3CPJB

Crystal structure of ypt31 in complex with yeast rab-gdi
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
198
structure length
164
Chain Sequence
YDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMGVEFATRTLEIEGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDSKSSSYENCNHWLSELRENADVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALSENVDKAFEELINTIYQKVPTISL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab GDP-dissociation inhibitor
publication title A structural model of the GDP dissociation inhibitor rab membrane extraction mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 50
structure length 164
sequence length 198
ec nomenclature
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cpjB01
4KI0A 2QM7A 2BMDA 3CRW1 2IEYA 3TLXA 5B30A 5G3YA 2FFBA 4NYIQ 2WHXA 4B6FA 3LFUA 4B34A 4L9WA 1E2DA 1II0A 4OI2A 1TEXA 2R9VA 3FKSA 4OI4A 4PZZA 2C98A 1XNJA 4B2IA 1GG2A 1VG9B 4V02A 5EJEA 4IVQA 4LWZA 4F91B 2IEZA 4NCHA 4C7OA 3I8XA 3VR6A 4ZCIA 4F92B 3QSYA 4OK6A 4M1KA 4FMDB 2O8EB 1G8PA 1P3JA 3THWB 1B0UA 3TR0A 4JVNA 1DELA 5L3QA 3TBKA 1HA3A 2XTMA 4XVQA 3NBZC 3OEHD 2GJKA 4HAVA 5DYGA 4TMVA 2PEZA 1H8HD 3EASA 1PUIA 4C0SA 5K8LA 5FR1A 2WWYA 1X6VA 3LDAA 2OLKA 4Q1AA 3BBPA 2JA1A 2QQ0A 5EXPA 4IKEA 3TQFA 3K9NA 2GCPA 1W44A 2HF9A 2ZRCA 1GTVA 3HP1A 4EPYA 5KSYA 1Z63A 2O8FB 1TL7C 3U44A 1SZPA 4DC9A 1Q1QA 1NN3A 1VHLA 4MRVA 2N42A 1VKJA 3AP3A 3GPLA 2FZ4A 3EA5A 3K70D 4CZ2A 4DCNA 2Z0MA 1KKMA 3B8HA 3FKSD 1DADA 5IDVA 1G20E 4Q21A 4EPXA 3UWOA 4NYIR 3QEOA 3OESA 4BE7B 1T8UA 4C0LA 1LW7A 4D4JA 3OIUA 1Q1BA 2YOGA 4JVLA 1YVDA 2ZJOA 3L43A 3P4XA 3R7WA 3CH4B 1WBDA 4OHXA 3CPJB 3ADKA 5FTKA 1ZAKA 4LBYA 3NXSA 4RCZA 3C5HA 5KU1A 2Z6VA 3GEEA 2FPMA 2EFGA 3A4LA 2J0UB 4HLUA 1IAQA 1Z5ZA 3CWZA 3TVTA 4OHZA 3LH5A 2H5EA 4PQRA 2V3CC 3RS5A 1IN5A 2FSGA 4MUAA 3KZ1E 1YKSA 1D6JA 3B82A 1M2OB 4PPGA 1E0SA 1ZIOA 5FI1B 4A6XA 2PZEA 1KSGA 2K5UA 5KSOA 1CF4A 2IUTA 4AYXA 1NKSA 5CLQA 1E2MA 4DLSA 3O8DA 1T5LA 2WIAA 5FTNA 2KSQA 3AF0A 1JEEA 1KO7A 4M53A 4DKXA 1GWNA 1CP2A 4BASA 4NKRA 4B74A 1YZTA 4A92A 3AUYA 2ZYUX 4LHWA 2DFLA 4NU0A 2ZI7A 1HT1E 1V5WA 3SR0A 2QA5A 1OKKD 5L3SB 2FFAA 1R8SA 2IYLD 4JJKA 3T06B 1LV7A 3J81k 5DO9A 3MAAC 5E7MA 4HB3A 1KO8A 4B32A 1AKYA 4Q7KA 2QBYB 1QHHA 1US8B 5J4VA 3OAAA 2WIBA 3QPVA 3KQKA 1ZUIA 2E87A 3U3MA 3GLHB 1UBEA 3X1ZA 1NG9A 1G4AE 3ZZTA 3E70C 3ZD7A 4PHFA 3SJZA 2R6CA 4LJ8A 5H68A 1E98A 2BJWA 2PZGA 2RGDA 1R6BX 3WNBA 4QKQA 2JLXA 2MMGA 2J45A 3R9WA 4R2IA 1B23P 3BB3A 1E9FA 1KI2A 1TQ2A 4GFDA 4MYTA 1R0XA 2IS6A 1VPLA 4KFUA 3IHLA 3AVOA 4BFUA 2CL6X 2GDJA 2PZFA 2IX3A 2C5LA 1FTNA 2OCBA 2GXSA 2VO1A 4V03A 3EZ2A 2OBNA 4JIMA 1KK2A 3PXGA 3K0FA 1FUKA 3B1YA 3KKQA 4MGIR 1VIAA 1D9ZA 3AB3A 4IVPA 1XZQA 5SZJA 1GKIA 1MR3F 2GEVA 4A4DA 1TUIA 3MWYW 2ODWA 3NHAA 2Q9AA 2JCSA 1UBFA 1AQYA 2F3RA 3ZZ0A 3I32A 2W58A 2P6NA 5J4LA 4KO8A 1MO5A 1YRBA 4OYHA 5AJYA 1DAGA 4DJTA 1RRGA 5EXXA 1ZW6A 4IDPA 4TTQA 5HTKA 1UKYA 1LFDB 2H7VA 3F0TA 3GLGE 2C77A 3UG6A 1P73A 5KDOA 2JLRA 2FA9A 5AK0A 4KXFB 1JJVA 4KCGA 4ZO4A 3RS4A 2O8EA 4KFSA 3THWA 1XTQA 2OO7A 5JSZB 2A5FA 2J87A 4OHYA 1EFUA 1NVVQ 1RZ3A 2NG1A 3AF4A 5A0FA 3VU9B 4C0AC 4DZZA 2IYWA 3EZ7A 2JDIA 3BORA 5KHOC 1QZXA 1OH7A 4LOAA 3UPUA 5JS7A 5DSZA 4H1VA 2VP4A 4KHZA 4Z1MD 2O8FA 4BZXA 3B1ZA 3I4LA 3CF6R 3UIEA 3LWNA 5KDDA 4AC9A 1W47A 1W4CA 2GCOB 2W2VA 2DWOA 1A2BA 4GI7A 4DCSA 4FWTA 1C4OA 3LLUA 2ECKA 3WBJA 3CRMA 1Z0DA 1SXJB 2GCNA 2P65A 4P33A 4TQUS 4EUNA 3SQWA 1RPZA 1XF9A 2AX4A 2BM0A 3K0AB 3WRYC 4QJ3A 4NZYA 2FX3A 1M7GA 2H16A 1G5RA 1N25A 1SULA 4IFEA 2IYSA 5EE0A 3I5XA 4HSEA 4JYBA 4RFSB 4IDQA 2ZSDA 1DAMA 1F2UB 3NBXX 3THOA 2O52A 3K70C 4E22A 3QF7A 4CEIB 3VMFA 3EG5A 3TUZC 3REGA 2J0UA 4OK3A 4Q66C 2ANBA 1AQUA 2FWRA 3ECCA 4LJ7A 2GZAA 4WXPA 1NBMD 2JDID 1ZMXA 3SNHA 4AK9A 2ZM5A 2JAQA 2NGRA 3CF0A 3KFXA 1K6MA 3A36A 4LSGA 3IGFA 5EZ5A 1GIAA 3X1WA 2OCAA 4LHYA 2IUUA 3DPUA 2QGZA 2ZRJA 4QL3A 2IYUA 1NJFA 5JWRA 1Z6AA 4GZMA 5GJCA 3U3OA 3F5FA 2PH1A 2NZJA 1K5GA 2IXFA 2W00A 5JI2E 1II9A 2XB4A 1VCNA 1EFCA 3B7GA 3UG7A 2XJ9A 3Q8XB 1KI4A 1NN0A 2VHQA 4UXHA 2G0NA 2IT1A 1ZBDA 5L3SA 2W2TA 3T1TA 4H9GA 4G0NA 4AKEA 3CIOA 1FNNA 2AKAB 2D2FA 2IYVA 3PG5A 2J9RA 2ZUBA 4TMTA 2QBYA 4Z8XA 521PA 1US8A 4E09A 1FNMA 3DKPA 1KAGA 3KUCA 4LYAA 3GLHA 2QPOA 1W0KA 5A5GA 2NMVA 1VECA 1M74A 2H1LA 2C78A 2IYTA 4C0QC 1WRBA 3QF4B 1QG2A 2RGNA 1TADA 1GKYA 4KSBA 2GVZC 3PV0A 4QBGB 3R9XA 2AWNA 2PCLA 4D4LA 2XITA 3M4YA 3N5CA 2EYQA 4HYYA 2XXAB 3K09A 3ZS8A 3EPKA 3UWKA 1OIVA 3L82B 3WMFA 1NY5A 3Q3JB 2YJTD 2ZRNA 4M1OA 3B1XA 4Q4JB 1HURA 3DZ8A 5C4GB 4PO8A 3IQWA 3K1JA 3Q9LA 3LAWA 1YQTA 1ZD1A 2QMOA 4Q47A 4GRAA 5KNBA 1SHZA 4RSGA 2YWEA 1IY0A 1A82A 4KVAA 1Z3IX 4Q5IA 3A4MA 2ZJ2A 4WIAA 3HDTA 5HCIA 1VIYA 2ZANA 3CR8A 2F1HA 1KDRA 1DOAA 1CRPA 4NPHA 1E3MA 3SU8A 2VYFA 3K9LA 4G5RA 4QGAA 2VQSA 4QBFA 2QNRA 2V6IA 3CH5A 4IEIA 3W6NA 4FIDA 1P2VA 1UKZA 1QBKC 3SJCA 4DWJA 1J8YF 2FSFA 2ZSEA 4QGHA 3CPEA 5EP1A 4AWXA 3HPRA 4MDEA 2IS2A 1BS1A 3ETLA 3VU9A 3T61A 1W1WA 2ZR9A 2O0JA 4WZAE 4AURA 4HLQB 2YVUA 4FI3C 1FTSA 4OQMA 4KYUA 4M21A 2FV8A 1GAJA 1TPZA 4B43A 2RMKA 1G3IA 2CLDX 4HB2A 3FVQA 2C03A 2UVQA 1F2TB 2GCOA 4DCTA 4JBXA 