4IYJA

Crystal structure of a putative acylhydrolase (bacuni_03406) from bacteroides uniformis atcc 8492 at 1.37 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
211
structure length
211
Chain Sequence
SDAQKQDWGNLKRYAEANKELVRKGKQKDRVVFMGNSITEGWVANDAAFFEDNGYVGRGIGGQTSSHFLLRFREDVIKLAPALVVINAGTNDIAENAGAYNEEYTFGNIVSMVELARANKIKVILTSVLPAAAFGWNPSVKDAPQKIMQLNARIRKYAQENKIPYVDYYSEMVEGDNKALNSSYTRDGVHPTLEGYKVMEALIKKAIDKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative acylhydrolase (BACUNI_03406) from Bacteroides uniformis ATCC 8492 at 1.37 A resolution
rcsb
source organism Bacteroides uniformis
molecule tags Hydrolase
molecule keywords GDSL-like protein
total genus 73
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4iyjA00
1PP4A 2VPTA 4K3UA 4NRDA 2WAOA 4K9SA 4LHSA 1V2GA 4M8KA 3PT5A 3HP4A 5A4AA 1WABA 1DEOA 1YZFA 3SKVA 1U8UA 4K7JA 3MILA 1ESDA 3DT9A 4IYJA 4DEVA 1K7CA 2HSJA 3DT6A 4H08A 1ES9A 5B5SA 4JGGA 1FXWA 4S1PA 2Q0SA 1DEXA 1ESCA 4Q7QA 5JD3A 1ZMBA 1BWQA 3U37A 4TX1A 3DC7A 2WAAA 5BN1A 4PPYA 3W7VA 1J00A 1BWPA 3P94A 2W9XA 3RJTA 1VYHA 1FXWF 3C1UA 1IVNA 4Q9AA 2O14A 5CD9A 4JHLA 4I8IA 1Z8HA 5HOEA 4RSHA 2Q0QA 3BZWA 4RW0A 4JJ6A 2APJA 4HF7A 4HYQA 4OAOA 1JRLA 1ESEA 4JKOA 4XVHA 3DT8A 2WABA 4K40A 4OAPA 4JJ4A 3DCIA 3KVNA 1VJGA 3SLRA 1BWRA
chains in the Genus database with same CATH superfamily
1QFSA 5CDTA 2PSFA 2O3RA 2PBRA 3GRKA 1XHEA 3ORYA 4L5JA 2AS0A 2G4LA 5HBRA 4EZIA 2VPIA 4GICA 4ZVOA 1RI5A 3A4NA 2WMOB 4OYYA 1CQJB 5REQB 1V2GA 1M76A 4RTRA 4EFDA 2ZJ5A 3IUYA 1G4UR 1U1CA 2YS7A 2ZRIA 3CJTA 3NAQA 4GLLA 4U7HA 4H31A 5AW5A 3L1HA 1D09A 1HKHA 1IHYA 2JATA 3GY0A 3BTVA 2WE7A 3T5PA 2JA2A 4R0VA 3RARA 1W1WA 3PT5A 2UYYA 3IBCA 4MV8A 1NT2A 4GDMA 4Q0MA 4DDMA 3ZKAA 4ZDKA 2AFHA 3NDJA 5EKSA 3BSFA 1NN5A 4BO2A 3IA7A 3IYLW 5AW0A 1HZZA 3TCNA 4L0QA 4PCLA 3GPCA 4R5MA 2RGRA 1Q1EA 2VBCA 3CBQA 3MJTA 1I10A 1OZAA 1PYGA 3L0PA 2BEJA 3NZEA 4G1UC 4URHA 3TOZA 4BNXA 5JSUA 1VG8A 2EL9A 3VDNB 1J21A 1ESDA 1QVZA 1XDBA 3BOSA 2IHTA 5I9BA 2CLOB 2Q9UA 3PNSA 4EL5A 1R5JA 2BMWA 3NW9A 3UYKA 3IPCA 4LNAA 1U9YA 3X2FA 4LOHA 4RXMA 2NUTA 1XTKA 3V8QA 5I7UA 2ZFUA 5IJXA 5KNDD 1FP2A 1LQTA 1OGYA 1QGAA 3EMVA 3MTJA 4PEVA 4QBFA 1HK7A 4FI3C 1LX6A 4JUBA 1PWEA 8OHMA 4RTLA 2CGEA 4QPJC 1CZNA 3PRKE 4EW3A 1W5SA 3F5DA 1TQ8A 3TFOA 2X14A 1JH9A 1EB9A 1WXEA 3UQYS 2QR3A 2HJHA 2QNIA 2G5PA 3D8NA 1T6ZA 3T8YA 3W8RA 4X66B 2OO5A 5DBFA 4OI0A 1VMKA 3CNBA 1EX9A 3DOCA 4B3SB 1YZGA 2GN1A 2Q3JA 4LE0A 1J2RA 3G49A 2MDTA 3KZMA 3P9YA 4RPJA 5EVJA 1CZRA 5K3CA 1WB6A 1ZNZA 3IGFA 3OMXA 3IS3A 2ZT7A 1AVTA 2Q6LA 5TMPA 3SYMA 2BH2A 1KPGA 2ZS8A 1Z74A 4FYYA 1O95C 1O03A 2FXVA 2QG4A 2SNIE 2FSFA 2Q3MA 3L6OO 3CR7A 2EARA 1EMDA 2UAGA 3GDWA 4IIGA 5LA6A 2ZETA 3EGVA 4EPWA 4ZIRA 3CX7A 2GA8A 3TB6A 3SIWA 2MYUA 1JDPA 5EIFA 2VZ0A 2YHBA 4ZVSA 4AJ4A 2V7PA 5IXYA 3G2HA 2EW2A 2JLAA 1OX4A 1YS7A 1J33A 2ZWVA 2XRYA 3W04A 4EABA 3L7BA 4TYYA 1Z8DA 3UV6A 3ZCXA 3EOBI 1KDTA 4TLCA 1FPMA 3BB3A 4M98A 5A2GA 3I8SA 2R2GA 2XCIA 4CMHA 2C94A 2ZE6A 4AUEA 1XEWY 3BZBA 4FI3F 4BVEA 5GVSA 4U6SA 1A72A 3DLCA 3CLHA 4P3PA 3SQNA 4RV9A 1JHPA 2FOIA 4BNFA 5G1PA 5LIPA 4ACBA 2BH9A 2P75A 3WJ7A 4B80A 1DJQA 2EWWA 4KXQA 1P2TA 2J3EA 3MB8A 2FN3A 1E99A 3PD0A 4IJQA 5AVKA 5JR3A 3VKHA 3R20A 3TQRA 4DPKA 3I9FA 3RVLA 5IF3A 4LJKA 2BF7A 5HIJA 1HE2A 4AKEA 3ZI0A 2P5TB 4ZI5A 2Q27A 2XDAA 1KP9A 3O93A 3SHWA 5AESA 1C80A 3JATA 1QIJA 2EIHA 2VPTA 1HQKA 3QLUC 2RJ3A 3BMNB 4KB5A 1LA2A 4R81A 1RWXA 5F5LA 3DMRA 3RWBA 2QZSA 3WI7A 3KHSA 1PZNA 2PTHA 4JXJA 4UAUA 1P2BA 1G63A 3EXFA 3NTRA 4GMXA 4YMGA 2NAFA 3ANXA 5F76A 4D0NA 4U2FA 3Q0TA 4GXRA 3J81A 4MRNA 3ETLA 4TVOA 5PNTA 5IT4A 1TKRA 3KYBA 4YAUA 3I42A 1D1TA 1HFEL 1X19A 2BC9A 2IUEA 2WUEA 4K6KA 3NONA 4X85A 4PGHA 1A9SA 3GRUA 1OXKB 1IOWA 1XV5A 2PT5A 3MTGA 4L72A 2V74B 4TWIA 4S05A 4CKWB 3VC3A 5BUCA 5DISB 1KMHB 3UCXA 2Q7OE 4M54A 3OO0A 3FIUA 5AWFC 2ANBA 4A10A 5K45A 2I3BA 4RL4A 2JJ1A 1HTTA 3KWLA 4C05A 2TRSB 2AZMA 2RGBA 3BVPA 3K30A 4FMDF 4FFVA 3VR3D 3WMWA 2RB5A 4YMVA 4BGDA 3NIGB 1SWVA 1EFAA 1T26A 1MVOA 1JWBB 1DKLA 3BWMA 2AG8A 4Q4AA 3UCEA 2GKSA 5LJIA 2WZBA 2EGUA 3GYBA 1IUKA 1TJYA 3ASVA 4ONEA 1EGHA 3VMMA 1JJBA 1A82A 4CMIA 1ZWLA 2OZKA 5LQUA 2XGOA 4KCGA 1PL6A 3ON5A 3EH2A 4OJQA 1SVOA 2HI0A 1K86A 1ZZEA 2A59A 3AK4A 4GL4A 1I8TA 4KIJA 4F4IA 3HXQA 1QF9A 2J46A 2FEXA 2J3KA 1ULTA 3ROGA 2VXYA 1P8JA 1FOEB 5M34A 1DEHA 2WJAA 3FF1A 2OPBA 3LXXA 4YDSA 4KX3A 2Y0DA 3TJRA 4DREA 2ZB3A 3CIFA 2EYUA 5KCZA 1CR4A 2JAPA 2DWCA 1OXXK 4KQHA 5E3HA 2EGGA 2JIOA 2JAOA 4I0WB 3A3OA 3ROEA 4G36A 3SIRA 2XKAA 4AKGA 4QATA 5CNKA 1YMUA 3FNGA 1HEIA 4TYWA 1SBYA 2HW8A 4C30A 3VR6D 2I7DA 3HDVA 1UPUA 4LDAA 4B6EA 1TZ2A 3N8GA 2V7WA 4N3BA 2DAPA 4YP9A 4DABA 5K3DA 2YIVX 4Z1OA 2DPGA 1IY8A 3O83A 3FPHA 4MRRA 3BH0A 1YB4A 2QIOA 4NCJA 3EGWA 3X44A 1Z2PX 5B1HA 4GOLD 1J0EA 1FFSA 3R7NA 4C3UA 1WHSB 4MCIA 2GQ0A 3UWOA 3B52X 4O1HA 1QVWA 3O2QB 5DNDA 3W90A 4IY1A 1EVEA 3GBPA 1XXHA 1Z08A 4R8VA 1AS2A 5D51S 4GX5A 4O4LB 3LBAA 1CQXA 4B33A 2I80A 4F0JA 1E32A 1E79D 1NR5A 3R7SA 3ZQUA 1JA1A 4K8OA 1F1BA 5B12A 3DWGA 3Q3EA 3FMFA 5IBCA 5BVGB 1GN8A 1XRPA 3C5VA 1C8BA 2ZBDA 1IN1A 3PENA 1V35A 2YJ3A 1IRXA 