3CPJB

Crystal structure of ypt31 in complex with yeast rab-gdi
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
198
structure length
164
Chain Sequence
b'YDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMGVEFATRTLEIEGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDSKSSSYENCNHWLSELRENADVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALSENVDKAFEELINTIYQKVPTISL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab GDP-dissociation inhibitor
publication title A structural model of the GDP dissociation inhibitor rab membrane extraction mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 50
structure length 164
sequence length 198
ec nomenclature
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cpjB01
1U0JA 2P3SA 3U44B 1OXSC 5FBWB 2F43A 5EP3A 2HLDD 4I1OA 1Z6XA 4ACAA 4POAA 1T8TA 3DEFA 2IUSA 4TLBA 4Q1AA 4CEIA 4A92A 2FPLA 2V7QD 2VHTA 4CGZA 3P27A 1QVRA 1DG3A 1YZGA 2F6RA 3H1TA 1DO2A 2GVZC 3C41J 1O87A 1PV4A 2ZIAA 4FI3C 1CF4A 4QBGB 2JJ2D 4PC6A 1TF2A 1CJKC 1SXJD 521PA 3QKRA 2QTFA 4UXHA 5JCPA 4EQ6A 5JJLA 2Q9CA 1OFTA 1HA3A 1GRRA 3CKLA 4JJKA 2QZ4A 5FPYA 2ZRPA 1JR3D 2O52A 4ZDIA 1P75A 1XTJA 2UZIR 1T5IA 3NBXX 2GDJA 4A2PA 4H1VA 5CIWA 2GCOB 2QA5A 2VO1A 4Q1EA 2QTHA 3T61A 1GVNB 3DM5A 5JHGB 4DB2A 3FMPB 3FYHA 1NI3A 4O2LA 2O8DA 2XOKD 3FKQA 3A4MA 4R71A 1L2TA 2N46A 2GETA 2QMOA 4QJ4A 4XD7A 2GXQA 5DGXA 5IDVA 2ZSEA 1P72A 1CR2A 1IAQA 4Q21A 2WAXA 2DYKA 2RGEA 2ZSDA 3VHXA 3PUZA 2P65A 5E7IA 4M1YA 1P2TA 2WKPA 3H4MA 3FKSA 2QROA 3GFTA 1GTVA 2I1QA 4O0MA 5FL3A 3DOEA 1YR8A 3SYLA 3VMFA 1KO7A 1Q3HA 2KE5A 1FP7A 2OAP1 4WZBE 5FI1B 2ZJ2A 3K9NA 3ZGXA 3KXKA 4EFMA 1UM8A 4HUTA 1Z0AA 3KQLA 4I1SA 1X8LA 1DO0A 2FE4A 4QM7A 3FTQA 1ETUA 3FDIA 1SHKA 1HTWA 5JRJA 2QT1A 4Q00A 1P61B 3JZAA 2PX3A 3GJXC 2QL6A 4CF7A 2FG5A 2IC5A 4CVNA 2AWNA 2IYRA 3H2YA 1JI0A 2VRWA 3E1SA 3NEJA 4HAVA 3CZQA 2HJVA 3RS7A 2WSMA 4NONA 3BE4A 4RCZA 3P4XA 2HF9A 4B43A 2QAJA 3KB2A 1OXTA 4M8NE 3TSWA 3MUFA 4DT1A 4FWTA 3OIYA 3W8NA 2WWFA 4I99A 5L3RA 1SVIA 1D9ZA 3TSZA 4E5UA 5LDDC 2BMEA 4BECA 2WZQA 1WCV1 2HXYA 4PR0A 2GBLA 4Q9LA 3WP1B 2FF7A 1G8PA 2DFLA 4FIDA 3MRSA 1ZU4A 2ZRJA 2GJ8A 3Q3JB 4LPSA 1DBSA 2G1KA 4TMXA 1N5IA 3TRFA 3I61A 1Z3IX 3H84A 4URXR 1EG7A 1Q57A 1HE1C 1G7SA 3CB4A 2EVWX 3ZVRA 4TWZA 4WVFA 3CRMA 2ZRFA 1XRJA 4M9QA 4JVSB 3EC1A 1GOTA 3DDCA 3M1IA 4ESVA 1ONBA 3P1JA 3VNUA 2YWEA 2ZI4A 3FHCB 4B44A 4TYYA 1G19A 1OSNA 3DPUA 2MSEB 2O8FA 3JZMA 3MWLA 3I4LA 2C03A 1NRJB 3I72A 1G5PA 1S9DA 4KLZA 4IFBA 2ZUCA 1FTNA 2GA8A 1MO3A 1BYIA 4A9AA 1US8A 2YHSA 5JBQA 4EUNA 1GUAA 3RSLA 1VCOA 1JPNA 2W6JA 3I92A 3C4JA 2OCPA 2YOHA 4BFTA 4FCWA 1UBEA 1ZUHA 2EWVA 1E2IA 2ZU0C 4KI0A 4MGYR 3WYGA 4WXRA 5B57C 3WY9A 5KDDA 2ZUDA 2PEYA 1TADA 2CXXA 2NO1A 3O47A 1Z8FA 4X8HA 5FOTA 3RRYA 4D0NA 1CR0A 4IVQA 1TNDA 1OXUA 1XTIA 4Q4HA 1W0KA 1A2KC 1W4BA 2FA9A 3MLEA 5CIQA 4US2R 2YNMA 5FOUA 1H8ED 1A5TA 4BFVA 3UWKA 2Z4RA 4R2HA 1RJ9A 1MABB 3IQXA 2Q0HA 2V1UA 2PLFA 1KI3A 1YR9A 4IVRA 3VR1A 1SKYE 1TEVA 1LF5A 5EZ6B 5EQTA 2E9SA 4BWYA 4IFEA 2DHRA 2JEOA 5FOWA 3LQQA 5EXTA 3R9WA 3IO5A 4HZUA 2RMKA 3S1AB 3B60A 3HPQA 1OYYA 3X1XA 3ZS8A 4N1AA 4U7DA 2IS4A 4YQFA 3RABA 4DLUA 3NBFA 1E1RD 3VKGA 1XEXA 4KSCA 3K9HA 4A8JC 4DUGA 3MCAA 3PEVA 5CYOA 1HUQA 2YINC 2O8EA 3X1ZA 1IONA 1S9HA 2IWHA 1FMLA 3DO6A 3FWYA 3QUSA 4OHXA 4V0NA 2FPMA 1G5TA 3C8UA 1KZ7B 4ESHA 5B58C 2ZVQX 3GLIA 4P4TA 4HAXA 1E2DA 4M21A 3EC2A 4PSVA 3EZFA 4FMDF 5L3QB 5AJWA 1N6NA 4PXAA 2Y8EA 5L3VA 3JVVA 1T9HA 4C0KA 1XPOA 1AM4D 2QP9X 1Q1BA 3I8XA 3T15A 4M1WA 1JXMA 1KKLA 5EP4A 2HT6A 1E2QA 2WJVA 1NVWQ 1XXHB 4LSGA 1BO6A 3CR8A 1NKTA 3VAAA 5KSOA 5BYJA 1ZP6A 1FOEB 2GJKA 2QMUA 3SYNA 3REFA 2AX4A 1N6HA 3GP8A 1OIWA 5EUMA 3R9IA 3TW4A 3VQTA 1W36B 4XTCS 3TVDA 4HLCA 3OEHA 2EQBA 3CW2A 2ASEA 4AY2A 2X19A 4V0MA 3E70C 1GRQA 3B13B 1N6IA 2NPFA 2LKCA 2NTYC 4L15A 4S2EA 3QXSA 5CM9C 4B75A 5KUTA 2ZRIA 5DISB 4ARZA 3Q5DA 5BN4A 2ZE7A 3U4QB 4U02A 2W0MA 1Q22A 1KTVA 2B7BA 4P3YA 2GRJA 4YMVA 5DHAA 1Z0DA 3I3SR 4ZKDA 4DLYA 4NP6A 2ZJOA 4KYIB 4R7ZA 3U6KA 1U0LA 1G16A 1NMYA 1VIAA 1G4UR 4QHSA 2BV3A 2IXFA 1DAFA 1TU3A 4GOKA 5KHOC 1P2UA 5A5GA 5CDFE 1R0XA 3T1QA 2O0HA 1SHZA 1AQYA 3K1JA 4Q18A 3U7GA 1XNJA 2QPOA 2XJ9A 4XIGS 4QM6A 4TZ6A 2ZTSA 2HYDA 2OE2A 4L16A 3B9QA 4KXFB 2EWWA 4Q03A 4FN5A 4PO8A 3EZ9A 2I3BA 2V1XA 2HXSA 4N0DA 4URVR 5DSZA 1EX6A 2GK6A 1E0JA 2GCPA 3IQWA 5CLQA 4LBZA 4DLXA 2PZGA 1KI6A 4A82A 2CBZA 1GDDA 2V55B 4TMVA 3B82A 4TTRA 1JR3E 2LWIA 1NMXA 4MKHA 2ZI7A 3W8RA 3PEUA 2P2LA 1D6JA 2Q3HA 3PUYA 4MQBA 1DTSA 4BLQA 5B64A 2ECKA 1BIFA 4G5OA 4L8GA 3L43A 1FQJA 1FUKA 2R6GA 5KOYA 1JB1A 2FPKA 2X77A 121PA 1CU1A 2GEDA 4DC9A 1UFQA 1ZAKA 1IJFA 2VP2A 5FBQB 2VH5R 3V4RA 5HZHA 1XZPA 2XSZA 3L8ZA 2WWWA 2XNDA 3R9XA 4LV8B 4AKIA 3EARA 2PT7A 3RDPA 1W49A 1COWA 1R5NA 1BH2A 3UATA 1E9FA 1YRBA 3GJ4A 3THXB 2QBYB 3QPWA 5BXQC 2OT3B 1DAEA 2FX3A 5JI2E 1OXVA 2PMKA 4D6PA 4D80A 1DAMA 3K09A 1VYUA 4XSGA 4W5WA 4DLSA 3GJ6A 1W36C 2OEPA 3Q85A 1OXXK 1R7RA 2PMDA 3G5UA 4P0TA 1FNNA 4PPFA 1IY0A 1G7CA 1NF3A 3CRW1 1XPRA 4G5GA 1R10A 4PQRA 5AUQA 1IN4A 4HLDA 4OQXA 4TQ9A 4RD2A 4KODA 3SZRA 2ZROA 2CJWA 2XXAB 2IW3A 2O8BA 2BMFA 4NCKA 4LK2A 5FTJA 2CL0X 