1H8EA 4W5JA 3WNDA 3VX3A 4DSUA 2XGJA 1SXJA 4TYWA 1AS2A 3PUWA 4A8JB 1OXTA 2R8RA 1KI6B 3D3QA 3K0AA 3MWLA 4F4IA 5K8UA 3NH9A 1NI3A 1DAEA 3HJNA 3IO3A 4BECA 3BH0A 5JRJA 4RFSA 3PUXA 1NMZA 2BBWA 5KUTA 1XTJA 4FXPA 1F2UA 4TMWA 2XZLA 2BBSA 4AIIA 2CMKA 4CEIA 4AI6A 3HU3A 3ONWA 4M1MA 4IHQA 3QY0A 1E9EA 1WMSA 4DT1B 4C4PA 1KK1A 4IJMA 4DSTA 5HPYB 3B78A 3SJBA 1XTRA 3CNNA 1JI0A 2QG6A 2NZ8A 1J8MF 3EIEA 1QHSA 4TZ6A 5CLLA 5TXGA 3TQCA 2ZVPX 2UZ3A 3E1SA 1I4LD 3SJAA 1L7VC 1CTQA 3K53A 2V7QD 4Q4LA 2LKCA 5DN6D 1F3OA 1N6OA 4AD8A 2QP9X 1OYYA 1VCMA 2ATVA 2IF0A 2ZS9A 3FKQA 1D2MA 3GD7A 4M8NE 5AUOB 2ZRKA 3U2QA 2Q9BA 1MT0A 3SYLA 1GSIA 1HYQA 1RYFA 2KJQA 5AJVB 5TDHA 4V0NA 1TTTA 2ZUCA 1VG8A 3L0IB 2FPLA 4UXIA 1XMIA 2DFTA 4RZ3A 3VFDA 2ERYA 4KU4A 2F43B 4ABYA 5FR2A 4XWOA 1YHNA 1G7RA 4FINA 3QF4A 2REBA 5FBWB 3UMFA 2BMFA 3SS8A 3WHLA 1WP9A 3O8CA 5LD2B 2O8CB 1P4SA 4LUCA 4MUBA 1KI9A 4ERNA 1E2LA 1KO1A 1UADA 2XEXA 3ZVMA 3QG1A 2XXAA 1Q22A 3R8FA 2Q3HA 4K46A 3RS7A 3ICEA 2XZOA 2ZRGA 3NVAA 4Q4JA 2ZS7A 2ZJYA 2WJHA 4BRUA 5JFGA 1G8YA 1PLLA 3LO5A 2G6BA 4URVR 1L2TA 4BFZA 2A7QA 1QHNA 2VLIA 2W0SA 3MWJA 4RD6A 4AKGA 4AYWA 1DBSA 3CPHA 4GDFA 1S3SA 3HPQA 5AUNB 3Q7PA 3O8RA 1Z06A 2B7CA 4G01B 5G40A 4GP7A 4ZKEA 1UDXA 1G3MA 5J5CA 1UEJA 4ON9A 3WHKA 621PA 3PUVA 3QKSB 1Q3HA 4JZKA 4TLBA 1KTVA 1P9RA 2GWHA 2YC2C 4W7SA 4LJ9A 4Q1DA 3UKDA 4NHOA 1T0JB 1GM5A 4OBEA 4DUGD 3AVPA 1QHYA 4Q7MB 3AVUA 5HE8A 1DPFA 3LXXA 4P4UA 4QNMA 2E9SA 1ELOA 1OT3A 4QGGA 2ZTSA 3KUDA 2DYKA 1Z07A 4FMBB 1BMFD 4M9QA 5FTJA 4DDVA 4JL5A 4P4SB 1T3LA 1T8TA 1X8KA 1G3UA 2I1QA 5SZHB 3KQLA 3DDCA 3GJ6A 3N70A 1TAGA 4DLZA 1E2JA 2OHFA 4TWZA 2MSDB 1U0HC 1G8GA 3LVQE 1KSJA 4URWR 1RC8A 1W2GA 5BN3A 3CRVA 2XAUA 5HZKA 4V0OA 5JBQA 3U4QB 4LGMA 2PT5A 4TLCA 4HEJA 2IS4A 3I8SA 3GJXC 1S1CA 2OILA 3GJ5A 4A8JA 1KI6A 3AKYA 3WRXC 2C95A 2WKRA 4UNNA 5FOSA 1XJ0A 2NPIA 2OCPA 3KFVA 2R62A 3ASYA 2ZVQX 2EYUA 1WQ1R 4QHYA 3TSOA 1GNQA 5A4JA 3CR7A 1J2JA 3N2IA 2OAP1 2I3BA 2F9MA 4R71A 2R65A 4TQAA 3QIAA 1O87A 2BHRA 3W34A 4WXRA 3SQXA 2QMHA 4HUTA 1FFHA 5AR1A 4DT1A 4CIDA 1S9DA 3QPUA 4LBWA 1XX6A 3TUJC 1LF0A 2ZI6A 4KYIB 2E1RA 2QTVB 4TN1A 1ZM9A 3EX7C 1NSTA 2X2FA 1N6RA 1X8LA 2HLDD 1NLYA 1SVSA 1T9HA 1ZNZA 2ZEJA 1DAHA 1IXRC 3U3JA 1HQCA 1ZUHA 1JR3D 1KGDA 2I4IA 5B64A 1NSFA 4B44A 1XP8A 4Z54A 5SZKB 3KJIA 3X1XA 2ZRHA 2RGAA 4LK2A 4PHGA 2ZSAA 5AWFC 3T5GA 3KX2A 4E07A 221PA 2D62A 2J41A 1XEWX 2D2EA 4HDOB 3WP1B 4US2R 2FDCA 3ZD6A 2ZIAA 4P4TA 2ZR7A 4G5QA 4P32A 4RZXA 1WCV1 2WWXA 1Z83A 4EPVA 5F9HA 3QENA 2VSXA 3VQTA 3ZS9A 4DSOA 1HV8A 2ZSFA 1DE0A 4O25A 5JCPA 2YYZA 4A15A 2F43A 2V9PA 1TQ6A 4JMPA 1UM8A 4JVMA 5GVSA 1SKYB 1Z47A 2CK3A 4S35A 1FMJA 4E5UA 1TEVA 1XMVA 6Q21A 3IIJA 5E3HA 2V55B 1XPRA 2NQ2C 2O8CA 4ILEA 1ZCAA 1E9RA 3B85A 2A5JA 4FN5A 4M1TA 2VH5R 2XZPA 2ZU6A 1DS6A 2R6FA 3U5ZB 4D26A 1R8QA 1QVRA 1BO6A 2YWHA 1CJTC 2CE2X 3ADCA 1Z0FA 1KDPA 2OV2A 5FUVA 1E2NA 3WBKA 1TU3A 1CR1A 4OQNA 2Q9CA 4TYNA 2OXRA 3Q5EA 2NPFA 5DI3B 3SFZA 3RYTC 4MKGA 4RD3A 3WNCA 4POAA 3I1FA 2H92A 1Y3AA 1K8RA 3CZQA 3QKSA 5BQ5A 4W9MC 4DHEA 2PBRA 4YMWA 4GNKA 5JEDA 2J5XA 3LBNA 2D3WA 1XCGB 2Q21A 2QRZA 2QQEA 5FTMA 2RB4A 4LY6A 4Q1FA 2Z5FA 1RE0A 2RGCA 4DB4A 2CHVA 3NIBA 4Q02A 3H86A 4BEBA 3BAFA 4IEEA 3OFND 3AVYA 3W3ZB 2AFHE 3RC3A 3VKGA 3GCGA 2ORWA 3K8YA 4QHTA 3PJRA 3ADDA 4BLTA 2RCNA 1U0LA 2ZRLA 4P4SA 1X8JA 2AK2A 3A1UA 4JLOA 5IRCD 3AF1A 1C9KA 3EZ9A 2CEAA 3A1SA 5EUMA 4IOLA 1N0VC 3RRZA 2IL1A 4LYHA 4KVGA 2OEPA 3U4QA 3LXRA 5GVRA 3SDZA 4LBVA 2WWFA 1NJGA 3VNVA 4PO1A 1CXZA 3MCAA 4OQFA 4PFSA 3REFA 4C0BA 2HXYA 3KB1A 1HE8B 2DHRA 3ZJYA 2V1XA 4EPRA 2IUSA 1OLOA 5DYIA 4B47A 2CLSA 4B3DA 1M34E 4PAOA 1GRNA 5FTLA 2H17A 2FG5A 2IK8A 1PV4A 3IO5A 3L0OA 5F3WB 1XDBA 2ZE6A 2A2ZA 4F93B 3D6TB 1XXHB 2B6HA 5LDDC 1IY2A 3RSLA 4H1UA 2BOVA 2CHGA 5JECA 3AF3A 2CCKA 4JLJA 5HCNA 1BOFA 2RAPA 2WWWA 3G82C 2VA8A 1CR2A 3DEFA 5JRZA 3ZVNA 2MSCB 3O47A 1N6KA 1Y63A 1ZC4A 2GXUA 1EWQA 1Z0AA 2IYZA 3N2EA 1S2MA 3TW8B 4HZIA 1KHTA 1ZU5A 1U94A 5FFMA 4LV6A 4B2LA 3TSZA 1NVWQ 4D4KA 4ZDIA 4YXWA 2JATA 4P3YA 2J0QA 1VYTA 2GJAA 2QT0A 4A0RA 2WPDA 1BIFA 4LBZA 1E0AA 1W49A 3B1WA 2ONJA 3OEEA 1ZVQA 5KNDA 3WXMA 2C99A 2G88A 2GJ9A 5CDFA 4XIGS 5TVKA 5D3QA 5CB8A 2IXGA 1COWA 3DVLA 4Q4HB 3AUXA 4LJAA 4Z8YA 5H8WA 2EFEB 4DIEA 1L8QA 4MGZR 3X2SA 2FMXA 4YQFA 1TQDA 1VCIA 1G16A 3RANA 2CNWA 4IRUB 2VL7A 1D5CA 2IYYA 4WVFA 1ONBA 2BC9A 2HJGA 2JLZA 1E1RA 1N6HA 1JXOA 2DBYA 2NOAA 1UKEA 1E2FA 2P6UA 1RYHA 3FDIA 1KIMA 5DH9A 2OXCA 1CEEA 1XXHE 1N2CE 2X8AA 1E2QA 1KOFA 1ZC3A 4BLRA 4URXR 2R6GA 3BWDD 2WPDD 3GLGB 5JJIA 1HE1C 4Q19A 3GFOA 1DO2A 4XVUA 2HXSA 1FZQA 3OEED 3TUIC 3WYAA 3MWKA 3MLEA 2XNDA 1BKDR 4LYFA 2BJVA 4PC1A 4BLPA 1AZSC 2GVDC 3VTKA 1TMKA 1MO6A 1W5TA 3FHCB 4A9AA 4LV8B 4PSKA 2P3SA 5DI3A 4L8GA 4O0MA 4MYCA 1Q0UA 2FEMA 3U6KA 3W6PA 3FTQA 4GOKA 2GHIA 3KDSE 4A0HA 3EC2A 3T12A 4A0GA 2KE5A 4FW9A 4G5SA 1W36B 4RVCA 1MRSA 3A8TA 3QXXA 3JZAA 2FSHA 2JLVA 4LPKA 4HDQB 3L8ZA 1AS0A 5CYOA 1NN1A 1J7KA 2UKDA 2QI9C 3W9YA 2ZRAA 1EFRA 4MKFA 1ZD8A 1G8HA 3OE7A 1N0WA 2B8WA 4W5WA 1G41A 3LV8A 3IBGA 4JSTA 5LD2C 2CVFA 3BXZA 3FMIA 5CM8B 3TE6A 5TMPA 3QE0A 3MMPA 2AXPA 5C4MA 1J90A 3BFXA 3OAAD 5EQTA 5G41A 3UMRA 