3CPJB

Crystal structure of ypt31 in complex with yeast rab-gdi
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
198
structure length
164
Chain Sequence
YDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMGVEFATRTLEIEGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDSKSSSYENCNHWLSELRENADVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALSENVDKAFEELINTIYQKVPTISL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Rab GDP-dissociation inhibitor
publication title A structural model of the GDP dissociation inhibitor rab membrane extraction mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 50
structure length 164
sequence length 198
ec nomenclature
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cpjB01
1YR9A 1E1RA 2WJVA 4MRRA 1G18A 1N5KA 2D3WA 1JQJC 5FUXA 3RS3A 3WXMA 3ZGXA 2OBMA 5IHPA 1T3HA 3LFUA 2C03A 4GOJA 3GJXC 2CBZA 4NCJA 4PAOA 1PUIA 1SXJD 4ESVA 2QENA 2ZR0A 4KU4A 3RSLA 4BASA 1G16A 1DVRA 2JJ1A 3QKRA 4D2IA 2RGDA 4U02A 2C98A 1T91A 4R9UC 2XJ4A 2QM7A 221PA 4M1WA 2P0EA 1AS0A 2NGRA 4F4JA 5IK2A 2VHQA 2HJGA 4KV9A 4ILEA 4KI0A 2ONJA 3CH5A 1JQLB 2REOA 3L0OA 1Z5ZA 1DG3A 1KY2A 1NMXA 1ZBDA 3LDAA 4FCWA 1HT1E 4UXHA 2ATVA 4UNPA 1YZGA 1EWRA 5FOUA 4B71A 1FNMA 3VNVA 3GFOA 5KO2A 5K8UA 2UZIR 1X6VA 3AUXA 4S35A 3R9IA 3QF7A 4DLXA 3W9YA 2IS1A 5DI3A 2G88A 1H8ED 1ZUHA 2OLJA 1QHNA 1XFAA 4XVRA 2D7CA 5DE3A 3LBIA 1E2QA 2IL1A 4LZZA 3EPKA 2N46A 4TMWA 4ZI2A 5K8TA 2DYKA 3CW2A 1W4RA 2C96A 2IS6A 1IHUA 1KI6A 1VPLA 3ASYA 4WZ6A 3FHTA 5E7JA 4LCBA 3T06B 2V7QA 4PAMA 1OXVA 4DSTA 1D2EA 3D6TB 5BWMA 4AI6A 1JXOA 2D4HA 4D6PA 2QRZA 4ACBA 2IUUA 1Z8FA 2RHDA 3K8YA 4A9AA 5J4VA 1J90A 4G5SA 2ZRPA 4QL3A 3EC2A 2O8EB 3SJAA 1O87A 1XCGB 1NY5A 3QJYA 4G5RA 2R62A 3D31A 1Z28A 3V9PA 4CVNA 1JPJA 5EP2A 5K8IA 3TSWA 5KYKA 2E1RA 3FE2A 2IWRA 4U7DA 4PR0A 1TMKA 4WBSA 3LAWA 1D9ZA 3AF3A 3QXXA 2X1VA 3IIJA 4MKIA 4TLBA 4AK9A 4FD2A 4MA4A 3L2OB 4ZDKA 2V3CC 3WHLA 1E2EA 2ZS8A 3THOA 2OBNA 2P3SA 1II9A 3K0CC 1EFHA 1FL9A 1S9HA 1TAGA 3HPRA 4LJ8A 1AA9A 1IM2A 1DAIA 1IXZA 2QTHA 4FWIB 4OBEA 4QKQA 1BMFD 5EZ5A 4MRPA 4JLPA 1Z6GA 3BERA 4EPVA 2JLWA 2CJWA 3SHWA 1EFUA 2H17A 2PCLA 1FUKA 1MRNA 3H84A 1IY1A 3UPUA 3AVYA 1CR1A 2O8DB 1A2KC 3KB2A 3NH6A 2OESA 3BS4A 1BKDR 4TQAA 3DKVA 1NVUQ 3LLUA 4BZPA 2QGNA 2ZI4A 4TSFA 1NKSA 2ZIAA 2A3RA 4D4LA 1T8TA 4AIIA 2ZANA 1GTVA 1GM5A 4DJTA 2B7BA 3K9LA 1K5GA 3WMFA 1E6CA 1SVMA 1DARA 2GK6A 3KXLA 1G3QA 5FI0B 3UXMA 4XWOA 5K8LA 2RGXA 2OAQ1 3L8YA 3QY0A 3BORA 1MH1A 4LBYA 1OXSC 3Q9LA 1Z6XA 3OESA 3MRSA 1VYUA 4M1KA 5GVRA 1XMJA 3ZJYA 2IEYA 1P2SA 5EE1A 2GEUA 3GEEA 4NBSA 2FSHA 4L16A 1OKKA 2FF7A 4DLZA 3SBEA 3NKVA 4ITRC 2V54A 5M04A 4TLEA 1MOZA 1WE2A 2HCBA 2ZS9A 3K0AA 4HB0A 3TSZA 2FA9A 1W4BA 3K70B 5BYJA 5EXXA 4HUTA 2PX3A 4A0RA 1OYWA 4JL5A 3NBYC 1P75A 3BB3A 2YVUA 4IXNA 1JBKA 4IOMA 3CPJB 4QGHA 4TYQA 3AVVA 2H1LA 3KTAA 1Z6AA 1II8A 2WIAA 4IVQA 4PPFA 4M2LA 1N5IA 3MWJA 4RD1A 4O25A 4ESHA 3FTQA 2F1JA 3U4QA 3RDPA 4LK2A 1UKYA 1N6OA 2J3EA 4QM6A 1Z0FA 4TYYA 1Q3TA 2V1XA 5FPTA 3QI2A 1E9FA 1WDTA 1Q1QA 3LXRA 1U99A 2FG5A 2C8VA 4D82A 3AVWA 3A1UA 4A92A 3N70A 2PX0A 2W2VA 2C04A 2C78A 2JLQA 1Z2AA 3ASZA 3AB3A 3ZVMA 4DUGD 4AYWA 3CONA 1N6KA 1X3SA 2ZRAA 3K0FA 4TZ0A 4AKIA 4D4KA 5GJBA 4WVFA 5KNBA 5FPSA 3U3JA 1XZQA 1KIMA 4LBWA 1D2NA 5KDDA 1TF2A 4XWKA 2XZLA 2FFAA 5J4YA 1GKUB 3P27A 2HF9A 3W5IA 1P62B 5FPYA 1LB1B 2H16A 1M74A 4HEJA 2VL7A 2WJIA 3B78A 3RC8A 1E96A 3B1XA 3WYFA 5JZVA 4NYIQ 2JJ2A 2X2EA 3BIFA 4QHSA 3EIEA 1S96A 4RZ3A 2G3YA 3IEVA 4AD8A 2QL6A 1J99A 2K5UA 2XB4A 3SJZA 1W5TA 1L8QA 1AQYA 3QKSB 2NO0A 4BLOA 3DEFA 1XXHE 2VBCA 3TE6A 4W9MC 2QU8A 1TQDA 4RY2A 821PA 2IXFA 5JS8A 1FUUA 3NBZC 4TWZA 3SE0A 2DY1A 3SS8A 4DCNA 5EP1A 2QPOA 4G5GA 3MCAA 3HU3A 2G6BA 3RRMA 1ONBA 2GNOA 3CZQA 1WBDA 1NBMD 4RSGA 2IF0A 2FFQA 2OCPA 3H1TA 2ZJAA 3KQHA 2UVQA 1E1RD 1EGAA 2Q6TA 4Q01A 1KO4A 4P33A 5FFMA 2SHKA 1HE8B 4UJ3A 5HR5A 2F3TA 4DDTA 1KKLA 4YDSA 1W2HA 4JBWA 2ZRJA 3TIFA 3BK7A 2JJ1D 1TU4A 3B8HA 1ZNZA 3VFDA 4HAUA 3DDCA 5JCPA 5KPJA 4N0DA 1MR3F 1UBGA 2IXGA 3THYB 1NLYA 5F3WB 1E3MA 2ZPTX 2W0MA 1MABB 1ZCAA 4G1UC 1KDTA 2ZJYA 4B3DA 1U0JA 1XZPA 3LQRA 3QIAA 5CM9C 3CF2A 2WJGA 2WKRA 2G1JA 2FPLA 2Q9CA 3C8UA 1KMHA 4B48A 2VHCA 3QXSA 1CULC 1BO6A 3CF0A 1R2QA 5E7IA 3TR0A 1OIVA 1DBSA 1R8SA 2CCJA 3AVPA 4YLGA 5EZ6B 2R6DA 4B76A 2OCAA 1QHYA 2XTZA 1TPZA 2XX3A 4HYYA 2PEYA 1RJ9B 5JJKA 3SYNA 1XD2B 4JJKA 1U0HC 2CHQA 3QF4A 1EXMA 2NO7A 3LWNA 4JL8A 1VKJA 2MSEB 5ELXA 2AXNA 2J0UB 4DDVA 4XJXA 2AKAB 2GZHA 3GEHA 4BUJA 2ZUDA 3C41J 1NJGA 3U61B 2ZUBA 1US8A 3K53A 4TMVA 2GAOA 3VR1A 3U44B 4DRZA 4YMUA 4EKDA 4CEHA 2NOAA 1P6XA 2MMGA 4P4SA 3FKQA 3EIQA 2V7QD 5F9HA 2BM1A 4XOIA 5DHFA 3W6OA 2IHYA 3O8BA 3RS0A 4YMTA 1NG9A 2HV8A 4BFUA 2N1BA 2Z0MA 4LHZA 3DZ8A 3W6PA 2WWXA 1GL6A 1AIPA 1KAGA 1UEJA 1KK2A 2YWEA 1GKYA 3LX5A 4QJ4A 1DPFA 3CB4A 1Q21A 3RS5A 5EE3A 4M21A 2ERYA 3CKLA 421PA 4G5OA 4B3CA 1XX6A 4A2QA 2NZJA 2ZYWX 3BRWD 3IQXA 4DEXA 3X2SA 3TAUA 4KLNA 4LRWA 1QG2A 3TUZC 2CNWA 4KO8A 4NHOA 3KKPA 1SHKA 4Q5IA 4AC9A 1CKEA 5CDFA 4YQFA 1X8KA 2GTPA 3LY5A 1GNRA 1IXSB 1T3SA 1E98A 2IYVA 2A5FA 3REGA 1M2OB 4OK3A 1TF7A 1YE8A 1W44A 1CP2A 4Q7KA 2FZ4A 