3CPJB

Crystal structure of ypt31 in complex with yeast rab-gdi
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
198
structure length
164
Chain Sequence
YDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMGVEFATRTLEIEGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDSKSSSYENCNHWLSELRENADVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALSENVDKAFEELINTIYQKVPTISL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab GDP-dissociation inhibitor
publication title A structural model of the GDP dissociation inhibitor rab membrane extraction mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 50
structure length 164
sequence length 198
ec nomenclature
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cpjB01
1Z6TA 1I2DA 4MRNA 2RHDA 1U0JA 1B23P 2LCFA 4R2HA 4B47A 4EUNA 2BVNA 2WJVA 3OE7D 3C5CA 4HB0A 3GLGA 2H92A 1NF3A 2BMJA 2JDID 3CPJB 1D9ZA 3UATA 3NTUA 2ZYUX 2YC2C 3M0EA 2P6RA 1GRQA 2VHCA 2XNDA 2A5FA 4BZPA 1XPOA 3VR2A 2VF7A 3U3OA 3KKOA 1JXMA 3VR4A 4PXAA 3QF4B 1NVWQ 1CJTC 3ZH9B 2JLSA 1OJLA 1G5RA 2IYZA 1E1RA 1Q44A 4XIGS 3ZD6A 3WYFA 1AS3A 3VKGA 4B2IA 2IS1A 1E4YA 3HDTA 2O8FA 1ZM7A 5FTJA 2O8DA 2V7QD 2W6JD 2CDNA 1F2UA 2OO7A 3CW2A 1XXHA 3NHBA 5KPJA 3SQXA 1EXMA 5EE5B 4ERNA 1TEXA 1YR8A 3B6EA 4LHXA 3FKQA 4BEBA 2IWHA 3BS4A 4G5GA 5AUOB 1KMQA 1QBKC 5FR1A 3R8FA 1GSIA 4OI0A 2CEAA 1CJKC 4AYXA 4BZXA 3CF6R 4QHTA 2IS2A 2ZE5A 3DHWC 4D26A 4TYPA 3TMKA 2FSIA 4JVSB 3ICQB 1OPXA 1AA9A 4JBWA 5KSYA 1HH4A 3CF0A 5CK5A 3SYNA 2NMVA 3HPRA 4PSAA 3GFTA 4WZ6A 1GL7A 1X86B 4Q4JB 4C3ZA 2Z0MA 4WOPA 2FMXA 1DBSA 1QRAA 3P4XA 3QXSA 4HSEA 1WQ1R 1IN6A 3DOEA 3T34A 3H2YA 3SOPA 4PAQA 3OE7A 2W2XA 5DE3A 2VP0A 2WPDD 2DBYA 3B1VA 1EFRD 4FINA 3AF0A 5H1YA 1ESMA 3TW8B 3WYGA 3S1AA 1QDEA 2VP6A 5KOYA 1ZU5A 2Z4SA 1RKBA 2JDIA 4F93B 2NZ8A 3TSWA 1Z5ZA 3FVQA 5AUQA 4C30A 4MRPA 4BPBA 1Z0KA 4OQFA 5DHAA 3HU1A 4HEJA 4IFBA 2VHQA 3QG1A 1CR0A 4GFDA 4ITRC 2ODWA 2AR7A 4BUJA 5HCNA 1RZ3A 1E2IA 2QP9X 5AJWA 4BECA 5KU1A 2O5VA 2JAQA 1Q1QA 3UMSA 1BMFD 1CU1A 2PZGA 1E9AA 1KSHA 2C8VA 1ZNZA 3CF2A 3WNDA 1ZM9A 2ODBA 3MJRA 2RGEA 2ZJYA 4ZPXA 2QP3A 4XWOA 2V7QA 3NC0C 2W6JA 4Q1CA 2GJAA 4QGGA 1W4BA 1GILA 2BEJA 1I4DD 3DPUA 5FL3A 3K70B 4NYIR 1JEDA 4UXHA 3VFDA 3RC3A 1OH6A 3AVOA 5G40A 4WVFA 2UVQA 3CIOA 1JQJC 4JKIA 2WBLC 4EIWA 4AY2A 2OCYC 5FUVA 3X1XA 2ZU6A 3DDCA 4TMWA 1SVIA 3CX7A 1JR3E 5EE0A 3GLFB 1S9DA 3KKPA 2HT6A 4UNPA 4HUQB 4IXNA 1DG3A 3IQWA 5P21A 1W36D 1K8RA 2GA8A 4DDWA 1VG8A 2RKOA 4HDOB 4M1WA 4M1SA 5KO2A 5C1BA 4NYIQ 3ICEA 4Q1DA 2ZIAA 4HB2A 4MKIA 5DYIA 2B8TA 2WPDA 3K8YA 5BXQC 3GJ6A 2VSOA 1GKYA 1BIFA 3MSXA 5L3VA 4DCSA 4PO9A 4ZKDA 1M2OB 4JVNA 3NG1A 3BORA 3QEOA 4B43A 4EQ6B 3QXJA 1NVVR 3R20A 2ZSDA 2ZI3A 1VCMA 4PANA 3H0KA 1RVDA 2IUTA 3P32A 3W3AA 4CEIA 5DI9A 1KI8A 4PAMA 1T0HB 2WTUA 4TMZA 4WA7A 4QNRA 2IBMA 4UNRA 4QHYA 3QKSB 1P72A 3HR7A 4TSFD 4OJKA 3K0FB 3L0OA 1JAHA 2PBRA 3AKYA 1F5NA 1P2TA 1TADA 3A1TA 3T1QA 3U44A 4Q66C 5F9FA 1LY1A 1NLYA 2WWIA 3Q5EA 5BYJA 3BH6A 3PUWA 1TL7C 4JSTA 4M8NE 4MGKR 5GJWC 3RAPR 5K8IA 2J0UA 4LYJA 4W5WA 4XWKA 2R9VA 1KDPA 3AUYA 4CEJB 2PL3A 2N1BA 1KK1A 4LPSA 2IYTA 4KLZA 2AXPA 1SVKA 2ZRJA 3GLIB 3U60B 1RC8A 2C9CA 2DFTA 3RWMB 2WIAA 4Q9KA 1MH1A 1NKSA 3U61B 2DHRA 4NCJA 1YR6A 3U7FB 1XEXA 2EWWA 3GEHA 5KDLA 3OESA 4PAOA 1GNQA 2ZTSA 2OG2A 2V8OA 3MRSA 2B7CA 3ECCA 4DC9A 4AYWA 3ND9A 5ANRB 1TF7A 3E2IA 1XMJA 4PX9A 3B78A 3REGA 1LNZA 2QA5A 4NTZA 2X2EA 1XTSA 3LVRE 5CDFE 4LYFA 4OKSA 3B13B 4ZIRA 2WOJA 4OI2A 2UZIR 1FX0B 3A37A 4BFSA 5H70A 4R98A 4XOIA 1OHHD 1XRJA 3KQKA 3IILA 2R65A 3GEIA 4OQLA 5TB5A 2F1HA 1GNRA 3AGPA 1E2JA 2PEYA 3W9YA 1Z29A 2GJSA 4IHQA 2C9YA 3TAHA 4ARZB 3WHKA 3ZQ6A 1FL9A 4TLEA 3C4JA 2GK6A 2I4IA 3U6KA 1N3BA 3DZDA 1Q12A 5K8UA 4TSFA 2F9LA 3EAQA 4IOKA 3RWOA 1PVOA 2ZJOA 3F5FA 4B2LA 4Q4LA 1NLFA 4KAXA 1WDTA 3MAAC 4EPXA 1E9BA 3KXLA 1OH8A 4L5BA 2FEOA 4Y0VA 3SFZA 3FHCB 1XB2A 1ZIPA 2RGNA 4D4JA 3R9WA 2JJ1D 221PA 3EZFA 2GJ8A 5KNDA 1CKEA 421PA 2EFDB 1WMSA 4H1UA 1IY0A 4CT5A 3L2OB 3ETLA 4QJ3A 5FL7D 4QFMA 2G0TA 5J4VA 2CMKA 3OEHD 3V9PA 5JCZA 1G6OA 3R7WB 1KK0A 2ZANA 4UJ5A 1OF1A 3I8SA 2P5SA 3IPXA 5FPHA 1PLLA 1NY6A 5CB6A 2HXSA 3SU8A 3GLGB 1YKSA 1S2MA 2E9SA 2VP5A 1NMYA 5L8VA 3K0CA 2KSQA 1IN5A 3CRW1 4A9AA 4ASUD 4Q03A 1OW3B 4B74A 3FMIA 1KDOA 2LWIA 2YVUA 3FHOA 2BJWA 4JL8A 2E1RA 1T3LA 1GFIA 4LJ5A 1AM4D 5EZ5A 2J87A 4IEEA 2ATVA 5GJBA 4JT4A 3G0HA 1CLUA 1KSJA 1TQDA 1OXTA 4Q9HA 1LB1B 1ZUNB 2QN6A 4KVAA 3IO3A 4E03A 1VYUA 5JI3E 2O8FB 1SVWA 2IYUA 1OHHA 2IHBA 2J0QA 2AX4A 1QG2A 2Q3HA 4NYMR 1XXHB 2FOLA 3LRPA 4JLPA 3BFXA 4OQNA 2WSSD 4KHZA 2PZEA 5FBRB 3WNBA 4MA4A 5DHFA 5HZHA 5FOUA 1E9CA 2B6HA 4RZXA 3LLMA 2IWRA 1E9DA 1N6IA 1AQUA 1ZD9A 3AF3A 5KTYA 1A4RA 4PZLA 4BFYA 1N6HA 1G19A 4F7WA 1XWIA 2VEDA 1R4AA 2WV9A 4M0LA 4JSYA 4TQ9A 1ZNWA 2GTPA 3UMRA 1LF5A 2C77A 3BH0A 4KVGA 1F2TA 3CWQA 1ZJ6A 5JHGB 2LKCA 3LBIA 4M2LA 1Q3HA 1EFCA 4LX0A 4V03A 5FL7A 1Z0DA 1ZRHA 1Z0FA 3OEHA 3T35A 4LHYA 3SNHA 3AVXA 1SKYB 3ZGXA 1U81A 2H16A 3A1UA 3TUJC 1KY2A 3PUYA 4DSOA 5KSOA 2CJWB 4M53A 2IYQA 2BCGY 3SDZA 5JCPA 2P3SA 5TDHA 2ANCA 3GLHE 4DLTA 4RZ3A 2WM9B 4Q9JA 1UKVY 2B8WA 4FW9A 4ASUA 1HQCA 2JLRA 4YDSA 1M34E 