1KI8A 4WBSA 1PZNA 1QHGA 1KMQA 1XWIA 2FF7A 2HCJB 4RY2A 5KSPA 4XTCS 5DISB 3QKTA 1P2UA 2F1RA 2N46A 4GOJA 1P62B 1XRJA 2JEOA 3QKRB 3THYB 1E79A 2C04A 3H1TA 1QVAA 4B3GA 1OXVA 1RRCA 4PXAA 5JWHA 1FP6A 2XTNA 1WXQA 3KQUA 2QROA 2ZJ8A 3EXAA 5EZ6B 1G8FA 3QXHA 1W0JA 1XXHA 3PITA 3CNOA 3OE7D 3CF2A 2QMUA 4NCJA 1XB2A 2CDNA 2WOJA 4ZCMA 5BYKA 1JBKA 1OV4A 3W5IA 1IM2A 1CU1A 3QJYA 3ZGXA 2XNSA 4DLWA 3QBTA 3KKOA 5JWOA 2RGGA 2CCGA 4HAYA 2GBLA 3CWQA 2GF0A 2YWFA 5D3MB 2B7BA 1TX4B 4PQFA 2IA5A 5JCZA 1D8TA 4ZDJA 3KXIA 2CVHA 5J4YA 5K8IA 3A37A 4HAXA 3MFYA 2OFOA 4M0LA 5KTYA 3VNUA 1E79D 3NEJA 3U60B 3QG5A 2XOKA 2ZI4A 3GMTA 2DR3A 3EPJA 2AFIE 3GLFE 2FSIA 1OIWA 2XX3A 4G1UC 4LJYA 4LV5B 1UBGA 3TH5A 4BLSA 2DFKB 4LHZA 4Q00A 2ZRIA 4B33A 3CM0A 3AEZA 1P5ZB 3AVQA 5E7JA 4Q4HA 2O8BB 1YU9A 2QP3A 1S4QA 5KPJA 1Q20A 2VIIA 3S1AB 3IQXA 1DEKA 1E0JA 1GILA 1U0JA 4B3XA 4XSHA 3SYKA 4LJ6A 1NVVR 4XD7A 2R44A 3AVWA 2VHJA 1E2GA 3RAPR 1Z2CA 4TMXA 5TB5A 1E99A 4HLDA 2HEIA 1LF5A 2BM1A 4B3FX 2JIZA 2Q6TA 3LQQA 3A58B 4TQ9A 1PUJA 4F4CA 4N1AA 2ZPTX 4Q7LA 1JJ7A 3GFTA 4GL2A 4A2PA 1E9AA 3GLGA 2QSYA 3H84A 3AKEA 2HYDA 1T91A 4NH0A 1ODFA 2F6RA 2MMCA 2PJZA 4QGFA 5TV2A 4BZQA 4F4JA 4I1UA 3NTUA 3P1JA 3LY5A 2QN6A 4EQ6B 1GNPA 4PPQA 2J7PA 4ZI3A 721PA 3ZQJA 3K9HA 2P67A 1G5PA 4PQYA 3WY9A 3OIYA 3FB4A 1IJEA 2GRJA 5L8VA 3ZQ6A 4GMDA 2DWPA 5TARA 1LY1A 2HT1A 3B9QA 1E2IA 3D31A 4Q03A 821PA 1P72A 2F1IA 4OL0A 1P61B 2JJ1A 3GLIE 1ETUA 2BVNA 3CO5A 3I72A 2PMDA 4K81B 5JI3E 3AF2A 421PA 3C7KA 4HLUC 2JIZD 4PPNA 4BLQA 4F7WA 5IF9A 3X1DA 1ZRHA 4D6PA 1KY2A 2QAGB 4ZV4A 3BC1A 1RRFA 4M9ZA 2ZRMA 3QQ5A 4DXAA 1G291 2ZREA 1XPUA 5FPSA 3LBHA 2FGJA 5J47A 3AM1A 5FH9A 5CJ2A 2VSOA 3B60A 2RGXA 1OXSC 1M7HA 4IVRA 2J7PD 4HAWA 4RFVA 4ACBA 1XCPA 3HU1A 3PEUA 4BGDA 1LVGA 1CS4C 3LQRA 4GOXA 3I5YA 2MSEB 1G9XA 1LTQA 1W0KD 4C2UA 3UK6A 2OE2A 2ZRBA 3GJ3A 5AJWA 1CJKC 1A2KC 1XEXB 3D8BA 4YMUA 3GJ4A 2V1UA 3THYA 5IHPA 1JPNA 3QKRA 4JLMA 1G21E 2X19A 2XB2A 4MH0R 2WKQA 4MQBA 1I4TD 3KB2A 1NG1A 2A9KA 5B2ZA 2FPKA 1U8YA 4JLPA 2EFDB 5KPDA 4TYYA 1P2SA 1XMJA 4I1SA 1T3HA 5P21A 3VR2A 2NO7A 2G77B 1YZNA 3K9GA 5EE3A 2PLFA 1QRAA 4WA7A 4OJKA 3ZVRA 1U98A 4WW0A 1KI3A 1S3GA 2IXEA 2QTFA 1VDZA 2IF2A 3HWSA 5D3MA 1NKTA 1Q12A 3I62A 3LD9A 1E9DA 1OFIA 3QKUA 4TTRA 3A6PC 2Z43A 2IYQA 4GP6A 3OHMA 3OF5A 2QGNA 4OHVA 5FBRB 3AKCA 2IS1A 4YMSA 5SZIA 3MUFA 5B58C 3HYRA 1OHHA 3AQ4A 4TTPA 3CX8A 1FP7A 1LB1B 4LC0A 2EWWA 1AS3A 4MGYR 4NDZA 1D2NA 2VP0A 2O8BA 3NDBB 4WAUA 4PR0A 4Q1EA 1E4VA 3IILA 2PX0A 4GSYA 3S1AA 4MYHA 1ZP6A 1MH1A 1GITA 3ADBA 5EUQB 3EC1A 1P9WA 4K8OA 3AV0B 1XBTA 4DLUA 1H8ED 2WWHA 1T6NA 1TU4A 1OE0A 3SC3A 1EFTA 1SXJD 4NP6A 2V6JA 1X86B 2QEQA 1X1RA 4B71A 4U7DA 1FMLA 1TF2A 1YE8A 3PCRB 4PSAA 1KZ7B 2C9YA 2GJSA 5JLJA 4ZI2A 1E9CA 2W6IA 1DAFA 1E2KA 3MJHA 4M1SA 4Q7JB 3ZIAA 4D82A 3B13B 1G7SA 1KY3A 4EQ6A 3A1VA 1UBCA 4UNSA 2NO1A 1XD8A 4ZDWA 2G1KA 2YNMA 4XSGA 2W0MA 3M6AA 5J4HA 2HJVA 2REXB 3FFBA 2QAJA 1ZINA 2QRNA 1YR9A 2VPPA 3LX8A 4HZUB 3RABA 2QSZA 1ZM4A 2VTKA 2LWIA 4LPSA 2FFHA 1CR4A 1S9HA 3TSWA 4BFYA 1A1VA 2QM8A 3CBQA 3G5UA 2W6JA 4PSVA 5FOXA 2QAGA 3FHOA 2GEDA 4X8HA 1Z22A 3SHWA 2WJGA 3DO6A 5K8TA 5CK5A 2Z4RA 2IYRA 2EFHB 2VHUA 4DEXA 2W6ID 3ZIAD 3VAAA 1OH8A 4JVSB 1IHUA 1BH2A 5C2JB 1N5JA 5CJPA 2D06A 1EXMA 3CUEF 3L8YA 4RJLA 1KI1A 2VHCA 1SKQA 2ZJAA 1XEXA 3DL0A 2VF7A 4RKFA 4ASUA 5HR5A 4ZIRB 3QVUA 3VHLB 4PZYA 4LC1A 4CGZA 1DAKA 1NIJA 4M9SA 4PAMA 2CXXA 4Q01A 2ZU0C 1QDEA 3EW9A 2WVJA 3C8UA 3D7MA 3I73A 4CW7A 2QP4A 4OK5A 4X8OA 4D2IA 1G3RA 2F9LA 3TKLA 2G1JA 2AL7A 2RGNC 5KYKA 3FE2A 2CL7X 2WAYA 1IQPA 5LB2A 1XD2B 3IHWA 3AH8A 3K09C 2NIPA 2ZYTX 4KJZA 2WMOB 4TMZA 3C15C 3DOEA 2QMEA 2ZE5A 3IKJA 4DLTA 2IYXA 1IN7A 3W3AA 4Y0AA 4YONB 1F48A 1W4AA 3F8TA 3RS0A 3SE0A 4PHHA 3AVTA 2QE7A 2ZROA 1G1MA 5ELXA 4N0EA 4IXMA 1DG1G 1KNXA 4M4SA 4PHTA 2D7CA 1NVUQ 1OSNA 1CJUC 2X1VA 3NBFA 1ANKA 5HKKA 2IHBA 1LS1A 4MKHA 2PEYA 4TL8A 2DCUA 5JHHB 2JLWA 1W7AA 2TMKA 4KFRA 3K70B 2P0EA 3V00A 4JLDA 3FWYA 4PC6A 4AG5A 3EZFA 1NY6A 2J1LA 2WSSA 4EJSB 5CITA 1SVWA 2A30A 4PZLA 3L2OB 1EX6A 2BBTA 2RHDA 4L5BA 3R8CA 1II8B 4C0JA 4QC2A 3WYFA 1KDTA 3W5JA 2O5VA 1EWRA 4DLRA 4R98A 4MKIA 3U3RA 1OW3B 2GETA 1CIPA 2KI5A 2ASEA 3QXJA 1E1QA 5F2EA 2YINC 4TT3A 4LI0A 4I1VA 4MDFA 4JT2A 1D2EA 3BERA 1MOZA 1RRPA 1AA9A 4UNRA 1JNYA 4M2LA 3ZH9B 1YZKA 2ZE8A 2QE7D 4A2WA 1GL6A 3K0CA 4CEJB 2QORA 3EA0A 4JLNA 3IEUA 4QJ4A 5IK2A 2BBOA 2HT6A 5FUWA 4EDHA 5HKKD 1E94E 4QRHA 1NLZA 4JLBA 1MO3A 2EWVA 1S1MA 3DZDA 1TUEA 2WKPA 1SXJC 2C8VA 4MGKR 1W46A 3NWJA 4O2RA 4YLGA 1J70A 3SHFA 2PX3A 3A1WA 1Q1ZA 3IBYA 4B2PA 4MRNA 5G3ZA 2PL3A 4JS0A 3PENA 4PO9A 4TSFA 2FNAA 5IT5A 3P27A 1RIFA 2L0XA 5ANRB 1M7BA 1ZM7A 4HZUA 3VKWA 1WF3A 1G6OA 3BIFA 4TT3D 2JGNA 3TVDA 1Z6XA 1G4UR 3TJZA 1JR6A 3U7FB 3BRWD 5BYJA 4Q1CA 3BOSA 1YZLA 1N6LA 4I99A 1OXUA 3SOPA 2FN4A 1ZNXA 4JYCA 1VTKA 4W5HA 1TF5A 3O8BA 1ZU4A 3FMPB 3W90A 2RGBA 3KQNA 5IK2D 3ZLJA 2ZITA 5CB6A 3BB4A 1Z0KA 2OLJA 3W8NA 3RHFA 5LPNA 2PLRA 4NCIA 3RRYA 1VMAA 2ODNA 4DCVA 1XD9A 4NL4H 4C3ZA 4YMVA 3EIHA 1HT2E 3BFVA 5E7IA 1U9IA 5JEEA 3VR3A 2WJYA 4MRSA 5AJXA 4URZR 1FX0B 2Y8EA 4NBSA 2ZUDA 2CK3D 1GP2A 2Z83A 5GJVC 4I1OA 3GJ8A 1ZM3A 4ZIRA 