4IYJA

Crystal structure of a putative acylhydrolase (bacuni_03406) from bacteroides uniformis atcc 8492 at 1.37 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
211
structure length
211
Chain Sequence
b'SDAQKQDWGNLKRYAEANKELVRKGKQKDRVVFMGNSITEGWVANDAAFFEDNGYVGRGIGGQTSSHFLLRFREDVIKLAPALVVINAGTNDIAENAGAYNEEYTFGNIVSMVELARANKIKVILTSVLPAAAFGWNPSVKDAPQKIMQLNARIRKYAQENKIPYVDYYSEMVEGDNKALNSSYTRDGVHPTLEGYKVMEALIKKAIDKVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDSL-like protein
molecule tags Hydrolase
source organism Bacteroides uniformis
publication title Crystal structure of a putative acylhydrolase (BACUNI_03406) from Bacteroides uniformis ATCC 8492 at 1.37 A resolution
rcsb
total genus 73
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4iyjA00
1VJGA 4XVHA 2WAOA 4NRDA 4Q9AA 5B5SA 1Z8HA 1IVNA 4PPYA 1FXWF 4I8IA 4H08A 4JJ6A 3DCIA 4IYJA 1WABA 4K9SA 4RSHA 1ESEA 4JGGA 4DEVA 3MILA 1YZFA 1BWRA 1ESDA 2WABA 4JJ4A 2W9XA 1VYHA 3DC7A 1U8UA 1ESCA 4HYQA 1BWPA 3BZWA 1DEOA 3DT8A 4K40A 3DT6A 5HOEA 4JKOA 3C1UA 1DEXA 1V2GA 3W7VA 5BN1A 3KVNA 2APJA 1JRLA 4OAOA 4JHLA 5A4AA 4RW0A 3SLRA 1BWQA 3HP4A 2HSJA 2VPTA 1ES9A 1PP4A 3RJTA 4LHSA 2Q0SA 4HF7A 5CD9A 3P94A 4K7JA 4M8KA 4Q7QA 5JD3A 4K3UA 2WAAA 1J00A 4TX1A 4OAPA 1K7CA 1FXWA 2Q0QA 4S1PA 3DT9A 3U37A 1ZMBA 2O14A 3PT5A 3SKVA
chains in the Genus database with same CATH superfamily
1N0IA 3AUSA 1Z25A 5DVZA 1DB3A 3A9RA 4HNUA 4QJBA 4DR2B 1XAJA 1Z2DA 4TXHA 4JX8A 4MKIA 2FN3A 4Z1OA 1EUQA 1ENZA 2QUJA 4JMPA 4XW2A 5EXTA 5IC6A 1YRYE 1SOAA 1DAEA 2P6UA 4LZNA 1NULA 4FGKA 1EX9A 5YASA 4ND8B 4A03A 2VKQA 1VA5A 4EQ6A 4YX9A 3I83A 2Z83A 1WSBA 1YCGA 5JQGA 3AZOA 4G01B 1GQQA 1XLTA 1VE1A 2HU2A 2Q5CA 2C7BA 2G76A 2YW2A 1LD3A 3FUXA 1M1UA 3T34A 1PS8A 4H15A 4JXXA 4CM4B 2FRVA 4CEJB 4NCJA 1FRVA 2HU7A 5LIPA 4Z1MA 4POAA 4F4IA 1XTPA 3G2JA 4FR0A 4JI2B 2B1RA 3KQVA 2OR3A 4MAMA 4ZCIA 3ZZUA 3GGSA 1YMVA 4PXYA 5T3YA 2ISQA 1TKRA 2WABA 1U9IC 4LECA 1FU4A 2JBAB 1OBHA 5ARCA 4A6DA 4MKRA 1KP2A 3B8EA 5DOZA 1DCFA 4YJGA 4IXNA 4IHAA 1EHCA 1ZBDA 5B2FA 1FNCA 1U28A 4DTCA 2OVBA 2PGIA 2C77A 2D0OB 1BWPA 2ZR0A 4IVQA 1KAQA 4NFLA 4QT0A 2EQBA 1JZSA 3AETB 4BU0A 3UMSA 2GUWA 2EZUA 5HF6A 1WETA 3CGWA 5GJCA 1GNRA 1ZPDA 2HI0A 1PL6A 2R4QA 4H7HA 4Y2SA 5JXHA 4R8MA 4B09A 5FTLA 3JTMA 2A14A 3N2EA 4QZVA 4MS4B 5L3SA 2F4VB 1M7HA 4LF8B 1E92A 1BRTA 2ZBEA 3GJ3A 3STUA 5IJXA 1Q7CA 2AC2A 3OY2A 4LV5B 3FCYA 1BXRB 1JBKA 3WK7A 3BMCA 3DVAB 1EUCB 1QRRA 5CX1B 2XD9A 1C3XA 2QL6A 4TMTA 2R6AA 1NSYA 2YMQA 4MWZA 1YRQA 4EF4A 1CUSA 5CGZA 3AGPA 5DYYA 2ZULA 1SH7A 4MQEA 1QIGA 3PNVA 1OXMA 3L7OA 5GINE 1XZDA 1JR6A 4ZYLA 3H05A 2V03A 3F5FA 4PRKA 1SHLA 3CZAA 2ATCA 1GUZA 3A6DA 3ANTA 1Z22A 2IGBA 1JG1A 1JLSA 1K86A 3CLRC 1E5VA 2HA5A 3HJCA 2RGNA 3ZVRA 2ZTLA 4CM5A 1EZ4A 2RHDA 4DNFA 1ZM4A 4EGSA 3R6WA 4OQLA 2QG9A 3ZHBA 4R0NA 2ZJFA 3VBCA 2YQZA 1DTWA 2W90A 3ZLUA 2BCEA 5K99A 1HRKA 4R0MA 3EVFA 4Q7JB 1NBWB 3JD3A 5G53C 4EMUA 2IOFK 4CKCB 3C5WP 2BHSA 3LA8A 4TS3A 5EERA 3U5ZB 2JZOA 2V45A 4H16A 4QO7A 3RBXA 4AF8A 4EG3A 3EVDA 3MNFA 4Q7EA 5BNFA 3QVTA 4ACBA 3T3MB 1LNSA 4AJ1A 4DV6B 1G4UR 5TDHA 5FULA 1YRLA 3LC1O 4JNKA 3RC3A 1TTQB 1U8CB 1ZJ4A 3CNLA 3CZ4A 4JUAA 2EDAA 4H7FA 4EVQA 4UUQA 4IDHA 5DSTA 4J91A 1SKQA 4YV1A 3V48A 4DSZA 3CNOA 4NNOA 4D8UA 1Q7RA 1U4NA 1UADA 4HX2A 1HZZA 4FBMA 1IL0A 1WMFA 3FTDA 2WA2A 4KSCA 3ZV6A 4B3FX 1EUZA 1QLJA 1A8UA 4HH4A 1US8A 4MV7A 4AVYA 3M6LA 1DJMA 2I3DA 4UAGA 4OFWA 4Q3NA 4MHOA 4MYDA 1KFEB 4IINA 4OXXA 4JJKA 1IJEA 5JYCA 4MRRA 2CYAA 1C8LA 1GL7A 1MQAA 1J2JA 2O2JA 3ANSA 1XPOA 3EISA 2I4LA 1YDFA 2ZI6A 3OFJA 1SUEA 4H9GA 3RNOA 2Z6UA 3FG9A 2RHBA 4YRAA 5HBGA 4FZ3A 1Y7IA 3BWEA 2C5AA 2V58A 3IILA 3M2PA 4NONA 4P33A 2I2DA 5DISB 4D4MA 1STOA 3V1UA 3S2EA 1X1SA 5G3YA 2ZUUA 4HGYA 1WXFA 1M34B 3MSCA 1GCUA 1L4KA 3O73A 3PR1A 3NTOA 2OILA 4OQPA 2X5KO 4Q1BA 4XJSA 5AI4A 5JFGA 3FE2A 3FN4A 1WPRA 2WJZB 4CM9A 3AH8A 4ZHQA 2IXEA 1GL3A 3ETGA 1E96A 5AUOB 4NZOA 1PV1A 1U1GA 2KYRA 3JVDA 1G4HA 3ZCTA 1JXOA 4ZI7B 3IULA 1KU6A 3EBPA 4FFMA 4RZ2A 4EA7A 1XP5A 3PLAE 4R05A 3JQ9A 4KX5A 1IAQA 1W93A 1T4CA 4HFJA 5D7BA 1PUJA 2RHJA 5AJUA 5BMVB 4G09A 4DDTA 2JS7A 2X5OA 3CB2A 5F2NA 3W5CA 1B23P 2F43A 2J3MA 4W8OA 4EYOA 2ZIWB 3DP9A 1AB5A 2G67A 4ER7A 3OQJA 2BEKA 1MJNA 1MQSA 2NO1A 3T9EA 5DEIA 4I6GA 5A1TA 5EXXA 4OHYA 1RC0A 4GX2A 4TVOA 1E2PA 2IUTA 1FZQA 2Q9CA 2PT6A 4BO8A 4CLDA 1SCAA 1NBIA 3QFSA 4XD7D 5H16A 2ZIGA 4GPEA 4S1VA 3ZDQA 3BB3A 2ZJOA 1L5RA 2P2YA 4KXQA 2OHHA 1P8AA 1XRSB 3QLJA 2WC1A 