3C15C 1ZVKA 2YN0A 2WJ3A 4GYWA 5H9VA 1SPXA 4Y2TA 3CE6A 4WZBA 4MDFA 5DGTA 1OI3A 3ICQB 4DGSA 1DWOA 1XTPA 3Q41A 4LHSA 1WDLA 3QI2A 4PO8A 1JG4A 5KU7A 2JLZA 2ADFA 3DFMA 5DK4A 1A88A 1LDMA 2EQBA 3BXGA 3KKPA 1YJBA 3NKLA 1W9HA 4PC7A 2WK1A 1Z4MA 3T3DA 4ZI7A 2LRHA 1KI4A 3U31A 3OZWA 1KY4A 1LDBA 1ZMXA 2WDPA 2P6OA 4IAOA 4XYBA 2WV7A 1Z37A 3PNLA 2ZVQX 3QEMB 2YS6A 1O0SA 3A3KA 1QQTA 3I6IA 3NYQA 1Q1NA 4J29A 2DSNA 3TSWA 3TQSA 3V1KA 3WGLA 2I1WA 4DIEA 2JGLA 1CP2A 3H1FA 4NEGA 4BX0A 3WIUA 5COQA 3GLGE 3L1KA 5FCDA 4PAQA 1AK1A 1P1KA 3LH5A 3JASA 1GCIA 4MPJA 4GKBA 1T10A 2O1SA 4XI9A 5B7PA 3FOZA 4OHZA 1F9AA 3WWEA 3D1VA 4C0KA 2P0YA 4BFTA 4ZAXA 2QDXA 3WL5A 4PIPA 4JI3B 3AF5A 2O2JA 1GYPA 3TOXA 3UJ7A 3EGDB 4YT4A 3AHFA 2VP6A 3BF7A 4AMZA 5KOIA 2BCEA 1K89A 4PS0A 3E8MA 1JKMA 2VL7A 3KOZA 1OJ7A 3E5NA 3SY8A 1GILA 3A6PC 5A9TA 1EA5A 2P1RA 1WF3A 4E2FA 2Z6VA 1KRXA 1EXVA 4XEUA 4WLFA 1R0KA 1WXQA 5LU8A 4OHWA 4JYAB 1NC3A 1RI1A 4Y6GB 4OU5A 3H9GA 1CE8A 1I2ZA 2C04A 4LC0A 4R9NA 1Z2DA 2EC5A 3EF3A 1DMSA 5IW8A 5E4YA 2QPOA 1A2QA 2PUTA 4LHXA 4WY5A 3TQOA 2AN5A 3WZ2A 4P0PB 3TX2A 4E0BA 1VLLA 1UK8A 2QSZA 4HATA 1DELA 3ZS8A 2RSLA 1EZZA 4HNTA 1NOIA 2C7RA 2R8EA 5GY7A 4J6EA 1AHPA 4BFCA 1K98A 1GZ5A 1M0TA 1QKJA 3BIOA 3SSMA 4CMIB 3R5SA 4CF6A 3QVLA 1INLA 2NQTA 1NJ2A 3JALA 5LVAA 4HJRA 1YKSA 2IDMA 2Q5CA 3HACA 3LIIA 2GETA 4QXAA 4DSOA 4CKCB 1LTQA 1B14A 2VUSA 4G0OA 4LJ8A 1Z0DA 4LZJA 1GNTA 3LZCA 1PZGA 4DXHA 3EA0A 1E8MA 4BNDB 3QXCA 2NUAA 3GT4A 3SYRA 4EY4A 2WB2A 1IDN1 3I9NA 4DAEA 2CWWA 2QM0A 3FZEA 3MZ0A 3E7DA 3FWNA 4QDXA 3TIFA 3UC5A 3EH1A 3OZFA 4DLTA 5DTIA 4E21A 2Q4TA 3DHNA 2HAEA 4LISA 5BPHA 3AVTA 5IT9A 5CH3A 5F77A 1QTIA 1GAJA 1U2EA 2PKQP 3ILYA 3RIXA 2IEDA 5I7AA 3WLJA 4XX1A 5BV1A 1CQZA 3H3XA 4LF6B 2PMCA 1R0SA 3IQEA 2VQDA 2E5WA 4A0HA 1SHZA 4QOEA 4K3VA 4N47A 1A8QA 5AKEA 1I3NA 1FUKA 2H52A 5HF9A 5JVDB 4YMSA 1GKKA 2BFOA 4FINA 2ACWA 3MJRA 1ISJA 3ZQ6A 3GLFA 1G3IA 4MKXA 4D8TA 4FGKA 4EKIA 3EDYA 3WIVA 3AM5A 1VJCA 3EZNA 1ABBA 4D45A 2Y77A 5KDDA 2JFHA 2C0QA 1CNFA 4UBNA 3EVBA 3ED1A 4F1KA 1SXJD 3DDCA 3JRWA 4LF7B 2R7MA 4NABA 4PBSA 4EI8A 1EZ4A 2H4XA 5B3JC 3K0CA 3LF1A 4C0SA 1YZHA 4D4HA 5LL6P 1KO5A 4W5JA 3T0GA 1ZVMA 4NPAA 4P81A 4ARVA 2Q5EA 1LRJA 1QOQB 3B6KA 3ZW7A 3IR5A 4ZO9A 2HB6A 2HA3A 1BS1A 1LPSA 3AJAA 2R6FA 3VJLA 621PA 1SCIA 4BGIA 2BMFA 4TL7A 1WLYA 1GPYA 2VHQA 5B3AA 4X7PA 2VHUA 4R1PA 3TBHA 4ZCLA 4AC9A 1OTHA 1CLUA 4XSGA 4DA0A 3QWIA 3GEBA 1OX4B 2XPCA 3CEPB 1TJ3A 2FDRA 4DRXA 4JB0A 1A4IA 5JCPA 5JARA 4IGKA 4DUZB 1CETA 3ZLBA 2P1DA 1OGJA 1KE2A 2UVPB 3MNFA 1YOBA 4Q03A 4U8GA 2F17A 4MA4A 4ZQEA 2EFHB 1J70A 5T4EA 4KPYA 3BRQA 5TIIA 1FU4A 1OWLA 3IMCA 4P80A 1JBQA 2KS6A 4HB4A 4F3TA 1SIOA 1Q50A 4XEHA 2K7ZA 4QX6A 3VAAA 5A62A 2EZ9A 5ITZA 2Z2XA 1QC5B 2ZTMA 2PMBA 3GEDA 3DLBA 4G41A 3D4PA 1N1MA 3BWXA 1OBCA 5AI5A 1R5NA 5DXJA 1UXJA 2UV8A 3ZR4B 3CGGA 3WDKA 1AKEA 2X0IA 3QVWA 4W8GA 1Q1BA 4AKTA 5JAMA 4X65B 4XD7A 3WOHA 4ARZA 4DHWA 3ZE9A 4LF9B 2B78A 1PD1A 1T3GA 3PLNA 3RSLA 2I71A 3ZE0B 1NBHA 1RIIA 2M6RA 1PWXA 1L5YA 2Q0SA 2IKQA 1QDEA 3O8OA 4PRKA 2PXHA 4K1XA 3WFZA 1O9BA 2QV0A 3ZU2A 2BEVB 3GCDA 2O50A 4RZXA 3Q15C 1YZQA 1RTKA 1F4LA 4AXXA 4QTUB 2ODNA 1C0PA 1K3FA 2XKJE 1NVXQ 4FDVA 4IJUA 4M0FA 5IC4A 5DRTA 1MENA 1ONBA 1BFUA 2XNDD 1RW4A 2ZXFA 3HMKA 4KFTA 1RRVA 4PCAA 4U2DA 3RFVA 2P8JA 2JLWA 3DWIA 3GJSA 2Q1WA 5LBIA 5H02A 2DY1A 4X41A 1HLGA 4F9GA 5JCOC 3HJTA 4BIIA 1X1TA 2GDJA 2K2QB 4K6HA 3MXTA 2XECA 3Q8XB 1HM5A 2GCEA 3OKPA 4H7DA 5D1HA 3UVEA 1PN3A 1U28A 2DJIA 2NSYA 1M7GA 1FNBA 3M2TA 1PR2A 4ITVA 1GIAA 2FV8A 2R87A 5F78A 4J1TA 1NVKA 2FYTA 5JDCC 2FZWA 5TRTA 4E3ZA 2PIAA 2WHEA 4MA0A 2D2EA 2A78A 3ICWA 4I2NA 4WNYA 1W9MA 4BEBA 4DMHA 3FYHA 3MHTA 2OO7A 3HR7A 3IBFA 5GOTA 3GMSA 4EY3A 1OZHA 1EDEA 3SICE 1ZN9A 3QFTA 2AOWA 4NWIA 2E37A 1M6WA 4HFMA 4RFVA 1HYQA 3GCXA 4U2CA 5DGDA 4KXFB 4WLUA 2C7VA 2KB0A 3FPAA 3G5MA 1G7SA 1SKMA 4BFZA 3EBPA 4MUXA 3AHCA 4PX9A 4RTMA 5ANRB 5I5GA 1ZXBA 2TMKA 1UAYA 1QH9A 3QWHA 3FNBA 4ANFA 4AZVA 1MIOB 2N3ZA 2Q3DA 4RIIA 2A7XA 1GPNA 4WK6A 1QIKA 4H7HA 1OU4A 2F3TA 3WNDA 1DBWA 4M55A 3AHHA 3PGMA 1U3GA 4OK5A 3K9FC 4XAQA 3H1TA 2W42A 2C96A 3ELUA 3TMYA 1Y98A 5HQ3A 3SS8A 3WAGA 3RS7A 4P4LA 1XUOA 3I9V6 4UBMA 4Z51A 3R3JA 4UUAA 3V00A 4BXOB 4JHXA 4NZOA 4YACA 3BWEA 4JMPA 4M6WB 1R3DA 5HIAA 2BTQB 3HJCA 2BW0A 2PZKA 3A1SA 4Z4IA 4WY8A 2Q5LA 1AQJA 3AEUA 2NU6A 1CW2B 2I4MA 3M5DA 5EMNA 3W8NA 3OX4A 3LC1O 1QFJA 2PN1A 1P5FA 3A6LA 2G71A 4EGCB 1PNOA 3SEFA 4FX5A 4Y9UA 3QYAA 5C8DA 2QRVB 5DHQA 3H1PA 1K4KA 3EFHA 2OL4A 4PIVA 2QMUA 4B31A 4C4ZA 3I9LA 4XCQA 4YIKA 4AZ3B 4A9AA 1VXRA 3HADA 1Z0AA 4BB0A 4X71A 4EBFA 3PK0A 4EYOA 3EFEA 3NEJA 1LSUA 2Q6TA 4BQIA 4KR0A 4ABTA 3I62A 3AW8A 2C29D 1P9NA 2E9SA 1G42A 1P60A 1MT0A 1JQKA 2WTBA 4LV5B 4BAZA 3R8FA 3IFSA 4H4CA 3UMYA 2AMYA 3D4LA 2RFLA 3J7TA 4BX8A 3KQNA 4POAA 3UXYA 3U0BA 1ZM4A 2B8JA 2PCLA 2H2FA 2XMQA 3G85A 2HRBA 1FU8A 2Q8NA 1JZSA 1QHYA 1R8YA 2E0IA 1QORA 4CBVA 4US2R 3TTWA 2QYOA 1EQ2A 3PD7A 4MYRA 4E2YA 4LMPA 1OC2A 1GGFA 2XD9A 3B78A 4EGFA 4QAQA 1NUUA 4AG6A 2RAFA 2ZAMA 3K09A 2H2WA 4C2BA 3CUSA 2F1JA 2FVYA 4MI9A 1QH1B 2VJNA 4EO4A 1NVWQ 1KKLA 1R9JA 2GKGA 2LE0A 3FFTA 2OCLA 3THXA 4PO1A 5EYPB 3YASA 1RP7A 