1E4YA 3UANA 4L4UA 1IBRA 4C2TA 4GT1A 4M1WA 3QI2A 1NL3A 5FOUA 4A82A 3RRMA 1HH4A 1AIPA 4FCWA 5JZVA 1HTWA 3ND8A 4XH9B 1E2PA 2OAQ1 1S0UA 1N6NA 3UMSA 1YR7A 2C9OA 3B2EA 1KO4A 4MYUA 4QHSA 4KITB 1CJVC 1XD2A 4URUR 4L9SA 3MD0A 3C5CA 4R2HA 3GP8A 4Q48A 2RKOA 2J0VA 2BKUA 4RD0A 1NF3A 3OEHA 4EFNA 3I92A 1RVDA 2F1JA 4RCYA 4QM7A 3KTAB 1H65A 1GVNB 4B35A 1JB1A 4D0LB 4X8LA 1DVRA 1PJRA 2ZAMA 1T5IA 2VP2A 1WE2A 2B21A 3GJ7A 1NN5A 3U7GA 2FGKA 5FL3A 1EG7A 2JLQA 2REOA 4HAUA 4QG7A 1YR8A 4KBFA 4PC2A 4AKIA 4MRRA 2CHQA 5G53C 1NMXA 2EQBA 5DGXA 1G18A 4D81A 3EIQA 2WAXA 4CT4B 1G5TA 2YC4C 1F60A 2BCJQ 4EJSA 1KK3A 2BEJA 4GMXA 1W48A 3IIKA 1JPJA 2PCJA 4PX9A 2ZRDA 4WOPA 2WZQA 4DDWA 3TAUA 5J4KA 4IOJA 4MRPA 1EGAA 1V43A 3RS2A 1II8A 1SVIA 3DKVA 2OBLA 1GDDA 2GF9A 3RWOA 1ZD9A 1GOTA 4UNPA 3MJRA 1HQYE 1KNQA 5DHFA 3X1YA 5AUQA 4OJQA 1IY1A 3OZXA 5LBIA 3TGPA 2BKEA 1YZUA 2ZS8A 1MV5A 4RZ2A 4E03A 1Z6TA 2G3YA 2WJVA 5FPYA 4KV9A 1N5LA 2EW1A 2ZQ5A 2G9NA 3HU2A 2P5TB 4URYR 4CYMA 2NO6A 4CEJA 4NTZA 4YDHB 4JL8A 2DFNA 1KK0A 3RSOA 3NEYA 1KZGB 1YZQA 4UKDA 4UXJA 2F3TA 4IOKA 3TR5A 4B3BA 1XZPA 1ZM2A 3DMNA 4LDJA 1E0KA 1IN4A 4HAZA 1N3BA 3CKLA 4I4LA 4A8JC 4PANA 4ZKDA 3AVXA 4JLVA 2ZRPA 2ORIA 2WBLC 3GJ0A 3RC8A 3I3SR 4Q4AB 5FL7A 3U3KA 5H1YA 2B8TA 3SFVA 2QPAA 1UDWA 2WWGA 2GTPA 3FPAA 3LLMA 1Z08A 3WYGA 4Q18A 1OKKA 1PLKA 5L3VA 1LS6A 1JAIA 4LHVA 1NNEA 5FBVB 4BWYA 4ZPXA 5AUPB 4JBWA 1ZJ6A 2O0HA 3VR5A 4JSYA 1M6NA 4YXWD 3ZYCA 2HYIC 1IJFA 2QZ4A 4U02A 3RS3A 4DRZA 1N5KA 2ZSBA 5EXSA 5J40A 3KQHA 1L4YA 2VRWA 2DB3A 3HR7A 4B73A 4KLNA 2JJ8A 1E9SA 1K5DA 1IOZA 1RW4A 4EFMA 4BPBA 4YC7A 3I61A 4FCTA 3FHTA 3ICQB 1COWD 1FOEB 3T5DA 5FI0B 4DDTA 2ONKA 3QNUA 3SBDA 3LRPA 5BXQC 3K0CC 1FX0A 1NBME 5FL7D 2BV3A 4DB2A 2CNWD 1XMSA 1S8FA 1E1RD 3VKHA 1OB2A 1CBUA 2OZEA 4QNRA 4BFTA 4HUQB 2YWGA 1JALA 1OXXK 1GL9B 3M0EA 2RHMA 5DI9A 3TK1A 5LB4A 1YRAA 4Z51A 3L0SA 4DLXA 1MKYA 4PTLA 2IWRA 2EVWX 3RNLA 1UAAA 4II7A 1WA5A 3PIRA 5FBLB 3QPWA 4JT4A 4IXNA 4US1R 3BD9A 1JXMA 2WICA 2V4ZA 2F55A 4PPFA 1OH5A 2XNDD 1YR6A 2QL6A 2QTHA 4M1YA 1UFQA 2GEUA 4BUJA 2O8DB 3IIMA 2FFQA 1SVKA 1DO0A 2Z4SA 2J0SA 3EARA 2VF8A 3GLFB 2OFWA 5JMTA 5DNYB 4FMDF 2GXAA 1N5IA 4UJ3A 3G0HA 2V8OA 4JKYA 1SVLA 1Z2AA 1S96A 3KTAA 4U00A 1R5BA 4XWKA 2ERXA 4WZ6A 2ZI3A 5FUXA 4D25A 4DDUA 3IDQA 2GAAA 3CNLA 3WMGA 2JJ2A 3BH7A 3W6OA 1U9IC 1GUAA 2WJIA 4C9BA 1JECA 3UXMA 4BFXA 3CW2A 2AD1A 1FQJA 3CLVA 1NRJB 4Z1MA 1BYIA 3IPXA 3NKVA 2I1VB 1EFRD 1ZIPA 3ZZUA 4DEYA 2P5SA 3CRRA 3HR8A 2IBMA 3M1IA 5TY0A 1GKUB 2OUKA 3KKPA 2HUPA 2EU8A 4LJ4A 4KSCA 4M9XA 3AKDA 4QFMA 1OFUX 1Q1EA 2JLYA 4FMCB 2W83A 2LCFA 3T34A 4QOSA 1JAHA 3ND9A 3IEVA 1A4RA 2PT7A 1FL9A 1VCOA 1CR0A 3GLHE 5CIQA 4O3MA 1M8PA 4GBMA 1AZTA 2OCYC 5EP4A 2AD5A 4JLKA 2H57A 1NBMA 4G5GA 4D0NA 3PUZA 2JJ2D 1L4UA 3GLIB 4PC7A 1P2TA 4XWAA 4TYQA 1KMHB 4HB4A 4B48A 3LBIA 1GNRA 3C4JA 4V0KA 4V0ME 4XJXA 3RDPA 4BQSA 1W0JD 2GILA 4D80A 5FUYA 2UZIR 3LNCA 1E96A 1Q57A 4LX0A 1R10A 4Q9HA 4Q4AA 1N6IA 2GNOA 2JLSA 1EK0A 4LRWA 1T4GA 2GZDA 3JVUA 4MITA 2YOHA 1G6HA 1N6PA 3Q85A 2FOLA 4L15A 4EAQA 1I2DA 2CJWB 5EP3A 1E69A 2WM9B 4BRWA 3H4MA 3EPHA 3A1TA 1FQKA 1P7CA 4EJSC 3U61B 1IXZA 2ODEA 3T1QA 5JJLA 4G3XA 4Q9IA 5CM9C 4UQOA 1KDOA 3NH6A 5CYPA 2XOKD 2OFXA 3E2IA 1KJWA 1W4BA 2GA8A 3DM9B 2CBZA 1XCMA 1VYVA 1G7CA 5FOVA 3GEIA 1T3SA 4IDOA 3BK7A 3VR4A 2YKGA 2OSBA 3EPLA 1SHKA 1NLFA 4CEHB 1KI7A 2YV5A 2ODBA 2GK7A 1DTSA 2AKYA 3GQBA 4RD1A 2QY9A 4XD7D 2O0KA 3W8RA 2YOFA 1CRQA 1XEFA 4NMMA 1Z0IA 2ORVA 3QUSA 3AP1A 3WMEA 1I2MA 2Q3FA 4HUQA 1A7JA 2WWIA 3NDPA 4OQXA 4RD2A 3R9IA 1YZGA 2HDNB 3VX4A 1E9BA 4HI0E 1SXJE 3SN6A 2R2AA 3BS4A 2P6RA 4TZ0A 1C1YA 1CULC 2C9CA 4RKEA 1ESNA 2A5DA 5CIWA 2AR7A 4O2LA 4L16A 1Z6GA 2YZ2A 5BWMA 4JKIA 3V9PA 2GZHA 2O8DA 5UKDA 3AGPA 4ESVA 3RRNA 2QENA 3GLFA 4V0LA 5H70A 1W4RA 4FMCF 1W2HA 4V0MA 1MRNA 1QHXA 3CX7A 3K0EA 4WZBE 4IDNA 5F98A 1XU4A 2ZETA 1QHIA 1R0ZA 4KFTA 1UPTA 2LKDA 2XJ4A 2F7SA 1W36D 1EESA 2JJ1D 3PR1A 4AKHA 2D4HA 4TLEA 1E2EA 4IFBA 3L0PA 1RFLA 2DY1A 1ZNWA 2N1BA 4PC3A 4JLAA 3LW7A 4JJZA 2AHOA 2FEOA 2ZR0A 2H18A 4BEJA 2W2XA 4LJ5A 1VG1A 5C1BA 4QM6A 5DHAA 2ANCA 2J3EA 2YHSA 3NG1A 1W5SA 2ZRFA 4XOIA 1QG4A 3SI7A 2BIFA 3RVBA 1ZUNB 5KSZA 2XSZA 3BGWA 2BWJA 3R20A 1NIPA 3KXKA 2NO0A 2B92A 1JQLB 2OG2A 1KKLA 4P31A 2P2LA 4PAQA 1Z8FA 2GESA 3ZVLA 5JSZA 1P9NA 3PEWA 2QPTA 5M04A 1G19A 2WSMA 1OB5A 2GAOA 2J7KA 2PMKA 2OT3B 1R0WA 1WDTA 4TLAA 1U8AA 2KB0A 1OFHA 2HF8A 4TLDA 3CB4A 4HLCA 5EXTA 3SBEA 3GLIA 1KMHA 4AYTA 4NYMQ 4BZPA 4EPWA 1R5OA 4C30A 3DHWC 2X77A 4TL6A 2GKSA 4Q1BA 5CK4A 1P6XA 3B5JA 1UF9A 2V7QA 4GZLA 3AVVA 4DLVA 5DN6A 5L3RA 2XSZD 4ARZB 1FUUA 4QXAA 3K0SA 2RH5A 4KODA 1XTIA 3NBYC 1XTSA 2CJWA 4BFWA 2RGEA 1Z28A 2AWOA 4HDCA 1G3QA 1U90A 4QBHA 4Q9LA 1OYWA 1RJ9B 3HYTA 1KSHA 5FPHA 3LW8A 121PA 4ZDKA 4AY2A 3QOFA 2FJUA 5BN4A 4NYJQ 1CLUA 1GRQA 1JEDA 3LVRE 1HEIA 4FD2A 2D7DA 1E6CA 3GFPA 2D74A 2GBLC 2NTYC 5HE9A 5EE5B 1OHHD 1N0UA 2CE7A 1HUQA 2R6AA 2OESA 4BFSA 5EP2A 3Q7QA 3CX6A 4HATA 2CCJA 1F6BA 4UNQA 4DSNA 3FMOB 4CEHA 5E4FA 4A1FA 2ZE7A 2IWHA 1XFAA 1R5NA 4C0KA 4NYMR 1UEIA 4OKSA 1XTKA 3V4FA 4J0QA 2G0TA 2A5GA 3KJEA 4OI0A 1G7TA 1DARA 2DPXA 3P32A 5HZHA 2VHTA 4QJ5A 4RZUA 1JR3E 