1P6XA 4ZDIA 2J45A 3X1YA 4L16A 1TQ4A 1YZNA 2ZRBA 5E7JA 3NDBB 4JLJA 3AP2A 3ZDQA 1VCNA 2PX3A 4A0RA 1OLOA 3A58B 5JEEA 1ZM4A 3VHXA 3NBXX 2J0VA 2P0EA 4HZIA 1CF4A 5CM9C 2A9KA 4TT3A 4B3CA 3PEUA 1Z6AA 4OYHA 2ZRPA 1E2HA 2O52A 2VYFA 1FMJA 1D8TA 2R62A 4D4KA 2ATXA 2NGRA 3ZZ0A 1UDWA 3QKRB 3ZIAD 1MRSA 1W1WA 2FEMA 4NP6A 3Q3JB 3CWZA 4G1UC 1E9SA 4KXFB 4N3NA 3W6OA 1Y63A 2QT0A 2XZLA 3V4RA 2FX3A 2H18A 4B33A 5GVRA 4LUCA 1G8PA 1RFLA 3EZ6A 1Q57A 4PO1A 1JPNA 2A3RA 1UF9A 2OV2A 1R8QA 1P61B 1U8ZA 2IYWA 1U98A 2VBCA 3CM0A 2G3YA 1AK2A 2VP2A 2H5EA 1SGWA 5DISB 2GVZC 2GVDC 5FOTA 1Q0UA 3C8UA 4P32A 3OHMA 4KITB 4G5QA 3CKLA 2RGXA 1NBMD 4YQFA 1XPRA 2X2FA 1KO7A 2JA1A 3REFA 2BC9A 3LQQA 3R8CA 4AC9A 3NXSA 1P73A 4BFVA 3NH6A 1AN0A 2YNMA 2WSMA 2DY1A 1XMSA 4PPQA 5K8TA 3BBPA 2JEOA 4PPNA 4NCIA 1KYIA 2F1JA 4KU4A 4DIDA 5H8WA 2IK8A 2BMEA 1EFHA 5E3HA 1G3RA 4PFSA 4MYUA 5C4GB 4CEIB 2GJ9A 4JJKA 2A7QA 3IO5A 4ZDJA 2OSBA 3FB4A 3FKSD 4Q1BA 4ZI3A 1RRGA 1MOZA 4IVPA 3UPUA 2PEZA 1IXRC 1CXZA 1LTQA 3VX3A 1W5SA 1XTQA 2JIZD 2O0JA 5UKDA 3EIEA 4GP7A 4K46A 5HKKD 1I2MA 2W6IA 1AS0A 2ZRAA 3U44B 3CH4B 1IOZA 1E9FA 4Q7KA 3ZD7A 5IT5A 2G77B 3SJAA 3WMGA 2HEIA 3KDSE 2VHTA 4NZYA 1WF3A 1QHSA 4C0JA 4X8OA 3I61A 3BK7A 1Q1BA 2F1IA 1OV4A 1I4TD 2VTKA 2GZHA 4QBHA 2ZS7A 5FI1B 5KPDA 3EG5A 2AHOA 1OH7A 4X8HA 3W6PA 2GWHA 2CVHA 3IIMA 3BE4A 5FPTA 5JI2E 3CPEA 4MKGA 2RGNC 4L9WA 4DCTA 1A1VA 5KNBA 1M7BA 2QMEA 2C95A 2QQ0A 2WMNB 3DM5A 5EXSA 4L9SA 3TSZA 1P5ZB 2FU5C 4IEIA 4TLCA 3GP8A 2D62A 1R6BX 4OHVA 2GKSA 2J41A 3DEFA 1KAOA 1GITA 4FCVA 1OB2A 4C4PA 5GVSA 3AP3A 4US2R 1NBMA 3ASZA 4P4SB 121PA 1W36B 1FQJA 2BCJQ 2IHYA 2WWWA 4XH9B 3K0CC 4B73A 2PH1A 1DE0A 2IA5A 1IBRA 4RCYA 3TVTA 3GJ3A 1KI4A 2J59A 5FH9A 4KLNA 3K9NA 3KUCA 3X1ZA 4MRVA 1GUAA 1NN0A 3X1WA 1OSNA 2PT5A 2P67A 2QEQA 3QOFA 1M74A 3OIYA 3C14C 4GOKA 2ZRKA 3TUIC 2I1VB 1KNQA 3PCRB 2FDCA 2VA8A 5DGXA 1IONA 1TU3A 2JLQA 4LJ8A 4F92B 2AWOA 2FGKA 1QVAA 5FBQB 4ZCMA 2MSEB 2XB4A 3D3QA 1J90A 5LPNA 3C5HA 2JIZA 2ASEA 1VYVA 2Z43A 5HKKA 5CJ2A 2Q9CA 3CUEF 4RFSA 1BO6A 3KJHA 1YU9A 3NBYC 3RS4A 2VHUA 3PG5A 1TF5A 4LSGA 3EX7C 3U4QA 3T1OA 5LDDC 1CS4C 4BZQA 3UIEA 5GJVC 1E2MA 5JBQA 2WKPA 4TTRA 1HQYE 1MABA 2ZR9A 4TLBA 4JLVA 2YC4C 1E9EA 4LBWA 4YLGA 3ZVNA 3CRVA 3PV0A 2IW3A 4A0HA 2OESA 5IRCD 2WIBA 2O8EA 4BLOA 3AF4A 2IEYA 1L2TA 2REXB 1GL9B 4MKHA 1G9XA 4RD4A 2J9RA 1ZU4A 3P4YA 3KTAA 2XSZA 1ESNA 4FWIB 1E6CA 2FPKA 2YINC 1Z3IX 5J47A 2XNDD 3W90A 2C78A 2HF9A 2OM2A 2JATA 2O0HA 1V5WA 4IDQA 1E2KA 5L3QB 4R71A 3K9GA 1KDTA 4IDNA 1A2BA 3NBFA 3AKEA 1II8B 1CR4A 1P60A 3QE0A 1E1RD 4QC2A 1OIXA 1T91A 4RD0A 1C1YA 4O0MA 4FI3C 2KB0A 5BQ5A 4ILEA 2OBMA 5AJXA 4OK6A 1AQYA 3KXKA 1FP6A 4B6EA 2ZAOA 1MR3F 1H65A 4W7SA 5EXTA 4F4IA 1ZVQA 4RSGA 2JASA 2XX3A 4PSVA 2GF9A 2N42A 3NIBA 1OT3A 1YZQA 4A2PA 4OBEA 4NH0A 2DB3A 4B44A 3X1DA 2P6UA 2ZUDA 1U2RA 4C7OA 4HLUA 1W4AA 1OXUA 1CR2A 4URVR 2BWJA 1LV7A 1P4SA 3U3JA 4E5UA 4AYTA 3A4LA 3W5JA 4DVGA 3MMPA 4JYBA 3AP1A 4MITA 2D74A 3W8RA 4LCBA 1F2TB 2X19A 3VR6A 3NHAA 3I5XA 2GCPA 2BKUA 3Q72A 3AQ4A 4QNMA 1C9KA 2BIFA 2P2LA 2VPPA 3LX8A 3WHLA 4W9MC 1XZPA 1XEWX 4PC3A 4JMPA 1QF9A 4EFMA 1QHHA 3L0IB 3B9QA 4MQBA 1KI1A 3WRYC 1BS1A 3O8BA 4Q9LA 4HZUA 3CBQA 2CCKA 4KYUA 1P2UA 1QHIA 1YZUA 3UG6A 1W0KA 3B1ZA 3QVVA 2F1RA 1SXJD 2VQSA 1XBTA 2QPOA 2W2VA 4PPGA 3ZS8A 3BAFA 1Q21A 3M6AA 2AKAB 3LV8A 4Q4AA 4M1MA 3EPLA 4GT1A 1TU4A 2HXYA 4MH0R 1HT1E 3DL0A 1VPLA 4D82A 2DFNA 1XCPA 1XD2A 4RZ2A 3X2SA 1RRCA 4BLPA 1E0KA 2CL0X 2X8AA 1QHYA 4DCVA 3GJ7A 1IN7A 4JKYA 3WNCA 4DDTA 3A1WA 5CLQA 2REOA 4HDQB 5C2JB 5J4KA 3THYA 3RS5A 3TGPA 3M1IA 1JR3D 1X6VA 4GZLA 2D7CA 2ZR0A 1GKIA 1IXZA 2ZROA 3BFVA 1DARA 1SZPA 4K81B 2XITA 1IY2A 1KMHA 3QY0A 5AWFC 3ADBA 2QM7A 2HCBA 4JLDA 2NPIA 4YXWD 4LBZA 1M7GA 1W47A 1DVRA 5EE3A 2GAOA 1EWRA 5FPSA 3SBEA 2Q9BA 4BLQA 3GFPA 2IX3A 2ZE6A 4U02A 5HTKA 4Q1AA 1KO4A 2G1KA 4HAWA 1CR1A 1OFIA 4LC1A 2DFLA 1KO8A 4CF7A 4N0DA 1XNJA 1XTRA 3QKUA 2C5LA 4B3FX 2N46A 1NG9A 2XXAA 2PMDA 2AKYA 1EFUA 2W83A 3FPAA 4KSBA 3K9LA 2GZAA 4TL8A 2P6NA 4A8JA 5CIQA 4MGYR 5FPKA 1UADA 4HI0E 3FGNA 4AK9A 3MLEA 2CLSA 1PUIA 4GL2A 4KO8A 1XPUA 2YYZA 4Q48A 1COWD 2H17A 3A1VA 4POAA 4PR0A 1UKEA 1EX6A 2JJ8A 5EE9A 3D7MA 3VR1A 2Q6TA 2OILA 4W5JA 4QJ5A 1SXJA 2XNSA 3K0AA 1XFAA 2G9NA 5F9HA 3FMOB 4YC7A 3CONA 1J70A 2EYUA 2QBYB 2O8CA 1G5TA 1NVXQ 2IYVA 1N2CE 1U99A 4HAXA 3HYRA 1OYYA 3AUXA 4KBFA 1ZC3A 3PFIA 2OXCA 3QEJA 5FTLA 5E4FA 1X1SA 2RAPA 1XTKA 2F43A 3VAAA 1G21E 3IQXA 2XEXA 2C98A 1SXJE 5JHHB 4RKEA 5DLQC 5FFMA 1UFQA 3RYTC 1JR3A 3SFVA 4BRWA 5EJEA 2JLVA 3PQCA 1ELOA 1E2GA 1MO6A 3UMFA 1HURA 1RYHA 4DDUA 1CP2A 3U3MA 4DSNA 2QENA 1NSTA 4O25A 4QBGB 2AXNA 5KUTA 4Q19A 1TF2A 4YXWA 2QP4A 4BFUA 1UBGA 1VDZA 2D4HA 3K9HA 3KKNA 3L8ZA 1AIPA 3PVSA 4B2PA 1W44A 3KKQA 2Z83A 5KSPA 1IJFA 2Q3MA 1A2KC 3GFOA 4LJ7A 4KBGA 4E22A 1EFTA 4NYJR 5DI3B 3SEAA 4IJMA 5JMTA 2EU8A 2HYDA 1WXQA 4XSHA 4JLBA 3BC1A 4DLRA 1KOFA 4R9UC 2O8BA 2HJGA 4I81A 3SZRA 3ZS9A 4NU0A 4N0EA 2VP4A 4GSYA 4B34A 4NCHA 5FUWA 3OIUA 4GMXA 2UZ3A 1COWA 2E87A 3MFYA 2NQ2C 3CH5A 1Z28A 1JJVA 4M1OA 2CHGA 2HCJB 2IYYA 5D3MA 1VG0B 3W8NA 4JZKA 1G18A 1E3MA 4FMDB 3CR7A 3W6NA 5LB2A 4B3XA 3PJRA 2ZRIA 4NL4H 