1ESCA

The molecular mechanism of enantiorecognition by esterases
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
302
structure length
302
Chain Sequence
DPVPTVFFGDSYTANFGIAPVTNQDSERGWCFQAKENYPAVATRSLADKGITLDVQADVSCGGALIHHFWEKQELPFGAGELPPQQDALKQDTQLTVGSLGGNTLGFNRILKQCSDELRKPSLLPGDPVDGDEPAAKCGEFFGTGDGKQWLDDQFERVGAELEELLDRIGYFAPDAKRVLVGYPRLVPEDTTKCLTAAPGQTQLPFADIPQDALPVLDQIQKRLNDAMKKAAADGGADFVDLYAGTGANTACDGADRGIGGLLEDSQLELLGTKIPWYAHPNDKGRDIQAKQVADKIEEILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
publication title A novel variant of the catalytic triad in the Streptomyces scabies esterase.
pubmed doi rcsb
molecule tags Hydrolase (serine esterase)
total genus 104
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 1994-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1escA00
5HOEA 1U8UA 3KVNA 1BWQA 3RJTA 1FXWF 1ES9A 1YZFA 4Q9AA 4NRDA 3C1UA 1DEXA 4Q7QA 3SKVA 4JJ4A 1BWRA 4JJ6A 4RW0A 3DT6A 4PPYA 2HSJA 5A4AA 1ESEA 3HP4A 3PT5A 5BN1A 4OAPA 1BWPA 1VJGA 4IYJA 2Q0QA 4OAOA 3DCIA 4JGGA 1V2GA 2W9XA 1WABA 1JRLA 4HF7A 3U37A 3MILA 4DEVA 1PP4A 2WABA 3DT9A 3DC7A 3SLRA 4K7JA 2APJA 4XVHA 3P94A 1DEOA 4S1PA 4H08A 5JD3A 4I8IA 4K9SA 1ESDA 4TX1A 4LHSA 4M8KA 4K3UA 4JKOA 2WAOA 2Q0SA 1FXWA 4JHLA 5B5SA 4RSHA 3W7VA 1Z8HA 1IVNA 3BZWA 3DT8A 1ZMBA 2WAAA 1VYHA 1ESCA 1K7CA 4HYQA 2O14A 4K40A 2VPTA 5CD9A 1J00A
chains in the Genus database with same CATH superfamily
2J08A 4IOMA 1H4TA 3CH4B 4N5LA 1U8UA 3AJRA 4JBIA 1XMVA 3O74A 3I72A 4NARA 2HQ1A 3VVCA 4YRGA 5JEDA 1BWQA 2BZSA 3ZLJA 1AN0A 2QUAA 1VYVA 1ZP6A 2IKQA 3F9CA 4YXFA 2WF5A 3AJDA 2D7DA 2IUYA 3DMTA 2XY4A 3QFTA 3C39A 3THSA 2P2DA 2QDXA 3FPEA 4EF4A 1DPFA 4MUKA 3GP8A 1PJBA 4HWGA 1BCSB 3T3MB 2QI9F 1QOZA 4GKVA 1WP4A 5JRZA 1CZNA 1AD2A 1KGDA 5FOVA 5BT9A 1PT7A 2G1KA 4DJFC 4CQNA 3L2OB 5C5IA 3HL4A 1QYRA 4NU8X 2VZ8A 4JZYA 2D59A 4WNAA 1M2JA 1MO4A 3CLHA 5JAIA 1DAMA 4GPIB 4OFBA 3WWPA 3VPAA 3ITEA 5ED0A 5A3SA 3EDRA 2BR4A 2O2DA 4JV5B 2CF6A 3I04A 3FMOB 4JODA 4R2MA 5AW5A 5DBHX 1T4DA 2AJCA 2Z3ZA 5DTQA 2EIXA 4B4OA 3O8CA 3QF7A 3PVCA 1CF4A 2X6RA 4YASA 2J48A 4L27A 4BECA 3HR7A 4R4JA 3MJEA 2XEDA 5ARDA 5MFPA 5JMTA 1FXUA 3NASA 2AEFA 4AB1A 1JLLB 1P7PA 5DYYA 3A1SA 4N5MA 4MUHA 3I9LA 3R3ZA 4ZAGA 3SYTA 3AVTA 3CN7A 4A8TA 3F5MA 3R6LA 5TPZD 3E61A 1POWA 2MHCA 2WC1A 4K87A 1YVPA 3JD3A 2DB3A 2XDQA 3ZJ5A 1H3NA 2CE7A 1ODIA 4LWZA 2WABA 3RUDA 4QC2A 1A8SA 1U1CA 3GRRA 1SBNE 4FOTA 2RHTA 4GGPA 4FHGA 2OV6A 5TMPA 3NIDB 5GWXA 2EJTA 3WWYA 3Q87B 4B6FA 1FDOA 4OB6A 1B8UA 4V03A 1RRGA 1UANA 2Q3BA 2W6JD 5DTMA 2E4WA 1UBOS 2O3SA 4LDRA 4EZEA 1JG6A 1MT0A 4E4YA 2X8BA 1IWOA 1C0PA 4YJ3B 4P82A 1QUEA 3GWGA 4IHAA 4DLYA 2HEIA 1DDIA 2XB9A 3AP1A 1DE0A 2K2QB 3DAYA 2ZSIA 1NXWA 4G0OA 4YJHB 1BCRA 3D81A 1QJCA 2WM3A 2ZSKA 3W5CA 4GL2A 2EWWA 2I29A 2Q27A 3DKRA 4RSMA 4TQAA 2CL5A 5AVQA 1RWWA 9MHTA 1ZOSA 2F1OA 4UTXA 3FWNA 1U0GA 5CAEB 5AESA 2F48A 3H6GA 5J4YA 1N78A 2JCBA 4KK4A 2JAOA 4AT1A 3PNYA 4H0NA 3ENVA 4E1VA 4F4IA 5F3WB 5HF9A 5BVHB 5LLTA 5KWIA 2IVZA 3KZVA 5F51A 2GS9A 5KKNB 5L51A 1GR1A 2EWMA 2CKMA 2WE7A 1PNTA 1W96A 2H8GA 3PBKA 3RSGA 4AMBA 2GF9A 1HYEA 2G3YA 1I32A 2XUZA 2GJ9A 4DCMA 4C4XA 4ZMBA 2W6QA 3A6KA 4BXOA 1C3EA 1L8XA 2MIIA 2IHTA 1A9RA 3AT1A 3BWCA 3R3SA 1R88A 4GLOA 1D1PA 4K9MA 3V1LA 4QELA 2WFZA 4C7KA 2DJ5A 4IZIA 3PXGA 5AO9A 3P2JA 1R74A 2FOIA 2BY4A 2VEOA 5JO9A 3EAGA 4B3DA 1OB5A 1T36B 1JDVA 2TSYB 2WPDA 3K3PA 1E9CA 2J4FA 1TUBA 1KO5A 1ODKA 3HBJA 3N7TA 4R81A 5JJLA 4URXR 3R3XA 5FUVA 2R6FA 3DDWA 2CVOA 3TD6A 1LU9A 3G2MA 4YDHB 4Z9BA 5EZYB 2G9VA 3JQAD 2HDOA 4B9EA 1QH9A 1EVYA 3MJHA 5HUHA 3FMGA 1B6TA 3AOEC 4XASA 1E6KA 2HMWA 2JFHA 3C7CB 4MARA 5AIBA 5K2OA 4DSNA 1VL5A 3GLHB 2O8CA 3ITNA 4D46A 3WLOA 2OD9A 1BFDA 5JCZA 2K5UA 2JFGA 4ND8A 1L4LA 3GLSA 3VO1A 2VQDA 3UXMA 3WGOA 1WTAA 2GKSA 3SYMA 1PX0A 2PRIA 3JVVA 1O89A 4TL8A 4LWOA 4P7FA 1E92A 5HRUA 2A78A 5TGDA 3VJLA 1OX4B 3VR4D 3WIBA 3STTA 1XNRB 5B6IA 3HCRA 3KVRA 5HIAA 1EFVA 5CDHA 3SS9X 4CODB 2X6QA 3CCFA 5KJ6A 5LMNB 5BV1A 1E5VA 2XDWA 2OBFA 4RAQA 3A9WA 5SZHB 3D8BA 5DI9A 3IEXA 4KMSA 1NVBA 4DJ5X 1B8OA 2W6JA 3A4MA 1Y6JA 3F1LA 3FGZA 1E60A 4UVGA 5FI5A 1WV1A 1ULSA 2Q5FA 3AH8A 4IGEA 5JPIA 2OEPA 1R3UA 2ASEA 2PX5A 3QUAA 2ZIEA 4FUQA 3PNQA 2FZWA 3S28A 2FUG1 2F1JA 1NQXA 3C14C 3DV9A 3L4JA 3GA7A 4CEIA 1XDWA 4O02B 1RLIA 2BRUC 3OCYA 4BV2A 3T5MA 3IAAA 4MDFA 4CL2A 1YQTA 2BFPA 3JAKB 3KLBA 3VPCA 2PH7A 3H2SA 4ENVA 1EX6A 1BC5A 1TZ2A 1Q84A 2OHFA 2IODA 5JOQA 3K70C 4MW5A 4OP2A 3CH7A 1X14A 1AGNA 1ELOA 1XWIA 1HKUA 4MPPA 1QFXA 3D0QA 3H17A 2EKQA 5B1SA 5IXJA 1MIOA 2ZXEA 5BO5A 2HN9A 3Q11A 4ECEA 3C5VA 4P98A 5AM2A 4KI7A 2V7GA 1QGOA 5U9CA 3CE9A 1I5EA 4RF3A 5D6NA 4JOBA 4TWZA 4XQEA 3CIOA 3BD9A 4I3HA 2ZDQA 3FHCB 4TSFD 4UHHA 4MW4A 1U6IA 2ASVA 1DS6A 3GDOA 2W6ZA 4HNTA 1RXVA 2EU8A 2JLWA 3QHAA 1C50A 3NXSA 2HRZA 5I9MA 3ZWYA 4B83A 2ZITA 1L5ZA 3AETA 4D9BA 3OA2A 2IEBA 4OIMA 4R8KA 3F96A 3TZEA 3T9DA 3SMQA 3V3KA 3ZE2B 4K86A 2G63A 2R68A 1XROA 1UDWA 4REOA 2ST1A 1COWA 2VC2B 3M6FA 3F3MA 2QYSA 2RB4A 1OBCA 2MMCA 2K6GA 3D7LA 4CKWB 2QRKA 2VZEA 4LWPA 1S3SA 4MVJP 4R8SA 1O87A 3UH1A 4J0IA 3KM0A 3L0YA 4GM1A 4LE2A 4FGSA 4S1OA 4Q6BA 1NXQA 3VU8A 3FUVA 