3CPJB

Crystal structure of ypt31 in complex with yeast rab-gdi
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
198
structure length
164
Chain Sequence
YDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMGVEFATRTLEIEGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDSKSSSYENCNHWLSELRENADVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALSENVDKAFEELINTIYQKVPTISL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural model of the GDP dissociation inhibitor rab membrane extraction mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Rab GDP-dissociation inhibitor
total genus 50
structure length 164
sequence length 198
ec nomenclature
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cpjB01
4D4LA 1YZQA 3C7KA 4S2EA 2G6BA 3GEHA 2O8EA 4OQMA 4Q1FA 3SI7A 1R5NA 3CLVA 4G1UC 1SVOA 3ZZUA 1IONA 4UJ3A 1XFAA 6Q21A 1NL3A 1NG9A 2ANBA 3KKNA 1GG2A 5JRZA 1OYWA 3LWNA 4KVGA 4B2PA 1EFTA 2CVHA 3NHBA 3RS3A 3DM9B 5EUMA 3FWYA 4BEBA 4DSTA 2G0TA 1UKZA 1Z2AA 1XRJA 2GCOB 2OO7A 4LOAA 1HURA 1WA5A 2IXGA 2J0VA 3AF2A 3H1TA 1CF4A 1G7TA 4RJLA 1KYIA 2C9OA 1EX7A 2VQSA 3AGPA 1VCIA 1XCMA 1G291 2DYKA 4IVQA 2JLWA 1JEEA 1SGWA 2D2FA 4LYFA 3WBJA 2OG2A 2DFLA 4LBWA 2F43B 3FDIA 3PUYA 4JL8A 1E2QA 4MGIR 4OQXA 3FFAA 4JS0A 3KQLA 4QBHA 2RGAA 4IFEA 3VFDA 3DKVA 3T35A 4B35A 1ZINA 1E2FA 1Z0DA 2VEDA 2E9SA 2GETA 4TYYA 4QHTA 3PUXA 3Q5EA 1GAJA 2FEMA 2NZJA 1M1YE 4M4SA 2JJ2D 1UF9A 4PPNA 3OE7A 2ZREA 4YDHB 4KLZA 4FCVA 4E09A 4LHVA 4NYMR 1MABA 2FPKA 4TQUS 5FUYA 2QNRA 1OV4A 2RMKA 4TMWA 2VP2A 3VTKA 4W9MC 4HSEA 3TUIC 4YMSA 2FFQA 5EE5B 1VG8A 2BHRA 2K5UA 2X2FA 3EPJA 2ZE6A 4QNRA 3H84A 4DUGA 3U7FB 4L4UA 3CWQA 2ZI3A 4N0DA 2EU8A 4DCVA 4NZYA 5LD2B 1D2NA 1COWD 3QJYA 3KL4A 4LYJA 4AKIA 1JXMA 1XZQA 2YINC 3SOPA 1IQPA 2JATA 2REXB 3BH7A 1BH2A 3NVAA 3DZDA 3B13B 2IYVA 3HYTA 1Q22A 4K81B 2DFNA 3B9PA 2WWGA 3ZD6A 1D8TA 1LS1A 1SHKA 3RDPA 2A2ZA 3ADDA 1G1MA 1Z63A 1OH6A 4O25A 3DM5A 4BFZA 2DWPA 1RPZA 1KAOA 2EVWX 5L3VA 5DI3B 3AEZA 2VP0A 2VP6A 3HPRA 2W83A 3EW9A 1O3YA 3BD9A 1AS2A 2P2LA 2GDJA 3N70A 1FFHA 1WQ1R 1ZCBA 4FMDB 2XNSA 4D0GA 1N6LA 2CNWA 2BCJQ 1TAGA 4YXWA 5SZKB 2RCNA 2Z4RA 3QF4A 3CR8A 2R6FA 2XXAB 1W47A 5DI9A 3R9IA 4YMWA 2WJIA 4HAWA 2ZSEA 3D6TB 3LFUA 4US2R 4JLPA 2P6RA 2IHYA 4OJQA 3CWZA 3A58B 4RZ3A 3OFNA 2PH1A 5L3RA 1F2UB 1GRQA 3A1WA 2RHMA 2ZSDA 2AFHE 3WXMA 3RHFA 3SFZA 5HKKD 2R62A 5L3QB 2F55A 1OSNA 2XB2A 4L16A 3PEUA 1AZTA 3B7GA 1MO4A 3AP2A 3CO5A 4JVMA 4QGAA 3RS7A 4DWJA 1OT3A 1OFTA 3CRVA 3KZ1E 3QBVA 4BFSA 1MO5A 2PMKA 4DLWA 1G16A 5J4KA 4C3ZA 4NHOA 2QMHA 4A0GA 1RFLA 5B30A 1JB1A 4DLSA 3P27A 2NO7A 1GL7A 2A3RA 3L2OB 1KDRA 1E2MA 3R9XA 2NIPA 4LBVA 4A2PA 1H8HD 4LHWA 3K9LA 3V4FA 3SBDA 1WRBA 1KI7A 1XWIA 3NDPA 4HYYA 2R65A 1ZUHA 2QN6A 3NKVA 1V5WA 5BWMA 1DAIA 4M9ZA 5AR1A 1ZJ6A 4Q4JA 1Q44A 2H92A 3C16C 3AVUA 2C78A 1FW6A 2V54A 2V6JA 3PVSA 2ZJ5A 3LW8A 5KYKA 2ZEJA 1QHGA 4ZDIA 4PFSA 4JLBA 3C14C 3ZLJA 2ASEA 2KJQA 3BAFA 1Z28A 1E32A 2XTMA 4D4MA 2WICA 3U6BA 3SU8A 1YR6A 5FTMA 2ZVQX 3Q8XB 5G41A 5JSZA 1G19A 4GOJA 1Z0JA 1G9XA 4XTCS 5EE1A 1ZCAA 2GWHA 2WSSD 4IFBA 2J46A 3I5XA 4M9QA 5CIQA 1KI3A 4BLRA 1V43A 1RYFA 1CP2A 3QVUA 4Q66C 2ZJ8A 4F92B 1XZPA 3NWJA 3VHXA 2YJTD 1G21E 4I1VA 4HATA 4M9XA 1N2CE 3CF0A 4TL7A 2NO1A 2ZUCA 1E96A 3U6KA 2ZAOA 4XTRA 3GLGB 1NN3A 4MITA 3RANA 5A5GA 3EIHA 2J0SA 2LWIA 4DIEA 3EARA 4Z51A 1AA9A 1FQJA 3CX8A 2P65A 3AP1A 3CUEF 3LX5A 2KBEA 3TAUA 3U44B 3PEYA 4IXNA 1FNMA 4LYAA 1N6IA 1NN5A 1YRAA 2FSGA 1EG7A 1A4RA 3FKSD 2PCJA 4JSYA 2F1RA 2AL7A 2R6DA 4BFUA 2A5GA 5LBIA 5HZKA 5TV2A 2BKEA 4EPVA 2RGCA 3LQQA 4QGGA 1GNQA 3QXJA 4AC9A 2ZI5A 4Z54A 5TMPA 1GDDA 1PJRA 5AJVB 2WOOA 1FTSA 1P5ZB 3GLIB 3THYB 3W34A 2WKPA 4OI1A 2GAOA 2GJSA 1JEDA 2FF7A 2EYQA 3QKSB 1ZM2A 4NMMA 4OQNA 1LS6A 4C0KA 1G4AE 1KO7A 2IUUA 1FMJA 3R7WB 1KDTA 2J45A 1R0WA 4KSCA 1XTRA 2GCPA 4IDOA 4QOSA 4TL8A 4M1MA 3MFYA 4JIMA 1GNPA 5AJZA 3R8FA 3PENA 1TTTA 4Z1MA 5B57C 3RRZA 3TGPA 3MGCA 5KOYA 1OKKA 3K0CC 1E6CA 1SZPA 1ZAKA 1W5TA 5LB4A 3Q72A 4AYWA 3EA0A 4NCHA 2GTPA 1NKTA 1IJEA 2QUZA 5AUPB 1GL6A 4Q7JB 3SYLA 4FCWA 5GADl 3LQRA 1T8TA 2QU8A 2ZS7A 1K8RA 2ZANA 4P3YA 3U4QA 5C4GB 1W4BA 4PQYA 2RGEA 3A4LA 4V0ME 1TF2A 5GJBA 1N0VC 4US1R 3SR0A 2CHVA 4BEJA 3KQKA 1UKYA 2B8TA 4NYIQ 2YV5A 4N1AA 1TMKA 3N2IA 4MRRA 4GFDA 1JAHA 2V3CC 2V7QA 3OEED 3T1VA 1CIPA 4GP6A 4RFVA 3CKLA 4UJ5A 2ZPTX 1GRNA 2BOVA 3P20A 2O8FA 5CJ2A 1KDPA 1IN7A 5CYPA 3T1TA 2RGXA 2MSDB 2N42A 1S9DA 3ICEA 1OHHD 4Q9LA 3ZH9B 2GZDA 2YOFA 4EJSB 2H5EA 2OE2A 1IY2A 3AUYA 1E9BA 4PZYA 1W2HA 3D3QA 1G5PA 2GBLC 1G8FA 4GBMA 1XJ0A 1NMXA 2A5YB 4YLGA 2J59A 1XPRA 1E9CA 3CPEA 1Z6GA 5CB8A 5EE0A 3AVXA 5BQ5A 1G41A 2JGNA 3UWOA 2XZOA 4POAA 1D6JA 1XEWX 2NPFA 5FOWA 4BFYA 2CL7X 4HUQB 1YU9A 5TY0A 1KO5A 1ESMA 4H1UA 4TYQA 2ZU6A 4JLJA 3I8SA 3MJRA 4MKHA 4R2HA 1TQDA 3RNLA 3AVVA 3PV0A 5FTNA 1GZSA 1P75A 3HU2A 1OB2A 2WIAA 3L0IB 4U02A 3RC3A 2G3YA 2IYLD 1HQYE 1A5TA 4LWZA 5CM8B 4RY2A 3QQ5A 5LPNA 2JA1A 3B1YA 4A8JC 2GCOA 2IYZA 4PQFA 2EWWA 2PBRA 4E5UA 4HLDA 3QXHA 3LA6A 4U5XA 4CW7A 4EPYA 1ZP6A 4TLDA 4QGHA 2IEZA 4AURA 4HLQB 2QEQA 1S2MA 2QT1A 4M21A 2WSMA 1XMJA 3R20A 2F1HA 5M04A 3ICQB 2BKUA 1II8B 1R5BA 