1ESCA

The molecular mechanism of enantiorecognition by esterases
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
302
structure length
302
Chain Sequence
b'DPVPTVFFGDSYTANFGIAPVTNQDSERGWCFQAKENYPAVATRSLADKGITLDVQADVSCGGALIHHFWEKQELPFGAGELPPQQDALKQDTQLTVGSLGGNTLGFNRILKQCSDELRKPSLLPGDPVDGDEPAAKCGEFFGTGDGKQWLDDQFERVGAELEELLDRIGYFAPDAKRVLVGYPRLVPEDTTKCLTAAPGQTQLPFADIPQDALPVLDQIQKRLNDAMKKAAADGGADFVDLYAGTGANTACDGADRGIGGLLEDSQLELLGTKIPWYAHPNDKGRDIQAKQVADKIEEILN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
publication title A novel variant of the catalytic triad in the Streptomyces scabies esterase.
pubmed doi rcsb
molecule tags Hydrolase (serine esterase)
total genus 104
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 1994-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1escA00
1PP4A 1BWRA 4JJ6A 4JJ4A 2WAAA 3MILA 2Q0SA 4K3UA 4Q7QA 3BZWA 3DT9A 4HF7A 1ESEA 2W9XA 1YZFA 1ESCA 3DT8A 3HP4A 3C1UA 2WAOA 3PT5A 4K40A 1BWPA 4K9SA 4OAOA 4LHSA 1J00A 1WABA 4Q9AA 4I8IA 1DEXA 4IYJA 5HOEA 2HSJA 5B5SA 3U37A 4RSHA 2Q0QA 1FXWA 5CD9A 2APJA 1JRLA 4OAPA 4RW0A 4JKOA 3SLRA 1FXWF 3KVNA 2VPTA 1K7CA 1Z8HA 3P94A 3DT6A 4JHLA 2O14A 3SKVA 4S1PA 1VYHA 1V2GA 3DC7A 4K7JA 1ESDA 4TX1A 3W7VA 1IVNA 4HYQA 5JD3A 1DEOA 4XVHA 2WABA 4M8KA 3DCIA 1ZMBA 4H08A 1BWQA 4DEVA 4PPYA 1U8UA 4NRDA 4JGGA 1VJGA 3RJTA 5A4AA 5BN1A 1ES9A
chains in the Genus database with same CATH superfamily
2WYIA 1GRNA 1KSHA 2ZRKA 4NEGA 5AOCA 5ES3A 1SVKA 2ZB7A 1B2RA 1UKYA 4WLEA 4B81A 3AVXA 3LUKA 2I1LA 1J9EA 5ULLA 1H6AA 3P9ZA 2YJ4A 3GZNA 1T0BA 3NBYC 3NM6B 1R2QA 2WUWE 2CV1A 1BKDR 4CMIB 1JG4A 3DVAA 1W75A 4A8TA 3L7NA 3PNPA 1ZNZA 4BZXA 4ZEMA 1KXZA 2PQ2A 3EDYA 5CVVA 3RS5A 4XPZA 3V1LA 4KG7A 3AWDA 1X9GA 1I4EB 2CWWA 4URXR 2FR8C 1OI7A 1R0RE 2XR1A 5FADA 4C7MA 2OGTA 3E48A 5TMEA 3MFYA 2QM7A 4X1IB 2J32A 3ZCPA 3HTXA 4Y30A 2XWPA 1MH1A 3GZNB 3HCBA 5A71A 1VL6A 2VTEA 5K3FA 4AMYA 3FGZA 2CLSA 3LI2A 4Z1MD 3GUCA 2AOUB 1JBEA 1M54A 1MKYA 3C1UA 3VRHA 2V6BA 4BFCA 1MIHA 3BAZA 2YW9A 3PEUA 2B5OA 4KGXA 1D9XA 4QDJA 3TJRA 1AO0A 3I30X 5JS8A 1SKAA 3ELYA 4MR7A 1MFZA 1J0CA 1U5CA 2AC4A 2CLKB 4XA8A 5EMJA 1D2GA 2MU1A 5DP2A 2P5SA 5IVDA 4ZYWA 1WY5A 4OJQA 3K92A 4LXGA 3SK0A 4CLHA 4ZQHA 5K3BA 1C7EA 1A50B 2OHIA 1IRIA 4JVLA 3IPAA 2GDJA 2ORWA 4F9GA 2V7GA 3BXOA 3L5OA 4AVYA 5CITA 1MG0A 1K9SA 5ADWA 1XK6A 1BS1A 4MDHA 1LUAA 2WU3A 1DCKA 3LFTA 4UZFA 5KYVA 4FYJA 6REQA 2P5TB 2WPNA 4AZ3B 3GEPA 4KVAA 2BSAA 2O52A 1P0CA 1QH0A 1TZ2A 2E1RA 2GCIA 2QJFA 3BRQA 3FVQA 2ID9A 3IAFA 3ONEA 4G8BA 1E6UA 3EC1A 4ECEA 1OC4A 5AOVA 1P31A 2UYCA 4CM6A 3I2KA 4JY7A 2VHTA 1E92A 4L2IA 1E98A 4ZC1A 4LOAA 4MPPA 2SNIE 4N7BA 3IAXA 3C3MA 3KQPA 5HK9A 5AFSA 1LS1A 3UYKA 1TM1E 3OZUA 3UUWA 4CLXA 3OCUA 3P2IA 4OFBA 5JSUA 4NESA 1XRSB 4QLBA 3ZV4A 2PHZA 1ACJA 5C1DA 1I80A 4YLGA 4ROSA 1JMKC 1F4PA 1NW6A 1PWZA 2G06A 4J16C 1KXJA 3GRRA 1NR5A 1XZCA 5ALUA 4OX9Y 5GVRA 1TYCA 4ZYUA 2JD0A 3OU7A 1M1NA 5FBVB 4A8HA 3VVBA 4J4BA 5BUZA 1FC0A 1T2UA 2ZTSA 1C3OA 1JNYA 1CLEA 1A8SA 1O8CA 3A3NA 1T6BY 4II7A 1AC5A 2JC3A 3LLUA 3PX2A 1XZIA 3R41A 5FWXA 2EEZA 1J2UA 3DFKA 2HA4A 4MYTA 3WGVA 1M7BA 1QQBA 2XCIA 5T7BA 4Y2RA 2E18A 2C2KA 1SOMA 3EH1A 2JZCA 3H9GA 3IPRA 2PZMA 3A10A 1JLSA 1N2JA 1PSWA 1A97A 2DAPA 3IBFA 3LBYA 3I2FA 4PANA 4Q24A 5IVKA 4L5JA 1GA4A 4LWOA 3G5LA 5F1PA 3RG8A 2HREA 1NUHA 4UTZA 1BHSA 4BBAA 5F2NA 1MX9A 1FDWA 2WPDA 5IX8A 1RWWA 1OGJA 4WZAA 4LZOA 2HF8A 3RAFC 1QVVA 3SKYA 2AE1A 2G83A 1J20A 4TROA 8OHMA 1Y6JA 1X2EA 1RWVA 1XZHA 1A27A 1XL0A 2XWQA 1E32A 4D57A 4DV4B 4F8YA 1ZITA 2HK6A 3EY9A 3K0CA 3N74A 4FFMA 3KQNA 4QGBA 4HMPA 3QG1A 1HV8A 3D5TA 1IH8A 4XWKA 1UC4B 5D51S 1AQJA 4J7CA 4PTZA 5CDFE 4KXFB 1GFSA 4MV3A 1MGPA 1QNLA 1COWD 1Q1EA 4RGBA 4WZAB 3HFSA 5T5QA 4AJHA 1ACMA 1JT9A 3PDUA 5CXUA 3G9QA 4M4SA 5DT9A 5JMTA 2B1QA 4G1EB 5KTNA 4KGDA 1KYIA 1T9AA 2C94A 3WTBA 1SVWA 2GKSA 2R6HA 5AK3A 3O8NA 5J58A 4DV6B 4W8OA 4UHKA 3ZWKA 1CR4A 2VSXA 2ZRPA 3G13A 1OVGA 4QM6A 4BO0A 1OTYA 4OAOA 1FPMA 4MULA 1K8XB 1DUVG 2AG6A 3B20A 3KHSA 4OL0A 2P9BA 4M8NE 5CVUA 1RZVA 3QVVA 4O4HA 5FTNA 2KB0A 3G2QA 2WHQA 3O8CA 1O6GA 3AUAA 1SUWA 3I2GA 4N76A 3G59A 4PLWA 1E8DA 3F96A 4PYIA 2AUNA 3TZQA 3KD2A 1FLDA 4K8OA 4N7RA 1C3LA 3W9SA 4AURA 2ERXA 1RQPA 4HTFA 1YFZA 2PQ0A 4AWAA 4CMAA 5I45A 1XHEA 1NNUA 3NPMA 4LZJA 5HF6A 3TCXB 5IMBA 1BS2A 4I1RA 4AN1A 3I23A 1VBNA 4FC7A 2P9EA 2WD7B 1BMFA 3JQAA 1LX6A 1P2VA 1PR5A 2HY7A 1I51A 2Q27A 3O9ZA 3PNQA 1CZLA 3BD7A 4M83A 3UH1A 3W06A 3V7WA 3P9YA 4DCNA 3QE4A 1IXSB 4MIYA 5DASA 8ADHA 1JZTA 2QJTA 3LVRE 2J9YB 4DUGD 2ADMA 5TVKA 3TL2A 3CH5A 4D4JA 1QCCA 3GI1A 2PX4A 4Y6PA 3VO9A 1RYBA 3N0VA 3I6IA 3W5JA 3AXSA 3DMPA 4BV8A 1EWVA 4RD0A 3GF4A 1OC2A 1QFXA 1XMXA 2HQRA 3OJ0A 4JQOA 3PUZA 4D45A 5EVCA 1EM8A 1Y82A 3F49S 4MO9A 2ZBVA 3ZVLA 3EZYA 1ZI8A 4DUYB 2WILA 3KALA 3EVBA 2XXBA 3WBFA 3AW9A 1VKRA 3SX4A 3UOGA 2PUWA 1GGNA 2VAVA 4PNZA 4TM7A 5ALGA 3GJ6A 3FOZA 1ZJZA 2GN9A 1JS1X 3FFWA 4Y6LA 1A96A 3WWEA 3R8FA 1NP6A 2ID7A 2ZP1A 1FVFA 2HB6A 3P0RA 4Z9FA 4A26A 4RDXA 1ZD4A 2V9PA 3KR2A 4H7KA 4R6WA 3D4NA 5IRCD 2WF5A 4EL0A 4KXYA 5AUNB 4CQLA 1XROA 1EM8B 2QG9A 2YC4C 2D8MA 1W34A 2ZDQA 3IEKA 4UBKA 1TX4B 1GNTA 