1QHHA 2NGRA 4ZIRA 2Z43A 4MDFA 4TMKA 3GLHB 1MT0A 1LS6A 2OCBA 4LZZA 3BIFA 5FPHA 5KSPA 2OBLA 4NH0A 1DAIA 2IXGA 5K8IA 5AWFC 1PJRA 5FTKA 4U00A 4PC2A 4KBGA 3I5XA 4F91B 3KKPA 2EFDB 5E95A 2C78A 3WRYC 1AA9A 2V6IA 2R2AA 4K8OA 1WQ1R 4P33A 3P20A 1T6NA 4KVGA 2G77B 4R98A 3RS2A 5JFGA 1QHNA 2PL3A 1HEIA 1ZU5A 1N0WA 2IF0A 1G21E 2FN4A 2PEZA 1XEWX 5EE9A 4BFUA 4AYWA 3EA5A 3EZ7A 4OHVA 5C4MA 1OHHA 5JWHA 3ZQ6A 2GEUA 3NHBA 2C8VA 3F3YA 4U5XA 1JAHA 1RVDA 2OCYC 5P21A 2J9RA 1IN5A 1GAJA 4RY2A 5J4KA 3QVVA 3W5JA 1J8MF 3SEAA 1Z6GA 2XEXA 4XWOA 3AF4A 1OFHA 2ZREA 1VPLA 1WB9A 1B0UA 3J81k 4JVLA 1DEKA 2XTZA 3OHMA 3UANA 5SZHB 1U2RA 1XWIA 4M1OA 3NBZC 2DCUA 5C18A 4YC7A 4G3XA 2JLQA 1CR1A 2QSYA 3PR1A 4TZ0A 4Q7JB 2Q3FA 2WTUA 4WOPA 5JWRA 2QRNA 4WA7A 3CUEF 1K5GA 2D7CA 4JSTA 3WMFA 3AKYA 1G18A 1CIPA 1OIXA 4UNSA 5KSZA 4I1UA 1A7JA 1KGDA 3PG5A 2DR3A 1KI8A 1KI1A 4GNKA 2KBEA 1KDRA 5EP1A 3ZLJA 1M7GA 3BC1A 4BEJA 2H5EA 5LD2B 1F2TA 1E0KA 1KJYA 1X1RA 2JATA 4FCTA 4M4SA 3IIKA 1GIAA 4OK6A 2BOVA 4QHYA 1QHYA 4A0RA 4F93B 4EPYA 1F60A 3MSXA 2WSSD 4FMBB 1ZC4A 2IYUA 2WWHA 3K0AB 4LYAA 5DN6A 3KJGA 1M8PA 4WIAA 2GZAA 3UMRA 1W7AA 2GJ9A 1GNQA 4HYYA 4BFXA 4HB3A 2G1JA 4JS0A 1MH1A 3U3KA 4C7OB 3B6EA 3OESA 1C4OA 4MGIR 5SZJA 3R7WB 4L5BA 5DH9A 4V0KA 4Z1MD 3U7FB 4DDVA 2OCAA 1QRAA 4BRUA 1JR6A 4Q7MB 3C15C 3WHKA 2F1RA 3KQHA 2JLVA 2C9CA 1NIJA 1YR6A 2ERXA 3AVOA 1D5CA 1EFRA 2RGDA 3GEHA 4RD3A 3AVTA 1FPMA 3AVWA 1NBMA 4AD8A 3VFDA 1NKSA 5FI0B 4MRVA 1G9XA 5G41A 1VG8A 2YC4C 3NEYA 1TU4A 3QKSA 2BKUA 4O2RA 1Z08A 1Z28A 4ZI2A 3CF2A 1RYHA 4OHWA 4BLTA 1WDTA 1N2CE 1ZM4A 3RRNA 5JS8A 5CDFA 1E2KA 3QKRB 3M4YA 4URUR 5G40A 2V7QA 1VHLA 1IN8A 4EQ6B 1IN6A 5JS7A 3SU8A 3C16C 1OW3B 4B3FX 3ZVNA 3RC8A 4D25A 3RSOA 4C0SA 2MMGA 3AF0A 3LXXA 4M9ZA 4OL0A 4BFWA 3UIEA 1G8FA 2WWYA 3KKOA 1W36D 1SXJA 5ELXA 2H17A 1AZTA 1RRCA 2OILA 1WA5A 3SQWA 5AK0A 1PLLA 3PUXA 1N0UA 1BMFA 3LBHA 2GXSA 2H7VA 3KQUA 1JR3A 1ZUIA 4WZAE 1Q20A 2NO0A 1FQKA 2W58A 2IBMA 3SBDA 2AL7A 2H92A 1VIYA 1Q3TA 4HLUC 4M2LA 4OJQA 4RKFA 3Q7QA 3CX6A 2FNAA 2E87A 1U8ZA 2WMNB 2XOKA 5CITA 2RGBA 3SJBA 4C3ZA 4C2UA 3FE2A 1Z47A 4GL2A 2W00A 3NH6A 3UWOA 1V5WA 3ADCA 3QEOA 4KVAA 2OFOA 1R0YA 3TW8B 1XJ0A 1XJQA 3IILA 2F9MA 3A4LA 4M1SA 1DPFA 4CEJB 1U98A 1OFUX 2WVJA 4XVRA 1IOZA 2J7PD 4LY6A 1SVOA 4Q19A 2QUZA 1KK1A 4BLSA 2ZM5A 3W6NA 5LD2C 4MRSA 2OSBA 1CKEA 4DDUA 2J41A 1E9SA 3KKQA 2OZEA 5DI3A 3TR0A 3IKJA 1OH8A 4MRRA 2V54A 3LX5A 5K8UA 2FEOA 1NP6A 2MSDB 1N0VC 3CBQA 3CRRA 4C9BA 2IYVA 1IY2A 1KYIA 2QY9A 1KY3A 2OESA 2ZRCA 2V6JA 2JLWA 2BC9A 2OLJA 3DHWC 2K5UA 2QPAA 3KKNA 1KKMA 2NG1A 4TL7A 2EU8A 1EFCA 1U90A 2WIAA 3B9PA 3A1TA 4KYUA 3U6BA 3R8FA 2J0QA 1S96A 4NYMQ 3RS5A 4DT1B 2CLSA 1FX0A 1U8AA 3LNCA 4QOSA 4EJSA 4PQYA 1F48A 3KUDA 3LVQE 5TV2A 2PT5A 4FXPA 1IM2A 3I62A 3RYTC 2AWOA 1D2MA 1LTQA 1CRQA 1KY2A 5DYIA 3AGPA 3HDTA 2D2EA 4HDCA 2P6NA 4BLPA 2ZRLA 3PEYA 3EZ2A 4LV5B 3RS3A 4AYXA 3QOFA 4DSTA 1S1CA 2R9VA 2D62A 1KHTA 2ERYA 4Q1CA 2DFKB 3LVRE 4A0HA 5JCZA 3NC0C 3X2SA 2REOA 4W5HA 3GLIE 3RS4A 3BK7A 2GKSA 3FMOB 4XH9B 4B47A 1P9WA 4KBFA 2O8FB 821PA 3U7HB 2FSIA 2QMEA 2QE7D 3WMGA 1OKKD 3C5CA 4ITRC 2KBFA 2OXCA 3L2OB 5E4FA 5C46F 3LH5A 4PZZA 1YU9A 4LJ9A 3SS8A 2JJ1D 2QAGA 5JEDA 2OM2A 2NO6A 4Q66C 3V4FA 4F4JA 3BGWA 3ZD6A 1I4DD 5LPNA 1UEIA 3ETLA 2FFBA 4OI2A 1KSHA 4OI0A 1AKYA 4UQOA 2O0KA 1U94A 1E0SA 1ZD9A 2O8EB 3ND9A 4IW3B 4Q4HB 4V0ME 4CT4B 1X8JA 1J2JA 1ZUNB 3IEUA 1RFLA 2G3YA 3LA6A 1VYVA 4QGGA 4AIIA 1T0HB 4HB2A 4PSKA 3PJRA 1KI4A 4QG7A 1UBGA 2JGNA 1TF7A 1JJVA 3KX2A 3CM0A 3VU9B 1P5ZB 1G64A 2QSZA 2R65A 4C4PA 4ASUD 2R6DA 4PO9A 2Z5FA 4DB4A 1H8EA 3D31A 2A78A 4MA4A 5GADl 2F7SA 1M7HA 1JEEA 1XCMA 4TMWA 2FFHA 2XZLA 1FZQA 3GJ0A 4NYIQ 5D3MA 5EP2A 4DRZA 4B76A 3NWJA 2QENA 1Q12A 4ON9A 4E07A 4Q48A 3KKMA 1XEXB 4D26A 2GXAA 2JLUA 4LBYA 2ZPTX 4IKEA 5B2ZA 1II8B 1GKIA 4KFUA 4JBXA 4PZYA 1QG2A 1G1MA 2IEZA 1OIVA 2VP5A 3QF4A 1E1RA 1TQ4A 2A5FA 2O5VA 2VTKA 1E4VA 1CBUA 2VLIA 2GBLC 2JDID 1Z2CA 2Q6TA 3MJRA 2VP4A 4IDQA 3VX3A 5AUNB 2BKEA 3AUYA 3N5CA 2E1RA 1KO4A 1VKJA 3FVQA 3LDAA 4M53A 1A82A 2QN6A 4TMTA 4BFZA 4JL6A 2GJAA 2ANCA 4ZDJA 2CE2X 4A8JB 3H86A 2BEKA 1NLYA 3BB3A 1E1QD 2AK3A 2ZJ8A 3EZ6A 2ZI9A 4JVMA 2RGCA 4C0AC 1NY5A 2RGAA 4RD6A 4V02A 2G83A 2DFTA 2VSXA 4G5RA 4O25A 3G0HA 1E9RA 3D6TB 1XD9A 2F3TA 5EE1A 5EXXA 2J3EA 4HAUA 1M6NA 5JECA 2XGJA 2UZ3A 3W3AA 2ZRAA 4NCNA 1AN0A 4A36A 3HU1A 3IGFA 3W9YA 2O8CA 4EPXA 4ARZB 4YMWA 1WF3A 2OBMA 1NVVR 4RD1A 3MWKA 3QBVA 3H0KA 4TYWA 1J8YF 2A5YB 1GL7A 4NPHA 5EXPA 5FOXA 3T06B 4B71A 1DVRA 5BW8A 2PZFA 1YZNA 3GLFE 4BEBA 3FHOA 1ZNWA 4MUBA 3ZYCA 2FFQA 2CHVA 3MJHA 4CZ2A 3ECCA 2JJ8A 3NBYC 2GF9A 2PLRA 3U2QA 3SE0A 1TUEA 2ORVA 4P4SA 1WBDA 2YWGA 2IL1A 3L0SA 1GL6A 1Q1ZA 2EW1A 4TQAA 2CHGA 4GDFA 5FUXA 3OEED 4ZCMA 5F9HA 3KTAA 1HE8B 2QM8A 3B5JA 3AVVA 3F8TA 2MMCA 2AXPA 4JLNA 1R2QA 2XJ4A 4DWJA 4GMXA 5CM8B 3O8BA 3WRXC 1ZRHA 2OXRA 4NYJQ 2ZJYA 4PC7A 4NTZA 3IHWA 2CVHA 2JASA 1E2EA 4RZ3A 4FD2A 1XD8A 5JSZA 3AVYA 3CNOA 4QBFA 2Z6VA 4LJ4A 2ZU6A 4PX9A 4TSFD 2CL7X 3LW7A 1Z6TA 1G3QA 1OFIA 4R2IA 1ZVQA 4ZO4A 1E79A 2QEQA 1G4AE 1KI6B 4IEIA 2B7CA 1ZCAA 3CH5A 2VSOA 4OI4A 3IIJA 1KK2A 5IF9A 4CDGA 1U9IA 4XWAA 4DKXA 1XP8A 