3ZVRA 1M34E 4I1VA 4E07A 4JL6A 4LBZA 2BJWA 4M8NE 3EA0A 5D3MA 3FMOB 4AG6A 1Z0IA 4TSFD 5FTLA 1OH6A 3LQQA 1KI2A 4FIDA 4CEIA 2JLXA 2OXRA 1P73A 3LVRE 2VF7A 1NRJB 2AKYA 2IS2A 4P3YA 2FX3A 1KMQA 4BLTA 2NQ2C 5TV2A 4LV6A 2D62A 1G7SA 4UNSA 2D06A 4MKFA 3T1VA 2XZOA 2IYRA 4GP6A 1RRFA 1PUJA 2QMOA 3WMGA 4EJSA 1ZM9A 4M9ZA 4IKEA 1H8HA 1FTNA 1FW6A 4DIDA 1W36C 4B75A 1K6MA 4D81A 4M1OA 4IFEA 1N6HA 5HCNA 4IDHA 5EQTA 1ZM2A 2EWWA 1ESNA 4QBIA 2P5TB 3ZIAA 1GRRA 3RS2A 3ICEA 1QVRA 1Y3AA 2BBTA 5E3HA 3T34A 5J47A 2QN6A 5ANRB 1UADA 1VG9B 1WBBA 1VYVA 2ZRIA 2I1QA 5KDOA 3K09A 2Q9AA 4PPNA 3B6EA 4OHWA 4CGZA 1SGWA 3EZ7A 2YJTD 3L0IB 4B2IA 2W6ID 2GVZC 4DB4A 1KK1A 2ZTSA 4GRAA 3N5CA 4TL9A 4A8JA 1CEEA 2BMEA 1ZIOA 3OAAA 4QJ3A 3CF6R 4LI0A 1NKTA 4M1YA 5DLQC 5JEDA 3DOEA 3MWYW 3I1FA 1G9XA 1G17A 2YNMA 3W5JA 1VIYA 3NXSA 1VG8A 4Y0AA 3ZYCA 4WZAE 2C9YA 2NTYC 4Q4HA 5EJEA 4FWTA 1YU9A 2GJSA 2ZI5A 3A58B 1PLKA 2PCJA 5FOXA 5GJWC 4F92B 4XWAA 1M7BA 3KKMA 1BYIA 2YINC 4X8HA 2P2LA 3FB4A 4AURA 4E09A 1OFUX 1ZNXA 3FKSA 4POAA 4HZIA 5JI2E 3NDPA 1NVWQ 3CRQA 3OZXA 2XOKD 4Q1FA 4TYNA 1XD8A 3GMTA 3RHFA 3JVUA 3DO6A 1KNXA 1GKIA 1M7HA 2AFHE 3B1YA 1GWNA 3R8CA 4Z51A 1M8PA 3T35A 1BYUA 1Q1ZA 5E4FA 1Q3HA 2R6CA 1RYFA 5CIQA 3QBVA 1AQUA 1AS3A 4UXJA 2JGNA 4RKFA 1LV7A 4JKYA 5C46F 1IY2A 3IPXA 5JSZB 2YWHA 2VPPA 2H7VA 5JHGB 1OYYA 5UKDA 4HB2A 2RAPA 2GF0A 3T5GA 4JYBA 2QP4A 4C0AC 1XXHB 3VU9A 2OFOA 1KO8A 4YMWA 4BZQA 2A5DA 3UANA 5DYGA 3WHKA 1P4SA 4HLUA 4I99A 3ADCA 2ZETA 1Z6TA 1EFRA 4NMMA 4X8MA 1XF9A 2YZ2A 4TYWA 4HI0E 3SN6A 2FFHA 5DNYB 2QE7A 2HCJB 1N0VC 2VSFA 1DAGA 5AJYA 3RLFA 3SZRA 4DDWA 2GJ8A 4YMVA 3UKDA 4HAYA 1JR6A 2CMKA 2NO6A 2GXAA 4URWR 4FMCB 2FDCA 1XCPA 2PZFA 4I1UA 4MITA 2Q3FA 4D26A 4IOLA 2LKCA 3ONWA 1ZUIA 4BRWA 2CE2X 3KJIA 3K09C 1OFTA 2MSDB 2W0SA 4RFVA 2IXEA 5FUWA 4BFWA 2VP4A 2VP6A 2ECKA 1SKYB 1ZU4A 2R6AA 4M9XA 2XEXA 1LFDB 2JEOA 4RD3A 4BLRA 1G7RA 3TNFA 4CDGA 2OSBA 3KKQA 1KSHA 4MGYR 2ODEA 4JLKA 3GJ4A 4JLJA 2OCBA 1RVDA 5L3QA 5KSZA 1SZPA 1XTRA 1A1VA 4WXPA 3CX6A 2OXCA 4Q66C 3R8FA 4B32A 2YC2C 2QRNA 3I5XA 3FWYA 4C3ZA 2VP0A 1F2TA 2OG2A 2GCPA 1G3IA 4MGIR 1GFIA 3NC0C 2J0QA 2F3RA 1V43A 4NCHA 4DEYA 2JA1A 3MJHA 4URVR 1G20E 2J9RA 2R6FA 1JXMA 4FI3C 4XTRA 5FBLB 2GK7A 4OYHA 1AZTA 5CYPA 3SR0A 1JECA 3PUYA 2OFWA 1FPMA 4XTCS 4L5BA 3C7KA 2RH5A 1S3SA 2GXQA 4Q9HA 1NY6A 3O8RA 3U2QA 1G3UA 5DSZA 3ZQJA 3SQXA 3PIRA 2OO7A 4RVCA 3W3ZB 4JYCA 4PANA 1R10A 1U0LA 2BV3A 5EE5B 4EFNA 2RGAA 4FCTA 1X8JA 4UQOA 3SYKA 3TQCA 1HE1C 4M22A 5TDHA 1GILA 1XP8A 1GNPA 2QAJA 1CJVC 4X8OA 1UEIA 4TZ6A 4LJ7A 1DOAA 2WIBA 2IUTA 1OJLA 1XTJA 4HLUC 1KO1A 1SVSA 3HR7A 1NLFA 4RZXA 2W83A 3H2YA 1L7VC 2X8AA 3TVTA 5CM8B 5H70A 4R7ZA 4EQ6A 5J40A 1P2TA 3JVVA 3G5UA 2JDIA 3LV8A 2IYYA 2BHRA 2BKEA 2BC9A 4A0GA 1VDZA 1N0UA 4NYIR 4IEIA 1U81A 1F48A 2JATA 1Q1BA 2JLZA 5H1YA 4TT3A 2FE4A 2IC5A 3A4NA 2QTFA 1ZU5A 1E2KA 1EK0A 2AWNA 2W58A 1GZSA 2VP5A 2QP9X 3MD0A 1S4QA 1Z83A 2IYSA 2KI5A 1HY3A 1W1WA 3L0PA 1QF9A 2FGJA 3CH4B 3ETLA 4Q4JA 5DI3B 4C0LA 4PTLA 2PZEA 2KE5A 3SBDA 3NHBA 3ZD7A 2GF9A 4LHYA 4URYR 5P21A 2W6JD 3QG5A 1IONA 2OILA 3IDQA 3QXHA 1G4AE 4IVRA 1A5TA 2EU8A 4O2LA 1W0KD 3B1ZA 3FVQA 1LS6A 2XXAA 2GEVA 4UXIA 5IRCD 2REXB 2PZGA 1KI6B 3Q7PA 5GVSA 5BN5A 2V4ZA 1E1QA 4Q47A 1RKBA 1DAHA 1KJYA 2GKSA 2BMJA 1U2RA 1JNYA 2NO1A 2HT6A 3OIWA 5DN6A 2X19A 4BFYA 3WP1B 4MYUA 4Q4AA 1CR2A 3FMFA 1H8HD 1T5IA 4B35A 2EYUA 3BD9A 1RE0A 1VCMA 1KK0A 2A2ZA 3FPAA 4BFSA 4XVUA 4GZLA 3KKNA 4F4CA 1CRPA 3VTKA 2VRWA 1XJQA 2XSZD 3QOFA 3TKLA 4RJLA 2WWIA 1GG2A 3KDSE 3ZIAD 3HYRA 1U8YA 1MO4A 5JJIA 1XJCA 1VIAA 3LA6A 5KSYA 3CRRA 4Q1AA 4JKIA 4B6EA 3CNOA 1L4UA 3EAQA 1GAJA 1KYIA 5SZJA 2OEPA 2QQ0A 4WXRA 5CDFE 2XGJA 2ZU0C 1FX0A 4UKDA 4EPYA 2CL7X 2BCJQ 3CNNA 1G64A 4PXAA 4PC1A 4TL7A 5CJ2A 2CJWB 2ZSFA 1X1RA 2GJKA 3CWQA 2D2FA 4OHVA 1N5JA 3OAAD 2W2XA 2GETA 4Y0VA 5FOTA 2FN4A 1RC8A 2HLDA 4D0GA 4PPGA 2O8FA 5AJXA 4Q18A 3PJRA 3UWKA 1OT3A 5LDDC 4C0HA 3P4XA 2G0TA 2O5VA 2Z43A 5JFGA 4QGFA 4OHZA 5A5GA 2GA8A 1W46A 2BDTA 1KI3A 3KKOA 4EPXA 1BH2A 2CLCX 3IHLA 4QBHA 3IKJA 4MRSA 4URUR 4PHGA 4ZV4A 2HT1A 4A82A 5FI1B 2FEOA 2CL6X 5LB4A 3CO5A 3FKSD 2AR7A 1ZYUA 4IDNA 3I92A 2QSZA 2Q3HA 4C9BA 5F98A 2ZJBA 1ZINA 4M1MA 1SVWA 3HWSA 2QT1A 3I61A 1XPOA 1JEDA 4BFZA 1TADA 4I1OA 1HA3A 2J45A 4PPQA 4TMKA 1EX6A 3SI7A 4ZIRA 4V0NA 3K0AB 4KITB 3QQ5A 2RGGA 5JBQA 4DLWA 4HUQA 5SZIA 3EZFA 3UMRA 2WJHA 1E9SA 4B47A 4UNQA 3KTAB 1LF5A 3PUWA 1II8B 4MDEA 1G5RA 2BMFA 2RKOA 5FR1A 1NI3A 3F0TA 3R20A 1CLUA 3FHOA 4NP6A 4M1TA 4PSVA 1QRAA 2V8OA 3BWDD 5JMTA 1EFRD 2WPDD 1P72A 1UBEA 3THWB 4PO1A 5KTYA 2ATXA 1GNQA 3LX8A 2A7QA 3NH9A 2QE7D 2JAQA 4NTZA 3T1QA 2WWYA 1JPNA 1N6RA 1KO5A 2OLKA 4PFSA 1DEKA 1COWD 2EFCB 3QEJA 1QZXA 2TMKA 4B34A 2ORWA 3TK1A 3AP2A 1E0KA 3P32A 3DZDA 4IFBA 1J8MF 5TB5A 3IIMA 1N25A 1NSTA 3PUXA 4M0LA 4WOPA 2ZXUA 4GPTA 5IF9A 2O8EA 1E0SA 1XBTA 3MJRA 4LOAA 1YJ5A 2LCFA 5GJVC 3S1AA 1P9NA 2F43A 1OHHA 2J87A 3MFYA 3PUZA 4XSGA 1OIXA 2J1LA 3RRNA 2GEDA 1QG4A 1AN0A 2FFBA 2JJ8A 5HZKA 1E69A 1PLJA 3FMIA 1DS6A 2KBEA 2FWRA 2RB4A 1KKMA 1ZIPA 4PO8A 1IAQA 3EZ6A 2Q9BA 3UG7A 2WZQA 3IILA 4ABYA 1D9XA 1KTVA 2ZS7A 4F38A 4JBXA 2WAXA 3KUCA 4OI0A 4EAQA 4E03A 