3H84A 2XBUA 1OYYA 2HBZA 3NIDB 3PDWA 5HFAA 5KNCA 3ICEA 4MA4A 5JMOA 5JI3E 2NP6A 3EEQA 5C8ZA 2WHXA 2O2DA 1BE1A 2XD4A 5JNWA 1TK2A 1TYZA 4QUJA 4N40A 4Y1RB 2FLVA 2A3NA 3RC1A 3B9PA 3GGPA 3CT4A 3DBHA 3ZZNA 4S1NA 4MIOA 2GJ8A 5CNIA 1UBNA 1Z29A 5IBQA 1IBMB 1LQTA 4QG7A 1YONA 1Y9AA 3M8KA 5AVQA 2V7VA 3T1NA 1D2RA 3TB6A 4YJ2F 5J5VA 3H5LA 4X71A 3Q11A 2AK2A 2WLSA 2UUPA 4JC0A 2CNWA 3OD1A 2H5LA 3IUYA 1MEEA 1S4MA 4O2LA 2WNSA 4E5PA 1RLMA 4NZYA 3ZK7A 1F7UA 1WZUA 4LRXA 2H7CA 4Y6QA 4XXHA 3EOZA 1SKMA 2WE7A 3PP8A 2O8DA 2FFHA 1RQLA 3O1JC 3WXMA 3EWIA 3CSSA 5CDHA 3A11A 4PXAA 3TOVA 2VC2B 1WEHA 4PG5A 4D4LA 3NWPA 1CIVA 4ZMBA 1V6AA 2WM8A 2X5NA 2XOKD 4FZJA 5D2CA 1XZBA 2AI3A 3OBBA 4JP1A 1V71A 3BRCA 3R3WA 2BE9A 1L5QA 4LDPA 4MAAA 4EO7A 5BSEA 3TGWA 3PFWO 4DR1B 3LPCA 2C9YA 1LZKA 3LKBA 4ESHA 3SYTA 1O4VA 5KNBA 3W5AA 3PEWA 4V1CB 1GITA 2OBXA 4FZ5A 1IBKB 4C5BA 5DE3A 1DXYA 3A58B 1VIDA 4FFBB 3ROGA 1C0KA 5INTA 3N07A 1J4AA 4BAGA 3RG2A 1BVRA 4NZPA 4BX9A 5HNKA 3C7AA 1PLKA 1W8IA 2LBPA 1ADYA 1YI8A 3EMKA 1W29A 3R4VA 1HQKA 3N05A 4C06A 5I8WA 5JWOA 2WF9A 1H05A 4D6YA 1Z34A 2QF7A 3JQDA 1HDEA 5EP4A 3MD0A 1K0UA 3AETB 3ENNA 1JJFA 3JAMA 1C9KA 2FPIA 3WHKA 2X9GA 2ZCUA 3N6XA 1L4NA 4UCFA 4RMIA 5KINB 1ICEA 4OIMA 3SJAA 3QFFA 3G02A 2V7QA 5HFNA 5CFOA 5CW1A 1KQNA 3KSBC 3UJ7A 1MF7A 4GEGA 5KHOC 4GZMA 2JI4A 1MX1A 4ND8B 4F45A 3BX1A 3HGQA 3NALA 4XCQA 1TZCA 4CG2A 2FFQA 3I04M 1JIVA 1T9GR 3K7EA 3RFXA 1JJIA 4UUMA 4QDOA 5HIMA 1RDFA 3U4MA 1FOEB 2HJWA 2HWWA 4BNMA 1NLUA 3UK2A 5E2IA 1GFZA 2R6CA 5IHXA 4PS0A 1K3FA 2JFHA 4KNYA 2RH4A 1X42A 1G59A 4RIEA 3PQ6A 1KJYA 4JR2A 3KYIB 1ADJA 3P97A 2MTBA 4MB6A 2C4TA 4FGJA 3WMWA 2QTHA 1Y3CE 4U7TB 4UULA 5BR1A 2H2AA 5TGDA 3WLKX 1X74A 2XMSA 4EP1A 3G1WA 2DWCA 4JJIA 4JLJA 4PLCA 3WWPA 1G21B 1S1MA 1LJ8A 4P3NA 3GLGB 1XC7A 2ZSEA 1ZJ6A 4BNHA 1A5SB 3PC8A 1I0LA 2E7ZA 3GELA 4CKXA 2VZ8A 3MQ4A 1V5IA 3KRTA 4J4TA 4KPGA 5EP3A 4C4RA 5L45A 3AEZA 3EVAA 3IR6A 3O2JA 3OHSX 3ORHA 4KR0A 2ZB4A 4W1SA 4WI1A 1XQVA 3COJA 3LQQA 3MUOA 1A3CA 2VNJA 3IV6A 4IG4A 2WSSA 3U4HA 2VJBA 3SAJA 3UJ6A 2ZYGA 4C88A 4HX2A 3ICVA 3E5MA 1F8FA 1L5HB 4C0KA 1OD6A 3KQQA 4RIFA 3BZBA 1GYQA 1KKLA 2IWHA 3WWYA 4BP1A 4PC6A 3Q7QA 4QBHA 3V7UA 4DDMA 2QAIA 3C39A 3PZBA 1CJCA 1SXJA 3H1FA 5FR2A 4MDEA 2XKBA 4IWYA 3NVDA 4KLCA 4Q3BA 2K87A 4Q3EA 2BGLA 1KBZA 4OFWA 1K6XA 4CNQA 1HMYA 2C2HA 2SKDA 1ZRMA 2WYWA 1DQRA 4IOMA 5EIBD 5CG2A 5HF9A 2P0YA 3B7PA 3E7PA 3HY3A 4KWCA 1X1AA 2OWDA 4XX0A 1H2AS 5A4DA 4G4SP 3LAWA 3UK6A 1VP3A 2O2SA 2VAXA 3FHOA 3HBLA 3PS9A 4J75A 5F4BA 5TMBA 4KW7A 1XV5A 2OBMA 3FNBA 5BSMA 2CCKA 3UMGA 1EKXA 1G98A 1N8SA 1OCEA 3KBOA 1ZVJA 2P69A 2BFCB 4JI0B 2M1ZA 1SD1A 4ENSA 2CLIB 4LX0A 3A05A 1GM5A 3JYOA 1ZR2A 1RI2A 1EVKA 1Y8CA 4XX0B 4C6TB 1ISMA 1KJWA 4OUDA 4LOKA 5B1DA 3C7DB 3FRIA 2FDXA 1M1UA 5CVDA 4TTIA 2GEFA 2PR2A 4HDRA 4LCEA 3SF0A 1TYDE 4MDFA 1D8TA 2J3KA 4NCHA 1CVLA 3A0UA 3EIEA 4DJFC 2Z1NA 3L7MA 4HAOA 3WRVA 4NMWA 4K6GA 3PPVA 1WHSB 4K86A 3U3KA 4ESOA 4N82A 2CLEB 1PBTA 4PLPA 4NYMR 1DRJA 3HN6A 3I6BA 3ROZA 3LUAA 1F4VA 1Q20A 2ANCA 4G07A 2BBWA 2RHMA 1FX0B 3H9CA 4RMJA 1RI5A 3DWFA 4OUDB 3BIWA 4W5WA 1PYGA 1H69A 2GEJA 4J0JA 1SEPA 2DPGA 5H59A 3KQOA 1GTG1 4QULA 3HXTA 4HDRB 4I6JA 1FUKA 3AEQA 1U5BA 3H5AA 3OPYI 2XCRB 1CERA 5DSZA 7MDHA 1ZH0A 1DBSA 2QRUA 2TMDA 2DTEA 4C6HA 1TCBA 4EEKA 6CHYA 4JIMA 5IWAB 1WG8A 2VJQA 3IQHX 1ZGJA 1C80A 1R0YA 6ABPA 4ZVKA 5ILQA 2PY6A 4KYTA 4OQZA 4EJFA 3ZOKA 2HBRA 1XZFA 2AMVA 1E7RA 1GQYA 1I3NA 4ZCRA 1UFRA 5FLKA 1E1NA 3UV3A 2MMCA 2GM5A 3DD1A 3AEQB 3B6IA 4G0MA 2XWBF 2QXTA 4Y3UA 4RYDA 3JZMA 1FNSA 3G0GA 2N0SA 2WWRA 4B3XA 3QXJA 1EG2A 4YCAA 4HB4A 4NF2A 4RDCA 4RL6A 4S04A 1IHYA 1PIWA 2MYPA 1Y33E 1QYCA 2GEKA 2CXQA 4EH1A 4GXRA 1J8QA 5JT1A 1Y6FA 3JCZA 2X1LA 2WHRA 3IVAA 4HFRA 4N6NA 4ZRDA 4QPCA 1WETA 3BRSA 1A9XA 4KX3A 3IRVA 4RQBA 2W8BA 1QMGA 2XMGA 4FKZA 1M9NA 2VUTA 1H9CA 5ILGA 3OQPA 2PGXA 2VP5A 4ES6A 1CUFA 2QAGB 4F1WA 2WM9B 4J2TA 1U2PA 1CEQA 5ALJA 3HLKA 1GDDA 3IEUA 1SU7A 3QF4B 4QJ4A 4R1TA 5IM4A 2PX0A 1BMDA 5AO9A 5ITZA 2WJ4A 1MDBA 2J5KA 1PBNA 3NEYA 2X0DA 4BECA 5C8XA 3DO8A 2VJYA 4DBZA 5LCXA 3FBWA 2EX0A 2PVSA 2FVXA 1FFGA 2W8BB 3PQ2A 3R5JA 4NEHB 4BIIA 2HQBA 1F0NA 4XJSA 1IB0A 2CXHA 2X77A 3ESYA 3MIIA 3RYHA 2EERA 4J07A 2HSDA 2OE2A 1D6NA 5T4HA 1NBHA 5AKEA 1JDTA 1M74A 2FF5A 1RQGA 4KJXA 4RJKA 1XAGA 5ITZB 1ZW1A 1TCAA 1DRVA 1C7IA 3P5SA 4WSOA 1IBCA 3R7DA 1PTJA 2CXRA 3RQIA 3T5GA 4ZJUA 1BN7A 1II8A 1NN0A 2C3MA 1MO4A 2VRNA 3UHPA 4DR3B 2Q1YA 1GNPA 4HN2A 2QMHA 1CQWA 2O0HA 2Z5VA 2NUPA 2B37A 1DI0A 2QQEA 5TPZD 5JSFA 1SG6A 1QK3A 3RYHB 1E5LA 5KJCA 2GBCA 4HWOA 1EXMA 1WB6A 4M9ZA 2BCJQ 3T1OA 4JENA 3EWSA 1AMOA 5B64A 1EFVA 4JT2A 3WY9A 4UBIA 2AL7A 4JJEA 4Q4JA 1T8PA 3EULA 3I83A 4YRPA 5TT0A 1XZQA 4ARVA 1GKYA 4ZCSA 1HL3A 2C97A 3KEOA 2DQKA 4LXYA 3CS3A 4RK4A 3I9V6 4UU8A 3GN1A 3WBKA 4DIFA 1GR1A 2G8NA 2EJWA 2PG3A 1N77A 2ZIVB 2NYAA 2EFCB 2BGRA 3BE8A 5FHRA 3HHEA 1FW6A 1BJKA 4PYLA 1B3BA 1EFVB 2NZYA 3QVOA 3OESA 5TT1A 3P1JA 1L4KA 2HHAA 4UHJA 2PCLA 4JBWA 2RHRA 4IYJA 3DNFA 4BJ6A 1FYFA 3L0YA 4MJ3A 3INTA 1KAEA 4IYRA 3TW6A 5JBIA 1AD2A 1J97A 3LX5A 4K2AA 2I76A 2XVXA 5JSHA 3EODA 3KAQA 3I53A 3DEHA 2UZ0A 3TIFA 5KYXA 5EI5A 3ROEA 2OYSA 3KIPA 