3B9QA 3THWA 1SVIA 1MO6A 3EIQA 1VHLA 2FSFA 3NEYA 4MGZR 1YRBA 2IS2A 1CEEA 4ZIRB 2P67A 4JBYA 3P1JA 2ZRJA 4GL2A 4TL9A 2CNWD 4UKDA 4ZDWA 1BYUA 1EFRA 4QBGB 4CEIA 1TU3A 1E2GA 1JPJA 1KO8A 4MKFA 2JAQA 4C7OB 1OXXK 2MSCB 3B2EA 3PUVA 4XVQA 3I61A 1KY2A 4M1YA 4PC2A 2J7KA 4CVNA 3DVLA 5K8TA 4Q00A 1QVRA 1F48A 3OHMA 3SYKA 5HTKA 2G88A 3TQFA 1EGAA 3G0HA 5EZ6B 2HCJB 5JHGB 1EWQA 1N6KA 1H8EA 3MRSA 3CW2A 3E70C 4ITRC 2OAQ1 3KXKA 3H0KA 1KI1A 1DO2A 2WKRA 1VCOA 1U94A 1P9WA 1G7RA 4P0TA 1W4RA 3KX2A 3N5CA 5TDHA 3VKHA 4MRNA 4CF7A 3PITA 2J7PD 4AG6A 4L15A 5JS7A 4ZCMA 3HPQA 4LJAA 1IY0A 1PUJA 1UBCA 4LUCA 1G3QA 5JBQA 2O8DA 1QHXA 1S3GA 1OIWA 4I1UA 4HUTA 1VHTA 2ERXA 2PJRA 3TSWA 3LVQE 1L2TA 3GD7A 3ZIAA 2NO6A 4AD8A 1KZ7B 3BK7A 3NBZC 5GJCA 3TJZA 1AKEA 4BFWA 2FGKA 4KU4A 1EFUA 1U2RA 4DIDA 1E1RD 4MYTA 4M1OA 3SEAA 4CZ2A 4AKHA 2QT0A 4Q4JB 2H16A 3PUWA 4NCIA 4TMZA 2GJKA 4CEJA 5CK4A 2IYXA 4Q9IA 2BVNA 2Q9AA 1FP6A 2O0JA 2O8BB 2WBLC 4BFVA 1ZVQA 1COWA 1Q3TA 1RYHA 2FJUA 1QHHB 1NF3A 1ZNZA 4TL6A 1L4UA 4DCUA 4QJ3A 1XJCA 3CH5A 3WY9A 2FFAA 1YZGA 4XJXA 1R0ZA 4KYIB 1X86B 3I8XA 3GCGA 4PSVA 3UPUA 4PR0A 2XJ9A 4FWIB 1NMZA 3I72A 1SKYB 5GJVC 2QRZA 4AWXA 4A8JB 5FPSA 2GCNA 3GQBA 5L3QA 2ZRCA 5CLLA 3GPLA 4Q03A 2J0QA 1R4AA 4M0LA 4A6XA 3NBXX 2AKYA 3TLXA 1ZMXA 3QOFA 1TUEA 2W58A 4B2LA 1SXJC 3VR1A 1FP7A 1HTWA 4OHYA 1RIFA 3FMOB 2ZSBA 2IS4A 5KPDA 1OXTA 1SULA 4TMVA 2B8WA 1Z5ZA 2CCGA 1AN0A 4Q4AA 3KXIA 4JBXA 2GA8A 1I2DA 4M1WA 1TQ6A 1MH1A 3AKDA 1IY1A 1Q1EA 3BJIC 3U44A 2PT5A 2KWIA 4Q7LA 4TLCA 3FTQA 5KNCA 4CT5A 3NHAA 5KSOA 1KK3A 2AD5A 4DBLC 3TVTA 1OF1A 2JLSA 2AXPA 1YKSA 1A7JA 3FOZA 3WP1B 3GFTA 4A0RA 4V0OA 5EQTA 2ZTSA 4KHZA 3RAPR 3FB4A 5FPYA 5EP4A 4WIAA 2JJ8A 1G17A 2F3TA 2BJVA 5E7MA 5P21A 1E2DA 1Q1BA 2O0HA 2NMVA 3KJHA 3ZYCA 2Z5FA 4Q02A 2WWYA 2GNOA 2DCUA 1XF9A 2ODWA 1P3JA 3K0EA 1VCMA 2I3BA 3WBKA 2N46A 3K0SA 4A4DA 5AUOB 1U0LA 4F4CA 4B43A 121PA 4V0KA 5J40A 1E9FA 5K8UA 2PJZA 1Z0FA 1M2OB 5FL7D 3LNCA 2O0KA 2V55B 3W9YA 5A4JA 3AB3A 521PA 4I4LA 3P4XA 4R9UC 4ERNA 1GSIA 2ZR9A 2PCLA 1U99A 3BFKA 5CITA 1WXQA 1OB5A 1F2TA 1Z0AA 4G5GA 5KTYA 3FKSA 4GPTA 5CLQA 4LPSA 4URZR 5J5CA 4ARZB 1UKVY 4X8HA 5JWHA 1EXMA 1DE0A 1NBMD 5KHOC 5HCNA 2F1IA 2UVQA 2V7QD 3OEEA 5TXGA 2O52A 1N6HA 1B0UA 1U90A 2VO1A 2FN4A 4LV5B 3UMFA 1Y3AA 1NMYA 2V4ZA 4BLSA 1X3SA 3A36A 4JLVA 4XWAA 1P72A 3CRQA 4A0FA 4DKXA 1XEWY 5F3WB 821PA 1J8YF 4JKYA 3IBGA 2D4HA 3N2EA 4ZI2A 3O8RA 2RAPA 3C5HA 1T3LA 1CTQA 2RGBA 3K53A 1W0KD 2CEAA 1L8QA 2OBNA 4ACBA 4EPWA 5JWOA 2RGGA 1AS0A 2REOA 3VAAA 3IO3A 4LHYA 3LLUA 3WRYC 1YZTA 5EP2A 3NIBA 4AK9A 4B3BA 5J4LA 2F7SA 4LV8B 3CRW1 5K8LA 4Q21A 3EPHA 2ATVA 1F5NA 2AX4A 2OM2A 3AF1A 3R9WA 3RS0A 5FBVB 2QBYA 4BZQA 4BE7B 2QSYA 2ZRHA 1QF9A 5AK0A 3QY0A 5EE9A 3CNNA 2WTUA 2CL0X 2Q9BA 2ZRNA 4JZKA 4Q4LA 2PZEA 1EX6A 2VP5A 4JLAA 3WHKA 1WF3A 3MWLA 4R71A 4C2TA 3MJHA 2WKQA 3RSLA 4KAXA 4NCNA 2FX3A 3X1ZA 1UEIA 2G77B 1VCNA 2V9PA 3QPWA 3LXXA 2FV8A 4NYJR 2EFHB 3ZZ0A 3WYFA 1WBBA 1P62B 4TLBA 4DSOA 2ZR0A 1G3MA 1MRNA 2QE7A 3Q7PA 1JR6A 2QMOA 3LD9A 4TTQA 1SXJD 2WJJA 2VRWA 4M1SA 1KNQA 3K1JA 5JEEA 4IOJA 4A9AA 1YR8A 3C5CA 1XU4A 3UKDA 1QRAA 3WNDA 4A36A 4G0NA 1U8AA 2VPPA 2C98A 4EJSC 2VSOA 3NXSA 3NTUA 4AYXA 5FR2A 1Q1QA 5KDLA 1XBTA 2HJGA 5FPTA 2FZLA 1RJ9B 2ZS8A 1KK2A 4URXR 3MLEA 1E4VA 3REFA 3DHWC 2Z4SA 4HAXA 4Q9HA 5CM9C 3I5YA 2O8DB 1E79D 4PHHA 4WZ6A 4G5SA 1U81A 4DLXA 5KSPA 1JR3D 3LBHA 4HB4A 1KJYA 3IHLA 2D7CA 3E5HA 1RRCA 4Q4HA 3KB1A 2GVZC 3I32A 1KMQA 1GTVA 2GZHA 3I1FA 5FBWB 3BH6A 3NEJA 2B7CA 4M2LA 4D4JA 4MKGA 2CBZA 1ZD8A 4E03A 1KI6B 4DEYA 2C77A 1KSJA 2CL6X 3TBKA 4FWTA 1Z8FA 2UKDA 1OH7A 2WJVA 4I1SA 1DO0A 2ZIAA 4A92A 5B58C 3HU1A 3QXCA 2CDNA 2FPLA 4FD2A 4TYPA 4V03A 4F7WA 1DARA 4G3XA 1KHTA 1P9RA 4OJKA 2GF9A 3U7EB 1TX4B 2GAAA 3GLHA 1XMVA 3OIWA 4D82A 1US8A 1UFQA 5E4FA 1KNXA 2BIFA 4A8JA 4A2QA 4PPQA 4P4TA 2UZ3A 1G18A 1S8FA 2OAP1 4YMVA 1U0JA 1ZYUA 2ZSFA 2YOGA 1XX6A 3RRYA 2QTFA 2HT1A 5JWRA 3SQWA 2RB4A 1P4SA 3M1IA 2H8KA 3LW7A 2XEXA 3BE4A 4PSAA 4IOKA 5GVRA 2HYDA 3B1XA 3ETLA 1OH5A 2Z83A 4KCGA 4Z1MD 2W0MA 3GJ3A 3ZS9A 4OKSA 1VDZA 4JJZA 1JJVA 1G6HA 1NSTA 4D81A 2C04A 4CT4B 3BRWD 1T4GA 4DUGD 2CLSA 5AJXA 2AFIE 3CRMA 3BORA 1Z83A 1H65A 2IT1A 3C15C 3U2QA 4D0NA 2JJ1A 1KIMA 4EIWA 2GXQA 3IQXA 3CONA 5JSZB 2EQBA 2GJ8A 2ODEA 4O2RA 4PX9A 3DDCA 1T5IA 3GJ8A 2H7VA 1XCPA 3U7HB 5GJWC 5DGXA 3VU9A 2QL6A 1AK2A 1OKKD 1G5RA 3SQXA 2BBOA 4QBFA 1FTNA 4XWOA 3BS4A 2Z0MA 3AV0B 2JJ2A 2W6ID 3MCAA 5KUTA 2MMGA 5KPJA 3ZDQA 2ZR7A 2QQ0A 4RD6A 4ZV4A 4ASUA 1KI2A 2WZQA 3DMNA 4FI3C 4YMUA 5GVSA 4LJ8A 4HDQB 4JYCA 4ZCIA 2D06A 2IYRA 1FZQA 1GVNB 1SXJE 3PUZA 3AF4A 3K9NA 1KK0A 4EPXA 4LJ4A 2IK8A 3RYTC 2C5LA 2NZ8A 1I4DD 2OCAA 2WV9A 4AY2A 5FI0B 2GK7A 2WVJA 1NRJB 4H1VA 1FUKA 3RABA 1PZNA 3JVUA 2FA9A 1T8UA 3K09A 4ZKDA 1BKDR 2IXFA 4MYCA 1KTVA 1OIVA 2ZJAA 4RD1A 1W4AA 3H4MA 4W5JA 3X1DA 1E2KA 1NN0A 1E2IA 1G7CA 4JLKA 4BLPA 1E98A 4QM7A 1C9KA 4II7A 1FPMA 1JJ7A 3A1TA 3EA5A 4R2IA 1HYQA 2O8CA 2XZPA 2ZETA 2W2TA 3RLFA 1AGRA 1M7GA 3GJ0A 3SBEA 4HLUC 5CK5A 4OQFA 4JJKA 2PLRA 3CZQA 2ODNA 4LCBA 1TU4A 3TSOA 2Q3MA 2KBFA 2V6IA 1QHIA 4OI2A 4TQAA 4WVFA 2W6IA 3HYRA 5DO9A 5FTKA 1XXHA 1IJFA 3VR5A 1G3UA 