2ZJBA 4Q15A 3S44A 4E7OA 3GN1A 3HJHA 2XUKA 2PUGA 1XYGA 2X8AA 1R6DA 3A8TA 3M3PA 1ENOA 3L82B 4O4IA 4QZVA 2WY2D 1Q84A 2NZYA 2BI8A 4NMXB 3RLFA 3DE3X 4HF7A 2OP1A 2V6MA 4MEAA 4KYTA 3OJXA 2I6XA 2AJLI 5A4DA 7ADHA 2A9VA 4BFYA 1ZEMA 2I4LA 3AB8A 3CNEA 3DNFA 4NAHA 5E3IA 3UANA 2O2CA 3E9NA 2FMIA 4AMVA 4TKVB 1AK9A 4QYMA 2JGMA 2VYNA 3HV2A 4G5XA 1P2VA 1R0WA 1QVAA 3OWOA 4JUCA 4ZAFA 3OSUA 1JHYA 3FSJX 2WAXA 4YPOA 4GE0A 4Z4QA 1HSZA 1QV9A 3K05A 4HLUA 4X3CA 1U9IA 3ERCA 1WSWA 2FFQA 3C3KA 3E8SA 5KVCA 2IYUA 3QP9A 1FP7A 3FNRA 4JEHA 4JQSA 2PZGA 5EG5A 3NRJA 2J0QA 2V0CA 1QG0A 3EDQA 3OOEA 3T7RA 3X1KA 4K6GA 3IEVA 1L7PA 1J8MF 2A88A 3EZLA 2PPLA 4KBYA 4UCXA 4UNIA 3LU1A 3VU1A 1AXEA 3KXKA 4RKEA 4RX1A 5BOVA 3RYIA 5JYEA 1YCFA 5EXEA 5ULLA 3L4BA 4EVRA 2I6SA 2CYBA 1ZIYA 1YDMA 3DMGA 4H7FA 2D5IA 2FTKE 2JZCA 1YRBA 4CQMB 3PC8A 4U6NA 1JAIA 2WKRA 4GSLA 2ZIZA 3B9PA 1V5IA 2ECOA 4AP5A 1AUVA 2H5IA 1BDBA 2AUTA 2IZ7A 2YWHA 1AO3A 3HU3A 3LF2A 4RCVA 4TKVA 5ICSA 1FK8A 1QOPB 1LXCA 2ZRCA 3KB2A 2Z2ZA 4QT0A 2Q46A 4E31A 3IOCA 3ZTTA 4TXMA 5I9NA 4AW9A 5CDSA 3HYNA 4MB6A 3RIEA 1BC5A 1USUA 2JCVA 2M9MA 3GNLA 3TIXB 5A03A 5KJ6A 3D64A 1QAOA 4TT8A 1IJEA 1L5NA 2O2GA 1A8PA 3CX4A 3BTSA 3LX4A 4QYTA 2C3PA 2HNAA 1G8FA 1XF1A 3A7DA 1GDHA 5KOHB 2OMEA 2Q2QA 1XFDA 1SNYA 2IEAA 3PQEA 4R9RA 2CT8A 3WOVA 5AIAA 4N6OA 3EE6A 3HL4A 2WSLA 3ANLA 3W4IA 2H8KA 4EK9A 2BELA 2OO5C 3HKBB 3E03A 4W7SA 3C0KA 4GP7A 4F8JA 4UVGA 4Q1DA 2CHVA 3UA3A 1S2LA 2AEMA 1QRAA 1A27A 1QK3A 4EHNA 5AJTA 1OBFO 2I5PO 1VL6A 2NYUA 1DC6A 1X14A 1GNQA 2WKWA 1VRVA 5ALOA 5DN9A 2XCLA 3SC6A 3MYYA 5TXGA 3UM9A 1WU7A 4E1BA 1KR2A 1JTFA 4ES6A 1LBSA 1NN0A 2AB0A 3KZOA 5B1YA 3KCQA 4AJEA 4D42A 5BN5A 3JALB 5KTRA 2UZ4A 1VCNA 2CV1A 1TCAA 4X7BA 4EDFA 2VNHA 4W9NA 4N9QA 1NI3A 5KJEA 1ETHA 1CJKC 4RIGA 2N1BA 1M6HA 2DH6A 2GN6A 2A35A 2XY4A 3G7UA 3M49A 5DX1A 5ITSA 1G4AE 2JIBA 2VNAA 4B4OA 3KJIA 4J0HA 1SOVA 3PGLA 1ORVA 3ZK7A 3PE3A 4GPBA 3DLHA 3VH3A 1PT6A 4KK3A 4GVLA 1IHXA 1UOEA 4E4TA 4P08A 1MO2A 4I4IA 2FFHA 2GBPA 4BATA 4GZMA 3P4UA 3E8XA 3NAZA 1C9EA 3T3HA 4GS5A 3BORA 3PGXA 3TW6A 1O87A 2QD4A 5K7SA 4Y2YA 1I01A 4R9VA 4NCKA 4Y67A 1GLVA 2CUKA 5ALFA 2G07A 1H4SA 1JXMA 1UZLA 2Y93A 1BD4A 2WABA 3DOUA 4FYVA 4WFJA 3NTLA 3RJZA 1I7QB 5EUBA 4FFPA 3SD7A 4Q3AA 5GMOA 3WK5A 3DCIA 4LBYA 3OU7A 3NCHA 1KTVA 3H6GA 3DVQX 3I6YA 1SUIA 3OQ6A 2VWGA 3T7EA 2AFIB 1Y7IA 3OTWA 2WFMA 1J8DA 4HXGA 1O08A 5D2CA 4BTLA 3ZVNA 4F3NA 2ECFA 1KNQA 3IEMA 1G16A 4B7CA 2O8CA 3GEHA 4WVFA 2HQSA 3ZEIA 1VMIA 5FI1B 5LM3A 4JI0B 4QL3A 2R7AA 2FMTA 2WICA 2R2AA 2GD0A 1BH2A 1DOZA 3SOPA 2GYVA 2A7QA 2H2GA 1U8YA 3O2SB 5EZSA 1FCJA 1X7ZA 3DXFA 4DJJA 3A4LA 3W1EA 5AXAA 5JJBA 4CRWB 1A8IA 2IC5A 4ERNA 1VIDA 3CF4A 1E9RA 1AIPA 2NM0A 3HXPA 3OKCA 2FKNA 2NVWA 3NASA 4RY2A 3OIWA 3KP1A 3UJNA 3VHXA 3QG5A 4JFAA 4NH4A 1VSQA 2EIXA 4QE3A 4TWZA 4Y98A 4AF6A 3U44A 4PS1A 3ASZA 1O5OA 1C8VB 1E3IA 3GYGA 4BE7B 1ICIA 2VF8A 3C6BA 4FOOA 4YEDA 1H85A 5J5AA 5JO0A 4BY9E 3NC1C 1C1XA 3SKVA 3K96A 3HI6A 1PHRA 3BMQA 4DQ0A 4EEKA 4WW0A 1BCSA 1YACA 5BVGA 5CUQA 3PRJA 5JJ5A 3TQCA 2XYHA 1GUYA 3FZYA 1DKQA 4EJMA 2OUIA 3NHMA 4IR7A 3GLGA 1T9CA 1UBKS 4MQ6A 3ISJA 4JWTA 3G5UA 3NHRA 2HSJA 1W5TA 3DE1X 3WYAA 1WDKA 3E3OA 4LWQA 1UDBA 2BSQA 4O4IB 2JB9A 2FW6A 3ZZTA 5LXTA 1M1YB 3FOWA 3EX7C 1H9CA 1WHSA 1XWFA 2FN4A 1QJCA 2XZTA 1WL8A 4QC2A 1BGXT 2PRKA 5JXJA 2DQ4A 3GCZA 2G17A 1Z6TA 3LT4A 1RWPA 3KXDA 2H2AA 3WNQA 3GXBA 1E18A 3M1AA 1TK2A 2ZRNA 4G5SA 3HRIA 1R1DA 4G0PA 3TLGA 3FLBA 2VNSA 5I8PA 4Q3DA 2J0EA 2PXXA 2WUGA 1JHMA 4LMRA 3TS1A 4FYJA 1GD1O 1XJCA 2WUVA 1CT9A 1H2YA 1WAMA 3QWAA 3UY4A 4B7AA 4YV0A 2EW1A 1T1IA 1QZUA 4K2HA 3RS3A 4GXQA 4NJMB 1DC5A 4MJXA 1CUIA 1CF2O 1BDHA 4DG8A 1AB6A 1L7EA 2FXIA 1X9IA 3BMXA 3WKDA 4CT0A 5JI3E 3EVNA 1VJ1A 3QUCA 4C89A 3C3WA 3OEEA 5I5EA 2PRIA 2F3RA 3FCYA 1ECGA 4B7ZA 2GJKA 2I4OA 5CT6A 4RMNA 5EE9A 1O5IA 5CD9A 3INTA 4ZCPA 1ADJA 4J75A 3RRYA 2X0JA 1L5WA 5DHTA 2OBNA 3EXG1 3B38A 1EK6A 3ESZA 2H1OA 1Q7RA 1NLZA 2LTAA 4EYSA 3E4DA 3EUAA 3IDOA 5HJ2A 2CJFA 4UM9B 2W6CX 4KITB 4GLFA 5ITZB 1Y7LA 4F9EA 5A5VA 1MW8X 1E6WA 4M9UA 1R4MB 1EHCA 2NO7A 1RAFA 3LBFA 2HIMA 2FK7A 5SZIA 1G66A 3GP8A 4TMXA 2CDAA 1DIOB 3TX6A 2KE5A 2JAWA 5L3QB 2RIPA 3HLKA 1NW9B 1OZ0A 2EEZA 3JQAA 4LWPA 4RGQA 5FYDA 2YVLA 3TR6A 4D57A 4DTIA 1SVSA 1WXXA 1XQ6A 3DO8A 4MEBA 1JL3A 1S8AA 1U8EA 2EP8A 2VTEA 4QQRA 4RCYA 2OILA 4Q9KA 3X1WA 2GR9A 3JYOA 2O2EA 3D8BA 3GQVA 4MR7B 4NBUA 3OPVA 4JYBA 3V4ZA 3PC7A 4A2WA 7REQB 4PZCA 2J6CA 5AJXA 1S8NA 2E1RA 2XF8A 4JEUA 1GZ6A 2CXPA 2GERA 3QFHA 4YJGA 3DOEA 5EHGA 4ZT2A 1DG9A 4TWJA 4DWOA 1QX4A 3THYA 1QP4A 3QVJA 1FQKA 3DBLB 2D2XA 1AF4A 4NNPA 2QVXX 5FJJA 2J9GA 5DN6D 3VPAA 1ACLA 4G1FA 5FRDA 2NYVA 5DTQA 1Y9DA 5JNRA 1UDWA 4W9NC 2OD9A 2PMEA 1KQNA 2VN8A 3GOQA 1QYRA 3WMGA 2O52A 2I91A 4D4LA 4EEXA 3F6CA 3T4EA 5EWJB 1ZOIA 1ADGA 2GEFA 4CTJA 1YBAA 4QWMA 4NENA 5A4AA 1PGPA 5DGIA 1MKYA 2H2DA 1N5LA 3PICA 4IVPA 4QUAA 4GP6A 4LOAA 4WQMA 1IONA 2HSEA 3LGXA 2AN4A 3WRXA 5A1TA 2G1AA 4CETA 4HWRA 1ZJ6A 1ZITA 2ZUTA 4KYUA 2VZLA 2OYRA 1N9KA 2HU2A 1K8ZB 2OKCA 2C99A 2NZUG 3E9EA 4IMJB 1GARA 1GPWB 1K0FA 3I83A 3ZGNA 2HWYA 4MQ5A 1XJWA 4D0LB 1Y42X 1ZCBA 3OTGA 3PG5A 4HS9A 4E5MA 1MJGA 