOA 4M7WA 5FA6A 3G2HA 2RGUA 5U1PA 1XVLA 4KRFA 2J6HA 1CUGA 1D9ZA 2P1ZA 4GSLA 1A9QA 2WU8A 3O82A 4TVBA 3WFZA 2KS6A 1HE5A 2A78A 4MULA 1DT5A 8OHMA 2W6JD 3BH7A 4J16A 1N8NA 3Q11A 4TTRA 5CT4A 5I4CA 7MDHA 1AGYA 2HSDA 2PZLA 3IMGA 3MQ2A 3QX9A 1KFBB 1NUTA 2H92A 1C7QA 2J08A 2VNKA 3DL0A 4JC5A 5AD1A 2JJYA 3DNPA 1NW9B 4RMNA 4YMLA 1S8AA 2PH7A 3FG9A 1TF7A 1SKAA 2BR3A 5MGNA 3SSAA 4WGFA 1YBFA 2CJXA 4R3NA 4GECA 5COAA 4RH1A 1DX6A 4A16A 3QLUA 1Z2DA 4ARZA 4BJ5A 1XRMA 3OT5A 5B6IA 5JYBA 1OROA 1U99A 4TUYA 2HMUA 4MIKA 4WZBA 3CH6A 2ZUEA 2QYHA 4FFVA 5LD2C 1LLFA 1QIJA 3OPVA 1NJ1A 1Y42X 2B4KA 5GAJA 4ZCQA 5EWMB 2HGSA 1QZZA 4FZVA 2Q5IA 3NANA 2OSBA 3U09A 3TBHA 5LU9A 3RVJA 4D9KA 4EAAA 4EYQA 3VZQA 5HHTA 1UAAA 1PW7A 3KQOA 4MKZA 1B1CA 1G17A 4BAGA 4D8YA 4NBUA 2JG3A 1OT3A 1I2AA 1R0KA 1WOMA 1TCCA 2G40A 2QNIA 2L17A 1OYWA 1IULA 3FPAA 5KOHA 3TLEA 3VZDA 1V5EA 2PUJA 4UMFA 3VU1A 4BAUA 4H7PA 2AOTB 3DHWC 1KFKB 3S81A 2P6NA 3N76A 3ORQA 4ZJZA 4WK0B 2FSUA 1F4VA 2LV8A 3C3BA 3DONA 4HK4A 5G0VA 4GC5A 3ZVRA 2O7VA 1TJ3A 3LUCA 2W2QA 3SJ7A 1L3IA 1NASA 5EJEA 3O8BA 2BI4A 2C4WA 3LFTA 5JQGA 1NDQA 1E7MA 2D0IA 1A8SA 1GU1A 2YDYA 3PUHA 3WJAA 4NCHA 4WSOA 4DS3A 1SK8A 4EPTA 2J5KA 5B4VA 4NNOA 2P40A 1KY4A 1E58A 1FNNA 1JIQA 1IBMB 1XNJA 3V55A 4J1QA 1JDUA 2CZCA 1UBFA 2PQMA 4QOSA 4YMIA 2PXHA 3HCWA 3R8XA 4CYMA 2CVOA 5CB8A 4LFBB 1QH0A 4OGWA 3EWSA 1UPTA 3TW4A 4IDHA 3NU1A 1I0ZA 4EW2A 2JFOA 4NOKA 3THSA 1O54A 3OLVA 2JGJA 4DZZA 5G41A 2W2MA 1T1GA 4QUBA 4EEZA 2FJUA 5CA1A 1OB2A 4F91B 4BYMA 1WR8A 1J8DA 1D2CA 4QGBA 5AXAA 4R9VA 4BO6A 1GRCA 1JHOA 2QSJA 1Z0UA 4V0ME 3AEYA 3QKIA 3TB4A 5KQSA 2ZAGA 4B82A 3HB7A 4IIHA 5JCZA 3KKZA 1J06A 1KF0A 1V0JA 4OEHA 2J3EA 