1KYXA 4NCIA 4B3IA 2AWOA 3EJWA 2OCDA 2GZMA 3HU1A 4MTLA 3RRYA 4QOHA 4E2YA 4QQFA 2J0EA 2RGGA 2VF8A 2ZJ5A 3G79A 4H0NA 4QWWA 2XUFA 4V0RA 5LP6C 1YKSA 3LLVA 1DIAA 2JJ1A 5AI0A 1QHXA 2ZB8A 3GP3A 4AYWA 1ZM7A 2VTVA 2W8ZA 4B73A 2J3QA 2AMYA 2YDXA 1TD1A 1VYVA 3LPDA 4D42A 1TJ3A 1EWQA 1QVZA 3EIUA 4LTNA 4KE6A 4CL8A 2Q9BA 3K30A 4YNBA 2ZPTX 4PFKA 1NVTA 5BRAA 3ZDBA 3LCVB 1KA9H 4EA7A 3KOOA 2OV4A 2YWCA 1SFRA 1XCBA 2PSJA 1TCCA 3FX2A 3NHAA 4J90A 4KPUB 1PFYA 1J0AA 4QUIA 4M8LA 2GB4A 1BDIA 1IOVA 1GNSA 1TJPB 1ZCAA 4U6NA 5TS2A 2ONJA 1PZGA 3T6KA 3IPLA 1V4NA 3PUYA 5K8IA 3AF1A 3MT8A 4Y2HA 3E6AA 3E53A 1CRLA 1P1KA 1ZW6A 1RXUA 4RNCA 5AKYA 4F5EA 3BHIA 4A2QA 4DSUA 1UKBA 4JI3B 1NYRA 1BYUA 4RESA 3OEED 2VXYA 1S8AA 3PNKA 2YWXA 4ALIA 1AMNA 3BVPA 3NW9A 3BGIA 3SMVA 2K2WA 3IV7A 4HPWA 1N0VC 2NYRA 2Y27A 4L9RA 4QGGA 4TN1A 3NUGA 1BROA 2H6EA 1JB9A 4LK2A 4U0JA 2PZAA 1YS1X 1XU4A 4EX6A 3G0IA 1K7XB 4QEKA 2WB4A 1H4QA 2H06A 3EAQA 1JEOA 1YRBA 2PTHA 3R5KA 4Z9BA 3SYLA 3ZD9A 1F6DA 5CBKA 2ONZA 1W4BA 2ZI3A 3W6NA 4FGWA 1PU2A 2QM8A 4HVTA 5L7YA 4U1RA 1TIBA 1N5IA 1QYXA 3M34A 2Z6UA 1QHYA 3H18A 4FUQA 1RJ9A 1TJNA 4JDUA 3KJIA 4LJAA 1AY0A 2VK4A 4KFRA 4NK5A 2BEWA 3FTDA 4TLBA 4B76A 1TVMA 1J1UA 1YA8A 2YUIA 2YY7A 5DXAA 2A57A 4IXDA 4WBNA 2D0IA 3GEMA 1Q1NA 2RAPA 4TWBA 3TKLA 1UKVY 4HN4B 4OBEA 3KT3A 3P2OA 4WZBB 1B76A 1RI1A 3FMGA 4TS9A 3SR4A 2LCQA 2IDMA 1VHJA 5GONA 4I9NA 4ZCTA 4ZDJA 2D1RA 1DAEA 1UP4A 2FCAA 5FHQA 2UXDB 5KZMB 1XZLA 5LPNA 4BGVA 3WLHA 3ZQKA 4BVHA 5EJ4A 1SKYE 5FV7A 4QTTB 2GMWA 3PLNA 1YQWA 4REOA 3BM5A 7YASA 4G5GA 5M5BA 4Y6RA 3UGTA 3CGGA 2UDPA 1FNNA 1N25A 3DFMA 4FGLA 3V7FA 2YMPA 3M6XA 2EP8A 2AJCA 1OKKD 2J6IA 2RB5A 2WW8A 5JMPA 5GPBA 4BX8A 4CRWB 5HOEA 2I34A 3OI7A 4NARA 4MR9A 5JQWA 3MCTA 1V11A 2PGIA 2R97A 3JWHA 4MYRA 3CZRA 3GRUA 1R0LA 1RYYA 2C99A 4R9SA 3F7OA 3KSRA 2IOFA 4RVFA 2JIQA 3BWYA 3DV9A 3TN7A 3PXGA 1RP7A 4EFLA 2QZZA 4N3BA 1W2GA 3U3RA 1TKBA 3LX4A 3V3TA 3O4GA 1VG1A 2FYTA 2XHZA 4D4KA 3C1TA 4ZVNA 3TJZA 3GLIB 3A1TA 4NVRA 5EY5B 3G2IA 3TH5A 1D04A 4MVJP 3TZEA 4ALJA 1Y6ZA 4MR9B 3D6HA 4XZ3A 4CVNA 1WDMA 1V11B 3NHSA 1B8OA 3B6EA 3KTAA 3OJXA 4QPDA 5ALXA 2PJRA 2F17A 4WNCA 2LDBA 3VISA 5DHPA 2PL5A 3IDSA 1E9BA 1ADFA 1X8XA 2FXIA 3KYCB 4PAWA 4OKNA 3PQ4A 3BC1A 2FZGA 4WQMA 4BE4A 3VJRA 1N33B 3NR2A 1L5RA 1KDVA 1PR9A 5GY7A 3ZW7A 3EAGA 4LNUA 1NXPA 2W6ID 2I2BA 4GUDA 4S12A 3TDKA 4DIDA 4MTCA 4CT5A 4R1SA 4A73A 5IJ9A 1YNSA 4HWTA 2QGNA 3RREA 1XQYA 4B4VA 4E31A 2H4WA 5KNBH 4JJ7A 1PZEA 5NLLA 2H92A 2ZJ0A 3KTAB 5JD5A 4RO0A 3G88A 4S35A 2QRZA 1Y1KE 3D0OA 2RGAA 1H23A 1OX6A 3HEAA 3LWDA 2QZJA 5HZHA 1DADA 3NOXA 4IEFB 3B3GA 1P2FA 3OCYA 4KZKA 1ZMBA 3K1ZA 3UWDA 3VOTA 4H7EA 1DX4A 1Z38A 2C5HA 2OGZA 3EGXB 2GD0A 4NK4A 3EZ9A 1M3SA 4JT8A 4LWQA 4WKCA 1TTTA 3O0TA 2HCBA 3CRRA 3STWA 1L1RA 5JJBA 3R7WA 2AFIA 3B38A 1QFMA 3KLOA 3LT1A 3TOCA 5JCOC 1U3CA 1IY2A 4V0ME 2JBAB 1W4AA 3JASA 4R84A 4GG1A 3TLYA 4DUZB 4CTMA 1GU7A 2BT4A 2O8EA 1OLUA 2X5XA 1QIMA 4G0QA 1A7AA 2ZIXA 2YVAA 2DUJA 3U3XA 1L8AA 9LDTA 2GHRA 3IRUA 4WNAA 3WIOA 1DRKA 2VQ3A 2AXEA 4ZQBA 3RSHA 1VCIA 2KI5A 16PKA 3ITKA 4AUNA 1XXHA 4RD2A 5DYGA 2OBLA 1OAKA 2AFIB 1CZRA 1DLJA 4O59O 1M2NA 3QMVA 3G9UA 1GPJA 3HO8A 4ZOCA 4EITA 1YZKA 1VKOA 2B2NA 3NBQA 4C2UA 1L4GA 5HDQA 3OTHA 3T3PB 4A8JC 2O8EB 1OLUB 2V03A 1SC6A 2TECE 1CQIA 1T3TA 1B6RA 3RAEC 2BKVA 1ZI9A 3OIYA 2MCFA 4LUCA 4EPVA 1WP4A 1A95A 1GPDG 1NOJA 4WNAB 3TLKA 4D81A 4F4JA 1JX6A 4OHMA 4Q9KA 3O7MA 2GPBA 1Z2EA 3HYTA 3CUTA 4YBRA 4AROA 4C01A 2NXEA 721PA 3R8XA 2C5SA 2PS9A 1AKVA 2C4KA 3TZ6A 3VH3A 2HWKA 2IYFA 3NOQA 4AJ2A 5IM4F 4FUTA 3LZ6A 3M4ZA 4IIHA 4R1PA 4I1PA 5JJ5A 4CEHA 1M10A 3DE3X 5IMSA 1MN6A 2B4YA 3ZOZA 3C6BA 2P77A 2NZXA 4UTXA 2AMLA 1ORRA 1HUQA 1JIKA 3AVPA 3M6WA 4IW3B 3VZBA 1ZLYA 4EPYA 5B7PA 3ADBA 3NC0C 2MMGA 4CQJA 3BERA 3ZNNA 4AUEA 2QN8A 2XCOA 3OWOA 1FSSA 3B6ZA 4Q7MB 1OHHA 4XQGA 3WMFA 3HJGA 4DSOA 4J03A 1TC2A 5HRUA 1MO6A 4DRZA 2FEOA 2JIBA 2VCEA 1GG9A 3DEJA 3P9SA 4DPLA 1P4RA 4CEHB 1DG1G 4R8LA 4MV8A 3IFSA 3FWKA 3PVCA 4E7PA 3ROFA 1VGRA 4QQRA 2F9LA 5J4KA 4M7WA 5JANA 5LXTA 2LXNA 3BDIA 1U4OA 1YFLA 3M9XA 3H0CA 1V35A 1PI3A 1S3GA 2G5PA 3CFYA 3DNMA 3KQWA 1QIKA 2VDWA 3OE5A 2JKZA 4CR8A 4LYHA 5SY6A 4F84A 1BOOA 5JAOA 4OHBA 1DVRA 2CV0A 3U7FB 2E48A 2YHSA 4L16A 4P5EA 1E5VA 3GAAA 5CYFA 5EAIA 5JWHA 5DLDA 3OCXA 4BNXA 1E9DA 3BFJA 2BRUC 5E9WA 3EG9A 4S24A 5FQNA 2BV3A 2XITA 2C8VA 4GL4A 1KQPA 1X2BA 2P9ZA 1WBJB 4KVZA 1Y34E 1ZJYA 2XECA 5JH7B 3VDNB 1JGTA 3TIGA 5LU8A 2XUZA 3O84A 5A7GA 1SGWA 1J2JA 4QOGA 4H3SA 4BLTA 5DNCA 2OG1A 4WW0A 1ZOSA 1TA4A 3OM1A 1V9CA 2RHOA 2XVAA 2VOJA 4OFZA 5JRZA 2GRJA 2OTCA 9ATCA 2BEJA 2BMEA 2C1ZA 5CYGA 3QWBA 1SK8A 4TSFA 4IINA 3JAKB 1EFLA 3OLQA 4FD3A 4R31A 5ELLA 3G0CA 3NGXA 2Q5CA 1FBNA 4OJMX 1OXBB 1LDGA 1V25A 1PX2A 1P8JA 4G1MB 2NO7A 2ODQA 3JQ6A 1WV1A 4FCVA 1R0WA 1ZGGA 4OXXA 2UVQA 5CT5A 1E2BA 3G23A 2HK9A 3SE7A 4KQ2A 1OU0A 5LN1A 3GJ5A 3F6CA 4MRMA 4F3NA 5JRDS 1DOZA 4UFOA 1QG0A 1N6HA 3GQBB 3AM5A 3GJXC 4REMA 2IPOA 5K1ZA 4N65A 4WL0A 4C07A 2FWBA 1BQ3A 2BI8A 3HJTA 1C1XB 3KQVA 4W8GA 4A9AA 2RCYA 4ITRC 3DLBA 1YH3A 4IIXA 5KEIA 1E1CA 1W8DA 2J3JA 1KOGA 4DB4A 4HRXA 3FY4A 1VC2A 4G0PA 3JX9A 4N3AA 4D3SA 1F0YA 3HQ4O 3HMKA 