1TKAA 2IHJA 3HB0A 2NPFA 4CIXA 4YR9A 3SVTA 4NSNA 5THKA 3EIFA 2LCIA 3Q12A 4KI7A 3E1GA 4CU5A 1XMVA 3ETDA 1XMQB 3EBLA 4A0GA 3WGNA 4EJ0A 3ORRA 4HR7A 4P0QB 3EQ6A 1EDZA 1FS4A 1VPLA 3INGA 3O8QA 4QQNA 4D4IA 4HLUC 3LXUX 1O89A 3FH0A 3R6GA 3FMGA 4N5MA 2NUAB 3QTBA 4KH1A 1UMDB 2JFQA 2G9ZA 3HHPA 5F4BA 2QN1A 4LGMA 1QONA 1TZJA 4W1RA 4KZPA 2PMDA 1DKUA 3KTDA 3UJ8A 1J22A 3MOIA 1L5ZA 4FC6A 4MS3A 6REQB 4E15A 4G1CA 4ENWA 2XLCA 4BQOA 4R8KA 1T13A 4KQ9A 4I50B 4Q05A 3WGOA 1FP6A 4OOEA 3W77A 3MMSA 4TUYA 4CCSA 3KD3A 5ALGA 4E51A 5FWXB 3ZIAD 1L9XA 4EHIA 1KYVA 3N2NA 5TR9A 1MVNA 3FAZA 4REQB 4Y30A 5KREA 1IN5A 2X6RA 1E3DA 2FKAA 2DBVO 4TV8F 5IH3A 9LDBA 4XD2A 4DDUA 2XCSB 4NCNA 4GNKA 4QPDA 3T52A 2Q0QA 4DIDA 3RI3A 4LEIA 3HGQA 3BS4A 3B48A 3W5IA 2BM1A 3AY3A 1QFXA 1DQZA 4LRXA 4KR7A 2BDUA 1J2UA 2J4FA 1Z0KA 1U4OA 3DKRA 1KY2A 3EGDA 5BYJA 2CXOA 2DLCX 1K75A 1C7JA 3CLSC 3THRA 5AVZA 1TPZA 3ZVKA 2FEOA 3UTDA 7MHTA 4IV5A 1U63A 3F3SA 2QLLA 2ZYGA 4H59A 4YALA 2DX7A 4KL8S 1VDMA 2GLTA 5SYMA 4ENUA 3JQ8A 2MU1A 2ARKA 1VJGA 4EW2A 2MSWA 4GMHA 1G59A 2F1IA 2ZITA 5B58C 1XCPA 3DFFA 1Z4OA 2YL2A 1Z73A 3A9RA 3AIMA 1WCYA 4L51A 2QVYX 1ECPA 1D2RA 3A9WA 2YRWA 2WWIA 4KN9S 3R4CA 3M1IA 4CTKA 3I1IA 5D3KA 1MOQA 4ZRNA 1K9SA 1ZH6A 3WGJA 1M1XB 2ZSEA 1MA0A 1UBHS 3D2AA 4YGYA 4N65A 4GOMD 3KJFA 1SXGA 1MX9A 4GKAA 1T5SA 2I6TA 2Q6KA 1KAHA 2PM8A 3E48A 3IP3A 3NFRA 4B8YA 1VSUA 1G8GA 2XUZA 2FLWA 3LRTA 2OA0A 5K2OA 1T8RA 3C6QA 4TYMA 3VSEA 1AS0A 4M7RA 1L4FA 1B42A 1SCBA 1O57A 2RHBA 2WB4A 2PSEA 3GA5A 2BEUA 1UH5A 3K1ZA 3VI3B 4EHKA 2D7JA 1UJBA 1YZFA 4BRWA 4YY3B 2B4YA 4L5AA 3LK7A 4IDNA 4I4NA 3ZWBA 1LPAB 3TI7A 2QZ9A 1BEUB 1WHTA 4HUQB 4W5HA 3B7GA 4O4LA 1IK6A 1WPQA 5EKUA 2SCUB 1W8DA 3HBFA 4DKJA 3MS4A 5FBHA 3BXPA 3FHOA 1M6VA 2H00A 4D9NA 4JA0A 4KAJA 5ADHA 2CL0X 1FMCA 5LMNB 1SM4A 1NXQA 3O8BA 4OB6A 3TTVA 3IA2A 1TF2A 2B3TA 1BXRA 4CUKA 1FX0B 4B3CA 4L28A 3CZMA 2XMPA 1ISSA 3FKQA 4KUHA 1QQBA 5DX0A 3MFYA 2CMDA 1DINA 2QTCA 8ATCA 3P2IA 4M7PA 4IG4A 2Z2IA 4WKCA 2OPHA 5LZ4A 5WRFA 4BNDA 5J2UF 5LNK6 4RNCA 4HPXB 1YS1X 1LF0A 1AHNA 1XMIA 1PIWA 5HR5A 2YX1A 2DCMA 2GJ8A 4FT2A 4KAAA 4G2TA 4AI6A 3GG9A 3D3EA 5EXSA 3DLIA 2CWDA 5IVIA 3SDZA 1M34E 2XOEA 5HUQA 3K20A 3QV1A 3WE7A 1Q7GA 2EQAA 1T8TA 2VJOA 3DV2A 1FS6A 3M6UA 4WFKA 3W5UA 4X90A 5FTJA 5GIPE 3KVYA 4NMWA 2Q29A 1HDRA 1C7IA 1QLJA 2RHWA 2CEKA 2XQFA 1U9ZA 4GPD1 3RQIA 4D3ZA 5JCJA 1KS9A 1LJLA 1QG4A 4Y2QA 1Y1RA 2E49A 3DZDA 5EOVA 2VTBB 1EWYA 3DBRA 3HDGA 3IC5A 5AJHA 3HGMA 4C76A 5ES3A 2XGGA 1E6CA 4Q3OA 4Q3BA 3LYUA 2G63A 2IEYA 3K9CA 2M1ZA 4YAWA 3AKEA 4LAFA 5BN4B 5C3UA 2GN8A 1MJNA 2Q1XA 1VLVA 3AHJA 4O2BB 3V7YA 3S8EA 3DEHA 2HNKA 4NEHB 1JHUA 1PR1A 3IBSA 4IOLA 4MQFB 2QMOA 2XA9A 4NK4A 3DNMA 3A31A 4MYUA 4DE5A 5JZ9A 3BTOA 3CG0A 1EXWA 4EF5A 4ZOBA 3V42A 3BJMA 4F5WA 1NXWA 1ZH8A 2QTHA 4MGIR 5JQGF 3DUWA 4QYXA 4L4ZA 1SIWA 4R7ZA 2QYHA 5D3MA 2JGNA 4URZR 1KMNA 2Q3HA 4V3BA 1NJGA 5DHUA 2AA3A 1SBTA 3KTAA 4QEDA 2PXAA 4MVJI 5EJAA 4HCJA 4I3GA 3WMEA 5JW6A 2FE4A 5AJYA 4RV4A 1IY9A 1VSBA 4XB2A 2XT9A 4EI2A 1GQ2A 4EUKA 5K0BA 4WOCA 2GLUA 3UJDA 1PYDA 1P1JA 3WMXA 3NO4A 1ZUD1 2DF8A 4RK0A 9LDTA 5DSXA 3F8SA 2QL5A 1J39A 3KZXA 4ZGWA 2UDPA 4WSOA 5CAEB 1IQRA 1CULC 3M9WA 4JLMA 5AHXA 2OYSA 3L05A 2NIPA 1LFAA 2O2SA 1ZXXA 1G21A 1E5LA 1WR8A 2AF3C 1I3MA 5C7YA 4IKPA 1I0LA 1KZ7B 2ZRKA 1UIRA 3OAAD 1HE1C 2WWXA 4ZAZA 3BK7A 2AXQA 1FA9A 4YYEA 4R2MA 2OB2A 4FGSA 3MS7A 3CWQA 1BGVA 5TGTA 1C7RA 2FUEA 3IHLA 4AWAA 4UFNA 3O4IA 3HRHA 1KDOA 3FHCB 4AROA 1S3SA 3NT2A 4EUSA 3SVZA 4ZK2A 3WDMA 1CUHA 3H04A 5CCEA 4F4CA 3CR3C 1B6SA 4DUGA 1T8UA 1XXHB 3CNQS 5F64A 5FNVF 5JYDA 2O7QA 4U02A 2CV0A 4GDFA 1ZIDA 1V3UA 5EN4A 3WWPA 2IFTA 1R8QA 3ISTA 1MPXA 4NCIA 1R4NB 2HDHA 5A0TA 4HAVA 2VG8A 4UPDA 3WNVA 3FMPB 4J4TA 3ND6A 4PICA 4W1SA 1N3IA 4PC6A 1AZLA 1ORRA 2C59A 2AZXA 3I92A 2G77B 3T7CA 3EXAA 3CVOA 1BS9A 1TADA 2VDQB 2IYNA 1MX5A 1VIYA 3AO0B 2CUTA 3CPHA 3OT4A 4GYYA 3KJQA 5HUHA 5FI0B 4A36A 5T3UA 3GV0A 2DHCA 3E3LA 4B76A 3UIEA 5J4VA 1EVKA 4BGEA 1RBZA 4NS1A 2EV9A 5CD1A 4CXMA 1YQGA 1DRUA 1IHPA 2ZWMA 3KOUA 3MUEA 3OO1A 4KQFA 1GOTA 2C3MA 4P7GA 5GM2A 4FFWA 4J1NA 1KFEB 1YASA 2AJ8A 1UWCA 4IGEA 2EFGA 3OQ1A 3OPYA 1PYOA 3FYTA 2AQHA 4Z4HA 1GCUA 3B6IA 3LD9A 4C0BA 3PXXA 3K8YA 2QTGA 4KXNA 4BQEA 4EVQA 4MPRA 4NPCA 4JOBA 3OZXA 1T9KA 2D13A 5DOVA 1KWKA 2JJ2D 4P83A 3E2MA 4BJHB 3K5WA 3IVXA 2E4YA 5HG0A 2C5HA 5BYAA 2XB4A 5CT5A 2C9DA 2YWGA 2ZU6A 3R6DA 5AOVA 3VKGA 4GC9A 1X1CA 3BD7A 5UKDA 2NUTB 3VYTB 1YIAA 2YZGA 4EPYA 5IULC 4MS3B 3UGQA 6REQA 1QC5A 4LY6A 1RI2A 2WJ4A 1M8FA 1USVA 4OM8A 4PGAA 4R9UC 3EEOA 4QUBA 3SR0A 2FSPA 1JHAA 2FPXA 1EYZA 3K6KA 4YRNA 1T4GA 3LNTA 3GT3A 5E7QA 4K40A 5FA6A 3TVYA 4I6JA 1VC2A 4DLNA 3SE0A 5EXDA 5HZKA 3BQNB 3D7KA 4JLJA 4HEA1 4PU0A 2QYSA 2GESA 3SI7A 4C0HA 5JS8A 1FUUA 2PT6A 1M8JA 4IDPA 5U1PA 4DMMA 4AWXA 3BGVA 3KXLA 5T57A 3QBDA 4ZYLA 4LXYA 4O02B 2AEJA 3GAMA 2MYNA 2WYVA 3DEJA 4CYMA 4ARCA 4CODB 4JDPA 2EZ4A 1QFZA 3B2NA 5PGMA 1ENYA 5KYVA 4C0WA 1XZMA 1ZD4A 2WJGA 3E58A 3SZGA 4I55A 5IKPA 1VBMA 5NLLA 3FKJA 4EF6A 3Q7SA 4RD3A 2O4UX 2VUIB 4H0FA 1N1DA 1ADCA 1ZOPA 4PG7A 1YR3A 4RA9B 2FOLA 4MROA 4A27A 2HPHA 1PVDA 3L4BC 4RHEA 4WOPA 1D6JA 3LDAA 4EG4A 