4WZBE 1SQ5A 4HZIA 1YJ5A 3RRNA 2GXAA 2PL3A 3RS2A 3NH6A 3SJAA 3W6NA 3PCRB 3C8UA 2QY9A 3BFXA 4PHTA 3O8DA 4GMXA 1L4YA 3KKQA 1KAGA 3D31A 3ZVNA 3WNCA 4TSFA 3NBFA 4DLRA 3W8NA 2C99A 4HUQA 4MDEA 2D7DA 1RC8A 4QJ5A 1E9SA 1NBME 2BM1A 4GNKA 3ZVMA 5JJIA 1GILA 1AS3A 4ZDJA 5JI2E 5JI3E 1A1VA 3QPUA 2PEZA 1G8GA 1P2UA 3TW4A 1DAGA 3MD0A 5D3MB 5IK2D 4XWKA 3BC1A 3IPYA 2OEPA 1RZ3A 2HLDD 2OBLA 4B34A 1IN6A 3QI2A 5CIWA 5H1YA 2WWXA 4XVRA 2ZRMA 2D74A 2FDCA 1CJUC 2WHXA 3Q9LA 2JLVA 2F9MA 4UNNA 4WA7A 5DNYB 4F4JA 3NH9A 3EASA 4K46A 4C30A 1WE2A 2A9KA 2VIIA 2GEDA 1TNDA 4TZ0A 3ZQJA 4O3MA 4DDWA 3F5FA 1T3HA 1U98A 1E9DA 2IW3A 2OLJA 5SZHB 3B1ZA 5D3MA 4B3GA 2X77A 3KKMA 4Q1EA 3B1VA 1QHNA 1PLJA 1XXHE 2FNAA 5EXTA 4FN5A 1IOZA 4EAQA 4IW3B 1D2MA 3L8YA 1M74A 4JBWA 2IX3A 2G1KA 2IC5A 3MMPA 4DT1B 4B2IA 2Z6VA 4DXAA 1OXSC 2HT6A 3CR7A 1E1QD 1GP2A 3MWJA 1JPNA 1NSFA 5FBLB 1GUAA 4Q9KA 5FOTA 1NJGA 3SZRA 1Z6YA 1IXSB 3FYHA 1E9RA 1II0A 2YC2C 1SVMA 3RS5A 5FOSA 1JQJC 1SXJA 1J70A 4DCSA 4BLQA 1J2JA 4KI0A 4M9SA 1BO6A 3GLFB 4LYHA 3TW8B 4Y0AA 1RRPA 2A78A 5FOUA 4LBZA 3RC8A 4KFSA 4BRWA 3U3RA 3O47A 3OIUA 3A6PC 2OESA 4I81A 4LSGA 5FR1A 3EWAA 4MKIA 2ATXA 2CE2X 3IPXA 3B60A 3LRPA 4OK6A 4Z8XA 3R7WA 3ZVLA 2G9NA 1P73A 4ON9A 1VECA 1TEXA 2ZITA 4Q47A 4DEXA 1SKQA 4F91B 3Q5DA 4W7SA 1W5SA 1TADA 2DR3A 4CEHA 4YDSA 2J87A 2ORVA 1YVDA 4HEJA 4Q5IA 5C46F 2ORWA 1HE1C 3EAQA 4U7DA 3U7GA 1ZM3A 4OHZA 3FMIA 1UKEA 4A82A 5KSYA 3W6PA 2ZYUX 4DDTA 4URUR 1BIFA 1NVVQ 1R8QA 5FL3A 5JLJA 1KY3A 3U4QB 2H18A 2OCBA 5AUNB 1F2UA 2P5SA 1IHUA 1EK0A 1I4TD 2IXEA 3UIEA 3X1WA 3HR8A 2XXAA 1NJFA 3F3YA 3OAAA 1IBRA 3KKPA 5JRJA 2ZYWX 5C18A 3U3MA 1XEXA 4XIGS 3BB1A 2QQEA 3MWKA 4C0HA 1CJMA 4XD7A 1KSFX 5JCZA 2R9VA 1A2KC 3EZ9A 4P4UA 1N6RA 1OIXA 5KO2A 2P5TB 1S1CA 5FL7A 2FEOA 3GJ5A 2ZVPX 4QKQA 1NN1A 4EPTA 1UM8A 4MDFA 3PXGA 5AWFC 4DVGA 4ZDKA 2ZQ5A 3GLIE 1OHHA 3GLHE 2AKAB 4DLUA 1WCV1 4ZIRA 3L43A 5HCIA 1KO1A 5FUVA 2C2HA 2V1XA 2IYWA 4GT1A 1SVKA 2WPDD 5FPHA 2Q21A 4G5QA 1HT1E 2IWRA 4B44A 4TYWA 2IUSA 1K6MA 3R8CA 1E9AA 1QG2A 2C96A 3ECCA 3SHFA 4HAYA 3KJGA 3B82A 1HE8B 2WJHA 1KJWA 3THWB 1T91A 1UDXA 1Z6TA 2MMCA 4RKFA 3NDBB 2WMOB 4IOMA 2CE7A 5LD2C 4UNQA 3U3KA 4B6FA 4XH9B 4JT4A 5E95A 4OBEA 3TNFA 1UJ2A 1QHYA 3WMFA 2YHSA 1TQ2A 5DIFA 3AVTA 4CDGA 4KJZA 3CF6R 3SYNA 2ZI7A 2IHBA 2XTZA 1PVOA 4J0QA 1KI4A 1IN5A 3LVRE 3ASYA 3B85A 2XOKA 1LVGA 3IKJA 1R0XA 4OHXA 4OK5A 3RVBA 3QF4B 2A5DA 4D0LB 5G3ZA 3PEWA 1OFUX 1Z0KA 5ANRB 1OFIA 4TMXA 4PC1A 3AF3A 4IVPA 1KGDA 3A4MA 4L9WA 5BYKA 2QM7A 5CDFA 1Z0IA 1ETUA 2FH5B 1NI3A 1QBKC 2BEKA 4P31A 4GI7A 3M6AA 1CR4A 3W3ZB 1WB9A 2B7BA 4C2UA 3QEJA 2FFHA 1R2QA 4BQSA 4C0SA 4BECA 4PXAA 1E79A 4C7OA 2DBYA 2R2AA 4P32A 1H8HA 2CLDX 2R6GA 1X1SA 3CB4A 4RD3A 4KITB 1N5IA 3CBQA 3ND9A 3EZ7A 3TRFA 4KBGA 2QAGA 5FH9A 4ESVA 2BBSA 2QA5A 3K0CA 2JIZD 1JALA 1UEJA 3K70D 1T5LA 1UBGA 4PPGA 2VA8A 1DAMA 1DPFA 4PZLA 2J9RA 3CPJB 3HDTA 5AUQA 2QG6A 1H8ED 4EPRA 1W1WA 2BJWA 2ZSAA 1QHHA 3P32A 3GLGA 3F8TA 1NLYA 2N1BA 3M4YA 4IOLA 4B75A 2REBA 2V1UA 1ZC4A 2QGZA 3QEOA 2XSZA 4Q1AA 4TLEA 4X8OA 1XTIA 5IDVA 4AYTA 4LJ7A 4GZMA 2VHJA 4NPHA 3GFOA 3TSZA 2IL1A 2J7PA 3C4JA 621PA 3MWYW 2FSHA 4NL4H 1ZRHA 3E1SA 2Q3HA 3AVWA 3ND8A 4GDFA 3AM1A 2JLUA 3REGA 1E2HA 1VG0B 1RKBA 1ELOA 2BMJA 3OEHD 3A1UA 3JZMA 4AKGA 1CU1A 3EIEA 4OHVA 5LB2A 4LJ9A 1W2GA 2ERYA 3FFBA 4D26A 4NDZA 3LX8A 2MSEB 3GLIA 3THYA 1XCGB 2JLQA 4A1FA 3LBIA 4PZZA 2WJGA 3VHLB 4IEIA 4LRWA 4W5WA 1QHSA 4HAZA 1KMHA 2ZJOA 4OHWA 3UMSA 2I1QA 4YMTA 4JLOA 4NYMQ 3IQWA 3HP1A 5SZJA 4EDHA 1E0KA 3IUYA 1VKJA 3DOEA 1LB1B 3KJEA 4DJTA 1Q1ZA 2OBMA 4NBSA 4DLYA 2CK3D 3ZD7A 3FMFA 3KUCA 1U8ZA 4ILEA 5EXXA 3DEFA 1KDOA 1N5JA 3BIFA 1P6XA 4B73A 3SC3A 4IHQA 1LW7A 2H1LA 3GLFA 5LDDC 4FIDA 3PR1A 1Y63A 1QZXA 3A8TA 1CR1A 1XJQA 4F93B 4C4PA 1GOTA 5H8WA 4Q4AB 1ZW6A 5DYGA 2VSXA 3TAHA 4LY6A 4LBYA 3BBPA 4Q1BA 4ARZA 4C0AC 2XJ4A 5J4HA 1PV4A 4MUBA 1W36B 1AKYA 2YWEA 1F6BA 4ACAA 3RSOA 2UZIR 2H57A 5FI1B 2DWOA 1DAFA 5KNDA 3TUZC 3THOA 1GL9B 3QKSA 1ZC3A 3V4RA 2Q0HA 2BWJA 1W7AA 2W2XA 3FHOA 1CR0A 2IBMA 1R7RA 4DLZA 3X1XA 2ZS9A 3AVQA 1E2LA 3S1AA 2P6NA 4DB4A 4JVNA 4CGZA 4I1OA 4HZUB 1ODFA 1P2VA 2FE4A 2OSBA 5KDDA 3V9PA 2E1RA 3KUDA 4FMDF 5E7IA 2F1JA 1SHZA 1BYIA 1T6NA 1XDBA 2OXCA 2AHOA 2R6AA 2XAUA 4HDOB 4DZZA 4XVUA 2R44A 1YR9A 3IIMA 4CEIB 3SE0A 1DS6A 2ZAMA 1SVSA 5JEDA 4G01B 2QRNA 4IJMA 1LTQA 4LJ5A 3TIFA 2ZJYA 3THXA 1M7BA 2FFBA 3CNOA 3QG1A 4R7ZA 5SZIA 3UG6A 2QP4A 2WPDA 4AIIA 4HZUA 1II9A 4TMTA 4DCNA 4DRZA 2OXRA 4DSUA 5L3SB 3AH8A 2FMXA 2OZEA 2PEYA 3IBYA 3QXSA 4FW9A 4V0MA 5DISB 5FTJA 3WMEA 3FMPB 4RD2A 4B47A 1Q20A 4TQ9A 2ZJZA 4LHXA 1NIPA 1XTKA 2ZROA 4AG5A 3E2IA 2XNDA 3IILA 3TH5A 1B23P 4EFMA 3AVYA 4HB0A 4Q1CA 3EC2A 3TR5A 1KI8A 4LDJA 4WXPA 2ZRAA 1NVXQ 2AWOA 3A4NA 2OV2A 3L8ZA 4BFXA 4C9BA 2QBYB 4EFNA 2QMEA 2X8AA 3LBNA 3UMRA 4B33A 3OEHA 1UDWA 3GLGE 3WP0A 2AK2A 5IHPA 2OFXA 3K0FA 5BN5A 3CH4B 3HJNA 4Z8YA 2QORA 4XSHA 3ZIAD 4Q18A 4Q9JA 4HLCA 5BXQC 5FBQB 3GEIA 4B74A 1CLUA 4QFMA 2J0UA 4AI6A 3AP3A 2Q9CA 1XMSA 3HR7A 1S3SA 3GP8A 2IYQA 1RVDA 3ADKA 4PC3A 4KFUA 4RFSB 2FOLA 3K0AB 3HWSA 1NP6A 3EG5A 2KI5A 2FG5A 3EWSA 4IKEA 3O8CA 1X8LA 3K9GA 4LHZA 4QM6A 4KXFB 1JNYA 