3UG6A 4GI7A 2AFIE 3KB1A 4IOKA 4JKIA 3KJIA 1AS3A 2GCOA 1NN3A 4QKQA 4PAOA 4A6PA 3SQXA 3SHWA 2VIIA 5CJPA 5B30A 4O3MA 2J5XA 1HY3A 2R6FA 1VYTA 2GF0A 2B8WA 1YRAA 3U5ZB 4PZLA 5HKKD 3ZZ0A 1UADA 3QKTA 1LS1A 2ZXUA 1LNZA 4LJ7A 5LBIA 1NN0A 1ZM3A 4M9SA 1IXZA 2VHJA 3RLFA 2BCJQ 4Q7LA 1YZQA 5TY0A 4Q02A 5FUVA 1N6RA 3BRWD 1YKSA 2YWHA 3MAAC 5TXGA 3GLGA 1OT3A 5BYKA 3NXSA 1Z29A 3D8BA 4IOJA 3NVAA 4TTPA 4D4JA 4F7WA 1N5LA 4XSHA 5FR2A 4MITA 4MUAA 4QGFA 4KAXA 1IN7A 4GPTA 4ILEA 4RFVA 8OHMA 1WMSA 3BXZA 1E6CA 2CJWB 2I4IA 5F3WB 1DOAA 1P9RA 2O8BB 1J70A 3HP1A 4IXMA 3R20A 2ZE6A 1N3BA 2ZAMA 3LBIA 4IRUB 2AKAB 1NSTA 5FOVA 4AYTA 3OF5A 4LBVA 1G41A 1Z6YA 1QHHB 4LPKA 4ZDWA 4DEYA 3PXGA 2Z83A 2R8RA 5IHPA 2VA8A 1TPZA 4YLGA 1H65A 4MKGA 2KSQA 1EESA 1ZM2A 2ZEJA 4GOJA 5L3SA 4A15A 2JIZA 2ZI6A 4JBWA 4ZDKA 4X8LA 2IXEA 2ZITA 3PVSA 2AD1A 3IEVA 1B23P 4DCUA 2NMVA 2F1HA 1NMZA 2HF8A 3KFVA 4D4MA 2H1LA 1SKYB 1CJVC 4Q4JB 1DAKA 3EG5A 1NG1A 2QGNA 4II7A 2G9NA 2W6IA 3ZJYA 3U61B 5HCIA 4FMCB 5KU1A 3QKUA 2WPDD 3M6AA 3FOZA 2J0UB 3B2EA 3UG7A 4Q1DA 4KU4A 1NBME 1OLOA 2FH5B 4PHTA 2G88A 4D0GA 4Q9IA 1T3LA 3GEIA 1Z63A 2WBLC 1KI9A 4PQFA 4TLEA 3UMFA 5KNCA 1MO4A 3GJ3A 4YMSA 4BLRA 4KLNA 4UKDA 1ZINA 1E2MA 3GJ8A 2RGNA 1KDTA 2J1LA 4B48A 2IF2A 1Q21A 4Q4AB 4JKYA 3LAWA 4CIDA 4G1UC 1G6OA 4GMDA 3TUIC 4B33A 4I81A 4CT5A 5HE9A 2VSFA 4AC9A 1Z06A 1SVMA 3X1YA 2FZLA 1N5JA 2GHIA 4C2TA 3UK6A 2OFWA 1SXJE 2W2VA 5KNDA 4V03A 5CK5A 4DBLC 1L8QA 1KSFX 3MFYA 4YMTA 3NHAA 4Z8XA 3A1VA 4RD4A 1KMHB 1XDBA 1E69A 3ADKA 3KJEA 1I2MA 4EFNA 4RZUA 1CEEA 4C0HA 4GSYA 4YMUA 3BAFA 4AKGA 1EK0A 1TMKA 1E2FA 1KIMA 1M74A 3TK1A 3FMFA 3QENA 4MRPA 4H1UA 1F5NA 221PA 3K09C 1P7CA 2BM0A 4QJ5A 1F2TB 3RRZA 4BFSA 1ZJ6A 1PUJA 3GFPA 2VF8A 4QNRA 3M0EA 3TGPA 2XNSA 2HT1A 1FNMA 3AF1A 3QPVA 4LYHA 3A4NA 4NU0A 4NKRA 2RGGA 3ZZUA 2CL6X 1VG1A 3BH6A 1SVSA 1Q44A 2C9OA 5DLQC 1UDXA 2WJGA 4LDJA 5FL7A 4DUGD 1JPJA 2IK8A 4EPVA 2FMXA 2QG6A 1VCMA 1EWRA 1G5RA 1HH4A 4H9GA 4BASA 4URZR 1N5KA 2JLSA 4TL6A 1IXRC 4RVCA 4US1R 4BZXA 2J59A 1G8GA 4E03A 3GLFA 1LF0A 5J4YA 5J4LA 1FMJA 3MGCA 3OAAA 3K8YA 1ZM9A 4Q7KA 3SNHA 1J90A 3DMDA 4UJ3A 2FZ4A 2I1VB 1WBBA 4LX0A 4RD0A 2AXNA 4LBWA 2IYSA 3B1YA 1KSGA 4CRWB 1XCPA 4DLWA 4FINA 3DKPA 2H18A 1QBKC 2C2HA 3QKSB 1R6BX 2XTMA 4RFSA 1UDWA 1L4YA 1WRBA 2A9KA 2PCLA 2PCJA 5IK2A 1BKDR 1ELOA 2F9LA 4MDEA 1E2HA 1LW7A 1WP9A 4IDOA 3B1WA 4NZYA 1R5OA 1I2DA 2EFEB 2WOJA 4B2IA 4CEHB 1MR3F 2W83A 4D4KA 5JJIA 1LFDB 1G6HA 2FWRA 3THYA 3IBGA 4P31A 1SXJB 1EGAA 3TJZA 3OEHD 2OO7A 3HPRA 3G82C 4MYTA 3SFZA 4DHEA 3T35A 2DBYA 4QJ3A 3W3ZB 1EFUA 1JBKA 1TTTA 4MKIA 1DE0A 1K5DA 4OK3A 3B7GA 3BFKA 1AS0A 2XZPA 3QBTA 4NCIA 3FB4A 4GT1A 1E32A 3HU3A 4HI0E 2IA5A 4JL8A 2Q9BA 2ZQ5A 4TT3D 1ZM7A 5CB8A 1QF9A 4UNNA 2ATXA 5GJVC 1GNRA 2NZJA 1KO5A 5E3HA 3BJIC 4G5QA 3GCGA 3U4QA 4KCGA 2CCJA 3K9LA 3KDSE 4F4IA 4IOMA 3QXHA 2HV8A 5KSYA 4B3DA 4JL5A 2NO9A 1AJEA 1S3SA 1D8TA 1AGRA 1XMJA 4Q47A 3N2IA 5A4JA 4JIMA 2C99A 3UXMA 1GWNA 1XX6A 2CNWD 1K8RA 2FGJA 4V0LA 2ZS9A 3DZ8A 3QG1A 3MWYW 2B8TA 4F92B 4QGHA 2KWIA 2ZI5A 2R6AA 2A30A 2A5GA 2YYZA 1PLJA 3ZH9B 2VP9A 2YJTD 3IDQA 4IEEA 5DI3B 3T34A 1OYWA 1W2HA 1HQYE 1S2MA 3B1XA 2J7PA 2L0XA 3TQCA 3NKVA 2QQ0A 2LKDA 1A4RA 3IPYA 4G5SA 4DLTA 2IEYA 3AP3A 3ASZA 2DB3A 3DL0A 1XEWY 1R0WA 4YONB 3WP0A 2NPIA 3BB4A 5LB4A 1OH5A 4XJXA 2RHDA 5JMTA 5KO2A 2PX0A 5FUYA 1GSIA 3X1WA 3W6PA 3EWAA 1YZTA 1FFHA 3Q9LA 1FX0B 4PTLA 1A2BA 1M7BA 4EJSB 4Q9HA 1JECA 2WIBA 1DARA 4BQSA 5F98A 4EKDA 1CS4C 4HDOB 3RVBA 4BGDA 4PPGA 1ANKA 3AEZA 3VR5A 1ZNYA 3Q8XB 4NE2A 3TVTA 3CONA 1UAAA 2GEVA 1AQUA 3SJAA 1W4CA 5EZ5A 1P3JA 3LFUA 1KOFA 1KO1A 2V8OA 5K8TA 3RC3A 1XMVA 3E5HA 4DCVA 2XB4A 2ZANA 1J7KA 2ZSAA 4RSGA 4BRWA 1XF9A 2IS2A 5TVKA 3CRQA 2QM7A 4I4LA 1ZBDA 3THWA 1Z0JA 1COWD 4M0LA 1CXZA 4LC1A 1VMAA 1W0JA 3A1UA 3WNDA 1KJZA 2F43B 4LI0A 1CTQA 1C1YA 3P32A 3EPKA 2FFAA 2BMDA 1SXJC 4CEIB 3ASYA 1P60A 3PIRA 3BH0A 1XMIA 4YDSA 4EFLA 4ZI3A 3EIHA 1PZNA 5F2EA 5FBLB 4L9SA 3CPJB 1JXOA 2J87A 1LY1A 2HLDA 2NZ8A 4MYCA 1X1SA 4KITB 5FPSA 4TL8A 1HQCA 3BFXA 4LRWA 4AK9A 1HT2E 2HEIA 2QAGB 2FSGA 3QI2A 2EFHB 1MRSA 1OKKA 2XB2A 2PBRA 1VECA 4URWR 3RNLA 3K0CA 1OV4A 1XEFA 2A5DA 2JJ2A 4OK5A 3VR4A 1JNYA 1CRPA 4G01B 3AM1A 2IHYA 4W5JA 1KK0A 2JJ1A 1E0AA 5SZIA 1TAGA 1YE8A 4Q1BA 4XTRA 1T91A 2O8DB 3GLHA 1TQ2A 1IBRA 1Z83A 5GVSA 1I4LD 1Y3AA 1U0HC 1W44A 3C5HA 4GRAA 1M1YE 1AKEA 4Y0AA 1GILA 1Q1QA 4B3GA 4QFMA 3P26A 1SVKA 3FHTA 5BWMA 4HDQB 2Q21A 3UMSA 5BN5A 4DVGA 2AR7A 3CX7A 1QG4A 3RS0A 4F38A 3AKCA 2YVUA 1S4QA 1XD2A 3OFND 4LHVA 1JJ7A 1KI2A 4BZPA 4ASUA 4DJTA 5E7MA 3F5FA 1E9EA 4AURA 1RZ3A 1PUIA 4JLKA 3SHFA 4BUJA 5H70A 5HR5A 4X8MA 1NJGA 3AH8A 3U7EB 3WBJA 4EJSC 2XZOA 2ZE8A 1ZD1A 3AKEA 3U3OA 3QSYA 3RRMA 3SJZA 4YXWD 1T5LA 2P5SA 1VDZA 2WM9B 3QF4B 3VHLB 1E99A 4TMZA 3UPUA 4M1TA 1SGWA 3ZZTA 3SOPA 4B6FA 1JQJC 1OH7A 5KYKA 5CYPA 3KZ1E 2ZR0A 1ESNA 3SI7A 2B92A 3BB1A 4UJ5A 2ZRGA 2YOFA 1UEJA 3T1TA 1G7TA 2JDIA 3BORA 4LHXA 3TAHA 4Q4LA 2HUPA 4PSAA 2NOAA 4HAYA 1W5SA 1NLZA 1TL7C 4PPQA 5DHFA 2F55A 2ZJAA 2CK3D 4JMPA 2EFGA 3AF2A 2GJSA 3W5IA 2ZSFA 5J40A 4A2QA 2IS1A 4KFSA 1UBFA 4B74A 1RPZA 4LYFA 2SHKA 1M34E 1RE0A 3B8HA 2ANBA 1E2JA 4QGAA 