6PFKA 1FS5A 5A4IS 4GMFA 4MWBA 2JHGA 5TX7A 3GRCA 3RS7A 4HUTA 3ONVA 4IOKA 4WOBA 2HSEA 4E3ZA 1GRRA 2FTKE 4X3OA 2MOKA 4DV0B 4EB0A 1E1CB 4OSEA 1BHJA 1MAVA 2QSUA 5JO9A 2ECPA 3MLEA 5JASA 5PNTA 2VTBB 1DG3A 2ZG6A 4KUEA 4BEJA 5EERA 3MRXA 1XYYA 3ELWA 3VKVA 4DV3B 3PXCX 4Q39A 3OKAA 4EECA 4ZT7A 2YCBA 1OQAA 1W2HA 5LYJA 2ET6A 4KYVA 4UMDA 3W3AD 1YQDA 3PGXA 4TT8A 2XIQA 4QJ5A 4CR7A 1UQUA 3MA0A 1G8HA 1OAOC 1IN8A 1Q95A 4HLDA 1LWNA 2INGX 4BLQA 1O0SA 5HPYB 4DUPA 5B1EA 1U9CA 1DNPA 3HADA 3P0FA 1TLTA 5BUSA 2HLPA 4E1BA 1JIIA 3G8BA 1K06A 5U9CA 3L7OA 2A5YB 4P5DA 4IJ5A 5LYJB 3EZNA 1N6NA 3D3EA 5JDCC 4WBNF 1BA2A 5E8RA 1VM6A 1YBMA 3GROA 2Q0QA 1XA3A 3HMQA 3T3GA 4ZDWA 4OK6A 1W48A 2BF4A 2VTKA 3KZXA 3QLEA 1F7VA 5IHPA 4HDCA 4QIHA 5E3JA 3F9CA 3T1HB 4HAZA 1X19A 1NDHA 1I33A 3ROKA 4LISA 3V4RA 3U37A 3P9QA 4COKA 5DW3A 1UK8A 4YP9A 2J7PA 1I10A 2P2CA 1EGHA 4HH3C 4RE5A 3K71B 5J2TA 4E4TA 1JQKA 2OKCA 3FPJA 3W7BA 2QYHA 1UCFA 5F3RA 2HCFA 5FL7A 4MVJH 3DBLB 4HADA 4YR9A 1JG2A 3W5CA 3CO0S 4OHKA 3LYLA 4HWGA 2QMUA 1TADA 2XDQA 2VKTA 3OWXA 2I80A 3EY4A 2YWDA 2CXUA 5A9TA 3ZWPA 4L51A 2AQKA 3X1ZA 1J5XA 4HZIA 5BO5A 2BKXA 5BSRA 2OO3A 2EGUA 2JFWA 3ME5A 3H8SA 1IVNA 2JJ2A 2ZR0A 2J3LA 2WWHA 3DH0A 1GILA 3NM4A 3DVRX 3HCAA 2W6CX 4WGGA 2QAJA 3IT2A 4K9DA 3L6UA 2ICAA 1Q83A 4Q3OA 3H5OA 4DDWA 2Z5GA 1HDRA 1TOAA 3D6NB 4A0QA 2SBTA 5E2BA 2QKYA 2YXDA 3KDSE 1YJXA 3GCXA 2VPZA 4EVRA 2OAQ1 5JG7A 3UJAA 2EFYA 1D2AA 1U99A 1NLYA 4WK0B 2EZTA 2I4RA 2J45A 4ICIA 2A1UA 3IIMA 4PIMA 4TL6A 5HG0A 1UDRA 4ZJZA 4KH0A 4LRQA 3ZKWB 1JFTA 4O2RA 4JGBA 4AS1A 2VPYA 1WU7A 1JBKA 1E94E 8MHTA 2NMVA 2J5QA 4YV1A 2C2MA 1U2GC 2AE2A 4IX9A 4QYXA 5DLYA 5EVJA 2Z9CA 5T64A 3D7SA 4B3HA 4JYBA 5BVGA 5I4BA 5A62A 4Q9DA 3WLMA 2WTNA 4HPJB 1P0PA 1Z3CA 2F67A 2WRZA 1GDHA 1IG3A 2OHVA 2QNBA 3IAHA 2A1UB 2CMKA 2WBLC 1KFCB 1PJ3A 3KUDA 4L15A 3WP0A 5KIAA 4QOIA 1AKYA 5A06A 4AUKA 2GF9A 1L7RA 3NMUF 1VYUA 1GYPA 3KAKA 4AP9A 3KHTA 1ZM3A 4UJ5A 3BWDD 4TKUA 5D84A 5FTJA 3TLMA 5CDTA 5BVGB 9ABPA 1QKKA 1SQ0A 4BN4A 3CEAA 4DZRA 4Y7CA 2R6JA 1CSEE 2PWAA 3RBZA 3BCHA 4BLPA 1YFJA 3V9AA 1YTLA 2I6XA 2NP7A 3UW3A 2WYUA 3NWEA 3CKYA 2EWMA 4RX1A 4PYJA 4I46A 1XXHE 1R8XA 2ZJYA 3HE3A 3IIIA 4D0NA 5K9ZA 4JFRA 2FMTA 1N92A 3K16A 2O2GA 4FYYA 4TKUB 2XMDA 4K9QA 4ZICA 1QQTA 2AK3A 3ODGA 4B3TB 4YGYA 5TQ2A 3Q6IA 4YT8A 3GVHA 4MMZB 4I50B 3E9YA 3FZNA 2FW8A 2BI7A 2ZXEA 3GD5A 2X0EA 3MTAA 4F6RB 3BJZA 4B3SB 3B13B 5IABA 5ILOA 2GQ0A 4IZIA 2R8XA 3R6GA 3DZDA 2G9RA 3OBIA 4QVKA 2G67A 2XD9A 4BQFA 2H31A 4BMSA 1XEAA 3JQPA 4ZA2A 2H52A 3F6EX 3OLYA 5JSZA 1AF4A 4G5XA 4K05A 1LPBB 4FQ8A 4KXLA 3L93A 3C6XA 1U3GA 1PJZA 2O8VA 4P34A 4MV7A 3WHPA 3C3EA 3EUAA 1JIQA 3G9ZA 4NE2A 3VZQA 5LSAA 1C9YA 3SVZA 1CP3A 2YV5A 5FPQA 1JVSA 1I32A 3IT0A 3ZUGA 4CMKA 2CE7A 2J6BA 2XF8A 1Y63A 5AW2A 4JSRA 4LRSB 2GEDA 1R00A 3A26A 2H8GA 1HLPA 2G36A 2YV1A 3I0MA 1U8YA 4PQGA 1MC1A 4TV9A 1XOIA 3BSFA 5JSZB 2YS6A 4C22A 2QLMA 2A9QA 3G5UA 5BOSA 1DELA 4XARA 1WM1A 1IZYA 4B8YA 5MFZA 4Y9TA 2QENA 1LRJA 2RGYA 3GRZA 5A2GA 3WQBA 4L9WA 3PGKA 3K53A 2PXCA 3CUKA 2O2ZA 3N76A 4JKYA 1BAPA 5DTQA 1HORA 5LA6A 4AY4A 5DM70 2FN7A 2Z04A 4DSTA 1L8OA 4Z4EA 3SYKA 5HYVA 4LF9B 4A6PA 4EEZA 3P5BA 4C2TA 5LXTF 3SHTA 3EFBA 5BOSB 2B3TA 3ZTYA 4RIIA 5HZGA 3LRXA 3QEAZ 1YQ9A 3WK4A 3H3XA 4EG1A 1ZISA 1YR9A 4C1BA 5BQFA 1EVIA 2M98A 2Q6TA 1ISSA 5CFNA 3C8ZA 5I3CA 2O0JA 2REBA 1N7JA 1RQNA 4E5DA 5AVTA 1ZNWA 3RT1A 1ZYUA 3MTQA 4E6PA 4FWBA 1K97A 4AJ1A 3FNIA 4GGPA 1N1MA 1TUBA 4MQFA 5G0UA 4G5OA 5REQA 3RARA 3FCSB 1PQWA 1DBPA 4LE0A 3UCEA 1IM2A 4PFQA 3OH8A 2WTUA 4H59A 1U90A 1Y3IA 2DSTA 2R5NA 2GK3A 5GINE 3D8SA 3L3BA 3MOIA 4L74A 2DGDA 4RVCA 3V1TC 2BMVA 2ZRHA 1YD7A 3GRAA 3G0OA 4R81A 3LC7O 2NOAA 3RM3A 1A72A 5I9MA 4KREA 2EATA 3U2QA 1KZYC 1TUBB 4MQFB 1YS2X 4DKXA 4EGJA 3I62A 1VCOA 3QLVA 1MRNA 1CUHA 5JD4A 1U7DA 1UP6A 1QKJA 4GQAA 2WIFA 1NOIA 4AJJA 4DQVA 1XNGA 1SUFA 3BFPA 1EFRD 1YZFA 2BW0A 3L1IA 3MK31 1ZU4A 2AR9A 3NG1A 3QFTA 3QYFA 1LGYA 1W2WB 2MYNA 4GGOA 1X9HA 4MUMA 4XOIA 4JLSA 4KN6A 3A04A 1EK5A 1R4MA 2P35A 1TZJA 4L5BA 4Q3KA 1IWPB 1O94A 5G1NA 1G9TA 3DHYA 2NT4A 1KRHA 1P18A 2EFGA 3FOFC 3VDQA 5C7OO 3HM9A 1RXCA 2ATEA 3DTVB 3HI4A 1HG0A 3OF3A 4TTPA 3VSBA 3BE4A 4YMHA 4RZUA 3FN4A 3NEPX 4OQEA 2PU5A 1BX0A 2A9OA 3KL4A 1S7GA 4J1SA 4LPKA 4NU6A 5DHRA 3RKUA 4ZI2A 3RSFA 3VC2A 1VA4A 1XMJA 2WNIA 4XCXA 1Z4IA 2NUAA 1GTZA 3U9LA 2X8JB 1QF6A 4IMJB 4CM8A 2BEVA 2VJOA 1C8KA 1L4LA 1Y1LA 1IBRA 2HXYA 3C5WP 1EG7A 3ONDA 1ATIA 4TVKA 4AF6A 4II3A 3W2HA 3ZZUA 2JKYA 1UT5A 1P0IA 3H1GA 3N2GB 2J8ZA 1HT0A 4D0SA 2C7PA 1Y8QA 3DHEA 3AHJA 1JEJA 2OSBA 2BDUA 1L4MA 2N1MA 1KK2A 2Q3DA 1UT8A 1KJ9A 2FU5C 1PQ4A 1GEGA 2IIPA 2QEQA 1H9BA 1HKHA 2ZJ6A 3HP1A 3QG5A 4BCDA 5KQLA 1FS6A 1Z22A 4QLAA 2BEVB 3HCEA 4QWMA 4YHBA 3WSWA 2BONA 4MW7A 1WW2A 2NUBA 4ACBA 1RRGA 4C6SA 2HFJA 2DFNA 2CBXA 1R50A 2RK6A 1EZZA 4FLEA 1OI4A 3DB1A 3I9NA 4K9LA 3TD2A 3HNPA 2IPNA 3T4PA 4WJKB 3DT6A 1Y3FE 4IOLA 3UGQA 3Q7TA 3TPFA 1TAQA 5MN5A 2CY0A 4HAXA 3C3BA 1XPOA 1UQRA 1O87A 2RHHA 3TKAA 3COZA 1ZONA 3VHQA 4D80A 1GGJA 4EQ6B 4F1KA 1V16A 1NW7A 3FVVA 3F1LA 1V2GA 2VF4X 5JLAA 2DFLA 4WEQA 2Q7OE 1J21A 2OQRA 1UOPA 2D7CA 2I2WA 2VDNB 2WFAA 4MWEA 4U3JB 4A3SA 3NHJA 5T6BA 