3IOCA 4GKVA 4YN3A 1YKGA 2PG3A 4EDHA 4ENQA 4CIBA 5FIUA 2H08A 2GZHA 1Y80A 1U2PA 3W9UA 3A6GA 2ZCJA 2EVWX 3CR7A 2OT3B 3L4BC 4KOAA 1D7OA 3GQBA 4WXEA 4QOIA 3K0HA 1ISHA 3RWBA 5SZHB 4OYRA 5FV4A 1H1LA 1MHPA 1ADFA 2V97A 1QIIA 3DLAA 2B69A 1J6UA 1DKQA 3MGKA 5LA6A 3KBBA 3I58A 4URHA 5T7BA 1G3MA 1E77A 1IDOA 3OE1A 4OQQA 4EZIA 1T9AA 4FJ2A 4QTTB 4A73A 4ME6A 3I5YA 1BE0A 2CDRA 3W4KA 1YA8A 3ABRB 3BMOB 2OBFA 2E49A 5FDFA 4Z7JA 1L7MA 3FNGA 1XWWA 4RPJA 3C4QA 3GZNB 1A9XB 3DVAB 4JOSA 1I6LA 2GX6A 2O5EA 4FFSA 2ODBA 1NC3A 3UH1A 1MOQA 2R6ZA 1RWWA 2H29A 2CY0A 2PV7A 3TNFA 2YV5A 1W0JD 2C42A 1CUJA 1VXOA 2BUBA 3N3BC 4GVXA 1P1FA 4PGFA 2GEBA 2PZAA 4N7MA 2R11A 3V7FA 2PBRA 1Z4QA 1LVGA 2QLNA 3ZE8A 2A33A 1HT1E 5AI5A 1QQBA 3LHDA 1V3QE 3TMAA 2L2QA 4JU8A 4RMIA 3IQWA 3EC7A 3Q0IA 4JN6B 5JZOA 2ZANA 4V0RA 4O4HF 4Y2XA 4V0MA 1SKYB 3BL8A 1ZUHA 3AILA 3I0MA 4IUDS 4U0KA 5JC1A 2ECFA 2OECA 3HSSA 4D3DA 5DP1A 3ER9A 4QOFA 4WHMA 3B70A 4AO8A 1V43A 4M0KA 5A7HA 3OCCA 3WGZA 2NXEA 1NUAA 2JA1A 2ZLBA 4FDLA 4O4LB 3IVGA 1G9SA 3UKJA 1UMCA 3GCDA 2H4ZA 2VBGA 2ZE7A 1P1BA 4EI7A 3QHAA 1ABBA 1WSAA 2H8KA 3L9XA 4WJZA 1POXA 1O96B 2QD4A 3K1JA 3SXPA 1YDWA 1P1CA 4Y18A 4ENTA 3RFFA 1SVSA 3HXPA 1D09A 3DBRA 2BGNA 4DPMA 3CNHA 4P38A 1LLDA 1UZLA 4MRRA 2LWIA 4OOFA 1EGQA 5DM70 3IAEA 1AGRA 1Q3HA 2XCQA 4Y9TA 1FNBA 3WGNA 4D6YA 2VRNA 3M9XA 2A35A 4QQKA 3R0VA 2BFPA 3MJVA 5JPIA 1EA7A 1BO6A 2VDRB 2ZSJA 3E3LA 3IHKA 4YDSA 1W94A 5GONF 5CB6A 5FUBA 2CFCA 3T5MA 3VU9A 4U63A 2PGLA 3CNEA 1RHRA 1EXWA 2UU9B 3ZNQA 1Y4ZA 3KUXA 4DT1A 1RBYA 1G2OA 3KB6A 3CE6A 4N01A 1E79D 2DH6A 2DWPA 3ZU4A 3OOWA 5AOCA 5J4VA 1M5UA 1CY0A 1ZCAA 2V7XA 3ZJ5A 1BDIA 1CU1A 3EEYA 1YAJA 3OM9A 3STVA 