5B4UA 4ZQBA 3KSBC 3FBWA 4NENB 2D5BA 4I9HA 2Y71A 4IIJA 1G20E 4MAAA 2GJSA 3DL0A 3RAGA 1CYDA 3PDHA 3DOIA 5TE9A 3ELWA 3QPDA 1XB2A 1DNPA 2W7TA 4Q1AA 3BM5A 1FDIA 1IEXA 5DBOA 1H66A 4MUAA 4U63A 3V1YA 1AQLA 2JJ2A 5SZHB 4ZXFA 1I1HA 3SBOA 4NBKA 3LBNA 1RRFA 5ECGC 3GP5A 1TYCA 3NVAA 3MCWA 3M4XA 1ZR2A 4TMKA 2XMCA 4HAZA 5AK6A 3FOBA 4ZA2A 3B7PA 1Z18A 3U4CA 5K0FA 4BN5A 2W6NA 1YS9A 2BCGY 4G5YA 4MVJD 4QULA 3OCUA 5DT9A 1QIFA 4YCSA 4EB8A 1E2GA 3LFTA 4Y2GA 3U48A 4MR7A 4N9WA 2FOXA 4B9EA 3FRIA 5I4KA 4BN4A 4PM4A 1KU0A 3D8RA 5CCBA 1QXSA 4IJWA 3IALA 5FPPA 5BW5A 4LSWA 3WIBA 5BYKA 2Z0MA 3W5DA 5IF9A 3K1YA 4PTYA 1A69A 1GSIA 5F9HA 2CJWA 3NM4A 3HKDB 1KNXA 3KEOA 4N0DA 3RUIA 1AQUA 2QGNA 1TVMA 2ADOA 1CS4C 1EEXB 4FX2A 4NARA 3I9V1 4UM5A 3F98A 1T2AA 1TEZA 5BV7A 2E89A 3L5KA 4R3WA 2JBHA 3L7OA 1PSZA 3WLMA 4X7RA 1JILA 2JGJA 4L5CA 3Q8LA 3RLIA 4YJHA 3H18A 1OXVA 2ZYTX 3QVKA 5F7ZA 1A9ZA 4F3YA 2QOEA 1CUZA 1Z7WA 4FZ3A 4RO0A 4Z0TA 3U5TA 4R68A 3TUIC 5A7GA 5HKAA 1J23A 1F8XA 3TDNA 1JXOA 4C4SA 1AS3A 1MO3A 2FF7A 2FUG1 4B8ZA 2WZDA 2FG5A 4GQBA 4UKDA 5DNEA 3AVXA 2ZWPA 3KELA 2BFWA 1NRWA 2RK4A 1JT9A 2ZSKA 3NGMA 4I08A 5C52B 4NIMA 1GVNB 2D7DA 2ZB8A 1FFGA 2HXYA 1AKUA 4K9PA 1FEZA 5HK8A 3T9EA 2V8BA 2CN1A 5I9MA 4QVIA 1L4NA 4ZEWA 2BM0A 2FW0A 3G8CA 3R3XA 1RPZA 2ZJAA 4CUJA 1IBRA 4JB8A 2RDMA 4P38A 4IIVA 4M0MA 3KBBA 2I0FA 1HT0A 3GPBA 2Z1DA 3HB9A 3IEPA 5BWBA 1N25A 2VSXA 1P7ZA 3TKLA 3PEEA 2XVMA 4DCTA 4YQFA 1F2UB 1IZYA 5JG7A 2QTVB 1PJLA 3CY6A 4G25A 3KUKA 4KXUA 4FB5A 1LFDB 4JLKA 1RBMA 4FTWA 4Y1RB 1K7XB 1QYVA 3U9TA 2D0IA 2C84A 2C54A 5A71A 1ECCA 5ENDA 1ZPDA 4G9GA 1OSNA 3KV1A 1EE1A 3EULA 5JTTA 2FCAA 5BR8B 2YUIA 2ZYVX 1XKQA 4IHKA 2B1QA 5IAOA 1UKEA 2FQ1A 1ZIPA 1FFWA 2A5FA 2WJIA 3GMTA 4NFYA 2VYVA 3M89A 4OV6B 3EARA 3R2JA 1JAHA 4IS3A 4RM3A 5D86A 4Y3UA 5FI5A 4CCWA 4FM9A 1BCSB 4OYLA 4FYMA 2KMLA 2P6UA 2AWOA 2OHJA 3QTLA 4WNAB 5KX5B 2OAP1 3QNUA 3E9QA 4WASA 4X64B 4ASUD 1RKVA 2JAQA 2C95A 4JJKA 2OV4A 4PWYA 1FVOA 1DU4A 3WLSA 4EGJA 4PG8A 3KFLA 1G21B 4RY9A 5K01A 1NQVA 1T9GS 1NT4A 4DQXA 3R3VA 4D9EA 2GPWA 1K6IA 1Z0IA 2EKQA 2OORA 5K3EA 2QB5A 3E05A 5JPCA 1UOPA 1XR3A 4U2EA 3PL1A 1OWMA 3VM6A 1Q0LA 2IX9A 1TW3A 2RBGA 3A1WA 3FRJA 2R84A 2JIZD 3RU7A 3TQQA 6ADHA 1FSSA 4UAJA 1L5HA 4COKA 3PKIA 4V1CI 4JROA 3UMRA 3EVAA 3OPMA 4HGRA 1E0KA 5C8YF 4EARA 4RFSB 2ZSHA 1QHFA 4I1SA 3LXRA 1KJJA 4OCZA 5IFLA 2WJWA 5HGJA 3GBVA 3NDIA 1GL7A 2QP4A 5LFAA 1W75A 3C16C 5D3MB 1MV8A 1X1RA 2DFLA 2G72A 1P1CA 1C3OB 1JE1A 3EZ9A 3Q5DA 1TYDE 3IIMA 4GU5A 3DTNA 4JAVC 4GOJA 1BYIA 2B4AA 5F4ZA 1W93A 3GJ3A 1ESMA 2QL7A 5AM3A 4EQ6A 2B30A 3M4YA 4KUGA 2WQ6A 2DCUA 4Z5XA 4W5RA 2HK8A 1JBKA 3LWBA 2BGMA 4I1IA 1GPBA 4LIPD 1O54A 4MQFA 4YR7A 4ND5A 4WBNA 1VB3A 4NOMA 2GUGA 1ICEA 2EBUA 4E08A 3FYUB 1LV7A 2ADMA 1H2ZA 1US8B 3IRUA 4FOTA 2YQZA 4DC1A 4W63A 1X0XA 1MEJA 3I01M 3MN1A 5ICMA 3RSSA 2VK2A 4OKIA 2ZCVA 5LP6B 5JLAA 2W2KB 1RM5A 1IPHA 2DFKB 5H0IA 3WBKA 4X8HA 5DMHA 3NVMB 3IO5A 2SKCA 3T34A 2G1UA 3FB4A 3MG9A 1URPA 4MUNA 2ZR8A 4PLCA 4S24A 1XNGA 4B2YA 2C3YA 1DT3A 1K7EB 3CW9A 4JBGA 3IL2A 2AR7A 3CRZA 1ZIXA 1T1RA 5T6MA 2OB1A 3RHZA 1E4EA 5HYVA 2WWWA 1IN4A 3MAGA 4LWZA 5JECA 4XDZA 2QJWA 1Q95A 1F7VA 4ALMA 3O0DA 3ZC3A 3ILXA 1JIKA 5KZMB 3B3GA 4RTOA 2Y2UA 2W2PA 3GHHA 2HMSA 5FXMA 2FX3A 1RHKA 2GTPA 2OFXA 5CB6A 1A0OA 2YBEA 3NEAA 2GI4A 1WY5A 1RU3A 1ZCZA 3RYFB 5GV8A 4PBTA 3HKBA 1KMHA 1JLLA 1QZ3A 1D8AA 4TQUS 2QKYA 5EGSA 4FMPA 1FDVA 1V1RA 2X0RA 1S7GA 3BD9A 3KEMA 4OMUA 1L8AA 4OXIA 4YCLA 4JUIA 4CZ2A 1KOLA 3SHQA 3B1ZA 1AUXA 3NOQA 3C1TA 3AY6A 4WV3A 4QTYA 2I3AA 4LPKA 3O2JA 1EDDA 5DM70 1J9GA 1EJ0A 3PCRB 4PYMA 4WWHA 4N49A 3SF8A 1II8B 1JHQA 3BWBA 4Q21A 4PCVA 2ET6A 1X87A 4BQPA 4BQRA 3OJ0A 4W5WA 4RQAA 1KYZA 2ZREA 1J49A 4HUQA 1G9TA 5JXWA 1TRKA 1NTOA 1UIMA 5EWMA 4ZU3A 4FR2A 1ZJWA 1ODIA 2ICAA 1CYEA 3EZFA 4LXTA 3IILA 4UMVA 1HE5A 4FOLA 5BXYA 5TC4A 4CFZA 3MT8A 2NN3C 1HTBA 5JFTA 4FZ5A 4KQCA 3N7TA 1XLVA 3N74A 4Z86A 3VDQA 1SCAA 1EH5A 2JFGA 4E46A 5D3ZA 3WTBA 4MARA 4AMBA 1Y63A 3QELA 4N39A 3RSGA 5K99A 3CNNA 3V1UA 2FUCA 4HLQB 3SSNA 3HLTA 5JY1A 3FI9A 5HDQA 3ELBA 3F9RA 1LU9A 4G0ZA 5EHNA 3ZYZA 1IPFA 2EKZA 2J5BA 4YT5A 1D3AA 3OIGA 2HHAA 1TGYA 4MO2A 1YTUA 2BL4A 3L0YA 1YQTA 3A1NA 1BYUA 2B94A 4QQ8A 1JG6A 4OGKA 2WILA 1AKTA 5HJ7A 1DDGA 3ESXA 4AF8A 3GZTB 2WHQA 4GM0A 3ZX4A 1IOVA 1FRQA 1GG2A 5KQLA 4DBVO 1G3QA 2VK1A 1O94D 1WXIA 2FPRA 1MCZA 2FRVA 3I28A 5AM4A 1IEQA 5J58A 5K6TA 3BHNA 3D7LA 3OD5A 3QY9A 4NESA 4R2JA 3NUZA 1R0YA 1NVVR 1G7TA 2EDCA 3G8YA 3S2YA 1A04A 1XDSA 3T7TA 3DB2A 2CVOA 5LDDC 3U26A 2UXDB 3PFWO 4ZVRA 4AUNA 1K3TA 3E9YA 3HXKA 4IIXA 4G63A 2JFBA 3FFXA 4M36A 4MCHA 2XWBF 1RYMA 3O21A 1B0ZA 1V6CA 3GLUA 4F8EA 4LDPA 1YH3A 2GRJA 4NBVA 1A3CA 3KIPA 1WULS 4BV3A 4M9CA 1EP3B 1GO2A 1JS1X 4K88A 3C48A 3HQ4O 4QFDA 1R10A 4CKBA 4JT8A 4B44A 4DT1B 4H1HA 2D06A 3E22B 2EFCB 1KARA 1K7YA 2WPDA 4LXXA 3HO8A 4Z2YA 2F2TA 1X3LA 1YKGA 2JDIA 3WICA 1NU6A 3FPLA 1JQJC 1PT7A 4Q3CA 2W4QA 1BMFD 1OIXA 3ASUA 1FE8A 3TSAA 4BYGA 1JB9A 3ANSA 3GLHE 4A2QA 3QJGA 1NKTA 1CDZA 1S0UA 3WGVA 1U0RA 2HCBA 1OIVA 2XNJA 3DXYA 3G59A 1YNOA 2JHGA 1AT1A 3MCAA 1IHOA 4GSYA 2CNOA 4M88A 4EG1A 4YMLA 1YVUA 4RZHA 1W48A 3G1UA 5EHZA 1MHTA 