4ERNA 2WWHA 2LKDA 1TEXA 4EIWA 3AVQA 3QSYA 1KJWA 4KVGA 2B8WA 4Q4LA 2ONKA 2PMKA 2DFLA 2QMEA 4ZKDA 1KI7A 2O8DA 1NN5A 4GDFA 2RMKA 1J2JA 4ZCIA 2IYQA 1IJFA 3BE4A 2CHGA 3K1JA 4OJKA 1E9RA 4Z8YA 3TH5A 3LVQE 3J81k 3GLIB 1NVXQ 3DVLA 1AM4D 1DAFA 1TU3A 1LW7A 1SULA 4JVNA 1JR3A 1XB2A 1XEXB 4HLQB 4MKGA 4GZMA 3FFAA 4TTRA 1MV5A 1NIPA 1ESMA 3NDBB 1S8FA 3LNCA 1F2UA 4RD6A 1XTSA 1RRGA 4WW0A 4FMDB 1IXRC 3B13B 2GILA 4P4UA 3BGWA 1A2BA 2UZ3A 4LJYA 3WP0A 1XU4A 2G1KA 4G3XA 3X1WA 1IQPA 1WMSA 2A5YB 2RGCA 1A82A 3A37A 3VQTA 5FBVB 4V0KA 4QOSA 3E2IA 4MRVA 3TUIC 4HAZA 3REFA 2ANCA 1TTTA 1I2MA 2DR3A 3IHWA 5C4MA 4CIDA 1U94A 4BLQA 1GOTA 2CLSA 1GRNA 4EFMA 1IN6A 3IUYA 2WHXA 1K5DA 4Q7JB 1DE0A 1R6BX 1TNDA 4Q1CA 1GSIA 4UJ5A 5LBIA 1GL9B 3WNDA 2J7KA 1IBRA 1SKQA 3NEJA 3QEOA 4TT3D 3GLHB 3IBGA 4PZLA 4US2R 1KMHB 4W5HA 3U7EB 5JJLA 2IUSA 2ZM5A 2H92A 2Z83A 4J0QA 5JWOA 1IN8A 4KBFA 5CK5A 2X77A 1E79A 4YDHB 3W34A 4HAXA 1IY0A 1W4CA 2ZRDA 3MG9A 3ZS8A 2WTUA 3JZAA 2O8BA 2QORA 4BFVA 1OXUA 2MSCB 4LJ9A 3UATA 3QF4B 4X8LA 4Q1EA 1W36B 1GL7A 5KU1A 2JLUA 1AJEA 3X1DA 2KB0A 3OFNA 3AF2A 2O0JA 3BXZA 4QBGB 1L4YA 4PHFA 4O3MA 2C77A 3I72A 3C14C 4V0LA 4LYJA 1SVKA 5HE9A 4GP7A 4CEJB 4DLTA 1US8B 2PEZA 3QVVA 5JWRA 1Q12A 4O0MA 2NIPA 4RD4A 4RCZA 1B23P 3GJ0A 4CEHB 4LHXA 3RAPR 4P4SB 3WYAA 4IDOA 4TMZA 3C5HA 2IYUA 1H65A 4JVSB 1R4AA 4PO9A 3RC3A 5DN6D 1Z29A 3AKDA 3F3YA 2PT5A 2Y8EA 1W48A 3KFXA 5IK2D 1N6LA 2P6RA 2J5XA 4MYHA 1XMIA 2ODNA 4Q1BA 1XCMA 5EE0A 1XTIA 2O8CA 1Q0UA 5FBRB 3FHCB 5FOSA 2EFHB 3RANA 3VR6A 3CRW1 3SJBA 1I4TD 1ZUNB 1G7TA 4W5JA 3CR8A 4M1SA 4BPBA 2W2TA 1YHNA 1E4YA 1I4LD 2AD1A 4CRWB 4PQFA 2IX3A 3Q7QA 1OF1A 3QKSA 2JLVA 2PLRA 3SFZA 3TRFA 3RVBA 4NYMR 3QPUA 5JEEA 3X1XA 3OIVA 5FH9A 2VTKA 4OI2A 1JEEA 2WAYA 5J4HA 2QBYA 1Z0KA 2ZR7A 1FQJA 3U5ZB 3QXJA 3P4YA 5KOYA 3UWOA 4CEIB 4OJQA 2PMDA 2ZRKA 3VHXA 3V4FA 2B6HA 1YRAA 4ON9A 3Q72A 2WWWA 2WMNB 2PL3A 1E9DA 2A9KA 2AHOA 2VIIA 5CIWA 3ADDA 4JSTA 1VTKA 2QAGA 2QP3A 3WNCA 4D0NA 2B21A 5G40A 1W0JA 2ORVA 3OE7A 1UKEA 1NMYA 1J8YF 4PZZA 1E2GA 4E22A 4NDZA 2HYIC 4LY6A 3M0EA 3THYA 2V6IA 3B9PA 3FDIA 4PC3A 5F9FA 4WZBE 4A2WA 2C95A 2PJZA 2XITA 4MUBA 3VR4A 2NMVA 1T6NA 3T61A 3U6KA 4F7WA 3TLXA 1KGDA 1OFHA 2WWGA 1O3YA 1KSJA 4HB4A 4KFUA 1U9IA 1RRPA 1UF9A 3QKUA 4BWYA 5KUTA 3O47A 4C2TA 1YQTA 3ZS9A 4D25A 3BC1A 3VR5A 1M6NA 1N6IA 4OI4A 1S3GA 1MT0A 4M53A 1RFLA 5L3SB 3RABA 3QXCA 3KQNA 2GZAA 1E2DA 3BFXA 4DT1A 4QNMA 4URXR 3BFKA 4LJ6A 4HZUB 1U90A 4B3XA 4WAUA 2F7SA 1XRJA 1TQ2A 2IA5A 2XTNA 3UMSA 1E9CA 3LLMA 5DHAA 1OXXK 1XD9A 2GHIA 3C4JA 3RRYA 2WWFA 4XIGS 3KQLA 3U44A 1HV8A 2AWOA 4IEEA 4A15A 1DTSA 2F9MA 5HE8A 5AUPB 4MH0R 3AGPA 3L0SA 4OQNA 4IOJA 4M9QA 2OBLA 1OKKD 1SXJA 3GLGA 1YZKA 3AF1A 1YR6A 2GDJA 4B3GA 1OV4A 3CM0A 2OUKA 4AYTA 4M4SA 1OHHD 2VSXA 3IIKA 2EQBA 4OK5A 5FOVA 1IOZA 2ZRNA 4DHEA 2FH5B 2CCGA 4UNNA 4US1R 1GVNB 1ZP6A 3A8TA 1G5PA 3HP1A 2C99A 4PSAA 1E2IA 4GT1A 1VCNA 1YZUA 4QBFA 5CJPA 2DPXA 3TAHA 1ZMXA 3I62A 2GXUA 2I4IA 5H8WA 4WIAA 4ACAA 1MKYA 2HXYA 2ERXA 4P0TA 4QNRA 5C4GB 4TL8A 1E9BA 3U3OA 1ELOA 3TUJC 3W8RA 3T1TA 2QAGC 1VYTA 1KZGB 3A4MA 3QENA 4DXAA 4BGDA 2AN9A 2IYLD 2GWHA 4EPTA 3W6NA 3VU9B 3VNUA 1GP2A 3AGQA 2FMXA 3M4YA 2REBA 1GRQA 1G8GA 1A4RA 3IO5A 2FJUA 4A2PA 3GPLA 5FR2A 2F9LA 3P1JA 2CCKA 1I4DD 4W5WA 5B58C 4TLCA 3TVDA 2B8TA 4MRNA 2BMDA 3TR5A 3W90A 3ZVNA 2ZJZA 4NCKA 3DM5A 5FTJA 3U3RA 5DI9A 3GJ7A 3QKTA 3AVOA 2CVFA 1KSFX 4KLZA 2ZRBA 4US0R 4LHWA 3GP8A 3EPHA 3F8TA 5B2ZA 2H8KA 4LPSA 3MWLA 4BLSA 5CB8A 4BFXA 4IVPA 5EUMA 1YZLA 1OH5A 2JCSA 2QROA 3AKCA 4KCGA 2ZE7A 5JHHB 4ARZA 2X2FA 2ZJ8A 4JLAA 2VSOA 4MGZR 4LWZA 2JJ2D 2Z6VA 5TY0A 2ZYVX 3GJ3A 4V0MA 5L3QB 2F1IA 1E94E 2GJ9A 2DFTA 4MKHA 2R9VA 3H86A 2XAUA 5FOWA 4C0SA 4EJSC 2I1VB 4DLVA 3CX8A 3GLFA 4TYPA 2H57A 1F2TB 1G8YA 3EZ9A 3OF5A 2NO9A 3LW7A 1E79D 1NVVQ 1BMFA 4Q9LA 2BEKA 2DWOA 1WF3A 1OSNA 3NBFA 4B3BA 4EPWA 1SXJC 2WKPA 2GCOA 1T3LA 4QHYA 2I3BA 2R6GA 4DCUA 2GESA 4LPKA 4LC1A 2WOJA 5FTMA 3OFND 4PX9A 3E5HA 3I8SA 3CPEA 3MSXA 4YC7A 4DSUA 5B30A 4LV8B 1KI4A 2QT0A 1FQKA 3TMKA 2ZI7A 4OI1A 2ZE8A 2FPMA 3LXXA 4N1AA 2ZR9A 1ZAKA 3I32A 2IS4A 4XD7A 1JR3E 5HZHA 521PA 1DELA 1EFCA 2HUPA 1KNQA 2FEMA 2ZSBA 4ZKEA 4MYTA 2CE7A 4JZKA 3PFIA 4RFSB 8OHMA 2QMHA 1E4VA 4A8JC 1UBCA 4L9WA 3R7WB 2YYZA 4FCVA 4LC0A 2VP2A 2GZDA 1RW4A 2QPTA 1FTSA 1GITA 1LNZA 2P65A 2VO1A 5AJVB 4E5UA 3EC1A 3ECCA 4C2UA 3K9GA 1F6BA 4Z1MA 5A0FA 2QM8A 4C0KA 4AG5A 4G01B 4JBYA 2C2HA 4A1FA 1R0WA 4EQ6B 1E2PA 2VHUA 3DL0A 4I1SA 1CS4C 2DCUA 1VCOA 3M6AA 5JSZA 4HLCA 3I4LA 5G3ZA 3SFVA 1E2JA 4L15A 2CEAA 1PJRA 3DHWC 4JLNA 1W36D 4NYMQ 5EXPA 1FMJA 1YVDA 3ZZ0A 5HKKA 3I8XA 4NKRA 4DIEA 5TARA 3LO5A 1Z2CA 3P20A 3R9XA 4Q4JB 4NONA 1XMVA 4JVMA 1VHLA 5E95A 1YR7A 1G7CA 1JAHA 5AUNB 1R8QA 4KFRA 4OHYA 4LJAA 3PG5A 3WBJA 2VF8A 4TMTA 2WMOB 4TTQA 3I5YA 4BEJA 1OIWA 1RRCA 1IN7A 1E9EA 1W47A 2ZREA 3IPYA 3QKRB 3T15A 5DISB 5L8VA 3R9WA 2ORIA 4JS0A 4AY2A 3SNHA 3PEWA 3C15C 1W0JD 4D4JA 4MDFA 4Q9IA 4Q4AB 1Z07A 4DUGA 1BIFA 4BLPA 1VECA 5EE9A 2ASEA 4B2LA 4DWJA 3BBPA 1AGRA 4C4PA 4AKHA 2CNWD 1U8ZA 4C0BA 2KSQA 2E87A 1F3OA 3AF4A 4L4UA 3PXGA 1CTQA 5B57C 4FMCF 4BFTA 4C7OA 3RRZA 2IYWA 1QHIA 1E9AA 1Z63A 3EX7C 