2X3UA 1NULA 1XDZA 2FDXA 2HRDA 2OZLB 4IRMA 4MV5A 4PYNA 4I4NA 4DM3A 4X7RA 2PRJA 4CF5A 4U6SA 4W6ZA 3FCOA 1O9HA 1MVOA 2WQ6A 1SB8A 2OGWA 2V6MA 2VH5R 4QXMA 1E2IA 5DWDA 4ETMA 1XJQA 4F0JA 1ZGAA 2RKWA 4BCCA 3WWEA 1SNYA 2F7SA 4YRNA 3EULA 4ZIRA 2XY4A 2HA0A 4UVDA 4BFYA 3HTXA 4PTLA 2E4WA 4JDPA 1D4ZA 1E6EA 1Q3KA 3WYAA 2Q07A 5B7QA 3PHJA 4Z49A 2HCRA 1DV2A 1SCBA 2C07A 4I50A 4YUWA 3LPNA 3RKRA 2FRXA 4KITB 3GFSA 5KX5A 1DHRA 3JSXA 3WRYC 1U90A 5JAQA 5BNFA 4CCWA 3Q7IA 1SUSA 1ZOLA 1ZYUA 2QY6A 4B43A 3UXHA 4W5NA 1W0KA 4E6PA 3NDIA 1THGA 4MVJP 2TSYB 2M98A 3IRUA 4D3XA 4W1QA 4WPGA 1A97A 1FJHA 3JAMA 4LXQA 4M86A 1JEYA 2ZT7A 3VR0A 2D8MA 2FSFA 4KXMA 4P58A 4RIGA 4OHKA 1NIPA 1WXEA 4O2RA 4EFMA 4FNAA 2EATA 5EIEA 1EJ6A 4M89A 4UZFA 4WK6A 2O0KA 3SCZA 2C88A 5AI4A 3LLMA 2P1RA 1GCIA 3MD0A 2HK8A 3O1JC 4JLNA 4EG8A 2W42A 3EBLA 1XV5A 2VPTA 4CKXA 2IZ7A 1PTJA 4X54A 1Z6PA 4OF4A 3RD5A 1C9YA 1EQAA 4GOJA 4UPVA 2G0NA 2IOQA 1EJ2A 1W4LA 2O4UX 3NBMA 3LK7A 4GGPA 5T3UA 2OZKA 5CT9A 3KKQA 2XCIA 4J0EA 1K5PA 4QVIA 1N0HA 1VZ3A 3PVZA 1U2GC 3QKWA 3OFKA 4DDTA 1R6BX 2CF5A 1K88A 3BH6A 3DEKA 1J7JA 5DV9A 3KTDA 5IYZF 1K6JA 3B2NA 1NXSA 2P2ZA 1T8PA 2EKZA 5LUBA 1QHNA 2H85A 2J6CA 3G6KA 1E6UA 4WBNF 1GQ2A 1KL7A 1W88A 3GXBA 4ZARA 3SJUA 3OOHA 4MYRA 5JNRA 3Q85A 2REBA 1OH8A 1P5FA 1H3EA 1Z8HA 4HQLA 4NU8X 3IOEA 2O8FB 2W2XA 3IP8A 1JAZA 1XR3A 1X1EA 4JOBA 2XE4A 3GLVA 4BVLA 2R65A 4RF4A 3S40A 1YB4A 1Q14A 2GBLA 3X1JA 4BC0A 1IY1A 3TGWA 3EDYA 1DRKA 1J07A 3QK7A 1RXVA 2O8EB 2BZSA 2EF0A 2RJNA 1N2EA 2VJPA 2DTDA 1PDWA 1E32A 2BMWA 5I3ZA 3JCZA 3VTZA 2UZAA 2FQ1A 4TMTA 3ZGNA 1S6YA 2VDWA 4AU1A 3UCFA 4DLBA 1IQ0A 1KP2A 1U6JA 2GM5A 2OO5A 5YASA 4D45A 5JE8A 5CCBA 