2Z30A 4P31A 1NG9A 1MC4A 3A28A 3HLYA 4UTRA 2WFZA 5IMSA 3EEIA 2PT5A 2VDJA 4N3GA 1OE0A 3WB9A 3ZCRA 1SRQA 1F38A 1NXPA 1T5DX 2DHDA 4I99A 4YP9A 1QRUA 5IM4F 1V3QE 4HDRA 5DYIA 1DXYA 3KOXA 4TTIA 4D45A 4AQ7A 2YS6A 2DFPA 5FNVA 1C80A 3D0KA 1G0NA 4FN4A 4US2R 2QL9A 4ZT4A 3PGA1 2LKDA 3U3KA 4DV1B 3THXB 4X00A 1QIHA 4P35A 4W5HA 1I4WA 2KW5A 1E2GA 1ABBA 4FWIB 1U8ZA 3T5TA 1OZFA 4PGMA 1UJCA 3KCNA 4A82A 2YHSA 1KGSA 3DMTC 1SCNE 2VF7A 2XYPA 4YALA 4D9NA 4E09A 5KSZA 5B4UA 4HQLA 5FAKA 5DW3A 3IPLA 3L8CA 3VZRA 1NMSA 2BE7A 5HRUA 4IG9A 1KE1A 3KLOA 2W58A 3RU9A 1IZ7A 1IJKA 1I7NA 1RPTA 3OFND 4S35A 2RKBA 1QR6A 2QTHA 1V1JA 1X6VA 1M5RA 4LFBB 1GAQA 4Q7LA 1GRNA 2AWOA 3SAJA 2GTPA 1NQ5A 1ZOPA 4ZGGA 1SA0A 3L0SA 4RIFA 4XYEA 1ADBA 3R3YA 4LQLA 1EP2B 4O4JF 4II2A 2R85A 1KYXA 5K3OA 2RGAA 4CCYA 4NECA 5IRCD 1CTQA 3L6OO 3URMA 4QVIA 1YJ8A 3BL8A 4DA7A 3DR5A 3U7EB 1JUDA 3MYRA 3H7IA 3GEIA 1UEXC 3O91A 4IYJA 5IC4A 3V2UA 5HFAA 5EP4A 1X0XA 1KI8A 5TEWA 1C7JA 4P3NA 1J0EA 2ORYA 1ISHA 3QYFA 3Q3CA 4YIKA 1HMPA 4N3CA 1QTRA 5F1YA 2W37A 3ORFA 3OZCA 3DYBA 2X1MA 5D1HA 3GCZA 3IAM1 3KSDO 3DV0A 3FPSA 4MYHA 1AIPA 3LZCA 3E4DA 3S2YA 1W48A 2FRDA 2PL1A 2QWXA 2XGOA 3K4QA 5GQSA 5MN4A 4J3NA 2C4HA 1AY0A 2W2LA 2HYIC 4NARA 4KQHA 4UQPA 2BKVA 3U7IA 2WJWA 3UC9A 2GZMA 4ZVQA 3ZE0B 3WYBA 4JLUA 2KE5A 2FX5A 1SURA 3RKSA 4EMSA 2IP1A 4DVGA 4CQJA 5A4MS 4G86A 1K63A 1OMOA 3RO7A 3BTVA 4IMIB 2GFQA 1PYDA 2I65A 4KYIB 3A6PC 1ZKMA 2O0MA 3RG8A 4WFQA 3JPYA 3P0EA 1WXEA 4PWYA 5DHTA 2NX2A 4ZREA 1G16A 1C7IA 3RKUA 3TTVA 3DZFA 3Q7QA 5KBYA 2FW0A 3H99A 3DMGA 1FTYA 1MRSA 1XRJA 4LXTA 1Y3FE 1XI2A 3KYJB 1JDBB 2EOAA 4MAAA 5E4TA 4AZWA 1KEEB 2H4ZA 3GJRA 3HXLA 2ZTMA 4CM8A 2GD0A 4I7EA 5LMNB 2XRFA 3AEUA 2OM6A 4TKZA 4F38A 1AMOA 4BO7A 5DFAA 2VT2A 5TGTA 4TVSA 1ECFA 4HUQA 1R27A 1NYRA 1OX4A 2V3VA 3PDCA 4B75A 3UT0A 3IDFA 3IOEA 4CI0B 3TB6A 2R7NA 3FFAA 4MS3B 5FO0A 2JLYA 5AJXA 3S4YA 3CUWA 4R40A 4OLAA 4KSBA 1FNNA 1KR2A 2GXUA 4J76A 4GE3A 1Y80A 2VLBA 3E9CA 1QVVA 3EE6A 1PN3A 3P5SA 2POCA 4LVUA 1JSZA 1KARA 3Q2KA 3QE3A 4KLAA 2AN4A 2QQ5A 2WIKA 3LNTA 2IV3A 3WG9A 1Y3DE 5IM5A 3S7ZA 4RQTA 2FDXA 1H0HA 1MZVA 3ELBA 4Q47A 1X9IA 2Q0SA 1QYXA 5IBPA 2XWSA 2IUYA 4L22A 4FW8A 2ZRNA 4KO1S 4BKUA 1IHOA 4LJLA 3DBLA 4Z4IA 2DULA 3H5OA 1DAMA 2IZ6A 4HWPA 3O83A 5IJ0A 1Z18A 1VMDA 5TVGA 3JQGB 4MVJM 3UC5A 4BTLA 4CV0A 4CKWA 2GBGA 5JD3A 3TZ6A 3BN3A 3AJ8A 2J67A 4C3UA 4O1MA 1U0HC 6CHYA 3EGIA 4P7KA 5D5QA 2H9IA 1N3YA 2EFJA 3E5HA 3CLVA 3PPWA 3W3AD 5C5CA 3O9ZA 2G04A 4LY0A 4U4AA 4RF4A 4C6SA 3W06A 1BQEA 4UEJA 1Z08A 2OD7A 4GMXA 4OAQA 4H17A 4ZDWA 5FEUA 4PYNA 2QXUA 3QPAA 1BC5A 1GSIA 1DPFA 1MJGA 2C5SA 3QG5A 2EW2A 3LQ4A 5CNIA 5BPFA 1V7QA 3IKMB 2O14A 4F8EA 4EG6A 2R0QC 3OM1A 1Q11A 1J24A 1YD7A 2NZJA 3PNYA 1KO1A 1YI8A 4LK3A 4ASUD 1GTVA 3SXUB 2PV7A 4CLEA 1EFTA 1UZLA 3LDFA 3CEAA 2JAHA 3QE4A 4ZVNA 2OGUA 4BJHB 2RHGB 4WCDA 3ZXUB 4EGCB 4QXMA 1RRPA 1WHSA 2QTMA 1XFDA 1GSOA 2J3IA 3G8CA 4LPSA 1T36A 2I66A 1FSZA 1NW9B 4LGCA 4QATA 3PIRA 5ALKA 3EWSA 2CK3D 4BZPA 4CDMA 2DFTA 3VNVA 4ZT7A 1FE8A 3EGWA 2B0CA 1ZJJA 4TLDA 3ZBUA 1T2DA 3MJFA 4KAJA 4YHBA 3QLVC 2C2OA 2CJXA 3CFYA 3EGXA 3QYAA 2JIZA 2J7PD 4CU2A 1G55A 3D5QA 2RB4A 4OOEA 4B4WA 4ALNA 3BXHA 3EH1A 1PT5A 4F9FA 4KXWA 2ZFUA 3JXEA 3DE7X 4M8NE 5HEKA 2VJNA 2O8EB 5BV2P 3KPJA 1HQCA 4Q9KA 1Z39A 1F48A 4TTRA 2N42A 3HXTA 4US1R 5B1IA 3TDMA 1N33B 3K9NA 4BNWA 1QH8A 3AWDA 3OA2A 2ZUSA 4K6HA 3I37X 5F77A 3GJTA 5COBA 1FEZA 3CG0A 3H5NA 3TYXA 4KLRA 4DLYA 1QG4A 4FFNA 4GGMX 2QYOA 4LBVA 5CYOA 5K3AA 3M4XA 2O8DA 1V7PC 4KVAA 3UJPA 1ZUNA 2JLCA 3ICCA 3RVQA 2OHIA 2CJYA 1C8VB 4RABA 1G9XA 2XQJA 4CN8A 1Y1LA 3DDWA 3JD2A 2BMVA 3EAQA 4KTVE 2ERXA 2WD7A 2GAJA 5CLHA 4HR7A 4JJ7A 5KYYB 1KIMA 2GO1A 4NK5A 4Q1CA 3S2ZA 1TB4A 4G0ZA 4I1VA 4O5AA 5BSUA 4O0LA 4LCEA 1WD7A 2XVAA 4O2BB 4K2HA 3THRA 5C32A 2ZBGA 2APJA 2C9DA 2GYWA 2NV0A 3O8LA 4QOJA 1RCFA 3BD8A 3L7KA 3DGFC 3PYMA 3OWOA 3N2ZB 3ZWAA 3F6SA 1UWVA 3GQBA 3CN7A 4CL0A 1Y63A 2ZIFA 2Y4OA 3QELA 4LXGA 1Y0BA 1V1RB 5KZMB 4QYIA 4RKWA 1A82A 4QUAA 1LV8A 4E70A 1DQYA 5JQGF 1F20A 1C1DB 1C2TA 1DAFA 1DBVO 1J0BA 1OI2A 1JDUA 3FCCA 4X94A 3SZUA 1AF4A 1C3EA 1K2VN 5EHZA 1IIRA 3HFJA 1JFRA 1GAWA 3FIUA 3L9XA 4MUJA 4YXWA 1JV2B 3ME5A 2PBLA 4CFSA 2NLOA 1GEGA 4O2RA 5FT9A 1NY6A 1TU0A 2XGJA 1D1TA 1MC8A 4B5LA 3NGLA 1PDWA 1DKNA 3LT0A 3PWZA 1JJVA 2QTZA 1WV0A 4QU5A 3F7MA 3RGGA 3MHPA 5BPHA 3NHBA 4BLVA 4MNTA 3O9MA 3GHYA 1F7VA 2ZJ4A 4FMCB 1BG6A 1YHNA 1QC5B 1KHHA 3CUUA 4GE0A 5DHQA 1KAHA 2PZBA 1SK8A 4KNWA 1D8AA 4RFSB 2OZPA 3LVQE 5E7IA 1E9RA 