3DPUA 4GOKA 2CLDX 3I73A 2ZU6A 2IW3A 4Q7LA 3GFTA 4TMXA 3PVSA 3THXA 3BJIC 2HEIA 4B3FX 2QI9C 1CR4A 1ZNYA 3B5JA 2FSFA 2IYTA 2BCGY 4PAQA 5EP4A 3D8BA 3EG5A 4HB3A 4TLDA 1FZQA 1M1YE 4M9SA 2N42A 2RCNA 5TMPA 4KHZA 3WNBA 4Z8XA 3BH7A 2FV8A 2D2EA 3OIUA 4BEBA 2H18A 1UAAA 4NCIA 2VQSA 2YV5A 1DO0A 3WBKA 2ZRHA 1W4AA 1ZCBA 2ODBA 4DBLC 5JWHA 5LD2C 1TUIA 2OAP1 1CR0A 1R5OA 2CXXA 3K0EA 4IJMA 4DKXA 1SHZA 1ZM7A 1W49A 4LYFA 4IDQA 4OQLA 4P4TA 3X1ZA 2HXSA 2OZEA 2F6RA 3BAFA 4NZYA 4DDUA 1CXZA 5EXSA 1OW3B 4FINA 3U60B 1T8UA 2BBOA 1W5SA 3OIYA 4RCYA 5JRZA 4QG7A 1HQCA 1XEWY 4NYJR 4HDOB 1TQ6A 3ZZUA 2GXSA 3RNLA 2YOHA 5JS7A 4JVLA 3T1OA 2QSYA 1QHHA 1XPRA 2WSSA 3AEZA 4DC9A 3TJZA 2QTVB 1ZNWA 2ZRFA 3B1VA 3VAAA 4ZIRB 4V02A 2OV2A 1Q22A 3SYLA 4GNKA 3UMFA 4TN1A 4PHHA 1G6HA 3NWJA 4HUQB 4KFTA 4U00A 1T4GA 5L3RA 5BQ5A 3HR8A 5FPKA 3VX3A 4NH0A 1Z0AA 4KBGA 1WXQA 4I4LA 4R71A 4XVQA 2P67A 1N2CE 1E0JA 2J7PA 3VMFA 1FOEB 3RS7A 4CT5A 3ZQ6A 1KO7A 3V4RA 5FTNA 1NL3A 3B60A 2GJAA 3FMPB 3EARA 3HU2A 2PJRA 3TGPA 3AVXA 2V6JA 1W2GA 5GJCA 4D80A 4AKGA 3ZH9B 4UNRA 1R0XA 4LHVA 5EXTA 5KPDA 2AX4A 4A0FA 2WJYA 4ZPXA 3VR2A 2RGBA 2FGKA 5GADl 3AUYA 1PZNA 2FSIA 1HURA 3HU1A 3WY9A 2DBYA 1E99A 1YR8A 3VX4A 2Z5FA 1YZQA 2HDNB 2PT7A 3B9QA 1FMLA 1SXJE 2MMCA 1OXTA 1P2VA 3GLGE 2FPKA 4JJZA 1T9HA 3IQWA 3S1AB 2F43B 4R2HA 4LYAA 1KY3A 4JLMA 1G3MA 3PITA 3O8DA 3IBYA 3KL4A 1UFQA 1OPXA 4JLVA 3RWOA 4GBMA 4A6PA 1TX4B 3B7GA 2V1UA 3GJ8A 1Q57A 1OH7A 5D3QA 3D7MA 1N5LA 1ODFA 2VEDA 2GBLA 1KJZA 1NN1A 5CLLA 3U4QB 1CJTC 1E2LA 4HAVA 2FOLA 4QGGA 3AV0B 1CJUC 2GCNA 3TW4A 3B2EA 2R65A 3RYTC 1VCIA 1VHTA 4K81B 2ZITA 5IT5A 1QDEA 1U98A 2OCYC 3T5DA 1F60A 2BBSA 1PLLA 2CDNA 3GQBA 1MO5A 5KNDA 3CPHA 1ZM3A 1YKSA 2EWVA 4ZCMA 5AK0A 3A1SA 1Q20A 3LRPA 4Q9KA 4NPHA 1L2TA 1R5NA 5HPYB 3D3QA 3OHMA 1CRQA 4RD2A 4XD7D 3VKGA 4A4DA 3DOFA 3ZD6A 3B85A 1WQ1R 3BB4A 3K0FB 3KJHA 4B73A 4EUNA 3NVAA 1X1SA 4GSYA 1KSGA 2EYQA 1F2UB 2PLFA 2Q0HA 3KFVA 2YC4C 1S2MA 3A1WA 3EPLA 1G1MA 4QM7A 4K8OA 2G9NA 3BH0A 1UJ2A 2ZQ5A 2QNRA 3BFVA 4LSGA 1G19A 3GD7A 3PEUA 1Z6YA 3QNUA 4H9GA 2KJQA 2FSGA 1R5BA 3CRVA 4DLUA 4PQRA 4Z1MD 2VLIA 3PR1A 2IT1A 2DWPA 3AH8A 3HYTA 1N0WA 1DAMA 3CLVA 2QZ4A 1CIPA 1QHGA 1Q44A 4V0ME 2ZYTX 3FYHA 1EFTA 2R44A 3BOSA 2FNAA 1OE0A 2ZYUX 3KJGA 4QC2A 3VHLB 5E7MA 1AKYA 3VKHA 4IW3B 3GLFE 5HKKD 3Q3JB 4Q9JA 2BJVA 1JJ7A 1CF4A 1DG1G 1S1CA 1KOFA 5JRJA 2O8BB 3LH5A 1PVOA 3LBNA 1YZTA 1C4OA 5DGXA 2W6IA 3RS4A 5AUOB 5CYOA 2ZRGA 3DMNA 1KDPA 1SVIA 1ANKA 3F5FA 5KNCA 4S2EA 2XZPA 4K46A 1E2FA 3TW8B 1SVOA 3THWA 4D0LB 4V0OA 4YXWA 1TQ4A 4TL6A 2BIFA 4PZYA 5G41A 1G41A 5FL7A 5F2EA 3SU8A 1JB1A 1OB5A 1E2HA 2DWQA 3UK6A 3ZDQA 5BXQC 4B44A 4D4MA 5CK4A 2GBLC 2GVDC 3AKYA 4KODA 1QBKC 1U8AA 1Z47A 3GJ5A 5LD2B 2ZJ5A 4LV5B 2WV9A 2CVHA 1HT2E 4P31A 2JDID 2WM9B 3BB1A 3OEHA 2CL0X 3CIOA 3X1YA 1VMAA 4P32A 2XOKA 1XMSA 2AL7A 2A5GA 3RSOA 5FUVA 5BYKA 2QY9A 4LDJA 4XSHA 5KSOA 5DYIA 2ODWA 2O8CB 1E0AA 1WRBA 3QVUA 3VKWA 3K0SA 4DB2A 2C5LA 1IJEA 1J7KA 1NSFA 1KHTA 2XJ9A 1ETUA 3P26A 1HQYE 1NVVR 4NCNA 2L0XA 3KQKA 2DB3A 3EIHA 2CK3A 1UM8A 2XB2A 2JLSA 3KX2A 4ASUA 4Z54A 2BWJA 2BEJA 1GIAA 3ICQB 2GRJA 4LJ5A 4XH9B 1ZC4A 4IHQA 2FZLA 2Z4SA 1KAOA 3AM1A 5FPHA 4HAWA 1TL7C 1P7CA 2RGEA 2QBYB 1CBUA 1V5WA 1R0ZA 4JLBA 1E1QD 4FXPA 3SJCA 3GLIA 4IRUB 4KJZA 1MO6A 1NIJA 1XEWX 2J46A 3U7FB 1XEXA 2ZRLA 4NE2A 1HH4A 2J0VA 1NMZA 2NPIA 6Q21A 1G21E 3DM9B 3EZ2A 1E32A 1AGPA 5DIFA 3I3SR 3NBXX 2F55A 1OB2A 4Q7MB 1D2MA 2QAGB 3SC3A 3E1SA 4TLAA 4B2PA 1GUAA 1AK2A 2JIZA 2GAAA 4NYJQ 2R2AA 2IYXA 1LY1A 1XWIA 3IEUA 4IXMA 1HYQA 1UBFA 2AK2A 3L8ZA 1UPTA 3NG1A 3MLEA 4PC2A 1XDBA 5FBWB 1Z22A 1TUEA 2VHJA 3C16C 1SKYE 2IEZA 3PCRB 1RIFA 4PC6A 2F1RA 3AQ4A 3HJNA 4RZ2A 5SZKB 3SEAA 5C18A 2ZE5A 1OLOA 2WSSD 1II0A 3KZ1E 1EESA 1Z08A 1FP7A 2PH1A 2Z4RA 3ZLJA 1EX7A 4JLDA 4DCVA 4FMDF 5FBQB 3GLHA 2IWHA 2XTMA 5H68A 3BH6A 4FMBB 5DH9A 4F93B 5JCZA 2G0NA 3CX7A 3U3KA 5CITA 2C9OA 2ANBA 3AVUA 2WOOA 121PA 4OQMA 3U7HB 4II7A 4YMSA 2HLDD 1NJFA 3E70C 2OFXA 5D3MB 4DT1B 4PSKA 3VR3A 2J7PD 4GI7A 1BOFA 1EWQA 2XNDA 2YKGA 2QA5A 4MYCA 3A4LA 3OEEA 2ZJOA 3K70C 3T12A 4KYIB 1NG1A 2VHTA 3GFPA 4AYXA 3AKEA 3KUDA 1BS1A 4B43A 2ZI3A 4G5QA 4QJ5A 4CEJA 3CRMA 5CLQA 1NLZA 1NBME 1D5CA 4EJSB 4QRHA 5FUYA 3TSOA 1ZD1A 3QE0A 3KJEA 4CF7A 5HCIA 2WBLC 4RD0A 1ZC3A 2WVJA 1MABA 4NL4H 1SXJB 2AXPA 1E2NA 1Z0JA 1Q1EA 1G291 3GLGB 1M7GA 4MGKR 5EUQB 3U3MA 3W8NA 4R2IA 1R0YA 1Z3IX 3KXKA 1WA5A 3MAAC 5J4KA 2W00A 1W7AA 5JECA 3KXIA 3K9NA 1HUQA 3RWMB 1G5TA 1IN5A 2ZUCA 3AP3A 5JI3E 4WA7A 1S1MA 4PC7A 2WJJA 3IO3A 4KYUA 2KBFA 2P5SA 4N3NA 5LPNA 2HYDA 1X8LA 2RGNA 3C5CA 1RJ9A 2B92A 1AS2A 1VG0B 1XD2A 3KB1A 4A36A 1EG7A 3ADKA 4L8GA 2EFDB 4JMPA 5KHOC 1J70A 1JALA 4JSYA 2P6NA 2ZROA 3ND8A 5CB6A 4GMDA 2JLYA 1ZJ6A 4A8JB 4Q19A 3LD9A 2WSMA 5AWFC 2J0UA 2YOFA 4EDHA 2YOGA 4Q03A 1NN3A 1P3JA 2YWGA 4F91B 1QHSA 5BN3A 3G82C 3FFBA 5FL3A 4RKEA 3PV0A 4QXAA 3JZMA 3MGCA 5C2JB 1CU1A 5KDLA 2BVNA 2RHMA 1P2UA 4Q4HB 2W6JA 1T0JB 3AF0A 2ZVQX 2O0HA 4TTPA 2BBWA 2NZ8A 4ZCLA 1C9KA 4FN5A 2OE2A 1PV4A 2NG1A 2BM0A 3FGNA 1MO3A 1W0KA 4URZR 1I2DA 3SQWA 4KAXA 5AJWA 5AUQA 3WRXC 4B6FA 3N2IA 3A6PC 4ZI3A 2QGZA 1LVGA 4MUAA 4R98A 4LJ4A 2DFKB 4RZUA 