4FK8A 4PBSA 2VXCA 5KSWB 1NRXA 2OBLA 3BN3A 4Z54A 3AG5A 1NQAO 1XZ8A 1KO4A 2BEWA 3AUJB 4DCOA 1K06A 1UQTA 2RIPA 4K87A 3TIFA 3QV2A 1HSZA 4HPWA 4PNHA 5JPDA 1C9KA 4LC9A 1P4RA 2A4MA 1H4SA 2VJDA 3PCTA 3PUIA 1X38A 3OCJA 4ESVA 1XTTA 5AM1A 4RZ2A 3RKSA 1U5CA 1TO1E 1LI7A 3OP4A 4CUJA 1QZUA 2XA2A 4NOLA 2QZZA 5JXWA 1KQ3A 2HJSA 3KKNA 2C5AA 1WKBA 3E3NA 4KXUA 1POWA 2WV9A 3LNTA 3M6MD 3A06A 5L53A 5LQNA 1SCAA 2C7OA 1X77A 1GNLA 4JLAA 2VPQA 1PQUA 4X24A 3NH9A 3DE0X 2WPDA 3MWDB 5C7LO 5AVKA 4DSOA 3QIAA 3BZUA 3ZYZA 4C0SA 4UTVA 4JBNA 3ZS8A 1KK3A 4JI2B 3BIWA 1IUKA 2HJVA 3H87A 1EFRA 3U3ZA 1ZXLA 1AQIA 2NZ8A 3WJ7A 3HYNA 1E9RA 3AERA 4R7TA 2WTUA 2Q28A 5EPOA 5A4IS 5E7IA 1MQAA 3OAAA 4IIDA 5K6RA 5LYJB 1MXHA 1MHTA 3ZJUA 3UA3A 2IEGA 4QSMA 3RLFA 4R81A 2B4AA 2P4UA 4IIUA 1GNVA 5KOIA 4FNGA 3K3PA 3NTLA 3W5AA 2X3YA 1Z7YA 3JTEA 2PKEA 3RT9A 4FYPA 5J5VA 4PLZA 4KDEA 3LY5A 3C1TA 1FXSA 3E70C 3P20A 1DOAA 5U9CA 2B99A 1GM5A 3FIJA 1N2SA 4EG7A 221PA 5BQ3A 3U5ZB 1JG4A 2DJ5A 2FXVA 2J9RA 1LVUA 4I36A 5JO9A 1JHVA 3V7YA 4AY2A 2L18A 1QUFA 3MWJA 4EKDA 4OJTA 1YZQA 3IQEA 4J7CA 3M6FA 1P33A 2JLRA 3M4XA 5JC8A 2ZTLA 1YQXA 3E0QA 3TZBA 4RF5A 3VOAA 1IE3A 2E6KA 2Y93A 2GNPA 4BZQA 4LOLA 3BMQB 1M8GA 1ISPA 2B8EA 1STOA 3OZXA 1Z45A 4OSPA 2ZSAA 5F1YA 5GPBA 3K53A 3GJ6A 2C2OA 1M1NB 2P2YA 3SBXA 3GLHB 1A5TA 1JEQA 1IRIA 2IYTA 3CLUC 4NZOA 4D92A 4Z7NB 1KI3A 1GILA 1SFRA 2YXDA 4C3VA 1F12A 1EFDN 4HGNA 3I9LA 4CG2A 1S1MA 3A6LA 1I7SB 1K6XA 4LDJA 3JYPA 4X61A 3ACBA 1YI8A 2BCJQ 1O9GA 4V0SA 4X71A 4ZCLA 5B2FA 4MQFB 1CS4C 1DUSA 1WD5A 3FKQA 1A9OA 5FD8A 4AKTA 2IYZA 1NU8A 4KK3A 3R44A 2NUTB 3MUEA 4MNTA 5I8ZA 4PU0A 1P81A 3R6DA 3KJXA 1FS5A 2OXCA 4I19A 2HT6A 1GG8A 