3A1SA 1OFHA 3RABA 1N5KA 2IXFA 2G88A 3MWKA 2ODNA 2IF0A 5G41A 1NMXA 1DAKA 4V0MA 1SHKA 2I3BA 2RGDA 4JLNA 1QG4A 3AF2A 2FG5A 1Z6GA 4WXRA 4EPVA 4M9ZA 4NMMA 2REBA 2HYIC 1U8AA 4OQMA 3U4QB 4GZMA 2V9PA 4OHYA 3PIRA 1HE1C 1X1RA 1L4YA 3JZAA 4CT4B 4M9SA 1T0JB 4HLUC 1E9RA 1NIPA 6Q21A 5AJVB 2FSHA 4I1OA 1OKKA 3CRMA 1XZQA 1NVVQ 1R0ZA 1Z8FA 1U0HC 4DLWA 4LGMA 3WP0A 4XVRA 4V0ME 5E95A 2OCPA 2XJ4A 4B75A 4DLYA 1N6RA 1Z2CA 5D3QA 1E2PA 5B58C 4HAYA 3U7GA 1XJQA 5CDFA 3KQNA 1W4CA 3G5UA 4UQOA 1JECA 3BB3A 4LHWA 1DOAA 1US8A 5KHOC 1E99A 1NN3A 2GJKA 2XTZA 3UWOA 3THWA 1ZCAA 4R2IA 3QPUA 1HTWA 1GNPA 2PCJA 521PA 4U5XA 2EYQA 3PUXA 4M4SA 4QGAA 1N6PA 3CZQA 1NN1A 4DXAA 1UBFA 4MGZR 2GESA 2G6BA 3BH7A 3QNUA 3JVUA 2CCGA 2F55A 1AGPA 2D06A 4A15A 4HB3A 4FMBB 2BOVA 2ZI9A 4CEHA 2PJRA 2GXQA 1VTKA 1W0JA 5TARA 1JQLB 2H1LA 2VHJA 4Q1EA 3E1SA 4P4TA 2FFHA 5F2EA 4A92A 1NNEA 4TN1A 2QPTA 1NL3A 3Q9LA 5LD2C 3DM9B 4JIMA 3KJGA 1TTTA 3T1TA 1NRJB 3B1YA 5CIWA 1R0WA 3LFUA 4FMCB 4HAUA 4BLSA 4AG5A 1YJ5A 1Z47A 1YR7A 4ACAA 1XU4A 1OXVA 4LJ6A 5HR5A 4LWZA 3AVVA 1QHGA 2QG6A 3F3YA 2OAQ1 4UNQA 1TEVA 2AD1A 1HUQA 2YWHA 2ZSEA 1VIAA 1ETUA 4PHFA 1FFHA 4URUR 1GDDA 2HV8A 2C04A 5AUNB 4Q00A 2G1JA 4QRHA 4TYNA 3VNUA 2QGZA 1E4VA 5HPYB 4TLAA 3EZ2A 3LO5A 1G3QA 4DB2A 2YOHA 4M1TA 3C41J 3BOSA 2DWQA 1JNYA 4CW7A 1KJWA 2WHXA 1XTIA 3Q7QA 4C0BA 2GCOA 1NKTA 3NEJA 5B30A 4EJSC 2D2FA 4OL0A 1KZGB 3QSYA 1J8MF 2ZRGA 4A8JC 4D25A 3IGFA 621PA 1XJCA 2FJUA 3P1JA 4XTCS 2ZYVX 2G83A 3U7EB 3WBKA 3UG7A 5FTKA 5CYPA 3HYTA 5BN4A 2AK3A 4TWZA 2BBTA 4MYTA 5JRZA 2GCNA 4A2WA 5H68A 4TT3D 4IKEA 2XTMA 1SXJC 4Z51A 2VRWA 5J4HA 1W49A 3THXA 1LS1A 2OLKA 2GDJA 4MUBA 4XWAA 4ZKEA 1DADA 3N2EA 4M9XA 5AR1A 2O8DB 4DRZA 1KK3A 4PC6A 4TTQA 1KJZA 5A5GA 1F2UB 2VP9A 1WCV1 1O87A 4HAVA 1JI0A 1EK0A 1KSFX 3PXGA 4NE2A 2AN9A 1N6NA 2RH5A 3FOZA 4LK2A 2FV8A 1YZKA 3ADKA 3EC2A 1CJUC 3PUVA 4N1AA 3VKWA 1XMIA 3BIFA 2CLDX 2ZI4A 4WAUA 5C46F 4O2RA 3ADCA 3LVQE 5JRJA 4TYQA 2ZEJA 5J5CA 2R6FA 3WRXC 2LKDA 1PLKA 4I99A 2IXEA 4LDJA 1ZC4A 3GLHA 2CVFA 2WVJA 3FWYA 3J81k 2QAJA 2DR3A 4YMVA 2FZ4A 3L8YA 3KJEA 2ZJ2A 3UWKA 2XXAB 4TQUS 4RKFA 4NYMQ 4RD6A 3PUZA 1TX4B 3FE2A 4LRWA 4L15A 4RZUA 1FNMA 3W3ZB 4DT1A 1MO3A 1P9WA 3QQ5A 1QHNA 1NP6A 2Q21A 4NCNA 3TQFA 1VECA 1J8YF 3S1AB 1XD8A 1GKUB 1WA5A 2WJYA 3DKPA 4LBYA 3HJNA 3TVDA 3ZVLA 2CL6X 3GJ0A 4F4CA 3B8HA 3OIVA 2R6DA 5TV2A 3QF7A 4Q1FA 1P2SA 1XF9A 3NWJA 5EE1A 4BFXA 1BH2A 2WAXA 4BFZA 1GVNB 5IHPA 1ZP6A 4LC0A 4DCUA 2WWYA 1UAAA 2CLCX 2QQEA 1Z0AA 3VHLB 1IJEA 2WZQA 2W58A 3U3RA 3T12A 2GILA 3B85A 4WW0A 4BWYA 1IQPA 1KAGA 4WIAA 1AGRA 1AZSC 2F43B 2W6ID 2YOFA 1DAGA 1H8HD 2R6AA 5J4LA 3LBNA 3NH9A 1NJFA 4ZV4A 5C18A 1EESA 4URZR 1G1MA 4QXAA 4UJ3A 4KFRA 5JZVA 3F8TA 4PQYA 5FTMA 4ESVA 2YV5A 2KWIA 1H8EA 1E2QA 4TL9A 4TZ6A 3T5GA 3CRQA 5BN5A 4TTPA 1Q22A 2TMKA 3NEYA 1G6HA 4LPKA 3QF4A 8OHMA 3KX2A 3B82A 1N5LA 2DCUA 3D6TB 1A5TA 2XAUA 4IFEA 2CE7A 3H1TA 1N25A 4BQSA 3FMFA 2WAYA 4MRRA 4OQXA 1V43A 4BEJA 2ZSBA 4OHXA 1G3IA 3B7GA 5FOXA 1F6BA 2D7DA 3H4MA 3ZLJA 3Q7PA 4XD7D 1N6LA 1SVOA 1DG1G 5JLJA 4Q9IA 4KFUA 4PSKA 5E7IA 3KJIA 1AKYA 1KK2A 3BWDD 4GOJA 2JLZA 4E07A 2A2ZA 1JAIA 2GBLC 1U9IA 4TLDA 1E1QD 2ORVA 1NJGA 2VSFA 1E0SA 2QTFA 5JSZA 1XP8A 2EFEB 1KO5A 5FTNA 4DSUA 3KQLA 3OEED 1OB5A 2ZRLA 3OZXA 4KSCA 3IBGA 1Q20A 2OXRA 2ZRMA 3OF5A 4GDFA 1LF0A 2ZVPX 3MCAA 1FTNA 1T4GA 3GJXC 4HAZA 3LH5A 3LXRA 4GMDA 2XZPA 1R0XA 5TXGA 4HATA 1E0JA 4QHSA 4Q4JA 1HT2E 4B48A 1U8YA 4LYHA 3TBKA 4OJQA 1FP7A 4B3DA 4C9BA 1KY3A 1QVRA 2FSFA 1H8HA 1GG2A 2A5GA 1S1MA 1IY1A 2ANBA 3PENA 2EFGA 3QI2A 2WJIA 4EPYA 1GM5A 1Q1EA 3ZYCA 3TK1A 2IUSA 1WP9A 4KODA 4Q4HA 5DO9A 3TLXA 1DAMA 3E5HA 2H57A 2J0UB 3MGCA 2ZXUA 1UJ2A 4EKDA 4JLAA 2MMGA 4LJAA 2QMUA 2YWEA 4DUGD 4DWJA 3TAUA 4QL3A 4TL7A 4D0GA 3RVBA 5FBVB 5J40A 1CIPA 4EFNA 4LZZA 1KI7A 3CO5A 3ADDA 3DMDA 3I8XA 4QJ4A 4YDHB 3KQHA 3W34A 3FHTA 1XEXB 1T3SA 4GRAA 4A82A 3THWB 3B5JA 4JL5A 2Q3FA 4EPWA 2NO6A 2XSZD 3QIAA 1IM2A 4XJXA 4DLXA 3LY5A 4XD7A 3RRYA 2QY9A 4LOAA 1WBDA 4FD2A 1Y3AA 1VIYA 2PX0A 3IUYA 2RGGA 2ZE8A 4ZIRB 1G7SA 4W5HA 2BBWA 1E1QA 1W4RA 3DVLA 4CEHB 3THOA 2K5UA 1UKYA 2Z4RA 3OEEA 3M4YA 4Q7JB 2QNRA 5CLLA 4LV5B 1KNXA 4V0NA 1NMZA 1WB9A 2R44A 3GLFA 1L8QA 2D3WA 2IEZA 3EA5A 1W7AA 2VLIA 3BXZA 5EZ6B 3CX6A 3FFBA 3LW8A 1UEIA 2Z6VA 4Z8XA 4LYAA 4PO8A 2DYKA 4DEXA 1XJ0A 2V6IA 1ZBDA 3KQUA 4AG6A 4HB4A 1IXSB 4LHZA 2EW1A 2OBLA 2A78A 3UANA 4U7DA 2FPLA 4Q01A 1GZSA 5SZHB 1PV4A 3IIKA 1ZM2A 3GLFE 4IVQA 3GPLA 2L0XA 1E96A 1LFDB 2QRNA 3H84A 2F3TA 3IKJA 4TMVA 4US1R 2WWHA 4V0LA 3TQCA 4LJ4A 4F38A 4DUGA 2IF2A 2PLFA 3SHFA 1G41A 1G4UR 1D5CA 2QMOA 5JWOA 2ECKA 3QKSA 1E2EA 2H8KA 4UXJA 1G20E 3QUSA 1OYWA 3K0FA 4CGZA 2ORWA 2W2TA 2A5JA 4B3BA 1G3UA 3NDPA 4Q18A 5M04A 1AZTA 2QAGC 1S3GA 3RHFA 3GJ5A 3QPVA 1KI6A 5HCIA 2ZRNA 1W0KD 4DEYA 3WBJA 4PHHA 3AKCA 1E98A 3K1JA 2F3RA 3KB2A 3A4MA 3SJCA 3DZ8A 1CJMA 2W0SA 2XTNA 1PLJA 4CEJA 1O3YA 2ZYWX 4LHVA 3ZVRA 1JR6A 1OH5A 3L82B 3EASA 2GXAA 2IUUA 2FA9A 1M1YE 1YE8A 4O2LA 1PZNA 1P9NA 3AV0B 1P7CA 1ZIOA 2ERXA 2ZREA 4MDEA 2QSZA 1LS6A 4G3XA 3CR8A 1T8UA 2GEVA 5BW8A 1OXXK 5TVKA 2FFBA 2NO1A 1MO4A 4JBXA 4RVCA 1KI9A 1XCMA 4GOXA 3RS0A 4JVLA 4IRUB 3TNFA 