3EEQA 1W94A 4KO4S 2JCSA 2VYVA 3LF2A 1YQ9A 3BMCB 4QFDA 1R0RE 2FHSA 1N5OX 3ESCA 2R6HA 1O9BA 4XRGA 4C7OB 5D00A 4F6RB 1TUBB 2BISA 2IEZA 5FI3A 1Z0IA 2AKAB 3MTBA 3CZ5A 3ZQ6A 1ECBA 1SCJA 1MRZA 4NL4H 4DLAA 4RAOA 4BY9E 4GL4A 3W4KA 1LBEA 3K0HA 3ZUGA 4EVRA 2DHQA 1R50A 5JLAA 3B6EA 2G1PA 4MJXA 3W4JA 2L18A 3N5KA 4QODA 4UNSA 1EVQA 1IBKB 1IZZA 3ROPA 4YIHA 2NUTB 2QVXX 2VF8A 2E2WA 2ZVQX 4HTFA 3I30X 2CMDA 3UTDA 4B4VA 4BNYA 4WXEA 3AB7A 4W9NC 4YDRA 1BFKA 1E2EA 1POWA 4RD1A 1DVRA 1U94A 1HYQA 2B5WA 3AG6A 3E7FA 1AKTA 4DLWA 1Z73A 2QN8A 3UMMA 4OHUA 5D2CA 3OFVA 1U5CA 4UNPA 5FNVF 3OLQA 1T4BA 3TGLA 3JSAA 4IKOA 3Q7RA 4RZXA 3GNLA 1XU7A 4GVPA 3AKEA 4H18A 4KLZA 3SM3A 1ZCZA 2P77A 2HFKA 2WWGA 2CUNA 4G5HA 2C9BA 4IMJB 5DYWA 1CK4A 2PXHA 4J2OA 3TUJC 1ND6A 3ZHRA 1Q21A 1WAMA 4C7XA 1N6PA 1T2UA 2QY6A 2FSVA 2YW9A 5EZSA 1MN6A 3MM4A 3OZRA 5FORA 5C8YA 2CL6X 1JDJA 2KI5A 5JJBA 2AOWA 3FHOA 3MQ2A 1BW9B 4BQSA 2HK9A 2P35A 3TD6A 1ZQ9A 2RHWA 3F49S 3SR4A 3RAFC 3RVBA 1EFKA 1YS4A 1XMVA 5CVEA 4Z0PA 4FUTA 2FMTA 2CY0A 3KOZA 2RMKA 1X8XA 1UC4B 2OMKA 1MO6A 2ICAA 1RKVA 4E4TA 5I8PA 2X7XA 2ZYAA 4UHEA 3EXEA 2R6ZA 3NNDA 1GPKA 1S4MA 4DA6A 1K98A 5FPPA 3LLVA 2OQIA 3I9V6 3R23A 2FJPA 5E4FA 3V4OA 4E5SA 1RCTE 1QLWA 4J0HA 5K8IA 1FYFA 4U2BA 1EWTA 2ZIZA 3K30A 1SMKA 2HB6A 2HUPA 4KCGA 1JEEA 1II0A 1L7XA 2LIPA 4L75A 1QQ6A 4QLAA 4RSRA 4WX2B 1KYYA 1V9SA 1DO2A 1NKTA 2WHEA 3DZIA 4B6RA 1OWOA 2AG5A 4WZAA 3IJEB 1OPXA 2IDMA 4PFKA 4MVJA 1A2OA 5DM0A 2D7JA 5GJBA 3K0AB 4Z9FA 4QXRA 1PZNA 2CKDA 2XUQA 3CH6A 1RT9A 1ZJWA 5EEHA 4XE5A 4BB5A 3EXIB 4DLUA 1RYZA 1GRQA 4ENSA 1IEQA 2HDWA 3JAWB 3A06A 2H6EA 2GPSA 2BRUC 2QMUA 1SAYA 4Z3DA 3OU2A 1Z4QA 2AEMA 4HDMB 3P5BA 4JP5A 1GZ3A 4TX1A 3INRA 3KQYA 5AR1A 3W5AA 1B3BA 2E1RA 4IWXA 1ML4A 2QOEA 3HTXA 4JJZA 5E9WA 1KZ1A 3BSWA 2ZROA 3WMWA 4YPFA 1X9HA 2HKIA 2PG3A 4HDSA 4HO1X 5KTTA 1OB5A 4MQ5A 4AMUA 1GM5A 1WY7A 3SQLA 3VH1A 1Z2OX 2BM9A 1T5LA 4OO3A 4G5GA 3TCNA 3TI9A 4A5OA 1P1FA 2ZYIA 5HM6A 5LQRA 2NUBA 3MJCA 5AI8A 4HWOA 2HV9A 2C1XA 3G1UA 3QU2A 4MGEA 4YCNA 4LE1A 4PCUA 4R8KA 2Q3HA 2XTJA 3CUVA 1T9DA 2M6RA 3HHPA 1KQNA 3W8DA 1HDOA 3SR0A 3GZNA 3DE0X 3CTPA 4BNDA 2R6DA 3NANA 3TSOA 3TNLA 4JB2A 3RHSA 4KVGA 2B4YA 4YV2A 1WV1A 1DWUA 3DGEC 4QNMA 3OT5A 4HUQB 4G67A 5JC8A 3BM5A 4V3CA 3AESA 1YWGO 2CNOA 2TMKA 2I3BA 3PUVA 3PUHA 1OFUA 3C3JA 3P52A 3DVAA 3K9CA 1OZGA 1M6EX 5LXTA 2G63A 4HBGA 1FDIA 4KW7A 3U4HA 1T5SA 5A9TA 1R8YA 2PWBA 4N39A 4BRZA 3U5TA 4XDHA 3NC0C 1JEQA 3R2JA 4M76B 5EP2A 4RH0A 1ANKA 3JQ6A 3BTOA 3OWHA 4P5EA 2ZRAA 4E51A 3W0LB 2NSDA 3O4HA 2QDXA 5BQPA 4ZXPA 1SN7A 2UZ1A 2FE1A 2XKKA 2QW1A 3CBGA 1JFVA 4MAFA 5JQWA 3X1MA 3ITNA 2NG1A 1PS0A 4F5WA 3Q8LA 4FHZA 3T8YA 2WKSA 4YJ3F 1KP9A 2PLRA 4AF7A 1H69A 2OZLB 4OI0A 5LZ8A 5K8LA 1FS5A 2Q5QA 3FPEA 1ILEA 5EMMA 3BOSA 1SQSA 2B0JA 4YUYA 4W5WA 2IZOA 5FP0A 2FPIA 1ICEA 1EQUA 2D1QA 3OCUA 3HSKA 3A1SA 1YGPA 2QRNA 1MP0A 1Y9EA 2XKAA 3U7JA 5JOQA 3L02A 1Z6GA 2WWHA 3FLAA 4EO4A 3GLFA 4Z6KA 3B1ZA 3F5QA 1GUFA 2XZPA 4IJUA 2QT9A 4N8EA 1JJIA 1E1YA 1CZHA 1PR1A 3GGCA 3I5MA 4I4TF 4RZHA 3RV3A 1JA0A 3PNMA 4JLWA 4CM4A 3U16A 1XU9A 5KWEA 2IYFA 1B8OA 3NONA 4B4OA 1YDHA 2VH2A 4C4RA 4KI7A 3O3MB 4H6WA 4Q93A 3B9QA 2J0EA 2QL5A 3IEPA 5JNWA 3KSBC 1LBQA 2VDUE 3NP7A 3KHTA 2FPPB 4FBGA 1QK5A 2JPDA 3RSCA 2CV0A 3AIOA 3RPEA 3CSUA 3S1AA 1DRUA 3OEHA 4X85A 3PFKA 3WX0A 3KT8A 5IDYA 3AF4A 3VR5D 2B6NA 4FDAA 3VI4B 4YCSA 5JBQA 2V9CA 2P4EA 4CKZA 4F5DA 4CNBA 1HNWB 2G83A 5F3RA 5J58A 5DNAA 3CU5A 3SZLA 4XAQA 1Z4OA 4LQCA 1EE1A 5L51A 1U3DA 1ISSA 5CHEA 5DGHA 3V4VB 4EZEA 4Q1DA 5A6SA 2W2LD 2CFSA 3KB2A 4EVIA 5IT5A 1RQRA 1MFZA 3OE1A 3AUTA 3L5OA 1RLJA 3CKKA 3LC7O 3PQFA 5DI3A 1UIMA 1DKOA 4DZZA 2GPBA 1KGDA 1LPMA 1RWVA 4M0KA 3L8GA 4E12A 1E8DA 3E15A 5C8ZA 3ASUA 1XWIA 4BUCA 3NW9A 4X3OA 1PHRA 4YGXB 5BSKA 1IRIA 1ZMBA 4FJ0A 4L5YA 4L3VA 2WHPB 5FAXA 1YR2A 4JI1B 1B7GO 4AO8A 1DBQA 4RVSA 5AW0A 2YV3A 2R2AA 4L5IA 4EW2A 3WNQA 4L4UA 4D9FA 3KNZA 4XZ3A 1SBIA 5LYJA 1SG6A 4DTIA 3LX4A 5GAJA 1REQB 2BLLA 3DEFA 4WN9A 4ZOEA 2VH5R 1RM5A 1Z5PA 3RTDA 5C5IA 1NN5A 3RK4A 4C4SA 5A9RA 3TINA 2VJQA 1ZXBA 2BSQA 1CUCA 1YZLA 2OCBA 2AN9A 4KOAA 3CF2A 2RAUA 1D4FA 3BD6A 5I9NA 3FDZB 5HGJA 5C5EA 1Q91A 5CVDA 1FF9A 2XWJI 2F2TA 4L08A 1NY5A 4Y6QA 4L4ZA 7MDHA 4G0UA 4I66A 4HV4A 2BVNA 2P9FA 1EFHA 4Z9XA 2IYNA 5A06A 1N7JA 2GWHA 1E2UA 2V1XA 3PGMA 5JSZB 2EZ8A 3CEJA 2VPPA 3QMMA 3BCRA 2HQRA 1C1DA 3P32A 2AW5A 1P4AA 2PX8A 1JHAA 3ZU4A 4ZIRA 5BR7A 5JFTA 2Y3IA 5CK4A 1EA7A 4HATA 3HDVA 1M2HA 1NUTA 1ZITA 5E8RA 3MRVA 2D2FA 4YJHA 3KWLA 