3WKBA 4JC4A 1QB7A 1IUOA 3SSMA 1VJRA 5IN4A 1NURA 5JADA 2BZGA 4G5YA 1KJ9A 3WQQA 4NI5A 1XNRB 4HC4A 1QBKC 1WUKS 2J5XA 1ZNWA 3CIFA 1XTRA 5EQTA 2NACA 3I04A 3RIHA 1XQYA 4XGKA 2VP9A 3SOPA 3W05A 1H94A 5JWRA 3N70A 4DJAA 1ITZA 3T1QA 5BV8A 1D2HA 2G0TA 3OKCA 3JWEA 3H05A 4K6GA 4DIMA 4OA5A 4YAKA 1RSZA 1YZFA 1RI5A 4RHTA 4GEGA 2YRFA 4LV8B 1U9ZA 3W8FA 4OVKA 1ADBA 3DCNA 1ZUD1 1I3CA 2B1JA 2W0SA 3IAAA 2PX2A 5K0NA 5DXJA 5BSFA 3BE4A 2DVMA 4QYSA 1KI7A 3C6BA 2JLXA 5CVVA 4FGLA 2YWDA 1Q0QA 1M0SA 2H0AA 2IYWA 2LUOA 3ZWQA 4YT4A 1YTLA 3HGMA 4QZVA 1G60A 1E1YA 1MD9A 4OBBA 2EYQA 5SZIA 2QQ0A 1GLNA 4RKWA 1EEXB 4YMVA 2QRVB 1G42A 3RUFA 4OYYA 5K01A 4V1CA 1HA3A 3IQIX 4MLCA 1Z4MA 1PSDA 2WYWA 2YS6A 3A28A 3M6VA 3GRYA 2YY6A 5LP1A 3R3JA 2R751 1OAKA 1YRHA 1U7XA 3SQWA 1MAAA 3U62A 3FNEA 3HXOA 3FE2A 2YJ6A 5CCDA 1IJBA 2VPXA 1FOEB 1LLQA 3CPSA 1J39A 5IULC 3E58A 5FP0A 1RPAA 2JGKA 3A4LA 1XLTC 4MK4A 5IAGA 5DNDA 4NVRA 1WXIA 3S70A 4E5NA 4RTPA 2FUEA 4IIEA 4Q4JB 1W34A 4PC6A 5CP8A 2EP8A 4YDHB 2RGAA 4IG9A 2CVHA 2C9DA 1FFEA 1W25A 1TYCA 2Z9DA 3WGVA 2R7KA 2NT4A 2YDXA 4K9LA 2MIIA 3LTNC 3VUFA 3TTXA 2JVIA 3S44A 3KUUA 3WSVA 3SS7X 1G8FA 4IMIB 3MGAA 4DOMA 4ARIA 1NMEA 4X5OA 3THWA 4FB5A 4RFLA 3ZD8A 3K31A 1W0KD 1J7KA 3QMMA 4HGPA 4KVAA 3ND5A 1Z0IA 2ZS7A 4MW7A 1NXXA 3T3IA 1NBAA 5KC8A 3E2IA 1UM8A 2RK6A 3RV3A 2IGTA 5IU6A 3MBIA 4JZYA 4BBPA 1JLMA 3K92A 4MZXA 5I9LA 4OH7A 1JKJB 1XEXA 4QODA 3WMXA 5ADWA 1SHUX 3NBQA 1Z17A 1FX0A 3A6HA 3SF8B 1J42A 3BCHA 1K4MA 2CL5A 2OOSA 4FGZA 1W4BA 2G77B 4NU0A 1JQLB 5F4ZA 4YWHA 3ZLBA 2ZI5A 2P3OA 4XYBA 2KI5A 4B8YA 4TV8B 5KWSA 4JI0B 2FMKA 1J1UA 4KRYA 5M2QA 4Y7DA 4YJHB 1CJSA 2YH2A 5LP6F 1GGKA 4MDEA 4B2YA 2P4EA 