3I01M 3LOPA 3ZX4A 4TMVA 3RUAA 4RU1A 4RLFA 4F85A 1YDWA 3VSDA 4L8LA 4I1OA 4WZBB 1RWVA 3BDAA 1ICEA 3BXEA 4RF5A 1V7QA 3AG6A 4IQGA 3S2FA 1B6SA 3UFXA 2R6CA 4M76B 2W6NA 4ZVVA 1COZA 4YV2A 5J2TB 3E3NA 3S8EA 3TPFA 1EP9A 4EHHA 4UVIA 2GM3A 3D7SA 4OI1A 3G0BA 5F9FA 3KB6A 3DMHA 2IP4A 1SUSA 4OGWA 4AIRA 4M0CA 4YVFA 5LQRA 4HB3A 1KQNA 2TMYA 4Q9AA 1C7IA 5K0TA 3HXQA 1ZH0A 4NFLA 1JYFA 3OLVA 3OJLA 2C2YA 1UZAA 2HRQA 4EAQA 3M5CA 4ZGGA 2OL4A 3PXXA 3B6IA 4ZANA 1A9SA 2R65A 1M2VA 2JGNA 2OO5A 3DAPA 4D5EA 5HZHA 1EHIA 4Q00A 5DKFA 3SM3A 4B3FX 3HJTA 3EFOB 3K30A 1D4AA 1ZJZA 2NU8A 2I67A 3LXUX 1NBIA 3SN6A 2Q2QA 4DXDA 4EA8A 1H6AA 3EIHA 4Q4AB 3X2EA 3T95A 1YE5A 4JASB 5D00A 5F1OA 3BIWA 4H7DA 3V7WA 4LG1A 5TRTA 4RD3A 2JHPA 1BEEA 2B7LA 3KOXA 5DM0A 1E9BA 3RT9A 1U7WA 3DKIA 1Q7TA 4TMTA 2L2QA 1PFVA 2IPOA 3ZG6A 4LC1A 5DGDA 2DZDA 3QEOA 4TYYA 4EDFA 4AKIA 1UKZA 3KAQA 3QKIA 4YQZA 4BIIA 4HGOA 2IYYA 1L9XA 1LSJA 3EMKA 3BD6A 5FBHA 3VYWA 5CA0F 4W8OA 5AW9A 1UP4A 3UJNA 4Y2GA 1V47A 1L7EA 3JALB 2LW7A 4JBWA 5L3SA 4TSFA 4ZTUB 3CG4A 2HWWA 4JUAA 2JGRA 1QVRA 1SKAA 3HPRA 1ML3A 1Z7BA 5M04A 5AVOA 4RD0A 5HBGA 1I13A 1ZD9A 2R4QA 4RWEA 2QUZA 5F2EA 3BC1A 4QDKA 2GCGA 3WQSB 4BO9A 4RABA 1E1DA 4BNZA 1V0JA 3IUYA 4LHYA 1NY5A 5K0SA 3L04A 1WEHA 4YC7A 2VQSA 3M1LA 1E0SA 2VZ0A 1LDEA 1G3RA 1VFNA 4PZLA 4EB0A 2XTZA 5CG2A 3HVRA 5F98A 1F7UA 2EBHX 1X1TA 2EOAA 2VSYA 4LKOA 2VK8A 1I33A 4XUCA 5DHRA 2P5SA 4Z0HO 5FV7A 4BL5A 2VLBA 3KKEA 3VFDA 1UZMA 3WYDA 1R0CA 4OHFA 3WMEA 1KWGA 2OZLA 5U1PA 1T4CB 1XCPA 2W6CX 1XDUA 3RAFC 1ZD1A 4WJLA 3U7HB 1A69A 1KF0A 5AKHA 2IS4A 5DLEA 1PBTA 1X70A 2JLCA 2ZRBA 3LC2O 3MOGA 1L3IA 1T3HA 3DZ8A 4KE8A 3MD9A 3QPDA 1C9YA 1JA0A 1SCIA 2PQ6A 1W19A 3KWLA 3OX4A 5IBPA 4RPIA 1FX0A 3A36A 3HP1A 2FLWA 3LV8A 3QX3A 5ILOA 4AXBA 2HPVA 6REQB 1J42A 5IVHA 3FPHA 3BRWD 2JAXA 2JFOA 2QTGA 2W22A 4FFMA 1AHNA 4K9OA 3R7WA 4ND3A 4YT2A 5FX2A 3GLIA 4P4TA 5IS2A 3BK1A 5DK4A 1JDUA 1SUIA 3SYRA 1QO0A 3AVQA 2CT8A 5ELLA 1RAHA 4L0CA 2VDUE 1C4KA 1QU3A 3QUCA 5K09A 3L7NA 1XKQA 2JGJA 3WO0A 5IHXA 5MN5A 3CF2A 3SNHA 2WJIA 3O8OB 4N8EA 1A88A 3UMGA 3IVAA 3VDMA 3ICEA 1P77A 4X8HA 2DJIA 5CFZA 1EBBA 3U0BA 5I45A 3G1TA 3LKVA 2NYAA 3W6NA 4BNKA 1JHPA 1U5BA 4L5BA 1KBQA 1NLYA 2WDPA 1IWBB 4XIYA 3BSYA 3OLCX 1DRVA 3QVSA 4FS3A 4BCCA 2VJQA 2HKIA 2WKRA 1JEQB 4YQEA 1EI9A 4JL6A 4DIUA 1YS4A 1WMDA 4GZLA 2CXXA 3U4CA 4K6GA 5FDFA 1BN6A 2DXIA 3IMFA 4BX2A 2O59A 4NULA 4OL9A 1ZW1A 3M3PA 2RGRA 2UXDB 4WCFC 4EY5A 2P9YA 2JFPA 2NADA 1D2CA 1TZBA 3GJYA 3PFNA 1EFUA 5G4KA 1V4BA 1UKEA 4A0FA 1YACA 5ITVA 2PA0A 3HCBA 4XPZA 1OZGA 4X62B 4WKNA 2Q9UA 3INYA 2OYRA 1D5WA 1S3IA 4KI0A 2GMWA 4G0PA 3JVDA 5JNLA 5MHTA 1X19A 5ITWA 2EJBA 4QDOA 1XZGA 2BEJA 3KUKA 4QFCA 2ZIXB 1CFJA 1VKNA 3E0QA 4H7FA 3C7AA 5FYQA 5IRCD 2WZDA 4FGUA 1FDUA 2NO6A 3F49S 3AUFA 1A0OA 3IIEA 3AV3A 3MW8A 5A9SA 5JIBA 4MGEA 1Z3IX 1I3OA 1BA3A 2G36A 2RIRA 1AZLA 3HVJA 3K0CC 4XGNA 4Z9FA 3O91A 4CR7A 4R71A 1W1WA 2PKXA 1O0BA 5DM60 4D96A 1RJ9A 1B3RA 2SICE 5EUBA 3VTFA 3W8EA 4DCCA 5EJ2A 3ZIAD 4DPKA 3LQ1A 1IXYA 4KAJA 1FJGB 5DZSA 5G2OA 1CRQA 4ZC1A 4OI4A 2OV1A 5CT6A 2JKYA 1QKIA 2VI5A 5T8KA 5ESRA 4NBSA 2Q2OA 2WBLC 1XRSB 2D0DA 4PNHA 4RORA 3WV5A 4IGFA 4J3FA 3TD9A 4CMCA 4WECA 1WUYA 4ZZ3A 3UG6A 2YHUA 2V9CA 3O95A 1EUYA 4TT8A 3MUOA 1J22A 5J2UF 3UANA 2QX9A 3IMCA 1XGKA 1JDBB 2B1RA 2CDRA 3FRIA 2UZ3A 1QIDA 1C7QA 4RULA 1LBQA 3K5PA 3EVZA 1T1RA 3IUEA 4YTEA 2BFOA 3V4FA 2Q8QA 4IVPA 1RRKA 3QTLA 3HI6A 3SC2B 4LHXA 3OAAD 4GX2A 2PNJA 2WWGA 4AJEA 4MI9A 2QRPA 2IH2A 1EXDA 1A2QA 2C4KA 3GBPA 2VAXA 4EHJA 4Z3KA 5KBYA 2FPXA 1S0UA 2O1XA 2XOEA 3T0FA 4CW7A 3K0FA 3MS2A 4L8FA 4G2NA 2BHTA 3NTLA 4FFWA 3RU3A 4TZKA 2GN6A 2VDWA 1QGZA 4NWIA 2C2XA 1ZNQO 3JQFC 1R8SA 3T5DA 1UC8A 1Q1GA 2ORVA 2EG9A 3H8WA 3H2BA 1FE8A 1Z36A 3EH2A 1PNVA 3SNKA 1ZX1A 2FW8A 3I04M 4LMBA 5BSRA 3UNXA 2VP4A 3TOCA 4V0SA 4FR2A 2Z9DA 1HQYE 3G5AA 3QBJA 3KOUA 3F9IA 1R27A 2G25A 2VKQA 2XCOA 3PR2B 1GNPA 4HC4A 4WUVA 3RAGA 3MMZA 2PRZA 1PYGA 4RMJA 1RE1A 2QTZA 3ANTA 3PXUA 2Z2IA 4LMAA 3TW0A 3HKCB 4V3CA 4E4TA 3QEMA 4KWEA 3SIRA 3I1YA 2V55B 3TX6A 1B0UA 5I9LA 2DWOA 1ZGGA 3RJZA 1JV2B 2G8NA 1SVSA 3G8CA 5DVZA 2ZUBA 4OJQA 4DAOA 1E4VA 2VTKA 3PE3A 4MPJA 3HP7A 3PUJA 4BFCA 3MRTA 1W2GA 1DO8A 1Q95A 2AB0A 4RXTA 5ALNA 2O8EA 4O4JF 1RJFA 4H7IA 3CRMA 2J3KA 4YUXA 1J49A 2DPXA 2EKLA 3U4GA 2JDIA 2Q46A 1O7JA 3QVJA 1OXVA 4EKNB 4DA6A 4TV8A 4PAQA 2G9ZA 1Y9AA 2V7TA 3KAKA 1GARA 1V1JA 4YAEA 4ZVNA 4YUWA 3HB4X 4JJEA 4QATA 3JQBA 4GFDA 2QSZA 2BFCA 2QJFA 1VE1A 1X1AA 1X80A 3OOSA 4AVYA 2ZCJA 1XTPA 4X20A 5EG5A 5HIMA 3GF4A 2C8KA 4LRUA 1EKXA 3H42B 3HY3A 2W70A 4YJFA 3LCCA 1JR3E 2PWZA 1W1IA 2XSZD 3J81A 4PZCA 4XWKA 1XMJA 1BS1A 1XZKA 2C4WA 1FDRA 3ABSB 3AHIA 4P1ZA 4K9LA 3U9SA 1ZCAA 1CCWA 4WN9A 3DCJA 1I2BA 3DE5X 4HLUC 4FNOA 4KYUA 5CP8A 2ZETA 1HORA 2AJTA 2FSGA 3RW9A 2WT9A 1F2UB 1A7JA 4IRMA 4OL0A 3T4XA 2A4MA 2BKXA 4CG1A 3CZ5A 2Q3JA 1BQ4A 2JJQA 2XA1A 2D2VA 1W36D 5JWRA 1VFPA 5CXXA 2PT7A 4ETMA 1W8IA 5JO0A 3ROZA 1ORIA 5EMKA 3PSAA 4L2IB 4LDAA 4QYSA 5I7AA 3R24A 1L7NA 2KX7A 3GRYA 2Q3CA 1U0NA 2GN4A 3DUWA 1KDYA 4F2WA 3SP1A 4KJZA 2FE1A 1F2VA 2X5NA 5HKOA 5EJ8A 5KNDH 1TIBA 1XTUA 2Q3LA 1TO2E 1ZD4A 4HS4A 1JNXX 2A5LA 4JX9A 3A1CA 