1OFTA 2OFWA 3SJZA 2XB2A 1RRPA 3EIQA 4P4UA 4B35A 1K5GA 3QPWA 3GLIE 1C4OA 3AKDA 2P5TB 2QSYA 4C0KA 2B21A 4XVUA 4I1VA 4Q47A 1FX0A 3GLHB 3A36A 3MWYW 1EX7A 5TY0A 3P20A 2V54A 1Z06A 3LX5A 3TJZA 2QT1A 5A4JA 3RNLA 4EPTA 4ZI2A 1G5PA 3CNNA 4AURA 3K0SA 3AGQA 3AM1A 4ARZA 1S96A 1YZTA 1Z63A 1W5TA 4BASA 2RHMA 3T06B 4CIDA 2OUKA 2IC5A 2NOAA 2OCBA 4GPTA 4IOLA 5FOVA 4OHWA 2QUZA 3QXCA 4C2TA 4UXIA 1WRBA 1KI2A 3VX4A 4MGIR 2D2EA 2ZETA 1N5JA 2RGCA 5JWHA 3KKMA 3MD0A 3T61A 4Z54A 2J3EA 4OK5A 4C0LA 2NO7A 2AFIE 1U9IC 3EPHA 2HLDD 2HUPA 4LY6A 5FR2A 4Y0AA 1KDRA 3EXAA 1KI3A 1N0UA 1ZUHA 2IS4A 4US0R 1II0A 3R7WA 2GAAA 2NO9A 2RMKA 1NIJA 1R5NA 1DO0A 2VO1A 4D6PA 4CDGA 2OEPA 1YR9A 3I4LA 4D2IA 2JLWA 2JLXA 5DN6D 2WICA 1GAJA 3HU3A 1YQTA 2I1QA 2KE5A 1FW6A 1P75A 1ZM3A 2FFQA 4A2QA 3LW7A 2JGNA 1MRNA 1Q3TA 2QZ4A 1EWQA 1N6OA 2QGNA 3EWSA 1YRBA 1RYFA 2MSDB 3SC3A 4YMSA 2FF7A 2OCAA 4D0LB 3ZVMA 1MV5A 4AKGA 1PJRA 2ZI6A 4A6PA 2IS6A 5EQTA 4B71A 1G8GA 3GLGE 3CNOA 4EFLA 1R8SA 721PA 3KZ1E 4I4LA 3VU9A 3Q85A 3Q8XB 1U0LA 4PZZA 2FE4A 3ZQJA 3L0SA 4P0TA 3ASYA 2YHSA 2GNOA 1RIFA 2GETA 5FOSA 5DSZA 3KFXA 4ZDKA 3SJBA 4EJSA 4URXR 4IW3B 3V4FA 1D2EA 1XTJA 2ZS9A 3HP1A 5B2ZA 2YOGA 1KJYA 3RS3A 2X77A 2CL7X 1P62B 5JSZB 4IXMA 1Z6XA 1E79D 1J2JA 1TUEA 3K70C 2F6RA 4TYWA 1E94E 1XXHE 2XJ9A 2J46A 4ZCLA 4JLKA 3CNLA 1VCIA 5CM8B 3GQBA 2Y8EA 4P31A 2GXUA 2HLDA 4EDHA 2W0MA 3RRMA 4UNNA 2ZJ5A 1WE2A 1W2GA 4RD1A 2ZRFA 4Z8YA 3TIFA 1SVMA 5G3ZA 2CJWA 3EA0A 1TAGA 1UM8A 3DKVA 5KDDA 2OBNA 2X1VA 3A6PC 1P3JA 4Q4HB 5EP1A 5DN6A 4ABYA 2H7VA 1FPMA 2ZJAA 2ZVQX 2C99A 3RRZA 3IBYA 3BERA 3WMFA 4QM6A 2QL6A 4RCZA 1OKKD 3QENA 1SKYE 3I3SR 1CBUA 1E2LA 3GEEA 3O8DA 1J99A 1R10A 1W48A 1NY5A 2BJVA 1VCOA 1Z07A 5EP4A 1HEIA 3GJ4A 5GADl 4C0SA 1YVDA 2ZYTX 1T6NA 4Q7LA 5JFGA 4KV9A 1GWNA 2FNAA 3QKRA 3UKDA 5F98A 1AS2A 3KB1A 3N5CA 3CB4A 2CBZA 2ZI5A 2ZJZA 4R7ZA 5LBIA 2GF0A 3QXHA 3VR3A 1DO2A 1UKZA 1GRRA 5LB4A 5HZKA 3U7HB 4FMDF 2KBFA 3A4NA 3QKTA 3TUZC 4G5OA 2QRZA 2J7PD 1XMVA 3KL4A 4EPRA 1KIMA 4TYYA 1RJ9A 3GJ8A 3VNVA 2BDTA 1ZW6A 4QGHA 1JXOA 1E79A 4PTLA 1W0JD 4KFSA 1NLZA 4Z1MD 2OLJA 1OFUX 3QBVA 1G16A 3RDPA 2CHQA 1TNDA 1T5LA 1XX6A 1ZMXA 5EXXA 1Z6YA 1QHXA 2BM1A 2EVWX 2GXSA 4A4DA 4AI6A 4NYJQ 5JS8A 1BYUA 3MJHA 5CK4A 2B7BA 4MYHA 2WWGA 4BRUA 3LQRA 2WJGA 1CULC 3TSOA 1CTQA 4RFSB 3GCGA 3K09A 4WZBE 4C0QC 1EFRA 2ZS8A 4CVNA 2YJTD 1FQKA 1L7VC 3AB3A 1ONBA 1IHUA 3F0TA 2VIIA 2EFCB 1EGAA 2ONJA 3NVAA 1NVUQ 4IDHA 4FCWA 4BFTA 2YWFA 3SE0A 2CHVA 2ZRHA 2WJJA 2C03A 4I1UA 4MRSA 4URYR 4DLSA 5DNYB 3L0PA 5JS7A 1E32A 1MABB 1VHLA 2ERYA 2WWXA 4RD3A 3TE6A 3RS2A 4DDVA 2XZOA 3AF1A 3AVQA 4V0KA 1GP2A 1S4QA 2QI9C 2O8EB 3I73A 2FH5B 2R6CA 3IEUA 1BMFA 3OFND 1F48A 4S35A 3B1WA 3PEVA 1YZGA 2IL1A 1KI6B 3UK6A 3ZZTA 1G8FA 3KTAB 1NG1A 5FOWA 3MWJA 4TZ0A 2QTHA 2ZQ5A 1FTSA 1TUIA 2GBLA 3CZPA 4D4LA 4PQFA 5FPYA 1F3OA 1G291 2BEKA 3TH5A 2IT1A 2J7PA 5C4MA 4BLRA 4HLDA 3CLVA 2ZM5A 3AVTA 1LVGA 3NC1C 4DKXA 4F4JA 2AD5A 1EG7A 1KZ7B 2ZE7A 4ZDWA 4FMCF 4BLTA 2FPMA 1F60A 4AKHA 2ZUBA 5FBWB 5G53C 1UEJA 2R6GA 2IYSA 4B3GA 1XEWY 3FTQA 3TR0A 4Z1MA 3LLUA 1KHTA 2BHRA 2ZSFA 1T5IA 1FUUA 4L4UA 5AK0A 1E2NA 4QOSA 3PITA 3O8RA 3AVPA 1E2FA 1D2MA 4P4SA 1FUKA 2GEUA 2Q0HA 2GZDA 4NKRA 3SHWA 3V00A 2RGBA 1N0VC 4NHOA 1GL6A 1HY3A 1FMLA 2QU8A 2ZI7A 3LNCA 4C7OB 2J7KA 2IYRA 2P65A 1DAEA 4I1SA 4O3MA 2C2HA 3UXMA 4H9GA 3BFKA 2BBSA 2YKGA 3JZMA 1VG1A 1XCGB 2PMKA 1GOTA 1P2VA 1G17A 2KI5A 3EPJA 4FIDA 3KFVA 1R5OA 2PLRA 4QG7A 1A82A 5BWMA 3VKHA 4U00A 1XEFA 1NI3A 2QMHA 3JVVA 4LJYA 1D6JA 2C96A 2JCSA 2RCNA 3BB4A 3OIWA 4A6XA 3D31A 1ZCBA 2DFKB 4MUAA 2BBOA 1R0YA 1ZAKA 5KDOA 5K8LA 3EWAA 1QHHB 4RJLA 2ZUCA 2EQBA 3FDIA 2QORA 1E69A 1KO1A 3B60A 3LA6A 3OFNA 3HWSA 4HLQB 1TQ2A 2VL7A 4HZUB 1S3SA 5CYOA 5HE9A 2XGJA 5JJKA 3KXIA 1T3HA 2Q9AA 1DS6A 1J7KA 2JJ2D 3ND8A 1X8JA 1ZD1A 2FZLA 4E09A 4M1KA 3RLFA 4JL6A 3W5IA 3IHWA 4IOMA 4Q4AB 2G0NA 1G8YA 3WY9A 4X8LA 4NCKA 5LD2B 5HE8A 1GIAA 1M7HA 1XD2B 2OE2A 1M6NA 4GP6A 4JVMA 1DELA 4M22A 2OAP1 3U2QA 821PA 1AKEA 1M8PA 4GI7A 1KGDA 3KUDA 4YMUA 2ZJBA 3C7KA 4P3YA 3TKLA 3THYB 1CRPA 1FNNA 1N0WA 3SS8A 3EIHA 2FGJA 3L43A 3WMEA 3I62A 1S0UA 1TPZA 3TW4A 2YZ2A 1XD9A 3VQTA 3AEZA 2GRJA 4WBSA 5IF9A 1H8ED 1KMHB 1RW4A 2NTYC 1U94A 1VHTA 4HYYA 5L3QA 1G64A 4F91B 4AKIA 2FSGA 1DEKA 2KJQA 2CCJA 4G5RA 4B6FA 3I72A 4IVRA 1II8A 2FWRA 2DWPA 1TQ6A 1YRAA 3TRFA 2BMFA 3NKVA 1IAQA 4UKDA 2WOOA 2NZJA 3VU9B 4AIIA 4M1YA 5EP2A 2CK3D 5FI0B 1RPZA 3B1XA 4NONA 4Q7MB 2VF8A 3RRNA 3TR5A 2CE2X 3LDAA 4EJSB 4FXPA 4V02A 3T1VA 2QAGA 4A8JB 3Q5DA 1FOEB 1Z0IA 5DIFA 2VSXA 3LD9A 1JB1A 3O47A 5KNCA 2WKRA 3N70A 2HJVA 2IYLD 2ZU0C 5B57C 1R2QA 4M21A 3SYKA 4QBFA 2JJ2A 3PEWA 1VMAA 2F7SA 1SXJB 2JJ1A 3LBHA 4TQAA 3G82C 3K0AB 4AKEA 4OHZA 4XVQA 5L3SA 4IOJA 3A8TA 1X8KA 2AL7A 3BGWA 4LV8B 3SN6A 3NBZC 4WXPA 1R7RA 2O8CB 1JJ7A 4OI1A 1G8HA 4A36A 4Q21A 4CRWB 3R9XA 4ON9A 4RFVA 5FBLB 5G3YA 4CZ2A 1SKQA 2V4ZA 3GMTA 1Z0JA 1D2NA 1JEEA 4LJ9A 1E0AA 4FWTA 2Z5FA 4BGDA 2QPAA 3SQWA 1CEEA 3H86A 3SYLA 3BD9A 1T8TA 3K09C 4P33A 1Q1ZA 4J0QA 4ZCIA 2A30A 4Q02A 5IDVA 4PHGA 3HR8A 1TMKA 5FUYA 3EW9A 1IN4A 1MT0A 3DOFA 3WP1B 2RGAA 2AK2A 2MMCA 2PZFA 5IK2D 1SVSA 5EUQB 3P26A 4D4MA 4A0FA 