3NBYC 4CUZA 2LDXA 4X1IB 5G02A 2ZG6A 1KJYA 1PJQA 4E51A 1APBA 3EPLA 1LUAA 5DI9A 2OLKA 1Q17A 2QPOA 2Z08A 2WEKA 2DMRA 2GN2A 2K4MA 4YRMA 3KQKA 2XXAB 4BNKA 3RAGA 1QB8A 1JIJA 3BXGA 3ID6C 4TOIA 1RLTA 1D4FA 3ABZA 4IJWA 4NP6A 3IELA 3FFWA 3L6DA 1E4EA 4FFWA 3KLNA 1N5MA 2GRAA 2L82A 5C18A 1FLVA 1NSFA 5F1OA 5BVGB 1UFQA 2IZ0A 2V5AA 4K1XA 1PWZA 3LCMA 4DSNA 4PBTA 5E6RB 2NQ8A 3I9MA 5KTKA 1RBQA 2XYHA 3GRVA 2G82A 2DY1A 4LNHA 2R68A 1AQLA 1COZA 4ID9A 1R9GA 2IODA 3OT4A 4HS4A 5IXJA 5LVAA 1WF3A 3AM1A 2EJBA 5IW8A 1F38A 4QICA 3Q9UA 4GICA 4PZEA 5HG0A 2AVNA 2BP7B 1LC3A 1AQJA 1EE1A 1G7SA 2OESA 5ILGA 3L0PA 5CYFA 4M99A 4MVJG 5K3FA 3UOAB 3GQVA 1EHCA 5EP4A 1ZCFA 1QM5A 5AVRA 1NAIA 4N3NA 2ONYA 4RZQA 3W7AA 4A7PA 5AVTA 3RU9A 2I3DA 1ORWA 4X93A 4DV7B 4A8HA 2R9VA 2Q3DA 4AJHA 2K2QB 2JJ2A 3L7DA 3ER8A 4O2AB 4MR7A 3VZCA 3G9ZA 1W36B 4GRAA 4P82A 1XYVA 2PRKA 3U2QA 3HZHA 3VYVA 3VKWA 1LK0A 1E9EA 2J3HA 4JUDX 1JZTA 4LQCA 3QJYA 1FDWA 5JMPA 4LAFA 3QVMA 3CG4A 3FGNA 1SXJC 2GM4A 2A94A 1E3LA 2WPDD 1RHKA 2Z83A 1A4RA 3DP9A 1A8QA 5EWLB 3OJFA 5K8UA 5KBYA 1GQOA 2CB0A 5HPYB 4ZD6A 5BOVA 1K6IA 2EKBA 2EYUA 1PZNA 1EFRD 2X42A 3A6KA 3MMNA 3A6FA 4C07A 5KYXA 3ICEA 4FE4A 1LF5A 2H4HA 3JQFA 2YS7A 1EP9A 2Q21A 3OAAD 4DMUB 3VC7A 1ZQ9A 1WOYA 3P0EA 4DNFA 1NZFA 2FQYA 4F6RA 1NJ2A 2GD0A 2PXCA 2ZTUA 4NBVA 1EAMA 2GLTA 3A9RA 4ZDKA 2JAWA 1RC0A 4FDVA 4MA4A 2H1IA 3NATA 3WK9A 4ZHQB 1M8KA 4KQ6A 3LBNA 5JFTA 5IAKA 1G291 2R8YA 2O19A 5TGZA 1B2RA 4UHEA 1GP2A 4QHYA 4RENA 1VFNA 1HY3A 3NVMB 2VK8A 2DLNA 1Q74A 2ZSKA 4LSMA 1KI2A 4OGKA 5ICCA 3VC2A 3G5UA 3LBAA 1J2YA 3V8EA 1H6BA 5IX8A 1ZRSA 4AWAA 1YNOA 5ALVA 3MINB 1Y7IA 4I46A 1FP2A 1ZICA 2E2WA 4OAOA 4HTAA 4ZO4A 