1HUQA 1KJZA 4GP7A 1YZUA 2AK3A 4ESHA 4URVR 4MRVA 1US8B 2WJYA 1CJTC 1ZNWA 2VHQA 5CB6A 1W36D 2QTVB 3LLMA 1VTKA 4MA4A 1ZD9A 4UQOA 1XXHB 1GNRA 4I99A 2OFWA 1N25A 1VPLA 4JSTA 2WOJA 1KKMA 1ZM9A 2FZ4A 2ZUBA 3UK6A 1G64A 4DDUA 1Z08A 4E07A 2Q3FA 1NLZA 2W6JD 3P4YA 4RZXA 4A6PA 3B6EA 2IS6A 4NU0A 4RD4A 5AJYA 2RGNC 5DN6A 3BGWA 2A30A 1OJLA 4BFTA 1HH4A 1XTJA 1P2TA 3IGFA 2QTHA 2ZJ2A 4LJYA 1UAAA 1G5TA 4XD7D 2RKOA 4C0BA 2WWIA 4ZI3A 2VLIA 4AKEA 2J1LA 3QNUA 2YOHA 4WOPA 3M0EA 2HYIC 3H86A 2XOKD 4G5RA 5CYOA 3OAAD 4DC9A 5EE3A 3SS8A 3QVVA 3UATA 5C2JB 4PO9A 1F3OA 2RGNA 2P6UA 3SDZA 2AXNA 1E94E 1S0UA 3WNBA 1M7HA 5DYIA 8OHMA 1NVVR 4ZKEA 2VF7A 1JR3A 1ZIOA 5G3YA 1HQCA 1W44A 1SVWA 4K8OA 1PLKA 2X1VA 3WRXC 3WYAA 1YZKA 2PX3A 4CRWB 1GKUB 1A82A 1BS1A 2B92A 2HJVA 1FX0B 4WZAE 4PANA 4IDQA 1XD2B 1D2EA 1CULC 1D5CA 1G20E 2HXSA 3Q3JB 2WIBA 4Q1DA 1DG3A 1ANKA 1S96A 1GWNA 1X8KA 2ZRPA 4JT2A 2IUTA 4ZCLA 1U9IA 4UNRA 4QL3A 1WP9A 1MV5A 3WYGA 4KV9A 1A2BA 3U5ZB 1JAIA 5HR5A 1E2PA 2IS1A 1FNNA 2BMFA 2XB4A 1UBFA 3TMKA 2QROA 2GESA 3U60B 3VNUA 1E2NA 3VKWA 3BXZA 4D4KA 1VIAA 1E3MA 3J81k 2C03A 2QE7D 1ZU5A 2W6JA 4W5HA 4LC0A 3SJZA 4DLTA 3FE2A 4A0HA 2BMDA 3AVPA 3OFND 1C1YA 2C9YA 1J8MF 1U9IC 1IN8A 3ZS8A 2ZRIA 4IDHA 1ZNYA 2HCBA 3U3JA 2QPTA 3VU9B 5JECA 2TMKA 3BB4A 2B21A 3KQHA 421PA 4NP6A 3VR4A 1ZM7A 4LZZA 1WDTA 1ZUNB 3IEUA 3X2SA 3FPAA 4LX0A 1NIJA 4IDNA 3CPHA 1TF7A 2YZ2A 2ZRKA 1HA3A 2IWHA 2NG1A 1Q21A 1NBMA 3OIYA 1LY1A 2CHQA 4RKEA 4B3XA 1MABB 1N5LA 3BH0A 4RZUA 4B48A 2G83A 2ODBA 4X8LA 1XB2A 2HV8A 1X6VA 2I4IA 1N6OA 4BASA 1E99A 2GXSA 3P26A 1P2SA 3QKUA 3S1AB 2F3RA 1OLOA 2EFCB 3T12A 4BWYA 3K70C 4JLDA 1JI0A 2NO9A 2FGJA 4OI0A 1X8JA 3NBYC 3QXXA 2AWNA 2WWHA 1CRQA 4PO1A 4UXHA 1Z29A 4FMBB 1XD2A 5TARA 4ASUD 3EPKA 3SN6A 2KE5A 5IK2A 1G3IA 3PIRA 3QKRB 1ZIPA 4GOXA 2ZE8A 3TE6A 2OILA 3AQ4A 1LF5A 4HB2A 5FTLA 2ZU0C 4S35A 2XNDD 3CX6A 721PA 2ZJBA 1F60A 1GITA 1YQTA 4MRPA 2FSIA 4KFTA 4ZO4A 4CIDA 1CR2A 2ZM5A 1PLLA 1AZSC 2ZI9A 2GHIA 1U0HC 2OCYC 3LXRA 1OXUA 1CJKC 3DKPA 3W5IA 4B6EA 3I4LA 5IT5A 1AQYA 1U8YA 2PZGA 3LV8A 2GJAA 3T34A 2IEYA 5AJWA 4GZLA 3TK1A 5F9FA 4M22A 1MR3F 3VX4A 1F2TB 2O8EB 1GFIA 2YWFA 2ZYVX 4L8GA 2IYSA 2IA5A 4A2WA 1NVWQ 4O0MA 2WM9B 1JR3E 1FQKA 1CBUA 4JYBA 4R98A 4D6PA 2QENA 3VNVA 3EZ6A 1MO3A 3O8BA 1GM5A 1GKYA 4TTPA 3AKEA 4IXMA 1DVRA 3T1QA 1E2JA 2JLXA 3SHWA 2EYUA 3L0PA 2ZE7A 4JL6A 4RCZA 2BCGY 4BLTA 4F38A 3TVDA 4RFSA 1NKSA 1M8PA 1Z3IX 2ZE5A 1RRGA 1LF0A 4OL0A 5FUXA 3IHWA 2VHTA 5D3QA 5JCPA 2SHKA 3MSXA 4KODA 4HLUA 4CEJB 1IN4A 2YWGA 1DADA 3KTAA 4C0QC 1BMFA 3AF0A 4BPBA 3KQUA 2ORIA 3GJ4A 4DT1A 2XTNA 2ZRFA 4LC1A 2CMKA 4LV6A 4NYJQ 2I1VB 4KYUA 3X1YA 1IAQA 4B3DA 3QKRA 4JVSB 2D3WA 2P0EA 1E1RA 2CVFA 5EZ5A 3PG5A 1N5KA 1BOFA 3QKTA 3ZZTA 2QPOA 2GILA 2EFGA 4BGDA 1FMLA 5E7JA 5H68A 1N0WA 3UG7A 4A15A 2C8VA 3LH5A 4L9SA 1Z6AA 4WBSA 2ZI4A 3OE7D 3T61A 3KDSE 3I3SR 4WW0A 1ZBDA 3RRMA 1S1MA 4M8NE 3RWMB 3VX3A 4C0LA 1E2EA 2QAGB 1OFHA 3QSYA 5DE3A 2AN9A 1ZD1A 2OHFA 5DSZA 2VYFA 1R8SA 3CZPA 2ZRDA 1YZNA 3KJIA 3T5DA 4B76A 2G0NA 3A37A 4JMPA 4MQBA 2BBWA 2XITA 3THXB 3NC1C 1II8A 2ZI6A 3BERA 3EZFA 1RJ9A 4KVAA 2CJWB 3IDQA 3K09C 3T15A 3QBTA 4D2IA 2V8OA 1D9ZA 3B1WA 5KU1A 3L82B 1FUUA 1W4CA 1DG1G 2WMNB 4TWZA 3SJBA 3B78A 3KB2A 5FOVA 2EW1A 4D25A 3EC1A 2NQ2C 2ZRGA 1KI9A 2KB0A 1DOAA 5CJPA 3TUJC 1DAHA 2EWVA 1EFRD 1NY5A 2GBLA 5JS8A 1D9XA 2DB3A 4PHGA 2YKGA 1CJVC 2GVDC 4YONB 5CDFE 4GMDA 2GRJA 2WSSA 4OK3A 3ZJYA 2EFDB 1J90A 1DEKA 2QAJA 3BOSA 3SJCA 1EESA 3DMDA 4FXPA 1CRPA 3PFIA 3EXAA 1KKLA 1ONBA 3B5JA 2YNMA 2E87A 1W0JA 4KO8A 1XMIA 1N6NA 1FX0A 2PMDA 5HE9A 1TEVA 1XEXB 4BZXA 4YXWD 1VYTA 2IYUA 1R10A 4QHYA 2PZFA 1JECA 3BB3A 4RVCA 1Q12A 3W6OA 1P9NA 3EX7C 2J3EA 1OPXA 4N3NA 1IXZA 1Z2CA 2DWQA 4PSKA 3ONWA 2ZRBA 1T0HB 4NCJA 4MUAA 3QG5A 1W0KA 1IXRC 3I92A 3VR6A 1XTQA 1OYYA 4KSBA 1G6OA 2QM8A 1VMAA 3W90A 4DCTA 4DHEA 3GMTA 4FINA 1R5OA 2VSFA 4FMCF 4RSGA 4BLOA 4MYHA 3ADCA 1XTSA 3CIOA 1HY3A 2YWHA 4XSGA 4F4IA 2NOAA 4TT3D 3CF2A 2PX0A 2O8FB 3V00A 3DPUA 4PPFA 3ASZA 3TR0A 1YE8A 2CK3A 4TZ6A 4YC7A 2H17A 4WAUA 1KSGA 4LJ6A 4H9GA 2LCFA 4M1KA 1W48A 4O2LA 2OUKA 4JLMA 2GK6A 3PJRA 3BWDD 4FMCB 2GEUA 4UXJA 2HXYA 5IF9A 3VKGA 3GJXC 1GKIA 1JQLB 2R8RA 1NLFA 1E4YA 3UXMA 1NVUQ 1AGPA 1C4OA 3K8YA 4QC2A 2DHRA 5FBRB 1TL7C 3KFXA 3T06B 1Z07A 4L5BA 4QRHA 1OW3B 4Q7MB 4NCKA 3PEVA 3QF7A 2BMEA 1RE0A 4LI0A 2BDTA 4EQ6B 1TPZA 4KLNA 2G1JA 5BN3A 5JHHB 1X1RA 2YC4C 2LKDA 4WXRA 5BYJA 2QPAA 5L8VA 3G82C 4BRUA 2O5VA 4ABYA 3K70B 1I4LD 4P33A 2ZRLA 3UANA 1Z6XA 2F9LA 1VYVA 3GLFE 3FGNA 2BM0A 5C1BA 2BC9A 1ZUIA 1L7VC 4TLAA 4US0R 4OQLA 1Z06A 3IIJA 2IYTA 4IDPA 3QUSA 1E69A 2BV3A 2JDIA 2ZYTX 2QI9C 5EJEA 1GIAA 2B6HA 3MG9A 1Q0UA 2QP9X 5J47A 4EFLA 5HPYB 1VYUA 1K5DA 1YZLA 3EZ2A 2YVUA 2NO0A 1KOFA 4QG7A 5J4YA 4TT3A 3VR3A 2HF9A 5EXPA 4FCTA 2VP9A 3L0OA 5JMTA 1KO4A 4GSYA 5H70A 4NTZA 5UKDA 4QJ4A 4CEHB 4IVRA 4URYR 2Z43A 4PTLA 4PAQA 4UNPA 3QE0A 5E3HA 5FUWA 5FFMA 1LNZA 1ZU4A 5DH9A 4JKIA 5ELXA 1T3SA 4HDCA 4TTRA 3UWKA 2HF8A 2ONKA 3DZ8A 1OXVA 2F6RA 2J5XA 3GFPA 2Q6TA 3QIAA 4URWR 5B2ZA 3KQNA 1K5GA 2VL7A 4HI0E 1G8YA 2QP3A 5F2EA 3IO5A 1KMHB 2HLDA 2FWRA 5TVKA 2C9CA 1JBKA 1OE0A 2QZ4A 2ECKA 