2WWFA 2HF8A 4QGFA 5SZJA 1UBEA 4JS0A 2AFHE 1UDXA 2V1XA 2JLUA 1MO5A 3EZ7A 2CK3A 5DYGA 4DJTA 4DIEA 2ORIA 4KJZA 2WSSA 1G3MA 2O8BB 4MYCA 2GK7A 3C16C 3LWNA 4MKFA 3K70D 4AWXA 4OI4A 2J0SA 1KKMA 1RJ9B 4C2UA 1QZXA 4KCGA 4B32A 1VG9B 3ZJYA 2OFXA 1S9HA 3HPQA 2B92A 1UBCA 2DPXA 4LI0A 4AD8A 4JLOA 1Z22A 3I92A 1ANKA 5D3MB 2F9MA 4BFWA 1GTVA 4PPFA 2CXXA 5E7MA 3AVUA 3I1FA 3QBTA 4II7A 4Q5IA 2NG1A 2ODEA 2QROA 3OAAD 2W00A 1WBBA 2PT7A 2V1UA 1A7JA 1P9RA 3T15A 1DPFA 3MG9A 4FCTA 1K5DA 4NPHA 3O8CA 2QM8A 3CX8A 4BE7B 1ZNXA 3IHLA 1I4LD 2NIPA 3ONWA 2YWGA 1XDBA 1OE0A 2ONKA 4NBSA 4PHTA 5DH9A 3RS7A 3ZZUA 3EC1A 2AWNA 4HLCA 2NPFA 1W36C 1OIWA 3CRRA 3LXXA 3P27A 4KFTA 5ELXA 3D8BA 4X8MA 4IDOA 5EP3A 2BKEA 2GHIA 3VR5A 2SHKA 1ZD8A 5EXPA 3I32A 4YONB 4D81A 5KYKA 4TMTA 2BMDA 3GD7A 3IDQA 1X3SA 5JJIA 3AH8A 2QBYA 3QG5A 1B0UA 1BYIA 4G01B 3C15C 4DBLC 5CB8A 4H1VA 5F3WB 4FN5A 3IPYA 5IK2A 1DAFA 1DAHA 3RSLA 5AUPB 3VMFA 3ZIAA 2OFOA 1US8B 2A5DA 5JEDA 1CJVC 2XOKD 4DLUA 4C0HA 1ZYUA 3WYAA 3LAWA 1CRQA 5AJYA 2OZEA 4ZO4A 3VTKA 3RC8A 4QBIA 3U5ZB 4JBYA 2PJZA 1ZUIA 1UPTA 2KBEA 2V55B 4GBMA 5JWRA 2DWOA 4B76A 5BYKA 1R5BA 2FFAA 5TMPA 1NN5A 2IXGA 1T9HA 2QTVB 2CNWD 4KYIB 4C0AC 5SZKB 4KI0A 4URWR 2HT1A 1G7TA 1DTSA 5L3RA 4WZAE 1IN8A 3K0EA 3N2IA 4HUTA 4CYMA 5DI3A 1KTVA 5JJLA 5JECA 1W46A 1DAIA 2QE7D 3OAAA 1HV8A 4HUQA 5AJZA 4DLVA 1Z83A 3AVYA 1G7RA 5EUMA 1N6KA 1W2HA 3FMPB 1G7CA 4HDCA 4QM7A 2IYXA 2A5YB 3FFAA 1JBKA 5SZIA 4RD2A 3B9PA 3BB1A 1U90A 3DO6A 2PCLA 3CPHA 1D9XA 1NBME 3R9IA 4ESHA 1SULA 4EQ6A 2ZPTX 3FKSA 1RRFA 4DSTA 4UNSA 4TMXA 2EWVA 4M9QA 1KSGA 2ZJ8A 3QVUA 1VYTA 1L4UA 3IIJA 3I5YA 2JLYA 1LW7A 3DMNA 1NSFA 1BOFA 1VKJA 4YMTA 3MUFA 4PQRA 1X8LA 2WMOB 3HU2A 5A0FA 2GCOB 3EPKA 2FN4A 5CITA 4MDFA 1PUJA 2XOKA 4D0NA 2R2AA 1OIVA 4JT2A 3EZ9A 1YHNA 4PC2A 1G4AE 1N5IA 4ACBA 3PR1A 1HA3A 1E2DA 2ZRDA 4OK3A 3PEYA 1GRNA 4G0NA 4S2EA 3GLIA 4JJZA 4LV6A 1OXSC 3THXB 2ZR7A 2CNWA 3B2EA 5FUXA 3MWLA 2R8RA 4DLZA 4EAQA 2OT3B 4L8GA 2WKQA 1JALA 5J4YA 4XSGA 4DB4A 4A1FA 4A0GA 4TMKA 5GJCA 2C9OA 2HDNB 4DZZA 1MKYA 2MSCB 2QE7A 4YMWA 4DCNA 1SQ5A 2BV3A 1ZNYA 4GNKA 2V3CC 2RB4A 4D80A 2OHFA 1HE8B 1SVLA 3IEVA 4PZYA 3FYHA 2ZAMA 4JYCA 1ODFA 2UKDA 1K6MA 2VH5R 1FZQA 5KSZA 3RANA 1KKLA 1HYQA 1Z08A 1Z2AA 4XTRA 1JPJA 4RY2A 3EARA 5BN3A 3T5DA 2ZSAA 3WXMA 3SR0A 2NO0A 3SBDA 3QXXA 3BJIC 1SHZA 4DHEA 2O0KA 2QAGB 1YZLA 4PC1A 3SI7A 3U3KA 3QJYA 1AJEA 4DT1B 4V0OA 3U6BA 2BM0A 4JLMA 2V6JA 4LBVA 1S8FA 2J1LA 4IDPA 5B64A 4TL6A 5L3SB 3K53A 2GEDA 4QKQA 4K8OA 1II9A 3E70C 4G5SA 2ZITA 1BKDR 5CJPA 1S1CA 3BRWD 3RSOA 3AVWA 2ZRCA 1RE0A 4NDZA 4PC7A 2J5XA 2WJHA 1ZINA 2EFHB
chains in the Genus database with same CATH superfamily
1L7PA 4D9EA 4NR0A 2I6TA 2LCFA 1EWVA 2FI1A 3ROQA 2J6BA 1ICIA 3R3ZA 4JUBA 3WAKA 2WJVA 3ZE8A 1XDGA 3C5CA 1EG2A 1I94B 1X15A 5REQA 4BXOA 4CLRB 2NSLA 2O8VA 4X62B 4AP5A 4PFQA 2BGMA 2F2TA 3Q0EA 1NF3A 1WG8A 1ESZA 4ZMSA 2CC2A 2GZ1A 4M0FA 1SR8A 1OX4B 5DDIP 2VHCA 3JRXA 3M2TA 3PT9A 4BZPA 1AKNA 2NU9A 1WPXA 4RM2A 1WHTB 3U3OA 3D9QX 3KKOA 5D5HA 3RUPA 4E3WA 3CO0S 1Y4ZA 1OWPA 4I9GA 3ZDFA 3ZH9B 2LCQA 1JG7A 3TEFA 2VXBA 1E1RA 2AOWA 3OU6A 3MTBA 4FEGA 3ZD6A 1ZUNA 3VKGA 4GEGA 4B2IA 2QLMA 3BJZA 1YO6A 2Z8XA 3HDTA 3VVLA 3KVRA 3WSTA 2O8DA 1Z2NX 1VDMA 2QUKA 5CVUA 1AQLA 2V7QD 1MB0A 3CW2A 2CDNA 1GQ2A 3NHBA 3SQXA 2V0NA 1CUDA 1DCKA 1EXMA 1DHTA 1AGNA 4ERNA 1TEXA 1H94A 3EXFB 4MPPA 1IZYA 2ZQZA 5DFAA 5FA6A 1VE7A 1FXUA 2N3ZA 3B6EA 3FKQA 2Q5QA 2VDNB 3HY6A 4EEZA 3G9ZA 3CKYA 4RTJA 1AH2A 4JI2B 1RYEA 3AY3A 4OI0A 1GZHB 4JQCA 4L3VA 3SHOA 1CJKC 4AYXA 2C07A 4HS4A 2WLSA 2ZE5A 2HPHA 3DHWC 3GRCA 1QVWA 3SF8A 1NXPA 1FP4A 3TMKA 2P68A 1NW7A 3SX4A 5KSYA 3CF0A 5CK5A 3SYNA 3I0MA 3GNSA 4YX9A 2VHVA 4WZ6A 4OUDB 2WQZA 1WD5A 2Z0MA 5FEMA 5JAQA 2IKQA 1DBSA 3ZI7A 2JZNA 4MS4A 4E14A 2XDWA 3OQBA 1Q7EA 3D1LA 4BNWA 3DOEA 1K97A 5IZCA 3LLVA 1IUPA 1L1FA 4E5NA 1N8NA 1Q7CA 2WPDD 2DBYA 5KVQA 1Y6FA 5LP1A 1ESMA 3HP7A 3SM9A 4DA6A 1EM6A 5AD1A 2CV2A 4DV7B 2ZT6A 2I2CA 2Z4SA 1RKBA 2JDIA 2WWVD 4F93B 3VPAA 5M34A 3I2HA 1Z5ZA 4OFWA 4BN5A 1Z0KA 3TD2A 3WK4A 3L7MA 2IY9A 3HU1A 3W3AD 4IFBA 4O1IA 1BE6A 2VHQA 4CQMB 2R8OA 2OHIA 4IGIA 3ZJ5A 4BS9A 3BWMA 1S3FA 1E2IA 4XR4A 3HJBA 2QP9X 3GLUA 3TZHA 1LZKA 4WXYB 5AJWA 2AMVA 5KU1A 2JAQA 3N58A 3R7LA 1TQ8A 3NORA 1BMFD 2PZGA 3UMSA 1ZUWA 3GRYA 1E9AA 5TRTA 4GSLA 3SKXA 1RXVA 2C8VA 4MRMA 4UZFA 3WNDA 3P5SA 1WTAA 1E3WB 2ODBA 4HFNA 3FDJA 2IEAA 2E1PA 1YL6A 4IJVA 3RVJA 4M0KA 2IPXA 4XWOA 2Z2KA 5K2MA 1KEZA 5B55A 2GJAA 3BJRA 4NU8X 2PUEA 2WYWA 2IZ7A 2IQ5A 1NF9A 2QL7A 2UVPA 1KYYA 3P2OA 3UT5A 3ML1A 1JEDA 3O26A 3S29A 1WDWB 1IEVA 3WV5A 3AVOA 3N8IA 5IEJA 1F8GA 2ZR8A 2GO7A 3HCEA 3MGAA 5F35A 5G40A 3H2BA 3UJ6A 5JSQA 1O2DA 1OAKA 5AW6A 3OEWA 4WBNF 5BSWA 1RQPA 2WBLC 2BGNA 2ZYRA 4DPLA 4EIWA 3DDHA 3G2OA 4A2CA 1ZGCA 4MGHA 3H7AA 1U6IA 3ETGA 3MB8A 4L9AA 5D6NA 1V7QA 4R41A 3CX7A 4NQZA 1NJ2A 4X84A 2H65A 2GN9A 4DIUA 3JTEA 2HL6A 3CRNA 2PRIA 1BEZA 4IXNA 3RFCA 3HCOA 2IXDA 4FX2A 2Z2IA 1K8RA 4UHFA 2RKOA 4HDOB 4M1WA 3RASA 4M1SA 2D0DA 3HACA 5C1BA 1KZHA 1X7WA 1MIOB 2ZIAA 5EYPB 1CEYA 2MTBA 3V2UA 4H3KB 3D4IA 2EFYA 4GM1A 1BIFA 3MUOA 4CMAA 4ZKDA 4M0MA 1J9GA 3UXYA 1BU8A 1U9ZA 3NLLA 3N2KB 