1X7YB 4N03A 5DV9A 3RARA 1LW7A 1JAIA 3EUFA 2CXPA 1TJNA 3LWZA 4ZT5A 1IPEA 5FNVB 1I5RA 2BKEA 3SZRA 2HWXA 5K7SA 2HW8A 1OHHD 4OYLA 1V37A 4FJ2A 2GFQA 3V4OA 2BM0A 2C77A 1HETA 2B1JA 3L4BC 2EX1A 2RC6A 3TEFA 3OCJA 3KYCB 5TJHA 4P0PB 3MNFA 1DCMA 4EA7A 3P8ZA 5GAJA 4L02A 4DB4A 2Y8EA 1GRNA 2HNBA 4D0RA 3G9TA 1DOHA 3LX5A 2HADA 2YR0A 3QITA 2WWHA 2QMUA 3LUKA 3AVXA 3K32A 2JFBA 3HJAA 2VQ3A 3AOEA 4UTPA 4DNFA 5CEEA 2FMXA 2QX6A 2FPWA 4K3VA 4EY3A 3U4DA 1K98A 2C57A 1SRRA 1VE7A 3UMVA 1G9XA 4I50B 1UWLA 5CDFE 2OHGA 3BJMA 5JTUA 1E7WA 1IBKB 2OAEA 2ZB2A 4XWYA 2UXCB 1GGNA 2QUHA 3BM5A 1XWWA 3TSZA 5ITSA 4LRXA 4NXMB 2OZPA 1HT0A 1L4UA 1ZVMA 4YRPA 1YMQA 2C3UA 1N9GA 3M2PA 3BE6A 3OZAA 3PIRA 3WMWA 4DQKA 2BEWB 4W5QA 2YKGA 3I1FA 2CCJA 4PSVA 1IHDA 3W5BA 3ZHVA 2OPHA 2HCRA 3U7JA 1U1IA 1VLLA 2XYVA 5B3KA 3UHJA 3H65A 1Z4PX 5AQEA 1K2VN 1KEWA 2F8SA 2YHAA 1KAOA 1RAIA 2QPOA 3TRDA 1AUPA 1E0DA 2V96A 3OZFA 4KJXA 2QRHA 5AT1A 4NPAA 3G49A 5FQNA 1DKNA 2JI4A 2B82A 3DZFA 2LKCA 3OY2A 4G8DA 1XG5A 4HXFB 5BWNA 1WZIA 1WXXA 1ZRSA 1E64A 5JDCA 3TW6A 4BAZA 2FFRA 3UYLA 2BP7B 5AIAA 5AOAA 1EFAA 3C3DA 2PLRA 1KVTA 4BNWA 5IW8A 1KK2A 1UFQA 4M55A 3HB9A 4ZKDA 3UHFA 4HFJA 2F8LA 3RC7A 2BRUA 4LVUA 2C7GA 4MQUA 5IK2D 1BDIA 1NMEA 4JYCA 4RL4A 4J7UA 5J3JA 4N5NA 2N3ZA 2A9FA 3BSFA 3O38A 2CXHA 1HL7A 2I71A 3MT9A 1E2IA 3AF6A 4M60A 1UJ2A 3H04A 4X1KB 2JFZA 4OGGA 5E2IA 1MV5A 1QVWA 2J3IA 1G19A 2C5BA 2OM2A 1VPLA 3UKJA 4BKMA 5HJ7A 1AGPA 3IOBA 4KIGA 4EKYA 1U2DA 5TVGA 2IU4A 3KE8A 4MW9A 3E9QA 3WSWA 5KX5B 1UBFA 2QRVB 2VAVA 1LI4A 2JVIA 1NDQA 1XJ5A 3GLVA 2JCGA 3CKKA 4HEJA 1JG4A 3K9HA 1EUZA 4F3NA 4J3NA 5JQGF 3WNQA 3AUYA 4K7JA 5B1IA 5ESWA 3PJDA 2I4MA 1NU6A 2C2GA 3I37X 5TEWA 1SURA 4F04A 1XLVA 1WNFA 5DP1A 3W05A 1QH1A 1W5BA 4KMRA 2R6R1 3OU2A 4IJ6A 4E32A 2CNBA 4YO7A 4MS4A 1RXWA 2XGJA 2DTXA 5FUXA 1T9GR 2WU1A 2NSJA 4PCVA 5LDHA 3K8OE 2C3OA 3GGOA 2A1UB 4F4HA 4NF2A 3L5KA 3N2LA 3KYJB 1SZDA 1HDIA 5DCYA 1W7AA 5AI4A 1PIWA 4AO7A 1FFWA 1VBMA 4BLVA 3RSLA 1QV9A 1T8YA 4P2BA 1O58A 1XEXA 4REQA 4RKQA 1JE0A 3NATA 1OZHA 5LA6F 1J5EB 5A03A 3IQXA 5CRIA 1KEUA 4Z7NB 4RE6A 5F3DA 2HJ9A 3RF7A 5B7PA 1JHZA 5A7GA 4ZK6A 2J59A 1KTIA 4DV1B 1K4KA 3SSOA 2WZBA 3ETGA 2AMJA 2I2DA 3PUXA 2GRAA 4GG1A 1PVOA 5K8IA 2QYTA 1NBHA 5DGIA 5HDBB 4QM7A 5L3RA 1HG0A 2G67A 4MGHA 3E9RA 1OFGA 1IN1A 2NV6A 1O5TA 2R1TB 1NYLA 2ZVPX 2X1HA 3C85A 2EFJA 4EJ2A 1YULA 2VJKA 1MKYA 4XFJA 2GD0A 1A97A 3FTPA 4W82A 3OCCA 5LBUA 3T4EA 3UJBA 5ALVA 4UHFA 2HU5A 5E9AA 4ZRDA 3TCXB 3EGDA 3EAQA 5DTEA 4C01A 3QKTA 4IXWA 4XRRA 4F6CA 1XTZA 4YMTA 3RSZA 4LXUA 4TLAA 3TKAA 2QSYA 5CGZA 2OCXA 1IY8A 4FEGA 2MWMA 2O05A 4U7PB 1OTYA 4XIFA 5HOEA 1M2HA 2QL6A 1R2QA 3VUEA 2B20A 5TXGA 4LDNA 2ID4A 5ALSA 1NXOA 1U0HC 4BMXA 2QHXA 4IUCS 5HKKA 1EESA 2GRUA 3ABIA 3WGHA 2WOOA 2PSDA 3RLIA 1PFKA 4KLAA 5DTIA 3OPVA 4FXOA 3SZMA 4GOMD 4IEEA 2FEMA 4KLCA 5AD1A 4NEGA 5KWSA 1RRCA 2QTCA 2R96A 1U4NA 2JH9A 2NTYC 1G6Q1 1A2OA 4F2PA 5K6RA 4ZCRA 3NETA 4ZYUA 5JCJD 2HYDA 2FWIA 3LQKA 3ZV3A 3Q4GA 2XQVA 1USVA 4OQDA 4KX3A 3KKLA 3LPMA 3BFXA 4QSMA 4INJA 4R6WA 5EERA 4V39A 5FJJA 3ZE7A 1ZYUA 3FKQA 3N8GA 4ZO7A 4UUOA 4HDMA 4R1TA 3STVA 3FTQA 3FUCA 5CLFA 2VBIA 2JIPA 2VNAA 1Q16A 1D09A 3HXMA 1NBMD 4YUVA 3M6UA 5CLJA 5HRCA 3CR3C 4KTTE 2RGNA 3T9BA 3TNDA 4QZVA 5L8VA 3FROA 4IX9A 5B6PA 1YL7A 3H97A 3KR2A 1NGSA 2CL6X 2AN3A 3D54D 4Q93A 2QP4A 4TUYA 2P3SA 4LBYA 5DHTA 3UA3A 1KVSA 2CLIB 4YV0A 3CG0A 3ZHXA 5HGJA 3CUYA 2R44A 4E30A 4CUZA 4MV3A 4CMJA 1HXHA 2P7IA 2R1ZA 1GUYA 2YQ5A 2CB9A 2NU6A 1N3LA 3A28A 3N9IA 4CDNA 1EXVA 4TXLA 3VMMA 4C4PA 1ESDA 4GI5A 2IHZA 1Y5LA 3GL9A 2YVUA 1MFZA 1Y9EA 4KN8A 3A9UA 3RS9A 4EENA 1U5CA 4FBGA 2JA1A 2F8MA 5FWYB 3DDOA 1JKMA 3ZS8A 2VTBA 2XE6A 1K3TA 4F5ZA 3KJNA 3FCCA 3MCZA 1DOAA 4J6EA 2XYHA 1G8PA 3BHNA 2VDOB 4LDJA 4OMFG 4TMKA 4TRNA 1G20A 4UBMA 1A8HA 4DG9A 5C9ZA 2R60A 1E2DA 5L3ZA 4ND1A 1NQAO 3OCWA 2P2GA 1XZLA 4D74A 1AUQA 5HXAA 1X8LA 3PQEA 1X3LA 1T4BA 4X95A 1DC4A 5KAMA 3VH2A 2VO1A 4MUXA 2J8ZA 3ZXYA 2G77B 3CVYA 5HQ3B 4IKOA 2YXEA 2XTAA 1FNBA 2DY0A 2IYNA 3R4CA 1I6KA 2EYQA 3PNMA 1RXCA 1HT2E 5ES3A 2KSQA 1X86B 2H7VA 3L6OO 3L7CA 2ZYRA 2PSJA 4ZJZA 2DLCX 1JL3A 2AFHA 5FTKA 1ORDA 1NOKA 1H2BA 2EATA 1T6NA 4ZZ2A 1SB9A 1U0OC 1N5DA 2G6BA 1AH2A 4LISA 2BR3A 1MO5A 2Z09A 3IHWA 4GMFA 3MUFA 1USWA 2HDWA 3BVPA 3IR7A 4JYAB 4RJIA 4KAFA 2X8JB 1R5OA 1XJQA 4WCFA 3TNLA 4MRMB 4QRIA 2H2AA 4D3ZA 4B3SB 4ZQHA 4ZAYA 3ONWA 5H4GA 2PS9A 2B4TO 5HF5A 1Z0JA 5B2FA 5E0KB 3HADA 5D3MB 3IXLA 2G40A 4N3GA 1X7XA 5E0OA 1S6YA 4MYRA 1T5LA 2B1QA 3DEHA 3HEAA 4Q47A 4ZP1A 1A82A 1EGHA 1X77A 4JROA 1U0TA 1YSCA 2WJZB 2I3DA 1QGUB 2A4KA 4ZOLA 4P92A 1GFWA 3KVYA 3NHYA 1W0JD 1KVUA 4UM9B 2ZXFA 1II8B 1A9ZA 4Q0MA 1G4HA 4W7HA 2VHJA 3M3HA 4M7OA 4IW3B 4MLZA 4N65A 4OXRA 4RF4A 4EUEA 5MFZA 2PWAA 5HZGA 3X2FA 3DMRA 3OZTA 5E1DA 2IIQA 3LS2A 4XM0A 1GLNA 3PUZA 2QG9A 3W6OA 1HT3A 4GVXA 2J07A 4CE6A 1OD6A 3GXBA 1CS4C 4V0MA 5JCOA 3TDNA 1XCMA 2BE7A 2ZSDA 2DFVA 3IDZA 3AINA 4C0WA 1K7XB 3N2GA 3WHPA 3TGWA 4LYEA 5H3CA 2GUWA 2YVKA 2VG8A 4I3FA 2FK8A 5K99A 3L6DA 3OPYA 1D9ZA 3IURA 1C0LA 2WU8A 1ZNYA 4YEDA 5CVVA 5BRNA 1QPZA 3U7EB 4G89A 5B1YA 1C80A 2ODTX 2VP3A 4XM1A 5KSYA 4R1SA 3R40A 2HSGA 2HPZA 2XZOA 3E22A 