2Y8EA 3GEEA 4PC6A 2XGJA 2CCJA 1HT2E 1VG9B 1T0JB 1BMFD 2L0XA 4NH0A 1AIPA 2ANCA 2QMUA 2VBCA 4PHFA 2OFOA 3H2YA 5FOXA 1XD9A 1SVLA 3WMGA 4DLVA 4MH0R 2JDID 2F43A 3IEVA 2W2VA 3A1VA 4GOKA 3PQCA 4PC7A 5DN6D 1JXOA 5TB5A 1TUIA 3OESA 4IRUB 2ZXUA 1Z22A 3Q7QA 4GRAA 2XSZD 3K0AA 3I62A 2JJ1D 3U61B 1EFCA 2VTKA 1DTSA 2VHCA 1Q3HA 1XNJA 4JLNA 1TF5A 3LDAA 5EP3A 2WWWA 2VP4A 3KKOA 5HE8A 2AR7A 2RHDA 4E22A 4U00A 4LPKA 4NONA 1QDEA 1S9HA 2CCKA 2W00A 2J41A 3L0SA 4OI4A 4C0JA 2RGDA 2X19A 4HAUA 4JVLA 5FPKA 1WMSA 1LFDB 1UPTA 4MGKR 4Q4HB 3GJ6A 3SNHA 1XEFA 5K8IA 3AUXA 4YQFA 3I73A 5A0FA 5G40A 1ESNA 1AM4D 3CX7A 2PLFA 5J4VA 2D2EA 4KBFA 4TYNA 3C41J 2HUPA 2WAXA 2A5JA 2ZUDA 3T5GA 1G4UR 2WWFA 2CLCX 3G5UA 5F9HA 1RRFA 1MRSA 4TN1A 4BUJA 4EJSA 4HB3A 1G8HA 1KK1A 3NG1A 4V02A 3FHCB 3GJ7A 3W5JA 1SKYE 5DLQC 3ZVRA 2DPXA 2DFTA 3KFVA 5JJLA 3VMFA 1P61B 4DB2A 4QGFA 2XZLA 4UXIA 1J7KA 4Q19A 3LY5A 2IF2A 2CJWA 5BN4A 1G8PA 3HU3A 3VQTA 1MT0A 2X2EA 2XX3A 5DHAA 1R0YA 1NG1A 3ZGXA 3DL0A 4JL5A 4XOIA 5DI3A 5JZVA 1J99A 5G53C 2JLZA 1T9HA 1KZGB 1XD8A 2JASA 3LO5A 1N0UA 3D7MA 1AJEA 3D8BA 1OH8A 4CYMA 3DO6A 4Q48A 2YYZA 2GF0A 2JCSA 2W0SA 3U3OA 4OYHA 4V0NA 1FOEB 1E0AA 2IF0A 3MAAC 1KI6A 2CHGA 2RH5A 3RS4A 1W49A 4MGYR 3TQCA 2JEOA 4M53A 2JLRA 3WHLA 2O8CB 1VG1A 2GZAA 3OIVA 3ADBA 4EKDA 2PT7A 1XPOA 2NGRA 2JLYA 4LK2A 2C95A 1QVAA 1EWRA 1G3RA 1XP8A 3AGQA 3GLHB 4UNSA 5EUQB 3IIKA 1CXZA 3B8HA 1W0JD 3FVQA 4NE2A 3KTAB 1EFHA 4MRSA 5IRCD 1HV8A 4PAOA 5B64A 1LV7A 2GKSA 1I2MA 2FU5C 3A1SA 3W8RA 5JFGA 4BZPA 1M34E 5L3SA 1CKEA 3KXLA 3RWOA 1P7CA 5EP1A 3K0FB 1CS4C 1MKYA 1N3BA 3CNLA 4P4SB 1E0SA 4TSFD 3JZAA 2QAGC 4NKRA 2FPMA 5HZHA 3SFVA 1ZM4A 1YHNA 3T1OA 4B3FX 1QG4A 2LKCA 4DSNA 2DFKB 2J0UB 1KSHA 4D80A 4N0EA 2O8BA 2AD1A 2EFEB 2BBTA 4RCYA 2CXXA 2HEIA 3K9HA 1M6NA 4RZ2A 1Z47A 1MOZA 2DY1A 3CM0A 4ZPXA 3EPLA 1YR7A 5F98A 4Q7KA 1E9EA 4V0LA 1XPUA 4LGMA 4TMKA 1IM2A 2R6CA 4Y0VA 5BW8A 1DAEA 2ONJA 1NNEA 4Q01A 1DBSA 1E1QA 2NPIA 1NY6A 5KSZA 2GEVA 4PAMA 4QBIA 2A7QA 4DDVA 3TKLA 5JJKA 2OT3B 1TQ4A 1S4QA 1R6BX 2OLKA 1W46A 3AKCA 3LAWA 4X8MA 2QSZA 4IEEA 2VHUA 4M1TA 1UADA 2QGNA 1RW4A 1ZNXA 5C4MA 2WAYA 1GRRA 1AQUA 2A5FA 2BEJA 2NTYC 2D62A 2KSQA 1UBEA 4MYUA 221PA 5HKKA 5KDOA 4B3CA 3NC0C 3OZXA 3JVVA 3FKQA 1O87A 1VIYA 4HAVA 4RD0A 3Q85A 3OF5A 3F0TA 2OCPA 3VR2A 3W3AA 1FL9A 3AVOA 2JIZA 4QNMA 3DOFA 3FHTA 3QPVA 1E0JA 1HEIA 1G7SA 4PQRA 4KFRA 2GJ9A 3MUFA 4QHSA 4NYIR 4QXAA 4B32A 3CRRA 1P60A 1W36C 1SXJB 5KNBA 2P3SA 2VF8A 4EUNA 1WBDA 1Q57A 1PUIA 3BFVA 4B71A 2HDNB 3AKYA 3QENA 4EQ6A 1DELA 2IYYA 4G5OA 1N6PA 4P4SA 3ZQ6A 2GXUA 1DAKA 2VH5R 5DHFA 4PO8A 5EXSA
chains in the Genus database with same CATH superfamily
3A3NA 3RNOA 1T10A 1V6AA 3C7KA 1HE5A 4S2EA 4YJFA 1JG6A 4RX1A 4D4LA 4IH4A 3EFBA 2MSWA 5C3MA 1SIUA 2CDAA 4EO9A 3SI7A 5MFPA 3OPXA 2GA9A 4YQZA 1IVSA 4NULA 1N0IA 1KJQA 3FPLA 2BN4A 1XFAA 1F0NA 4OAOA 4RXUA 2EGHA 4XJSA 2VOEA 2V7PA 5JH7B 2ANBA 3PUIA 3KKNA 3F5MA 4EJ6A 1OYWA 3LWNA 3UW1A 1GGEA 1TCCA 1TOAA 3OWXA 2CVHA 4JLSA 5EUMA 4DSTA 1UKZA 5BQ3A 3FETA 3RU9A 3KYIB 1MT3A 4YJ2A 4IH9A 2GCOB 2OO7A 2GPBA 1WUYA 3P9ZA 2MU1A 1XNRB 2IXGA 2EHDA 3FOWA 3WV4A 4CHGA 3AF2A 5EESA 3COJA 4OOEA 4Z7QB 4LRYA 1KYIA 2G1UA 1EP1B 3E5NA 3VPCA 3Q6MA 1ITZA 4AL4A 4WLUA 3TN7A 1QWOA 4KXYA 4MKXA 2DYKA 4PWYA 3GGCA 5AHXA 1R88A 2JLWA 1PVVA 1JEEA 2D2FA 3HBJA 2RKBA 4AJ1A 2IV2X 3LFHA 4LYFA 3VC1A 1ZWKA 3HC7A 3OPMA 2DFLA 2QLLA 4LBWA 5JIBA 5FQNA 2HB6A 4JL8A 4MGIR 5KNBD 4FM9A 2M1ZA 4NPCA 1RLJA 2HPVA 4QBHA 3O03A 4UOQA 4WOBA 1A9XA 4YREA 3USCS 1ZINA 2XE6A 4EECA 1Q2XA 1E5VA 3F5QA 2H4YA 4TYYA 3FPSA 2V6BA 3PUXA 2P7IA 3JAMA 2G63A 3HO6A 5ALMA 1MJGA 3ZK9A 4UUPA 4BV8A 3EF1A 2NZJA 3MQFA 3Q7RA 5EKUA 4M4SA 3TOZA 5JXGA 4NU8X 1SHTX 3ILYA 1YTUA 1TA0A 4XR9A 5BVGB 2I7XA 4D9KA 1UBNA 2Y4OA 1C5KA 2R5WA 4NYMR 4R8LA 3OPQA 2QNRA 2GAIA 1JU9A 4TMWA 2VP2A 5D1HA 4MMXB 3VTKA 5JD6A 4W9MC 2G7ZA 3KVVA 3K35A 4FR5A 1VPWA 5EE5B 2BHRA 4HGYA 2K5UA 3NJ8A 2HW8A 4ZHQB 3DCJA 4DNOA 1KBQA 4MI9A 2JFGA 1YHZA 3PK0A 1COZA 3FR7A 3OQHA 5DBGA 3G5LA 4CMEA 1BVYF 2P7HA 1L5FA 4K87A 2CV2A 1F38A 2GEKA 3QJYA 4LYJA 3KL4A 4YJFB 3WMRA 1JXMA 4DIOA 5IANA 3BH7A 3NVAA 4UDNA 3QK7A 3EVAA 1Q22A 4K81B 4YASA 1EWKA 1PIWA 3LF2A 3QVOA 2QUBA 3UMJA 1OJ7A 4OKNA 4F96A 2GM3A 4OYLA 3ADDA 3JYHA 3HYLA 2DBRA 3N7TA 4RFLA 1Z63A 4GSLA 3DM5A 3RVLA 2DWPA 5E2AA 1P1BA 2EVWX 4DJEC 3NCHA 1GXSA 4CMEC 2SKCA 1RKVA 3MJVA 3C3AA 2IPNA 3VYUB 1E5QA 1O3YA 1T1IA 3ZZNA 1N2ZA 1OU4A 4C87A 4LX8A 2C4TA 1ZCBA 4Y6QA 2PT9A 2CWWA 4CV2A 1N6LA 2QLNA 5IC5A 3VYVA 5M7EA 3IOEA 4L5AA 2HHHB 2Z4RA 3T41A 4CIAA 1YASA 3FD8A 4M8SA 5F21A 4L4RA 2PX6A 4C4YA 4OHRA 3TX2A 1WSWA 4RANA 4C1NA 1NNLA 3A26A 1AZWA 3F49S 1C9JA 2DMRA 1WS6A 2X2PA 4JN6B 2WJIA 3RT1A 4HAWA 4OBXA 5LQNA 5IAJA 3RVSA 2ST1A 3SZMA 4CV0A 2C5AA 4ISCA 1J7JA 4N9WA 2P6RA 1H2HA 1L1EA 1LW6E 2JAPA 2ZBFA 1UMBB 4OJQA 3RE1A 3GNLA 3L1VA 1S7GA 1C41A 3OFNA 1CUZA 2ZWOA 3DVQX 3TW0A 1SZJG 4M87A 3T3NA 4O2BB 3CEPB 4IM7A 2YCBA 1X70A 3AXSA 2VNIA 1GADO 1RP7A 3B7GA 1V6CA 4OV6B 4IX9A 5I7WA 1BDBA 5IWCA 1JIJA 3DUFB 3KZ1E 3D2AA 1G6KA 1KVTA 1TZBA 3WIUA 4AFNA 2DBQA 5LNK1 3QBVA 1OVGA 4JP1A 2PMKA 3DV0A 4KPEC 2VSQA 3JQFA 4UZSA 1FE8A 2ZDHA 