2N46A 2Z3VA 2R60A 1S2IA 3IOYA 3W5VA 3CLUD 3IP1A 5FRDA 1XEFA 2HA6A 1QV7A 2IJGX 2JAWA 4MI9A 4A7PA 5AW3A 3T1YB 1AV6A 1IBLB 1N2CE 3BBPA 1UM9B 3RS8A 4X65B 1GNQA 4C7JA 4OQMA 4QXMA 2F1OA 2ZUDA 2PE5A 1TGVA 1V16B 1W93A 1XQWA 3CN9A 3NP9A 3ZKAA 1ZCBA 2QE7D 3CUSA 4DM4A 4QRIA 3G0DA 3SC2A 3UMVA 4YRFA 1SIBE 3H9QA 3RVNA 4YAKA 2PS1A 1M1YE 3Q3HA 4ISCA 4K0RA 4QD3A 5J2TF 5KPJA 5DX1A 3ZU6A 1YRHA 5AKXA 2HSGA 1H4TA 2D8AA 2XQFA 4DIBA 3I0NA 5EXDA 3EIFA 5I9TA 3VNUA 4ZIRA 2V6JA 1P29A 4DARA 2X9VA 1GUFA 1JH9A 3LWZA 3O9MA 3KP1A 5DLPA 5DN6A 1U2DC 4F85A 2RGBA 3W6ZA 3F67A 1E5TA 1XT6A 1Y7PA 2FR1A 3SC2B 1UJ2A 4Q47A 2C84A 4PAOA 2JFOA 2OBNA 1HYQA 2GNOA 3I4CA 3SC3A 5DX8A 2IGTA 5KAMA 4HNSA 1U0BB 4CHTA 1WKCA 4D9HA 3IKJA 3H5IA 1S5PA 2HNBA 3EIQA 4L22A 2YMQA 1IONA 2OM2A 4C20A 5B6IA 2YWHA 2WFZA 3C3JA 4P0TA 1N1EA 3EDOA 3ICCA 2Q2NA 1Z6TA 2H4ZA 4GX1A 3RC2A 4E13A 1JA0A 5KOYA 1G8SA 3MT7A 1YJ8A 3CRVA 3Q8KA 1J06A 2I7CA 3H7IA 4CG1A 4EGSA 3V2IA 4TMFA 3MTJA 1P4HA 4GM1A 1REQA 3I9FA 2P68A 4KVFA 1INLA 3R6WA 5M2QA 2IXDA 2HWXA 1XG5A 2BZ0A 3EQ9A 1X92A 1G1MA 4FLMA 1C3XA 4MP8A 4IHJB 4XWYA 3PSHA 3QITA 4RVDA 2VT6A 3D0QA 3ENWA 4RK5A 4EJSA 4D44A 4NV3A 3SXPA 3IEMA 1K8ZB 1P3JA 5J9FA 4ZK6A 2HIMA 3H2JA 4RDIA 1ZZGA 4LRWA 2PMEA 1REQB 1YC2A 4BX0A 1T3ZA 3F73A 4CMBA 3LG2A 4OXRA 5KU7A 2IEGA 2WMOB 2APJA 1BDBA 4GWLA 3R9KA 3BXZA 3EWAA 4EA8A 2DBVO 3SFTA 2CJWA 2NZWA 2R5WA 1Y9EA 3VR0A 1W25A 1PL6A 4I50F 4QT4A 5ITVA 1X7HA 4N7JA 3QE0A 2Q49A 2B4TO 1RCFA 4C4AA 2BFEB 2YNMA 2QRGA 2C03A 4EJSB 4WLUA 4ILKA 4TUYB 2YXBA 2EJBA 2QRVB 5DEIA 1BC5A 5K0JA 3A2KA 4HEA1 1C3JA 2GO7A 4I4TB 3ZV6A 3CLHA 3ROQA 5ICEA 4K6HA 1QFSA 2PIDA 3UJ3X 5MN6A 4GDFA 5LKRA 5LU9A 2CJWB 3UG6A 4BO6A 4H7FA 1Q7RA 2ZT5A 4QEZA 3TJMA 1S7CA 3VU8A 1GTMA 1IE3A 3MMNA 4G23A 1IHPA 4II2A 1HETA 2I62A 2VBGA 3DLCA 8LDHA 4OHFA 1Z62A 3FMFA 2ASVA 2ZANA 3KWFA 1QRSA 4BLSA 1P2BA 2DTXA 1E3QA 1FVXA 1N78A 1P91A 1ZDMA 1MZPA 3PX3A 2GS9A 4S0ZA 1EU1A 1ISPA 2HUNA 2IS1A 4GPD1 3KQHA 1P1FA 3IO3A 3WK8A 2BFBA 4XDZA 5F2OA 3EEFA 3GLFB 2FW9A 2XDYA 3OZFA 4NBUA 1ZHOA 5HJEA 1K68A 1N9KA 3N8GA 2H16A 4YP0A 3LLMA 3QUSA 4DIKA 4DWOA 5KAPA 4EI7A 1Y6RA 3VU0A 4R1MA 1KIMA 5K6RA 1AOXA 2VAWA 4EW6A 4FSDA 1J8FA 2XB6A 3MNFA 4TV9F 1AUQA 2PIAA 2W83A 2BFBB 4LN1A 5CM8B 4JHXA 2FUCA 3AVQA 4N12A 1LD3A 1LSOA 1RPAA 2QLJA 3GFBA 1P1RA 4Q12A 1NTOA 3A2MA 5D6NA 2BFPA 1EXDA 3M3PA 1ZIOA 1Q1ZA 2D4AA 2HMWA 3OJEA 5LA6F 1YHNA 1JU4A 4LV6A 3CPSA 4BASA 3VYWA 1KJZA 3FYUA 5HTKA 4YUZA 1NG9A 4ZP1A 1ESEA 1Q0HA 1PLLA 3P19A 2L69A 3KV3O 4WE3A 1GUZA 1PL0A 2JGJA 2QDKA 3GEIA 5CAEA 2CMHA 1SK9A 2FG7C 2VJMB 4MQ5A 4YDHB 2P4QA 4R4JA 4M8SA 2EJUA 2HD4A 5E0OA 1NZFA 1L7VC 3I92A 1LDEA 1UKCA 3GOQA 5GV8A 2RC6A 2JFZA 3FYUB 1XRMA 3FDIA 2X58A 3HZZA 1G3RA 3LXRA 4IIVA 3QP9A 2PKYX 5DRYA 1U8EA 1YJAA 1GN8A 4JVOA 3ICQB 3REQB 1ZOOA 2XUAA 4WA8A 3M1AA 3NJ8A 1VJ1A 4HQLA 1L5KA 3SHVA 4P38A 4X1OA 6ADHA 4TXJA 4HGRA 4ENRA 4GSKA 4DV5B 3PFGA 4Z0TA 1H85A 1NBEA 2FSVA 3N3BC 3I5UA 1KH2A 4KIJA 1RKVA 4ZXFA 4BNGA 3WO0A 2C5GA 2OCBA 3QEBZ 3ICOA 1YL7A 3HYNA 3IHTA 5ABPA 3THOA 1AGPA 3H2HA 2ZM5A 3K9QO 3MYRA 4I1SA 2QHXA 1L5SA 3TPZA 2GPYA 4TWZA 1D0IA 3G1TA 1JG3A 1NUUA 2J4CA 2ZROA 3E82A 3TQSA 4BN0A 5IF3A 3B3JA 1QIFA 3CIOA 4M9QA 5T4BA 4QFCA 3SSNA 3KQYA 1PEYA 3P45A 3W7AA 1BTOA 4HQ0A 3QMMA 4G89A 4I4CA 1QJ4A 4N4AA 4PQFA 3W4JA 3WJ2A 1QGYA 3K9WA 2YY6A 1M66A 1Z56C 1NNSA 3R6LA 5BR8B 2X0IA 4PAQA 3L9WA 1VG0B 5F5XA 4B46A 3OUZA 1RACA 2DF8A 4O5OA 3AEKB 3I28A 2QD4A 3E1SA 4C08A 3WRXC 2CB0A 1GG5A 1L7XA 2D1QA 2ONKA 3AIIA 5TVGA 3ZK9A 2CUKA 2PWZA 4CKCA 2D0PB 2QX9A 1NBOA 4NG5A 2BSQA 2BI4A 5I9BA 1G5IA 3F8WA 2XDWA 3HUFA 3KJFA 2ZYTX 2HV9A 3IVCA 1LI4A 3OF2A 4K81B 4M76B 4XJVA 3EJ6A 3VC7A 1JZQA 5H4GA 1Y6QA 2DERA 2OBYA 2DH5A 4PCUA 5U4XA 1N2IA 4KO1S 4O2BA 1FQJA 2I5PO 2PRKA 3A9CA 2PBFA 3GPLA 1YK1A 3KKQA 2G63A 5TY0A 1GSOA 2B6HA 2CCGA 2WMDA 2Z9BA 3IAEA 3M89A 4G65A 1JZSA 3RIHA 1YXMA 3L49A 5FOQA 3Q41A 3NI2A 4P3PA 3D4IA 4TXHA 3TUJC 5CFPA 2ZATA 1CR0A 2QZ4A 4WECA 5FTKA 3ZGLA 1PNOA 2RJOA 2W2LA 3FGPA 1HYEA 3G8CA 2BISA 1WTCA 3H6KA 4DC9A 4YRNA 1QQ6A 4US0R 3HA5A 1WDLA 1F1BA 3MINA 2QSJA 4QU0A 1FX1A 4O2BB 2DQZA 3KVYA 4IO1A 4NX2A 3UAZA 3FI9A 4LF7B 4D1YA 2QMYA 1BKSB 4X61A 4XQ9A 4ABTA 2EKBA 1EHYA 3EOBI 4I4IA 2AV6A 4LSMA 2ST1A 2H2HA 2X0KA 2GF2A 1R5JA 3V97A 1SPBS 5C46F 3TM4A 4QYIA 2NO9A 2W5UA 2R6FA 4LKOA 1GGFA 1W35A 2FSSA 2VJAA 3WHIA 5ALWA 3UZUA 3MINB 4KR6A 3FYDA 1P7ZA 2F90A 3C3DA 4NL4H 3R7FA 3W2TA 2XE4A 2Z1DA 2A6PA 4JI8B 1IY8A 2V9CA 4JR0A 1WMEA 1KDYA 2V6GA 2EP5A 2VWHA 2G76A 2J6CA 3AQ4A 3CTMA 1SZDA 1T0IA 2IYZA 3QLTA 2B0CA 4BPBA 1DC6A 3K15A 4YAJA 1A77A 4PG4A 4DREA 4Y0VA 1YQEA 2IK8A 1H0KA 1THZA 1XSEA 5B58C 3WAKA 1HA3A 2DLNA 1WSDA 1L5LA 5L51A 3HBAA 1M73E 4OXYA 1QG2A 4UMFA 1RYHA 1ZO8A 1P9OA 3HA2A 3LCJA 3T41A 5G0WA 4KR2A 4D4HA 5A2QA 1Y4AE 1KR5A 3K1AA 1KFJB 3P7MA 5E6SA 3UMFA 1AQIA 2QR2A 4A0GA 3CF2A 1U3VA 3IBTA 3RAJA 2AMJA 2EKQA 4EYKA 3M4XA 1W6UA 2Z3ZA 2R11A 5JS7A 4AI6A 3OCJA 4PQRA 4DTCA 2ETXA 5J4HA 1J07A 2OXFA 3FDFA 3R0JA 4RADA 1TVKB 3DO6A 2XNKA 3ZXXA 1W0KA 5EKUA 1ORIA 1Z6YA 2R4UA 4LHYA 1MHTA 3K1AB 4X0EA 4H0CA 3JZIA 1O4WA 4JC5A 3W8RA 5H3LA 1JBQA 3QNUA 4F6LA 3KZKA 4A82A 4CLDA 5K0BA 