3IB6A 1RKUA 4AF7A 4B43A 4NXMB 3CUSA 3QXJA 1SD5A 4NATA 4PANA 3H0KA 1RVDA 5C9ZA 3EXIB 1DC6A 1CQPA 4MDHA 2GUGA 4BO0A 2WTUA 3IMFA 2HWKA 4F7DA 5LZ5A 4QHYA 1SZDA 3QKSB 1P72A 4WNCA 4YMGA 2F8SA 4LKOA 1RMYA 3K0FB 3L0OA 1FLVA 2XMRA 5FV7A 3JQ6A 1GT6A 3QVXA 3DL7A 4F4UA 3A1TA 3NHLA 2D1TA 2X3YA 4KR6A 3DMTC 4C4ZA 3OQIB 3Q5EA 4CXMA 1Q7TA 3QVSA 1J5XA 3BH6A 1MH9A 3PQ2A 3BXPA 3PUWA 3RCBA 4X7BA 5GJWC 2ZP1A 5D86A 3RAPR 3AUYA 5JPDA 5JBIA 2PMWB 2CHEA 1PF7E 2A94A 1YBAA 2AC4A 4GR5A 4KOEC 1KK1A 4KLZA 1SVKA 5JXGA 5CB0A 2ZB7A 2ZULA 3F6PA 3F97A 4B4DA 1PNVA 3KYBA 2C9CA 3RV4A 1OA0A 3KT0A 1MH1A 3DZKA 2AMFA 3NPMA 3T9FA 5E6UB 1UANA 1LBQA 3DFKA 3MAGA 1BG6A 1YK1A 4H18A 1XEXA 2Q8QA 5JW6A 1R74A 2QZSA 4GPIB 1P77A 2YXDA 4UHEA 1VL1A 3OZ7A 4AYWA 2HR1A 1QFMA 5BN1A 4OFZA 4OYLA 3HFJA 1ZMTA 4PX9A 5EZYF 2NVUB 4D9CA 1XXLA 4ER0A 5FLXA 3ZWWA 2DFDA 2BRUA 4HWKA 1Z5NA 3F8SA 1V16B 2X2EA 3LVRE 4E12A 1NVDA 1NBOA 4OKSA 5HGJA 2WOJA 3HJTA 2ETXA 3A37A 1Q6ZA 5I51A 1C8LA 3UBTA 1P5HA 4AZSA 5H70A 3ZY4A 4MK4A 1NNI1 4P82A 1OHHD 5K8JB 1GPDG 2O2EA 4XQEA 2F1HA 3AGPA 3UOGA 1C9DB 4MHTA 1VJTA 2DERA 4ARZB 2AFIB 1I8TA 1H1LB 4IHQA 3TZEA 3I45A 2I4IA 4D8YA 1N3BA 1CUYA 2HB6A 4FGKA 4G0UA 1Q12A 4FE7A 4K86A 1U1EA 2F9LA 1U7PA 4AJIA 1FE8A 1PE0A 3F5FA 3ITKA 4EL0A 4Q4LA 4EUSA 3PEFA 2V03A 1WDTA 2K87A 4QOIA 2FPXA 3KXLA 3SQDA 1P0MA 1PK7A 3F1KA 4B5LA 3FFXA 6ADHA 3S5JA 1RD4A 1E1CA 3AR7A 4JI6B 1MOSA 4ROSA 4FFWA 2R25B 3U19A 2Y1LA 2I2WA 4LCJA 3EZFA 5KNDA 4Y6OA 1E8NA 4FCCA 1CKEA 3WYDA 3SZLA 4EB0A 4QJ3A 4CT5A 1E3DA 5J4VA 1XAJA 1O5OA 1EGMB 1SCUB 2ARKA 2PD6A 2WM2A 3V9PA 4BX2A 1K0FA 1KK0A 1ZH4A 4FDUA 4L5AA 3LQKA 5EZSA 4JBNA 5FPHA 2QKYA 3SYMA 5A5EA 1NY6A 1ZUD1 3HNOA 3L7OA 2GPAA 3TD6A 4EMUA 4MJXA 2OXIA 4RO0A 1KVRA 4YJGB 4G1FA 3CRW1 4I8XA 2X2PA 1I7QB 4Q03A 2LWIA 1SHLA 2I2XB 2EGHA 2PX8A 1O6BA 5TEVA 4LQCA 3SIWA 3J81A 1GFIA 2IHNA 1WDKA 1JUDA 2HIMA 3GDOA 3JW8A 3UB2A 5ERGB 3YASA 4DRXA 1YH3A 2DHDA 4IEEA 4ML3A 4XGRA 4DJAA 1KSJA 5HXAA 1VXRA 1MJHA 3N8HA 4UREA 4FKMA 3UICA 4BOYA 1LTHR 2Y93A 1TTTA 1ZHOA 2P9GA 4S1WA 3LDFA 4RE6A 2BHSA 3UVEA 3V1MA 1AUOA 1DIGA 1YAHA 3IO3A 4E03A 5FAXA 3IAM1 4OFXA 2UXDB 4G9GA 2O8FB 2IYUA 1PBTA 1ARZA 3ZWYA 4I9FA 1GU1A 4YVFA 1X7YB 2Q3HA 3B36A 4WFIA 2RI0A 4AF8A 2FOLA 3LRPA 1NUQA 4JK3A 4AQDA 3HWX1 4ETNA 2PUAA 2XT6A 1QRDA 2VKTA 4U7HA 5LU8A 1W85A 4KHZA 2FOXA 5DWDA 4EG1A 5HZHA 2B6HA 2DOKA 3QI7A 3LLMA 4Y7DA 3AF3A 1ZD9A 2IVFA 4KPGA 2DBRA 4J4HA 1A4RA 1GPLA 3EDCA 3G5AA 4JSRA 1G19A 4LNUB 1AZWA 1XWIA 2BE7A 3C8ZA 4BMOB 3L77A 4KQMA 3VPSA 2OOKA 2Q0XA 1R4AA 2VEDA 3IMKA 1TGVA 3TQQA 4BB5A 4XQGA 2VOEA 1W75A 2NZWA 1LSUA 2VBIA 4UCWA 2H5LA 4ARAA 3H6GA 3L0YA 1LDGA 2PIAA 2RARA 3I9KA 3PQFA 4YWJA 3ELYA 4PVCA 1JHUA 1HTTA 3ZDCA 2BFNA 3DTVD 1G6Q1 3BH0A 4UBNA 1M34A 1F2TA 1H4VB 4KVGA 4WGFA 1E63A 2LKCA 2JEYA 3RH0A 1Q3HA 1EFCA 3NDIA 1LK7A 4XGIA 3K9FC 3T35A 1D1TA 4ZU1X 4N8SA 1U81A 3TUJC 4BEWA 2P4UA 1SH7A 1N34B 2QMQA 5DHTA 4Q0MA 4DSOA 3MINA 2PKCA 4KXYA 5JMOA 1KH3A 4M53A 3QVWA 3FJ1A 4DYDA 2K4MA 2Y68A 5TDHA 4D41A 1E5XA 4CM8B 5BUCA 1YA8A 4FW9A 2ETVA 3UUEA 1HQCA 4ASUA 2KQUA 3HI6A 3Q40A 3JAWA 1MD9A 1TQ4A 1C8KA 1TZMA 1H5QA 4L16A 3FGOA 3RGGA 3LLCA 5I9IA 3AP2A 3ZDQA 3WTBA 1JB9A 5I6DA 2BFEB 5AHXA 4Y1RB 1E6EA 1MZPA 1IDOA 1AXEA 3BGIA 3PP8A 3BQNB 3NBXX 4PY2A 2JIQA 4KGXA 1DO8A 2R8BA 4TT3A 3UAXA 4OHRA 2TECE 2FLVA 1ZN9A 2PWZA 5H3HA 1BE1A 2XOEA 2MU1A 3OJXA 3T95A 4AMBA 3ZIAD 5LYJB 1K0UA 2HFKA 4BX8A 4NP6A 1DRKA 2QZ9A 1QRSA 3CWZA 4N0MA 3HCCA 3W6OA 3M4ZA 4UATA 5IJWA 1AO3A 1SG6A 4FGWA 5ALHA 2R5WA 3LA8A 4GWLA 2H18A 4UZEA 3WK5A 3A3KA 2CFOA 4LUCA 3VA7A 1JDVA 2X0KA 3EZ6A 1ZBQA 4DCMA 1UF9A 2OV2A 1U8ZA 2IEGA 1PZXA 3GRUA 3L8DA 5E0OA 5F51A 1NWCA 4D02A 5JXWA 4R9SA 3CM0A 4E1VA 3KVNA 2MR6A 2A9VA 2FR8A 3KZNA 4GHWA 3ZLUA 4EF5A 3U4HA 4LRXA 2GVDC 1LA2A 1NBHA 3IJ5A 4FGUA 5FOTA 1GTMA 5CT5A 3OHMA 1K66A 2GR9A 4MCHA 2J3DA 4DILA 2FRVA 3WRYA 2V98A 2O50A 2CNKA 3HZOA 2X2FA 2JA1A 3CTMA 3AJEA 3C1OA 1M0SA 4E5SA 3D2CA 4PYLA 1C50A 1T9CA 1FSFA 2JD0A 1P73A 3LDHA 3M4JA 4YAUA 3I1JA 3GN2A 4KMSA 3TQSA 1OLUB 1HLPA 2WSMA 1QYCA 3FNRA 4ZCTA 1ONOA 5K8TA 3T5BA 3BBPA 1JT2A 1X1CA 2G4CA 3ENZA 1SPXA 3KAKA 2F1JA 4R8MA 1JH8A 2H63A 1MVNA 3KV3O 4PV7A 3RBVA 3WL4A 5CXUA 4YV2A 1G3RA 3MUNA 1LDEA 5HILA 3O3NB 1NE7A 2E6KA 1NWHA 1JG6A 2A7QA 3P96A 5AJHA 3Q3CA 1E6MA 1KJNA 3FB4A 1FXWA 4Q1BA 4V2UA 5KYTA 3RU2A 1MOZA 5EERA 2W6PA 2HMTA 3T8YA 2CLMB 2PA3A 5D1HA 4HQRA 1W5SA 2O0JA 3NJRA 3P9IA 3EIEA 4RPCA 3GMSA 4GP7A 2PQ0A 4K46A 1LNQA 3U17A 4DEVA 2W6IA 2CYBA 3IVAA 3U44B 2B37A 1GA1A 1Z37A 4UVHA 1UZLA 5JQWA 1PRYA 2WUEA 2DUNA 3JR7A 2OHGA 4ZV9A 4BO8A 3H6KA 2VHTA 3EHEA 1WF3A 1QHSA 4C0JA 4K6OA 1MAAA 3BUSA 1TKRA 5KYYB 4IWNA 1Q1BA 1AOXA 2GZHA 4QBHA 4KZKA 3X43A 1P2FA 3EFEA 2CVHA 1BS2A 2V7WA 3FDZB 3IIMA 4PWZA 5FPTA 5FWXA 3CPEA 5KNBA 1A7AA 1M7BA 4R1PA 1MX1A 1R0RE 1U1DA 1X7ZB 2WMNB 2XXJA 3EYWA 3GCXA 3MCUA 4JGBA 5EQDA 4L9SA 3ORFA 4EHBA 4TLCA 4Z2AA 1U5CA 5CFQA 5ECGC 1RQNA 1KMNA 2D62A 1R6BX 2PUFA 1GITA 1CDDA 1JE0A 2HIHA 1BZYA 5G2OA 2B5WA 1NBMA 3O8OB 3UEOA 1D7AA 1FQJA 1X80B 1PK8A 2BCJQ 1M6VB 4RESA 1IZZA 2JHAA 1MB9A 4INPA 3K0CC 3TX2A 2G5CA 2V7BA 4RCYA 1VI6A 4ZEXA 3UK0A 3VH2A 