4HNRA 2EOAA 1ZY2A 1IZZA 2C58A 1WMFA 3KWMA 2WKWA 4ZCPA 2A0XA 5IT0A 3TLCA 3OOYA 4KIJA 1DXYA 3Q0EA 3UJ9A 4CFYA 3GJQA 3R9XA 1XYYA 1JJAA 1NQWA 2HLPA 4RDHA 1GNLA 4YUZA 3PUKA 5EMJA 5AW7A 2W42A 1Y8RA 3AI1A 4FYWA 3IDOA 1CF9A 1WRBA 4UQLA 2NU6B 1CHDA 1Y6RA 4IBOA 2X9GA 3GFSA 4R9NA 1ZUHA 1MPXA 5BWMA 1V5WA 1DAIA 4M9ZA 3B6ZA 3FAZA 5AI8A 4Z7NB 1QC5B 4PZAA 5IUNC 3AESA 5DTEA 3WDSA 4D0SA 4J2HA 3O4IA 2C78A 3RUFA 4CG1A 2E49A 1FW6A 5L45A 3CN9A 3CXRA 3DUWA 4RF4A 1Z26A 2PDAA 2VHVA 4FFNA 5KYKA 3UK0A 1DDOA 3P9QA 3QNWA 3W2HA 3WGKA 5C35A 4DKJA 4YCAA 3L7LA 3M3HA 4EHNA 5H4GA 4JD5A 5JCJA 5FKJA 2Y1XA 1Z28A 4NZPA 4NNJA 2WICA 1BTOA 4R8VA 3ERCA 4IL5A 3Q8XB 4H1TA 4LVUA 5I7EA 1ZIXA 2DHQA 5C8ZA 1Z0JA 4HF7A 4JROA 3DOHA 4X9XA 4JJFA 4RH0A 4XJTA 4IFBA 3OICA 5CEEA 3ZI4A 5CIQA 3A1CA 1N57A 5IW8A 2R96A 4PIVA 4ZVLA 4E2YA 3I5XA 2BH2A 4PV7A 1RYFA 5LQJA 2ZJ8A 3VDXA 4MNTA 4YCMA 1XT6A 2FPIB 1B6RA 4Z0HO 4NABA 4I1VA 1V2GA 1KZYC 4AROA 4JVOA 5CLHA 4R0MA 5J23A 5FUBA 1F1BA 1JDTA 1EE2A 2WIJA 1T29A 1HTTA 2NO1A 3DL2A 1ORHA 3A6GA 4FC6A 1SWWA 3ZCPA 4F7DA 1EP2B 3U6KA 3C87A 3STHA 2V7WA 4GX2A 1N2BA 1Z2EA 3JQAB 1W0CA 4JCCA 1JQBA 3NONA 4MITA 4PLPA 3DYVA 3H7AA 3CF4A 5CTAA 1E7YA 4D9GA 3EARA 4Z51A 5JCOA 2Y77A 4TM8A 3VH3A 2CVOA 1JU4A 4Q9AA 4IXNA 3M5DA 5DK6A 3CURA 1Y4UA 2DUMA 2YV1A 3GN2A 1OFGA 3CV3A 4KQWA 5A7HA 3VKFA 2DEUA 4MJLA 1N6IA 1YRAA 1W8IA 2FSGA 3BTSA 3KUUA 3ICQB 1Y4AE 3AR8A 3LC2O 4NICA 1O95C 3T4PA 4C3VA 2CNLA 2XNHA 3P9PA 4CLEA 3AFHA 2R6DA 1TC2A 4BO4A 1ZK4A 3GXBA 4MW1A 1VE1A 2JRLA 5TV2A 3LQQA 4PLVA 3QXJA 4TKLA 2ZI5A 1AUOA 5FA8A 2OYSA 4L2IB 4Z54A 5TMPA 3ZHQA 4WASA 5IBRA 5JAUA 1CUYA 1EVLA 2FDRA 2Z58A 1EZZA 3GLIB 3THYB 2ZB2A 3N2LA 4GUDA 4OI1A 3BWBA 2GJSA 2EYQA 3M5PA 5ELMA 3V4SA 2P41A 2FZWA 2H5LA 3WB1A 3ZWPA 4OQNA 3N2YA 1Z5PA 1HF3A 1D2GA 2HMTA 1TZMA 3KOMA 4V2UA 4ZZIA 1V26A 1FMJA 1SUEA 2VDNB 2XCOA 1R0WA 3R7WB 4F72A 1SHLA 2R5NA 1HX7A 2GCPA 4PVCA 1ZITA 2VQEB 3V8PA 4JIMA 1GNPA 3C3PA 3R8FA 1QH0A 4CTJA 4KQ9A 2E5FA 3ZLBA 1MVOA 2JGDA 4NBKA 1SCUB 4L75A 1E6CA 4R84A 1IDOA 1ZAKA 1W5TA 1E3LA 1UXKA 1ESEA 4WMLA 5LB4A 5HM6A 1WD7A 4ATNA 3GROA 2GTPA 1PJ4A 1PR3A 3QH4A 5B1YA 1KYVA 1J8VA 3QA3E 1U6JA 1NMQA 2QUZA 4FX2A 5DYNA 5AUPB 4RMHA 1Z6QA 4R3WA 1T8TA 3RUEA 2ZS7A 1K8RA 1H93A 2I3GA 2IKSA 3ASUA 3MT7A 4KO1S 3CZRA 4P3YA 1L5LA 4E2WA 4EX7A 3UPTA 1V41E 3DFZA 4V0ME 3MPUA 4R69A 1UWLA 1W30A 1N0VC 1VE7A 4US1R 4B81A 1I2BA 5B1IA 5U4QA 1QPGA 4KWIA 4XEUA 5LDHA 1DLJA 4NZNA 4N01A 4DARA 5IDWA 4OSEA 4BUZA 4UU8A 3O8QA 4E14A 4UZEA 5ALDA 4BRSA 3I4FA 4GFDA 1O6BA 1ZXXA 4IFTA 2BMVA 1XIVA 4UJ5A 1A97A 3P20A 3I2YX 3DBRA 5CXQA 1Y6GA 1Q92A 2ZDQA 2MSDB 1YS9A 3ICEA 4PYQA 4MCIA 3L1HA 2H5EA 4L4YA 4MRAA 1QG0A 1YMUA 4K2AA 2A9QA 4BE4A 3LY9A 5D86A 4GMGA 2P68A 3N8NA 4WESA 4XX0A 3G2JA 3REQA 3C3JA 5CB8A 3AVXA 5BQ5A 4YT2A 3OZRA 4BQRA 2KQUA 4POAA 4LDZA 1NJ8A 2HTEA 3N3AC 1XEWX 4KXVA 1G2QA 2NPFA 4DGSA 3KHUA 5ICCA 2OK8A 4HDAA 4HUQB 1LPAB 1TCBA 4JC5A 1H69A 3UWSA 3ITNA 4YRMA 5D2CA 3OOHA 5TY0A 4B7ZA 2YZNA 3IUPA 3KBOA 1HBJA 1HT0A 2VR1A 1CUWA 4GM1A 4AY5A 3BQMB 1LNQA 3PV0A 4LXGA 3S2SA 3HCWA 4HC4A 1UP6A 1YI1A 3W2EA 3P9CA 4LZAA 4Z4QA 4TKMA 2G3YA 1HQYE 1A5TA 1SZDA 2DCMA 3M1AA 5AP9A 1XHLA 4DIBA 3BREA 2L42A 2OAGA 2FSPA 4F5EA 2GM4A 2GSDA 3O91A 3CLRD 1SKBA 2AMYA 4HYTA 4IIXA 1URPA 1OX4A 2AXEA 3RAFC 1KEUA 5NULA 4HLDA 5CFNA 5JJCA 2OV8A 2BD0A 2WABA 3LA6A 3OO1A 1LCIA 3L8FA 4RKWA 2WIKA 1LI7A 1D5WA 3G7NA 3UV3A 1NC3A 1TCVA 2JIRA 4GO1A 4MB6A 4QFDA 3QEKA 3T38A 1DV1A 2Q5JA 3B1FA 4M21A 1FFEA 4PGGA 3ZE7A 5DBOA 4I4CA 1TZCA 2F1HA 5M04A 2FPGB 2OQRA 2W93A 2HA2A 1JFRA 1II8B 1RHRA 2FLKA 2ACEA 2H08A 2N47A 3B9QA 3CZMA 1RC0A 1TO2E 2FSFA 3NEYA 4HNHA 3OZBA 4G9BA 4KDRA 5AW8A 1Z4OA 3BG5A 3O93A 1UDBA 1P17A 3E58A 1V1MA 2ODQA 3P1JA 1X1EA 3C3EA 3Q3VA 2UUBB 2JCYA 2Q7XA 4ZDWA 3FNIA 1TU3A 4QELA 1KH1A 3LKZA 1U6KA 1EFVA 1ACLA 1GFWA 2D7JA 3DQPA 3PT5A 5ALPA 3WMWA 1Y3FE 1CE8A 3KQMA 4GW3A 1JT2A 3R0JA 1OXXK 5C7LO 3PUVA 1CRZA 5HJEA 2JGEA 1C2TA 1KY2A 4M1YA 4PGMA 1QRTA 4CVNA 3VR0A 1K2WA 1USUA 3A9VA 2ADMA 1LJLA 2R7MA 5B7NA 1KVRA 1F48A 4L8FA 3SYKA 1L7EA 2G88A 3TQFA 1CY8A 3WGZA 2WF6A 3Q88A 1J56A 3BXPA 1DINA 3KQYA 1N7HA 4GQIA 5K0GA 3KXKA 1QRUA 1ZG3A 3A9WA 1KI1A 2WKRA 4HLNA 4FLFA 2YWDA 1WPRA 2FX2A 4R68A 5B7GA 2XYRA 5A4AA 1NDHA 1W4RA 2QZSA 3KX2A 4UHHA 3N5CA 1T4DA 1ULSA 4MQ4A 4R83A 4ZFNA 3EUEA 5A71A 4C4XA 4CF7A 1VGRA 5LMZA 2X0EA 3EXHC 1QR2A 4DLAA 3A0UA 2Q2QA 1AC5A 1Y7LA 4LJAA 1CS0B 2VHYA 1UBCA 4MLDA 4INPA 1G3QA 2ZIFA 4MI6A 7ADHA 1S7CA 3MN1A 1KYTA 3B2NA 3KKLA 3PU6A 4H77A 3RJZA 4UVGA 1SOMA 4DQLA 2WPNA 3RADC 1CP3A 2D13A 1VHTA 4HUTA 4QUIA 1JLLB 3A1EA 3TSWA 1ST2A 1W5EA 4WLOA 1GZHB 1L2TA 2NO6A 3LCCA 3BA1A 4ND8A 4QPNA 1M72A 5JAHA 2FGKA 4KU4A 1AXGA 1QTQA 2QZPA 4CZ2A 1I3OA 1RE1A 3OCWA 3SEAA 4AKHA 3E35A 1GV0A 2H16A 4Q9IA 3KLMX 1JYSA 3AEYA 1B14A 2O2SA 3EMKA 3PC7A 1QNLA 4K9NA 4ZYYA 1ZVQA 4FCCA 3MMXA 3AF6A 4KQGA 1RYHA 2O6HA 2B7LA 1ZNZA 3LHKA 4Y1GA 4W8OA 1ULZA 2D2XA 3H9JA 1R9GA 4GOLD 2AQIA 3WY9A 4AVYA 4CN9A 1N36B 3OQOA 3TJRA 1EX1A 2FXVA 1DMSA 1TK3A 4BWFB 4DWVA 4PR0A 3JR3A 2OAEA 3AIKA 3FVVA 1BJKA 1LBIA 3JSXA 4KYVA 1U8UA 1SKYB 3HY3A 3ZYZA 1XI2A 1RQPA 2OHIA 4JGBA 