1NI4A 1Y6GA 5F9FA 2OORC 3ZQ6A 3ABRB 4JROA 3DPSA 1YCGA 4DCUA 2OEPA 3OQMA 1M7HA 1QRAA 4J4HA 3GP8A 4O63O 3A1WA 3H1AA 4MARA 2IYVA 2CFCA 4L57A 2QM3A 1L7DA 2I8LA 2DWOA 3VR1A 3TEJA 1B2LA 1RJWA 3VTZA 1QYIA 2OGUA 3G5MA 3SC4A 1Q7TA 3WTCA 1U8TA 4NBRA 3ECAA 4EX7A 4Z7QB 3MS4A 4ZDIA 5KYWB 2Q6IA 1JU9A 2FMIA 2YYSA 4RTOA 3ZBTA 1LNQA 4CV2A 3E7DA 1QH9A 1HKUA 1XTKA 4UTOA 4UTRA 4MW5A 1NJ5A 4BV9A 3ZGZA 3ZBPA 2OCLA 6GPBA 4WXMA 5HA5A 2NTJA 2Q21A 2WPDD 5KNDH 4C04A 4BFXA 2ZW9A 1NSTA 3IQDB 4HJXA 3IP6A 4RORA 2YRWA 5KYYB 4X63A 3FI0A 2XJ4A 4JLKA 1YS7A 1PGOA 5AUOB 1E9RA 3KXIA 1JKJB 3VTKA 3ZDZB 3DXYA 5BURA 1DFHA 1HI9A 2PH1A 4FKMA 4RHEA 3WNCA 1EDOA 4MV4A 1S2LA 5THQA 5AXAA 1EWKA 3BORA 3IVGA 1E3WB 3T4UA 4OGGA 3KKOA 4BRZA 4WCFB 2CDCA 2JFYA 1UBFA 2OFWA 4OG2A 1IBSA 1Y9ZA 1NMYA 3FLMA 1E1QA 1SRQA 2E6UX 3SZGA 3N8HA 3TZLA 5TB5A 1G20A 1NNLA 1PTKA 1Z2OX 3LQRA 3QNWA 3AV0B 5A7HA 3ZW8A 5L40A 4Q1AA 3L43A 1H22A 4PQEA 1DZIA 1KK0A 3CG4A 3WJAA 4LZPA 1DEKA 1EP1B 2OFOA 4MRAA 1EFUA 2AC7A 5A5FA 1Y4SA 3KLMX 1V26A 5JS6A 1ZC4A 4BMPB 3OQOA 2DMRA 1SZPA 3HC7A 1US8A 4DLXA 2CVFA 3GX1A 1V7CA 1X1QA 2ODWA 3T7RA 2R4TA 1QOZA 4JB8A 4N5HX 4OSPA 5AJHA 3PL5A 2VSNA 4CQMA 1QIEA 4EG6A 1HSOA 1I3KA 1OBOA 1U02A 3GD7A 1HE4A 4I4LA 3C87A 4LY9A 1G4UR 1O9BA 1MAUA 2OT3B 1H1DA 4YEDA 1U3WA 2Y9MB 3OQVA 2AG1A 4XM1A 1AGXA 4KXMA 5EFOA 3VNBA 3CNLA 3HL0A 3FCEA 1BMFD 3JQAD 3OPVA 2RGRA 1DIGA 1NV9A 5ESXA 1QH1A 2IY8A 2NZ8A 1T6ZA 4CQMB 3E05A 1UIMA 4Q4DA 2GN1A 3K4QA 3L4BA 1UXHA 1GO2A 4C3VA 2C8LA 4C3UA 2NTYC 1NL3A 4FI3C 3OPMA 1T43A 3GRYA 1PGJA 1PGNA 1W0JA 3NXSA 4BQSA 1FTNA 4QT0A 4EW2A 2F4VB 4DBLE 2R5FA 1F3OA 1QH1B 2OLKA 2IEZA 3WL8A 1FBTA 1QB8A 2ES4A 3HDYA 3VAAA 3PF9A 1YUBA 2AHOA 1U0LA 3COSA 3ZHUA 1QOPB 2P2SA 1F2DA 4PO1A 4U00A 4KI7A 4ZOBA 2QTGA 2VNAA 4X8LA 3GJ3A 4LEIA 5KYUA 3D6TB 3UV6A 5F98A 1ONNA 2WJGA 2CNKA 1P72A 3AERA 3FWZA 3C4QA 821PA 3C7CB 3EPHA 4XTRA 2BEKA 5KNCD 1RKQA 4JQCA 4TQ9A 1I3LA 2CFTA 2NU8A 2YZNA 4PZPA 2EOAA 4L76A 1T5TA 2G4CA 1JKIA 1UAGA 3B36A 4CYMA 4TYWA 5CLLA 5A5GA 5HIAA 3OCVA 3TR6A 2FJPA 3BFVA 3GZJA 2JH8A 3HR7A 5DW0A 5AW9A 2DY1A 1P80A 3WB0A 3AERB 2H65A 4Q6BA 2V3CC 2J33A 4M7OA 3U7QA 1MO3A 2Y9PB 3MTBA 2VT3A 2C54A 1Y4DE 3MQ2A 3C3KA 2IEDA 2NU8B 2BDTA 4Z3OA 3L8DA 4B4OA 1NMXA 4KSCA 1TLLA 3PGJA 2CNWD 2G70A 3LVFO 4DSAA 2B4QA 3SIWA 3RSZA 2UKDA 2A0UA 3CKLA 4IIYA 4JGIA 4K9OA 2GVZC 4IWXA 2K6GA 4YIHA 4UNRA 4W9MC 5HUJA 3OLVA 4F8JA 1ZH6A 2VZ9A 3DULA 3AEYA 2EX4A 1GQQA 4X84A 4C21A 2NZUG 4LV5B 1PHRA 1KFEB 5AKKA 1LSJA 3Q7EA 4LQCA 4OMCA 3GG9A 3FUXA 1A7KA 4UKDA 3T52A 4DDTA 5KVVA 1DHTA 1RMTA 3RUHA 5FNVA 4QKQA 2L17A 2QTZA 5DZSA 4AJPA 1NXTA 2OILA 3ESAA 4HDNB 4MV6A 2X23A 1EDZA 1IOLA 3KHUA 1OROA 3UT0A 5KHAA 1R0XA 2HYIC 1VBMA 2QD1A 3K35A 1FRZA 2J30A 3U09A 3COWA 4I1YA 1GKKA 3OURA 4IUBS 4JJ6A 1KIAA 4FMBB 1KSGA 2P7HA 2KW5A 1NAIA 2I4IA 4K6OA 2JCGA 2JEYA 2PSSA 1P73A 3CF6R 3LO5A 4P08A 5IEJA 4TYNA 2QRQA 4O2BF 3T0GA 1YHZA 2BGIA 3GAMA 1BFUA 4ZVRA 4ZAZA 4JBLA 5DRTA 1AT1A 2RHBA 1HH4A 2AVNA 3N0RA 1WRBA 3GVPA 3M9LA 5E0KB 1U0FA 3X0DA 2PUVA 3WKCA 1SIOA 1AKTA 1AKWA 3D3KA 3EGVA 3QVTA 3PEEA 5CURA 5GGYA 3RFCA 4UU1A 5JE8A 1USUA 1ZESA 3ML1A 3Q0EA 5EGNA 4YXWA 3VV3A 5J23A 3A8TA 3LS2A 3NBUA 1ZK0A 2JATA 4V3CA 1G0NA 2A1TS 2V7QD 3HZRA 4GZLA 4MDYA 4HNAA 2Z1MA 4NKRA 2LTAA 2QRHA 3P52A 2E49A 4XPIA 3KKEA 2ACKA 1LY1A 3VYTB 2NADA 3AUYA 3WLSA 4QJ3A 5B2EA 5EMKA 2W2OA 2DPHA 4AJ9A 4EK9A 4LVUA 3V8RA 4HS9A 4MRVA 1KNXA 4PN3A 1DO8A 2ISCA 3HHPA 1L7MA 2CVPA 2VQEB 1RPTA 1VGQA 1DQSA 3DDSA 1G6HA 4Z99A 2DWUA 2E6KA 4HNAB 5I7OA 1ECFA 4ZCLA 4BNTA 2ZS7A 4XPIB 3VAYA 4D8WA 2G5GX 1EEHA 2XGGA 5AYVA 3NXKA 2BY4A 2HRBA 2ZXUA 4UMEA 1L9KA 3KTOA 1FDTA 4H15A 2XRYA 2Z08A 3V32A 1IN1A 4UVEA 1KO4A 3NRJA 4GI3A 2P6UA 2X4LA 4R2KA 4NOKA 2CGEA 3GQVA 4O4IB 1QUFA 1QSGA 3W34A 2JB9A 4JKIA 4MUFA 1UEXC 1Z68A 2HM7A 3KB2A 1PV2A 1D6JA 2E4AA 3LBAA 4FYPA 4LA4A 5DHQA 1VI5A 3RTBA 1V96A 3B1XA 2P6PA 1N5JA 5DO9A 5IM5A 1TM7E 1G0OA 4L0DA 2WSSD 1HYHA 1RR6A 5DEOA 4EQZA 1RMQA 2RGXA 4UDNA 3IE2A 5JZSA 1TKAA 4K2HA 4BMNA 1D7OA 2CFOA 4OTZA 1LF0A 3V33A 3BTUA 4G2NA 4TLCA 1GL6A 4Q7LA 3KJNA 2CYCA 2C78A 1SXJD 3I6YA 1RC8A 4PPNA 4A0SA 3JQFA 2ZE7A 2EZ9A 2I7TA 3FF4A 3FSJX 4GX2A 2I3ZA 4PNPA 2A5JA 2X0JA 1S2GA 3PUXA 2RB4A 4OOFA 1JECA 4U5QA 5AI4A 5IANA 1AQLA 3TCKA 3UOWA 3HB9A 4CTOA 1AXEA 4YA6A 4J7UA 4DG5A 4ZV9A 3K5PA 3OHMA 3F5FA 1QZ3A 2GA9A 4HUQB 5KKAA 2BUBA 1JKFA 4A91A 2JGLA 4D8UA 5ISMA 1XCPA 3ZWBA 1CUBA 4LVOA 4BVFA 3OJLA 1UANA 4ANFA 4E11A 4D25A 3WK6A 2GRAA 2VDJA 4M46A 1SKUA 2BH2A 2I78A 4XWWA 3MTIA 2P30A 2X2EA 1U3UA 2QPTA 2QY9A 5BT9A 3P4XA 3PVZA 4ER6A 1MW8X 4DY4A 4EFMA 1Z06A 4A15A 1XTSA 4BWGA 3F9IA 5IKMA 3RAPR 5IT4A 1XRNA 2X7JA 3CR3C 3RV4A 3BGWA 1P77A 3BULA 4FILA 1T4CB 3WKDA 4RJIA 1K6EA 3JAWB 1GP2A 1Q92A 5G3YA 3WQSB 4L1KA 1A9YA 1A71A 3GDFA 1Y1PA 3SQDA 1C3EA 1IG0A 3EDQA 4L4YA 3FA2A 3FOCA 1KI1A 2IP4A 1I2BA 1MAHA 3CX6A 3EZGA 3LXUX 1JDPA 3AT1A 2CB9A 1G20E 1HY3A 4W1PA 5KHLB 3ZIDA 1IK4A 2VEDA 4PX2A 4Y2JA 2DT8A 4EW3A 4TYQA 3HKBA 2IY9A 1SQ5A 3DE6X 3U7EB 2V55B 1T3LA 3IUNA 3N7UA 4XYLA 2OKGA 2ARKA 5DYWA 3V4OA 4RULA 3OZGA 3OJWA 4O2AA 1GN9A 2PT5A 2YQ5A 5I5EA 3ND8A 4IKEA 2O57A 4XB6B 5I3ZA 2Z4SA 