1CQJB 3S0JA 5IDQA 3V6MA 2XBUA 1DFGA 2V65A 2ZAGA 4R2KA 2OXRA 4D3DA 3BB4A 4LJKA 5B7QA 2VUTA 1AHIA 1KTVA 3KOMA 1QCDA 1DEOA 2BFEA 3CW2A 1JHOA 3EUWA 5T4FA 1C8KA 3G2NA 4CCAA 2QLLA 1CUVA 3QY9A 4BO4A 2ZRFA 5A3QA 4F56A 5KHLB 3M4YA 5FUYA 5TNXA 4OFZA 4GYKA 1Q92A 5A9SB 4V0RA 5CXUA 4OA8A 5MFZA 2F8TA 3NIDB 3LWNA 4DL9A 2D5IA 3VPSA 4B73A 5EJEA 2HUNA 1ZN8A 4WLFA 1DWOA 5C2JB 5AWFC 1GL6A 1PLJA 1XPJA 3BJEA 5B2ZA 3GLIE 2Q2OA 2XWQA 3AJDA 3C3BA 3CJTA 3EZNA 2AS0A 3JYOA 4HLQB 2C9YA 4XD7A 1TCVA 1XLUA 4OM8A 1TECE 1F8FA 1C4XA 1JPJA 1NV9A 3HCFA 2G6BA 3C3DA 3OIWA 4KYTA 3NIFB 3RODA 4D9HA 2FRDC 3TRIA 1Z5WA 3QQ5A 1LPOA 1KI6B 2ZDQA 2IYYA 2HDHA 2IZ0A 4KXUA 4TXMA 1FP1D 4QSMA 4BP9A 3TLMA 4FCVA 2HSWA 4E7OA 2C5FA 1DEHA 5LNK6 2X40A 3H2JA 2CSXA 3U7QB 1RIFA 1TPZA 3PWKA 1R3UA 2B8EA 4MMZB 3SJ7A 2EHJA 4MVJE 2C4UA 1T2NA 3ZV7A 2YMLA 3N0RA 4N3AA 1TUIA 1A7UA 3DE3X 3OHMA 4B2PA 1QGOA 5DTQA 1QP8A 5JXWA 5CYPA 4ZVRA 3AM3A 4LSMA 3NPMA 3OPMA 2ZB7A 4MVCA 3MINB 3QNWA 4EHHA 1FDOA 2XLCA 4FZ5A 1SXQA 5HE8A 1QS0B 1S02A 1T9ZA 3AVPA 4G37A 5BNIA 3WJ7A 3P9IA 4PNZA 3GIWA 1PUIA 4FNOA 2O5VA 3BWYA 1K5PA 3ABSB 1BJRE 5FUXA 3O5AA 1QGAA 5K1ZA 2O3RA 1IBMB 2G40A 5E1OA 4QWMA 1LSOA 4BBZA 1KH3A 1K7FB 1Y98A 1KHTA 1Z5GA 2VS1A 2PSFA 2XMRA 3MMZA 1JVBA 4IO0A 5K2MA 4WESB 1JMYA 2WZBA 1IWPB 3GJXC 2P3OA 1DQNA 3E7XA 3AHGA 1XK7A 2P0YA 2WE8A 3FYUC 3PFHA 5AVKA 4GP6A 3NHUA 1V95A 4UUNA 1I1HA 5I7VA 4J29A 4BBPA 1UWKA 4B8ZA 2P1RA 2EYUA 13PKA 1KSGA 1N0WA 3BH0A 1AA9A 3P8ZA 3GY0A 1VMIA 1TEHA 2AR9A 4DQXA 4OQ4A 5FOTA 3SYRA 2HMUA 5KPDA 2E4ZA 2MINB 4NR0A 1M8PA 1KYZA 3B48A 1ACLA 4L8LA 4ZYTA 2NXWA 5EWMB 3CB4A 1QC5A 4JBXA 5ELLA 2GBLC 2F8SA 2RFLA 1E0SA 2W6OA 4Z1MD 5IHPA 4X44A 3EBOA 1VMKA 1F2UB 4HDNB 1NUUA 3QPUA 3TRDA 4JUCA 2ZU0C 2CL5A 2BMAA 1J90A 3GRYA 4XJTA 1GTG1 4FYVA 4CQLB 3HKCB 2CDRA 4PO3X 4R1LA 3IUPA 2NVUA 4IKEA 2YKGA 4A92A 3LCUA 4X41A 5TF0A 3SF8A 4G8BA 4HAVA 4OATA 3VPGA 3KL2A 4K40A 3EXHA 1QQ5A 5BYBA 4N5DA 3M83A 3P2MA 2M98A 3ZWQA 3AI7A 2GJKA 1E99A 1RAFA 4TMVA 1PHPA 3I8SA 3M9XA 3ICEA 3WOVA 3S8EA 2HCBA 5DU2A 5REQB 1LA2A 3UZUA 1ZW1A 4Q4JA 3TD9A 5HJ7A 3DWEX 1ZN9A 2Z56A 3ADDA 2FWIA 1U4OA 2J9ZB 3CIOA 2KHZA 3BCHA 3OG9A 2VVTA 3IOYA 3E2PA 3UWMA 3H9GA 3T4UA 3ZHSA 3MSXA 3SE0A 1QYRA 5BN4B 1UMKA 2A1UB 4UXIA 5J4YA 4IOMA 1PWHA 4FOLA 1H9BA 3KXDA 3R9WA 4UTZA 5CA0B 2AJDA 2QVGA 3W5DA 2I91A 5ERYA 1A96A 4MULA 5C3UA 4I50A 1D6MA 3PS9A 2XUIA 3GVCA 1RTTA 3H6HA 4HB4A 4WVFA 2LBPA 3EW7A 4PIPA 4FINA 2HWUA 5I4IA 1HWYA 4L4SA 3GJ8A 2Y68A 1JHYA 3QWFA 3O0TA 4HX5A 4HXEB 3EQZA 4F96A 1SBZA 3G5AA 1SUCA 1VIVA 3K2BA 3ACBA 2O8VA 1EJ0A 3CCCA 1RKUA 4PGAA 4RHCA 4EJ2A 3Q10A 3NWEA 3U3OA 3OJOA 2JFHA 2I8AA 4UBNA 3C3YA 3GUUA 4MP8A 1Z0DA 3FYUA 4EKYA 3OQPA 5FLKA 1VLJA 3L04A 1R1DA 3RFTA 3CLTC 1YZYA 2NUAA 3T9BA 4BEBA 2LXNA 4M7WA 2I1VB 5IAGA 2O8EA 1SUSA 1YB1A 4ZODA 1GAEO 4FX2A 5C1IA 5H3LA 3E5NA 1ZR4A 1P17A 1P9RA 2LUOA 5HILA 4JC4A 3C8MA 3EIWA 3GR6A 2IWHA 2ZSHA 4DCOA 1MO2A 1L5HB 1Y6ZA 3A31A 3CE9A 1KQGA 2YXBA 2Q7OE 3EZFA 1U0JA 2GRJA 2QG4A 1DC8A 1XWWA 3MA0A 4NATA 1YZ3A 4ZAFA 3WGJA 2WM8A 5JRDS 1NNUA 3DKVA 2GYVA 5HQJA 4I8IA 1E2QA 2ZTUA 5EVJA 5LA6A 1ZK3A 4GOND 1Y33E 2A5JA 4RQAA 1UDRA 1DINA 1O5IA 2CVPA 3H13A 3TM4A 2WFLA 1G21B 4J1SA 3JQDA 4N5IX 3E9EA 5BN3B 4K9SA 3Q0TA 3OX2A 4DWVA 2PA0A 3UM9A 1DGQA 1QIJA 1R0WA 2EFHB 3MUOA 4G4JA 1FW6A 4ZQIA 2UUPA 3INGA 4UZSA 1J49A 1HYGA 2O2DA 2V9PA 2RGNC 2XUKA 3UGJA 1QBGA 1T8WA 2Z1DA 1G5TA 2BKUA 4QEZA 4JJGA 1IBCA 4XPIB 5AW4A 3F8WA 3UK2A 1M1NB 1DJNA 5IN4A 1OC2A 3QX8A 3X1JA 1YB4A 4GLFA 5AVJA 2UZAA 1ESDA 1SVSA 2EFYA 4R01A 4XQCA 5AKJA 1SVOA 3E53A 4RADA 5FUBA 4AJPA 3BQ9A 2WVHA 3O1LA 3OTOB 4LF7B 4KODA 1KO7A 3NORA 1UBRS 4JWKA 2E6UX 4LXUA 1SU8A 3O8QB 4WY2A 3NIWA 2ZCJA 2R7LA 3LRTA 4REMA 4K3VA 4ZVPA 3N59A 3H16A 1J21A 4CVNA 4S1TA 1QIMA 3CURA 1ITZA 1H1LA 3ERCA 4TYPA 1S7CA 4MR8B 5KB3A 3UW3A 3UY4A 1I9GA 1QAMA 3E18A 4IIUA 4OV6B 5ED0A 4G81A 2X9NA 1KH1A 4MPRA 4QYTA 2VAVA 2NQTA 1YKGA 2VTKA 1CLUA 4C89A 1PYOA 1NOKA 1Q3HA 4HPJB 3IPCA 3WNBA 4WVLA 3R9XA 1U28C 2ZB4A 1X77A 2VXOA 4HWRA 2V3WA 2XMBA 4I1UA 1ODIA 4PQRA 7ABPA 1KSFX 3GPBA 2P78A 3RYFA 1JPNA 4L74A 2WU0A 3L77A 3C5EA 2WHYA 3PLNA 2AFRA 4FMBB 2OLKA 1RYHA 5EWJB 3DZKA 3GJ5A 2H1WA 4DCVA 2VF5X 4P7GA 2XB6A 4OF4A 1CZRA 2JLWA 2ASVA 3PDIA 3FZGA 2VYND 4MW5A 3RYCA 3OX1A 3GLIA 1WBBA 2OQVA 2CLDX 1Z5NA 2C2HA 2RGYA 2XF8A 2DPHA 3N6VA 5JSYA 2VDMB 2G7ZA 2Q6VA 2ZRMA 4MI9A 1Y8QA 1B8PA 3GZ4A 2WU4A 3OMXA 4LCBA 4ZYZA 2PANA 2OMEA 3KTOA 1Q20A 5HZGA 4J8PA 5T6BA 1V3VA 4U7DA 