4B33A 4DLSA 2IYZA 4AWXA 2A5JA 4CZ2A 1ZD9A 1G8FA 1P60A 2V9PA 2VA8A 4C0QC 5C1BA 5SZHB 2OM2A 3NIBA 2WKQA 1S0UA 1ZRHA 3NEYA 4DZZA 2ZAOA 4G0NA 5G53C 4CYMA 4PHTA 4ARZB 3CWZA 3MWKA 3A1VA 1YZNA 5TXGA 1HEIA 5EP3A 2XSZA 3PUVA 1QVAA 3TBKA 4LYHA 1ZD8A 1DO2A 3EA5A 3GEIA 1CJKC 2Q3MA 4ZDJA 3KQUA 1H8EA 4GL2A 4V03A 4TQ9A 4L9SA 3GLFB 2J59A 1JAIA 1G6OA 2IF2A 1OH8A 4LGMA 2A30A 1NNEA 1Z0DA 1N6NA 5L3SA 1KI8A 3M1IA 2O0KA 2QUZA 1XEFA 4A0HA 4BECA 1F5NA 3FOZA 3G0HA 1D8TA 1ZM4A 2QG6A 1S9DA 3EASA 2QPAA 2C9CA 4BZXA 5IDVA 2GCOB 5TVKA 3SHFA 1JR3D 1U9IC 4HZUA 3QPWA 3EW9A 3NTUA 4OQXA 5AJZA 4HLDA 4YXWD 1CJMA 2AFIE 2ZVPX 4Q1DA 2G77B 5FL7D 3Q8XB 1JJVA 1P5ZB 3Q5EA 1UKVY 3QBTA 2RGNC 1ZW6A 2ZSDA 2ZEJA 4F4IA 1A7JA 1T0HB 2R8RA 1G8HA 1KI9A 4B74A 3EPJA 4Q21A 2UKDA 1N6PA 4IDPA 3WRYC 4H1UA 4DLYA 3OEHD 4OKSA 3Q5DA 3UIEA 4JIMA 4HDCA 5BW8A 4CW7A 3K70D 4EPRA 3QPVA 2F1HA 4KXFB 3QUSA 1QHXA 4KSBA 2CHVA 3V00A 4GMXA 4QFMA 1RYHA 3CNLA 2EFGA 1FNNA 2D74A 4DCTA 4CT4B 1UDWA 4QHTA 4NU0A 4HATA 1UDXA 4O2RA 3ZZTA 2O52A 4C30A 3WMEA 2VH5R 2ZSEA 5BN4A 1TEVA 1B0UA 3U6BA 2A78A 1LTQA 4GOXA 2CK3D 3CBQA 4ASUD 4Q00A 4KFSA 1KDOA 4JT4A 3EWSA 2AK3A 3ADBA 1N3BA 2NPFA 5J5CA 4AKEA 2H5EA 2AD5A 4DLRA 4DSNA 1G8PA 2DHRA 2ZI9A 5DO9A 5G3YA 1HTWA 1FFHA 2WPDA 2WICA 4FW9A 3L43A 1C1YA 3NHAA 3CUEF 1JI0A 1X86B 5AR1A 3GJ6A 4HSEA 1COWA 3NC1C 1UKZA 4EFLA 2QQEA 2QEQA 1D6JA 1RZ3A 3EXAA 3A36A 3PQCA 3MMPA 5JLJA 1XJ0A 2JIZD 3IGFA 4BQSA 4DSOA 4C0JA 3SOPA 3HPQA 1MRSA 1LS1A 4Q02A 3B82A 3LBHA 4I81A 3SDZA 1K8RA 2HF8A 2JASA 4DVGA 3DMDA 3O8CA 1R7RA 2ZJ2A 3W3AA 3QG1A 1KZ7B 4KVAA 4C7OB 1XXHA 1XNJA 1E2MA 3ND9A 2G83A 4GFDA 1XPUA 4OL0A 4JLOA 2EVWX 1P61B 2IHBA 3A1TA 2FU5C 3THXB 2DFNA 2J0SA 3PEVA 4H1VA 1P9RA 3CR7A 3HDTA 3EWAA 1Y63A 1Z06A 4LX0A 2VYFA 4BRUA 3U7GA 4OHXA 1KK3A 4ZDWA 2ZI6A 3L82B 2XNDD 2XXAB 2Q21A 3UG6A 3CZPA 1VG1A 3ZVLA 2EW1A 2HJVA 1KI1A 1XTKA 3OEED 1FP6A 4DCSA 3H4MA 3Q85A 2E9SA 4KSCA 2P6UA 1P9WA 1DAEA 5FTKA 4ZO4A 3GLIE 3AVTA 4HDQB 1LF0A 1SVLA 5HTKA 3K9HA 4JT2A 2IK8A 3OE7D 1AZSC 2B7CA 4LBVA 5KSPA 1YRBA 3LW8A 4U5XA 2BKUA 2ZSAA 4RFSA 621PA 2EFEB 5A4JA 4YONB 1DAKA 1KDRA 4TQUS 3R7WA 3WYGA 3N2EA 1GDDA 4OQFA 4A6XA 4MQBA 1ZVQA 3AP1A 4IOKA 1WCV1 3DKPA 2J41A 2JLRA 3TQFA 4ZDIA 1G3RA 2ZE6A 2XNSA 4N0EA 2VP9A 2QMUA 4BE7B 5J4LA 1WP9A 1T5LA 1XTQA 2OT3B 1RPZA 1QHHB 2D7DA 3GCGA 2OHFA 2IBMA 2LWIA 1FX0B 3B1WA 1WB9A 5LB2A 1TF5A 1DADA 2BOVA 1NF3A 3PENA 3MUFA 2ZRMA 3GLHE 5B64A 2ZAMA 3PEYA 1G4UR 4LUCA 4Q48A 2YHSA 4OK6A 721PA 5L3VA 2O8FB 2YWFA 4QGAA 4PQYA 2PBRA 2ZRCA 1OFIA 4W7SA 1NBMA 2V55B 1NN0A 2KWIA 3K0CA 1IN4A 1AKEA 1SQ5A 1NP6A 3H0KA
chains in the Genus database with same CATH superfamily
2WKWA 1UFVA 4MRRA 1E3JA 4HFMA 3OOSA 4RPGA 5FUXA 1GQQA 3P2KA 3E9DA 3PEEA 3FAZA 1L6IA 1X1DA 2H63A 1WULS 3INTA 1SXJD 4AF7A 4CCYB 4KU4A 4BMDA 4DIFA 1UANA 3U81A 1RR6A 2DRIA 1HTTA 1NXXA 2NQ8A 1TA0A 3LQ2A 2D1FA 4ZT7A 4EB6A 2CFRA 2BY4A 1HDOA 3IELA 4HYTA 5AM0A 1FBTA 4MAFA 4IIJB 1QFXA 4U6NA 2UUCB 2VJMA 2QM7A 4UAUA 5FPPA 2GT1A 3M9LA 1UIRA 2G4LA 3HBNA 4HWGA 4MWTA 4HVCA 1QYDA 4FTWA 4K9RA 1B42A 5DT2A 3TXYA 4KTVE 1DKLA 1UZUA 2PFGA 2VUTA 2HJGA 3RUFA 3HCCA 2F9FA 2R85A 4KI0A 2ONJA 3CISA 1JQLB 4CKYA 5EIFA 3CHYA 2JKYA 4K9OA 4Z7NB 5CFRA 2V0NA 1KY2A 4LDNA 1YJBA 3LDAA 4FCWA 2JCXA 3AVTA 4EMUA 4UNPA 1YZGA 4EG7A 3VNVA 4BV2A 2PKWA 4TWBA 4Q3KA 5F1YA 3WGJA 1KVUA 2UZIR 5TNXA 2HBZA 2NU8A 4DLXA 3TYXA 1ZUHA 5JJBA 1DL5A 1QHNA 1XFAA 5E4YA 4DZTA 3HZHA 1CUBA 3IAEA 2BFNA 1C7QA 5DE3A 2GZRA 3B48A 3GJSA 3LBIA 4UREA 1E2QA 5F64A 1BVHA 3HP4A 4ZAVA 4QQRA 2PZAA 4U7TB 1JHXA 4D6YA 4PGAA 1PSDA 3DDNA 1TM2A 3VO2A 1CNFA 4F9TA 2C96A 2FPSA 3F71A 4QAQA 1KI6A 1MFPA 4R05A 1YOBA 1LSOA 3IVAA 1CSEE 4NK5A 1TUGA 1GPKA 4PYIA 1GNLA 3TNDA 2G04A 2CLIB 3T06B 2OOKA 4Z4GA 1DX4A 1LBSA 1SBQA 4PAMA 3S1SA 3EODA 1YRYE 3L0YA 1FIUA 4AI6A 1QZTA 4I19A 1H0RA 1XLTC 2PO7A 3KZNA 3EDYA 3ZV6A 4UEJA 2J9YB 4A9AA 1T2DA 4TX1A 2R8YA 4QL3A 1KJ8A 1JPUA 1JXQA 5M7EA 1NY5A 3QJYA 4U4AA 4X1YB 3JR7A 5H81A 1JPJA 2C9DA 1VSTA 2EATA 3MA0A 5I7AA 2E1RA 2IWRA 3TSWA 3UPDA 4AU1A 4PR0A 1U3CA 4CQMD 5LQAA 5KNLA 1NW9B 1T8WA 2GWRA 3AF3A 4WEQA 4TMYA 5ALGA 3IIJA 5C18A 3G1TA 4FD2A 3OPYI 4OGGA 1FXUA 1DEHA 2XUFA 2ZS8A 3DCNA 4UPDA 7REQA 1LLUA 1Z25A 2AV6A 2H48A 1V8OA 1QYCA 2OBNA 1FL9A 2VBFA 3H16A 2Y77A 3PSAA 2BFPA 4CV1A 1CEXA 1TAGA 3D5TA 3HPRA 4LJ8A 3ANMA 1UBHS 3I2JA 4QKQA 1DRKA 3N2ZB 1K9VF 4EJ2A 4X97A 4H2DA 2D59A 2I7TA 2JLCA 1Z6GA 2NUAA 1C9MA 2VI5A 3RYFB 4QEZA 5AESA 3BERA 3P9RA 3A7DA 1RZRD 4HQOA 1PTJA 1AH2A 2PCLA 3A25A 1FUKA 5J2UB 3AVYA 4KYTA 1H5UA 1T3GA 3KB2A 3WLKX 1JQ5A 2EX0A 3DKVA 3JQCA 4ND1A 4AP9A 4BZPA 5C0OE 4TSFA 1TMYA 2AEMA 3D6JA 3L84A 1NZDA 1WXDA 3C8DA 3HWX1 3L41A 1X80B 4QO7A 2AC2A 1LPAB 3QTLA 1OJ7A 3O94A 1A9QA 1DARA 4K6KA 5JNSA 1U6IA 2GK6A 4MS4A 3RFXA 4ZTUB 3KXLA 3COJA 3UXMA 5BPFA 2D1SA 5DXAA 4FJ1A 2BCEA 4CM8A 3ZD9A 5FLKA 5IUJC 1D2GA 1T1JA 2YZMA 2XA1A 4ZVUA 4KXYA 5DW0A 4DARA 1U02A 4YACA 3OHSX 1BDJA 4M1KA 1B0ZA 1J97A 1RRVA 3IAM6 1XMJA 3NIWA 4I4TF 4MPTA 1N8KA 4MHOA 2XYPA 4NBSA 1KDVA 2WWTA 5K0SA 3EF3A 2J9ZB 1N5RA 1BG6A 4HK4A 1I24A 5AKLA 3OZTA 4DLZA 3AR2A 1JB9A 3DR5A 1TEZA 2VH1A 1XMXA 2ZS9A 1WE2A 