5DN6D 2O0JA 2RAPA 3O8CA 3T12A 3N70A 4OJKA 5FTMA 1R8QA 2RGXA 3OIUA 2O8CB 2V4ZA 1ZNZA 3A1WA 2QAGC 3IUYA 3GLGE 4WXPA 1EFTA 1NVUQ 2CHQA 2ORWA 1X86B 4P32A 3K0AA 3DOFA 4TYPA 3IHLA 3O8RA 2QPTA 3CH4B 2OUKA 3LQRA 4L9WA 3VTKA 2QORA 3A6PC 3ZVMA 1NLFA 1EFRD 1P2VA 2OV2A 1XJCA 5K8LA 1OB2A 3KXIA 4QHTA 5G3ZA 1ZD8A 1US8B 3CRVA 4EDHA 1VG9B 3OIVA 3ICEA 4KHZA 5D3QA 2WMOB 1HYQA 2HCBA 4LC0A 4Q5IA 3KTAB 5ANRB 2OHFA 1RRFA 2P6RA 2EYUA 3ZVLA 5H1YA 1XB2A 2AKYA 2VQSA 2C96A 2EYQA 2ZJZA 4JT2A 1OH6A 3MG9A 1II0A 2ODEA 3BERA 1FL9A 3OEEA 1OPXA 3CZPA 3E2IA 2WOOA 5JI3E 2DWOA 5JSZB 1UJ2A 3KXLA 2WWGA 3AVQA 4A0GA 3FMIA 1MKYA 1F2UA 1RJ9B 1JQLB 1VCNA 4GOXA 1N25A 4Z8YA 1KK3A 4K81B 1CJUC 2J46A 2ONJA 2FSFA 1PLKA 3CNNA 3PENA 1NIPA 1W48A 2J0VA 3VNVA 1BMFD 1YZUA 2NIPA 3LLMA 3U60B 1LV7A 4TSFA 1H8HD 2A2ZA 4OI1A 1KDPA 4HZUB 5FH9A 1Q1EA 1E9BA 1KI7A 5CB6A 3K9GA 3U3MA 4BFYA 4IOLA 4PHHA 3O8DA 2W0SA 3LX8A 1F3OA 3ZDQA 4ERNA 1AS2A 1AIPA 1SULA 2AFHE 2A7QA 2VF7A 2GTPA 4GP7A 4PC1A 2F3RA 5CLLA 2X2EA 5HZKA 3ZIAD 1EFHA 3F0TA 2FSHA 5FPKA 2VEDA 3AGQA 3ONWA 5CJ2A 4HAZA 1G20E 2R44A 5HKKA 2ZR9A 2D3WA 1AZSC 1Q0UA 3GLGB 3TAUA 1VHTA 3OE7D 4MGKR 2F1JA 2WJIA 3GLIB 4PFSA 2ZVPX 4DLVA 4WAUA 2R6CA 421PA 3KUCA 4CEJA 1Z6AA 2HCJB 3K0FA 2Q9AA 1TQ6A 3PUVA 3OZXA 3ZS9A 1G291 1MO6A 4KO8A 5AUPB 1KSJA 3DMNA 1RRGA 2J0SA 2Q3MA 2IUTA 1E9DA 1CLUA 4DZZA 2ZYWX 3RANA 2N42A 3ICQB 1X6VA 2GNOA 3VR3A 3AB3A 3UKDA 2D74A 3VX4A 1SZPA 2BBOA 4P4UA 4LUCA 1YJ5A 4XOIA 2X2FA 1N6KA 1D2NA 2C95A 4IVPA 4MH0R 5JRZA 2UVQA 5UKDA 4A0FA 3IPXA 4JZKA 1G8YA 3I8SA 2VHUA 4HUQA 4TTQA 1KDOA 5AR1A 2ZRDA 1P6XA 2JLZA 1W5TA 3EX7C 5L3SB 3LO5A 3IO3A 4PHFA 1MOZA 3KFXA 4B73A 5JHHB 3GJ7A 2IWRA 3T1VA 2FJUA 2ZYUX 1UF9A 4JVNA 4DDTA 1TF5A 3R8CA 3TUJC 3AVPA 4PAMA 2QI9C 4JYBA 3VR6A 3GFOA 2WKRA 1XTRA 1FTSA 1Z07A 4DLRA 2UKDA 4NCHA 5HTKA 3QY0A 3WMEA 4WW0A 3Q5EA 1T3SA 4FMDB 4PANA 4ABYA 2IYZA 3DZDA 4LHZA 1OE0A 3HYRA 3I73A 4OQNA 2IYXA 4UXIA 2QRZA 2ZE5A 3HR7A 2JLYA 5J47A 2QT0A 2WPDA 2BCGY 3EASA 4MGZR 3I32A 3U44A 3REGA 5JJKA 1XTSA 4JLMA 5DO9A 4C0JA 1T4GA 1KMQA 2AN9A 1G17A 3T1OA 2NO7A 1U9IC 4LJ5A 4DIEA 2IYYA 4OYHA 3K0EA 4GP6A 5AJYA 2JA1A 4JLBA 4E09A 2GK7A 4DCNA 5JEEA 2ZRNA 3A1SA 1JEDA 1TEXA 1JALA 1TQDA 4D0LB 4DSNA 3EAQA 2CVFA 4AG5A 1E2GA 4Q01A 4QL3A 2ONKA 3PITA 4LHWA 1P62B 4DDWA 1W4RA 1GRNA 1YVDA 1XXHE 1HT1E 3BOSA 1R5BA 4PHGA 2CMKA 1WE2A 4YDHB 1Z22A 3GQBA 4PPNA 1GL9B 4B35A 1E9CA 4Z51A 1BYUA 1JAIA 4GFDA 2C77A 2CLDX 3TR5A 2VHQA 3VR2A 3IBYA 4CYMA 1UKZA 2JCSA 1AGPA 1T8UA 3PUWA 3L82B 4XD7D 3HYTA 3QE0A 3EPLA 3AKDA 3TH5A 4QBIA 3AV0B 2YWFA 1DELA 3A58B 2YKGA 5FTLA 4HB0A 2QGZA 4D2IA 2MSCB 3FKSD 1GFIA 4L4UA 4F4CA 4PAQA 1QHGA 2BJVA 2JLRA 3VU9A 1EWQA 2HJGA 1W4AA 4XWKA 1QHIA 1ZCBA 4KSBA 1K6MA 2GVDC 4BPBA 3CF6R 4LWZA 4X8OA 3TE6A 4B3CA 3DVLA 5TDHA 4B32A 4Z54A 3GLFB 2DWQA 4ZCLA 4ZV4A 4B2PA 4GBMA 2ZSBA 1T3HA 1P9NA 4MKFA 3TUZC 2IHBA 4IDNA 2AHOA 2CLCX 4DXAA 5C2JB 2HYIC 2GCNA 1II8A 1UBCA 2WKQA 4ZPXA 4RZXA 1XTKA 2DY1A 4ZCIA 2ZYVX 1MRNA 3GEEA 2AK2A 4RFSB 1P2SA 4C30A 2N1BA 3TIFA 4ZIRB 3LY5A 5J4HA 5DNYB 4OQMA 4JLAA 5AJZA 5JZVA 4AG6A 4M9XA 3LXRA 3WYFA 1UKEA 2RH5A 1SVWA 5LB2A 3LW8A 2BIFA 2IYTA 4BZQA 5KPJA 2H16A 5JLJA 4KJZA 4A8JA 2ZI3A 3LLUA 3QNUA 3THYB 2BM1A 1QHSA 1LB1B 2BVNA 3CWZA 2TMKA 3PQCA 4Y0VA 2J7KA 2RGNC 2IUUA 3TBKA 2G0NA 721PA 1G7RA 2GESA 2XTNA 5DE3A 1OF1A 1X3SA 5GJWC 4K46A 3SR0A 3K0SA 1KZGB 2ODBA 2JAQA 4JLJA 3SC3A 1ESMA 3K53A 4NHOA 1G3IA 1QZXA 4DCSA 4TLDA 4N0EA 4LYJA 3TKLA 4B34A 4HSEA 4OQFA 5KTYA 2GAAA 1RIFA 4D82A 1CR4A 3QF7A 4NYMR 1NN5A 3HR8A 4WZ6A 2A3RA 2BMJA 3BWDD 1U99A 4RKEA 1OJLA 1D2EA 5J4VA 3B85A 5HE8A 3A37A 4JBYA 4HEJA 2WJJA 2CDNA 2OAQ1 4GZLA 4TT3A 1ZIOA 1V43A 2ZYTX 1EX7A 2PJZA 3B1VA 3Q72A 2EFCB 2W6JD 3RHFA 4HATA 5SZKB 4IJMA 1KAGA 1VTKA 2P6UA 2F1IA 3DM9B 5H68A 5KDLA 3PCRB 3K70B 3TLXA 4QXAA 5AJXA 4BE7B 4W9MC 1P73A 2XITA 2CNWA 1W0KD 1T0JB 4NMMA 2ZR7A 1UPTA 3KQKA 3BD9A 4DLZA 2PJRA 2H57A 1NL3A 3GLHE 3CWQA 2KJQA 4ZKEA 4EAQA 1GITA 3T5GA 1XCGB 1E79D 3CPHA 2V9PA 3B78A 3LWNA 3EIEA 1VCIA 1ZYUA 3QXJA 2QMHA 3JVUA 1A1VA 1C9KA 4I1VA 3SBEA 2WJHA 3PFIA 1MABA 1F6BA 4A1FA 5GJCA 3QXCA 1DADA 2WWXA 2JLXA 4A2WA 2ZRKA 1YZLA 2XAUA 3D7MA 3V9PA 3RAPR 1LVGA 2BBWA 3QIAA 5H8WA 3BBPA 5FTNA 2YV5A 3TMKA 3W6OA 1KO8A 2BJWA 4JLOA 2WSSA 3QPUA 2GZHA 3S1AA 3T5DA 4GZMA 4E22A 1YQTA 4MYHA 1KAOA 2G6BA 3I1FA 1HURA 3THWB 1DAHA 4NL4H 2YZ2A 3TSOA 2REXB 1E96A 2FV8A 4M1MA 3VKHA 2R62A 3GD7A 1GKUB 2C9YA 2NQ2C 2B6HA 2ODWA 4KV9A 5EE5B 5KPDA 1NG9A 1S3GA 2WWIA 1IHUA 1KNQA 2P5TB 3BFVA 4NBSA 4Z1MA 5EXSA 3A36A 4MRNA 1OB5A 4S35A 3EWSA 3ND8A 2DFNA 1NJFA 5FOSA 1FUUA 4OQLA 4FMCF 4XVUA 4AI6A 4FWIB 3AF3A 2X8AA 1U8YA 5IRCD 6Q21A 4NYIR 1I4TD 5L3QA 2IS6A 1E98A 1XBTA 1ZC3A 2P67A 2DWPA 2FGKA 4B6EA 2B21A 3EW9A 1R0ZA 3HWSA 5C1BA 1QHXA 1MV5A 1L7VC 3HU2A 1GZSA 2CCKA 3NTUA 3L0OA 4IXNA 2A5JA 1XXHA 3NG1A 2WAYA 1E94E 4NCJA 2JIZD 2V3CC 1E4YA 1ZNXA 5TMPA 4WBSA 1HV8A 5FFMA 1GNPA 4AWXA 3AVXA 1TUIA 3L0IB 3W34A 3GJ5A 2WHXA 4EPTA 1PVOA 5F9FA 3C14C 3P4YA 2XX3A 3FGNA 1RW4A 5AUOB 2VP0A 2C5LA 1RKBA 5DYGA 4HLQB 3K70C 3CPEA 2P0EA 1TX4B 2W6ID 3WYAA 4G0NA 2W2XA 3CNLA 2CE7A 3LBNA 1II9A 4IDPA 3ZQJA 2QNRA 