5FPSA 5JS1A 4ZQCB 2HU5A 3GQBA 1JW9B 2BUCA 2BEUA 3AUSA 4WOCA 4FQ7A 1Z8NA 3SZGA 1R12A 1C80A 1YVUA 4M0LA 4J7CA 2I8CA 3UJ7A 4HDKA 3QZUA 3TS1A 3QOFA 1QQTA 3MGKA 5JCXA 1F8GA 1FP7A 4LEIA 1RIFA 5FFNA 2BONA 2ZSBA 1BRMA 3L6BA 3UGTA 5KPDA 1SULA 2QN8A 4JZYA 3CUVA 3NGLA 4ZAYA 5HDBB 4AZ0A 3BCUA 5DT2A 2B8WA 2MWMA 1D6NA 1Z5ZA 4FUTA 4G1VA 5F7ZA 3V7NA 2FMTA 2GA8A 4RLFA 1FQWA 4I4TB 1EFLA 3ANLA 3AKDA 1Q1EA 2Y67A 3OEWA 4H17A 2KWIA 3A28A 3H3JA 3NS7A 4M54A 1XZDA 5D6OA 1U7PA 4RIEA 1J2UA 2GN6A 4MWDA 2JW5A 5KSOA 2AD5A 5KYWB 4DBLC 3TVTA 4YGYA 5KOJA 3WA7A 1V37A 1Z13A 2AXPA 2JLSA 3QWAA 1YKSA 3WP1B 4A0RA 4MWSA 3GX1A 2YN2A 3U17A 1XRMA 5CVTA 3LP5A 5FPYA 3OZEA 4B6JA 3G17A 3MB8A 4Z9XA 1XVLA 3HXKA 5P21A 1LQUA 3GAZA 3FCEA 4E11A 4WNAA 2I62A 2O0HA 1T4BA 3WNZA 3ZXUB 2Z08A 1UWVA 1D4OA 3ZYCA 2WWYA 4GUAA 3RTAA 2GNOA 1XF9A 5T4HA 1ZOOA 4OXXA 5C81A 1KFEB 5FHQA 3WBKA 4TV8B 4C1BA 5IAEA 3SS9X 2PUAA 3BFJA 1WTAA 3CYFA 4TV9A 3GT7A 4RPGA 4HXEB 2V4MA 4XLZA 4C14A 4FOSA 4A4DA 1L5QA 4F4CA 3VM6A 3K9BA 1WBJB 3ILHA 4KXWA 3QFCA 3FPKA 4ZOLA 2OKCA 1PAUA 1EGMB 5EKXA 1FYXA 5C5EA 2O0KA 1SCJA 3I30X 5A4JA 5WRFA 4IILA 2PRSA 4Q1VA 4LFCB 4R9UC 2OO5C 3HZOA 4PX2A 1GSIA 4ETIA 3A6EA 1JHDA 3D5EA 1OB5A 3CLUD 4BO1A 1Z0AA 2DSNA 1B0ZA 2HI0A 1E1MA 1RWMA 1Y37A 2PAFA 3T7JA 1MEOA 4BCDA 2GVNA 1QTNA 2HDOA 4LPSA 1HDXA 4OIFA 4YUYA 5J5CA 4X8HA 1EXMA 1PL7A 2B8EA 3KYJB 3OZCA 2F1IA 3UAYA 5M29A 1ZH4A 1U90A 1B0UA 2VO1A 1JVBA 2FN4A 2B5OA 2P9QA 4PYRA 4OHFA 3SC4A 4IMIB 1Y3AA 1FUIA 3JQPA 5CVDA 3UKJA 4G1MB 4BLSA 1T3ZA 4N0MA 4OY3A 4H0NA 1FF9A 4PFQA 2ES4A 2ODTX 1KJJA 1X14A 3CRQA 3IDFA 3PEEA 4LY3A 4A0FA 3V55A 5F3WB 2RHHA 3IBGA 2D4HA 1K66A 4K1LA 3G2PA 5ECWA 3W2FA 4ZI2A 4RTRA 1WD5A 3C5HA 3FYUB 4FGUA 4IIYA 1B43A 1IG3A 1W0KD 3C3BA 3K53A 1L8QA 1VZ2A 2OBNA 3DE2X 4AJEA 4WJLA 5LWHA 1HXHA 1L6IA 2REOA 1EIZA 3DT6A 1YDEA 3VAAA 4CQNA 3FZNA 4DW8A 2HK7A 4B40A 3AEUB 3VR4H 3JW8A 3G2MA 3IJEB 2YWBA 5HKLA 2C8LA 1QPBA 2OM2A 3CJQA 2F9FA 1QLHA 1UC5B 1X1CA 3EVBA 3TSAA 2ZRHA 5AK0A 1QYWA 3CNNA 2CL0X 3PHBE 5CBPA 2ZRNA 3I76A 1H2BA 1V7PC 4YJHA 3E5MA 3OH8A 3HCAA 4NSNA 4G0OA 3QYPA 1WF3A 3K1AB 4U8GA 5JYCA 3MJHA 5ENDA 4I19A 4F9FA 1ORWA 1B73A 1DKUA 2WD8A 4NCNA 4F3RA 1Q1NA 3T94A 4F06A 3RSCA 1KQFA 3X1ZA 1UEIA 3IXQA 2DP4E 4TV8A 3LXXA 3D1JA 1SPXA 2YWJA 4TS4A 1MX1A 3C7AA 2QE7A 4GVLA 3LD9A 1UODA 4KQMA 4TTQA 3S2YA 1EK6A 5KI6A 5JAIA 3I2FA 2L18A 4O8ZA 3TZCA 4GI1A 3ZBPA 2OA0A 5JEEA 2V5AA 1V1MB 4OXNA 1VP3A 1CUGA 5I01A 2LZ0A 2Z6AA 4QARA 4FU0A 3UKDA 3RSGA 3WNDA 1VA4A 5IDYA 3UJCA 1G5QA 2VPPA 5IMSA 2GCEA 1BCRB 3AR3A 4Q3CA 4N39A 4OEHA 2VSOA 3DAYA 3S2ZA 3CA8A 4G1CA 2JGRA 1H4QA 4L74A 5FULA 5FR2A 5KDLA 4EB3A 1OLXA 4MPPA 4IUBS 2GD6A 3HB4X 3DCNA 1KK2A 1V9LA 2VNAA 5B12A 4LF9B 3OJEA 3REFA 5H4HA 5JXHA 3I5YA 1VIMA 2C92A 5KYXA 1VB3A 2O8DB 1GTJ1 2CXSA 2QZZA 5GOTA 2DULA 1USGA 4JUIA 4PHHA 4UCQA 4ZV7A 3JYQA 1W2WB 4AUNA 2CEKA 5KSPA 2K6GA 1C4WA 4PN3A 2WNHA 1L7MA 1YSCA 3I6ZA 5ILQA 3DFIA 2QMZA 3E5HA 2RC5A 4Q4HA 1WXFA 1EQUA 1Z75A 3BH6A 3LIIA 3AEUA 4EG3A 2HIHA 2WA2A 2BP7B 3Q0IA 3WZ2A 4M2LA 4D4JA 4ND1A 1DQPA 2AEFA 2CBZA 3PKIA 4JJ7A 1UL1X 4E03A 2CL6X 4FWTA 3LPMA 3LT0A 3WK6A 2AC7A 3HDGA 2E89A 1RLUA 4HZGA 5CBPB 3DE0X 2WJVA 2HNKA 1VMKA 3GA5A 3VU0A 1KKUA 2AYXA 3K6JA 4A92A 2SKEA 5B58C 3HU1A 3QXCA 2CDNA 1NP3A 4NR0A 3BD8A 3ZHRA 5K45A 4XARA 2GF2A 2IPXA 2GF9A 4HWPA 3UTDA 2GAAA 1D0VA 2X58A 2OMEA 3EY9A 4MHTA 1A8HA 1JJFA 1RCFA 2G4CA 3T52A 4YUXA 3VO1A 1RAFA 1MC5A 2BIFA 3AEQB 5DP1A 1FJHA 1FXWA 4P4TA 4D9MA 3VKVA 3G2QA 1U0JA 1WY7A 1E60A 1VJRA 3ANXA 1BKYA 1PT5A 1XX6A 3TFOA 3OMLA 3VVBA 2RB4A 2CFTA 4P2GA 4ZYWA 4HDRB 1YUBA 1SZCA 2LIPA 1T5HX 2QRKA 3PIIA 3P2YA 4LIPD 3RCBA 4QZVA 3D8SA 5EXEA 3ROZA 2W8BA 3B1XA 1M1NA 1TJ4A 1PZXA 1IHDA 3JQ8B 1QIIA 1UWKA 3AX6A 4J8PA 4JC0A 4Z1MD 3CVWA 2QA5A 4G0YA 5T4FA 1VHQA 1L5HA 2XB9A 3ZCUA 4A2CA 3R4CA 4UTOA 4JJZA 5B53A 3UTCA 4D3SA 2UUAB 1JJVA 1G6HA 4C3UA 5ITWA 2Q4OA 2O7NA 1ZRSA 3BRWD 4OLBA 4DUGD 4YI5A 2AFIE 5H82A 1QUEA 3BGIA 1IK6A 3BORA 3VKUA 3K94A 1Z83A 2I9KA 1K0FA 1LQ2A 3CZ9A 5EIBD 5KVQA 4D0NA 1Z8HA 2GXQA 2OVBA 3EGDB 1ZNQO 1C3VA 1T24A 5IM5A 3TL2A 4BB5A 5KWEA 3EW7A 4K9OA 4CM8B 1XHFA 3QYJA 3L7CA 3F90A 1TMOA 3HCEA 4YV2A 4WBXC 5JDIA 1T5IA 1FBTA 1GEEA 2X14A 1ZHHA 4RETA 1XCPA 5PGMA 4JNCA 2HRCA 1OKKD 4M76B 4X1YA 3M4JA 3VHXB 1XC7A 2CNBA 2XVXA 3AV0B 1M76A 1FDTA 3MCAA 5KPJA 2MJLA 4M0CA 3U9TA 4E70A 3VUFA 3H17A 3I9OA 4LNUB 4O0LA 4OHUA 4K5QA 4PX3A 4ASUA 5IJZA 2WZQA 3RAEC 3ZX4A 4OCZA 2COEA 3FNHA 4EEKA 1OXMA 1FZQA 1GVNB 1SXJE 1TM7E 1TO6A 3AF4A 3PA6A 3PUZA 4LNHA 1YS1X 4K9RA 4O6VA 4QVKA 3RYTC 3KU4A 4XGIA 1JSRA 1WQ3A 3IMFA 4YRPA 4B7CA 2WV9A 4AY2A 2WNSA 4Y9SA 1LPBB 3EZLA 1JSZA 1V71A 1O6ZA 2JGLA 1R6UA 3ZDZB 4EARA 1JDBB 1OIVA 4O2BA 1MF7A 3GRVA 1PTKA 1SUPA 5EHGA 1NN0A 4RMJA 2IFTA 2V58A 4JLKA 4XUGB 4BLPA 3IL2A 4QM7A 2YRXA 4II7A 3A1TA 2ZSIA 1Q7EA 4KXQA 4R2IA 4WGFA 2ZW9A 5K03A 5AM1A 4G4JA 5I4KA 2ZYHA 4J03A 2JJQA 1ARZA 2ZETA 3KQSA 2O2XA 4IXWA 1M7GA 1KE2A 4HLUC 4WVLA 2PUHA 4OQFA 5DM60 4COOA 2ID4A 4BAGA 2PLRA 2ODNA 3DBRB 4LCBA 3E53A 4UATA 3PWSA 1P44A 4L4XA 2CVQA 2YIMA 1KZ6A 2Z2ZA 1A7AA 2FZEA 1QHIA 1Z74A 2DFDA 4TQAA 4CTOA 1S2OA 4DSZA 2HZ7A 