3K0AA 3TSZA 1SOUA 1PK9A 4GBJA 1C3EA 5ALYA 4C7XA 3WLHA 3TRJA 1LDNA 2P7HA 4L0CA 5BYJA 5EIBD 3W7VA 4B6JA 4HUTA 4KIUA 1XMQB 2JI9A 1QVWA 4IQ4A 4JL5A 2XQGA 3BHIA 4NPAA 3OJOA 3BE5A 4PGFA 4QU5A 3STWA 4WZZA 3TWOA 1QH1A 3W3AD 3H4IA 1KQPA 2GK4A 3ITKA 2O3QA 3JQ7A 1QGDA 4QGHA 3KTAA 4UBJA 1Z6AA 1II8A 4EJ0A 2WIAA 5KTRA 2X4DA 4WT7A 3MWJA 1HF3A 3V4VB 3FTQA 2F1JA 5AXAA 3U4QA 4LK2A 2JAUA 1N6OA 2J3EA 1SVNA 4YFVA 2V1XA 2VQDA 3KQPA 5FA5A 5EQJB 2Z98A 2IU6A 3QI2A 1W35A 1DNPA 3O1HB 3ORRA 4G25A 4LTDA 4YASA 3UA3A 1XQ9A 4NZPA 4KR7A 1LQUA 5EYPA 5KEIA 3FTDA 1FEZA 3KEGA 3O2JA 4LJSA 1RI2A 3TFQA 3WLQA 1Q1QA 3LXRA 4JBIA 1C9DB 1MEEA 1U99A 2FG5A 2WYOA 3AVWA 2XF2A 3DE4X 4RDIA 4D5GA 1RP7A 3JX9A 3RUAA 3N28A 1IJBA 2PX0A 2W2VA 5A3RA 2RKBA 2BFOA 4HC4A 3R5HA 4JJAA 4ZC1A 5E1OA 2LCQA 3V7FA 2QSUA 3H1AA 4DV4B 1HT0A 2C8KA 2IPAB 1DC8A 2ZRAA 3K0FA 5HX7A 3DV0B 1ZH6A 2PG3A 4AICA 4XLLA 4HPJB 4H7EA 3S5JA 4TKMA 1S01A 2QRHA 3GT0A 3UJ7A 1YJAA 2IH2A 1TLFA 3JARB 4G63A 1TF2A 4XWKA 1Q92A 2VUSA 2Z09A 1GKUB 2PZ8A 1MTOA 2QD4A 4R2MA 4BNMA 3P27A 1DOZA 1I5OA 4HTAA 2H16A 1M74A 5HRAA 4JH0A 4YJDA 4C6TA 1AQNA 3K6RA 4CM9A 3RC8A 2ZQYA 1E96A 4RVGA 4XUDA 2XRFA 4WY2A 5DVZA 4KQWA 3PPWA 1VJDA 3IEVA 2PWAA 1R15A 2QL6A 4AD8A 4S3MA 2K5UA 5FJJA 2XD9A 1VXOA 2WIJA 1W5TA 3SJZA 3DB2A 5CEJA 1L7EA 3QKSB 5LU9A 5A9RA 4W9MC 3G0GA 5LMCA 1TQDA 2LDBA 3PEFA 1U7XA 4WNCA 4IH1A 4BO9A 4DLBA 1D1QA 4H17A 821PA 4R69A 1FUUA 2HREA 1UC5B 1LPPA 2I1WA 3SE0A 3SS8A 4OHCA 4AT1A 4QFBA 2GVNA 2ROQA 3DBIA 3KYCB 2VAVA 3MCAA 4UTXA 3HU3A 3NBQA 2PSJA 2GNOA 1WBDA 4RE5A 1RBMA 1CG6A 1EFKA 4Y2GA 5J2TA 1K66A 4C4AA 1ZOSA 4N49A 2FFQA 2YVQA 2FPGA 3EISA 1Z8NA 1LFAA 2VNAA 2ZJAA 3H1TA 1KP9A 3L49A 3TW8A 2I3DA 3T6KA 1OXMA 3BWVA 1XL0A 4Q34A 5HHTA 2X1MA 1PDVA 2G36A 3EMVA 4KE7A 3R9KA 5HR5A 4DJDC 4IIXA 2B1IA 3K7EA 1WCXA 2ZRJA 4KWEA 5FV7A 1XI2A 3I6BA 4J43A 2I3AA 3TIFA 2WK1A 2TYSB 1Q95A 2JJ1D 2Q62A 3L8CA 4E1BA 5EZSA 4B85A 2RIRA 5JCPA 1WCWA 3THYB 2BM8A 2FUEA 1NLYA 1FDSA 3JYOA 3NYQA 4HS4A 3TFOA 1E3MA 1I51A 2BD0A 2GZ1A 2H1CA 3KBBA 3O31A 2LPMA 3KQYA 1G2QA 2RH8A 1LH0A 4EUKA 5LMUB 4MOWA 4JI2B 1JFVA 3DBHB 3VZRA 3ZK8A 1XROA 4E46A 3VSBA 4GM1A 3GBPA 1X7HA 2B8NA 2G1JA 5AKIA 1GARA 2Q9CA 3C8UA 1KMHA 1Z7EA 4YJHB 4I9HA 2VHCA 4BATA 1YB5A 5JALA 1KXZA 4EUFA 1QG6A 3KFLA 1ZK0A 1B26A 4RLSA 4B76A 2OCAA 2ZJFA 3FTCA 1DFIA 2ZBFA 2XTZA 3GWZA 2EQAA 2XX3A 3MJSA 3ETCA 4Q24A 1KJJA 2PEYA 3DP7A 5JJKA 1G8SA 5ESRA 1XD2B 4JJKA 1RZVA 1U0HC 3HYSA 5C32A 3MJDA 4IEFB 3LWNA 3SZOA 4YRNA 3S2GA 3H13A 4KPUA 2OXFA 2MSEB 3HB0A 3IALA 2AXNA 4LMAA 1I0LA 4UU0A 4YJFA 4A27A 4DDVA 5KOJB 1JKJA 2D54A 1NJGA 4C3OB 2ZUBA 2VDOB 3K53A 2H59A 3L6CA 4JEMA 2AG8A 3VR1A 4F4DA 2IUFA 5KTKA 1WXGA 1I10A 4M89A 5ERXA 4FS8A 2RHGB 1EFPB 4M36A 2W2KB 3W2HA 4I2VA 5FEUA 4U6SA 2ZT8A 3QHQA 5DHFA 4KWHA 5AOVA 4IDCA 4BMXA 3QJ5A 1U2DC 5ALKA 3RJZA 2Z0MA 2IGBA 3QH4A 3W6PA 1WV0A 1GL6A 2YWEA 1E5TA 2R25B 1Z4LA 4QJ4A 1GKYA 4CPDA 1HTBA 4E30A 1UPCA 5H16A 2FZCA 3ZQ4A 3ZLUA 1S02A 4UVEA 4DR4B 1HO3A 1BXKA 3L1HA 3EXFA 421PA 3ZHZA 2PY6A 1HNZB 3K1TA 4G5OA 1SEVA 1IOWA 1JP7A 1UDRA 4GW3A 2CNNA 3FIUA 1Y3BE 1UZAA 4FFOA 4DEXA 3PQ5A 4F1JA 3EDCA 4LRWA 3T41A 4NBWA 1BOOA 1EIZA 2F3PA 2R11A 5ECDA 1RQRA 3WL5A 3KKPA 2GN1A 1SHKA 2G25A 4Q5IA 4DLLA 4Z4EA 3B6MA 1Q7TA 2I33A 3IXQA 1GNRA 4IXTA 1LI7A 4IIBA 3FZGA 3QWBA 3M3PA 1U7HA 2IIBA 3REQA 1AZLA 4D9IA 1XWWA 2PO5A 2WW8A 2FCRA 2Y1OA 3U3XA 1KL7A 2JANA 3C7DB 4MK4A 2Q6IA 3T7CA 1AA6A 1NLUA 2B37A 3ZVRA 1NYRA 2WUGA 1M34E 1SK9A 3UCFA 3ZGYA 3NGMA 1TTPB 1KBQA 3PTLA 3UOWA 5C8YF 4K1XA 1XCJA 2ZJ4A 3H1BA 2JI8A 4LXIA 5FTLA 1RM4A 3I9OA 1EZZA 3LQQA 2P9GA 2YQZA 4FIDA 4GR4A 5FO0A 3MT0A 3ZWNA 3S1LA 1P73A 2ILTA 5CPFA 1NRJB 2D3TA 1PVDA 2CDRA 4TUYB 1FNDA 1IUOA 2FX3A 3D7NA 1K2VN 2ZDGA 1KMQA 2CNLA 3OQBA 4K9SA 5SICE 2FSUA 2CUKA 3FRJA 4CUJA 4D1YA 1KVTA 5CNKA 4YUAA 3SXUA 2D62A 5HZMA 4UNSA 3MUNA 1ZXXA 2R79A 4CDNA 2G4VA 5LXTB 2X4GA 3R23A 5D6OA 5JC8A 1AKTA 3QLJA 4YCSA 4U1RA 5JH7A 2HMWA 1H8HA 1Q6ZA 2WTXA 1U0OC 4ML3A 3PQ2A 3UJDA 2ZAIA 5BWBA 1PO7A 1KOGA 2AQKA 2BLLA 2IPLA 2YIDA 4MI3A 1DKQA 3ROFA 1CEQA 1QKKA 1KRHA 2TRSB 3IMGA 1T0PA 3L8EA 4ZCSA 1C50A 4TXHA 3NYRA 4QBIA 3S8EA 3WMWA 3ZIAA 3ASVA 3EOAI 4G0WA 2Z1MA 3CEAA 1AMNA 4L5YA 4EHNA 4JY7A 3JRWA 1JF8A 1VG9B 1UC4B 2B8JA 4RC9A 5JT1A 3ZWPA 5IZ4A 3V97A 1NKVA 2FW9A 1N2OA 1SD1A 3ZXSA 3H42B 1U8TA 2PZMA 1WOMA 5BV2P 5KDOA 3BXEA 2WZCA 3OQJA 5KBYA 4CGZA 4A0QA 4Q3NA 2YJTD 2QRVB 3EY4A 5K51A 3NAZA 2W6ID 1KK1A 1TLLA 3FGOA 4P8RA 1L7AA 3WWCA 3LUHA 3IERA 1E6UA 2PKQP 1SXHA 1USUA 4TL9A 4A8JA 1Z6ZA 1DKOA 1T2NA 2BMEA 1EDEA 3INRA 4LTNA 5JEDA 3DOEA 3MMZA 4AMVA 2YBEA 3IT1A 3RH0A 3V80A 1QVVA 1FS6A 4BVEA 1C0EA 2AJTA 1VG8A 3IOYA 6YASA 2H3HA 1BU5A 1PZHA 2OGSA 5CTAA 3S2SA 1YU9A 2GJSA 2ZI5A 3WLRA 4F4CA 2YJZA 2DJ5A 1KC1A 2X6RA 4YPFA 3AUJB 3D3EA 5GP1A 2C7PA 1YZVA 2B25A 4F92B 4ZZ2A 4GOLD 3JQAA 1SO8A 1TEHA 3HUDA 3KPWA 4ZVNA 3VSCA 1BYIA 5ALZA 4E09A 2FFRA 2P2LA 5EWMA 4AURA 4MUKA 4POAA 1U6KA 1B7GO 3DKIA 4HZIA 5JI2E 5K4HA 4NG4A 1XTTA 2XOKD 4A3SA 4TYNA 1QWOA 5ALTA 3KELA 3GMTA 3RHFA 1E7RA 1M7HA 4WBXC 1T10A 4Z51A 4P58A 4B83A 3M82A 1M8PA 2NNWB 1BYUA 3T35A 1KS9A 3BMNB 1SC4A 5IJ9A 4TXLA 