3GLGE 1IMJA 4E5VA 1EWRA 2VRNA 4AJOA 1UADA 3E03A 2FV8A 5FB3A 4KPYA 1PEYA 2TMKA 1E3TA 2JATA 2W42A 3OZBA 2RGXA 1GWNA 1RTKA 2XI4A 3JARB 1F0PA 4BLUA 1X39A 1NE7A 4RM2A 4FE3A 5BUSA 3FYUB 3QLEA 1CLEA 4EATA 1OXTA 2HWYA 5DSZA 2CMHA 2ENWA 2H4YA 3EFHA 3O03A 5IUKC 1LDBA 3DBLB 2V6IA 3W79A 4DPLA 3R1IA 3LY9A 2R6ZA 4U8HA 1Q11A 3ED5A 3LG2A 5JY1A 2GM4A 2QBYA 2PH1A 1RZUA 2ZGVA 5JNSA 3G79A 4AMZA 1P4RA 3OIVA 3WYGA 5KTOA 4HGRA 3NBFA 3MERA 3ZNOA 2DHDA 2FSHA 2HREA 3GP5A 3VR3D 2Z1MA 4XUDA 1MHPA 4L4XA 3PKJA 3KOZA 2V03A 3D6MA 3I64A 3LRPA 1MJFA 4YRZA 5KHOC 1ZL2A 4OD0A 2O8BB 2VDVE 4ZO9A 4CLRB 5B6JA 2Q5IA 3EZ7A 1P5ZB 4MKFA 5LQUA 5CB4B 1L5SA 3UUEA 3AHJA 1MW9X 2GCOA 4AUKA 1KVQA 1SQ5A 2GCEA 1F2TA 5IZCC 5ALEA 5E6UA 5EEHA 2XIJA 3WS7A 3RUEA 3RRBA 3IUQA 4WXMA 2XW6A 4HN9A 4QQNA 5DB4A 4CM8A 5EJ9A 5KYWB 3U5ZB 4D6XA 2JLXA 2FJ0A 1GAXA 2H54A 3WKBA 2BISA 3B1ZA 4IICA 3WC4A 1K7FB 2FW6A 1QMPA 1HGXA 5L7WA 2QAIA 4OF4A 3FOAA 2WQ7A 1RC8A 1PTJC 1ZNXA 4FCTA 2BSQA 4AN1A 1GITA 4J4TA 4A0RA 1AHPA 5D01A 3C7TA 3FAZA 4HLQB 4JQCA 2CL0X 4MQEB 4MVXA 3LKDA 3I1IA 2FCAA 2Y0DA 2P9GA 1L5HA 2Y93A 3ZE1B 3RH0A 4DRXB 1TO1E 3EVCA 2OBMA 3ISVA 3LM8A 3L18A 2GZAA 3H2ZA 4LE1A 3ELBA 3VKHA 4U7DA 3UJDA 2GD2A 3HKBB 2VR1A 1DCTA 1N5OX 4NVRA 2G80A 2I55A 1SBZA 2P90A 1JIUA 2HSZA 2O2HA 2FYTA 2PIDA 1RYEA 3BZBA 3TJZA 4CG2A 2FDXA 1Q6ZA 2GLTA 3GXOA 4DYVA 4D9CA 3KR0A 4ZOBA 4DZTA 4URYR 3WE7A 3QE9Y 1KZYC 1MEJA 1M75A 5FTJA 1FLVA 2OY0A 5FAKA 2F3QA 1JT2A 2PUWA 5LP6B 4UHEA 2W6PA 3EW7A 2VRCA 3BFVA 1Y89A 4BNFA 1Y7PA 2V6BA 5AVSA 1VTKA 3RIXA 2H5EA 1ANKA 2F3RA 1N2ZA 4C5AA 4ENQA 1VL1A 1TW3A 1XZNA 3SJUA 3GGDA 1EX7A 3PEYA 4IF6A 1DO2A 2JFFA 3NBZC 4CM5A 1E2BA 3VO2A 1CQXA 3NTQA 4V0KA 1Y4ZA 2YY5A 1GV1A 2I4IA 2JRLA 2PDAA 1UMCB 4D0NA 4TYNA 3CKMA 4IDFA 1CR1A 4UBOA 4S0XA 5ECYA 3I1JA 4PGGA 1U8CB 5IVDA 3UZUA 2IS2A 1UZLA 4LPKA 1XWFA 2F1HA 1WU7A 2Q1SA 4B3HA 3BSSA 3NCTA 4TTJA 3MGAA 2I7DA 1PD0A 3FLEA 4ZCPA 3U44A 4HBZA 1GRVA 1NP6A 1JXAA 3K0HA 4JUBA 5KIAA 3ZD9A 2XVMA 4QUJA 3DLTA 1GTVA 5JISA 3WYAA 3RG2A 4CLEA 5LYJA 1OI7A 3CONA 2WIJA 4FSHA 3E70C 1IHOA 2WAOA 2C04A 3EXFB 4N6OA 3WFJA 3BSWA 3IVMA 3MJVA 3CHYA 2IYPA 4HH0A 4GKKB 5GY7A 3VJMA 1T8PA 2CLFB 2C8VA 1ZD8A 3Q15C 4O25A 3VNVA 3DFUA 2QTMA 1BX0A 4QDTA 1KEEA 3QJ5A 4HAIA 4U63A 3U3XA 4OQEA 2B1IA 1M66A 1RU3A 2HCBA 5KAPA 3TO5A 2QTWB 2W8ZA 3OZUA 3RFVA 4URVR 4DLVA 2HLDA 3ZZUA 5ALMA 3IQHX 4UBLA 5FI1B 1CRWG 1JHMA 3NORA 4RZHA 1DXHA 1Q1EA 2A33A 1KI3A 3CNLA 1NULA 3GEPA 3K8ZA 1XXHB 1IZZA 3PNVA 1KFBB 1OLSA 2GAFA 1P81A 1PUJA 3I6YA 4AJ1A 1UMKA 4MWOA 3KB2A 5T7BA 1ZIXA 1LVUA 2V4MA 4W9NA 4C0QC 4WVLA 2VF4X 2ENUA 2IEDA 2WR8A 2ZBFA 3KQVA 3QI2A 3QG1A 4KXUA 3U3JA 4EHFA 5I7SA 2AXEA 4OM8A 4AX4A 4D9JA 4NATA 2HA5A 1HM5A 4GWGA 4TV9B 4AYWA 4DMUB 2V7WA 4CCWA 4RPKA 1NVWQ 3LW8A 5CG1A 3DR3A 3ZWBA 1SUFA 1EUCA 3FZNA 1E1YA 1KDPA 3B51X 3VJKA 1CUFA 3VKVA 3AL3A 2QM7A 3UKDA 1V16B 3KX2A 5SYAA 2ZKIA 2HJVA 2F3TA 1H69A 3I2GA 1UMBB 4C1BA 3V7FA 1GG2A 1V7PC 4YCMA 3QIVA 3F71A 3TSWA 4YIKA 3RWOA 1WCXA 2QX8A 2I4LA 4O1HA 1K5GA 4B3JA 4RW0A 5AHOA 3SJZA 3WFIA 1ZAYA 3BULA 2H7CA 4P6VF 2A7QA 2OYSA 2V7EA 3ILXA 2O8FA 4LSMA 3O93A 1Q12A 1DQYA 3HUDA 2G4VA 2O1SA 4G5FA 3SICE 1ZQ1A 1N5MA 1F20A 4ZI7B 5KO2A 1C1DB 3DVLA 4L50A 3TZLA 4RO0A 2Q29A 4GBJA 1ZFNA 2YV4A 3FDFA 4CM6A 1I94B 2CJWA 3LHKA 3WYNA 4QQRA 5DLYA 4FEAA 1LNQA 4OP3A 2IYEA 2GN1A 1OFUX 3JD1A 4WOBA 3B6ZA 4JYPA 3B9QA 1HUQA 1RS0A 2IUEA 3B53X 3F5FA 4BVBA 4DV6B 1NJFA 1E9EA 1FEZA 4DV2B 3WG9A 2C54A 3IDQA 4Y7CA 3SR0A 2ERCA 4HB2A 2RE8A 3GNQA 3UV3A 2V6JA 4RJTA 4FI3C 4IDGA 3OZSA 4C7JA 2HM7A 4J0HA 3I32A 4XM2A 1V35A 2XB2A 2N1BA 3L49A 3PQ2A 3IR6A 4OMDA 4MWZA 4RVHA 3HKEA 2PGAA 2P6RA 2NTNA 3DZIA 3S8MA 3TG8A 1YHYA 4YJ2F 4TMXA 4RPLA 5E95A 3WL6A 3TE6A 2DKNA 2DUMA 1ETUA 5LZ8A 2BFDB 2PGLA 2ZRNA 3PT9A 1KDVA 3GFRA 1U0JA 4UOEA 5A5VA 1ZM7A 4EO4A 5HHTA 4BX3A 3VAZA 1ZOIA 2YYAA 5PGMA 3SZOA 1OTXA 2BMDA 4M9XA 3RREA 2C7PA 3N2YA 4U4AA 1BA2A 1E7MA 4D9IA 1LZLA 1GLGA 4D9EA 1C4XA 3KTAB 4PS1A 3STXA 1SC1A 2ZAYA 3H9GA 2YWRA 3QSGA 2YC4C 1PR1A 4XCXA 5FV4A 2IZ5A 3L1VA 5HBRA 4FX5A 1KJWA 1DHTA 1WS6A 4UDYX 4DLBA 5CBPA 3SVLA 3O7WA 4ETIA 5LPNA 2OHIA 1IUNA 2MDTA 1XTBA 4O2BA 5J4KA 1XP5A 2AWNA 4UHBA 1NHWA 1D2RA 2TRSB 2WJ3A 3C5WP 5BN4A 2WILA 5AICA 3TMYA 1GQRA 3EISA 4CXMA 2AMFA 2QN1A 2XUAA 1BE8A 4NQZA 1MB9A 1YZGA 2REOA 1BTOA 4LC0A 1GUZA 1NYTA 4CKCB 1WB4A 2M32A 3MWGA 4ZMSA 1UWVA 3BL8A 5EIHA 4G0VA 1AUOA 1EDBA 2ZG6A 2FW7A 4FONA 1XTKA 2PAFA 5EMLA 3RYFB 2QQGA 2XHZA 2IPAB 4LPSA 1ISJA 4HAYA 1GPH1 4UCWA 3V4LA 4OKSA 1K3UB 5KHAA 3WWCA 4AUNA 3VGPA 2ATEA 4PLWA 3EWAA 3V4RA 2JBAB 1H2AS 2PZEA 1I3LA 2AFIA 5JJBA 3U80A 4LF7B 4M0PA 4RZ2A 1CUGA 4N5IX 3K2QA 1S4MA 4PZUA 4BRWA 1J0BA 5DYNA 1CQWA 1XTVA 2QYHA 3C3MA 3E58A 2X2PA 2Y1LA 1OLXA 1W4BA 2HF8A 3IHKA 4UKDA 1EUQA 1VZ2A 4DA8A 1ONSA 1R8JA 1T26A 1USIA 2XGGA 2YCBA 2FDCA 2A9RA 2BCGY 2V54A 4WBSA 2ZRAA 3VKWA 1TA9A 5BRAA 1ADCA 1E98A 2GSWA 3A05A 4BFLA 3MBOA 4EKEA 2OV4A 1QIFA 2Z1NA 4ZQCB 2A0WA 1L4HA 4YQYA 1M74A 3U7QB 3IQWA 1VG0B 1DJPA 3TI7A 4ZAFA 5CH5A 1E1RA 5H16A 4UU8A 5D51S 1U2PA 4HDCA 1WF6A 3G2HA 1CY1A 4LJ8A 5JZSA 1FIUA 3O4FA 1PNRA 1V7CA 2PWBA 3FGOA 1U3WA 1CK4A 5FPTA 4FYPA 2WNHA 