1DKMA 2PJDA 1U2GA 2Q4OA 2WTNA 2QMYA 4MW1A 2CYAA 1JLLA 4BJ3A 3CPSA 4MW5A 1EFDN 3K9NA 4HNTA 5JALA 1J0BA 3BWCA 1GZ4A 3KUCA 3LX4A 4UBKA 4Y1FA 3B6IA 1C7QA 5GONF 3X1WA 4D9HA 2PT5A 2P67A 3AEQA 1BHJA 3EH1A 4F60A 3WB1A 2V7PA 2VAMA 1M74A 3OIYA 4RAOA 3VYSB 3TAXA 2ZRKA 3ZZ1A 3ZXUB 4TXHA 3ZE6A 4ZICA 3T3GA 3WB2A 1IONA 3TZKA 3NP9A 3KAPA 3U1BA 4F92B 2AWOA 2H11A 3R24A 1J09A 4P5EA 5DEOA 5SYMA 2Z30A 3JQEA 3PDIA 4ITVA 4M83A 3U4CA 5KVVA 1T2FA 1VGRA 5LPNA 5LVAA 3N8KA 5AVJA 4XLLA 2Z43A 4ZODA 2A0YA 2BZ0A 4HXYA 2EZ9A 4HFRA 3JD1A 3NT5A 1U1GA 4PX5A 4C6RA 3H1PA 4CKCB 3KYCB 2VKQA 3LY9A 3ER9A 4XGNA 4LSGA 1TF5A 1KS9A 3EX7C 2ZIVB 5ECYA 2OZKA 1MAHA 5GJVC 3ZEIA 5IASA 5GINE 5BV7A 2XWPA 1PJAA 1JKIA 1ZMBA 2WKPA 3DBRA 3GGPA 3PFFA 4BWFB 4TLBA 2WD8A 4X91A 1E9EA 3H9QA 4ZVRA 1YDGA 4FFMA 4X90A 4R5MA 3TQIA 3ZV6A 4FVTA 5K3CA 4P92A 3E9DA 3GR6A 3I1YA 3NVKI 1IBKB 4UU1A 3PWSA 3SXPA 1QNFA 1B43A 4PCVA 1NVBA 2UZ1A 1B76A 1WXDA 5BOVA 3L4EA 3WNQA 1RI4A 2PT9A 3V4OA 4GLJA 1G9XA 4X1KA 3P4YA 3NVMB 3GUUA 3DWFA 4N5HX 1E6CA 2XNDD 1A9SA 2OM2A 1DWQA 2JATA 4WZZA 1XROA 4ZV7A 3RSZA 3TNDA 4RJJA 1F7UA 3AJRA 4LYGA 1YU6A 5LYYA 4AL4A 4Z4GA 1E2KA 5FYDA 3OCWA 3CZ9A 1KDTA 2V7GA 1ORWA 3AKEA 3P4UA 4Y2HA 3TDMA 2H48A 4FOTA 1CR4A 4IS3A 4D4GA 5CTJA 4S04A 1JYSA 1YJBA 2NU8A 1FLNA 1IZ8A 2B25A 2VBFA 4FI3C 1CUIA 4WLVA 1A8IA 1IAVA 1A27A 1EE9A 2CXSA 1SUCA 5ECWA 1M1NB 4RXUA 3LBYA 5IG2A 3ENKA 4BVKA 4CUKA 1KRWA 1N2SA 5ALGA 2Y1WA 2ZAOA 1CF9A 4NSNA 4IQFA 1H65A 2Q6VA 3MS7A 2OZLA 4W7SA 4NAUA 1I3MA 1U2DC 4N49A 5DM1A 1YZQA 2BDUA 4FM9A 1ZGJA 1MX3A 1TLLA 2FCRA 3R7DA 1CC1S 3K2QA 3IAM6 3FCOA 4WKNA 2XT9A 3QLUA 4C7OA 2I34A 1DDIA 4URVR 1LV7A 1P4SA 4PZCA 4ZYVA 5FULA 3U3JA 4E5UA 4F4FA 3A4LA 4ZYTA 4IXDA 4LOIA 1D4AA 3ROTA 1NQVA 3OHSX 3ZGVA 2CJYA 3AP1A 1WMDA 3LSTA 1B8VA 2QK4A 4LCBA 2F8LA 2X19A 2JI7A 3PC2A 3WL8A 4DM3A 3I5XA 3D8NA 3O2NA 1E4OA 4MP3A 1C9KA 2BIFA 2CXRA 3WHLA 1KR5A 4PC3A 4HDMB 1NYRA 1QF9A 4TZTA 5HDBB 2BYTA 4AJKA 1YT5A 4F6RA 2I1WA 5CX1A 2VT3A 4YP6A 2ZSIA 3OZCA 1CY1A 2JA2A 3G2QA 4MQBA 2P9QA 2DQ4A 4B79A 1MMFB 2ZOSA 4HN4B 3U49A 1BS1A 3Q3VA 2H07A 4HZUA 4CL2A 1WOYA 4KYUA 1QHIA 2AFHB 3NEAA 3P0FA 5AHWA 1A8HA 3GD5A 3C5EA 2COUA 2K2WA 3B1ZA 1WU7A 5T57A 4AFNA 1VGVA 1W8IA 5JH7F 5KYGA 4BAGA 4C4SA 2GYUA 1GEGA 3FZGA 4XRGA 1RPJA 3W9SA 2NSHA 1DSSG 3M6AA 1Q21A 1PNOA 1P1KA 3LV8A 5EN4A 4B81A 3HWRA 2HXYA 3GAAA 4J75A 2OO3A 1JDUA 1I0LA 3DL0A 3QLEA 3OP1A 1XN4A 2DFNA 1T6YA 3KHKA 4MQ6A 1JFTA 2FG6C 1L6IA 5CW2A 1FFXB 1X2BA 4M6WA 1S01A 1QHYA 3I52A 4C22A 3DYVA 2DULA 4G1CA 2VYND 3WNCA 1C1DB 4I50A 5E2BA 4HDQB 1RQXA 5A5FA 5C2JB 4HCJA 4EKEA 2AVDA 2ZBVA 1WQ3A 1X6VA 2OUIA 5DBGA 1J0XO 2OECA 2D7CA 4KQ9A 3ZWMA 1GKIA 1FXWF 3BFVA 3PLNA 1W52X 1VPVA 4NBNA 2ZUTA 4K81B 3E9RA 3T7AA 1QUEA 3ST7A 3HS3A 2PRKA 1EFVB 3QY0A 1ESDA 1R9MA 2PTGA 5GOTA 2QM7A 3X1JA 1HSOA 4G5YA 1L7NA 2XHEA 1G59A 3C7DB 1DVRA 2HK9A 3AI2A 3RR2A 5FPSA 1EWRA 3SBEA 3V1NA 1YKFA 4XIYA 3WRWA 4BLQA 2IX3A 3W7AA 4F4DA 2RHOA 5K0LA 1BVRA 4M0UA 4IJQA 3AI1A 3NWPA 4TX1A 2RCYA 5AM2A 1MAVA 4CF7A 4JUDX 1VRCA 2ID7A 4F9FA 5KNLA 2UZ4A 1GTG1 2C5LA 4WNIA 2CB0A 4KR0A 2RJOA 1O95A 4JR0A 3SD7A 1AF4A 2AKYA 2ADOA 1FRVA 3OWOA 4ZAGA 5TS2A 3NYWA 2AR9A 4OEHA 1HRDA 4TL8A 5H3CA 2Q3BA 5J9FA 4EY5A 1C7IA 2FEWB 3MLEA 2CLSA 4ENWA 5ITZA 3FCSB 3A25A 5I5EA 4AJPA 4NPCA 2PX4A 2Q50A 4Y6RA 5JSFA 3ILYA 3O94A 5HM6A 2PHZA 4UE2A 1O97C 3CLRC 1JBEA 3E9ZA 1C5KA 2RGYA 4WOCA 2O7VA 4QJ5A 2HHLA 1I3NA 3H0EA 4DNPA 4YC7A 1WVMA 2HGZA 1K6JA 1OX5A 1YZHA 2EYUA 1I3KA 2ICAA 3K0KA 2FFJA 5ARCA 1G5TA 2O8CA 4I6JA 4QPJC 2Q5CA 3LE8A 4EX7A 1LDMA 5AVXA 1NVGA 2JFQA 3LPAA 1O77A 2JVJA 1QGYA 4JXXA 4NU6A 1GL3A 4YALA 2IE8A 3RARA 2GTIA 3WLQA 3QEJA 4EQZA 1GTRA 1S8NA 2OCDA 2GNAA 3QFHA 3OWXA 3NYQA 2CJPA 2E4AA 4D3SA 3VAAA 1G21E 1IDN1 3IQXA 2XEXA 1XTVA 4PNPA 3PGMA 4JC4A 1PDWA 1RPAA 1GYRA 1C7JA 1SXJE 4RKEA 3A05A 3D3JA 3G2LA 4TV9F 3RYTC 4CF3A 1Q83A 3H9BA 5EJEA 2WYUA 4WKGA 4X6YA 4DLBA 1MO6A 1VJ0A 3X2EA 2XUAA 3KO8A 5IDQA 2UUBB 2ZAGA 4K26A 2R1VB 4EG0A 2AXNA 1V3VA 3H8JA 3V2IA 3S1SA 4DREA 5HRUA 3AR2A 1MENA 4XX1A 5ALPA 1BVUA 2WSBA 2YX1A 2D4HA 3K9HA 3L8ZA 2DAPA 2QTNA 2GN0A 1AIPA 1ADJA 2GZMA 4JDUA 3PVSA 3VKUA 2EL9A 4AJ9A 4V1CB 1DIHA 4G26A 4V1CI 1G42A 2Q3EA 2QE6A 3FH0A 1IJFA 2Q3MA 3OIGA 2ZAYA 4QDTA 4DVJA 3CUWA 3CZCA 4GXNA 5HA5A 4MEAA 2P91A 3SEAA 1VHJA 2I6GA 5K0BA 3LUBA 2AOUA 2FJPA 5AW7A 4R16A 1XT6A 4EHDA 3QE9Y 1K7SN 2NT3A 4UQPA 5F23A 1UBHS 2VP4A 3O93A 3RTBA 1FDRA 2ISCA 4GSYA 2JFWA 2G8NA 4BKQA 2C8JA 1RTTA 2ZGVA 4B34A 2I7CA 2W71A 4EYKA 5CG2A 3OIUA 3OURA 4GMXA 3ZE1B 1HNXB 2E87A 2WHPA 4EJ6A 2CXOA 2J5QA 1XZDA 4BVEA 4MR7B 1M2HA 3CH5A 3CZ5A 1L4NA 1HRKA 2QLTA 2FPGA 2HCJB 2GD2A 1E7SA 3AEXA 3W8NA 4UPVA 2X0EA 4FMDB 4DR7B 4Q15A 4YT8A 1FVOA 3G2PA 3V8EA 2ADMA 3CEPB 3FRHA 4F5EA 1DBQA 4NL4H 4WCVA 5TQVA 4MYDA 5B12A 3PJRA 1YJXA 2G88A 4I7EA 5G41A 4FDAA 2ZTHA 4R8RA 1LD3A 4V0MA 4XM2A 4LWQA 2OCLA 2X8BA 3TIIA 2QNIA 4WBNB 4YRKA 3BDVA 3PUHA 4EPVA 2Z2JA 3CLKA 2Z9BA 2ROQA 3OZBA 1HF3A 2UYQA 3LKVA 1X13A 2H6EA 5CVJA 3V9AA 4BP9A 2NQ8A 5EJMA 2HYIC 4KQCA 4F5WA 4OHYA 3PIRA 4HRXA 1SOAA 5IWAB 4M9SA 1NLUA 2D3TA 1G0OA 4HGPA 4HLUC 4II3A 2G5PA 1KJJA 3LPLA 3PVZA 