1RYFA 4H4EA 1JIXA 3WADA 1N0HA 5CCEA 1NDQA 4OM7A 3UGTA 4A73A 4NG5A 3IPXA 2GD6A 3JZFA 4INPA 3DKKA 4INOA 1D5WA 2H7VA 2QUBA 3HUEA 4I6EA 4HB2A 2RAPA 4WN9A 1GFSA 1PZMA 4JYBA 4JP1A 1DSSG 4O1IA 1CERA 3RB8A 5LOVA 1F8XA 5D86A 3L93A 1COZA 1PL8A 3QLVA 1W6RA 2NWQA 1L8XA 2OFOA 4YMWA 3R6TA 5ICMA 1TZKA 5GONF 3GVHA 1PSZA 4IXDA 1JDJA 3R9XB 3WHKA 4I99A 4DIUA 2ZETA 3K73O 1Z6TA 3AT1A 5BVHA 1EFRA 1ZKMA 4NMMA 3DPIA 4X8MA 5AK5A 3WIOA 3D4BA 2YZ2A 2RGRA 2YMMA 4WCFA 1P4HA 3SN6A 1L1QA 2HCJB 3N74A 3SZRA 5TLSA 3K30A 5AJYA 4L3WA 4YMVA 4QDOA 1T0IA 4GWKA 1QKJA 2IPNA 5CNJA 2HUNA 3E61A 3UKDA 1G21B 4YUYA 2B0JA 2AJDA 2W6NA 3WV4A 1PNQA 5ALLA 2HWKA 1C0KA 1XCPA 3LF1A 4I1UA 1IH8A 4D26A 2ZB3A 4YJGB 2DSNA 2EEPA 4FOSA 4ES6A 4C5CA 1AU9A 4BRWA 1D0SA 2XVZA 5B12A 1PIWA 4X94A 2RH4A 2QZ9A 3VOAA 3EZXA 4BFWA 2LVBA 3Q88A 4P3OA 4EI7A 3PPXA 2XZTA 1Z73A 4RYDA 5ITZA 2R6AA 4M9XA 1QYWA 1UWVA 2FX2A 2Z30A 5E4JA 3X0DA 1GQOA 3BBLA 1N2ZA 4MVJF 2P3OA 3ZU6A 4BLRA 3VH1A 2OSBA 3KKQA 2XIJA 4OQZA 1KSHA 4M6WA 4OA8A 3RKRA 3TMAA 4C76A 2JG3A 2C9BA 2XXJA 3OJXA 1GNVA 4YHBA 3PFFA 3PB3A 3I0NA 5FNVF 1BW9A 1N2XA 2A4KA 3W7BA 4WXPA 3CX6A 2YHIB 4XYLA 4X65B 4LY9A 1O89A 4RIFA 5IABA 3AV3A 4TZTA 4LZJA 2YIJA 2FSVA 1MENA 5KVVA 3F2IA 3AI3A 3R7WA 1QR2A 1VFNA 1G3IA 1SN7A 1VIDA 1HOTA 3NC0C 2J0QA 1NNSA 3TEMA 1LI4A 1V43A 5K45A 4G0VA 3SC4A 1AK9A 2J9RA 4X7BA 2R6FA 4XTRA 3UC9A 2GK7A 1HDEA 3KOYA 1O7JA 3VU1A 4YT2A 1DIAA 3AERB 3IMEA 3PUYA 3H4VA 3SR0A 2I2WA 3E27A 4NAHA 4XTCS 1ILEA 1GXSB 4O4JB 1DXHA 3U80A 1MHPA 2AJBA 2RH5A 2NZUG 2RK4A 4Q9HA 2GXQA 3EIFA 3PUJA 1HWYA 1L1EA 2YYSA 3O8RA 4UM9B 1RMTA 2AT1A 3PIRA 3TZBA 2P6MA 1QRRA 4GXQA 4JYCA 3Q8WA 4P1ZA 5C35A 1U0LA 1VP3A 2JIQA 3UB2A 4KUHA 4Y6PA 3PNPA 4OB7A 4EFNA 4QD3A 2H4ZA 1MX3A 5LJLA 1OUMA 3WGYA 1N3YA 1ORRA 3O8NA 1HE1C 1NZFA 4D9NA 1GILA 1C0IA 3FCXA 3QLVC 4D97A 5K0ZA 1FY2A 4BMNA 4X8OA 1Y5LA 2W2PA 4EB6B 4LJ7A 1DOAA 1ODJA 3JYQA 5DLEA 2VTEA 5KQSA 3TPCA 3NONA 4I6JA 2GFIA 4RQTA 1SVSA 2X0EA 1YS2X 1NLFA 4RZXA 4NE9A 5FUQA 2H4FA 2JGFA 2VJMB 1L5OA 5FYDA 4DS3A 1N2GA 2Q2WA 4IMIB 3TGLA 4M0UA 3JVVA 3G5UA 2AH5A 2JDIA 3KYBA 4WCFC 2IYYA 3ZY6A 2PKXA 1ZX1A 2BHRA 4A0GA 3DZJA 1VDZA 1BU8A 1GZ7A 2EJUA 2HJSA 4F46A 3DF7A 3KG2A 1F48A 1TT7A 1GY8A 4V3CA 3K1AB 2FE4A 5K0BA 2CMGA 3WK9A 2HMAA 1K1EA 2HC9A 1VE9A 2QTFA 3DNMA 5CVJA 1A69A 3D2CA 1TYBE 2EX4A 3OE5A 1PJ2A 1A7KA 1EK0A 1ENYA 4OJMX 4DNPA 3HO1A 2VP5A 3NHKA 2QP9X 1Y4SA 1P7YA 3PXAA 1MNAA 4ZYXA 5A02A 3EG9B 3QX3A 3L0PA 2NU8B 4EHLA 4Q4JA 4GRIA 5HIJA 4C0LA 2KE5A 5JDCA 2GASA 2EWMA 3KO8A 4JUDX 4LHYA 5P21A 4MI9A 1AG9A 4TYMA 2DCMA 2H9AA 1CFZA 2QJFA 1ULBA 4OU5A 2Q1UA 2O3SA 4S0XA 1Y5RA 1NE7A 2WJWA 3H9QA 4X6LA 3FVQA 2XXAA 2X0IA 1NFQA 3I34X 4L6CA 1P2DA 5IRCD 2I9KA 3QVSA 1KI6B 4KJXA 1WZIA 2ZB8A 2XH8A 5JZBA 1E1YA 3E8MA 2FSVC 2YYYA 4AULA 1E1QA 2COUA 1ZJYA 3P71T 1SUSA 2WILA 3SSOA 1ATIA 4XI9A 3SF8A 3TLAA 3SQDA 2RGUA 4ZT4A 5CX4A 2WIFA 5DM4A 4DILA 1WKBA 2EYUA 3FCAA 3KAPA 3RFUA 1TRKA 13PKA 1EHCA 2B3TA 2A2ZA 5THKA 3FPAA 4BYMA 2IIPA 2V98A 2DUNA 3GEBA 1UK7A 4HQLA 4YXFA 5EESA 1VLZA 4Y6RA 4BRZA 1CRPA 1Q0PA 4J0GA 2XSZD 1CWUA 1XJQA 2QLTA 2QQFA 3QOFA 4G5YA 1N1DA 4NIMA 5FKJA 5DASA 3BJMA 2XBUA 2IH5A 4LS3A 1GG2A 1OI4A 1WX1A 2C84A 5FO1A 4DCOA 4AIRA 5HMLA 7REQB 2NVBA 3NHSA 1MO4A 4H1TA 1I3NA 1WJGA 1J09A 3OLQA 4EY4A 3E1GA 2VHYA 5KSYA 4F3CA 2HQ1A 2QLNA 4JKIA 2QUAA 4RS4A 2QKYA 4N5LA 4O4HF 1GAJA 3BHJA 2FB9A 2OEPA 2XV1A 2AJCA 4XSVA 4B0OA 1GPAA 4BCDA 4YPOA 5J5AA 4EFKA 4H7FA 4EG6A 2B34A 2QZJA 3CLRD 2I6QA 1Z56C 2CL7X 2BCJQ 3UC5A 1G64A 2NUAB 3K94A 5BOSA 5CH8A 1NJ1A 3RVDA 1KMCA 1M8JA 2BLNA 2HIAA 2QTWB 9ATCA 4YDQA 1N2SA 2Q4DA 5IASA 3FM9A 1FU7A 4MWDA 3UJBA 2OVFA 5F7JA 5CA1F 3C6KA 5ES3A 3OTHA 3UXEA 4Y0VA 4EA6A 4KMRA 4V2UA 2HLDA 3AJAA 4PPGA 4D0GA 4MI6A 4RTJA 3PJRA 1SB8A 3FBWA 3UWKA 4U0KA 4E6EA 4J8PA 3D81A 4PRKA 1NI4A 3EDRA 1FE8A 2HQRA 2PQ6A 1XZ8A 4IJUA 4MS4B 2BDTA 3FCYA 1KI3A 3R3XA 5AKEA 5ESXA 4RZIA 2IJGX 3IHLA 4EPXA 3IKJA 1SBIA 1L5NA 4ZV4A 2IZ1A 3V8QA 2R48A 5GOZA 1Q7CA 1M33A 3LGXA 3MT8A 4A82A 1Z5WA 3NX4A 5B2FA 1F7VA 2C29D 3OZVA 3RVMA 2X7XA 1L8AA 3KB8A 4YALA 2JIRA 1N77A 5LB4A 3FKSD 4IDNA 2OM6A 1S3IA 4URFA 2Q3HA 1IL0A 4C9BA 5F98A 2IEDA 1E5XA 3P9PA 3ZE8A 1ZD5A 3GRZA 2A1TR 3HWSA 3U7QA 2QT1A 1RXYA 2CXSA 1XAIA 1TADA 4M7WA 1HA3A 3Q3GE 4YQEA 2J45A 3VMMA 5DLPA 1EX6A 2I4OA 4JELA 3SI7A 1V5FA 4KQFA 5B4VA 3QBEA 4V0NA 3K0AB 4YO7A 5CCBA 5HJEA 5AW2A 1T34A 2C8LA 2PLAA 4GKVA 4JUBA 5HDBB 3LSYA 3UHAA 1JLKA 4AO7A 4Z3DA 1EB8A 1LV8A 2XMGA 2Y4NA 2VVTA 3M4JA 2WJHA 2NV6A 3UMRA 1QH1B 2QVCA 1UXHA 3RREA 1QIEA 4B47A 1MX1A 2VJNA 3KTAB 1II8B 1VCHA 4AKTA 2RKOA 4I4TA 1SBZA 4LDAA 1IG0A 3F0TA 3ID6C 3BE8A 4ZU6X 1WVMA 3A4TA 4NP6A 3F9IA 2JHCA 1B2LA 3I1YA 1UXKA 4JOCA 4PSVA 3G59A 1UDCA 2P41A 4A03A 5BUQA 4LJRA 2Y0EA 5LNK6 4BO6A 4WKNA 5KTYA 3HEMA 1MAHA 2ATXA 3PQ7A 3RTDA 2QE7D 2AJLI 4ZQHA 2P77A 2O8VA 2WWYA 1N6RA 1DJQA 2WA2A 1GDHA 1KO5A 4LF7B 1SCIA 4PIPA 3H2JA 2GPWA 2QVZX 3GUCA 1B74A 1JDZA 3GN2A 3KQMA 1COWD 1YK1A 1Y7HA 4LOKA 3C6QA 3QX8A 3SE7A 4ANFA 2WJZB 1OGJA 1J8FA 1EA5A 4N5NA 3DQPA 4J1QA 4R68A 1EI9A 3BGSA 4CKWA 3DZDA 1F8GA 3FUWA 4AWAA 1AXGA 1EGHA 2UUBB 1N25A 1XQWA 2CSUA 2PNFA 