5EMMA 1SQ5A 5B1DA 3A06A 1QFJA 1YJ5A 3OZAA 3P2EA 3PYMA 5TT0A 2PL3A 2PO7A 3AY7A 1DJMA 5E0OA 4G9EA 1TW3A 4B6QA 5I9NA 4PHTA 2R6JA 2NZVG 5KEIA 2FW9A 3ZY4A 5ED4A 3NNNA 1PN3A 3ZVNA 1NHGA 4DLRA 2HF7A 4HUQA 1RC8A 1L8XA 1JG4A 4H1WA 4UEOA 1BEZA 2V7UA 1TVMA 2BM1A 3ZVMA 2YMLA 1AS3A 3OUTA 2V0GA 4W5OA 1T1SA 1WPXA 2RB5A 2C3YA 3QHPA 4W9NA 5T3YA 5LP6F 4RZHA 4MUFA 3UYKA 5IK2D 2ZYAA 3U4DA 1K0UA 4MIEA 5SY6A 3AZPA 1W85A 2O2CA 5IKOA 2OEPA 1QK5A 2GX6A 2OBLA 1GZ4A 5BSHA 1E1KA 1FDIA 2X3UA 4JNKA 3QXGA 2EJWA 2WWXA 3DOCA 4FLEA 4K8RB 4XVRA 2ZRMA 3TB4A 3ZWOA 4FD3A 3Q9LA 4BAUA 4C29A 5AW3A 2F9MA 2QX7A 3B38A 5C1OA 3NH9A 3EASA 1I80A 1SU7A 4B09A 1LLDA 3DG9A 1WU7A 2JFUA 1SEPA 2A9KA 2VIIA 2GEDA 1TNDA 4C30A 3ZXIA 3UBMA 4TZ0A 4DDWA 1BX0A 1U98A 1E9DA 2I99A 2LD4A 2OLJA 4B3GA 1BE0A 3PL5A 3RUCA 1QHNA 2FNAA 2BMWA 1DC5A 3BRWA 1DUVG 4PO3X 4XIYA 5EXTA 4CR6A 3FDXA 3LC1O 4P7JA 5LQDA 3PHCA 1D2MA 4X7BA 2I3DA 4WUVA 4GC9A 3CO0S 3QOXA 3DWEX 3BHJA 3T7IA 1N5OX 1TA4A 3WGGA 2Q6KA 2Z6VA 4IDDA 5CPBA 1C8LA 2W6PA 3I2IA 3T5MA 4RVSA 5DBIA 4AKTA 1V39A 1OXSC 2HT6A 4X60A 3CR7A 3MWJA 1NSFA 1P5JA 3DO5A 4BP3A 4KZPA 5C8VA 1R9MA 1KJ8A 1TRKA 3ILXA 3NM4A 4IUCS 2ZFUA 1V9CA 4H6XA 3FYHA 3R7BA 3DZHA 1E9RA 1B16A 4JI8B 2YC2C 1SVMA 1P0FA 2HOQA 5HK8A 4QE3A 1GPJA 3LA8A 1JMKC 1P7PA 3LBFA 3EZXA 3AV3A 1J2JA 4KI0A 1DJPA 3UK1A 2UYCA 4ES6A 3HH8A 4R1OA 5C4IA 1QR6A 2VNHA 2ZG6A 3EXHB 4FSXA 4YHBA 5FOUA 4LBZA 4C7MA 3VOBA 1XROA 2CBGA 2QDXA 4AY3A 4DY4A 2X6RA 5F77A 1KAMA 3MHPA 2XKKA 2Y71A 3H5AA 1M2VA 2VDJA 2Y6UA 3OIUA 2Q41A 4N40A 3AILA 2OESA 4MV9A 3OQ1A 5F73A 4BLUA 4H60A 1QIGA 4LSGA 3EWAA 1AKNA 3KPJA 4MKIA 1HPLA 5FR1A 2O23A 3R7WA 1ZGAA 2A3NA 4J0GA 3U9LA 4IUYA 2KYRA 2EJTA 1P73A 5CGZA 5JO9A 2G9NA 3ET5A 1NTOA 4HP8A 2WIFA 3IEMA 4W7SA 1W5SA 1TADA 4CEHA 1QSGA 4YDSA 1KOGA 3O1LA 4X63A 4Q5IA 3LF1A 4OHZA 2Y0BA 3S81A 1ZMRA 3R5XA 5BSVA 2BHNA 5FLEX 1M2WA 3ISVA 3ROXA 3DDZX 3VJMA 4F04A 1F20A 1XPJA 2H4HA 2ZJ0A 5CNJA 5IC6A 1H2FA 1QAOA 5JLJA 4DYHA 2H18A 2OCBA 1A8SA 3OU2A 3ZHZA 3GIDA 2IYAA 2QNBA 1IHUA 2HBRA 2IXEA 2YFYA 3D1VA 3UIEA 3HTXA 3C70A 1XZ8A 2WSBA 3T95A 3HZHA 4D9EA 4FNMA 4OBWA 4YH1A 5LL6P 2WDPA 4O1HA 5BV8A 2HMWA 3UWDA 3DDWA 5LZ7A 1HM5A 4TVBA 1QIEA 3L1UA 4XIGS 3WA6A 4C08A 3QX7A 4AJJA 1CJMA 1RD4A 3FH0A 1PG5A 5JCZA 2R9VA 4MUNA 5U1PA 5JRDS 3ZJTA 4RVHA 3UWMA 4QYIA 1HR0B 3L7JA 1Z4IA 4BGEA 4ENUA 2IVZA 1QIHA 2C5GA 1IUPA 3F2IA 2IW1A 2K4MA 3A9TA 4ND6A 5G4KA 1ZA1A 3EGWA 3JD4A 3ONFA 3GY0A 5LZ8A 4BMZA 4EPTA 1RPTA 5AWFC 4DVGA 2X4GA 2LUOA 4FNAA 2ZQ5A 1DHRA 3C3MA 4EKYA 1UMDA 1PQWA 3EGXA 4DLUA 4GLLA 1QX3A 4YCCA 1ZOLA 1TYAE 3EF0A 3PPVA 4H7HA 4ZIRA 3SLKA 3TG2A 2N0SA 3NDIA 4C6TB 1E4EA 3EQ6A 3NHPA 5FUVA 2V1XA 4P5EA 4TV8F 3UENA 2R87A 4GT1A 2EFYA 4ECAA 1KEZA 1U3CA 1SVKA 2WPDD 1ZJ5A 2Q21A 1EA5A 2VYVD 5FPHA 2IUSA 4TS1A 1YCFA 4J4HA 3NAQA 4L1KA 4L57A 4W8GA 5LUBA 1JF8A 5EWLB 4YCSA 1U3FA 1NOJA 3IA2A 3KJGA 4RS4A 3IUSA 1H5QA 1NFFA 4EGCB 1HE8B 4LZOA 3SD7A 1T91A 1NDUA 2PJDA 1UDXA 1Z6TA 3MWFA 4LK3A 3NDBB 4IOMA 2CE7A 5LD2C 1SBQA 3FTFA 1AQJA 2C7RA 1QQ5A 2Y1DA 2OTCA 2W8BB 3QVGB 4JT4A 3A1FA 5E95A 3TLBA 4EITA 1T8RA 3UB2A 3E9ZA 5JZMA 3ZWYA 1TQ2A 5DXJA 5DWDA 2PZKA 5JAPA 4C4TA 5A4MS 4ZC1A 3COSA 2Q4TA 3Q3IA 4RYLA 1JFFB 4Q3BA 4WOKA 1P5RA 3UJAA 2R6ZA 3ASYA 3FNFA 2HBQA 4RA9B 1SUDA 1ZGZA 2W98A 5HRCA 1D03A 1DCTA 1PGNA 5HIAA 1XP5A 2G04A 1Z0KA 3DPSA 4L6CA 1OFIA 3U1BA 4TMXA 4H7KA 5IYZB 1WG8A 4MSUA 4O4IB 4TX1A 1U5BA 5HRAA 4PC1A 4RVUA 3O9MA 1IG0A 1S2IA 4JA0A 5AD1A 5CDFA 4UUAA 3A6ZA 1ICIA 4QT4A 2JKYA 1FS5A 2NUPB 2GGSA 2GT1A 1XWFA 1OC4A 1XA4A 2V96A 3LRTA 1RWNA 4C2UA 4GPZA 3B9BA 3FRJA 4GH5A 4FGKA 4BQSA 4BECA 3M6WA 2DKOA 1RZVA 4PXAA 4IICA 4UVDA 1WB5A 1YQ9A 1M34A 1T6BY 2DBYA 3EZYA 3D59A 3O74A 5DHPA 2HSZA 3MM4A 5AVXA 3EQZA 4QNNA 2R6GA 4KOEC 3V9AA 1QH8B 4OQPA 1AGYA 3CB4A 4RD3A 4KITB 1PW7A 1N5IA 1LK5A 3ND9A 3LCVB 3ZV4A 1JS1X 2ATEA 2VYND 3GG9A 4YAGA 2QAGA 3KEFA 2YICA 4I8DA 1V8PA 1DKMA 2BFWA 1A98A 1QF7A 1YA8A 1V7QA 2CYBA 1JALA 1AX9A 2OB2A 2HA4A 1T5LA 1N1DA 2P2DA 1F8XA 3IE2A 1EDEA 2RAVA 1HMYA 3K4QA 1DPFA 4HCJA 2IHUA 4FLMA 2QG6A 4Y2GA 2DUJA 3T5TA 1EM8B 2BJWA 2BR5A 5JW6A 4P36A 2ZSAA 5I4CA 2GAFA 1N2CB 1UINA 1XU7A 2WQZA 2FMKA 1T4CB 4FJ2A 3U7QA 4IOLA 4RY9A 3ZK7A 4B75A 1Q7CA 1EBBA 2REBA 5A5DA 1CFJA 1GYRA 4Y1EA 1W29A 1ZUWA 2XSZA 4JI6B 4X8OA 5LIPA 1KEWA 4GZMA 2EZ4A 1VRCA 2IL1A 2Q49A 2ZT5A 3ELYA 3C4JA 2JKZA 2UYQA 3MWYW 3FIJA 2VSNA 1U0EA 5T5QA 5BXYA 2ZBDA 1P0MA 1Y9AA 5CDYA 2Q3HA 3TRJA 1TCUA 1PR6A 3ND8A 1PJBA 3G13A 2I6SA 2QD1A 3AM1A 1WVGA 4NDAA 5B7PA 4K6FA 1M6WA 2ZXFA 1RKBA 3PNQA 4U0KA 1A9QA 2RIPA 1PFWA 1PNVA 2H2WA 1ELOA 3CX4A 3HJRA 1I4EB 4FPXA 2BMJA 8ATCA 1DRUA 3RK0A 1M2KA 1SFRA 2ZOSA 4IHJB 4LJ9A 4QEKA 3CSSA 1XN1A 2ZIVB 3BL6A 2MSEB 2GERA 1GD1O 2XKBA 4BMDA 1Q6ZA 4YO8A 4MGEA 1G20A 3GLIA 3THYA 2FZVA 2JLQA 5FNZA 2CSUA 1GA1A 4BB6A 4BMOB 2JG3A 4DGQA 1SOUA 4IEIA 2Y93A 3KELA 4W5WA 1DRJA 3D3JA 3JQRA 4L3OA 4MLCA 3UV6A 1NW8A 4ZQBA 3A9UA 3ZG6A 5LDGA 3UF0A 2I1QA 3UMSA 1MDFA 4NYMQ 1VA5A 1IE3A 2FVYA 4GXRA 2DQ4A 3BGVA 4EDHA 5ICSA 4EL5A 1XRPA 1Q1ZA 4JB8A 3H3XA 2H11A 4UOZA 4P83A 3PX7A 4NEHB 3ZD7A 4WFIA 2F62A 4ILEA 5DVZA 1OBHA 1UBUS 2IHNA 2ZKIA 1NBOA