3FMOB 4WL0A 4CCSA 2B78A 1HUQA 2YWXA 4JL6A 4LJ4A 3FPFA 4RLHA 5CK5A 3ZWMA 3BXFA 5LSAA 2X6TA 5AHRA 3PQ2A 1T4DA 5ARBA 3LLUA 5GMOA 2WAYA 1NXXA 1CQZA 1W44A 2Q41A 3JR7A 1PGOA 3PYXA 4IIJB 1UC8A 3G79A 5B3JA 4DMGA 1NVGA 1HLFA 1PLLA 4M88A 1TZKA 3ICPA 3LOUA 5E1BA 1QF7A 2ADMA 2ZIAA 4AMBA 5DMXA 4ZJYA 1UAGA 2FEXA 2QI9F 1HE5A 3ACDA 2R47A 2R1UA 3PT5A 1DUSA 4OPMA 2QRMA 3JZIA 5KYXA 2YDXA 3GQBB 4BFZA 1K97A 1N1DA 1NNI1 3TQHA 3R3ZA 4NENA 1GEEA 3UQZA 3QVWA 4C7BA 4BKPA 3QEAZ 1PV2A 2JEYA 2UVDA 1AUVA 2QM7A 3KYDA 3DAOA 4BV2A 3VNUA 4JL5A 1NTRA 2YJ4A 3FYSA 3L1UA 4ZO8A 2X1LA 3R7AA 2JVJA 1U1IA 1PEYA 3IO3A 3WRVA 3JAMA 4LGYA 1IB0A 3OEWA 3PFBA 1G2OA 3DEAA 1LC3A 5G2OA 3TB4A 2D59A 5SY6A 2MSDB 1K0UA 2VBGA 4PQFA 4ZDKA 1TL7C 1XMOB 2A9KA 3AB8A 1FUEA 3LXMA 4EDFA 4F4DA 2AIRA 4EVSA 4V0KA 4MO9A 1DBWA 3SCZA 3GJSA 3ISJA 5A3RA 4KPYA 3MTQA 2NT4A 2OZVA 3IXLA 4MYTA 2W8ZA 5AI6A 4IIBA 1GIAA 2QB5A 3ENNA 4B3JA 4TL7A 5CLIA 2G36A 1GPUA 3KVOA 4BGIA 4INZA 1O5OA 2DC1A 4C6TB 3NEYA 1IDOA 1H1DA 3B3JA 2WU8A 4G0NA 5LJIA 2FVYA 4H1WA 1QG2A 1QHFA 1L7PA 4MLPA 3E3OA 4XWAA 1ECCA 4BFSA 3FKQA 4LMAA 3HR4A 3COSA 1WS6A 4ZV9A 1T0BA 4F06A 3D3WB 3ND8A 1UJ6A 3O4RA 1VB5A 2I6XA 2WJIA 1IG3A 3R0QA 3C0KA 3IHWA 3NAGA 4MIYA 4ARCA 2JEZA 4JI8B 3RWBA 3EPLA 2LP4Y 4BMSA 5KNBH 2MYTA 3DC2A 2AKEA 3UJHA 4C0BA 1RHRA 1O54A 1VDZA 3MINA 2J6BA 3DOOA 3IIMA 5DGTA 4EHFA 5KYGA 4MVJG 1SUBA 4DJDC 3T1OA 4RA9A 1OLSA 2H5IA 5C51B 4FC7A 1S3FA 1WLYA 2R86A 3M6MD 1JRLA 4XOIA 5BSRA 4LVCA 1ID1A 1C0EA 4HWGA 4DPKA 1G5IA 3K5HA 1WLSA 2D3TA 4ZO4A 2PZFA 3V1NA 3MD0A 3QX7A 4CJXA 1Y9ZA 3RWMB 4EPXA 2NO4A 3HEAA 1BKSB 1M8GA 4C07A 3KJIA 3BYZA 3CKYA 4YJ3A 3X1DA 3DL4A 4BNXA 3M6XA 2ZEJA 4F9EA 2MSKA 2EW1A 5AW3A 4RFLA 1JU4A 2X0IA 2YWRA 4L5AA 5J43A 2AUNA 1Y4AE 1JAYA 5E4YA 1IHDA 1BMFD 2F17A 3BCSA 4OQEA 1UXJA 2JGDA 3NM5A 1Z7WA 2QJTA 3PRKE 5EHNA 5IF9A 3AR2A 4TWBA 1IY8A 3KQLA 4ZQEA 4MV9A 1MRNA 1NJSA 1GUAA 4I36A 3RCBA 4W7IA 4WK4B 4EYEA 5LQKA 1R6AA 2RARA 4FYHA 3MN1A 4LJ5A 3U3JA 1ZSYA 1ODSA 5K0BA 3UMCA 4FEAA 4I1OA 5E7MA 1KAMA 1VFNA 2C9ZA 3C6XA 3VU3A 3TLEA 1JXAA 1HQKA 3BUSA 1YU9A 2WDZA 1MB3A 4FFWA 3RVLA 5I7FA 2QTLA 3W3ZB 1Q15A 1TNDA 1JQLB 5L9AA 4TKUA 2FZEA 5HDBB 1MAHA 1ZIPA 2IP2A 5FTMA 3PENA 5T4EA 4MW2A 3H8JA 4RE6A 3OZEA 4Z49A 1YV9A 3HWWA 2F67A 2PMKA 3SY8A 1XC7A 4ENWA 3FUWA 1A95A 4E94A 2Q5IA 2A5GA 3EEYA 3G8DA 3PX7A 3G49A 2IYVA 2A5DA 1E7RA 3I1JA 4U00A 1TJ5A 4Y6PA 4CIDA 5B4TA 1XE3A 2CNDA 3UQYS 3I45A 3WRWA 5BSWA 5CAEA 5CBPB 4W5NA 4MX8A 4MLCA 1G41A 1VKOA 2F1IA 1GZ4A 1NX9A 4EI9A 3LECA 2GFIA 1FFWA 3LC2O 4QXPA 3K0EA 2Z6QA 4OSEA 3GLGA 3PL5A 4Y9TA 2B21A 3SYKA 1H2ZA 1K08A 4YAUA 4XEUA 1ZI6A 1NW6A 1B6RA 3Q2IA 2XOXA 2FCAA 1KOFA 3AO0B 3FCAA 2JIDA 2YJ3A 1KH2A 3EPPA 3ZI7A 3WWYA 4E5VA 1E1QD 2Y8EA 4H2DA 5T4BA 3ILHA 3TZEA 4DWWA 4R1MA 4EUHA 4ZEOA 5JAIA 4DW8A 1NL3A 1PG5A 4ECAA 2X4IA 4X97A 2XUAA 2O19A 3B6JA 4AW9A 2AYZA 5ALQA 4G5FA 3IMGA 1JZTA 2VP9A 2FEKA 4BP3A 2OC9A 2OGZA 5KAMA 4RDXA 1DARA 2D0DA 4ZVOA 1PAUA 2AR7A 2EKQA 3K9BA 4CG1A 1VQ1A 1AXGA 1XTZA 3GRPA 4FFOA 1WTCA 4GOMD 3EB9A 3DC7A 2VJYA 1FQKA 3ETEA 3WLRA 4R7TA 4IJ5A 2H9AA 4BV3A 5DX8A 4X8HA 1ESCA 2ZDGA 4NVRA 3A1CA 1SHJA 2FW8A 3LNCA 3LQFA 4P54A 3TTTA 3VFDA 3X1KA 3CKLA 5D51S 4E22A 2O8FB 2Z6AA 4Z4HA 3WQRA 1RAIA 2O0LA 3DT6A 3RVRA 2X5XA 3O74A 1P3JA 1Z62A 3R5FA 4ZAZA 3K05A 3KU4A 1D7OA 2J33A 4MIKA 5HYVA 1GA1A 5A6SB 4JKOA 3CMCO 2F62A 3CA8A 3LI2A 4IHJB 4YS6A 1I14A 1A7AA 3R7WB 2ZK7A 3D6TB 3EC2A 1WEKA 2YMPA 5EKXA 4S12A 1H0SA 1R0LA 5COQA 5DBGA 5HZHA 5KC9A 1CW2B 2LE0A 4K9PA 2FI1A 1DJPA 1RPAA 5AXAA 2X4LA 2RGRA 1MGOA 2XDYA 2VSYA 2HNKA 3TVDA 2FG5A 3OJXA 4RFSA 3RS0A 2VSOA 1DXQA 1CETA 4QX6A 5B1HA 4IJ6A 4I55B 1GPBA 4H6VA 4AZSA 3RARA 4ZOLA 2PTHA 1P4HA 4S24A 1XEXB 4BMYA 3HI4A 5TJ9A 1OV4A 2IYAA 5FBQB 1PJCA 4HWKA 3FLEA 5JDIC 3P96A 3DO5A 1FDVA 1L6IA 3FOEC 3UAXA 3COPA 3ZWCA 3P0JA 1ZVKA 5KKAA 1VLHA 2Z5GA 1SXGA 1QV7A 4E5MA 1YJXA 2XSZD 1NNSA 2XUJA 2EGUA 3QWIA 4PAMA 4XLTA 3IUJA 4MDFA 1KPIA 3ECSA 5JXJA 1C7RA 4DREA 2SKDA 1XMJA 4QLBA 1FX0A 1UEJA 4OMDA 1N2CA 3LDUA 3ROEA 3PX3A 5A03A 1BXGB 1NFRA 3VJLA 2IU6A 1NJFA 1TLLA 3I5AA 3PG5A 1LKZA 2JBWA 3EOAI 4CIVA 2IZZA 3ZZ1A 1M1NA 3HXKA 4QTXA 4U7TB 4CV3A 1M75A 2W5UA 4ZTZB 4IUYA 2ENWA 1YJCA 2FZ5A 2PFGA 1FMCA 2RH5A 1A77A 1L5WA 4GR9A 3P7MA 3F96A 4HRYA 4CDGA 1BWSA 2GAAA 3N7UA 3OZSA 2XSZA 2AB0A 4M87A 3IPYA 2OE2A 3MRTA 4LYEA 2IPLA 3IP3A 4QOIA 4Y2YA 1C1HA 1X1BA 3GVPA 1ZLYA 1BCRA 2XVXA 2JLAA 4UXHA 4EMTA 1FFEA 1AKMA 4N5HX 4R1SA 4EUNA 1F2DA 1LRLA 2P8SA 4Q1AA 4XJVA 