4HL6A 4WOPA 4GPTA 5EPEA 3VOSA 2O8EA 1S6YA 4H7JA 1E0SA 1XBTA 3MJRA 4DV5B 1BC5A 1Q91A 3IQGX 1T5SA 3D43A 4YEDA 1OHHA 1CNEA 3C8HA 4L1KA 3S1AA 4EW6A 5IFKA 2J1LA 3RRNA 1QG4A 1AN0A 1SY7A 4C3VA 1PLJA 3BZUA 3LUBA 4RDXA 3H11A 4MW4A 5TF4A 3K8OE 3C4QA 1KKMA 4KH1A 1CY8A 1IAQA 1SCAA 2FN8A 3ZDYB 3P9IA 1CDZA 4G0MA 3GLQA 3ELBA 2H1SA 1YDGA 3G9XA 3M6XA 4UHDA 5ALSA 3T3HA 1D9XA 3FYUC 2ZS7A 4GHWA 5AW9A 4F38A 2VJYA 1EYZA 4LVOA 1U11A 4A7PA 3W5CA 3UBTA 2LKDA 1TEXA 4RYLA 4E32A 3QSYA 3U5TA 2O6HA 5K4GA 4LVNA 1HMYA 1BVYF 2DFLA 2H31A 1N33B 4E5YA 1NN5A 4JENA 3NT5A 2IYQA 5FBKA 1IJFA 1NVAA 3BE4A 3NGLA 3QUTA 1KH2A 2CHGA 3OZRA 3W5HA 3T1YB 3ADOA 3FSGD 3UM9A 4NBKA 3FF4A 2GHRA 3S44A 5I4IA 1L7PA 4ND7A 3DVLA 4WECA 5EERA 1CT9A 1QC5A 2AA3A 1IQUA 5EPOA 2WU1A 3LHFA 3VDRA 5KTPA 5ALEA 4G8BA 1XEXB 5J2TB 4MKGA 3BTOA 1K97A 1CY7A 2FPGB 4GE3A 3NDBB 1BVRA 1XRSB 3OMWA 1YHYA 1I14A 4FEYA 2D1YA 3G0CA 4Y9RA 5JROA 4FMDB 3ZHVA 1SUWA 2J3IA 2GS9A 5L3ZA 3BGWA 4MUIA 1A2BA 1MAWA 3NIDB 3WQQA 1XU4A 1RWWA 4G3XA 4WXHA 5A05A 3X1WA 3MELA 2RGCA 1A82A 3AM5A 4PZUA 4MVJG 4BNJA 2ZYHA 4E5KA 1FRQA 2FCAA 3K9QO 1LW6E 4R8LA 3TUIC 5T7BA 2NSJA 4QO8A 4LF9B 5KZMB 1I2MA 1HDZA 1V6SA 2DR3A 3UF0A 3RW9A 1JX6A 4CIDA 1I5RA 4UAJA 5GGXA 4UUOA 2OO3A 3CVUA 3DDZX 3SF0A 3Q10A 3WHPA 4M55A 4AROA 4ENSA 1K5DA 4Q7JB 2QRKA 1FJ2A 5LBIA 4UDYX 4QDZA 1GL9B 3WNDA 3QEOA 1G55A 1KMHB 2GA9A 1JYSA 3U7EB 5LM3A 1BS9A 5CFNA 2IUSA 4GI5A 1C1DA 3WISA 3C3XA 1OI3A 3NT4A 2PRZA 1JT2A 2HRDA 1W4CA 3QYAA 3JZAA 3K6JA 3L0CA 4E08A 2B7LA 5I7EA 2QORA 4KO3S 5DU2A 4J0DA 1ID1A 2MSCB 2VDJA 4LJ9A 4REMA 1S2IA 4JI3B 3KBOA 1CUDA 4R5MA 1J9ZA 2JLUA 3N39C 2IUEA 2F3QA 3Q2OA 3V1LA 1J5XA 4LE2A 3T9DA 3AF2A 1DZ3A 4OGLA 2V5UA 1QO7A 4ZEXA 1Z62A 3HH8A 5HE9A 2RJ3A 4CEJB 3TLMA 4C3UA 2X9LA 3LWDA 5AH0A 3ZUGA 4RK5A 5IVPA 1UBMS 4MWCA 4PG7A 4DCPA 1Q12A 3O93A 3FPGA 3OG9A 1XNGA 5KYKA 4F3TA 3WYAA 1VLQA 3ZCVA 2C58A 3HLTA 4UDNA 2WTEA 3FVVA 4JYAB 5DN6D 4ZEWA 5PGMA 3AKDA 1YS9A 2WT8A 3G17A 3LKDA 4RDCA 3V34A 3WB9A 1AGNA 2PT5A 5HM6A 1KU0A 3L7NA 3T0GA 3KFXA 3O84A 4QIHA 3DOHA 2PR2A 4UMFA 4OLFA 1KQNA 1SUPA 5AVWA 1FFDA 5CXQA 5ILGA 2O3UA 4YH1A 1XCMA 2BGNA 3EXFB 3RG8A 2XDQA 4WLNA 1YNSA 2O8CA 2QX6A 1U0BB 1IN1A 5FBRB 2EFHB 3T52A 3KR2A 1HE4A 5AM1A 3SJBA 2M9MA 1D3AA 1IWBB 3D54D 4OD0A 5WRFA 6REQA 2BKLA 2I7VA 3CR8A 3A3KA 1YHNA 3G7UA 3GGGA 4Z99A 4FNAA 2XCIA 3ZR4B 4K9MA 4NDNE 2A33A 2OKCA 1VGRA 1YCDA 3Q7QA 1OF1A 1J9EA 1XZMA 3EF1A 3OQNA 3EDOA 1XRPA 1OBFO 5CBPA 3SFZA 4QXRA 4XDYA 3REQB 5EMKA 3NHZA 2Q6LA 3QPUA 1NW6A 5F23A 3KEQA 1W5AA 1ITZA 1GCOA 1AUPA 2EL7A 3G2MA 1MX9A 3OIVA 3PQEA 1ZJJA 4YUXA 4IGAA 2E37A 3QEKA 1JEEA 2XRYA 1G63A 3IOBA 5J4HA 4UUAA 2QBYA 1Z0KA 1XOIA 1CHDA 2RSLA 3U5ZB 3EGOA 3QXJA 5CA0F 3P4YA 3MS2A 3PX3A 4JQZA 2M6LA 4ZTZB 3QEAZ 2JH8A 2PAFA 2QMZA 3DZCA 4MIYA 4QAJA 4YAGA 3EGDA 4YX9A 2XUJA 3L77A 1Z38A 4ENUA 3QXGA 2Q8PA 5KJ6A 2EC5A 3D0OA 1VTKA 5IC5A 4Y2PA 3WGLA 4HNUA 1KQOA 1BZYA 4D0NA 5LUAA 1X1EA 2VYNA 4YN3A 1FF9A 1LX7A 2XGSA 3GFSA 4N48A 2MOKA 3E7FA 4DCGA 3RIMA 5JH7B 3GEGA 4NH4A 2V7UA 1VL0A 5C8YA 4LY6A 1PJSA 3FDIA 1RKQA 2VF5X 2PHZA 1W5BA 2C95A 4MUBA 2AW3A 3LPMA 3VISA 3VR4A 1YBFA 2YCBA 5DTEA 3T61A 3TLXA 1KGDA 1F8YA 5IC6A 3LY7A 7ADHA 4WX2B 4ZALA 4WNYA 1I1HA 2QR5A 4CGYA 2DBRA 4ECAA 4BWYA 4B4KA 2RI0A 1XYYA 4U8HA 5G1PA 3K31A 4J6FA 5KUTA 3QFTA 1SQ0A 4C2TA 3M33A 4MQ5A 4KQGA 5DYNA 3SFTA 3PHHA 7MDHA 4FYPA 3VR5A 4CTKA 2C7BA 2QWXA 1PFYA 4UMEA 3WLAA 3OY2A 4M53A 3WX0A 3ZY2A 5ALFA 1LPNA 1N2CA 3GW8A 2GZAA 3GC6A 4DT1A 4QNMA 4URXR 1RLJA 1DINA 1YRQA 1K7YA 3WWEA 4I50F 2CFTA 3ST7A 3M5CA 3ZHRA 3EGWA 3QELB 1KZ4A 4ISCA 1K7EB 5A1TA 1WY7A 4HXEB 1U2EA 3EG9A 4LRQA 4C4XA 4UATA 5AHWA 4HR7A 3CYFA 5DFAA 4EWLA 1XD9A 3UHJA 1YB2A 3RFFA 1KFEB 4XIGS 2OV3A 3KQLA 2AWOA 1TJNA 4RX1A 4RZQA 2WM8A 3O83A 4A15A 1W85A 3IKLA 4LGYA 2ECPA 1W73A 5J1TB 4H6PA 1JAZA 2H0AA 3I42A 4TTJA 3S27A 3MYRA 1ADJA 2EQ5A 4MH0R 3L0SA 5H3HA 2GYVA 4OQNA 1D6SA 3JQAB 3M3DA 1YSCA 1OKKD 1SXJA 3WFZA 1U0RA 2UXDB 2P68A 4MW1A 1AHIA 4PN3A 5EWMB 1YR6A 2HZ7A 1P2FA 4FE7A 3PS9A 1XVTA 2WU4A 5KJEA 3PUIA 3ODGA 3ZGVA 4D9GA 3HMKA 3R7BA 5JVDF 2E2WA 2VSXA 2FLKA 4POOA 3KSDO 4BL5A 4NENA 2ZRNA 1V3UA 2CCGA 4IFTA 1D0IA 4UU8A 1YI0A 5CVDA 3SEZA 3ZCQA 4UNNA 5IJ9B 1OWOA 3WO1A 3HP1A 5DNUA 4C22A 5KCZA 3ED1A 5M3BA 4E5MA 1YZUA 2OCIA 2JC3A 2VT6A 1NVTA 3TAHA 4CF6A 3HXLA 4WN9B 1ZD3A 3H6GA 1U9JA 3W8RA 4H7DA 2FG6C 2DTXA 4RK7A 3A4MA 3AG5A 1YMVA 1U7ZA 2HJWA 1LBTA 2IYLD 2LZ0A 2RONA 3IXLA 1PS0A 1WDLA 3VNUA 4DCCA 3M4YA 1FDRA 4HVTA 1XTZA 5NULA 1C8VB 2REBA 2HNKA 1NSYA 4W5OA 1UZNA 4A2PA 4DW8A 3GPLA 5BVHB 3DE6X 4QYTA 4I4IA 4P82A 4XARA 2VWGA 3CUUA 4YQZA 3RU2A 4RXUA 3L06A 4WCFB 1HEUA 1OLUA 2B8TA 3O4IA 4YCBA 3W90A 3RJTA 4B0PA 4BTLA 3NRBA 3ZVNA 2H9IA 1YE5A 4RU1A 3SZUA 2HDHA 5LZ7A 1ABFA 4OXQA 4EG0A 5JAHA 2RGYA 3CLSC 2GD0A 2N3ZA 3FVRA 3PNLA 5K0LA 2K87A 3PF9A 1R0LA 1YIDA 3MWLA 1PZFA 4GKBA 1HX7A 5EUMA 3VDXA 1EDDA 2Q1YA 1RM3A 1SPBS 1U28A 3DZFA 4QVIA 1Q0SA 4CIWA 5JHHB 3RARA 1KWGA 2I6XA 1NUTA 4BFCA 2MDTA 1DBWA 3OE1A 2VSOA 4BVGA 4LWZA 4M9CA 4UVIA 2JJ2D 4M6WB 2X4IA 2EBUA 2RFLA 3RUDA 4CQMA 4GL4A 5K5EA 5LP6A 4V0MA 3J7AC 1I3OA 2EX1A 1BW9B 3IJPA 3R40A 4H6VA 4PLPA