1T0HB 2C2HA 1U99A 2X2EA 1SGWA 3MSXA 4LHXA 3A4NA 4BLOA 3OIVA 2WOOA 1R4AA 2C96A 1AGPA 4NONA 2QT1A 4KLZA 1R2QA 1OPXA 1GZSA 3VHXA 3EWSA 3T35A 3BJIC 1Z29A 2WV9A 4DUGA 2ATXA 4NE2A 3BB1A 4NYJR 1VHTA 1EFHA 2A78A 5AJZA 2ZYWX 5BN5A 3C41J 4DLYA 4KBGA 3PQCA 3BH6A 3KL4A 3Q5DA 4CVNA 5EE9A 4A36A 4ZCLA 1BMFA 2KWIA 2J46A 4FCVA 4C0HA 5KDLA 4DVGA 3PEYA 3TIFA 4EPTA 4EFLA 4IW3B 4X8MA 2BMEA 5FPTA 3NC0C 1X3SA 4IDHA 2W6JD 1AN0A 2GJ8A 2OBMA 3BFKA 1A5TA 3CZPA 3P20A 5E95A 2HV8A 1CJMA 1PLJA 3TW4A 4CT5A 1AGRA 3EWAA 1BYUA 4JL6A 4DCUA 2VP6A 3B9PA 1W36C 3SEAA 1Q44A 4JBYA 3U7EB 1WB9A 1R0YA 2FH5B 1NP6A 2NO9A 3LX5A 3QVVA 5C18A 3THXB 1AKEA 4YMTA 1J99A 2Q0HA 2FE4A 2KBFA 3JZMA 4R9UC 4G5OA 1SQ5A 4LYJA 2GXQA 3NHBA 4ASUD 4LZZA 4XTRA 1MABB 3PEVA 3T1OA 2Q3MA 4Q9JA 3RWMB 2CL0X 3MG9A 3MGCA 3MRSA 5F9FA 2IC5A 1KAOA 2HLDA 1U2RA 1P60A 3QXSA 4FWIB 3RLFA 4ESHA 1U81A 1E2HA 1F2TA 3B6EA 3BE4A 1ESMA 2ZJBA 3KKNA 1JR3A 3FOZA 2BCGY 3TRFA 2BMJA 5GADl 2GK6A 4C7OB 4OQLA 5JJKA 1XJQA 4A6PA 3FGNA 2QUZA 2QU8A 3AGQA 1R7RA 3CRQA 1OH6A 4ARZA 3NC1C 1EX7A 1TQ4A 2H8KA 1KO5A 4Y0VA 1TF7A 1RKBA 3ASZA 5L3QB 3KJGA 4B75A 1X1SA 2AK3A 1E32A 2VP9A 4TMKA 1XEWY 3ZDQA 4F38A 4TYPA 1DAIA 3C16C 3KXLA 4MA4A 1RJ9A 5FPKA 5C46F 4EIWA 3QEJA 3DOFA 5GJWC 4N0DA 5KOYA 3LA6A 2WMNB 1UKVY 5JHGB 1OFTA 2CLCX 1YJ5A 5DIFA 3U44B 3GEHA 2VSFA 2BEKA 3JVVA 2V54A 4NCKA 3KKMA 1P75A 3PVSA 1ZCBA 1SVOA 3EZ6A 4A0FA 1WBBA 2WJJA 2WSSD 4GPTA 4D0GA 4YDSA 4B76A 2IW3A 1VYUA 2G83A 1PVOA 4KAXA 2DWQA 1IONA 1U8ZA 3H0KA 2PJRA 1CKEA 1E1QD 3KJHA 4UJ5A 3AP2A 1GRRA 1I4DD 3R7WB 4XVRA 3TAHA 3UATA 1ZYUA 2A5YB 4HB0A 2KBEA 5KNCA 1SVMA 2XTZA 1ZNYA 2ZI9A 4QBIA 4TL9A 3T1VA 3SZRA 3TMKA 4B3CA 2JASA 4LCBA 1G64A 3PUYA 4NCNA 1GL7A 3F3YA 3FFAA 1KSFX 2J59A 3T15A 1GFIA 1LNZA 1TNDA 1AK2A 8OHMA 2HCBA 4D4MA 1FPMA 1MO4A 4I81A 2ZYVX 1IN6A 1AM4D 2BDTA 1UJ2A 5GJBA 2OM2A 5EE1A 2ZJZA 3QXCA 1KJYA 2FZLA 1OIXA 4R7ZA 3SYNA 4AG6A 2JLUA 3OIWA 4CDGA 3CONA 1IN8A 1JQJC 1Z0JA 3EAQA 3OFNA 4US0R 5DLQC 1Q21A 4CRWB 1OJLA 5BW8A 1VG0B 4B6EA 1XPOA 4DBLC 4TSFD 4BFVA 3PFIA 3FMFA 1NVXQ 1O3YA 2VEDA 4P0TA 1M1YE 5FOTA 2VBCA 1Z6YA 3DM5A 3IUYA 3U6BA 3V4RA 4DIDA 4OI1A 3C14C 3DMDA 3VR1A 1QHHB 2R6DA 2AXNA 2FU5C 3WP0A 1Q3TA 5FBQB 2VP5A 3E5HA 1OF1A 3TNFA 2ZAOA 4M22A 1HY3A 5FOWA 2WTUA 4S2EA 4EKDA 3P4YA 1KYIA 2AN9A 4ITRC 4U5XA 2A3RA 1FW6A 3H2YA 4CF7A 3B1VA 5DE3A 2ZXUA 3Q72A 3U7HB 2ZI5A 1DG3A 2ZJ5A 1IXSB 1QF9A 5CDFE 2IHYA 3THXA 3P26A 4RD4A 4A2QA 2QAGC 4ACAA 5JS8A 4OHWA 1G17A 4Q9KA 1H8HA 2SHKA 1F5NA 2EFCB 5KO2A 3K0FB 1NMYA 3FYHA 3IPYA 3QBVA 4TL7A 1KJZA 1SKYE 1D9XA 1XJCA 5B57C 4IOMA 1AJEA 4N3NA 1MABA
chains in the Genus database with same CATH superfamily
1XZIA 4OQDA 4MLCA 3BGDA 3PC8A 1RHMA 2BMDA 2QM7A 2X14A 2Y68A 4DDHA 3G7NA 5G3YA 2FFBA 4NYIQ 1Y1KE 4B6FA 4H7FA 1B42A 2NZYA 1DAOA 3S8MA 4DL9A 4RJTA 4RV4A 4RQAA 4PYQA 1IBSA 1PR3A 1TEXA 2WTNA 3FKSA 3Q40A 2ZBVA 4OI4A 5ELMA 2C94A 1GG2A 2DLNA 4B2IA 1E3MA 4LWZA 4I3HA 4F91B 5HRAA 1RC8A 4HVAA 1GFWA 3LDFA 3VR6A 4H4EA 4F92B 3UA3A 3QSYA 4LTNA 3DLHA 1SH7A 5CXSA 5C8DA 2H7CA 4MVJG 1P3JA 3BMQB 2C1ZA 4M9RA 4H7JA 1XQ6A 1ZO8A 4JJEA 1HA3A 3TBKA 1NDHA 2JGIA 3ODGA 2CFTA 2GJKA 5DYGA 4TMVA 3LY7A 3SLGA 4L0DA 1GPKA 2XNJA 4C0SA 5JJ5A 2GCEA 1N4AA 5CBKA 1BJTA 2R97A 3G1UA 3BBPA 3ZQUA 5DYYA 5I8WA 3QTLA 3UWSA 3RHTA 5CB4B 1Z63A 1FRFS 1TJYA 3HCPA 4O4JF 3UUEA 4DMFA 4Z6KA 4RH1A 1WXHA 2IYNA 5BSFA 3U44A 1SZPA 5CAEA 3WIOA 2NVUB 2J6HA 6NULA 3NXKA 4I3GA 1Z35A 3PF9A 5C34B 4EKIA 3K70D 3PLAE 1M5TA 1KKMA 3O8OA 4YO8A 2H85A 1MC8A 5C31A 5IDVA 4BU1A 4YAGA 1S6YA 2JW5A 3WMXA 3FNGA 2G71A 4OB7A 2XUDA 5ENVA 1OX4B 1XTVA 4IMIB 1NXVA 1TEZA 5D5PA 1M0EA 3PRYA 1MX1A 3OIUA 4KR0A 2WKWA 1QIKA 5K5EA 4JVLA 3QYPA 1FQOA 2AJBA 5HK9A 2J67A 3SSNA 1UPBA 1ZAKA 3NXSA 1W581 4UDYX 4HK4A 4B3SB 1IMOA 3B52X 3LPMA 4MCAA 1LW6E 5FADA 5AUQA 4OBBA 5JEEA 3OFVA 2GNAA 3L01A 5K4HA 3VA7A 1JLLA 3KR2A 1B8UA 2H5EA 5CX4A 4UHJA 2AG1A 2ISSD 4J1QA 3UK1A 4GI1A 4FR0A 1D6JA 1M2OB 3CT4A 2ZBDA 1HFWA 1IVYA 3UN1A 4QU0A 2JCXA 3FBGA 2XLBA 3H99A 3O8DA 5ALTA 2I66A 3LL4A 2KSQA 2O2DA 4YRZA 1G2PA 3PT9A 4MYRA 2B9VA 4B74A 2R85A 5IZCC 5IYZF 3EVFA 1LK5A 3WYDA 1O8BA 4LHWA 1ZJWA 2OM6A 2Q0XA 4V0QA 5TJHA 5L3SB 1V5WA 3ORRA 2B5VA 2FFAA 3RS8A 4OLBA 3T06B 3GUUA 1NW9B 4WV3A 1HLPA 2NYAA 3M4NA 1DBVO 3N8IA 5DO9A 1XQYA 2HQBA 1K7XB 3MAAC 1V37A 2DP4E 5AHRA 2O4UX 4HZGA 5E4JA 4B32A 4Q7KA 4B6QA 2QBYB 3VR5D 1US8B 4RZQA 1HFEL 2IGBA 3ZWKA 5JXHA 3NIWA 1Y6ZA 3ZWMA 4R51A 2C7RA 2IXTA 1NQOA 4IL5A 3U3MA 3X1ZA 1NG9A 1P2BA 2FMTA 1G4AE 3VDNB 5HEKA 3ZZTA 3E7FA 1YBMA 2H4ZA 5EIOA 4ENSA 2R6CA 2OKCA 2PZGA 3WNBA 4L22A 2WU1A 4NBTA 3ZWAA 4HDMB 4OHBA 4YBRA 3SHTA 2JLXA 2MMGA 5DTIA 5HJ7A 1Z38A 4R2IA 3CVOA 4L0MA 3RVQA 4MYTA 2IOQA 2D5CA 5FFNA 4YUYA 3ID6C 3DMGA 5KTRA 3IHLA 3GF4A 4RE6A 2C5LA 2GA9A 2BTQA 2GXSA 2YWRA 5LSAA 2RAVA 1FY2A 1NLUA 3EZ2A 4MIOA 4RABA 4YJ2B 3RSSA 3ZKWA 4JIMA 1N92A 2QF7A 4JWTA 3K0FA 4JYZA 4I5IA 4LGVA 3AB3A 3CR3C 3GAAA 5CFRA 1M2EA 3EGCA 5SZJA 3ZPXA 2PUCA 3S8EA 2IDZA 1GKIA 3FZEA 3ENKA 4G5FA 4JP2A 2ODWA 1I32A 1E8MA 5HOQA 1OV6A 2JCSA 4C6TB 2J3QA 4LDNA 1UBFA 3MIIA 1X7DA 2FZ5A 3ZZ0A 3I32A 2G4VA 4KKVA 2W58A 4QDTA 1B1CA 2P6NA 3HDGA 