2PKEA 5EWJA 2PGJA 2QPTA 3IP7A 2A6PA 1TJ5A 1WCWA 4L72A 1ZUNA 1J5XA 2R1UA 2RH8A 1K8QA 2WOJA 2RK4A 2OAGA 3MWFA 4Q66C 3VH1A 1GOTA 3NDRA 3DKVA 2AS0A 4KO1S 4POOA 1L4YA 5JCXA 4XQGA 1NPDA 3M5DA 2ZUDA 3H05A 2IW1A 1D4ZA 2Z1DA 2CSXA 1CEXA 4GYYA 4OX9Y 1RFGE 2VHYA 2YWFA 2UUBB 4B2LA 1S2NA 5LVAA 2G7MC 2Y6VA 4MV0A 4IDOA 3OZRA 3EC2A 4FPXA 3JYQA 2ICAA 5C32A 5BYBA 1U9IC 3D6UA 4AF6A 4CF7A 2EQ5A 2OGTA 3EA0A 5EQTA 1EDZA 4AJ9A 1NA5A 1D6MA 2OV8A 2XA9A 4FK8A 4HZUA 2ZTHA 4M8SA 2BFBB 4HTFA 2H18A 4EO7A 2P1ZA 1NVUQ 1G2OA 2UYHA 3OO1A 1R3DA 5E8RA 3AF3A 2UUPA 2JJMA 2I8AA 3VYUB 4F06A 2XXAB 4F5WA 1CUAA 3R9XB 2IOQA 4X6UA 5GGYA 3NZEA 3IAM6 3T9AA 1R66A 3PWSA 2GAAA 5SY9A 2FRDA 3E23A 4U1RA 4RETA 3KQTA 3VYVA 4CG3A 4RDHA 4MPRA 5E2AA 3OCVA 1ADGA 1T3TA 2BI8A 3OD5A 4BTVA 3FFWA 1OZFA 2UVDA 1CZRA 2CLCX 2PUHA 2Z83A 2P3QA 3LLSA 1T9CA 3QM1A 4JHLA 5A4KA 2ERXA 3G82C 4ZHSA 1BQEA 3JRXA 5A5GA 4GWLA 2DUWA 2C7OA 4YP0A 3WK6A 5KKAA 4MVWA 4RTMA 4KGZA 4C6HA 2Q2WA 2R7AA 1NN5A 4JC8A 3O8QB 4EG5A 4LDQA 4M9CA 2I4NA 2YMQA 3NTOA 2DH5A 4JENA 5FLYA 5K01A 5JLAA 1KZ4A 4MUYA 4Z86A 3UENA 4GO1A 3BMNA 3CTPA 3MLBA 1SXJE 3C8HA 1U2EA 4PLYA 4QDXA 4UNNA 3H4TA 3CEMA 1Y9ZA 4IILA 1NFQA 2E6KA 2FPKA 3AERA 3H1TA 2ZJZA 4YP1A 3I9FA 1JKFA 1BGWA 1J4AA 3UMRA 1JR4A 1ZL0A 1KKMA 2P8JA 1J2UA 3L7BA 4AAYA 4EB6B 3EULA 4NCNA 4N49A 1GDDA 4NZZA 1G4AE 2PGXA 1BWSA 3A1EA 3CZMA 1K63A 2C84A 1KAEA 2FMKA 3OECA 4WMLA 4YFYA 4Z7QB 1G42A 2MSCB 2R7LA 3G7UA 1Z5GA 1BFKA 2RJ3A 3BD8A 3HB0A 1E8NA 4NICA 5SY4A 3VM6A 1ZIYA 4KE9A 1X1DA 3RUCA 1XHFA 1DQSA 4K1XA 4D8VA 1Z5WA 4JSTA 4PG8A 3IDOA 4RC9A 2D1QA 4IEIA 2C3PA 1BMDA 2ERYA 2C42A 5D6OA 2I78A 5IN5A 3H1EA 3SIXA 3JVEA 3OTGA 1WMBA 3P2MA 2C82A 3ZY6A 4QVIA 3KT6A 5IEJA 1WPQA 1RVV1 1CHDA 3JAWB 1NOJA 2CXNA 2JD0A 3UAZA 4WBNA 3G2LA 3Q8XB 3QXXA 2YWBA 4X71A 5BWCA 4J3JA 5IBCA 1M2OA 1G8YA 4XIGS 2JFXA 3O9VA 4BUCA 3V5NA 4DVGA 2PRJA 2C9CA 5BNTA 1W93A 2I8LA 3BN3A 4TM7A 1E2LA 4G1CA 4WLVA 3NALA 4JT4A 3AUKA 4PBRA 1OXUA 2CFRA 1J7JA 2GEUA 1N57A 1TTPB 3CX7A 4OMCA 3FYDA 3S1AB 4M99A 3BIOA 4YAOA 5FCDA 1FFXB 5HCIA 2V1XA 5B2EA 1DRKA 3VH4A 1N6NA 1OFTA 2BWJA 4A1FA 1JEOA 4QUIA 5KU7A 1I14A 1A71A 2X7HA 8AT1A 5E9JA 2Y1WA 1CRZA 1PT6A 3I23A 1FC0A 5KMGB 3W4KA 1FNMA 3FFAA 4LXHA 3W8DA 4MUMA 1XCJA 5JHHB 4EVSA 4BVEA 2BJHA 3K16A 4UD6A 3RCBA 4AZSA 2ZBUA 3FSEA 3DLPX 2HCFA 1M10A 3MT0A 5LCXA 1FA9A 4A2QA 1H2HA 2AG1A 4DILA 4NJMA 1O6CA 1RBMA 4QXPA 5IT4A 2ZIGA 3TBFA 1TM4E 2PYDA 4G86A 4S1VA 2EP5A 4CL3A 5IH7A 1Y7LA 3W5DA 4FYYA 1QFZA 4CG0A 1JFFA 3Q9NA 4BU1A 1V8PA 1TQ2A 3RYIA 3UT0A 1C8VB 1V3TA 4E46A 3KQUA 3JQRA 2OHHA 3HEBA 4OFXA 4US1R 4HDAA 3SQWA 3LWDA 3DSRA 1B4DA 1NJ5A 4Q15A 4LF4B 2ETXA 4C2TA 3KUDA 4Y2JA 3P9ZA 4NDZA 1M5RA 3L7YA 5IF9A 3OKPA 3NOVA 1OBHA 1KGSA 1LQUA 3IEPA 4MVJE 3JRNA 4QECA 2JD1A 5IJ9B 2H6EA 1K4YA 3L8ZA 1G6HA 1FNSA 3ETJA 3ZWCA 5FWDA 1DZ3A 4I5GA 5A5DA 2YW9A 3H1PA 1R4AA 4ICIA 4DUYB 1PTJA 4ES6A 5IKOA 1HDEA 5TQ2A 1OYWA 1V6SA 3K9WA 4IFEA 2Q3HA 1UPCA 5AI0A 2FSSA 5FULA 5AM0A 5LN1A 1RM0A 1REQA 4CFZA 1YOBA 1GPMA 4RZXA 4UPDA 2JCYA 1PS9A 4L73A 4F9TA 3Q0IA 5B3JC 4IWNA 3C48A 2Z5LA 1ID1A 4TLCA 3LUAA 2B8NA 5NULA 1QIKA 3PXDA 4HAOA 3S7TA 1J7KA 4JLDA 3T38A 3BT7A 3C1OA 5E1OA 4TV8F 1I2DA 1XQVA 2OCLA 3D3JA 1F5SA 2IPLA 3PNKA 3ZUPA 1ARZA 3ZN2A 2HNAA 7REQA 2O7NA 4YALA 4K5QA 4DSUA 2YC2C 1PK7A 3ZDYB 4HDQB 3RC2A 2VWQA 2OGZA 5ALIA 1F48A 4QJ5A 4A2WA 1ISHA 2D06A 4D3XA 5CVTA 5HPYB 5HUJA 3GBSA 2WTEA 2EGGA 1NR5A 1SD5A 4MICA 4TS1A 4LSGA 1E2MA 3OZ7A 3C1UA 3BUSA 4GMHA 4JBNA 1HDGO 1V9SA 1L1QA 5EHIA 4LSZA 3GPDG 3MOSA 3VOBA 1YNSA 1CETA 3DZBA 4LJKA 2OWDA 1CBUA 4IIEA 2SCUB 3QUSA 3RI3A 4KSBA 3IVXA 1H9AA 2MINB 2AQ8A 3F78A 4B6PA 2GO1A 1E7QA 1V8ZA 1XYGA 3NWOA 4J90A 3TTUA 3IUMA 3BIXA 1U1FA 3NOQA 4AJ4A 5L4LA 3DLHA 2FHPA 5IXYA 1ECCA 4FILA 4RK7A 4B7ZA 4DKXA 3BEDA 3RHFA 5ALLA 2NACA 1WE2A 2QE6A 3AF1A 2JD2A 4I4CA 4ND2A 4UDXX 5G0UA 4UBIA 5CA1B 3T54A 3IODA 4HK4A 3JQGB 3N7AA 3ZGVA 4ZU1X 3S44A 2FJUA 3Q2IA 4EPVA 2EEZA 2OKCA 2Q6KA 2WB2A 3G85A 1SELA 1U02A 2Q8PA 4IIGA 1FLNA 3VI3B 3PENA 4JJZA 5JAOA 5ALFA 2M1ZA 2Y2UA 4AG3A 2ADFA 4FLFA 4PHGA 4L28A 3LAWA 2ODNA 2NAFA 3Q6NA 5BMVB 3ADKA 5D2CA 3IS3A 3GLFB 1MQSA 1IZ7A 3I6MA 1YJ8A 1FBTA 1Y8QA 1Z82A 2I3BA 3OMWA 2ALJA 4OO3A 3RS7A 4A8JB 3OQPA 2DQSA 2LVBA 4R2LA 5TPWB 2Z6AA 4PEVA 1VJTA 4PTYA 4TMYA 2FR8A 3NGLA 3CVOA 1GL3A 1QYXA 5F1YA 1TEHA 2QRUA 3TW8B 3F6EX 3Q6IA 5KVSA 4QODA 2B78A 2OCGA 3GRAA 4IYRA 3WICA 1KO8A 4FOSA 4MK4A 1KKLA 3AUSA 1SG6A 4WIAA 5DW0A 1WU8A 1AA6A 1PJ4A 3JV7A 4HWOA 4YUAA 5LZ4A 4G81A 1H8HD 1WBJB 2EZUA 2WA1A 3NGXA 4IS2A 3K05A 4DIBA 2PWPA 4WRRA 2XKAA 1L4GA 1M6YA 5FA6A 1JQBA 4QGGA 2XHEA 2DQKA 2O0JA 2GZRA 3GAMA 3H3XA 3QFSA 4L9WA 5EJFA 3RC3A 1GYRA 1EM8A 1M9NA 2A0UA 4JA0A 3RYIB 2FSPA 3KUCA 4PVDA 1X7WB 3CWQA 2WICA 2BAGA 3WLNA 3M3DA 3PDHA 3L8MA 3IQDB 2A3RA 2P1DA 2ZYWX 3NTXA 3CC8A 1QG6A 4G01B 4KLZA 4LGMA 1J25A 3UJ7A 2QY6A 4MYHA 3V4SA 4MRRA 5AKKA 3L02A 2AOXA 5JNVA 4F72A 3OF3A 1DEHA 1J8QA 4EK9A 1V71A 1Q1BA 1DBIA 1B3BA 1L5FA 4KLRA 4PAMA 3ZD8A 4AKSA 1QRTA 1U7UA 2AW5A 1Z6AA 3KJXA 5G02A 4Z2AA 4JR2A 1X6VA 3HMKA 2VIIA 3WO1A 4V2IA 3RSCA 4RK1A 1SO8A 4IDBA 5BVGB 1H4QA 2XXBA 4LVNA 5EZ5A 2C92A 1DG1G 2ZIZA 