1VCMA 1XZLA 2ODBA 2IPNA 4R1NA 3X43A 3H4VA 4M1YA 4D97A 1S2LA 4MQUA 1KI3A 1MABA 1PE0A 3BJMA 3QW2A 4U7JA 4ZQHA 3EPJA 4BLQA 1E64A 3AV3A 3BILA 3KLNA 4TT3A 3UATA 3KAJA 3AVTA 2J87A 4G6ZA 1GYPA 4D9GA 4KAAA 3TEMA 1TZ2A 3ZV3A 1O96B 2I55A 5DLQC 3OJWA 4R9UC 3TIFA 3ZCXA 5LWQA 5IANA 4YAEA 5F78A 4F6CA 4QU8A 2QPAA 2BONA 4XGIA 1LTQA 1UP6A 5FRDA 2H1IA 4EITA 1E7WA 1DT5A 1YZVA 3GGPA 3JVIA 1YHZA 1JPUA 4KHZA 3AL3A 4R2IA 1YUNA 5FWYB 1KFKB 3WK4A 4DNXA 5D85A 4AECA 1I10A 4RLSA 4AZ3B 3E8MA 1FXUA 4MJ7A 3A6EA 3C4JA 1CRWG 1TCUA 2P1DA 3GRZA 3RT9A 1NVKA 2CXPA 1J42A 3O4VA 1ZAKA 4W63A 5H82A 4D6XA 2G9ZA 4EI2A 3KQKA 3H2KA 2WP8J 2ECPA 3T0FA 1T15A 2YS7A 4O4IF 2A4KA 5BN3A 3KQSA 1KXJA 2P4UA 3RRXA 2RCNA 3TIVA 4F84A 3HU5A 4N0MA 1WOYA 4TV9F 3CPJB 5DRYA 2WOJA 7ADHA 4P2GA 1V2HE 5DLDA 4NZPA 2P2DA 4IIJF 3DO8A 1YNSA 3HKBB 3MYYA 1W6RA 3ASVA 1X1EA 1ISIA 1V96A 4LCJA 4CEJA 1J1UA 1GT91 3BWDD 4E2FA 3COWA 3GLHA 1VSVA 1UM9A 4MV3A 2HSJA 5CFRA 5CLGA 5LU9A 4DHWA 3ETLA 3UFXA 1OLUA 2JGIA 4KJXA 3AHCA 5AKLA 3QPCA 5ESWA 2FPWA 1K8YB 2W6MA 1O0BA 2H00A 3D5TA 3WADA 2XF2A 2V8OA 3UO8B 4GLOA 2J3QA 3MRXA 3QTLA 3GPLA 2C42A 2R44A 1P1HA 4KNVA 3TR0A 4PX9A 3TW8B 1ESZA 1P2SA 3S2UA 4KLCA 1ISGA 4EI7A 4HFMA 3RRJA 3LY8A 4MXDA 3AF0A 1CRZA 2BH2A 3PGKA 2BKAA 4RENA 1C2YA 4QQ8A 1AT1A 3ZWPA 4PVDA 3RF7A 3FXAA 4DCJA 4UC0A 4U6SA 5LMZA 2FVXA 1MVNA 3OM9A 2SBTA 1JH8A 4MS4A 1DJQA 1W0CA 1YRBA 2O48X 3JAKA 4QD3A 4QPCA 1M2EA 2J1LA 3DSRA 3HHEA 3KOWA 2XE4A 3LT1A 4Q0MA 2X9LA 1Y7HA 1OU4A 4Q5IA 1FS6A 1HQYE 3IP6A 2HFJA 1TAQA 2I29A 2B8WA 4JUBA 8ABPA 1LDEA 3B89A 3NM6B 3OTWA 2X58A 3VSAA 3ZQKA 5IJAA 3L40A 2HL6A 4EP1A 5EJ8A 1FDTA 5C5DA 3U2QA 2GARA 5CNJA 5FOQA 1XUOA 3PC7A 2QE7D 4R9NA 4YB8A 4C22A 4EW3A 3D6HA 3ICWA 2QZSA 3E3LA 4Q3BA 1UT5A 5JISA 4KR2A 5KNLA 3BD7A 3REQA 1GDDA 3LBIA 3C6ZA 4D4GA 5C8YF 1IFXA 2BTQB 1OASA 1X3LA 4HMQA 4IDAA 3LFHA 3AHFA 2HDNB 1ABFA 3C6BA 4O5OA 1K6MA 1ZCJA 3THOA 4A8PA 1CUXA 3MCUA 5AW5A 2BFMA 2W7TA 2XZTA 3N87A 5AI9A 1UAYA 4HXFB 4CR8A 4AG5A 1C1YA 1PQYA 4MPPA 1FSFA 4GR5A 1CZNA 1U8XX 1CP2A 3A1FA 4JN6B 1JKXA 1GTRA 3LXXA 3BF7A 3FKSD 3ILVA 3LKVA 3TE7A 1JWAB 1Q0LA 2FR8C 4RXTA 1QLHA 3S3TA 4AYTA 4C4YA 1VHJA 3DJYA 4DA8A 4MVXA 3I3SR 4LNHA 1KI2A 2DWUA 3OT1A 3V4LA 2C8VA 1P7WA 3UNXA 4D9IA 2ONCA 2TECE 3K0CC 1ONPA 4MV6A 5K05A 1PR9A 1J33A 2XAAA 3VNRA 1ZGBA 4ZZ3A 3FTQA 4O6VA 1BS1A 521PA 3CWZA 4UQOA 3QKTA 4JBGA 3HZOA 2AE2A 5H59A 5FI5A 3R0XA 4G4GA 1JT2A 3D4LA 3FYUB 2BM8A 3LL4A 4IRUB 4OK5A 3GEGA 4FLEA 1Y7PA 2OFWA 1OHHA 3DVRX 1SVWA 4B71A 1BDMA 2XVMA 2H8GA 2GVDC 3OT4A 2WSIA 4EYSA 1XVAA 2FHPA 2X8BA 4B85A 4XFKA 2WYHA 4IO1A 3W90A 3AVVA 3G2KA 3U44A 4AP5A 2KJQA 4HNVA 1IVSA 3IAUA 5K01A 5LJLA 2IYQA 4KXNA 3EYWA 4DBVO 2I7VA 1NXQA 3O8RA 1E1RA 1CEQA 1KXZA 4GRAA 4BNJA 3HKDB 1CR1A 3M1LA 3FOFC 4UARA 3B12A 4XD2A 3V8VA 4UDYX 4MHSA 3M6VA 4H6PA 3E22B 3PE6A 1TYAE 1E79D 4J7UA 4MCHA 3P9ZA 5EYPA 2GBFA 5B58C 1GZ6A 4YAIA 4ND1A 4RK4A 4RANA 4WOCA 5IM4A 2OG2A 3O7MA 2NUPB 1ORRA 4MZXA 4UTXA 4DQDA 2YMMA 3OQ1A 3E9DA 2AZXA 2ACVA 3COVA 1U2EA 4PLHA 1IPFA 2X41A 4BVHA 2AJLI 4FIZA 2IU4A 1HDZA 4YP5A 4DUPA 4PG6A 3ZW8A 1Q1NA 1RPNA 3B70A 4HNGA 4G65A 4ZVVA 6NULA 2VFAA 3UWSA 2OXEA 1RWWA 8MHTA 4I14A 4L4XA 1R12A 2YXNA 1B3RA 4B47A 3VYVA 1MA3A 4M36A 2VN8A 1TUEA 1GV1A 1QYIA 1KJYA 4HB3A 3S70A 3RC2A 4A2CA 4G0VA 1NP7A 3U37A 1XQYA 1OLSB 2IS2A 3U3RA 2X8AA 3CQ9A 4AP6A 2COKA 4CR6A 5C8DA 3B1JA 3KYIB 1KBZA 1WNFA 5GOZA 5ICGA 5D01A 2R4UA 4OI4A 2DTXA 2R1VB 5DHUA 1Z8HA 4AN0A 1K7EB 1OYYA 1ECJA 5JWHA 5AVRA 5J2UF 2QXTA 4EFDA 2VYNA 5K0NA 4QJ3A 2FK8A 1QRTA 3CH7A 4JYBA 1RFLA 1P5JA 1U3FA 4UW9A 3BWXA 1ZG3A 5ES4B 4LV6A 1EPUA 3C4QA 2Y0EA 1IN7A 2OHJA 5JARA 2G82A 1RM4A 5K20A 1E6WA 2OC4A 2W6ZA 3PNLA 2ZI4A 3AHIA 3OEEA 1XAHA 3HCAA 3BREA 5JBIA 4D9CA 1FP6A 3HGMA 4N7MA 2WIDA 2YJNA 2GWRA 3LWDA 4UBKA 4DA0A 3BHIA 3NAZA 3ZBPA 3I72A 4M22A 2VTBA 1DC5A 2VJAA 3AWIA 1V5IA 2YFYA 1KS2A 3T41A 3ORYA 5B1YA 4PTZA 1U4SA 2QP3A 2GD2A 5JJKA 3ZKWB 1ZH2A 3V1TC 1Z2AA 4FFBB 1ODJA 1NJ8A 2DTDA 4HEHA 5GM1A 3K1AA 1EQ2A 2O3QA 3HYNA 1PWXA 1VLMA 3L6UA 3LO5A 4JQSA 2A9PA 5H1YA 4DYVA 1XNQB 1XTRA 4OHVA 1YQDA 2C7GA 2EBWA 2HJSA 2RGUA 3SQMA 3X1ZA 4ZT6A 1CS4C 1MBZA 4NG5A 1I7LA 3ZD8A 1ZR2A 2DPMA 2NWQA 1QF9A 1OAOA 3GCGA 4UDNA 1T2FA 3LJKA 3PEEA 1G42A 2HIHA 5TB5A 4DHEA 1SVKA 2LPMA 1TW3A 2JGMA 3OF5A 1JQJC 2GF2A 1JDSA 3EEBA 3CX7A 3JQEA 3QOYA 4NE9A 3WYEA 2GHRA 1QZZA 4TV8F 3P4YA 3P1JA 4F3KA 2FOIA 4O4IA 3COYA 5ALZA 2QVZX 4PZUA 4RJTA 4OGKA 4HNAB 5BOSA 2O3JA 4JS0A 4JI4B 4XARA 4NFHA 3ZHOA 