1AO3A 3VPSA 4XCXA 2OPBA 2ZUUA 3FNBA 3DVQX 4PO3X 5AJYA 3AEKB 4IO0A 1SHTX 3TQRA 2H1HA 3KEQA 4IDPA 4KE6A 4UBNA 1P45A 3X1JA 1CUSA 3K2BA 1QX4A 4DNXA 4CQMD 1ADBA 2JGJA 3VO2A 1I33A 3ROZA 3UG6A 4G5XA 1VL0A 3FPEA 2PVSA 2O8BB 2YY5A 3RS4A 4ZO4A 1L8XA 3LYAA 4FOTA 3BMQA 4EF5A 1KIFA 1ODJA 2XMGA 1PL6A 1MX3A 2OO7A 2O5EA 5JSZB 2A5FA 2J87A 2WHRA 4R68A 5I6DA 4OHYA 1EVEA 1RTTA 2NG1A 2O2GA 4KREA 1FXWA 2ADFA 3AYZB 3VU9B 4DZZA 4CCSA 4EHKA 3H6GA 3EZ7A 3A25A 1BHQ1 1FDUA 5KHOC 5JH7F 2BDEA 3AIMA 1OH7A 3R7BA 3CLKA 2VP4A 4KHZA 1FRZA 2P7IA 3B1ZA 2O3UA 4LXTA 5KDDA 1YQUA 1X80B 4AC9A 1W4CA 2NVUA 4GI7A 1JAXA 1A2BA 4DCSA 2VJOA 1M5UA 1C4OA 1SQ0A 2BGMA 2IY7A 1VE1A 3D8RA 2XRMA 2I3ZA 1H22A 1XPJA 2BM0A 2K2QB 2YMMA 3K0AB 4W1QA 4QJ3A 2FX3A 4PSUA 1OX4A 2WHPB 2WTXA 1SULA 5LNK1 4BVJA 3UUWA 4CCAA 4L51A 3I5XA 2XMDA 4JYBA 4RFSB 1EU1A 3BIOA 3LY9A 1VBMA 2ZSDA 1DAMA 1RYEA 4PFQA 1NMEA 1OU4A 3NRJA 1E20A 3GVHA 3S1SA 4R41A 4OF4A 1RJEA 4CEIB 1H1TA 2BAGA 2PKXA 3VYTB 2XQIA 3IUMA 1OY1A 2A1IA 2D2XA 4Q66C 4WBXC 1AQUA 2FWRA 2HA4A 4IUYA 2HU7A 2JDID 3STYA 4AK9A 5IMSA 3KYCB 1Q1AA 1ECJA 1R15A 2C8JA 2J3LA 1V4VA 1TKCA 1M2OA 1P1KA 4HYEA 5E1BA 3DUFB 5LA6F 3X1WA 3MCWA 2V7PA 2YWXA 2ZRJA 4QL3A 4CL2A 1CY6A 4R8VA 4GZMA 3H4IA 2NZJA 3ESYA 2D0DA 2GNPA 3IESA 1GN9A 2W00A 5A3SA 5A3JA 1NT2A 2P4HX 1II9A 2PL9A 2XB4A 4JLSA 1LWOA 2FAXA 3H8WA 1WZIA 5T4BA 1SOAA 3SWWA 4GHWA 4Y8VA 4IDFA 1IZ0A 3ACBA 4KZKA 2VHQA 4LZJA 1HE4A 4W82A 1ZBDA 4L3OA 2W2TA 3JQAB 3TZHA 3UAGA 3W1EA 5L3SA 3T1TA 2JAWA 2OCXA 1CUYA 1T9KA 1TZCA 3LS2A 4G0NA 4AKEA 5BNTA 2QM3A 3CIOA 2O2ZA 1OZGA 3AILA 3G8AA 3TIGA 2ZUBA 2QBYA 4UFNA 4Y30A 4Z8XA 1T3ZA 1US8A 1YRWA 5DRTA 521PA 4E09A 1A9ZA 3DKPA 3KUCA 1ZITA 1PT6A 4OBXA 5JT1A 3EQ8A 1IBMB 1M74A 4HJRA 3TLEA 5H3CA 1Y6FA 1RDFA 2FE1A 2JIQA 2QRKA 1QG2A 1MQSA 2RGNA 3CIFA 3L92A 4HDMA 5TPZD 4F06A 3SYMA 5BPHA 5JQGF 2EKLA 1YB5A 3UOAB 4CM5A 5AFSA 3N5CA 1H6DA 3INNA 2RKBA 1THZA 3VR4D 1L9XA 1JSZA 4CBVA 3EPKA 5M34A 3UWKA 4YJ2A 1GPYA 4KTVE 2F3UA 2LVBA 2YJTD 3CZ4A 3B1XA 3CC8A 4WEQA 4Z1OA 1HURA 4INPA 4PO8A 2Q62A 3VKVA 4B45A 3IQWA 4WKCA 3U26A 3LOUA 2Q3CA 3LAWA 3MJCA 1YQTA 2W6ZA 4U4AA 4Q47A 4GRAA 5EMMA 4RSGA 4ZQFA 3AI1A 1A82A 1IY0A 4KVAA 2PKYX 5F77A 1W96A 3B2NA 4L73A 1I2ZA 1IK6A 3T95A 4C6TA 2R4QA 4D42A 5FUMA 2KMLA 3UMJA 2BFMA 1FLAA 2OO5C 1OWLA 5D1NA 1S8NA 4DUYB 4X64B 1HKHA 1KPGA 5ICMA 2O6HA 2ZANA 3FFWA 2VDKB 4N7MA 3M89A 3AEKA 3BL5A 4C4RA 1DXQA 3P0IA 4Q4DA 1KDRA 1DOAA 5ESDA 3JYOA 4NPHA 4EI9A 1SD2A 1T0BA 1O6BA 2Q7XA 2ZB4A 3Q9UA 4QGAA 4YV1A 4QBFA 3WAJA 1YQXA 1SCQA 1SOMA 1TVEA 4GKVA 4IEIA 3WG9A 3LT2A 5JAUA 1NQXA 3JATB 3SJCA 1ZN8A 4ARVA 4HR7A 4OMCA 1Z8NA 4DWOA 3PNKA 1B8OA 1E4OA 3GIWA 2FSFA 4E1VA 3FWHA 4HH0A 3GUYA 2WA2A 4AZTA 1KORA 4ZEWA 3U39A 4B6OA 4DJEC 4BTEA 5FBKA 2MTBA 3BIXA 2MR6A 1BS1A 2WJ4A 3VU9A 3DPIA 1W1WA 4UARA 3D59A 2ZR9A 3T9BA 3ZGYA 3ZU2A 4HLQB 2YVUA 1R4ZA 4U5QA 1RFGE 2B4QA 4OQMA 1GLGA 4EHHA 2H1WA 4MYSA 3IVRA 1Z12A 1GUYA 3MWDB 1TPZA 1UBOS 1HE2A 2FZKA 1OI7A 2RMKA 1FDSA 2XHZA 2CLDX 1M0WA 1BWPA 4G0YA 3I2KA 2ERCA 1XVIA 1N7IA 1X80A 2RK6A 2UVQA 3F7TA 3T3EA 5BN3B 3JW8A 2ACWA 4GYYA 2HF7A 2ZJ1A 4YGYA 2VKQA 1CS0B 3LUCA 2VBIA 1AS2A 3WBBA 4BNFA 3F98A 1CZOA 2DT8A 3ANLA 2R8RA 1KI6B 3K0AA 3N39C 4MMYB 4ZAFA 5L7YA 1HMYA 3RIGA 3MIZA 2WHPA 3HVIA 1DAEA 3HJNA 2JGMA 2NW6A 4EI2A 2ADMA 4EPWA 5CFZA 5DNCA 721PA 1A4XA 2C3YA 2B36A 4RFSA 3PUXA 4ZYXA 5JYEA 1NMZA 4QDJA 1XTJA 3QUTA 2Y9PB 4CPDA 2XZLA 2NXNA 1HWYA 1SCBA 4CEIA 2H2WA 4FFDA 3QV2A 4M1MA 3P5BA 2ETVA 4E5KA 4C4PA 1WWKA 5C80A 3HFRA 3KYCA 1O6GA 1PI3A 1CP3A 4JCOA 2HQ1A 5IAAA 2QTGA 2XTAA 3COPA 3STHA 3DUFA 1JLSA 2D0IA 3EIEA 3R3JA 4TVOA 3AEXA 2PUAA 1XNQB 4C7OA 2QZ9A 2JJYA 1BVHA 2UZ3A 5D3ZA 1IWOA 2PD6A 1CTQA 4JNCA 4PQEA 1QO0D 1P1IA 5FXMA 3SNKA 3TZKA 4YRCA 1CG6A 1J9GA 5DN6D 1F3OA 3JQFA 1YCHA 2QP9X 3IURA 2WHQA 3I2FA 3LGAA 4M8NE 2NP6A 5FQNA 5BV0A 3JQAA 4W5NA 4ADSG 1DIOB 2ZRKA 2O2XA 2Q9BA 1YE5A 3E7XA 3U2QA 2KJQA 3QUBA 2C8LA 1O9GA 3O4GA 4PLVA 3DYBA 4BB0A 1KAMA 3AHFA 3L6UA 2XWJI 1FQWA 2IU0A 3QOYA 2FPLA 4UXIA 1KJJA 3SQNA 2ERYA 1A8QA 3BMXA 1XYGA 2I6UA 3O75A 4B3MB 1SK8A 4JUIA 5E0OA 4HRVA 3AY3A 1OBVA 3UMFA 4BKMA 4KG7A 5I45A 3IJPA 1IJBA 4JUDX 5C1IA 2I78A 4FS8A 4AUEA 1G66A 4UAVA 1EE1A 4HDRB 4NICA 1KI9A 4ZT6A 3W9SA 4LTDA 1PR2A 4U8HA 3ZU3A 5DHTA 3CVVA 4NX2A 3ESDA 3OTHA 3Q3GE 2IYOA 1CF2O 2D2VA 1SG6A 2Q3HA 1QJCA 3PHIA 1NZDA 3F9RA 4J0CA 2VWPA 2Q3JA 4WUTA 4C0WA 3I45A 2XZOA 4EGFA 4BRUA 1AKRA 1NAHA 4FPXA 5JFGA 1PLLA 3GOQA 2YZ7A 4HH1A 1F2DA 4AMVA 3EY4A 5EZQA 2X6QA 4YCMA 1QF7A 4X93A 4BFZA 3S81A 4RD6A 3JZFA 2O3RA 4AKGA 3UKOA 1DBSA 3TJMA 1RBYA 3CPHA 4DUPA 4HWRA 1P7PA 4GDFA 1A4IA 3K73O 3O8RA 1Z13A 4I19A 1A8SA 1T8SA 1CQPA 2P7HA 3WKDA 3W7BA 4ZKEA 3RFUA 1PR4A 1G3MA 2FP3A 3CV3A 4Z99A 2RAUA 3PUVA 5L53A 2WE7A 3LY8A 1KTVA 1P9RA 3ESCA 3NYWA 3JTMA 4BX3A 4BTLA 4TVBA 4OBEA 4DUGD 4R0VA 3ZHYA 3T3HA 1QHYA 2XAAA 4PGHA 4UTVA 5M7EA 3EVZA 3L07A 3UAOA 3ANMA 3JATA 5I8ZA 3IL2A 2CLOB 4GR4A 4EP1A 1DPFA 3LXXA 4QXMA 1XA3A 5T5QA 4EJ0A 2DTXA 1CDOA 4UU7A 2ZTSA 3SMVA 4PRLA 5K51A 3HVRA 4TMFA 3I4FA 4CM9A 1D1SA 4M9QA 5FTJA 5JZ9A 4JL5A 2WUDA 3II6X 2C4NA 3AHJA 2OHJA 3L8FA 1IXKA 4MEBA 2X0EA 