1ZUHA 2EERA 2W8BA 3JVUA 4PC1A 3GVCA 2NVOA 1JHOA 3OE4A 3LQQA 5CJ2A 5HCIA 4DEYA 5LN1A 3IV9A 3M82A 2HWUA 4MWCA 1FTWA 4UBIA 3I0NA 2ZT8A 4XQ9A 4POOA 2WHYA 3SE7A 1IL0A 3GEGA 4YFYA 2IDJA 4IEEA 3FD8A 2QF7A 2J9ZB 3RC3A 4DR3B 4HB0A 1M2FA 1F8FA 1LPPA 3LT0A 1HDEA 3AEXA 3N8HA 4X61A 4LFBB 2R5WA 3UJPA 3EXEB 1M2GA 1PFKA 4ID9A 4B9AA 3HKEA 5L3RA 5KVAA 1AA6A 1FLVA 1GFWA 1NF9A 2WAOA 2XJ4A 5DYNA 3PEYA 1RC1A 2BSAA 2G7MC 2ATCA 5IHXA 4MGKR 5IMBA 2R8XA 2A5LA 1VP3A 3U6BA 4RXUA 1U7ZA 2O2YA 1FFXB 1EGVB 3PZBA 4UPVA 3NEYA 1BQ4A 4RQTA 1SU6A 2IJGX 3ZCRA 4MQMA 4BMOB 2R6JA 1EK2A 3TXXA 2OM6A 4KMMA 1ZIOA 5LP1A 5DE3A 4OYHA 5G1OA 3ZWKA 3ODPA 3PRYA 2P6RA 3U80A 3GLSA 2Q9BA 2VDOB 4G01B 4WXPA 4UQLA 1JFFB 4UVHA 3G0HA 3LQRA 3VYWA 4K26A 2FJPA 4F1JA 1UDCA 1YJ5A 4J49A 1HOXA 2A9PA 2WC1A 3R7WA 5LMCA 4AIRA 1VA5A 4MAFA 3HO6A 1LZLA 4X60A 4C04A 1KDYA 3V1LA 1LPOA 4M1QA 1OI7A 4U3JA 3FWZA 1EG2A 4RJTA 1TJ4A 1WXGA 3EEIA 1XMOB 4F4JA 3LYLA 4R98A 1P74A 1UMBB 5IJ0B 2LZ0A 3ZWXA 1FYFA 1H3EA 1BHJA 4XLLA 3RV4A 4WJZA 2R5FA 1FBTA 3GD5A 4NATA 3V97A 3ZWAA 4EHBA 4Z2AA 2C31A 1FXWA 2A8YA 1MNQA 1EFLA 1PE0A 4ZVQA 2YHIA 2IIVA 4Z9FA 5FH9A 5C0OE 1WMBA 5K0LA 4F71A 2Y0CA 4DQKA 3QEBZ 1W85B 2VHCA 3GEEA 5EUMA 3LY5A 1O94A 3SAJA 2BRUA 5LZ9A 1Q0UA 1YUMA 4IGIA 1EDBA 4EA9A 2LIVA 1HYHA 1XRJA 2G5CA 5AOBA 1T91A 2WG2A 4UNQA 2FEAA 3KWJA 4E4YA 1QIGA 3KU4A 1QGUA 1VYTA 1EUYA 2WWYA 3PEUA 2PRYA 4OLHA 3I34X 3GLIA 1JP7A 1FVFA 2X1LA 4RETA 1SQ5A 5K51A 3EFOA 4X45A 1EP1B 3KQLA 1ZHHA 1E69A 4NF2A 4Q9AA 3JQRA 3WO1A 3BKWA 4NBWA 3ZY3A 2E21A 4NZPA 4R4JA 1TQ4A 1VE7A 3ZJ4A 4QYWA 3E23A 5CT4A 2Y66A 1C4WA 2W2MA 3AY0A 3BRCA 1EXDA 3BGDA 4MVJA 3FFWA 2VR1A 4LZPA 4BU1A 3L7LA 3JRNA 4P4SA 2XV1A 5EZYF 1BMDA 3I3SR 2X8JA 3HCBA 1JAYA 2WLTA 2FE1A 2GHQA 1ZLYA 2C9OA 2PX8A 3AB7A 3PNBA 1DX6A 4IV0A 3KOYA 4ZD6A 2G04A 5ARBA 2V6GA 1JI3A 2VH1A 5AXDA 2MSDB 4U5XA 3AYZB 1ZRMA 1ZUNA 3GGJA 2F43B 4EA7A 3ND5A 2PKWA 3KKKA 2XB8A 3JVDA 3MWLA 3AP1A 4GPAA 4XYGA 5CGZA 1OH6A 3G8DA 3K70D 4WTOA 1FY2A 1O7JA 3EDOA 3HWRA 1ZJ5A 4AP6A 4WXEA 3IQXA 4YUZA 3B1XA 2XHZA 2J0UB 4GWLA 3GPIA 3NUQA 1V26A 3PCTA 4QEZA 4TN5A 2RH8A 5IJAA 1WO8A 1FMLA 1GWNA 4AULA 1GKIA 5DNAA 1UFOA 5G0UA 4D2IA 3LHSA 4MIOA 4M99A 3LC7O 3QHAA 4QEKA 3N2GB 1VYVA 4GECA 3OF3A 3OEHD 2IW3A 1ST2A 1BVRA 3PFNA 2AOTB 5DM0A 3F97A 5E1DA 2GAIA 4IMRA 1T0IA 1JKFA 3GFOA 5AH0A 2WZQA 2O7VA 1RWKA 5A04A 5JQGA 1U0FA 1YAJA 3ILSA 3OM0A 3WHPA 3U09A 4KSYA 3V4SA 4HDCA 2HXGA 1BKSB 2WIDA 5EQTA 1NQUA 4ASUA 1J24A 1V25A 2TMYA 4A4DA 1N75A 2BHRA 4BYMA 2FDCA 1M2NA 1U2DA 2IYEA 3ET5A 3ESAA 3JQ7B 4FFSA 4HTFB 1JQ3A 1Q0PA 4M8NE 1DXQA 1ORHA 4EQZA 1Q3TA 4FDMA 4R2WA 1VE9A 1CU1A 4BFUA 4D74A 3R0VA 5BMOA 1X3SA 5JAHA 2HWWA 3LQ2A 1QSGA 5JJCA 1BN7A 3N75A 3ZLVA 1AZSC 1YK1A 5BNZA 4RF3A 1O77A 2O59A 3SLKA 3V7NA 5IAEA 4NG4A 4C87A 2P5YA 2V7UA 4TTIA 3KXPA 4OIFA 2CBGA 3K9HA 4YRLA 2BMAA 5J1TB 4OLAA 4JA2A 2R8RA 2CVPA 3UGKA 1W35A 2BP7A 4PLTA 1NUQA 3T3MB 4TOIA 3EASA 2NPOA 1KAEA 2J0SA 5GV7A 3ZW8A 4IEIA 2PWYA 3WRVA 4EELA 1EQAA 2FFRA 3QE3A 3Q87B 5KVSA 5DDIP 4UOQA 4F6RA 3TE7A 3WHIA 2ZI4A 1E7QA 1M7BA 2OTCA 3LK6A 3V4OA 5CDHA 1U6KA 4XGRA 4DSNA 5LPNA 4YLEA 1ZEJA 3PXGA 4DLAA 4G0XA 3L0ZA 3ZGLA 5KOJA 3WFIA 1U9IC 5IYZA 3L8EA 4LYGA 3GEMA 3U49A 4NKRA 2FN7A 4KIFA 2G3YA 4IHJA 1TOAA 2EKLA 3GT0A 1M6NA 3K15A 4BB9A 3NJ4A 1Y5NA 3DOOA 5KTKA 3NH9A 2CSXA 1LBTA 1L7BA 4IDOA 5FBQB 3R9WA 1E5DA 4BFSA 2K7FA 1TQ6A 3LYAA 4I66A 4ZVKA 3PV0A 3U3DA 3GDHA 3AZQA 1COWD 2B98A 3D7SA 3QUQA 4K9LA 4KRYA 3JQBC 1R8XA 1A4XA 2CXXA 5FNVA 2GYWA 4QXQA 1ISFA 1JDVA 5AKIA 2P27A 2P2LA 3RC9A 1OFIA 2WFLA 4IOKA 4RPHA 2BKXA 4JY7A 1T0PA 4DB4A 3LE8A 3WLFA 2XUAA 3KOOA 4F2PA 1R50A 1S9DA 3V7WA 5FD8A 1C30B 2YWXA 2C3OA 3RRJA 4A15A 4HLCA 2XBUA 1YDHA 3OWHA 4JL6A 4UVDA 4V0ME 3ZHRA 4K46A 4YCMA 3H2IA 4YYZA 1IXKA 2PGXA 5JAQA 3P4XA 3DMNA 2NO5A 3TN7A 1UXHA 1CJCA 5INTA 1CJMA 1Z36A 2W37A 4DV7B 1YF3A 1G3UA 2DLDA 4HQFA 3QU2A 4K9MA 2PKXA 2JFFA 3RYCA 3N5CA 3KQYA 3ZCUA 1IMJA 4MRAA 2DXIA 2P5SA 5HUJA 5K6AA 1E5XA 2H54A 5ERXA 2NXEA 2QQ5A 2YRFA 3GDFA 4QU0A 5KOHA 1IZZA 3CU5A 5A4KA 2OV2A 3DMDA 4D02A 1Z17A 1CD5A 1JDUA 4QARA 1PNTA 4Q3KA 3L6CA 3WSWA 2AC4A 1GSOA 2I7TA 2QXTA 2RH5A 4ZAWA 5C4MA 4XSVA 1RLIA 1SELA 1GKUB 1SULA 2A1IA 4YAKA 1MB9A 3CHYA 5EMHA 2XOKA 1T34A 2CXUA 2UZ1B 2ZJ3A 3QY0A 4G4JA 4K9OA 5CP8A 5AK3A 5GVRA 4BZQA 1ZGJA 1MN6A 3E61A 2V7VA 3BJZA 2YFHA 4OBEA 1CJSA 2EJBA 2ZVJA 4P54A 4TLDA 1ISIA 1P5HA 4P7KA 4W9RA 3TPFA 1ZH0A 4BWYA 2JPDA 3QENA 3NVDA 4TXLA 4KLNA 3D8TA 4HGZA 3ABSB 4EO7A 1NAIA 1I2BA 3U1VA 3IAAA 4F4HA 3A1FA 4OHUA 1NNUA 4UHDA 2AZTA 3ASYA 1NW6A 2LIPA 4PIMA 3TFQA 1JSCA 3TI9A 3N8DA 1QZTA 5AW9A 1H4VB 1UF9A 5MN5A 4WVLA 4DSZA 1EJ2A 3WA6A 2PA3A 2QVGA 3KV3O 4OATA 4C7JA 4LVUA 3NEPX 3HHEA 1TJPB 1G2IA 3O6VA 4OL0A 3O1HB 4DR6B 2L18A 3TVTA 1S2DA 2J6IA 1VHLA 2AOVA 3AR5A 2VTKA 4FFLA 1TC1A 4ZT7A 2A9FA 2ID8A 4AZWA 4FHGA 3PUXA 4U0KA 3MVEA 3PUHA 3RJ9A 3THWB 1TKCA 1KEKA 2P68A 5K3FB 3OFNA 3TTYA 2D59A 5C8XA 4A7PA 1HYGA 3ID6C 3QMVA 4QBTA 1E2EA 3HBAA 3DR5A 1Q15A 3OPYI 3QF7A 5I9LA 1Z2EA 4LE1A 1RXCA 2QP3A 3NANA 3E3NA 1KC3A 3DTYA 2IEGA 1RXSA 3QPUA 3ZH9B 2IZ1A 1C50A 3TOVA 1MAHA 4W5NA 3ECCA 1P73A 1UKBA 3H2SA 