3JQ7B 3ONVA 4QNMA 4JI7B 2OUKA 2QMQA 3LCVB 4CUKA 2QD5A 5DXFA 2WY2D 1WL8A 1WLYA 4TVSA 1HPLA 1VIMA 1P9WA 4B40A 3H9JA 4L16A 5BRJA 3TOZA 5D5PA 3SVTA 1XCGB 3SKXA 3VV3A 2EGHA 3W9SA 1GIAA 2ECKA 4TTSA 1KJ9A 3D43A 4IWXA 4J1NA 1JKJB 4C7MA 1TVMA 1U9JA 2MR6A 2W8BB 2ZUSA 1SVLA 3HCDA 4RACA 1TECE 5HFAA 4EGQA 2IYXA 1H6BA 1P74A 4BLTA 4IP0A 3MSXA 4L3VA 1AKRA 1EAMA 3OLXA 1QFSA 1E62A 1YE3A 5DX8A 4CLOB 4LZLA 4ZYWA 5C7LO 2I7VA 4MDEA 1CR6A 4RKRA 3ODGA 4KO8A 4NEQA 1JPJA 2NUTB 1L7DA 1J5PA 1K6EA 2QVCA 3OJOA 3HJHA 4MR9B 5ECWA 4B34A 1KS9A 3LFTA 4DMHA 3AEUA 3HBMA 4OHVA 1N8NA 3B36A 2YZGA 2H7XA 1WUHS 1XJ0A 4GVPA 2V8OA 4DR7B 3MQ2A 1KK1A 5EKDA 1AC5A 3WQHA 2BEUA 4JLUA 4RMIA 3LA8A 3KPUA 1UM9A 2RHLA 2XUDA 3ASYA 3R6DA 4KG7A 3HP4A 4L6IA 1I3MA 1JPNA 2PJRA 1MQ9A 3E9MA 1W47A 4OU5A 4Y2HA 1JDBC 1ZS9A 3WRYC 3ZYCA 2XDYA 1RXUA 1SPBS 5CTJA 5TQVA 2B0JA 3KELA 1WB9A 5HJ5A 3EJWA 2FVYA 4CR6A 1CUBA 4TLBA 4JOQA 5EIFA 4COOA 2RGGA 4DJDC 4ZYXA 1ECBA 3THXB 1ZH6A 1X42A 1N7HA 4PLFA 3R7BA 1T34A 3TM5A 1CUXA 1YKFA 4WNIA 3ZI0A 5FHQA 5KTSA 3OP4A 4HGNA 5TE9A 3A37A 3DT9A 1BCSA 3ZGXA 1F60A 1XVAA 2CNNA 3OU7A 4U3JA 3HNRA 2ZAOA 3HN2A 1BD3A 4RSRA 4M46A 1OLOA 1SBHA 1W94A 2FCRA 3HB1A 1CDEA 4QGSA 1HLDA 1II0A 2Z98A 5ELMA 4HQOA 2HF2A 2I34A 2P4HX 2XT6A 1QRAA 1QDEA 1QK4A 3TAUA 1SCJA 1EFRD 3MAAC 1O94D 3H8JA 2GPBA 3MFQA 2VJMA 2R8EA 1Z6TA 3LHFA 4EUFA 4HYTA 1ADJA 1SVMA 4ZXPA 1RZRA 3U3MA 3P97A 2AFRA 3C6QA 3ESDA 1DBRA 3EPKA 2OB2A 3AF5A 3P9NA 3ZCRA 4MQBA 4G63A 5GIPE 2HSDA 5A4IS 1JLLA 2JGLA 3ZKWA 1E3JA 2J0UA 2G9NA 2R2AA 2FZKA 2W98A 1SIUA 4EUKA 3ONDA 4W8GA 1H5UA 2XT0A 1TYZA 1TM2A 1V5FA 1UF9A 4B45A 3ZCUA 1BXGA 2R8BA 4PLGA 4M49A 2C9ZA 3GI1A 2ZRCA 1E0JA 1LRKA 2LBPA 2QD2A 3W5VA 2VP6A 3DVQX 3ES9A 1DJQA 1I3KA 1P2TA 4Q7KA 5EINA 2FAXA 4QFDA 3DZDA 2HI0A 1J70A 1E4EA 3CX6A 4MUEA 3I61A 2EFDB 5CCXA 1PL0A 1SHJA 2Y71A 4IJMA 4TMWA 5CLIA 5D87A 3DJFA 2M98A 5EXTA 4TYPA 3WXMA 4P81A 2GXAA 1T5DX 3K0AA 2VP5A 3PRKE 1X1CA 4ZT6A 1GT6A 1N2JA 1ZA1A 3OG9A 3TINA 3H5AA 1KK0A 1N2XA 1YR9A 3L8GA 1E1NA 1RDFA 3VAYA 2PUAA 2QROA 2BTQA 2P6UA 2QS9A 3A6GA 1ECLA 2AKYA 1CERA 1NUHA 2QR3A 4J07A 4AO6A 5CXUA 1XZHA 2HK9A 3EBPA 3OE7D 5FBRB 2AN9A 5KDDA 1KVRA 1IUKA 4TL7A 2O0KA 2C2BA 4D4HA 2GNOA 2XUGA 4NCJA 4LZZA 4TUYF 3HSSA 2IOHA 2IXDA 3ELDA 5BVHA 1JAXA 1TEZA 5K3CA 3VPSA 3THOA 3W6PA 4GEKA 3F6BX 3VPBA 3BXXA 2FWRA 1RJGA 3NUQA 4GM4A 4DCUA 2HU2A 1JXOA 1K7SN 1T3SA 1J8YF 1FMCA 4L9SA 3E2PA 3WGYA 4NZNA 2J33A 3VI4B 4D7AA 4LDZA 1Q17A 1C4WA 4JQSA 3W6ZA 2VL7A 2BTEA 2QORA 1CP3A 3HNOA 3D3WB 3VDQA 4A82A 4BVJA 4TKVB 4FYVA 3R9IA 3KLOA 4BP9A 3D7KA 4EHDA 5JYEA 4LIPD 1AZWA 1A5SB 2W90A 2BDTA 3ELYA 4G8BA 1J33A 4L8GA 1E2QA 1A27A 1ENYA 1KH1A 2Q1TA 1CQZA 3G2KA 1SCUA 2C5FA 3NEPX 4FW8A 4E2WA 5BYAA 1JAZA 2FJPA 2ANCA 1C7EA 3PFWO 3T15A 2GK4A 4ARSA 4CQMD 2GTPA 3TSYA 1O1YA 5EZYA 4DYDA 3HZRA 1LA2A 4O6VA 3DFMA 2RC5A 3CISA 4GQAA 3UC5A 4Q9DA 1G3UA 1YK0A 3E4CA 4LFAB 1EFRA 2G06A 2C4TA 5FBKA 5C8YA 2WJ6A 3EK2A 3AP3A 3G6WA 2GBLC 3WNBA 1YRQA 3G2OA 3HJCA 4ZCLA 2NVWA 4HY3A 3KYBA 2Y1FA 3PTZA 4EMTA 2F64A 2EZ4A 3AR3A 5GONA 3DBIA 1FRZA 4NU6A 2FOXA 1L1EA 4YROA 2GLXA 4RHTA 1NVAA 2CLLB 1T2VA 1EFDN 2VHEA 4QYIB 3ZH9B 2EX4A 4N7RA 3S2SA 1L7OA 3UTDA 3O4GA 4G36A 4TKLA 5EA2A 3WRXA 4ZVUA 3NHKA 1SG0A 1Z4MA 1VJ1A 2QD1A 4BBPA 2C0CA 3LX4A 5J47A 3DEYX 1FP6A 4OJKA 3FJOA 1FRQA 1F17A 1QH0A 4Y9SA 1JR3D 1JZSA 3PRHA 2WF9A 1L5OA 2ZU0C 3DL2A 4YDSA 4DY4A 1W4RA 2JW5A 5BSTA 4BFWA 4G5XA 4CM4B 3N2EA 4W5NA 1YS2X 1GRCA 3DNPA 4HBGA 3DOHA 4A8HA 5CYOA 3ZLVA 4RTJA 5I9IA 4N4AA 1RABA 1XI2A 3RE1A 2B8JA 4D0SA 4RVSA 4XQ0A 3VR6A 3C3PA 4KSCA 2H0AA 3Q0EA 2COEA 4OHOA 3B1KA 4HB4A 5ELXA 5EUQB 1V3UA 1LZKA 3LUGA 3TZQA 5KOIA 3OE7A 4ZOLF 1Z74A 5FYDA 2UZIR 4JVSB 1ZMBA 3ANSA 4RJKA 3CRZA 5TX7A 3L8HA 3F73A 1VL6A 1WKCA 3KJEA 4M38A 4JS0A 4U9IS 3QH4A 1JHOA 2P69A 2ZPUA 5DHSA 5IDVA 1SXGA 3ESQA 2B7BA 3T3PB 1Q0SA 5I3ZA 1IC6A 1B7GO 2Z6QA 2DYKA 5ALKA 1YFKA 2R48A 3MXOA 1HMYA 3D6AA 1U8EA 2AE1A 3AJ8A 4ZALA 3REQB 3DPUA 3FCUB 1CLUA 4M7RA 4QOEA 3UJAA 2ZI4A 1GKUB 1SGWA 4YLYA 2XNCA 4IIJA 4LYYA 1BVYF 2I3ZA 5JH7A 3ISJA 3W7BA 2ZUVA 3C3CA 3VPFA 4KFTA 4I36A 2KPOA 2W4QA 3A3KA 1VB3A 2VPIA 3MTDA 1F4VA 4Q7MB 5AOBA 5CFOA 2EP7A 4B2IA 5FBLB 4P54A 4ZXFA 1CEEA 4CQMA 1YJQA 1G9TA 1ZUHA 2F4NA 3HN7A 2KQUA 1T8TA 5I4BA 2F17A 2C97A 1BW9A 2X41A 3AUUA 4UE3S 3WQQA 1ORWA 3NBYC 2YJZA 4BAGA 2AXQA 3Q3HA 2AI1A 3VU9B 2I2XB 4QGHA 1K86A 4FR0A 1GPAA 4IJ5A 1SC3A 3ADCA 3IOCA 1QH8B 4UUBA 5JMPA 2ATCA 2V7QD 3ETHA 1FU4A 1RJDA 3U17A 1DV2A 1ZI8A 3A25A 4ASUD 2JHAA 4ZYTA 3A4YA 1KDRA 3V97A 1VKHA 3NGMA 2N9UA 1AZTA 3QTTA 3QX9A 3A6DA 4MPTA 1TMGE 3QF4B 3PCXA 3GYGA 3NHSA 4AY3A 1L8QA 4FUTA 5ESDA 4XPIB 5FWAA 1IUPA 1Y48E 2C2ZA 1E2HA 1YS1X 3JSXA 4HWKA 4QOIA 4N7MA 2BBSA 3A8TA 3C5EA 3JR3A 5DHPA 3Q0TA 5EE9A 5GINE 1Z0DA 2V3CC 1JR3A 4NENB 5EPOA 2F1RA 2MMGA 2JC3A 4LJ6A 4OOFA 4X84A 2XZLA 1OF1A 3EIXA 4PBSA 3WIVA 2JANA 3C3KA 2P62A 1DIRA 1YI0A 2WYOA 3IOEA 3NRBA 2VBGA 4K9RA 4MO2A 3WSTA 1GG5A 1PTKA 3CBQA 1GL7A 2J87A 1TEVA 3Q7RA 2XCLA 3CUKA 3CZPA 2GD6A 3CGGA 1W5AA 3HFGA 3NEAA 3OIWA 4FOLA 1O9GA 4GSYA 1K06A 3I2IA 3LPCA 1BU5A 4HTAA 4IRXA 4K9SA 5FQOA 3TFWA 4X7MA 4B3IA 4F12A 4X54A 4YRFA 