2X42A 3JD1A 1R2QA 2G08A 4DLBA 2IWRA 4DN6A 5EZ6B 1FLDA 2P9GA 1PFUA 4HFNA 4YJFB 3TQCA 4CODB 1TQ6A 3DNPA 4JIMA 4OHCA 1HDYA 4FKZA 1EFVB 1EUYA 2JH3A 2OV4A 3WIUA 5BV0A 3OKFA 1L5NA 4M1WA 5L7YA 5IPFA 3TTWA 4GECA 2ZAIA 4C0XA 4AL4A 1U11A 2GZAA 3I0ZA 1U2ZA 4RGVA 1CR2A 2OV6A 4G9EA 2XBMA 2WM3A 3IESA 1JLKA 2I54A 2QZ9A 4GGOA 3L06A 5BRJA 1ZXXA 3LOQA 3QFHA 5DX0A 2YWFA 5F21A 1VJCA 2VBCA 1SVNA 1G20E 2G25A 2QZJA 1QCZA 4B6EA 1GP2A 4ZI7F 5JPIA 3K94A 5B6IA 2QUZA 4N6OA 5KKNB 1N1MA 1NI3A 1XCJA 2BEVA 2H2FA 2GK6A 2DLNA 3OKAA 2B34A 1LPSA 1OPRA 3X2FA 3OQ6A 4WBNA 2WV7A 3KKLA 4ZHQB 5AVQA 3VZBA 1IPEA 1Y81A 3VQTA 2Z9BA 4WLNA 5A7FA 4OL9A 3D1LA 1O89A 1EJ2A 1KZ6A 3H5RA 4RCVA 3TDKA 3RG2A 1L4NA 1X7DA 4CI9A 2BSXA 2IEDA 3TQOA 4I5IA 1JDNA 4ZZ2A 1ODCA 3QUAA 3K6SA 4AJLA 1CDOA 1FP4A 1JP7A 3SJAA 5JNUA 1Z83A 2FPGB 3LBAA 2QE7A 5DBEX 2C7RA 1HNZB 3LQ2A 2NAPA 1JQEA 5DB4A 2PEZA 5C53B 2QZPA 1XJ5A 2W6CX 4CN9A 1Z13A 2VDVE 3ZWKA 1QTIA 2D74A 2P3SA 4ARZB 2C4NA 3I1IA 4B34A 4Q02A 1ISMA 1PCXA 1W76A 5KI6A 1AKNA 2E4UA 3PFGA 3KM0A 4YRPA 1VG9B 2GHTA 4AUMA 3K1TA 1LZKA 2LW7A 3HJGA 3EPKA 3C8HA 4R1PA 1DDGA 1SEPA 3HPRA 1HE3A 1SU6A 4XWOA 1D6SA 4TL6A 2AN3A 3G85A 2YHUA 4OL0A 2NU8A 1WKCA 4RA9B 1FX0B 4P92A 3FHCB 4AP9A 4KR7A 4FGWA 1PL8A 4HVLA 3ROQA 1U6KA 3M33A 3GROA 2J5RA 2X8WA 4MUAA 1HE2A 1QIEA 3WLSA 1ST2A 3I2GA 1IOLA 2R9VA 3BGIA 2WMYA 3O2QB 5H83A 2VDPB 2RCYA 1GPNA 3ER6A 1CEXA 1EDDA 5EHIA 5JEDA 1TQ4A 1T9BA 2IYSA 4H1VA 2ETXA 3WMGA 3GG2A 1S8FA 1SEVA 2OFOA 2WV9A 3W8FA 3DB1A 2VAPA 3IELA 2A3NA 1LDBA 2CJWA 4EHIA 1Y8CA 3WAGA 4BE4A 1UOQA 3GWZA 1VYHA 1PTJA 3KP1A 3P2EA 2W2KA 2QAJA 3OVMA 4PZCA 5CCDA 5TPWA 3RUAA 1EFLA 3ZNPA 4ZP1A 3UUWA 4JI7B 2VDRB 1HFKA 2UYYA 4S05A 2GM3A 2OHFA 1B6TA 5CUQA 2EBHX 1E0JA 1SKYB 4LBZA 3DS8A 3H8SA 3OOJA 4CQMB 4LJRA 1A72A 1VSQA 3KV1A 2WM9B 4R41A 4ITUA 4BFYA 4ZCTA 1IM5A 3WO1A 3VTZA 2ZRBA 2QRVB 1HT2E 1H1TA 1X92A 3OZVA 3ZQ4A 1NZDA 2BW0A 4OQDA 2IBMA 2KM1A 6YASA 4ZVKA 4RF5A 3VOAA 2QPTA 4LHZA 4OI2A 1SZDA 1C9YA 3C70A 4W7HA 1TMGE 2QRUA 3LPNA 3P9YA 4EY6A 1ZMRA 3I9MA 4UATA 3P2KA 3GJ4A 2QTWB 4EPWA 1E1LA 3KR0A 4BRUA 5SZIA 3AV0B 3ND5A 3EDYA 4CDNA 2FG6C 2YOHA 2O3TA 1T8YA 1TJ4A 2AW3A 1T5IA 2I2FA 2OO5A 3ESRA 3OPYA 2ZREA 2OXFA 2R5NA 2HXSA 2NU7B 4XR9A 3M8KA 2XCSB 3TG8A 3PFIA 4B44A 1X86B 2FUNB 2QN2A 4GEKA 4ARAA 4WGFA 2JG3A 2EKZA 1BTOA 2OQ2A 3WV5A 1LRJA 3KE9A 5EKUA 3JWIA 2BGLA 2QORA 3KPYA 1WNTA 3WYCA 4BE9A 3ZY5A 1VHWA 1H4QA 4NOJA 5ALYA 1R4ZA 1JFFA 2CLHB 2AEFA 4JP8A 4ZVSA 1O7JA 2QVYX 1AQLA 3H86A 3OAAA 3MGKA 2QX7A 1EK6A 3HB1A 3ZGLA 2VUSA 3AQIA 4OGWA 4YWHA 2I3AA 2GKOA 3ZCSA 4EUEA 1G9TA 4X9XA 3SSNA 2BFDB 1KR5A 3ZWBA 5BQXA 1JH9A 2DR3A 1HRDA 2DR2A 4NC9A 4U6QA 4KR3A 2WJ3A 4XI9A 5JSQA 3PVSA 3CF0A 3HBAA 3CIFA 5FEMA 2GCIA 2QL7A 4PZZA 1U99A 4QPZA 2JFYA 3PUXA 1PKXA 3O1HB 4YLGA 4CLOA 3OQIA 4ALLA 5KIAA 3KSAC 4XVHA 1JF8A 1FB5A 4EFKA 5JSHA 5A3VA 1XLWA 3GUCA 2F4NA 2M2IA 3D3KA 4Q34A 1KYTA 1NJ1A 1P1BA 2A9VA 4KQFA 4LOLA 4F72A 2ZBRA 2WKWA 4FYYA 3OCCA 2CCGA 3GFFA 1YF3A 4ML3A 4DGSA 3VOSA 4XYMA 3AF5A 3FGOA 4BYGA 1AUOA 2B92A 3DO6A 5LBIA 2PGAA 3M1AA 1U3TA 4JP3A 1E1RD 1F0KA 1ZW6A 2ZDHA 1FRNA 1EM6A 2CVQA 3HRHA 3H2BA 4HWTA 4X8MA 1E9FA 1NPYA 3L7CA 5LQMA 1L4EA 4BPBA 1RZ3A 2ERCA 1YZKA 3M1YA 4ZRDA 4N0DA 4NJMA 4GMKA 3T9FA 3GGDA 1E62A 1GZVA 3PXCX 5CG1A 3H6GA 3U44B 2W6NA 3W2IA 2O8CB 1PFGA 2YHBA 2WVAA 4PLZA 4X8OA 4YEDA 2NYVA 3LYHA 3CLSD 3FFWA 5HBRA 2WUWE 4ZEMA 4U02A 1UJ5A 1NMZA 3GFPA 4PRZA 3UKOA 1GU7A 4UE6A 1HETA 2CFIA 4YMTA 2XMSA 1D9ZA 4J07A 3KWFA 1YA4A 1WMSA 3JD4A 3P27A 4ZHSA 3GEMA 4DDHA 1OF1A 1SKBA 4UBOA 3S99A 1TXGA 2QTCA 3FJ1A 3ESZA 1AB6A 3MTDA 2PM8A 4JBWA 1XLVA 1X7YA 3CCFA 3I2HA 4EEKA 3HABA 2FETA 4LI3X 2H63A 3FNHA 3X1XA 4C20A 2H5EA 3KFVA 5JI2E 2WJJA 3A1EA 3FTEA 1IXZA 4K0KB 3JU3A 3SDZA 3P2OA 5FPSA 4O3MA 4NH4A 4ABTA 4DIMA 4YDQA 3BFVA 1EFRD 5FO1A 3PQ6A 4MZDA 1UZNA 4B83A 2OPBA 4W5JA 3AERB 2WFMA 3Q7EA 4MVJP 4UCFA 1E4OA 4XVRA 3QA9A 3TOSA 1UBTS 2C5EA 4PYOA 4TTTS 3T1VA 1T2VA 1JB9A 2V7EA 4FM9A 3H5VA 2ZWVA 4HNRA 5DXAA 1BFDA 3RAPR 4B6SA 3KSMA 3LK7A 1M33A 4WCFA 1TZCA 2BFCB 4RK0A 2OENG 4IJMA 3B9PA 3LUFA 3PHHA 4OAOA 4IDNA 3UWPA 3I6MA 4RQUA 3ZYCA 3SIWA 3HJNA 2C3MA 2JFBA 3IA7A 5GPBA 1A2BA 1JDTA 1JQKA 3SQOA 2VIIA 1H0RA 4D9KA 1J7KA 1Z82A 1IVYA 1JZQA 2SHKA 4KWCA 4I5EA 3A6KA 3H11B 1EK2A 5EMKA 2YVUA 3HVHA 3QUQA 1TD1A 1G8AA 4FE3A 2PSDA 3E27A 3KTDA 1BSVA 2H07A 4J1QA 1S1CA 3FZYA 4ZOQI 3PGXA 4OP3A 3INTA 4H27A 1NN0A 1QG0A 2ZQYA 5HK9A 5CFNA 4XLZA 5CEFA 3ONWA 3ETCA 1PT6A 1Q0QA 2R97A 