2P9FA 1GRNA 5TQJA 3DQZA 3TDKA 4C3ZA 1W34A 1Z3IX 4HTAA 4NFSA 2XWQA 5B2ZA 1BU8A 2I2DA 3IV6A 2HC9A 2YRXA 1FPQA 1THMA 3FPFA 3VPHA 3ZTWA 4E30A 1OAKA 1YFJA 1XDDA 3KD2A 4FE7A 1E7MA 2QM8A 2QX7A 1QH1A 3CMMA 4HZUB 4G5HA 4NOLA 1UUFA 2REOA 3QVGA 4F5EA 2IH2A 2GEBA 2X5JO 4M9XA 4DAOA 4EW6A 5JCZA 2OK7A 3A25A 3FDZA 4ROSA 5IJWA 5CA1F 1IWOA 3DVLA 2GZHA 2OLKA 2QIPA 3D6JA 2JBAB 1HG1A 2O48X 2AMLA 4M60A 4MUGA 4Y6PA 1HR0B 4OQQA 3FDFA 4H17A 4JC8A 2CBXA 1VBFA 4HNQA 3UHFA 2XYVA 3IDZA 2XUIA 5EMMA 3D3JA 4CIAA 4KR3A 5DW3A 2IRWA 1R27A 4NV0A 1M2OA 1Z34A 2Q3FA 4CQLA 2JI6A 4OGGA 2GBGA 4B3FX 1QGOA 3NTOA 2TYSB 3WC4A 1G8JA 2QE6A 1WQ4A 2FWNA 2XH8A 4LSZA 2PX0A 3TZHA 3UK0A 5HS4A 4JBYA 1PLJA 3GIDA 4WXRA 4QSHA 1NKVA 4TRMA 1GTG1 4E5SA 4WT7A 3GRRA 2RBEA 1L5OA 1Q83A 3BGWA 4YRTA 4F2WA 4JB2A 1LDNA 3HDYA 1AM4D 4AWBA 2JIZA 3BILA 4I5IA 3PA8A 2VPWA 1C3LA 3FBTA 3GGOA 4PNEA 1M8KA 3IAFA 3L77A 4WXYB 4XLZA 5KNDA 1T0HB 4OK3A 1QYWA 4ROTA 3RADC 3D9QX 4BPBA 1E77A 1Y37A 2H51A 2ZKLA 1Q44A 3HK2A 1VLMA 3VNUA 3IPXA 2BFCA 2VT3A 4L07A 4OFXA 1PV2A 2PD3A 2H7YA 1LLQA 3DAHA 2H4YA 3KT8A 4CM3A 4CTMA 3EHDA 2PZFA 1IVYA 3S2EA 1JFLA 1RMQA 1MRNA 3AINA 2ZXUA 4QFBA 5D5PA 3THSA 3UWMA 2FSSA 2YJGA 3HGTA 3BQMB 4MPDA 5CB4F 4JLSA 3BB1A 1U81A 3GWGA 1UPFA 4MGEA 4OD0A 1GADO 2QEQA 1Y8RA 4ZPXA 2JFNA 1HE3A 5IH7A 4RVGA 2VHYA 4PFQA 1MVLA 5DYYA 1V37A 1QWSA 1GEEA 1P61B 3OCYA 4RZSA 2QZJA 3RU9A 5CXUA 3KL4A 4IS2A 4OYRA 4EFLA 4KFRA 4DDWA 1QP0A 1GSHA 1U8ZA 1HZJA 1XDZA 2QL9A 3PGKA 4FFBB 3WL4A 3CF2A 2NNWB 3ZY5A 4HEJA 3OPXA 3AL0C 3NHBA 5HJ5A 5JH7A 3I58A 1S1CA 3A9SA 5JJLA 1DE0A 2WSSA 4Z7QB 1H23A 4OMCA 4Q3EA 1Q20A 1OE0A 3WRWA 2JDID 3P2KA 3AVYA 3VNVA 4ZZ0A 1RQ2A 2MSKA 3FSEA 2X3FA 1T6XA 1XTRA 2F3QA 2X5XA 1V9LA 3BQ9A 2A0WA 1F8UA 5HTKA 3RRNA 3G6KA 4DDHA 1ND6A 4EY6A 1EFVB 1I2AA 1AQYA 1H0SA 2MINA 2EW8A 3CRRA 4WX2B 1T24A 4AMYA 1IG0A 1XDGA 3VQTA 3AFIA 5DIZA 2GYUA 1ZQ9A 2LDXA 3ZJUA 4PQEA 3DZIA 2NUBA 2BGTA 3SJAA 5ICFA 3AYXB 4BO5A 2Q8PA 4JLOA 3RKUA 1L9KA 2JI7A 2H9IA 3DUFB 3JWEA 3ZI7A 3KLBA 2WJJA 3T1YB 4A0FA 3DKIA 2HNBA 3A2MA 3K6RA 5IKOA 3OQOA 5I8WA 2ZU0C 3AFHA 3M3HA 2IP2A 4MRVA 1QS0A 5EWLA 4OQZA 3TNJA 3UHJA 1RLMA 2AE1A 2Z95A 1ISPA 1EWKA 3S2GA 4J2OA 3C6ZA 3LZ6A 1T5LA 1XYYA 2Q4BA 3RS0A 1DFHA 3ZD9A 2Q21A 5TNXA 1EUCA 1SKBA 1B0PA 4HX9A 1RQGA 3VTFA 4CTOA 3IODA 2GXUA 2SKDA 2A9JA 4JBNA 4DCUA 1YQWA 3BJRA 2GHRA 3L0IB 2ZSIA 2DTDA 3MTDA 4DSTA 2VSNA 1Z2CA 4EJSC 4YT8A 3L7CA 5B6IA 4GKVA 4PYIA 4EY5A 2R8PA 3JAWA 5AVWA 4EAAA 3DEIA 1X74A 1VIMA 2WD8A 1SXHA 3EMBA 4NL4H 4QBGB 4RABA 5DBEX 1H2HA 2GNPA 4G0UA 5LMZA 1SB9A 1BW9B 1E92A 4O5OA 3AESB 3O4GA 1Y6QA 2E85A 1B2LA 2QAGC 2GDZA 2YWRA 5EHIA 3GLHA 2DC1A 5EIHA 4CN9A 3T5AA 2HSDA 4B3IA 2Z58A 2PWBA 1W4CA 2OQVA 1NBEA 4R40A 1ZBQA 4RMJA 5CVVA 3VNQA 4AM8A 3MK31 3JQ6A 3OVMA 3Q0EA 1W2HA 3TNDA 4IQ0A 4A0SA 2B2CA 2GNOA 3K9QO 1VTKA 2G67A 3OA2A 4EX7A 1H2RS 2CW5A 1M66A 5FOQA 2JLYA 2GCGA 2ONCA 1F12A 4AJOA 2Z83A 3ORHA 1DWUA 1AQ6A 1QG6A 2FP3A 3UMMA 5FAKA 1FC0A 3T5CA 1X15A 3HVJA 1IZ9A 3KR1A 4CGZA 2P11A 1A9QA 5JS7A 3CVWA 2ZBQA 1F2TB 3LV8A 1YCHA 3SZ3A 5JROA 4LI3X 6LDHA 5C1BA 3QJ5A 4KNYA 1WU8A 3VR1A 1VE3A 2GN9A 4R5HA 1CS0A 1GGMA 4L0DA 3EXIA 2Q8QA 3WL6A 4F38A 5KYWA 4WZAB 1NHGA 3LTNC 1M2JA 1EVJA 1P91A 2V03A 3E1KA 3IDSA 4PY2A 4KW7A 4R0NA 3UAZA 3D02A 5FAXA 3K70C 1MQ9A 2C9ZA 3AXTA 5FWDA 5HNKA 5FBWB 1LW7A 4XM0A 1GZ4A 1X94A 3EWSA 3OMLA 1E89A 4MDEA 2DHRA 3S81A 2J3IA 3T61A 3HJFA 2ERYA 2HU7A 3BUSA 3E9DA 4MHOA 2OD2A 4C9BA 2Z5LA 1BX0A 4DEVA 2ZR7A 2A9RA 4R7TA 2GAAA 1ZICA 5MF6A 4BKUA 3B6EA 2FPPB 2F1RA 3P9RA 1HRDA 3I2IA 1WEKA 2LUOA 3HCFA 3RC2A 1FDSA 3AF6A 1I30A 3CSUA 3K0FB 5CTAA 1X38A 5A02A 1X1SA 3DAYA 4NG5A 3L93A 2JFYA 4EHHA 3OU6A 1KMQA 4H77A 2VRNA 1XU4A 1POWA 3OIYA 1C0LA 1HGXA 4FU0A 4AQDA 4X1KB 1XTIA 3W05A 1XBTA 2I6QA 1MTZA 4MEJA 4D1YA 1HE8B 2ZJ2A 4L6IA 4QODA 4WKPA 3K32A 1R6UA 3RKSA 3W5BA 1O9HA 1PJ2A 2XT6A 4DVGA 4ZK6A 2ZUUA 2J59A 3QPVA 2WA2A 2O4CA 4Q02A 4GUDA 4JH0A 2G28A 1OH5A 4ERXA 1XL0A 5G3YA 1KVUA 3H2KA 3U19A 3KT0A 3L6EA 1KI9A 4BMPB 2XI4A 1LBQA 1GHTA 1EGQA 1ADYA 4PG4A 4D0SA 2HRQA 4CLRB 2IGTA 1N9GA 5CLLA 2ZRHA 4ZP1A 4D56A 3V9PA 1ZI9A 3K31A 4RJIA 4DLXA 4JHLA 1I0ZA 3IT2A 1HNXB 4BNHA 1X70A 2EEPA 4Z6KA 2H1SA 4GSKA 4BJ5A 5JH7B 3HUEA 3ZLUA 3R9XB 2JLUA 3D3KA 2EYQA 3LUCA 4XH9B 3K72B 3B6JA 4H3VA 2XMGA 5AW1A 2YN4A 4MGHA 1OI4A 2C2YA 1CUSA 4UM7A 3EWIA 4XYMA 5F1PA 1M5TA 3HKCA 1JHXA 4IWXA 3U0VA 3GRFA 5IEBA 4QOFA 2PV7A 4DC9A 4U5QA 5FFNA 1D0IA 1Y33E 3NHUA 3PHHA 4MVJE 5FTMA 3LGSA 2OBYA 5FT9A 1AO0A 1E8DA 1PK7A 3TRFA 4HWPA 3W78A 1RKQA 3AUKA 3CF4G 4GE3A 1FNCA 1LC0A 1NLMA 3NBKA 4NULA 4Q3NA 4WFQA 3I76A 4YHBA 4DB2A 2BEWA 2FSVC 5B4VA 1E2PA 2A9KA 2A30A 3ZG6A 4ZQHA 4KREA 3R9IA 1KPIA 3SZOA 4BUJA 1ST3A 3SP1A 4TYNA 1KBOA 2FHPA 1M10A 1NE7A 1U0OC 2ZPUA 2FY8A 5KI6A 4LJYA 4HZIA 3GUVA 4DLVA 3UW1A 2X4IA 3EVGA 3FSRA 1CV2A 2OZLB 1QIMA 2YJTD 2ZYSA 3A05A 3B8EA 5EJ5A 4GVPA 4UULA 4WOKA 4HXYA 1NOJA 3FUTA 5IT0A 1P3Y1 1GGVA 4Z0PA 3UWPA 1MV5A 3TMAA 1PG0A 4FN5A 3L9XA 4BNMA 4FXOA 2FQWA 3LM8A 3O94A 1WQ3A 3TAHA 3L46A 3WGTA 3VPDA 2R68A 1N3BA 4O25A 5DYTA 4AN1A 1OA1A 4D3SA 2EX1A 3EVFA 2W70A 4EOGA 1X7XB 2W11A 5H8WA 2ZRJA 2Q41A 