4LJYA 4M22A 5EE3A 2QP4A 2RCNA 1WXQA 4KFRA 1ZW6A 1XPUA 1O3YA 4LGMA 3PEWA 4Q4JA 2CEAA 3B1ZA 1XD2B 1E2NA 2BBTA 2BDTA 4UNQA 1IJEA 1G8HA 4EPWA 5JWOA 2RKOA 1GKYA 3V00A 3ADDA 4HAWA 3SFVA 2BEJA 4ACBA 2PZEA 2J0UA 3EA0A 2FOLA 2IYLD 2IYWA 4TLCA 1CJMA 2GZDA 2ZRHA 2ORIA 4CW7A 5C4GB 2VPPA 1IXSB 1U81A 1W47A 3OFNA 4FW9A 1RRPA 3PV0A 1L4UA 3BH7A 3C7KA 1GP2A 4JLVA 4RCYA 4B3XA 3IIMA 1QVAA 2WICA 4DCTA 2FEMA 2VYFA 4C0LA 4A4DA 3KL4A 4AKHA 2ZRMA 4LJ6A 4Q4AA 3RWOA 1E9AA 4YXWA 2D7DA 1BS1A 1MO5A 1IY1A 5EJEA 5AJVB 2WJYA 2FU5C 3OIWA 2W2TA 2LCFA 1W46A 1NVVQ 4LHYA 1E3MA 2QP3A 2KB0A 3WBKA 2DPXA 1D9XA 1UKYA 1ZIPA 3CO5A 1KMHA 4LCBA 1KJWA 2Z0MA 4QBHA 1NY6A 5FBVB 1IQPA 4QC2A 2ATVA 2YOGA 4RZ2A 4C0QC 4LOAA 1Z0KA 3U3RA 2XSZD 2ZJBA 1NSFA 4JSYA 2XNDD 4W7SA 2ZS8A 4NYJR 4FCVA 4TQUS 2CK3A 1SQ5A 3HJNA 1S1MA 3EPHA 4JYCA 5FL7D 4US0R 3QXXA 1GG2A 2Z4SA 2ZRBA 3K0CC 1NVXQ 5TARA 3KQNA 3I5YA 4Q9KA 3BS4A 3WXMA 2QQEA 2C04A 1NN1A 5KNBA 5EUQB 1NNEA 1YR7A 1X8KA 2QBYA 3THXA 3OAAD 3DKVA 1N6LA 5HPYB 1W1WA 5A0FA 1RC8A 3LRPA 621PA 3NDPA 3WHLA 5E7JA 2D4HA 4MYUA 4UNRA 1ODFA 2QE7A 3SYKA 3MWJA 5IK2D 3NDBB 1KNXA 5G3YA 1E2LA 2ZETA 2XXAA 1SKQA 3A8TA 1XMSA 3EIQA 3QJYA 2QTVB 5IT5A 1BOFA 2X1VA 3ADBA 3NIBA 5FUWA 4B2LA 1N6OA 3W90A 4UXJA 2VBCA 3D3QA 3X1DA 1F2UB 3CR7A 4TYQA 5FR1A 3LD9A 5FPTA 3AP2A 4URYR 1P4SA 2J45A 2VHCA 2BBSA 3L8YA 1SVLA 2RHMA 3MD0A 3GMTA 4DIDA 1Z0IA 4IHQA 1GM5A 4CEHA 1CJTC 4RJLA 3CF0A 4PC3A 4A6XA 2C98A 3AVUA 3Q7PA 1G3UA 1G3RA 2QU8A 3N2EA 4QRHA 4PO1A 5BN3A 2D2FA 1OHHD 2OFXA 4V0OA 3NH9A 5D3MB 2IX3A 1S0UA 3QQ5A 1XTQA 4OHYA 4DSUA 1H8HA 3CX8A 4N3NA 5HCNA 3THOA 3SDZA 4JT4A 5KDOA 4M1KA 4DEXA 1YZKA 1RYFA 5TB5A 3FPAA 3QVUA 2BWJA 3KJHA 3EXAA 2GILA 4TLAA 2OLKA 1R4AA 2AD5A 3CIOA 2KI5A 1DAGA 5DI9A 4OHZA 3SN6A 3TQFA 4EPRA 2OG2A 2G0TA 4R9UC 2ZUBA 5BQ5A 3AQ4A 3ZD7A 3SJCA 3L0PA 4JLDA 1XZQA 4TN1A 4OBEA 3K70D 4OKSA 3ZIAA 4Q9JA 2HDNB 4EIWA 3FFBA 5DIFA 3K0FB 4QNMA 4AKEA 1S8FA 5GVRA 4BLOA 2IT1A 2ZAOA 4NDZA 4TYNA 5J5CA 3CLVA 3VKWA 3OE7A 5CK4A 5G53C 1FW6A 3TNFA 4LJAA 1FP6A 2PH1A 3MMPA 2D06A 3RWMB 2GXUA 4HLUA 2OBNA 5M04A 4UNPA 3WNCA 1CP2A 1J99A 4JJZA 4DSOA 1M2OB 1ZMXA 1Z0FA 1E1QA 1W2GA 2VP6A 5EE0A 4B3BA 4Q1FA 4D4LA 3GPLA 1Z5ZA 4HUQB 3U3JA 1VG0B 2GAOA 4HZIA 4LJ8A 2FDCA 1CULC 1DS6A 1R8SA 2BHRA 4XVQA 2YC2C 3EPJA 1N6PA 1DG1G 1XU4A 4HB4A 4LV6A 1AK2A 2ODNA 2IYQA 2ZJ5A 2VL7A 4IDHA 4TL9A 4C0BA 1G3MA 4JLPA 1EXMA 2H8KA 2ZS7A 3WNBA 5GJBA 1Z2AA 3FFAA 1W0JD 3QG5A 1E2PA 2RB4A 5L8VA 2REBA 1UKVY 4C7OA 3LV8A 2CCGA 1Y63A 1YHNA 1NBMD 4J0QA 3R7WA 3AP1A 3NC1C 4P4SB 1XFAA 1QDEA 3AUXA 2GWHA 2WV9A 4KFTA 5FBRB 4D81A 3QEJA
chains in the Genus database with same CATH superfamily
1G21A 2BF4A 3P9PA 2A1IA 2COUA 5A7GA 3U44B 1LC3A 4JFAA 4O29A 5J58A 4WKCA 4M49A 2HLDD 3BRCA 3CZRA 3A9WA 4POAA 1DEAA 2IUSA 2GN9A 3DZJA 4TLBA 4Q1AA 4KE7A 3IUSA 5LU9A 2UZ4A 5DTJA 2CZGA 1ZIDA 4A92A 1XAGA 4P8RA 5HYVA 1PR2A 4ZCSA 1Z7YA 3H1TA 4O4HB 3VUFA 1PN3A 2GVZC 5LIRA 3CG0A 4YRTA 1V6SA 3O3NB 1U2GC 4LFAB 2JJ2D 1CF4A 4PC6A 3MWEA 2Y6UA 4XWWA 4XQCA 2QTFA 1KAMA 3L6BA 3T6KA 1U7HA 3PRJA 3A9VA 1OFTA 3NHJA 1WW2A 1GJRA 1XKXA 1LD3A 3CKLA 1JFTA 4HP8A 3OFSA 3T3EA 4IGIA 4UTPA 4J76A 1AE1A 3HGMA 1JR3D 4YJKA 1K88A 3FYTA 1P75A 2UZIR 4S04A 1T5IA 4IIJB 4A2PA 2POQX 2YWCA 1MFZA 2GCOB 4CU5A 4Q1EA 2BYTA 3W5BA 3DM5A 2PRYA 2G7ZA 4GWLA 1CQIA 2XBUA 1NI3A 2D0OB 2DPHA 4K1LA 3IVRA 3F9RA 4MO9A 4DV6B 1UKCA 1ZGHA 2N46A 1QYDA 2GETA 4XD7A 1J1UA 2IRWA 2P2SA 5DGXA 3KR9A 4QAQA 3UOAB 2CFOA 5KZMB 4PRZA 3VHXA 3GAMA 5E7IA 5HX7A 3FKSA 4O1MA 2QROA 4U6NA 1RADA 2I1QA 4MVJM 5FL3A 5IT0A 2FWIA 3UO8B 1YR8A 1BMTA 3VMFA 1P1CA 1KO7A 2B78A 2R1TA 2X4LA 4HZGA 3RJ9A 1NDHA 2PV0A 4DKJA 3ZGXA 4X1KB 4E1AA 4OJNA 2QVGA 3CKKA 3KXKA 3NBAA 1UM8A 1DJQA 4HUTA 4PX2A 3KQLA 3S2YA 5EIWA 5T6BA 3U48A 1X8LA 1WHTB 1DO0A 1PD1A 4D5GA 1PJSA 3JQAB 4YCMA 1O03A 2E4WA 3C7AA 1SHKA 1HTWA 2BFCA 3UTCA 5JRJA 3F2IA 3C4QA 3CVOA 2XBMA 1HWYA 2YVQA 3TMYA 3GJXC 3TM5A 3WGHA 1LSSA 1ZD4A 1NPYA 1CUZA 1SUBA 2JIMA 4ZAWA 3SEQA 1L5SA 3URMA 3H2YA 4EGSA 3R41A 4OHKA 3CZQA 2HJVA 3OU2A 4JR2A 5CW2A 2WSMA 4NONA 1OT5A 1VSTA 3ESQA 3UJHA 5CB4B 3UV3A 1BD3A 4L8WB 3OZEA 1OA0A 2DUJA 5C1PA 3TLJA 4B43A 4Q3CA 2O07A 2O4CA 5H3CA 1Z4MA 3AEUB 1TYCA 1MVLA 2QAJA 4GE3A 3RTEA 1KBOA 2VXCA 3FM9A 2HJRA 3W2GA 2R8ZA 1EFKA 4NENA 1W88B 1JZSA 4BNKA 1EUCA 4HQNA 2XQFA 1JU9A 2A86A 2H51A 1E2UA 3WK6A 1EM8B 2PVCA 5L3RA 1SVIA 4ZO7A 1D9ZA 4YT2A 3OKFA 3PD0A 5LDDC 2HDHA 1KJQA 3HKDA 2PX5A 1WCV1 1RU3A 4PR0A 1IPEA 1UPAA 2GBLA 3ROZA 3WFIA 4YRNA 3W5DA 1FFCA 5IKMA 3FSRA 3H87A 3A9RA 3Q3JB 1MC1A 1PJZA 3MW8A 4LPSA 2GD6A 3PC6A 4BNGA 1RKQA 2Z2JA 4TMXA 1Y6GA 1JEOA 4Y6OA 1SBTA 3H84A 1KH3A 3D6NB 1GZUA 3T3IA 3CB4A 4HN9A 4MGEA 1ML3A 2CVPA 2NU7B 3QX9A 3WGOA 2GGSA 4YAIA 5EC8A 2EHJA 2VAMA 4ESVA 3TLBA 1TJ3A 1ONBA 1V7QA 2YWEA 4YEDA 4PCUA 1UXJA 1OSNA 1W6RA 4E0BA 4ZYYA 4EKEA 2O8FA 1O5OA 2ZAYA 3MWLA 4ED9A 3BE5A 1QCCA 2A14A 1NRJB 5JCOC 4Z86A 1IZ7A 4UVEA 1PBNA 3WYCA 4IFBA 4BB6A 4DV1B 3LSTA 4K0KB 1FTNA 2GA8A 4EGQA 5M34A 4EY3A 1VP9A 4MVJI 5LXTF 2YHSA 1FFDA 1KEEA 1MPTA 5JC8A 3DMFA 4EY7A 3JWIA 3KLPX 5DMHA 3OFJA 3RSLA 4BIMA 4J1TC 1JPNA 3M5CA 3C4JA 4JBIA 2FUG6 2C82A 