3TR6A 5CDUA 4C6TB 1FFBA 2N75A 2PTGA 1V8OA 2AXNA 2GPWA 2HT6A 1KAGA 4TTIA 1TCAA 2CNDA 2VYNA 1UC4B 1WUKS 5T4HA 1PW5A 3FN4A 4Z5XA 2Y9MB 4Y2TA 5GV7A 3LDHA 1L7BA 4N5DA 2B7CA 1T8SA 2P9EA 3O31A 2WU0A 3CY6A 2D7JA 1EUDA 1V8DA 2FZCA 3C6KA 4TQUS 3CUVA 1H8ED 2ZPAA 4RFSA 5KYVA 2FPIB 1L5WA 1E3LA 3P0HA 1CEQA 2H9YA 5A05A 5BOSB 1XD2B 1L7VC 2J31A 5C80A 4CYMA 3GFBA 3U0VA 1QZZA 4Q3AA 4N82A 2X2FA 4U2EA 2HCJB 3AW9A 3D0RA 1DXYA 2O2ZA 4FCVA 4EFMA 4ZDWA 4KU4A 3T7TA 1OPXA 3DC2A 4AZ0B 3ZV4A 2FQYA 4RVUA 2PK3A 5CDFA 4MHTA 5JHGB 3V7NA 3JYOA 3NIGB 4MYUA 1EJBA 4XWGA 3PWKA 4N1AA 2OFFA 4RJJA 2VYVA 4F6LA 5AI8A 4AG5A 3KT0A 2FG6C 3M9LA 1CE8B 1PJZA 2CYBA 4MSUA 2ZSUA 3P9KA 4S2UA 4FCWA 5AXCA 3UPDA 4YAWA 1W25A 1IULA 4ARVA 2A5YB 2O3RA 3OEHD 4E13A 3DA8A 5CEJA 2ZI7A 2ZQYA 2C98A 1WP9A 4QTUB 2WUEA 1HYHA 3K92A 1VPTA 2AK2A 2DMRA 4QUKA 5KZMB 5KOHB 3GN2A 4M21A 3SF0A 2PS0A 3QRWA 4QDZA 3PC6A 5FEUA 1SMKA 2GFIA 2QL5A 1U7PA 2Y4OA 3KQNA 4BMOB 2Y1KA 1HFWA 1E1CB 1Y1SA 4PXSA 4W7IA 3KZMA 3U9LA 2CBZA 3ASUA 3ZV6A 4B3TB 2ZFUA 1FK8A 3HJNA 1RPTA 5KNDD 4CV3A 3AY0A 4QXRA 5LKAA 4Q7LA 2VATA 4WLNA 3U61B 4CEJA 2Q2NA 3UK2A 2QOEA 5LYJF 1HFJA 2IXBA 3GJ8A 1ABFA 1EPUA 2MYPA 3TKLA 3ACCA 1CT9A 4IDPA 1MXFA 3C4VA 4Z53A 1WCYA 3VC7A 4BGVA 1E9VA 1XKXA 4HVCA 1DXOA 4B3MB 3B3FA 3FSGD 3JQ8B 2HD4A 3WMGA 3K2IA 4JR0A 4R9RA 4UTRA 4M1MA 4M36A 4HRVA 4RFLA 3ZVNA 1PLLA 3K9QO 1JYSA 1SR8A 3S29A 2K4MA 4YNBA 3ZDXB 4IR7A 2O8EB 3AFOA 4R84A 4BU0A 1E5LA 2A5JA 2H9AA 1QPGA 2ACVA 5HA5A 3U13A 3CUSA 1ZCJA 4D4LA 4XJSA 1JEQA 1U3CA 2OFXA 4OG2A 2BFWA 2NPFA 2WUVA 3HWSA 3RF6A 1ZH4A 4NMLA 1L5GB 2RSLA 1I3CA 4EHBA 5ES4B 2JAWA 3JY6A 3IE1A 1NZDA 5JD3A 4DIEA 4ESVA 4H1WA 1QJ4A 1JIXA 3CLSD 3ANYB 3TW4A 3PB3A 1KO1A 1E61A 3NP7A 4NNPA 3ZV5A 3DJYA 1GXSB 2XD4A 5KNBH 4YCNA 1LPOA 1WHTB 5M5BA 3BAFA 2H5LA 1MX9A 1NASA 2NU9A 4UXJA 1W5FA 5KCMA 4ZYVA 1NF2A 4K8OA 1KO4A 2VP0A 4RH0A 2P9JA 2NQ8A 3EUEA 3COYA 1C1XB 1NMQA 2NPIA 4OMUA 2EP8A 2OBYA 2B5WA 5AM4A 4BJ3A 4O5AA 4N6GA 3JQDA 4ZCQA 3H1AA 5DN6A 4Q4JA 5KPJA 1FTNA 1BSVA 3OZWA 3A2MA 3I2HA 3PX7A 4RQBA 5DXAA 1CUHA 5A71A 1BOOA 1SOMA 2WHPB 3UOWA 5LQNA 1N5RA 1XRPA 4P3NA 3LNTA 4PX9A 1Y6RA 3KL2A 1QU2A 2GTIA 2OHOA 3SEZA 2O0HA 1QP4A 2ID9A 4JJAA 5LIPA 4ZHQB 1RMQA 1NTOA 4JT8A 5HTOA 1MX3A 2ILTA 2QQ0A 1EE1A 5BYKA 4JYZA 2VJNA 2H92A 1HOTA 3KC2A 2VZ9A 4I4NA 4K28A 4Z51A 3B3GA 3QQ5A 3Q8KA 1S8OA 4C0JA 4MCHA 5FD8A 2Z4TA 4ARCA 2X5OA 2UXBB 1ZU4A 5AQ1A 1RRFA 2YFKA 2FPGB 2WP0A 3KEMA 5A0VA 1V26A 1EFLA 1Z83A 1GG9A 2B35A 2C3MA 3M6MD 4HXGA 4N40A 4R69A 4S1TA 4BEWA 4E88A 3CRNA 2ZJ1A 5KQSA 3LBNA 1RWOA 3JS5A 3DBOB 3RU7A 1FFEA 3QPCA 3UW1A 3VPXA 3G8BA 3UJPA 1QSGA 3AG5A 1O8BA 2PUFA 3L46A 2Q4TA 3OTQA 3PPYA 3L1HA 5IVKA 5F7JA 4P32A 4E33A 2JBWA 1U28C 3AI7A 3FYUC 4YMGA 1P60A 3U1VA 4HUTA 3VMFA 2XB8A 5LBTA 4IHQA 4ARAA 1XLWA 3UQYS 3W2GA 2PO5A 4LVOA 3JW8A 2O1WA 1O3YA 3GH3A 5EE0A 5LQSA 3LLVA 3N3BC 2NQTA 4R9VA 2NXCA 2JJ2A 4J7XA 3PTLA 1MENA 1TJYA 1XNHA 1CUJA 1IHPA 1KZGB 1S5PA 2ZTMA 2V74B 1NATA 1VM6A 4V0NA 3K72B 3GGSA 4UVHA 3P2OA 5ITZB 3ETDA 2WINI 2GBIA 3BX1A 5JI3E 6ABPA 5K2MA 4RY9A 2BHRA 2XMCA 5EKXA 3AL2A 3A1NA 3OTIA 3PUYA 4P5EA 3TPZA 3PF8A 1QX3A 1SQFA 4O2BF 5LM3A 3HKCA 2Z4SA 2H65A 3H6KA 4I9NA 5F4ZA 4CLHA 3S70A 4N41A 3HI4A 3LC0A 3DHVA 4J43A 5JWOA 1EZ1A 1FUIA 3GCDA 4ZO4A 5C37A 3IAS6 1IE3A 4B3GA 1VOTA 4ZDIA 2JFUA 3LRXA 2CUKA 3CEPB 5A4JA 1WJGA 3AVUA 1XZDA 1UCFA 2WIKA 4WOCA 5DRYA 4ZRMA 4QDJA 3ON5A 3QKSB 3O8RA 3WNVA 1GU0A 2DFPA 2QVYX 3PKZA 1JFSA 1V41E 1EMDA 1RI2A 5EE1A 5AW1A 4D92A 3QWHA 4DLZA 1D2NA 3T5AA 2ORWA 2BCJQ 2V4ZA 4LJAA 1USKA 5F5NA 4PZAA 5A1TA 5LQAA 3H5IA 5KOYA 3FIUA 1JXQA 4FDMA 3E9NA 4HQKA 4TRRA 2HWKA 3RGGA 3V48A 4JAVC 4K3UA 2LE0A 4JI0B 4O4LF 3SBEA 4MAAA 5CCEA 5H7XA 4Y6OA 1W36B 2I7CA 2D2EA 3L06A 2XMPA 1E79D 3O94A 1ZZGA 1ZN8A 4LDPA 2Y1EA 1PT8A 1BMFA 4B1FA 5CBKA 4RD6A 2DLDA 2DBVO 3AEZA 3DMFA 2QTVB 3K7EA 2XE8A 4L7QA 2FR1A 2K2WA 3R41A 4FD3A 1B14A 3MBIA 2QJTA 3C1TA 3LOQA 1HWYA 3E2MA 3TI9A 1E3IA 2IGBA 5KVAA 1NU8A 1IBLB 1CEYA 5GJVC 4CEHB 4TGLA 4CTKA 1IOZA 1FS5A 4AFNA 3EFBA 4BTLA 2CHVA 2WAAA 1CIJA 1E66A 1XDGA 3GEMA 4LSWA 4DPMA 2IYZA 4UEJA 5LP6C 4Q39A 4UBJA 3FPGA 2QLTA 2VOEA 3RYHA 3WNZA 5HK9A 1GSHA 2GZHA 1X7YA 2Z6VA 1H1LB 3IV9A 3KXKA 3OP1A 1R6VA 4J16C 1MJHA 4TZTA 1FSFA 5DXJA 3NHRA 5FUMA 2M6LA 1WSBA 4J1QA 3UAWA 4KRFA 4KUGA 3VHXB 2VPTA 2HU8A 5FOXA 1FFDA 2G8LA 2Q8NA 3KOWA 3FF4A 3MD0A 4GX1A 3BB1A 4R2HA 1T0BA 1YUBA 4GC9A 3VNAA 1FYFA 1OWLA 4QG7A 4NP6A 4IXMA 2R79A 2ZCUA 3JYHA 2XF8A 3GHHA 4JVMA 1H4SA 1VPDA 1WB5A 1WHSA 2FR0A 5K05A 4KQ6A 1WV0A 2WJGA 3BK7A 4M1TA 4G56A 4RTSA 1JLHA 4H2DA 4DCGA 4ARIA 1Q7BA 3CA8A 1XNJA 4D3SA 4QHTA 1L4KA 4OHKA 4CV0A 3KQQA 1G0NA 4J1SA 5K6AA 4NJEA 3VC2A 1N77A 1RPAA 2PG3A 3KKMA 3MMPA 3CW9A 1I6LA 1RM4A 2RAPA 3ET4A 3EF3A 1J06A 1LV8A 3KHKA 2HEGA 1QHNA 3LBFA 4JB3A 2Q2VA 4A1OA 3MT8A 3SZLA 3MHTA 2MSLA 1ENPA 1XRQA 4PIPA 1PYDA 3P20A 1ESMA 2RI1A 1FMFA 1BFUA 2V6MA 3ESYA 1NKVA 1SKQA 2I22A 2YN0A 4QU9A 4G4SO 4AMYA 1CKEA 1F4PA 2O7SA 4F1KA 2Q0HA 1PZHA 3MGGA 4PX5A 4B17A 1HTTA 1RXEA 1ADYA 1X94A 3E8SA 2LIPA 3EWSA 4PO8A 4QKQA 5A5FA 2WV7A 2IX3A 4QAQA 4RZQA 2PANA 3D7NA 4Q1BA 5EHGA 3K9NA 2VK2A 4YRDA 2JLYA 1YUMA 