3OPNA 4ZCRA 1GGHA 2NT3A 3B8HA 1QHHA 3H0EA 3KS9A 1YULA 2J85A 4C7BA 1SB8A 4K9QA 5KQSA 4CLRA 3DEFA 4RHXA 3K5HA 3WLQA 4C3OB 2DMRA 4KGXA 2ZRLA 1RLJA 2A1TS 2DE0X 4TPKA 3T41A 2JJMA 3DKVA 4ECAA 2R6HA 4Q39A 4BIMA 1PK8A 4FFNA 2WFZA 4L4UA 5TF0A 1HLFA 1NUAA 3NYRA 2Y1FA 3NALA 3HWWA 1R3UA 3ZUGA 5AICA 3ES9A 2EZUA 3MW8A 3JPWA 3RG2A 3EPLA 3S29A 4ZYUA 1SA0A 4NYJR 4AAYA 1I7NA 4BE9A 3RS5A 1QG2A 3EAGA 3AJEA 4C4XA 4DR4B 4JOQA 4KN5A 5IANA 1DHRA 1UODA 2HMYB 1OKKA 1YQDA 4I5DA 2O1EA 4LUCA 4PZYA 3TH5A 1PW5A 1EX1A 1KVSA 2ZDGA 4O5AA 3NNNA 4B7UA 4O4JF 4Y7CA 2QI9C 2IHZA 5T3YA 5K3BA 1X80B 4CIDA 4CFYA 4ZYZA 1EUQA 4U7GA 2HWXA 3RSHA 1PJ8A 3P2OA 2OMKA 3BE4A 2ZGVA 1BXGB 1E3QA 2ANCA 4WCFA 2WIBA 4BECA 5BRAA 5L6MB 1P0CA 3HZHA 1IEVA 2WLSA 3MGGA 1UT8A 4Q4HA 2W9XA 3QOXA 4MR8A 3NTXA 4F3CA 2OCAA 1YUNA 4F6LA 3RE1A 3FDJA 3M6WA 1J99A 4MYDA 2ZI7A 4XQCA 2X2OA 3QKRB 3KQUA 3VPXA 5ALQA 5KTTA 3HE3A 2F67A 1P19A 2VRBA 2A5JA 3I6BA 3URMA 4P8RA 3CEAA 1AGPA 4OA8A 3ZWPA 4DWWA 1L3BA 2ZB4A 4KXXA 1DX4A 1WMSA 4OHRA 4LK2A 2ZRMA 3EIWA 3UOAB 1C3XA 2WIJA 3F6PA 5IZCC 4AYWA 5FWNA 2J67A 4KLZA 1MAAA 4LWOA 4KNWA 2ZAIA 1K4MA 1TCVA 1P6UA 1FDTA 3AFMA 2G9VA 4KE8A 3ZGXA 2GCNA 5LQMA 2CZGA 4EB6B 4GX1A 3R3SA 4KPEC 5DHSA 1XQWA 2IIBA 1XCMA 5I3CA 3ZD8A 2VDKB 3B12A 5K0TA 3RTCA 4YRZA 1LWOA 1QHEA 2PSDA 2VXBA 5ECYA 3UFXB 1TXGA 4MV0A 3EVZA 1MQ8B 1JR4A 1N3LA 5DHPA 4EJFA 1PQPA 2R6CA 1NDQA 5I7SA 1OLXA 2D8MA 3P9NA 4PPQA 1DBRA 4V0MA 3VPGA 4KPUA 4AP9A 3DBOB 4XDGA 3R41A 4PSDA 4B3BA 2OBXA 3HUUA 1TVEA 4O29A 3HDQA 1PJCA 4HBGA 5HMMA 3ZHCA 3GNQA 5C31A 1T4CB 4MS1B 1RPTA 3QK7A 2DUUA 2WDZA 4OUDB 1ML4A 5CX1B 3WL8A 5ADVA 2FZEA 2YY7A 1KYTA 2FN9A 3GX1A 2KBEA 4WECA 2PWAA 1YI0A 5DRYA 2YDYA 2Z4RA 4KVGA 3RODA 1KEUA 4I8DA 4Y7DA 1PWZA 1JR3D 2QDKA 3SS9X 3WLNA 5HILA 3K9BA 2AG5A 3EYWA 1U0GA 2R00C 3D6NB 4NYIQ 2WWHA 5IUNC 1ZMRA 4C4RA 1BFDA 4AJIA 1QK5A 4BNJA 4ZKEA 3T95A 1E59A 4O2LA 3EPHA 4DANA 1KTIA 1EWQA 1LEHA 3FMVA 4C0XA 1KXZA 2GNAA 3AXSA 4NFHA 5I45A 5JLJA 4OGLA 4FGUA 4MV1A 4URXR 4FYHA 3GFVA 2DHDA 4KKXB 1F60A 2N9UA 3E0QA 3KHTA 5A4FS 3Q2OA 1G7RA 4RDIA 3SEAA 3OLXA 4YQZA 1B26A 1MDBA 1QGYA 3DMFA 1W76A 3VNRA 4FZRA 2NVUB 5BQ5A 2ZBUA 3N2LA 1AQNA 4OBWA 2P62A 1OREA 1XFAA 3H5OA 3NI2A 4QXRA 1KAOA 5EP3A 3KKOA 1ZK0A 5EJGA 4L3OA 1NW7A 2YIJA 5JNTA 4KE9A 2GZAA 4JXXA 3FDXA 4ZQFA 3H9BA 2OCIA 4FSDA 5FFFA 3NV9A 2XXAB 2YHIB 1UKCA 1CEQA 3ETNA 5DI3B 2CXNA 4D96A 4E6EA 1SKYB 3GLIE 1L7XA 2YTZA 3L6BA 3P0IA 2AYYA 1OPXA 4BO7A 2DTEA 2FHSA 3D43A 3I9KA 1UFQA 5EA2A 5JEEA 2JHCA 1V7CA 3NHWA 4LFCB 4FK8A 4L2IA 4IUYA 1WZCA 4JC4A 3FPCA 3U4GA 1N6OA 3GIWA 3R6LA 1RAHA 3R3HA 1J8QA 1GT6A 4V1CB 2JI9A 1XT6A 2QTAA 1QWOA 4GLOA 1PEYA 1U1FA 3PUVA 5J5VA 4CF3A 5J47A 2W6IA 2QX8A 4QA9A 1QTNA 5C9ZA 1OYOA 1XTUA 2NZXA 1HETA 1XEXB 2I87A 1JFFA 2ZJ8A 3DWEX 3HJRA 2IIPA 1Y3CE 4MKFA 4N40A 3SU8A 4LY0A 2AQKA 4PAMA 3T5DA 3V8EA 1OMOA 3B2QA 3KR9A 3OJEA 4U0JA 3EF0A 3ODGA 2R6DA 1JJIA 1I9GA 3B9QA 4MQUA 4ZYTA 5KNCA 4PLPA 2VOJA 1LDEA 5HZMA 1E1RA 1YR2A 3PX2A 3W0LB 1TU0A 1U94A 4Z53A 3VFDA 1Q1QA 1KYYA 4U7JA 3SC4A 2DWUA 4ZMSA 4BC1A 3ICOA 2VP5A 1Q19A 3DR3A 4L8VA 2BI4A 5A5FA 2WJPA 4TL8A 4LOIA 4ENQA 1SUSA 1ZGHA 4NXNB 3LSTA 3MERA 4G07A 4BV2A 5E3JA 5JU6A 1H2FA 1MW9X 1NU8A 2JKYA 3ITDA 1MXHA 1G6HA 2PX3A 4TTAA 4ZARA 2DBYA 2JIRA 1XO1A 2R6GA 3FOAA 4AZ0B 1GV0A 1DPFA 4MYCA 1GRCA 3HSYA 5KPJA 4HPWA 4TKUA 3KHUA 3WK9A 1NIJA 1KHTA 4G85A 4GI1A 5DHRA 1L2TA 3H7IA 4MW7A 3AFGA 5I01A 2C4NA 1RI3A 2FJUA 3NIBA 5FA5A 2B9VA 2VJCA 3EWAA 3QLEA 6AT1A 4YWJA 3VO8A 1UJNA 4B43A 4Q18A 1NNLA 1D5CA 1ORTA 4INZA 3RW9A 1DUVG 5E6UB 3IJRA 2AD5A 4IO1A 1Z15A 1KQPA 4NE7A 4AX8A 3B1FA 3DKPA 4V0QA 1PTKA 2V9CA 1I24A 2BTOA 1RWNA 3EIOA 4FDTA 4W82A 5A4MS 3FOCA 3QVGB 4FQ7A 3UW3A 2YBDA 3LPCA 5CVTA 5ADWA 4HMOA 1YMVA 3D7MA 5DGCA 3LKDA 2A5GA 4XQEA 3K35A 4I6GA 1HT1E 3WYBA 3ITNA 4LDRA 1CUEA 1L1RA 1XVIA 2B34A 2OSBA 1FQOA 4CF5A 4ZOCA 3DYIA 3N2IA 4B83A 4GOXA 4D9BA 1DBSA 3HY6A 3RRBA 1B15A 3SXPA 5JD4A 1NM5A 4BO4A 1J42A 1GQOA 4IDEA 5BSUA 1Q21A 4I1OA 4JT2A 4ED9A 2HDOA 4F93B 2OENG 1XTZA 1FVHA 2DM6A 4WN9A 3HBMA 3KWFA 4TQAA 4WESA 5H9WA 1OROA 2AXPA 1UDRA 3PGJA 3WRYC 2R4UA 1ZAYA 1GU7A 3Q7QA 4JEIA 5ALTA 1VPTA 2IYYA 3QMWA 1Y5RA 2WWTA 1YDFA 1QV6A 4Y2UA 5H5JA 2FFAA 1T6YA 4YONB 4DMKA 2P2GA 3NYIA 1KPHA 3FAKA 2PGNA 3VO2A 3H2JA 8ADHA 1J9ZA 2QHXA 3ADPA 1OZFA 3AR6A 3M34A 1WMFA 2FLKA 3QU4A 1DMRA 1F6WA 1W5BA 5ELXA 1KI1A 4QU9A 2WNSA 3FWYA 4R8LA 1IXZA 1SBQA 1J0AA 4G4GA 3S4YA 4CM8B 1NW3A 4LRSB 3UH1A 1QPGA 2FW9A 2PU5A 4ZCTA 3WQQA 1A5TA 4QT4A 1CJTC 1A5SB 3PEFA 4Y6OA 1YS2X 3N70A 1AN0A 1TX4B 4G09A 3ED5A 1GGKA 4QTXA 4HVLA 2FR8A 3OCJA 1ADBA 3PHJA 3H9UA 5A6SA 1Q7BA 1VYHA 4KMOA 3TSZA 4MWEA 4WADA 1JTVA 2W4MA 1NRXA 1S9HA 4IH1A 5JRDS 4MWTA 2FRXA 4G37A 4MICA 5AHWA 3JQGA 2OC9A 4KLRA 5BNFA 2BPOA 4B6GA 1SOMA 1SG9A 4Q4CA 3EPJA 1KBQA 2P40A 2H6EA 3E53A 4HGNA 4UARA 1N2ZA 1BXZA 4NE2A 2IXTA 4FCTA 3B6MA 4URWR 2Z9CA 3KLNA 1MD9A 3KFVA 4Q19A 4ZV4A 5CA0F 3KKNA 2AT1A 4ER6A 3NP9A 2QLMA 1ZWKA 1HDYA 3CVJA 3HBJA 1MG5A 5CFPA 5C5IA 2WA1A 3SM3A 1X7YA 1BDMA 1XX6A 2HJRA 1FRFS 1T15A 1Q77A 3QYPA 4JEMA 5E8RA 2SICE 1PVOA 3SF8B 1E2HA 4MUBA 1JXQA 3IDQA 5B6PA 1T1EA 1NXTA 1JH8A