4KGXA 1PFVA 2KLHA 4BFTA 1DHTA 3P2IA 2GPNA 3K9CA 1EKXA 4LS3A 4PCLA 2GK4A 2IYPA 1JE0A 2RBEA 2JFGA 4UAJA 3ONNA 3QNWA 5A04A 2K6GA 3W7AA 3H75A 2NO1A 3NZEA 4RVDA 4X8HA 1KPIA 4IPTA 3RVPA 1U6KA 2A9VA 4D0NA 1BDIA 1JDNA 5F2OA 4F6LA 3OWOA 4PFJA 2XODA 1XTIA 1ZCFA 3DOIA 5CIQA 5HILA 2YNMA 3TRJA 1B15A 3GNTA 1QE5A 4FYIA 5TF0A 5F51A 3BJZA 3WBBA 3UWKA 5EGSA 1IG0A 1RJ9A 4R2HA 1AT1A 4MUNA 3IQXA 2Q0HA 2P9HA 2V1UA 2P4HX 1TM7E 1YR9A 2PLFA 2WC1A 1EZZA 4IVRA 3UGKA 3JAKA 5ALYA 3LKZA 1TK3A 5D5HA 5EQTA 3S8MA 4BWYA 1TZJA 4BO0A 2GN4A 5D8DA 4Q24A 1DQPA 4Y2QA 3ANNA 3H8VA 2JEOA 5CBKA 1K7XB 2C2GA 2R87A 3VPDA 3QBJA 3R9WA 1V4VA 4HZUA 2RMKA 4MUEA 3ORSA 3W8DA 3P94A 5K0BA 1KYXA 3PNVA 3HPQA 4PBTA 1YL5A 4W1SA 4YMIA 2EJVA 1PQWA 3P2MA 1JVSA 1HEUA 3M6FA 3ZS8A 2RCYA 3RABA 4U7DA 1T4DA 3HVJA 3NBFA 5TVGA 1GD1O 2ILVA 2J9ZB 4BNMA 1KAQA 4BV8A 2VQFB 3MCAA 3WJ1A 2YINC 1ZN7A 4QULA 4DWVA 3KOXA 1MFPA 3T99A 5B2EA 3IXMA 1FMLA 2N75A 4E6PA 3EK2A 3QV2A 5A02A 4ZO6A 1G5TA 1PNOA 2JFZA 2ZTLA 4R8VA 3VI4B 4H7FA 2GPYA 2RJOA 1Y6ZA 4ESHA 3U17A 4ZEVA 4NFHA 4J3NA 5JH7F 3UCXA 4EO9A 1Y7TA 2QX7A 4M21A 4DE5A 2IE0A 1QNFA 2E1PA 3EC2A 1MJHA 4D7AA 5BPFA 2ARKA 4E46A 1H05A 5F7JA 2Y8EA 1EHIA 4YDRA 5PNTA 2YW9A 4F6CA 4JI5B 3V7UA 1G9SA 1Q6ZA 1AM4D 5HJ7A 3OZRA 1UDBA 3I8XA 3O2QB 2NTEA 3AM5A 1DZ3A 1PFWA 3NONA 1KKLA 3FLEA 4HRXA 4QRIA 5EP4A 5KVQA 3TDMA 5BYAA 2GCEA 4R2JA 4XIJA 1M8GA 2JG3A 1LDMA 4LSGA 4M0DA 5I8PA 3CR8A 1NJ2A 1NKTA 1WS6A 2ZULA 1VLJA 5BYJA 4F4DA 4AMVA 2GJKA 2QMUA 1QFYA 4F72A 3GJRA 2WB4A 4YLEA 1OD6A 3OPQA 1K4MA 4IS2A 1W36B 3VQTA 1QCDA 1KVRA 1UANA 3M5WA 3TVDA 3EMBA 2V59A 3MJ4A 4KIWA 3CW2A 3ZU5A 4AY2A 1GYPA 4V0MA 1GRQA 2NPFA 4PGHA 1JWAB 2E2WA 2OQRA 2HADA 4S2EA 3QXSA 5CM9C 2FPGA 3EUFA 3Q5DA 4DCPA 1EFLA 1P7PA 1ULZA 4S1NA 3OQIB 2C7GA 4BB5A 4Z7OB 1GCIA 2W0MA 3FFWA 3R76A 3M33A 1Q22A 3O90A 2H4FA 1YFZA 4C29A 2B7BA 4YR7A 3IUNA 1QG0A 1NNLA 4C4OA 3ENQA 4BATA 2G4CA 3G6WA 3SHTA 4C2AA 1T8SA 2V5AA 2G5PA 1E7SA 5J43A 4H6PA 3COZA 3JAWB 3HACA 3IAM1 1R8YA 2YHAA 4IEFB 3DG9A 1EXWA 1M2GA 1QZTA 1X74A 1B0PA 2R1VB 3EMKA 3DZBA 3KYIB 4MVJP 3U6KA 1HYBA 4BB9A 3IMEA 1KFBB 2H7YA 2PX4A 4O3FA 1AMOA 4BMDA 1ABFA 2ZUUA 3PNSA 2YWRA 4X9XA 4DJJA 1XZCA 3EB9A 2R84A 3F49S 3T1QA 1SHZA 1V11A 1AQYA 3ZLUA 4Q18A 1ZUD1 4XIGS 4BPRA 3FHLA 2R7LA 4K6GA 2D5BA 2OE2A 2P3QA 2XRFA 3L8DA 1K8XB 3TWOA 3NCTA 1WR8A 3URKA 5E1BA 3H04A 4PO8A 3JPYA 2V1XA 2C1ZA 3NYQA 4LRUA 2ZAGA 1EX6A 2QLJA 1I3MA 1UT8A 3NM5A 4K6KA 4MJ3A 5CFZA 4EYQA 1H93A 2M6LA 2VZLA 3NHFA 1KI6A 3V8NA 1XLTA 4I50B 1OWLA 1GDDA 4FT2A 3VDMA 1CUDA 2ON6A 1JR3E 2PBFA 4MKHA 1XF1A 1WCIA 3NALA 4ENVA 1G2IA 4O4LB 1D6JA 3PUYA 4QEDA 2YJZA 1Y9EA 3VV2A 1GA6A 1RQRA 3NJRA 4G5OA 4L8GA 4HLNA 1XSEA 2IZ7A 3DHVA 3T3PB 4EG4A 1LUAA 5HKLA 5AKLA 1QR2A 2I62A 3LVBA 2GEDA 4QWWA 4UEKA 4KDEA 1O89A 5BVHA 2VFAA 2WB2A 2VP2A 3M1YA 1GZ7A 1F4VA 5HZHA 1XZPA 3V4RA 1SCUA 4C87A 1UMDA 5EPUA 4ZQFA 1PWEA 1IOLA 1CNEA 1BDMA 3UB3A 4DV2B 4QQNA 2Q50A 2GPSA 3LKDA 4AKIA 5AT1A 3OCUA 5K3FB 3CS3A 4EYEA 1QYVA 3ENWA 3NDIA 1R5NA 3B6MA 3HYSA 4L4YA 4WASA 3OJEA 1UP7A 4FHZA 5A5EA 3LECA 1FBTA 2BGKA 5AVYA 5JQGA 1DAEA 4GOND 2FX3A 3MJFA 1P77A 2JKVA 3A10A 3JQAD 1W93A 1GGVA 1Y6RA 4W5WA 2WYOA 3W7BA 1KWKA 3UGJA 5DTMA 3RRJA 1R7RA 1FYXA 1GG8A 3WLNA 4X61A 3CRW1 3MFQA 2OSVA 2FPOA 4COKA 1XPRA 1EE9A 3GUUA 5JSKA 3ERCA 4G5GA 1B2RA 2AOVA 1AGXA 3AHHA 4G0PA 4TQ9A 4OQXA 4KODA 2CUZA 3V1TC 2CJWA 2O2ZA 2G4LA 1NBWB 3PLAE 2BSAA 3H2KA 4O5OA 2CUKA 2VNHA 4JGBA 4RY9A 5CD1A 1QIFA 2AJBA 4AQ7A 4IIUA 2CL0X 4DLBA 1QHHA 2WM3A 2PT9A 1BN6A 4TMKA 5KTRA 5KWEA 4R0NA 4MDFA 2OCBA 4LZZA 4NS4A 4JP1A 5KU7A 2DULA 2H29A 2H8GA 4Q3KA 3NOXA 1NF9A 1JVNA 3JPWA 3E48A 5IFKA 2WAAA 1KS9A 2X1LA 3FYCA 4CUKA 3BKWA 3PX3A 4FR5A 1ULUA 4ZQGA 4ER7A 2ZUFA 3K8QA 5D1NA 2C78A 4GLOA 2FWMX 5K0SA 4GGPA 1WQ1R 4WN3A 3TL2A 1A95A 3G8BA 3L7CA 3P20A 4R98A 3ZLBA 3OJLA 3P45A 2HQOA 4MR9B 3QUAA 4BFUA 4DEYA 4HH0A 2PEZA 3HB9A 4XYMA 3WWYA 3ZBTA 1MXHA 1GRVA 4UPVA 5AW6A 2JIOA 2ZB7A 1MX1A 1IEQA 1H2RS 1TE2A 2W6NA 2R751 4D3ZA 1IIBA 1R4MA 1NT2A 2EKZA 2J9XB 1DIHA 1WOYA 1TVMA 1Q16A 2G6TA 3AIOA 3NHBA 3LO8A 3DMPA 3F3YA 4JLSA 4U5XA 4HR7A 5ARCA 1JFFB 2OCYC 3MC1A 3E05A 5P21A 1IN5A 1GAJA 2AFRA 1Y8CA 2BONA 2YJ4A 1MUUA 2XDQB 1J8MF 3UN1A 4JJGA 1AUXA 3DBRA 2WSLA 3AF4A 1WB9A 3CQ9A 4QTYA 3J81k 1OBOA 3G2LA 3OHMA 3K6SA 4B5LA 1Z0SA 4EZBA 3K5WA 3UANA 3UV7A 4BE4A 1U2RA 3CURA 4KWHA 2LE0A 3SDSA 1NUHA 4KXUA 4BEWA 3OTIA 5AVKA 4M8KA 2D5AA 1Q7EA 1A04A 2HWUA 2VYND 4KZKA 4RHYA 4MYDA 5JPIA 3IPAA 2QSYA 5I45A 3OQVA 4XB6B 3TD2A 2Q3FA 3UT6A 1G9TA 1R6UA 1TYZA 3I12A 1CFJA 1QZUA 4M7RA 4ANFA 3A1CA 3ZCPA 2NNLD 1GQRA 1PYGA 3BMCB 3D6AA 4QPJC 4DREA 1N77A 1L3IA 5JE8A 3AKYA 1XU9A 1X14A 1I3NA 1R64A 3Q87B 4GMKA 4HXGA 4GNKA 4CFSA 1M7GA 3C43A 2H5EA 3ZDBA 3AKZA 1ZN9A 3KD2A 2IS1A 3H0CA 4FCTA 5EMNA 4LDQA 3S2IA 1NUAA 5LCXA 4RO0A 3NM4A 1GIAA 3OJCA 4R1MA 3UYLA 1JHDA 2BOVA 1L4MA 1M8KA 3FGOA 4CL8A 4KIFA 3JYQA 3PDCA 4E2XA 4JT9A 4A0RA 4F93B 1V8OA 1DG9A 4HWTA 2FE1A 2WSSD 2DSNA 3IOBA 1JKJB 4N5DA 3WLAA 1BHSA 5BWBA 3DCJA 3L79A 1G8JA 4K3UA 3JYPA 4JWTA 4WHMA 3Q8MA 3MOGA 2AEFA 1WL8A 4MEAA 3UMRA 1ND5A 5HIKA 3I9OA 3RRBA 1XNGA 1UK9A 2P79A 3BWMA 