2BOVA 4PVDA 3TQHA 4JNKA 1PJ2A 3R77A 2P9JA 3THXA 4HEA1 3CLSD 3WV5A 2AQ8A 5FOXA 2G63A 1Y9JA 2H9YA 2IYFA 4A8TA 4B2PA 2QGFA 4RGVA 4M8KA 2IPNA 3G8AA 5EKDA 1YZTA 3D8SA 3HCNA 4YAFA 1E1CA 5TQVA 3TEFA 4HNTA 1VCNA 2EGHA 4KQFA 4NBNA 3FUWA 1DEKA 4WJKB 1M3SA 5EIBD 4G0XA 2PM8A 3IILA 4YJ2A 1DAKA 1R64A 2G5TA 4R5HA 1JHMA 1YT5A 2RFLA 3UAGA 3NOXA 2V7VA 4HUTA 3H1BA 3LA6A 5M04A 2FRVA 1EX7A 1M8FA 1RTKA 1WXWA 1ZVJA 4IRUB 2HTEA 2ZTHA 3M89A 1UDRA 4TV9A 5CU7A 3VR1A 1O94A 1WY5A 2W6MA 4WW0A 1BRTA 1Q1BA 1WSDA 4CF7A 3HO8A 2XUKA 4DJFC 2M32A 2FEWB 1D1SA 4EDFA 1PEAA 2HJWA 4DRZA 2ETVA 2DF8A 3C41J 1U80A 3IBTA 4L5JA 3OFNA 2V0GA 2G72A 3KIPA 5ERYA 3WLOA 3WYCA 1TM5E 3LLCA 4L02A 4WADA 5EKSA 2UUPA 5EJ6A 3AETA 1OJLA 1PFWA 4J29A 3I09A 3WMWA 3S1AB 4D9NA 3ONWA 1C3OB 3H2BA 4C5CA 1LW6E 3NUGA 4XPIA 5BV2P 3IB6A 5F2KA 1Z13A 3KT0A 4MUIA 3RBXA 4ND7A 1JFFB 2A58A 4GU5A 1IN1A 3LQ2A 2JJ8A 3QRWA 1G5TA 3BKWA 2C7VA 3PB3A 4IWXA 4R2WA 3PNVA 2R96A 3Q1KA 4R9UC 2O59A 3CXUA 4K05A 2GERA 3AFHA 5J2UB 3OPMA 1ES9A 1S9DA 3ESBA 2I71A 4KIWA 5DEIA 5TLSA 2H9AA 3DFKA 4W5QA 4PZUA 4MRMA 5CD1A 2RGRA 4BMSA 4ALLA 2D2XA 2Y77A 1QKJA 1VPDA 3Q3HA 1IC6A 3OIUA 5LZ5A 3ME5A 4F3RA 3SR3A 1RP7A 4ML3A 1LBEA 4N0MA 5E4TA 2I22A 2VUHB 1WV1A 3R9XA 2A0FA 2G17A 1K8YB 4UTOA 2IEDA 1ZW1A 1NUSA 1G18A 1W30A 4H3SA 4O2LA 3RRNA 1LA2A 4PO9A 4ZQFA 3W5BA 1MW9X 1XHFA 3ZBQA 1QPBA 1I2MA 1XMSA 1L9XA 1J21A 1Z6AA 1CZNA 1P2VA 2XUZA 5JW6A 3JWHA 4H27A 1RAHA 1JHDA 1DT3A 1OLUB 2WB4A 3IEIA 4P3NA 5F2EA 2YQ4A 4I9UA 4U7PB 3GZ4A 4UQOA 1TK3A 3KVVA 4NJEA 1GZ6A 3C3JA 4Q05A 4NDNE 4LCBA 1NVDA 5G40A 5CEFA 2EV9A 2E85A 3ZZNA 1PE0A 2Y1OA 1SU8A 2Q3BA 2I54A 4KJZA 3U81A 5AVSA 1B6RA 1FTQA 2BH9A