5SZHB 2EQ5A 3IB3A 2FYTA 2XWQA 3MWDA 4YV0A 3ENVA 1QFXA 2FDXA 2OVBA 4HQRA 1RI4A 2NUTB 3DMRA 5BN3A 4BU0A 4F3TA 3CRVA 1WMAA 3G9TA 4LGMA 3EMKA 4NENB 1ZGCA 4FE3A 2QN9A 4TLCA 1CS0A 3GJXC 1IAVA 4CR6A 3DGEC 5IEBA 5JXIA 2PRKA 2OILA 5F5NA 1R00A 2DGDA 1KI6A 3JQ6A 3GRUA 2OAEA 2YWBA 3RREA 1GPWB 2A14A 4WN3A 3RADC 4OHOA 3SBOA 2W6OA 4EW3A 5AM2A 2ZVQX 4QEKA 1WQ1R 1XV5A 3CR7A 1J2JA 1T15A 1AQJA 4B81A 1ZJYA 2GZRA 2OAP1 3BK1A 4WVLA 5B6JA 3RUPA 1DQPA 4TQAA 2DPLA 4BBAA 3QIAA 4GOOD 4NJEB 4A23A 3N59A 5B2EA 1C7JA 4L5YA 1W75A 2V8BA 4UEOA 5AW5A 3W34A 2GEJA 3VSAA 3B6KA 3RYFB 1RAGA 5BOVA 4V1CB 5KJEA 1ICIA 1DBQA 1LI5A 3FUXA 2X2FA 1N6RA 1RLUA 2VBFA 3PHCA 4KN9S 3GEPA 5EKUA 4ECEA 1NLYA 1ZNZA 2EDCA 1FXUA 1PQ4A 3QYFA 5EJAA 2BRUC 4B82A 1ZUHA 1JR3D 1KGDA 3D6UA 3I12A 5B64A 1NI5A 1XP8A 3LM8A 4Z54A 3PHGA 3JXEA 1R88A 3FR7A 2ZSAA 4H4DA 5SICE 4W8GA 4JEHA 3WAGA 2FDCA 4YRRA 4GQBA 4FHFA 2VQ3A 4MO9A 2DLDA 2ZR7A 4IIJF 4KN5A 4ND8B 3TEMA 3U4HA 4BO0A 3T7AA 1H2XA 1T5DX 1RSZA 2WWXA 2C5EA 4D6XA 4FZRA 5F9HA 1VQ1A 4YR7A 3CUYA 3L49A 1XGKA 2VYVA 3ZD8A 4DSOA 5JNTA 5CP8A 3SM9A 1L4GA 1X42A 1QQ6A 1K98A 1P77A 3B1KA 1QGED 1DTWB 4JVMA 4RORA 1SKYB 4MQ5A 2X4IA 4FDAA 3MXTA 3DO5A 1QYVA 1TEVA 3CINA 2FPGB 3E1KA 2FDRA 3IMGA 4R83A 3N3BC 1K8YB 4WGFA 4HDRA 1E9RA 1U9JA 1GLVA 1UQTA 2A5JA 2FW7A 2L19A 3B85A 3JD4A 3M8KA 3L9XA 2Q1UA 4JJIA 4XRGA 1E3QA 3TG2A 1DS6A 2PGDA 3RT7A 2XUIA 2R84A 1GQRA 2DFPA 3MT7A 3HXOA 3LMKA 4C14A 3KKKA 1CV2A 3ADCA 2AS0A 4R1OA 5KVVA 4DIOA 4WY2A 3OZFA 4E08A 2I22A 2OV2A 1O96B 2BGNA 1E2NA 1AXEA 2Y1XA 1MRZA 1FDVA 3G9UA 2FEKA 3HEAA 1PQPA 2NPFA 3FPJA 3JVEA 3KZMA 2F64A 3MUNA 5EFOA 3RYTC 2I03A 5CEJA 3UFBA 3Q7EA 3T0FA 2OAGA 3WNCA 2CJYA 3I1FA 3NHSA 4MCJA 1K8RA 4B7ZA 1EFKA 2CBXA 2PBRA 2J5XA 2NTJA 3LBNA 1F1BA 2RH9B 3FDFA 2HHJA 1QMGA 4O2AB 2RI1A 4LY6A 3V8PA 5D3KA 2VUIB 4MV3A 5DM60 4E14A 4LJRA 1TJPB 1K88A 3SXUB 2I87A 1JVSA 4KQJA 1YS9A 4TPKA 3T5PA 3D1VA 3AIOA 3BAFA 4DSZA 4IEEA 2LBPA 1RMYA 1UT5A 5DYWA 1V6AA 2AFHE 3TE7A 1CUDA 2ZTLA 3I64A 2ORWA 3K8YA 1I2CA 4EGJA 4DR4B 1CZUA 1VCHA 2F1KA 3DHYA 1XXLA 5DTMA 3UMBA 1KH2A 2MT9A 1I8TA 1C9KA 3BA6A 1S89A 1ECCA 1UBKS 3F47A 3TTYA 3PNQA 5EUMA 3OQOA 3VJMA 3FCXA 3GEGA 2H4FA 3KHSA 1TJ3A 5JG7A 4DCMA 1QH0A 3IV9A 2GYUA 4RVOA 5GM2A 2NUTA 5EJ7A 2OEPA 1XLTA 3VI4B 3FOWA 3LXRA 2VNAA 1BJKA 2H48A 4LBVA 2WWFA 4NENA 3DZKA 5GVRA 4KXUA 5SY4A 1HNWB 1BVYF 1HNXB 4PO1A 3MCAA 3O3CA 4CHGA 4IIUA 3LXMA 3A6ZA 4NOLA 2G9ZA 3DLCA 5AM1A 1G6KA 5KC8A 3MRTA 4F9TA 4I2NA 4X54A 1RWXA 2C9DA 2V1XA 3JWJA 4EPRA 3H2BA 4L6CA 4B47A 1IZZA 1SXHA 1SZJG 4PAOA 1VMKA 5G0WA 2OHGA 1B16A 2AV6A 2FG5A 2IQIA 3IYLW 3L0OA 1M72A 3OD1A 1AKMA 5FKJA 4AO7A 1J21A 2Y77A 8ATCA 1FTWA 1SCDA 5KQRA 1QRUA 3D6TB 3FOCA 4YUVA 4RHUA 3TLCA 4OGWA 1IY2A 1VKOA 2PKEA 4GW3A 1MA3A 2BOVA 2JRLA 3RYFA 4JK3A 4V1CA 5L45A 5HCNA 4XKJA 1LRKA 2WWWA 4K1XA 1NXXA 1R6VA 2VA8A 4QDZA 5AKLA 3TRKA 3WSVA 1E5QA 1N6KA 1CZNA 1P1HA 1Y63A 1ZC4A 3DWFA 3O47A 1RKQA 1V5FA 1Z0AA 2GN1A 3IP9A 4N7RA 3N2EA 1S2MA 4PYKA 4YJKA 4HZIA 2JHPA 1DX9A 4NC9A 1U94A 3HKEB 4QRIA 3VDXA 3VPDA 4M55A 3WC4A 1T25A 3AUSA 1PR1A 2DRIA 3AUUA 1GPJA 4ZDIA 3TLYA 2JATA 5U4QA 1FVHA 2GBFA 2BFWA 4YLEA 5TIIA 4A0RA 3P9IA 5HFNA 3ZE6A 5IFLA 2WPDA 1BIFA 4LBZA 1I7DA 2DVMA 3PJDA 2YQ4A 3OEEA 3BA1A 4GNRA 4DV3B 3WDLA 1AGYA 4ND8A 1AGXA 5EIEA 2C99A 2RH4A 5DGIA 3JWIA 4YP7A 2I65A 1BXKA 4BNNA 3BXHA 3EVEA 5D3QA 4JBIA 4GLJA 1NTRA 1COWA 5C8YF 1JFVA 3AUXA 5JH7B 2EFEB 3BWVA 2QMYA 5FO0A 2IH4A 4AKTA 1DTWA 4G1VA 1YK0A 3A26A 3S2IA 3MGGA 1VHQA 4IRUB 1QBGA 3OTIA 4WVFA 1PE0A 5JD4A 2FPGA 5LXTB 3TYXA 2SKDA 2AEJA 2BTOA 2DBYA 2PZLA 3ZHQA 4P3NA 3ZCQA 1E2FA 4HFMA 3OCXA 2HRCA 2NU6B 2O2SA 3GJZA 3KOZA 5DH9A 4HQKA 1P29A 4AMUA 3ER9A 5EFZA 3Q3HA 1N2CE 4NY1A 5E9AA 2M1XA 1H5UA 2X8AA 5TJ9A 1P4RA 1E2QA 1N36B 1EUCB 4KQ9A 5HZGA 2QUBA 1HC7A 1HYBA 1U8CB 2R6GA 1VLMA 3M49A 3GLGB 4URFA 4Q19A 2IY9A 3CLTC 2I4MA 3TUIC 3WYAA 2CJPA 2XNDA 1BKDR 1O96A 4PLHA 2XCSB 2BJVA 1NPDA 3GWGA 3GW8A 3JVIA 4WOBA 2GVDC 4RC9A 2JFQA 2ZATA 1MO6A 1XZEA 3F3KA 4A9AA 4LV8B 4PSKA 1UP7A 1PUXA 5JC1A 5J23A 5ISMA 5G1OA 4MYCA 1U4OA 2FEMA 3IA7A 2Q41A 5FAXA 1RE1A 1TM7E 3U6KA 3IVMA 3FTQA 4GOKA 2ES4A 4BNGA 3KDSE 2K4MA 4LWOA 4MPJA 3C3BA 4A0HA 4Q4CA 3TB4A 1TD9A 4O2AA 2OSVA 2ZXFA 2O05A 4HDNB 3C24A 3SXUA 1ZGAA 4MICA 3JZAA 2JLVA 3EQZA 3PNPA 4HDQB 3GJQA 1AS0A 5AI6A 4BMOB 4LF6B 3IMCA 3A3PA 5CVUA 2QI9C 3W9YA 2ZRAA 2FWPA 4X61A 4MKFA 2H4WA 2PGJA 3PQ5A 3VV3A 5CT9A 1TFRA 3K4QA 3MGKA 3P9NA 1ZD8A 5DNDA 1XTTA 2H00A 1L7BA 1UCFA 1SWWA 4GQIA 1BDMA 1G41A 1FMFA 3IBGA 3S27A 3MT9A 4XQEA 1RI1A 3WZMA 4FQ5A 5IPFA 5CM8B 3TE6A 2HN9A 5HFAA 4ZI5A 5C52B 5ALJA 2A0XA 4R81A 1HG0A 2FPUA 1GNVA 1NBOA 1RMQA 3JYLA 3ANXA 3AM3A 4MPTA 3PEEA 1G0OA 1YDMA 3UMRA 2EGUA 1S2IA 2HI0A 5JQGB 2FF7A 2HCJB 1C3JA 3U17A 3FCUB 5CFPA 3BF8A 1P2UA 2A3NA 2F1RA 1Z33A 3AJEA 2LPMA 4L8YA 3I0NA 2BZGA 3RK1A 1QPGA 3QKRB 1N7GA 2C04A 5AKJA 5D7NA 3M81A 4NFYA 1QVAA 4B3GA 1OXVA 2R68A 1I0LA 1NBIA 2YXPX 4HGYA 5AOVA 2XTNA 3BJMA 3PZRA 4DW8A 2QROA 3F8SA 1MH9A 3EXAA 1Q84A 4R5HA 4D5EA 3GLTA 1OZ0A 2IX9A 4G0UA 1W30A 3CF2A 1T4CA 4NCJA 3JWHA 3KWJA 1EDOA 2CDNA 2CDBA 3HABA 4NESA 3B89A 1SZCA 1K0FA 4P4GA 