3AHIA 3IB3A 4RTOA 1R00A 1LQUA 1Q2UA 1NJSA 2I78A 2R8YA 4MPJA 4F8JA 3B6EA 4KQKA 1Z25A 1C4OA 5SZJA 1FE8A 4NFYA 4QXQA 4UD6A 4V0KA 3CINA 4DDVA 2OCAA 2PWPA 5CIYA 1BS2A 3LQ1A 2WWRA 4Q7MB 1E58A 3C15C 4X1IB 5HMMA 2Z8YM 4YUXA 1KZ4A 2P35A 1YR6A 2ERXA 4XASA 4HFMA 4UBMA 3HCEA 3WL8A 3GEHA 1KIAA 5FDFA 1JKMA 4UVDA 1C29B 4CM4A 1WPXA 3R9KA 1AV6A 5CTJA 2CXUA 3CLKA 3NRJA 4MRVA 4WH0A 3L7DA 3TPCA 1IHOA 1CT9A 3NEYA 4XQ9A 1XAHA 1TU4A 2DKFA 3A6FA 3HYCA 3ZW7A 5L53A 2ZBFA 4I5DA 1E5DA 2YQ5A 1WDTA 1ZM4A 2CLOB 3JR3A 4GM1A 4ITVA 3ESBA 3G0OA 2HFKA 1FEZA 1WXHA 1IN6A 4O2AB 5GONF 1M0WA 1OW3B 1KEVA 4TWBA 5IM4F 1NF8A 2YHUA 4BKPA 3LXXA 4B6QA 4E88A 3UIEA 2AN5A 2HWYA 4R8LA 2XT0A 4BO1A 1W36D 3F6RA 3VJRA 1GG9A 1AZTA 3K1AB 4BJ5A 2JVIA 3IKLA 1RRCA 1OZHA 2B9EA 2LV8A 3JASA 1WD7A 1YASA 3SQWA 3PQ6A 4MMZB 3UV6A 5D51S 5A06A 2Z5GA 3HVRA 3BMXA 2H7VA 3QWFA 3KQUA 1JR3A 4WZAE 4H77A 4YMLA 2YDYA 1SBCA 1BJRE 2NO0A 2VJLA 3DUFA 2UYGA 2YYAA 2W2KA 2W58A 4RKRA 5FAXA 4U7FA 1NBHA 2IBMA 2AL7A 1KXZA 2ZUWA 2H92A 3ZE7A 3ESAA 5TF4A 3GU3A 3A6EA 3ELDA 4WERA 3PXAA 1GZ3A 1V1RB 5SY9A 2RGBA 1V9LA 3U40A 5ISMA 4HUJA 1E62A 4EL5A 4GL2A 3CVXA 5I9MA 2Y0PA 1V5WA 2WHEA 2Q7DA 3QEOA 4FKMA 4LMPA 2Y6VA 1T5SA 3OZAA 1K66A 2HLNA 5E1OA 4F9FA 4GXTA 4B3IA 1RLOA 4J0EA 1DPFA 4CEJB 1U98A 2OV3A 4LY6A 2B1RA 2MINA 1SVOA 1TMOA 2Y2UA 4AJ4A 2DTEA 3BREA 1NOKA 2QLMA 2VLBA 4U7PB 4LVCA 4MUYA 5FQNA 3S2UA 3TZQA 3W6NA 2DF8A 3ANYB 3W6ZA 5JNRA 1ZKMA 3MTQA 4JUDX 3PKIA 5F1KA 3IKJA 3L8MA 3T4PA 1OH8A 5F3RA 1N9GB 3DVAA 4CUZA 1U2EA 4PYNA 3PVCA 1N0VC 4C9BA 1U0EA 1IL0A 1T9GR 2V6JA 4IQFA 2K5UA 4BVKA 2NQ8A 3CUYA 4L4ZA 2WUVA 1JEYB 1KKMA 3GFSA 2CXOA 1Y7PA 4C2BA 1EFCA 2J0QA 2ONYA 2FXIA 2WA1A 3GJTA 3I1JA 5IXSA 4B2YA 3HUUA 4NYMQ 5T57A 3RS5A 4DT1B 2CLSA 1FX0A 1U8AA 2IEDA 2P9JA 2QQGA 5K2OA 4JZYA 4OREX 4W4TA 3N6XA 3RFCA 4F4UA 3LVQE 2VF2A 3KKZA 4FXPA 4DG5A 3KSDO 3I62A 2JJYA 4FOOA 4U8HA 1KY4A 1XYVA 2GPAA 5DM0A 2C2WA 5BMOA 5DYIA 4NF2A 4DWOA 2D2EA 3C5VA 1BW9A 3PEYA 3D6HA 4WFIA 1S2IA 1F8FA 3K8ZA 1EQUA 3F97A 3AL3A 4FQ8A 4AYXA 2NVOA 4DSTA 1ETHA 4UUQA 4EOGA 2PL1A 2Q0QA 1SIBE 2D62A 4NX2A 1IATA 4D9HA 2DFKB 3LVRE 4CFYA 5JCZA 1X3LA 3X2FA 4B0OA 1ZGAA 5JDIA 3A4YA 3FJ1A 3OJFA 2I67A 3CCFA 2Z2YA 3PNLA 4G37A 5F98A 3DWIA 3RS4A 4JSRA 3BK7A 4CCWA 4XH9B 3DUWA 1C7JA 1V6AA 1LDBA 3G9ZA 4GE0A 1P9WA 4KBFA 4XI9A 4LXHA 1PS9A 3KJZA 2XA2A 1PSZA 1OKKD 2FEWB 5IJ0B 3RGGA 1TRHA 2AJCA 1JHZA 2OXCA 3E9EA 1A5AB 4F5YA 2WJPA 3OPYI 2B1GA 5C46F 4FILA 3P0IA 4G56A 1D3AA 2I7CA 1U1DA 2GPTA 1MAUA 3L46A 3LH5A 3MHPA 3SS8A 5CDYA 2BRUA 2ONCA 2P7HA 3A4TA 3AG5A 3CNHA 3H8WA 4FHCA 4F2WA 3AFHA 2BKVA 2R60A 1YSCA 3S40A 2J33A 4L73A 1F12A 3BGWA 3ZYZA 1I4DD 2IV7A 1ULSA 1Q17A 2WUGA 5EG5A 3ZQKA 1E8NA 1U0GA 2O0KA 4UQOA 5EMLA 1QIMA 2NUAB 4HT3B 3VSEA 2WSIA 3ND9A 4IW3B 4Q4HB 2EBHX 1OCEA 2SKDA 1GKKA 4H6XA 2G3YA 3LA6A 4UUAA 4QGGA 1MJGM 4AIIA 4ZHSA 3KLBA 2BGUA 4XOUA 2YXBA 4Z7JA 1U9YA 3JVEA 4NZ9A 5LQKA 4EI9A 4ND8A 1JJVA 3V2HA 3SS9X 3ZU2A 4I4TB 4EABA 4D3XA 3VU9B 1P5ZB 4LOHA 1WMFA 5ABPA 2ZCJA 4C4PA 5KJFA 1P81A 2E55A 2JGKA 2W8ZA 3G1TA 6ABPA 4DB4A 3KWLA 4LMRA 3ZCRA 1M7HA 3T1YB 2YXLA 3WIOA 3WLMA 2XZLA 3L1VA 2V4MA 2B35A 4N76A 1YMUA 3PXCX 5JTTA 3O4HA 5D3MA 5SY4A 1PR1A 3UXHA 1FNCA 5LQRA 4WSOA 1Q12A 1USIA 4E07A 4F56A 3VI3B 3QMWA 2NU8A 4Q48A 3GEGA 4MPPA 3E4DA 2RGUA 5B2ZA 1II8B 3KJXA 4IWXA 5LZ4A 2ZR8A 1U3DA 1VJRA 1M6HA 1S3FA 1L7RA 5TQ0B 5BMVA 3I6YA 4EECA 1A69A 1R12A 3FLAA 1P91A 3WG9A 3RYHB 2Z1DA 3QF4A 1U8FO 2F3SA 4FFLA 4OAPA 4Z9FA 3BHJA 2VTKA 1TJ4A 5KSWB 2ILTA 2FQ1A 2IQ5A 4ZZ3A 3FX2A 2VA9A 1RFGE 2B7LA 3N5CA 4RK6A 1Y8AA 5BNIA 5JZSA 1V3VA 1H6DA 1KO4A 3FNIA 1CUSA 4M53A 5ED0A 1U31A 4TMTA 5DLPA 4HGQA 2CE2X 3BB3A 3KQYA 1JLSA 4DIMA 1G98A 2Q1TA 1UZLA 1X38A 3EZ6A 3JAMA 4OQEA 4C0AC 1DRVA 1BHJA 1Y6QA 3JQRA 3ECSA 4E5KA 2IUYA 2VC2B 3PXDA 4V02A 1EP3B 3FYUA 2VSXA 1WCWA 4AQYB 1N5RA 3G0HA 2OBYA 4L3VA 3D6TB 1GV0A 5IWCA 2TRSB 1BQ4A 2ZFUA 3FPGA 3KPVA 3O1JC 4G67A 5EE1A 3ILHA 3DR5A 4B9EA 1FVHA 5FA8A 1FY2A 4HAUA 2WKWA 1M6NA 3W3AA 2VT3A 2C3UA 2Y66A 3E9ZA 3LT1A 4X0EA 4BBAA 4ZRDA 4MI9A 4QDZA 1JQ5A 4H3VA 4ZRNA 2O6LA 4EPRA 2ZG6A 2JLAA 3DL4A 3N74A 4ARZB 1NYLA 3O4IA 4P36A 5AI4A 2OBMA 5CURA 1FDOA 3QJGA 4TWAA 2G8NA 2JFBA 4OF4A 2DUUA 2CXRA 1GL7A 3DYIA 3KVVA 3LUFA 4NPHA 4WLUA 3STHA 3T06B 1RBQA 2XRZA 1H3EA 3DZHA 5IUJC 5WRFA 1X1QA 2GO7A 4U9HS 1J5PA 3KDPA 4XYEA 2X9QA 3FDZA 3JVDA 1PGNA 4KKXB 2AG0A 1ZJWA 3MJHA 4MP3A 3ECCA 1B1CA 5DCLA 2A33A 3H5VA 4COOA 2C5EA 4OFBA 3SE0A 1TUEA 5BXYA 2YWGA 4ZI7A 3NWOA 1GL6A 3C5EA 3TL6A 4DC1A 2CHGA 5JRDS 3ZY4A 4GDFA 4ND5A 3IT2A 3KWFA 4N7JA 5SYAA 5IDYA 3S7TA 3KTAA 1VKHA 4P3OA 1HE8B 3HJRA 3EYAA 1DFGA 3F8TA 2X0IA 4M9CA 2C7QA 2XJ4A 5E9AA 4DWJA 2IBTA 2GTHA 1Y81A 4OYLA 2O50A 1ZRHA 3FRIA 4NYJQ 2MT9A 3ASVA 3L1IA 4O4HA 1QTRA 2Q29A 3DONA 1Y9JA 4FD2A 5JSZA 1PEKE 2O1WA 2XQIA 1VOTA 4QBFA 2Y1WA 4NOJA 3LW7A 1M0TA 1C0EA 4R2IA 4QG3A 4WCFA 3TSAA 3JATA 1XVIA 3D6UA 1LVHA 2C29D 2QEQA 4MS4A 3NHZA 2FZEA 1EJBA 1OTYA 2J3JA 2VPXA 5B3JA 3IIJA 1R0SA 3VMMA 1LI5A 4UOEA 1WKVA 3D6VA 4XWAA 4LOJA 3UG6A 2PLWA 4O4IA 3FRJA 4FGSA 4IIJA 2I7XA 1NPDA 4AWBA 4JKIA 1ADBA 3KJIA 2GCOA 4PAOA 3IQEA 1HLFA 1RMTA 3SQXA 