2E0IA 3HDGA 4B8YA 2IHVA 3JVIA 3PD1A 1ONNA 5IPFA 3QYPA 2Q7DA 3TK1A 1FSPA 1F1JA 4FFDA 4MVJI 5IU6A 2DT8A 3BQ9A 4U2FA 2OXFA 4F71A 1EJ2A 3ROTA 3BGIA 3ET5A 1XTIA 1Q2UA 1XQ1A 1EXWA 1SEPA 3NH6A 4U02A 3REGA 4J1TA 3I9OA 3PEWA 1TGYA 4PLTA 5EXDA 1NN0A 1V45E 1QHSA 1ABEA 3G2JA 3W4JA 5C8VA 1PS8A 4DHWA 1T9ZA 1POXA 2NT4A 3E48A 4F11A 5I5EA 5THQA 3GLGA 3S99A 1ZRNA 3GLIE 3GZNB 1YHZA 2W93A 1J56A 2FPOA 2NAPA 3NYIA 4H0CA 1TM7E 3KJIA 4K46A 2H7YA 3PUKA 4XZ3A 1XLUA 4YCLA 4FVTA 4JX8A 4LZAA 4Q4DA 2Y68A 3WTBA 4X1KA 2CD7A 3V80A 5K0JA 4YRIA 2TECE 3ZZMA 2XOKA 1V1RA 2JGAA 4NKRA 2BGRA 3C6BA 4NU0A 3ZWDA 4DMRA 3S5JA 5CA0B 1Y8RB 5JPCA 2NSDA 5JANA 3RAEC 4M9UA 4U7TB 4Z1MD 3TOSA 1FLDA 3EHEA 1Z8HA 3M6LA 3R8FA 1J21A 2QRVA 4X1YA 5E7JA 1GD1O 1J20A 2CDNA 1NUTA 2GVNA 1H93A 1U8FO 1W581 5EHQA 5DGHA 1NNUA 5LP6A 3ZWQA 1A9XA 3PLRA 4HXEB 1ZR4A 1TVKA 2DBRA 2O2YA 2GHTA 3B9PA 5BPHA 3B12A 5KYXA 1LRJA 3R5KA 3AJ9A 3MFYA 4KR3A 1WKVA 3UCXA 2XGOA 4FZRA 3E3AA 2YVLA 1XPJA 3Q7QA 3UK7A 1OTHA 3QBEA 3BGWA 5DGXA 2PSHA 4MV9A 1GA1A 2O4CA 4N01A 4ARZB 1DLIA 3V3TA 1ZHFA 1LFDB 3JPYA 4AQYB 2HFKA 3VTZA 2I7XA 2MJLA 4IMJB 1LBHA 2CHQA 5FWNA 1OH8A 4XB6B 3D2BA 2H07A 5JI2E 1Q7RA 5F2OA 2D54A 1PHPA 1VG8A 4B2YA 5REQA 1RLMA 3CZCA 1I01A 2ZKLA 3RUIA 1JNYA 3QVVA 4R01A 4URZR 3RK0A 4MW6A 4AY2A 1TTTA 2ILVA 4QREA 3PJGA 4UM8B 1QBKC 3EIFA 1TC1A 3TZBA 1ZGHA 1M1NA 4YRAA 3MPUA 3TLKA 4YT8A 4M9SA 3SDBA 3ZDRA 2D1SA 1D1SA 4WD3A 5LP1A 2G07A 3RASA 1JJIA 3Q85A 4PINA 4RLSA 4MUBA 3W1VA 3F4LA 3QEJA 4QX6A 2R1TA 2HMVA 3N87A 1ZWKA 5JRDS 4BGDA 4EQ6B 2RH4A 5DASA 2DFTA 2R6AA 4CIXA 4M1SA 3D02A 4HT3B 4Y1RB 2RAFA 4BZWA 1EX9A 1B00A 3FPAA 1OFIA 4W5TA 2P2NA 1ZK0A 3I05A 5AVJA 5DI3B 3UK6A 3GGPA 4OM7A 4AJNA 1T0HB 2Y0EA 1GGMA 3OJWA 3R3YA 4XGIA 4BKQA 1BEZA 1MOQA 3QY0A 5JECA 1GN8A 1AK1A 1W1UA 2VYQA 3VVBA 1R0ZA 4C2BA 4B74A 3GD5A 4NZMA 3HA7A 2VH1A 3TH5A 4ETNA 1V3VA 3A6FA 4YAKA 3KTOA 4CCSA 2PNFA 5HEKA 3OJEA 1ZGCA 4C6SA 3AKCA 2Y27A 3H9BA 3HU5A 1MVOA 1KJYA 1UXHA 1Y1LA 4QGAA 1N5LA 4D98A 3DE2X 3DC7A 5A0FA 3QBDA 3S2YA 2LDBA 4EPXA 4F86A 1YDEA 1H3EA 3IEMA 3U40A 1JEJA 4ZK2A 1SCDA 4GAEA 5JNUA 4B6GA 3EVFA 1SWWA 4P0TA 4L1KA 3USES 1ZGZA 5EJMA 2LCQA 4DA0A 3I5YA 5A0TA 1CHNA 1GRRA 2HL6A 4D8UA 1TLTA 4RH1A 3L05A 1OASA 4XGRA 4NYMR 1OAKA 1KJZA 3GD7A 4OUDA 4KE7A 4R41A 2XCRB 3IJ5A 1W88B 3OM0A 3H5RA 2VP9A 3A6JA 3HHEA 4G26A 3WLFA 1OV4A 1AKUA 3QPWA 1UK9A 3T5PA 1YA6A 3LWBA 4U6NA 1J1IA 3DOUA 5I7WA 1KOGA 2RKBA 3A70A 4CR8A 5K0FA 3U16A 3BH0A 4U00A 3NV7A 3ESCA 3HXKA 3IAM1 2OXCA 4NV0A 1AXRA 4JB0A 4BQQA 2XWPA 1A72A 4NZYA 3WGVA 1D6NA 1YB5A 2HQBA 3LDAA 3VKUA 4BB5A 4TL6A 2CEKA 5FL3A 4RK5A 3ZOZA 1T3ZA 1V8BA 4OHPA 1JQ3A 2OCDA 1PG0A 4N47A 4A10A 1IVNA 5I9NA 3EBOA 3TGPA 3LK7A 3LT5A 4KR0A 1I9GA 2R25B 1RWBA 3CURA 4MKHA 1OOEA 3NHWA 4RHYA 1CIPA 1QP7A 4PQYA 4YRCA 2HMUA 3AHEA 4ZI5A 3RTCA 1ZNZA 1XF9A 2C31A 2HK8A 3C7DB 3ZCQA 1Y98A 3FJYA 4F56A 5LLDA 3DMDA 1AKEA 4U7JA 3VOSA 2XTMA 2IWHA 4I9FA 4KQJA 5TNXA 3AV0B 3FNEA 4TYQA 3VKFA 3TNFA 2IDKA 3I9JA 3VXKA 1V48A 3ZDZB 3DOIA 1ZC4A 3LUPA 5J2UB 1Q3HA 1SCAA 1JPUA 4BWGA 4AZWA 5AKLA 3TFOA 4DUZB 3LSTA 2YW2A 4GD3Q 4I2VA 3PQ3A 4FFNA 5CLQA 3J80A 3HKDA 4NBLA 3SQDA 4MI6A 1KEZA 1U1EA 1DPGA 2FB9A 4JQYA 1WKBA 1PQUA 3JQ6A 2VZLA 4LXXA 1IATA 1H22A 2J3HA 4O29A 2F43B 3CLKA 5DBFA 2H4JA 2D6FA 3MTGA 3PUWA 3HC7A 2POQX 3QWAA 1IBRA 2EKZA 2PBRA 3CZ4A 3EXG2 5CX1B 1VC2A 1MH9A 3O1JC 4K9DA 5CEFA 3H9UA 4PQFA 2O4UX 4QPPA 3UT6A 4DC9A 2J5XA 4CKBB 4BQFA 1QFYA 3AU8A 5JSZA 1FFAA 5T6BA 1BMTA 1WZCA 2ZRDA 4S04A 5H59A 1T2FA 3HFJA 1M0EA 1EWTA 1JJFA 4OQPA 4BMZA 4E6PA 4ER5A 4JOSA 3ENWA 3E81A 4YA6A 4CT5A 4KPEC 1UKBA 3WYBA 1XLTC 2RK3A 3C6MA 3ZI4A 1I7SB 3CUUA 1W30A 5HE8A 2OD7A 4KO3S 5MN4A 4JDUA 2CY0A 1T5TA 2BH2A 1Z06A 1X7HA 3ENQA 1UXGA 1R6DA 2M6SA 4Y0AA 1PX2A 3G89A 4MRMA 2XKKA 1U7DA 1G5TA 4B6RA 4PSCA 3G9UA 1GPWB 2RD2A 2AQIA 1TAQA 2FDRA 1OAAA 4CKEA 1JU4A 3EH1A 3EOBI 1PZXA 2FX3A 2NV2B 3M1YA 1H2WA 2R751 2BT4A 2HRDA 2RGWA 2XT9A 4EHAA 2YICA 1U65A 1PNOA 2OV2A 1P1JA 5G3ZA 4ACAA 2Y92A 4O4JB 2PUBA 4QXMA 1ND6A 3D5QA 2P0EA 3TBHA 5B64A 2X0NA 1VPVA 2GAOA 3DHWC 4I19A 5KTPA 2ZULA 3OQ1A 4XR9A 5DN9A 1Z5VA 5JFTA 4F9FA 1P45A 5AK4A 5IDWA 4PFKA 1MN6A 5FFNA 3K5HA 1WUTA 1BXRA 4NLLA 2ZZNA 4Q1EA 4PC6A 2G71A 1G5IA 2RJNA 4EGJA 1QFMA 1HSOA 4FBLA 2GBGA 4QGBA 5AUOB 2NVUA 2WM9B 3TIIA 1D8TA 5KYGA 1RCUA 2VUSA 3H7IA 1O9HA 1Y34E 2Q5OA 5D7NA 1VZ3A 2Z9CA 1IN8A 3R5JA 5K3FA 3FPFA 1CR2A 4NYIR 2PGIA 1SG9A 5DE3A 2PU5A 4WGFA 4RANA 4FLEA 4GZ5A 1G7RA 4DCTA 3NRCA 2P6OA 2O5EA 3NG1A 2ZM5A 4PE5B 1G6KA 2OCYC 2PJUA 3N8DA 5T5QA 1OGJA 3OSZA 5JSYA 2P4QA 5F52A 2ISSD 3OOJA 5B1DA 2WIBA 3TLGA 1SU8A 4L7VA 4C4OA 3OTOB 1IN7A 3ETCA 1KORA 2GPSA 1NYQA 1CIVA 1DC7A 2Z43A 4ZGBA 3WFZA 1CUYA 2O20A 5DWVA 2VYFA 4Q19A 3R5TA 3V1UA 4I55A 1X92A 2HRRA 1VCNA 2HA7A 3JARA 1DKRA 2QJOA 4UUAA 3VU3A 1NKTA 1U28A 4GW3A 1BXZA 1M1YA 1D5CA 3AKDA 2I6GA 5E2BA 1OX5A 3TM4A 3ELWA 4PXAA 2VJPA 4HEHA 2XQGA 1J2JA 3QJYA 3ZHBA 3DBLA 1SCKA 3A7DA 3H9CA 4RIHA 1DWPA 2FEXA 3GEHA 4ZC8A 4F91B 4M6WB 1QHEA 3MA0A 3FTEA 4HDRB 1TF7A 3T7CA 4HQRA 3LJKA 3TZ6A 1P1RA 2HHAA 4I5IA 3RK1A 1M6EX 2OFPA 2Z9BA 4Q21A 3WGQA 4CV2A 3ER8A 1JZTA 1JSZA 3ZY4A 3CFYA 1QE0A