4OI1A 3ZVRA 3IT3A 4D43A 1J8YF 1I1HA 1DIHA 3BH0A 3HKBB 4AY6A 4BMCA 4RY8A 4B47A 3X44A 4DNFA 2VHZA 3PF8A 4B71A 4AC9A 2IZOA 3T95A 5IBCA 1JLLA 1P0MA 5CK5A 5IZCC 4O2AB 2PKWA 4B31A 2R751 3BCSA 3HUDA 1CHNA 1CF9A 1G17A 4PINA 1QVAA 4MVJM 3O94A 3DLAA 4U2FA 3PXEA 5TXGA 1ZH4A 4NH4A 5EESA 3LUBA 3O2NA 3P0EA 1QXSA 4IDOA 4LJ6A 1KDRA 1VSTA 3DFZA 3QXGA 4NOJA 1RT9A 4WN9A 4ZVUA 1C14A 1N57A 4EL5A 5JDIC 5J2UA 3HKDA 1KS2A 4ZVQA 3GEEA 4HDMA 1JLLB 4DQLA 1EE1A 1WBDA 2Q3CA 4CMJA 3VH4A 5DFAA 3RJ9A 1ADGA 3PCTA 1P4GA 2H1HA 4YRDA 5B2FA 2ZVJA 3BYZA 3CRNA 1JYSA 1NIJA 4QTYA 1XDBA 4KV7A 3WV4A 5C0OE 1CZHA 3WLTA 2OAP1 5FWNA 5LZ8A 4XJXA 2HBQA 2L2QA 3QWIA 3FF1A 1VXOA 1H5NA 3HKDB 2BFMA 3X1YA 4HDMB 5FLXA 2ZWPA 1T0JB 1X15A 1FYEA 3PPXA 3QX7A 1J0XO 1R3UA 4FHDA 3U9SA 1FNDA 2HU7A 1KO7A 2JZOA 2VUHB 3DKPA 4PC1A 3K2QA 5CPBA 4Z9XA 3S2FA 4ECAA 2IH5A 4IKPA 1GPLA 4MWCA 1CXZA 1E20A 3BJRA 5L3QB 3VSDA 1GGEA 5DNVA 1M2VA 3O8QA 3Q3IA 3U1VA 1OH7A 1TM2A 5DM4A 2G28A 3VZPA 5EFZA 1Z33A 3VC1A 3ZY3A 4KR3A 1M5TA 1F12A 3BMQA 4WEOA 1BJTA 2WSYB 1BVYF 4HC4A 3FZEA 1A88A 2YJ3A 3E8XA 3O93A 1EA5A 2IIVA 1R4NA 2VF7A 3DE7X 2XMPA 4G1VA 4RPHA 3VU1A 2AG8A 4Q4AA 1LNZA 5ED4A 4M0FA 1KL7A 3RHFA 3R24A 4TTSA 4CIAA 3L6EA 3R3YA 1EM6A 4GQIA 1BGWA 1NY6A 4RVHA 4P0QB 3B5JA 1VKNA 3O8QB 4JUBA 4UOQA 2HHLA 2RJ3A 2VK8A 4QL3A 4QREA 5E7MA 1LVGA 3ZUPA 3CZ4A 1P5RA 4DIOA 2ZTHA 2B0JA 4F92B 1LXCA 3BMQB 4PSUA 4FGZA 4BVKA 4HJRA 1R4NB 4LE2A 1ZWLA 3MC1A 3QU4A 3F47A 3BT7A 1NVAA 4EUEA 3ZU3A 3NNNA 5C80A 5D1NA 1B1AA 3B7WA 1T5BA 3COYA 3PXUA 4QUEA 4YDSA 5H9VA 3DEFA 2QM0A 2YHUA 1SVOA 4KO4S 4X93A 2H8KA 3EQ8A 5DNYB 4DSZA 2NQ8A 2F3TA 4Z3KA 5BVHA 2F9MA 4RC9A 2RAUA 4B7ZA 2X3UA 4YMUA 1Z88A 3VO2A 1WKBA 3ULKA 2X3FA 3ANYB 3HB5X 4CMGA 1ZM2A 5FNVF 2ZU0C 2X4IA 4P54A 2POQX 1QLWA 2FZ4A 4IM7A 1FLAA 2ZT8A 3KL2A 3C5CA 3GMTA 2EL7A 5AVUA 5KDDA 3EZ2A 2PFGA 4LQ4A 5JAIA 1KMMA 3WLJA 1YRQA 2JJ1D 4KPFC 3QVKA 2RAVA 4FN4A 1Z28A 3FETA 3VVLA 2MYTA 4J76A 2GAAA 3OEYA 5LOVA 4KEAA 2YZ2A 4QUDA 4CV1A 1P9NA 3SZMA 3V6LA 3L0BA 3DMTA 2PKRA 4LJSA 4XB2A 3MBOA 2Q6LA 2ZJBA 5B1HA 1OFGA 1GCOA 4BN5A 4X6YA 5BY2A 2YJ5A 4H1HA 5AM1A 5EZSA 1R88A 3EUWA 3IEPA 2CXTA 3D2LA 3E7XA 3UNXA 3RODA 3W3ZB 2Z6QA 1O7JA 1P6UA 3PVSA 4CCYB 4DBLC 3KD3A 4J91A 4RL4A 3VVCA 4OAPA 4WJLA 2O23A 3W0LB 2E4UA 2DB3A 4R9UC 2C61A 4TRRA 4WDRA 3ZVKA 1JE1A 2B4RO 1G41A 2P9FA 2ZRBA 4DWJA 2IV3A 2D3WA 5LDDC 3KQMA 3BH7A 4PZ9A 4UE3S 1C1HA 4V0QA 1U80A 3ESBA 5DTRA 3JTMA 4X3PA 1PS0A 2CNDA 4TTAA 3KFXA 4V38A 3LP5A 3RTCA 5KSPA 1GGVA 3PFBA 3T9BA 3ROXA 3GH3A 2F1KA 5JADA 1CVIA 1KORA 3WYBA 2Z2KA 3OT1A 4GMXA 4P7FA 3WL4A 2VPXA 5EIWA 1T4MA 2JBWA 1FP2A 3LDGA 1AV7A 1E79A 1OYOA 1LKZA 3NBZC 3P2KA 2IS6A 3UIEA 3WXBA 1IZ9A 4IQ4A 4MA5A 2P1DA 1JHYA 3HCNA 4Z4QA 1ZOPA 4ID9A 1OW3B 3ZV5A 4KRFA 2SKCA 3TRKA 1WUHS 2QUAA 2BUAA 4IHQA 1CFJA 4CMEC 3UUEA 1A4RA 1GGMA 1LF5A 3L7LA 5DKFA 3OZ7A 3OT1B 1SC4A 1Z5WA 1FNBA 2AJTA 3I3SR 1G16A 4L72A 1K7FB 1GL9B 1IXKA 2QPAA 5E6UB 3AEUA 3GAZA 2YJGA 1MJGM 3GMSA 4CDGA 1A04A 1EAMA 3OPNA 2OESA 3OEHA 4PZDA 1Q0PA 1Z0SA 1VLLA 3TW0A 4FEEA 3VOSA 2WF8A 3LNTA 4XGRA 2R0QC 1QFJA 3DJFA 1KF0A 3N87A 2QT0A 5CFRA 3K0CC 3S6JA 4Q66C 1KOJA 1ILWA 3ADOA 2ORVA 5A3VA 1AS3A 4TTQA 3WNVA 4EO4A 5MDHA 1KYQA 3DLPX 4BJ1A 3KUUA 1VL8A 3AEUB 1JHMA 1KNQA 4L0QA 4AULA 5ES4B 4H0FA 4CGZA 4OO3A 1HZJA 1U7TA 2DY0A 3IJPA 4Q3CA 5HSGA 3U7IA 1C4WA 1KQFA 4WADA 2GA8A 2QVBA 3MF4A 3CNNA 2Q7DA 2QI9F 3MM4A 1K98A 2Y1WA 4W7IA 1CB7A 1BEUB 4GC5A 3GGCA 1U1FA 3NIWA 3O8OB 3OOWA 1HDCA 5IP5A 2B8NA 3W6OA 1IIBA 3IX7A 4PAMA 1K66A 2YZGA 3N70A 2VA8A 1W9MA 1HLGA 2GWHA 3JQBA 2QV7A 2AD1A 2WM3A 4BFVA 5JQGA 1DWOA 2CYBA 3QKRA 1W4LA 3F3KA 4P8RA 2YVQA 3PR2B 1QX4A 4UUPA 5AHOA 5ALEA 3T7EA 2R2AA 2B2CA 1H2HA 3CEHA 3D8UA 5A5EA 2AFHA 2ZIWB 4MGEA 1OOEA 1TGYA 3T3OA 3JRWA 5DBFA 4LYAA 5FFMA 2DECA 3U5ZB 4UPVA 4A03A 2I6UA 5KSZA 5EHNA 4IAOA 3AJ9A 4XUCA 1U9JA 5JQGB 4S2UA 1PGPA 1VZ3A 1XHLA 1XTTA 2Z58A 3QKRB 4A0HA 4D79A 1H3EA 2ZE8A 5DI3A 5AOAA 2FWIA 2JI8A 3T0FA 1L5MA 3OZCA 2ZRFA 1DBRA 2X19A 3C1AA 4LXTA 4YV2A 4ZMRA 4IKOA 3MFQA 1O95A 4E3WA 1NKVA 1I5RA 3FPSA 1AHHA 4FFNA 2WJIA 3KQKA 1HGXA 1ZUNA 1M8PA 3KWLA 1UOQA 2PVPA 3AR3A 1KSJA 3N2NA 3MTGA 1G5FA 7AT1A 3FYSA 4KXQA 3UC9A 3A14A 1DB3A 1NGSA 3F74A 2CHFA 3G7NA 4HAWA 1R1DA 4JYMA 4ZCMA 1IU9A 2FSIA 1UJMA 2VDRB 3KK0A 1KAHA 3PKJA 1ESZA 2C7QA 4JXKA 5TMPA 4C89A 5EJEA 3ED1A 5AKHA 1ZUNB 3QIAA 4O2AF 1KDOA 2O7NA 1V2HE 3V8NA 5BW5A 5EN4A 3H1BA 4BVJA 4HGNA 4N3GA 2BCEA 3HBNA 5CGZA 2CC2A 1Z5ZA 2WSLA 1AQ6A 1U7WA 2O3SA 1P1JA 9GPBA 1R9GA 1BH6A 1CQXA 5BSGA 4EYOA 1PX0A 1QC5A 4GI1A 3OUUA 5EIOA 3JVEA 1E7WA 3JATA 1AU9A 3KX2A 1WJGA 2XSZA 3F2VA 3WIBA 1VECA 2XCQA 5F5LA 4DCCA 1T4GA 1SCAA 2QBYA 3ZCXA 1UJCA 3B60A 5BQ5A 3GLHE 1ZXLA 2BHSA 3PI6A 4Q82A 5HW0A 4EHDA 1H2XA 1DKPA 4P80A 1QC5B 5J2UF 3CN7A 4I5IA 1FSFA 3PUIA 4Q21A 4E14A 2YQZA 1RE0A 5KC9A 1G6KA 2WYVA 4DXDA 2O4UX 2OCIA 5CDYA 1N1GA 1V39A 1QO0D 3WVNA 5GJVC 4FNAA 4OJKA 2JJMA 3D2AA 2ZWMA 1XX6A 4FDUA 4I5DA 4BFUA 4TS3A 3FFAA 4JOCA 2W71A 1BO6A 2MDTA 2BELA 1IOWA 5HCIA 5F76A 1G3UA 1WWKA 1R8YA 3C3AA 1J7KA 3F6PA 4EG3A 2ACEA 3VZCA 3WADA 2WIJA 5I6DA 1X94A 1P44A 3K32A 4ZOEA 5BW6B 1I4WA 1MLDA 1R6UA 3RRXA 