2HSWA 4QODA 5IBPA 3WZ2A 1RM5A 1JSCA 1T1RA 4I5EA 4ZYLA 1IM2A 5BYBA 1CU1A 4WDRA 3ZGXA 1FFCA 3KKOA 4H4CA 3Q3CA 1Z7YA 2DFVA 4RVHA 4YHBA 2H54A 1KJQA 4ETWA 5D3MB 1OMOA 1QCYA 2B7BA 2O7QA 3HKEA 4B0OA 3Q8LA 2IA5A 5G4LA 1QXSA 2AZMA 4M76B 5JCZA 3KXIA 1JLKA 1RWBA 1JWBB 2VUHB 4BNDB 3HB7A 3A37A 4PNEA 2AQIA 3MFYA 2OFOA 3RUFA 4HMOA 1F20A 2O7RA 3I0MA 1BDIA 3U60B 1WVGA 2CB0A 3QG5A 3ZDCA 2ZI4A 1USKA 3EPJA 2V3WA 2AEMA 2X9LA 3GLFE 1OIWA 2X8JB 4F6CA 4N01A 4LJYA 4IM7A 3OQIB 1UBGA 4WRRA 3WJ1A 3TH5A 3Q0TA 1YJQA 2TSYB 1NDQA 2ZRIA 3AEZA 3L7KA 4B33A 4ZK6A 3CUWA 1JH8A 2ZB2A 1ULAA 5JH7A 1JWAB 2UDPA 5ALHA 4NF2A 4ZO9A 2WWVD 4JJ6A 3S1AB 3PDJA 5H0IA 4R0MA 2RIPA 4B3XA 3IE2A 1FFXB 2AYYA 2QLBA 3QX9A 4HRXA 4NLLA 1NVVR 4IP0A 3HRHA 3SYKA 1XP5A 4K28A 2PKQP 2R44A 2HZ7A 5LXTA 4MZDA 3DMPA 3ZE2B 4RNCA 1NULA 3EF3A 2BGRA 2DJIA 2FEPA 3E03A 3EMBA 3GL9A 4AVYA 1Z2CA 4IKOA 2E4XA 1H1DA 1EP9A 4FFNA 1CUGA 2NU6A 2A0YA 2HEIA 2BM1A 4ITVA 2JIZA 2Q6TA 2XVXA 5E9QA 4QTYA 2NAPA 4P98A 4N1AA 9ABPA 5AVWA 1EUCA 4W6QA 4XEHA 1NR7A 4TKVB 1GV1A 3ICWA 3BXFA 4ZT7A 3VO1A 3IUNA 3GLGA 1SC6A 3H84A 1Z75A 2F6RA 2X5KO 4RSRA 5TV2A 4F8YA 2XVYA 3H18A 4A73A 1Z7EA 3V3TA 1LX6A 5CT4A 1GQQA 4EQ6B 2J7PA 2HHAA 3K9HA 2P67A 4CM1A 1MTOA 3ABQB 3D54D 1JFTA 5L8VA 3PQ7A 1WXEA 5BRNA 3IVGA 2HPZA 1ID1A 2WF7A 2I7CA 3PJGA 2WLTA 4FYIA 4G9BA 4GMDA 4ZAZA 1NVMB 2I55A 4FXOA 4WZAB 1NQWA 4JR0A 3S4YA 7MDHA 3B9QA 3TM4A 1E2IA 1QE3A 3JQ7B 3VC2A 4DLKA 2QLNA 1EI9A 821PA 1P72A 3CZMA 3VDMA 2NZXA 1P61B 2JJ1A 1ETUA 1FNSA 1YONA 3AERB 2OZPA 3I72A 4KNWA 4HDNA 2PMDA 4PZDA 1QH1B 5A06A 3B3FA 2OZLB 3AF2A 3C7KA 1GO2A 2XKBA 4PPNA 3RM3A 3AINA 1P0MA 1QV7A 2JS7A 1DIRA 3VXKA 4C76A 4D6PA 2P9ZA 3LSYA 2OGTA 1J20A 3RYCA 2K7FA 3QQ5A 2Z2JA 4EUKA 3MPUA 5J9FA 4TWBA 1LCIA 2ZREA 4E15A 1ZGHA 1Q3KA 2IZ5A 5ULLA 5EPEA 3V8QA 1QB7A 2FGJA 2V9ZA 1NUQA 4ED9A 5CJ2A 1I36A 5A4AA 3B60A 1LNSA 3H4VA 2RGXA 1OXKB 1A9QA 1OXSC 3G2KA 2VF4X 1L3BA 4IVRA 3T9FA 4BO3A 2OYRA 2UYOA 4HAWA 4RFVA 1N1GA 1XCPA 2RK4A 1W25A 4GOXA 3TNYA 2G70A 4JYPA 1D0VA 1G9XA 1H0KA 4KZPA 4Y6PA 3VOTA 2Y1DA 3UK6A 5JQGA 2ZRBA 4ESOA 3BILA 1XEXB 4F5ZA 1CHDA 1DXYA 3NHJA 3O9ZA 1C1DB 3KYJB 3QKRA 4QYSA 3HG7A 3TCKA 1G21E 3L05A 3OQVA 2AUMA 2WKQA 5BSHA 2FQ1A 1KC1A 1R0CA 1UMCB 3KB2A 1NG1A 2IPLA 2A9KA 2Q1TA 2BZSA 4N8SA 4D45A 2O0MA 1V1MB 4G0QA 4JLPA 3QX8A 3H97A 1EK5A 5C5IA 1B6RA 3B6MA 4FJ2A 1F17A 2NO7A 2OR3A 3BSYA 4BV9A 5ALDA 1V11B 2Y27A 2G77B 3MQ4A 5GOZA 2R8EA 3WISA 3AG6A 4Y3UA 1VJ0A 1QRAA 2PSSA 3OZSA 3G89A 2P9JA 2ZJ4A 4OJKA 4BX9A 2A0WA 3T7TA 2NYRA 3UJ6A 1S3GA 4LDQA 2QTFA 3SF8B 1XCOA 4UM9D 5D3MA 4QTTB 3LD9A 1U7PA 1OFIA 4ENQA 3A6PC 4G4GA 4BNDA 2HRZA 2WHEA 1TAUA 5CXXA 2IYQA 2A86A 1TCCA 5FBRB 3ZIUA 3AKCA 3FYCA 1RNLA 5IUNC 1R6DA 5A05A 3S44A 2X8JA 4DEVA 1IBKB 1OHHA 2YFHA 1QTNA 2HSGA 1IB6A 1KERA 3AQ4A 2ISQA 3OQIA 1S2NA 1NPYA 2RI6A 3OTOB 2M6KA 2GPBA 4MGYR 1D2NA 2H2FA 1Q7EA 5HGXA 4GSYA 2X5NA 1I3NA 2PX0A 3IILA 1OFGA 3S1AA 3Q3EA 4F5EA 5BWCA 3VYVA 1FFXA 3EIXA 4FR5A 5DLEA 3PR3A 1MJGA 3L7NA 1MGOA 3EC1A 4YRAA 1PZXA 4IJWA 5EVJA 3C5VA 3HNPA 3RLIA 1EPUA 4DLUA 3ROGA 1TU4A 3K30A 3KPUA 1OE0A 1WL8A 4JUBA 5ALUA 1FJXA 1DBIA 2XCQA 3EH1A 4EFKA 2YHUA 2QEQA 4K1LA 1YGYA 4NU5A 4B71A 3GU3A 4UUQA 3LO8A 4P22A 1HT3A 1TF2A 4XZ3A 1ECFA 4TKVA 1VHDA 1KZ7B 4J9VA 2ESRA 5JLJA 1KR5A 2X23A 4F4DA 1UQUA 2VDMB 2XQJA 4MUHA 2O1EA 4I6EA 4RPHA 2V0NA 3MJHA 1G7SA 3PNMA 1VKRA 1A71A 4EQ6A 4ZJZA 2EGGA 1GZHB 3A1VA 3B20A 4Z0PA 2NSJA 2WWTA 5AIAA 4BMYA 3VYSB 4CV2A 4HQFA 1UJ5A 2DAPA 2G1KA 3LIPA 4RGVA 3P5SA 2W0MA 3ORSA 3GAZA 3SIRA 3IERA 4NHEA 1OUMA 1VE9A 3KZKA 2GO7A 4XWGA 2HJVA 4P6VF 2REXB 5LN1A 2XKKA 1KQ3A 3FFBA 4P82A 5G0UA 3JQ7A 3HGMA 2VPPA 4HZUB 1YR9A 5BUQA 5IM4F 2PM8A 1QYDA 3TZBA 4IIDA 4YMLA 5TEVA 2AZTA 4N5DA 2E4AA 3AERA 2HW8A 4OMFG 3AZQA 1CB7A 5DCWA 4PS0A 1QH1A 1O5IA 2LWIA 2OZLA 2PAFA 3GIDA 4LPSA 3TLBA 4C5BA 1ABFA 3TSWA 4DA4A 1SHUX 3KD3A 4BFYA 2GGSA 3O4JA 3PD0A 2IW1A 4PSVA 4IH9A 2EG5A 2PX5A 3DWGA 1L5HB 2WD7B 4IIJB 2IOFK 1KOLA 2YJ4A 4XAQA 2X3YA 1BROA 3JAWB 1YK1A 1N75A 5CDTA 5K8TA 3IELA 3IIIA 4JI1B 4TXMA 1TMYA 2ON6A 3DE0X 4AZWA 1PD0A 3PYXA 4RY8A 4Z0TA 5KNDH 2RH8A 1UMBB 3RAGA 4L3WA 2D06A 3ONNA 1EXMA 3KTOA 4PQGA 4G6ZA 5F9FA 1PAUA 1QH8B 2P9YA 3CUEF 1QB8A 2NYVA 5CDHA 4RJLA 3ZJ5A 3E7DA 4HQLA 5DM2A 4JB8A 2ZJAA 2JAXA 1XEXA 2VF7A 1U2DA 2Q99A 3HWX1 3GJRA 3RCBA 2VK8A 2W2KB 4ZIRB 1C1DA 1ZVVA 3VHLB 1DDGA 2ZSKA 4BO4A 5K45A 2CXXA 4LYGA 3VI3B 5IARA 1ZD2P 3JCZA 3C8UA 1RXIA 1UMCA 4JH0A 2QP4A 4ZANA 1ENZA 4X8OA 6CHYA 2Q0SA 2FPSA 1G3RA 1OOEA 4GPD1 1V1MA 4BN5A 1HZZA 4PONA 2G1JA 1O1YA 1IOVA 2RGNC 1J49A 1VSQA 4UCWA 4WDQA 1RM3A 3EJ6A 3FE2A 1V11A 5FAKA 1UBRS 1TZKA 5TS2A 1IVNA 1IQPA 1ESDA 2EBFX 1ZH4A 2WAYA 3DQQA 1QIFA 3D02A 3QTTA 4QULA 4MIKA 3FHLA 3CLSD 5JS6A 3RD5A 3S99A 3A11A 2ZYTX 4KJZA 2QYHA 1K6EA 4DIMA 1ZJ4A 1EFPB 5C8XA 3C15C 1MHPA 1CUXA 3SF8A 1JYFA 1IN7A 4YONB 2ZYDA 2PFSA 1SU4A 5ESWA 2XUHA 2XMPA 1HT0A 2BISA 4DR3B 1ORRA 3CX3A 3PXCX 1N8NA 2ZROA 1G1MA 4UPEA 1D1QA 2A5LA 2R87A 4M4SA 4M46A 2D7CA 4PHTA 4UMFA 1EXWA 4HQNA 1LU9A 5U4XA 1ANKA 1NXSA 1UOPA 5HKKA 2F4VB 3RU7A 1NLMA 4MKHA 3KTDA 2G0AA 2JLWA 1J0BA 3IP6A 4JQZA 1MOSA 2TMKA 4KFRA 3JYHA 1HEYA