1LPNA 3TOSA 4LF6B 3L7IA 5CJPA 3S2ZA 2J5XA 2JVJA 2GF0A 4XDHA 3ORYA 1CUGA 2AMVA 5GGXA 3AUFA 2MWMA 1WZCA 3A6KA 3IFSA 3O91A 1BWSA 4OXXA 4PAWA 5CRIA 2PIAA 1QIHA 3RT7A 4DNXA 1I6KA 5LBIA 1ZHFA 3GUYA 1ORTA 3TQQA 1ZM3A 2DHDA 1XKQA 4B0PA 2M1XA 1QVVA 2X3YA 4KL8S 4M9SA 2A1UB 4RPKA 5D7NA 4JASB 1SNYA 1ZN8A 2Z9CA 4GHWA 3TTYA 4ZJZA 2H1RA 3FPBA 4J43A 2ZTHA 1RXIA 1I0ZA 1N6RA 2BY4A 3AR6A 1YKSA 2YWHA 5ERXA 3H4IA 2AE2A 2RHWA 2FXVA 1XDWA 3NXSA 3VU0A 4IOJA 1G2QA 2B25A 3GFQA 5HJEA 2V8BA 5MFPA 3I5AA 1H4TA 2FHSA 4D4JA 4F7WA 2GZRA 4MITA 2IOQA 4CCYA 4NCXA 1IN7A 4GPTA 2YBEA 4RFVA 4W9NC 2HU2A 4MUKA 3BXZA 2ECFA 3I2HA 4FDAA 3VPHA 4H59A 4EBBA 1FIUA 2GZ2A 5F3WB 5COQA 1NP3A 4DZTA 3N5KA 4AMBA 2FPIB 3ZIDA 4AROA 3BG5A 1RCFA 4MICA 3GZNB 4FFSA 4LBVA 1YIAA 2Y05A 1NAHA 4UTXA 3N2KA 4FDLA 3TGWA 3TLCA 4YRIA 4ZDWA 4TXJA 4RH3A 5T8KA 5IHPA 2ZB4A 4YLGA 1RMYA 4GI1A 4FE4A 1DJLA 3SE7A 1Z73A 3OECA 3PCXA 1ZM2A 2ZEJA 4WFKA 4YP1A 1G5FA 4A15A 4WNIA 2H48A 1CVRA 3KVOA 2ZITA 2AD1A 3LHIA 4JUIA 4DCUA 3D6FA 3ZI0A 3FY4A 3TRIA 2J3IA 5HG0A 1K75A 1C3VA 2VYCA 3EAFA 1SKYB 5I4CA 2HHAA 5FYDA 3RODA 2AXEA 2CF5A 2AC2A 1QQBA 4HRVA 1CY4A 2VPWA 1E6UA 4D9KA 3U61B 1IZZA 5KU1A 3QKUA 3EGCA 4I36A 3EXEA 4R2KA 1GCOA 1YZHA 2HQRA 1JHVA 2J0UB 3B2EA 4FK8A 4XDZA 3EVEA 4HVLA 3FOZA 1FS6A 1B14A 4NBKA 4PBRA 4G36A 3AETB 2FH5B 4PHTA 1W5FA 2G88A 4HF7A 4G0UA 4E22A 2GFIA 2BELA 2X4GA 2X8JA 4PQFA 4B8YA 1E7WA 2AVDA 1MO4A 1MW9X 1RM5A 2NU7A 1I2BA 3AFOA 4UMFA 2XUFA 5JAZA 3PYLA 1E2MA 5K01A 4P83A 3AINA 3NO4A 2J1LA 4YB8A 4AU1A 4TTAA 5JADA 4FEAA 1QIIA 1V3TA 2CBGA 4GPEA 2OHIA 3TUIC 3PQ8A 3H1AA 4CT5A 1ADGA 3DPIA 3QFSA 5KREA 2NLOA 4X54A 4XPIB 4BYGA 2FZLA 4C2TA 2NO4A 3UK6A 3CRNA 5GZ1A 2ZBVA 1BX1A 2VF5X 1DL5A 3PP8A 5IBQA 5CK5A 4HNSA 5I9BA 4BBPA 4DBLC 5J3JA 1KSFX 4RAOA 1SQGA 3D59A 2RGYA 3BMQA 1SRRA 3Q0EA 1TT5B 3A1VA 3ADKA 1XDBA 1E69A 4EFNA 4FBMA 5A0VA 1E1LA 2B5WA 4PZCA 1WUJS 1NFQA 4ALNA 4LZLA 1NZFA 4GSYA 3JD3A 4ZTUB 2VYNA 1FJGB 1SHUX 3BAFA 3WKAA 1U1CA 1EK0A 3FSGD 1E2FA 1SCAA 1DT3A 1MX5A 1JH9A 3FMFA 3QENA 5LUAA 1P7CA 1ISGA 3RRZA 5CDGA 3FUWA 4QYIB 4CFZA 1A8HA 3MAGA 1GNVA 1PUJA 5LP6F 3C97A 3R77A 2HHCA 1OI4A 3GFPA 3NHPA 3HLYA 4QNRA 2OCLA 2QR2A 4LHSA 4RZQA 1G8AA 1VJTA 4LYHA 1PJAA 2GN8A 2QQ5A 3F3SA 1OREA 1L1EA 1AG9A 3PGJA 2OR3A 1AOXA 1NVBA 4X3CA 3AHFA 1VG1A 4EO4A 2VTEA 1BGVA 4K9LA 1SVSA 3VKVA 4EY6A 5BOSA 2FWBA 3KOZA 1XRMA 2C9OA 2HMVA 3D5EA 1UDXA 3PKZA 4R1OA 4DUGD 4DN6A 1VPEA 5AKZA 4DR7B 1VCMA 4IIEA 3WIDA 1HH4A 4B40A 5K51A 4ZICA 3KE9A 3LLSA 4C7MA 2LDXA 4LNUB 4UM8B 4URZR 1IXRC 1NC1A 2G08A 2W7TA 4US1R 1G8GA 1OA1A 1QFXA 5J4YA 2QV7A 1FLVA 5GOZA 3NGLA 4HWGA 2Y68A 1NATA 1C41A 5H82A 1RCTE 1SPXA 1XZGA 2OB2A 1G1AA 4IQGA 4EYSA 1T0PA 2DLDA 5JXIA 5KNBH 3C6QA 1SUDA 3NKFA 3B1YA 3DFKA 4H7HA 2F64A 1XCPA 4H16A 4LBWA 3I39X 4GBED 1OYOA 1WW3A 4MKRA 3KYCB 3TNLA 4OEHA 3Q0IA 4RFSA 4D8XA 2PCLA 1C9MA 2QR5A 4P86A 1XRPA 1NPTO 3T9AA 4MDEA 1E2HA 1WP9A 5HNKA 2CV1A 3L02A 3EVCA 4HFJA 4NZYA 2Z09A 3G2HA 5JARA 4F97A 5B2FA 1C5KA 4B2IA 4IO1A 2W2LD 1FJHA 1MR3F 2ZIXB 3CN9A 3OC6A 3UFBA 4BKRA 4ENUA 4NXMB 2YYYA 2FWRA 1B3BA 3IBGA 2Q6KA 1SXJB 3KQTA 1SBHA 3G5MA 2E18A 2K2QB 4NNOA 4P31A 3TJZA 4IHJF 1LNSA 3OEHD 5D3ZA 2Z04A 1LPBB 5BN3B 3D8NA 3MEQA 3AJAA 3T35A 3L6RA 4QJ3A 5CAEA 5CXQA 4QOEA 5FLKA 4KK4A 1JBKA 3GOQA 1C7EA 1TTTA 1QM5A 3AI7A 2HRQA 4XGKA 1X1EA 2G76A 2JC3A 2MSLA 3QBTA 4NCIA 4BMPB 1BTOA 2HDWA 4J0FA 1NLUA 2PU7A 4EKIA 1N1EA 3WKCA 3PHBE 1SUSA 3RC1A 4L8YA 4O2BF 5E9QA 4PZAA 1HL3A 3I01A 5TEVA 5CB8A 1G5QA 5CEEA 1KO5A 3MYYA 3RKSA 2EGUA 3UOWA 4F9GA 1XGKA 1BXZA 3WK4A 3TAXA 5BUCA 3WSWA 2GEBA 3B48A 1VI2A 2XBLA 3O2JA 2O3UA 4IGKA 3OOEA 4AZVA 2VSNA 4B3DA 4JL5A 2NO9A 4INOA 1C7IA 2BFOA 3CLTC 3SLRA 3PPIA 4Q47A 3STWA 2PS9A 3FZNA 4PY2A 4JIMA 3UXMA 2D1FA 5CYFA 1K8RA 3E5NA 4G8BA 2ZS9A 2CVZA 3DHYA 3MWYW 1MN6A 2PL9A 4QGHA 4CM5A 3QPDA 5TLSA 4Z7QB 3EUWA 1VPTA 3ONFA 1GPUA 1SY7A 3IVXA 2R1VA 4KO1S 3IDQA 4Z7NB 3WQQA 3AEKB 2B94A 3L01A 1V45E 3NXKA 2XCTB 3NKVA 3K35A 3AR9A 5A6VA 4DLTA 4P34A 3PNYA 4N39A 2DB3A 1VZ3A 2AG8A 2P9FA 2CF6A 2XOXA 3D8UA 2DG2A 5AM2A 1JQAA 1XU7A 1ICIA 2EG9A 3K0KA 5LB4A 2IW1A 1TKAA 2FW6A 3CZCA 3ZHBA 2PX0A 1S8OA 4XYBA 5FUYA 1ZH0A 4MGHA 1HDYA 2XYRA 3A0UA 3EWAA 3KOYA 3ISVA 3HYNA 5ITZB 1PW5A 2RK3A 1H6AA 2BI8A 4KQ1A 1M7BA 4XUCA 3ZD8A 4EJSB 1JECA 3N6RA 3R6TA 1KARA 3GNLA 3O7WA 3SVZA 1CS4C 4BGDA 4PPGA 3K72B 4B09A 1SD2A 1ECPA 4QO7A 5IC5A 1ZNYA 3E6AA 2DPGA 2X6TA 2CB0A 2IHUA 3HJBA 2E85A 1T6BY 1W4CA 2ZTMA 2ZT6A 3GPIA 1P3JA 4REOA 1KO1A 2V8OA 1XP5A 3EW7A 4JP8A 2CXTA 3RC3A 1Z88A 5J2TB 4CE6A 4J49A 3AWDA 5TPZD 4BRWA 4PO3X 3CRQA 1LBSA 5EINA 1PDWA 4I4LA 3THWA 1ADCA 5E38A 1Z0JA 4EYKA 4HWPA 2HK7A 4DYDA 4KQ9A 2R8OA 2WJ3A 3A11A 3GT7A 5E4TA 4GW3A 2NNWB 1VMAA 3AESB 1W0JA 1IIRA 1B6RA 1YKGA 3V4SA 4LI0A 3LT0A 2YY6A 1PEYA 2Q5LA 4MKZA 4U4AA 3BXEA 4ZMSA 2BMDA 4FR0A 1P60A 3PIRA 3W2TA 4EFLA 4L5JA 3O1LA 4Y6RA 1PZNA 2G9VA 4PINA 2UYHA 2Z6QA 2WVAA 2COEA 4QU5A 5ALIA 3HZZA 4EA6A 1LY1A 4KR6A 4M88A 2NZ8A 1P44A 3PJEA 4ONEA 4WFQA 4UZSA 3TBFA 4BB0A 4C20A 1ZX1A 2Q3DA 7AT1A 2XMCA 4UU7A 2A59A 3W79A 1ODTC 3AZPA 5L7WA 1JG7A 3FCXA 3EEOA 2ZDGA 2FVYA 1OKKA 4CM3A 4HS4A 1QGZA 4LTDA