1NC1A 1FTQA 3JXEA 4AD8A 2EKLA 1H6BA 5DYTA 2NO5A 1SUIA 2O1SA 2XA9A 1NHGA 5AI5A 3QBVA 4C4YA 1I0IA 1FA9A 3O3NB 1JQ5A 5L3VA 1GSAA 1QGUB 5ECGC 3RVMA 1BE6A 3DVQX 1GIAA 5FUQA 4JLOA 2WYHA 1GLNA 3QPDA 1YVUA 3PNMA 1Q3HA 3PT5A 1XUOA 2KJQA 4RLSA 4JLBA 1YBFA 3CG0A 1ZN8A 2ONYA 2Y4NA 3E5RA 3C43A 4O0LA 3E1GA 5EJ7A 2VP6A 3SLKA 4IRXA 1AQUA 4RLQA 1COZA 2QVXX 2BTQB 4HL6A 2X2PA 3F8TA 3G8AA 3MHTA 5KREA 1AJEA 3KSUA 4Q18A 3REFA 1JTEA 1JXMA 3TEFA 4RAQA 1NXSA 1B0UA 2DG2A 3FUTA 3OPQA 5FWAA 1X1EA 3PEYA 2C5EA 1SUEA 3DMHA 1SUPA 2WZDA 5ALNA 1RQRA 3ORFA 3BK1A 4DLPA 2V58A 5DBGA 3UUFA 4C76A 2W22A 3C8DA 1FXWA 4CLRA 2R7AA 1D03A 4KR7A 1A9TA 1OI2A 3AHHA 1SVUA 5EKTA 3RUCA 1JHRA 1L4YA 3L6CA 4TSFD 3QKTA 5GIPE 4GMHA 1OASA 2NZVG 5FO1A 3AR6A 3I2IA 2A1IA 1Q2XA 2QPLA 2QUIA 4EJ6A 5HKAA 4G5YA 1Q7EA 1RAEA 1HDZA 2FW0A 3AW8A 3UT6A 2C4HA 2GPSA 3JVVA 4MUJA 3O75A 1XZEA 3LK7A 5JVDA 1TU3A 4GLOA 4AS3A 3NS7A 4NQZA 4CLRB 1PJBA 2EZ4A 3PWSA 4PXSA 3RDPA 5DGDA 4LOHA 4XH9B 3UAOA 2OGSA 4A10A 4ZAFA 3IUQA 1USGA 5GMOA 3QU2A 3TVYA 3G82C 3BFXA 4F4CA 3PC8C 5LC1A 3HSSA 5LOVF 4Y2QA 5ER9A 2KSQA 4OV6B 5CFMA 4X7RA 2QP9X 1FFXA 1Z74A 4TXLA 4CKBA 3RLFA 1TIPA 3E1KA 4RTRA 2EBUA 3OE4A 4QUKA 3LVQE 4IGEA 4GVXA 1C30A 1KI8A 1A5ZA 1ZNXA 2V7TA 2XCUA 2HRDA 221PA 3L1VA 3QFRA 3LK6A 2D74A 4F5DA 4HCJA 2ZKIA 3MEQA 3PGVA 3BMOB 1DX6A 1FFXB 3QQPA 5EE1A 4CKBB 2ECOA 4KOEC 4BX3A 5DBEX 2RHWA 1FSZA 2GPTA 4LC0A 2G88A 3GEDA 1W36D 1NY5A 4J49A 1RSZA 2C3OA 1K89A 2YVKA 1HX7A 1C8VB 4KWEA 3SNHA 5HMLA 5AJWA 3H11B 1LNSA 1ZRHA 1JSRA 4Y18A 2P91A 2FRDA 1Y5NA 5CVTA 1HF3A 5HRCA 3DDZX 2XTAA 3N28A 4Y8VA 1E6LA 2ZYRA 3IODA 2RH5A 4R3NA 5HXAA 1HE5A 2WQ6A 1DRUA 1DPGA 1FDUA 2AC2A 2G25A 2OVBA 3CY6A 1R37A 4U7WA 2X6QA 3W3AH 1Z39A 5EJFA 3D4OA 5DIFA 4W5JA 2YIMA 4XYGA 4Y6GB 3DWEX 4KE7A 2I7XA 1G5HA 3S2UA 1CUWA 1SQSA 5EXXA 2NO4A 2W90A 4YJGA 3C6QA 4REQB 2FQWA 2FUNB 1MQ9A 1WE2A 3QBJA 4X44A 2BDEA 2B21A 1KI2A 2Z8ZA 4DMRA 4EYSA 3DW3X 3V1KA 4RF2A 5EIHA 1R9JA 4HYTA 1SBIA 1FK8A 3DV2A 1YJCA 1JAYA 1UBUS 3CZ9A 3FJOA 1V4BA 4TV8A 4YRCA 2FDCA 3QBDA 1EEXB 3CLKA 4DYVA 3GLIA 1UT6A 4MQLA 2Y77A 4YI3A 4L5IA 4DMFA 1B8NA 4YJGB 3JVUA 4HB0A 2J7PD 1IN4A 1YB6A 4FSHA 5LD2B 4FWIB 4WLFA 2JANA 1WXQA 2IHYA 4FMDB 4LRTB 4S3MA 5AHXA 5FL7D 2PH3A 5EMNA 2DKFA 4F5YA 4OMDA 3DXXA 5K0NA 4IVRA 3EVNA 2NN3C 4RU1A 3ZTTA 4WY2A 4HBGA 4TV8B 3VR3A 1ZWKA 2WK1A 2IXAA 3TM5A 1MBZA 1UR5A 2CWDA 3A3YA 2IDJA 2QQGA 3W6PA 4MWGA 3WL5A 5HF8A 2PJUA 1SCUA 2PWBA 3UGKA 1X8LA 4RABA 4HDQB 2JJ2D 5JATA 5IAKA 2GARA 1XD9A 4CV0A 3DL7A 3TSCA 1W5SA 4GYYA 4BQIA 1U8FO 4NPAA 1GPMA 3KE9A 4IXNA 4OA5A 2IZ0A 5ALPA 4OP1A 4OL9A 1LB1B 2TYSB 1T8UA 1VGVA 5JQGF 2UXBB 4EG0A 1Z5NA 1PJSA 2QAGC 4DLWA 3WLNA 4FHEA 1NSYA 2ZTVA 3FE2A 1SCUB 2D3TA 1PR0A 2AX4A 2I66A 2VL7A 1J8MF 3PWTA 1TO1E 4BVLA 3ZWQA 2YRXA 1M2HA 3KVOA 2ORYA 3GBPA 2ZI9A 3GHHA 3ORSA 3Q8MA 3THYA 4FS8A 4KQ1A 4LF8B 3HEMA 2ZRNA 3IKLA 2P41A 2W98A 2Q5FA 4WKPA 3RUEA 3SQXA 4B4KA 4F4UA 2CNOA 4COOA 3PD1A 3HCCA 1NNI1 2XLBA 4DMLA 5CD1A 3MJ4A 1XTUA 4HATA 1TMKA 4LJ9A 2QTNA 5DOZA 4FFOA 2H63A 3VVMA 2ZUCA 4W8HA 2ERYA 2P7IA 1TW3A 4IPTA 3VJKA 2W6JA 2E89A 3OM8A 3R7BA 4Y9DA 3THYB 1H8HA 1KQ3A 1A9ZA 1KY4A 2AQIA 3PUKA 4G36A 3VPAA 4B8ZA 5IC4A 5HM6A 5JU6A 1YE8A 3MAGA 2V1XA 4GMGA 1VIAA 2AF4C 5BWLA 5I7VA 3PWZA 1RQXA 1RCUA 2G1JA 4Q5IA 4NZOA 4HWPA 3ISTA 2E82A 1C2YA 3W8NA 3V48A 3MLBA 1DINA 2ESRA 1C9DB 1D1TA 1PTJC 3NBMA 2VPQA 2TMKA 1W49A 2VHCA 4UAGA 4GNRA 2PKQO 3EGIA 3OFVA 1IIRA 1F9EA 1X86B 3AOGA 4HDSA 4X7BA 1ADBA 1KEVA 1UZLA 3ISVA 1MC5A 1I2DA 5DMHA 5DU2A 1GVNB 5KX5A 1R12A 2DBZA 5J63A 1J0DA 3BB1A 3ITDA 3GEBA 3PTZA 4C7OB 1SHZA 4YLEA 4B4DA 3DT9A 2GYYA 1GKIA 5DHUA 5GJCA 3M33A 1NVWQ 2RBKA 4IJUA 4J2OA 4CEJA 3OCWA 4L8LA 2X5KO 4OGFA 3IDOA 4HDSB 3I8XA 2A9PA 2Q6VA 2EFJA 2GOYA 2HRQA 2W2MA 2VO1A 4HWKA 3T0IA 1Y81A 3L6BA 3CH6A 4GXQA 4XYBA 2JCBA 1V8OA 2PDAA 1YSCA 5KX5B 1M34A 1SZJG 1XTVA 3ZY6A 1AG9A 1OIXA 3QPVA 1WX1A 1I7PA 4QDXA 3QBEA 2D5AA 5B6JA 1B6SA 1QGZA 1ZSYA 4TL7A 2BPOA 2I7VA 2A33A 4D99A 1P33A 1ZL2A 4YR7A 3DM9B 1CFZA 4TYYA 1EGQA 3QU7A 4H6PA 1JQEA 3LHDA 1FPQA 1KPHA 1N8KA 1MJ5A 3LQFA 4HGOA 1X9IA 2IEIA 3KKZA 1M34B 2LR0A 1W4ZA 3GLVA 3PTLA 4I19A 4RZXA 4BU0A 2PX8A 1DE0A 1SXIA 1P6XA 4E09A 1VHDA 3HM2A 4HMQA 3I2HA 3GNSA 2WAXA 3H9JA 4MGIR 1VIYA 3FHCB 5B37A 4E6EA 1EUYA 2ZKLA 3EPKA 3A3PA 1GA6A 3F5SA 1EWTA 4PICA 3OA2A 4JYZA 2AKYA 3M1IA 4QU5A 3EGOA 5J40A 3T8YA 3HVUA 1N6PA 3NKFA 4MGKR 1Z36A 4CETA 1UBMS 4NBVA 1P2TA 1JQBA 3BXFA 5CTAA 5FPYA 4S05A 1TAGA 1OE0A 3M5CA 1A2OA 1L5OA 1RAIA 4KXUA 3UMSA 3HJCA 4DDKA 2CT8A 1KU6A 3HJHA 3TW8A 4D56A 2OHFA 1BDHA 1KEZA 3NHLA 5ICGA 3NUQA 4W1RA 1EIWA 4JA2A 2AYYA 3R5HA 3L8FA 1L3BA 3TL3A 1RADA 2FI1A 4D4GA 1TU0A 1LJUA 1C9EA 1AKRA 4FFPA 3SYNA 1DQNA 4ZQFA 1ZXBA 4G0YA 1X1RA 3HVIA 4PO8A 1E7MA 4FX2A 2BM1A 4RCVA 1T9GS 5EE9A 1V1MA 3AC0A 3P27A 5AMXA 2I9KA 4FMCB 3BL6A 4G8JA 3MWDA 3WJ7A 4HQKA 3TW8B 1ZA1A 4NSNA 1U0JA 3FXAA 3H8WA 4KACA 2OXEA 4HYQA 4LHEA 2HQOA 4G5FA 2NACA 2V0CA 4M7RA 2WA2A 4MHSA 4DNPA 3SCZA 4AZ0A 3I42A 2YXNA 5CT4A 3PSAA 5FLYA 1H5QA 1YQUA 1ZFNA 4RZHA 1DV1A 3ZE2B 3EVDA 1Z0FA 1BJRE 4RIGA 1V1MB 1L5ZA 3H4MA 4E32A 3A25A 2O0LA 1DDOA 2CFRA 4BB9A 3OTQA 3PFIA