4H4EA 3C2QA 4NE9A 2CMFA 5IT0A 1PSWA 1Z8FA 4WY8A 4W5NA 3GQVA 2YHIB 4LGMA 3N6VA 5H9VA 1O6GA 3V7YA 1ENPA 4B75A 5JYBA 2FMFA 4JUFA 2I7DA 3BXHA 4HAYA 3HJUA 4IDFA 3EEBA 3CU5A 2B9VA 3RFXA 3HN6A 3KQNA 2A0XA 3F2IA 1OAAA 4G8CA 1IHPA 4RY8A 1KDVA 5DRTA 1NFRA 2QM3A 5T6MA 5KHOC 3DUFA 1DOAA 1RPNA 1NN3A 4XEHA 4G4IA 1A8UA 5I7AA 1C80A 1ZVJA 1Z2DA 4R2IA 3TSCA 1HTWA 4ZO7A 5I9BA 2XUDA 5BQOA 3TNYA 1GNPA 3IQFA 521PA 1N3LA 4U5XA 3PUXA 3R0VA 3OMXA 3OZUA 3PNMA 3QWHA 4LMPA 4M76B 4W1QA 2C4MA 1JEAA 3S8YA 2YS6A 3DBIA 1ACLA 3ISJA 2J4DA 4XWTA 3SOZA 3JYNA 1EVQA 4Z4FA 2F55A 2EARA 4Y6GB 5HIMA 1GT91 2XVZA 3K1ZA 3K32A 4P2GA 3T9DA 3K16A 2ZI9A 3UK7A 3V33A 4ZJPA 1VTKA 5TARA 3TLJA 4JENA 3EGVA 3WADA 3ZY5A 2DT8A 2OGUA 3AJ8A 2X0FA 1XK7A 2B2NA 1OWNA 1NT4A 3ZWNA 5KIAA 1NNEA 4GOND 4L4ZA 3Q9LA 1HORA 2AQ8A 2BFFB 5LD2C 2W22A 4OF4A 5EGNA 3BAZA 1Q7GA 1YTLA 1EAYA 2RHTA 2Z5LA 1SC6A 4ES6A 5EC8A 1HDIA 4BN4A 5A9SA 1N92A 1NRJB 1QFJA 2XDYA 2BJHA 3LFUA 5CIWA 4HAUA 5EA2A 3ZJTA 3HCBA 2WSYB 3LUHA 2VNSA 1FF9A 1T8SA 1K2WA 5GM1A 1YJ5A 2NYVA 5AW5A 2HEGA 1SXGA 1XU4A 1C1XB 1LBHA 4G63A 4LJ6A 3UJCA 1YK0A 5AI4A 1GCAA 2PUTA 2RHGB 1QHGA 2RBGA 1ZMRA 4WINA 4I50F 2OAQ1 3JQQA 4ZVOA 4QXQA 1HDEA 1ZOLA 3OUZA 2C4NA 1BSVA 2VS1A 4FKBA 3AZOA 2ZSEA 2BSAA 4QYMA 4WY2A 5CA1F 3T5TA 5IS2A 5EZYB 3WJ2A 1OR8A 2VUIB 4PG6A 1NMSA 4Q00A 3JQFA 4NV0A 4QRHA 3T7IA 5J2UF 5U9CA 2WQ7A 3DCNA 1BJRE 3DFZA 3EZ2A 4TLAA 4BXOB 4DB2A 2FPIA 4L8FA 3BOSA 1DPGA 1GQSA 3E22A 4K03A 4CKEA 2B5OA 1DRUA 1RLUA 3D4LA 3SSNA 2JIPA 1KJWA 2WHXA 4H1TA 4Y2UA 5DHPA 3UAYA 1OZ0A 3G23A 4EJSC 4OL0A 2O4CA 3PHCA 4PE5B 4A8JC 1XHLA 2V7UA 1F8UA 3I2KA 1MJ5A 4GP9A 4ID9A 4DZTA 2WSLA 4WY5A 4XTCS 3V3TA 2G9ZA 3U7EB 4OP1A 1E61A 1WKCA 4KACA 3FLBA 2LDBA 2ZSKA 5BN4A 5K3BA 2AK3A 4YAOA 2YV1A 1CERA 1RRMA 4BP3A 4MYTA 4YP5A 5JRZA 2PVSA 4A2WA 1YVUA 2G1PA 3HO1A 1LU9A 5BXYA 2DEUA 3VDRA 4Z51A 1NRIA 2VRWA 3IVRA 3K6KA 4WK2B 5J4HA 3LTEA 3IOEA 4FS3A 5L53A 2XQJA 4D8TA 1VXOA 1OFUA 3N2EA 3T7EA 4OLJA 2O8DB 4PC6A 4LI3X 3QWBA 2QIPA 2A1TR 1HQKA 2OY0A 1UXHA 1Z16A 2D1RA 1D1PA 1KAEA 1CR6A 2AN9A 4IF4A 1CUSA 1N6NA 3NWEA 3VO9A 5KQGA 3QP9A 2HMSA 3FOZA 1RADA 3KLBA 2FV8A 4NJEA 4AG3A 2C2ZA 1BGWA 4JFAA 2GEKA 2C3PA 3BIFA 1CF2O 5TF0A 1VM6A 2OENG 3ADCA 1G98A 3LVQE 4YR7A 2WWRA 2ZEJA 3E7XA 4DQDA 5JRJA 5AM5A 3WRXC 3SF8B 4Z7OB 1FP4B 2P2DA 3QVKA 4KX5A 3KOOA 4UEOA 1IBLB 4HJRA 4HQLA 2QSJA 3L8YA 3IULA 2ZJ2A 3N2GA 4G81A 1H23A 4KE9A 4NYMQ 4RKFA 2RGUA 3BL8A 1TX4B 2QV0A 1IK6A 1LBIA 1TYCA 4MS4B 5DYWA 4WMLA 4ZZIA 3NOOA 5J63A 2I6XA 3H9CA 1CLEA 3OJEA 4E08A 4U2BA 1P9WA 2E18A 3QQ5A 4G1MB 5BYAA 5KB3A 2NZYA 4I1IA 4BMNA 4NCNA 2G25A 2GGSA 2Q4EA 3HBJA 2VPIA 1QIMA 1ZD2P 3AFIA 2HA7A 3DKPA 3EK2A 1HT0A 3PVCA 4LBYA 5CLHA 3TVDA 1N32B 1WUTA 2XUIA 2QJTA 3B8HA 2VDQB 1D2CA 2DQKA 5KTOA 3ZVKA 3DBOB 5JNWA 1RACA 1XV5A 1JHQA 1QV9A 1XF9A 3ZWBA 4UVDA 3MB5A 5EE1A 5IC4A 1XMOB 2HSJA 2QT9A 2CLIB 4P3XA 4LC0A 3GAZA 1ZPDA 4DCUA 2IFTA 2O2CA 1Z0AA 2QQEA 4J0JA 4JEUA 3VHLB 5ALOA 4RL6A 1QQAA 2WZQA 4I5EA 4O0LA 5CJJA 2GILA 1UPAA 3B3JA 3EF0A 4YP0A 4EJMA 3I2YX 3SE7A 4MRMB 1I13A 2YOFA 1P4AA 3F98A 4DN6A 4UEJA 1H8HD 1GXSA 3HQ4O 5J4LA 1HNNA 3PRJA 3PC8C 7REQA 3EIOA 1NJFA 4BDSA 4D9MA 1U0OC 1HWYA 4UJ3A 4ZOLF 2XKKA 3F8TA 4L50A 5FTMA 3UT5B 4DLNA 2CZGA 4C05A 2ZKLA 2L19A 5F5XA 2XA1A 1E2QA 1LGYA 1Q22A 2TMKA 4D3YA 1ODKA 4LPKA 5IKMA 3QF4A 4KQGA 5IVPA 2AJTA 4PZUA 1JQ3A 2BH9A 3RG2A 2DCUA 3CE9A 3F9CA 1NXOA 4Q3NA 1RAEA 2ZZMA 2F00A 4EVQA 3IMCA 4JI8B 1FBTA 2CFSA 2EG9A 2GRAA 4MUGA 3W05A 4BQSA 3CXRA 1NPTO 4E4YA 2O59A 2WAYA 2HRRA 1V43A 1LPPA 3C3DA 4BEJA 2ZSBA 4RTQA 1NDHA 4KDEA 4Y2XA 5DXAA 2FY8A 4HDKA 4LK3A 4OSOA 3MJFA 1H93A 1YRWA 1NFFA 4XD7D 5IM4A 1PV4A 1N6LA 5D51S 2QTCA 1DJLA 1EFKA 4D4IA 1TZBA 2P78A 2QRMA 1EFLA 3PSAA 4PGAA 1KK2A 3ITNA 1YMUA 5IT4A 4E07A 2A2ZA 4TTJA 4WDQA 3E27A 1AE1A 2GBLC 1M2NA 4R3WA 4IMPA 4G65A 3HA2A 3PD0A 4M86A 5JSZA 2OV8A 3LYHA 1KO5A 2ZRLA 1BCSB 2MIIA 4CM7A 2OXRA 4MA0A 1FSSA 1C41A 4V3CA 2GCGA 1I3LA 4HAZA 5KYNA 3KV1A 4G4SO 3VOBA 3EGEA 4C04A 4H59A 1R0XA 4DIKA 5B3KA 4B17A 4XPZA 1MO2A 1E0JA 4R8SA 4EJ0A 3WK8A 4Q4JA 4FFSA 1NQ5A 4ZYYA 2C2BA 1DUIA 1ZONA 2C5AA 1H2YA 2DETA 2V7VA 4PRLA 3FY4A 4ODIA 3BDAA 1P1FA 3NS7A 3COSA 1U8TA 1F12A 1XMPA 1IY1A 4F11A 5K51A 2IUSA 4KODA 5DO9A 5ILQA 1B74A 5TF4A 1ISFA 2WZBA 1L5MA 3F2VA 3HLYA 1H1TA 3P5BA 4UHHA 3OJOA 4B6GA 1KQ3A 4JP5A 1LBTA 1Q77A 3OFKA 4TT8A 3TSYA 2YWEA 5FBVB 4QL3A 4TL7A 1FK8A 3GGCA 2AB0A 5J1SB 3B3GA 3R40A 4JDPA 3PEEA 3FKJA 4CR6A 3D0OA 3DAYA 3ADDA 3DMDA 5DCYA 4PS0A 4KQ6A 2O3JA 2KHZA 2QRKA 5KWSA 1XEXB 5ITSA 4K0RA 3G85A 2BGJA 2QRGA 4P93A 4FQ8A 4GRAA 1FU8A 3LFHA 4TWJA 5LA6A 3T1HB 4AJ2A 2NTEA 2OQIA 2VTVA 4O4JA 2Q3FA 2QTAA 3DQZA 1NHWA 1PFQA 1EHYA 4XJXA 4TRRA 2JBAA 5BO5A 3WKEA 4FNGA 1IQRA 4EKYA 2FZGA 3MXTA 5TPWA 2HO4A 2REQA 4RM3A 4G07A 5BQPA 2VDRB 4XOUA 3MM4A 4F6CA 1CUJA 3THRA 5IJZA 1XG5A 4FD2A 1YBHA 2P9EA 3M1LA 2RGGA 2FKAA 1NRWA 3DV2A 1K27A 1P7PA 4GU5A 1YBMA 4ZVKA 4BP8A 5L7TA 1NUUA 8AT1A 2BBWA 1E1QA 1JQEA 1BKYA 1OT5A 4I55A 4IO0A 4KLRA 2D5IA 3THOA 3TOZA 2K5UA 4MVJH 3ZG6A 1CS0A 4U8HA 4GLLA 4OIMA 1KEKA 2JGDA 4LV5B 3LGXA 1RHJA 3K8OE 4CFSA 3L6CA 5K0JA 1H4SA 2AS0A 2ZRQA 4PAGA