3YASA 1M8FA 1TIKA 3A26A 3FSEA 3GBSA 3NKVA 1P0QA 2PX5A 1UMBA 4XM1A 1MH1A 4G36A 2YZGA 1NUQA 1Z4PX 4WERA 3V9PA 4AZVA 3IEKA 2HLDA 2L19A 3T0IA 2HW8A 2IYWA 4YV7A 1SBHA 3C43A 4QBGB 1UJBA 2XMGA 3H18A 4E32A 5AUNB 4GQIA 1DADA 3DMYA 1AK9A 3FCUB 4LJAA 1P7PA 4BNLA 1KQOA 2XGMA 3HUTA 1L4LA 2I4IA 2IQ5A 1OX4B 3FFXA 3OC0A 2Y6VA 5T57A 3ZWVA 2P5TB 2KBFA 1VMAA 2NO7A 2XQFA 3GT3A 2JAQA 3JZDA 5TGDA 1NKVA 5JH7F 2OESA 4DLTA 1TEZA 3T3DA 3QVKA 3TMYA 4IDEA 4AY3A 2BPOA 2IF0A 2ZVJA 3WQQA 4EB6B 1L9XA 1A8QA 2AQKA 5CX4A 4YJ2A 3WGMA 5CP8A 3TO5A 4LTMA 4PPQA 3AOEC 4N40A 1DDIA 2VAWA 3NHWA 2PUWA 2H54A 2F64A 1MR3F 3DOEA 4LRSB 2CNBA 2JRCA 1N6HA 1OX6A 1ZIDA 2YXEA 1GKYA 2C58A 2ZAMA 3EXG2 2NUPA 4RA6B 4OIMA 3T7JA 4E46A 5AKYA 4MDEA 4I1PA 3D1VA 3GAAA 1MCZA 4R3WA 2JI9A 1CS0B 3UFBA 4C87A 1NRWA 2WHXA 3F90A 4ENPA 2I2CA 3QEMA 4PHTA 4UD6A 4ZVLA 4U7GA 4PC7A 3SYMA 3CO0S 2XITA 4FMCF 3WGZA 1N6RA 3K9GA 5EIWA 4DDMA 2CJPA 1SCQA 2FH5B 3EA5A 3I34X 2MJLA 1YFLA 4YRGA 2EEPA 4M37A 2YCLA 4X7BA 2W93A 4CKEB 1FMTA 4NULA 4EFMA 5C8VA 3F3YA 4I4LA 4HBZA 1WUYA 2B3TA 5ESDA 2EV9A 4F7WA 1WZNA 3D2AA 1CUEA 1KI4A 2O4CA 2CD7A 4JBYA 4UUAA 4WZBB 4CUKA 1DG3A 3KUXA 4LDPA 3OIFA 2ZYHA 5DHPA 3K1YA 3HZRA 1UZUA 3EXAA 3KPVA 4XB2A 3WGQA 4Y1RB 4PYQA 3VR2A 1IOVA 1J0DA 5KREA 1TTPB 2DLCX 2P91A 3KQUA 2AVDA 3SM9A 3DE2X 4K5QA 4PPFA 5DK6A 5H3CA 2EFDB 3VUFA 4BKQA 3W5BA 4DA4A 4IUCS 2C57A 5IARA 2NYUA 4UHBA 1NQXA 1O6ZA 3WSWA 2IITA 5ALEA 4AY5A 5AI0A 2JGEA 5AICA 5JROA 1YDEA 3U3ZA 3IMCA 4C4TA 4N7BA 2NVWA 2O4UX 4JVMA 5EXEA 2NW6A 5BWMA 3FHLA 3UT5B 2X2OA 4NTZA 2B83A 2OG1A 1WM1A 4OB6A 3TFOA 1G8MA 3WIBA 1OD6A 1WXDA 4K2AA 5E4JA 4BCDA 2DHCA 1KY3A 4LHYA 3BRSA 4NBNA 4RLFA 4YRCA 3RRYA 4MPJA 4RV9A 1P60A 1QHEA 3RBVA 1EA5A 1M72A 3HM2A 4GLJA 3EVEA 2CXTA 5GONA 1UBNA 4G84A 1Z28A 1VCHA 4KGVA 3AM4A 3HVRA 2AMVA 3U49A 2ID7A 2QN7A 5BR4A 1L2TA 3ZDZB 4P36A 5B64A 4QICA 1HPLA 4WNAA 1XVIA 3SEQA 3ZEAA 2NSJA 5CG2A 5JIBA 5KC8A 1HO3A 4MKGA 3J80A 4XUGB 1GZ7A 1G8JA 1UCFA 4UU7A 2BTQA 5GVRA 2R7AA 2OZLA 4ZVTA 1J8YF 4IQGA 1D2HA 4CM6A 5KJ6A 2GPAA 2XA9A 4RIEA 1LSUA 1U7HA 3GBVA 3PC6A 3ABRB 4A16A 1JQ5A 1F9EA 1OA0A 4TMKA 4HUTA 5KYYA 3P9QA 1JIQA 4JBIA 4CEHA 1JEDA 5TQVA 4RHXA 5AM2A 1U63A 1J0CA 2QLFA 4OP1A 4WBXC 3H42B 4DQ0A 4KFUA 5K8JB 4O2AB 3K32A 3X2SA 1QGUA 2XY4A 3OWXA 3NHJA 1RXYA 2NVOA 4YQEA 5TQJA 3GIDA 3WLAA 3HJTA 4YK7A 1E6EA 1DAIA 1YVDA 2HRZA 2V7QD 3GU3A 2W2KB 3MTAA 4FEEA 4PAWA 3GDOA 3LUDA 3B7WA 4H7KA 2VUIB 1Z0FA 1E4EA 1FBTA 1GU0A 2VPYA 2GN2A 3EF3A 4TVKA 3CX4A 2H51A 3OLXA 2P79A 1FXWF 1XYGA 2V6IA 4FJ1A 5H81A 3L41A 4CNQA 4GBED 2JKVA 4PR3A 2GR9A 3WDLA 4IXWA 1QU2A 3OZBA 4ZCQA 3PBKA 4C2BA 4IY1A 3DCIA 3KLPX 3LT5A 3MWLA 2WB2A 4MKXA 2I33A 1ABEA 4BGUA 2DERA 4NJEB 3KKPA 4UD2A 1CUBA 2REXB 5KAPA 3PJEA 2XWBF 1Q2XA 1WF3A 1CNMA 3E1KA 4M55A 4CKYA 3ER8A 4WDQA 3GEHA 4NV3A 4ENQA 5JCPA 2Q5EA 5F9HA 4BLPA 2Q0XA 1GNLA 1RWXA 4P98A 4H7IA 4X84A 2OORC 5F7OA 5ILQA 1FPMA 1P9OA 3LV8A 2D7DA 2J9YB 4H0NA 4Q3CA 2LCQA 3S2IA 3WLQA 2GF0A 4QL3A 3OURA 4RK7A 1AKUA 5GJVC 5K0EA 2WZDA 1V5WA 5B6PA 5I8WA 3K70D 1DBPA 3JWPA 2JANA 5T41A 4RPGA 1JYFA 3AEYA 4MRAA 1E1NA 3N8IA 3I12A 4U3JB 3E5MA 3L84A 3N86A 1M8JA 3PDWA 3SIPA 1DIBA 1QOZA 3VMFA 3WJ2A 1G17A 2AJCA 3L93A 1KRHA 6REQB 4G8CA 1RHUA 2GNPA 3UK7A 4NXNB 2HMVA 1ADYA 2H1RA 3WBJA 1QV6A 1N2SA 3U4IA 4FP9A 2J41A 2ORIA 5GIPE 1SC6A 3F1LA 1E2FA 3W4IA 3VX4A 4FMPA 4EFLA 4QM7A 2AUTA 2J48A 2P68A 1G6KA 1U2SA 2E4YA 4OHWA 3L4BC 4ARVA 4LY9A 5JO0A 1VIMA 1L4HA 2QNRA 1L3CA 3I6ZA 4F91B 1T91A 2VA9A 4TRRA 2B8TA 4MEBA 5J1TB 3LU1A 4DCTA 3K5IA 3IVXA 4JQCA 4J4BA 2O2SA 2KB0A 1NMYA 1X7ZB 2O2CA 2B35A 3Q6MA 2X15A 3FOWA 4K8RB 2B98A 2XKJE 1QNLA 1UXIA 3PWTA 3WL3A 1NBMA 1JIUA 1QDUA 4ZV4A 4Q21A 3DV9A 1BAPA 4R8RA 5DV9A 1NW5A 1E69A 1YC2A 3CF4G 3EHEA 3UG6A 2G28A 3QX9A 4IIGA 3AY6A 1MEOA 4E5KA 5KMGA 3P20A 3HYSA 1ZJ5A 1MV5A 1VIYA 1XCPA 2WUVA 1MDFA 2J85A 3AFNA 4I4CA 1DEAA 4U2DA 3TBKA 5L8VA 1NDUA 2X4GA 3OCVA 4UPDA 4F5YA 1XTUA 3L7LA 4B3SB 4MUIA 3QENA 4P81A 1XA4A 2OAQ1 1ZK2A 3Q9UA 3RHZA 5HR5A 3LS2A 2BFEB 2HMSA 4G1VA 3RVNA 1AKQA 1NPTO 1RZRA 3F7OA 5HVNA 3SD7A 3EIFA 1E2IA 2MINA 2RHRA 1KYVA 1NI5A 3I2YX 3INYA 4I5GA 1OBOA 1C4KA 4D8YA 3KQHA 4LF5B 1T9GR 3CLRD 1ISPA 1A9XB 1HV8A 2EZ9A 2XE7A 1OREA 2Z1NA 2ZYDA 3BG5A 2VRBA 4HAUA 4PYMA 2GKSA 2J7PA 3IT2A 2FMHA 1P7YA 3SC2A 1Z6AA 5CDTA 4YC7A 1KNQA 1V11B 2H06A 2ACWA 3DFKA 1Y34E 2IEGA 1RKQA 5EA2A 3V4ZA 2ATEA 1JHZA 2J4FA 2OL4A 2PR2A 1VL1A 4CYMA 2CD9A 1EVIA 1UFKA 1BA3A 2JLRA 3M6FA 3N2KB 3TW6A 3OCXA 1P18A 2RKOA 1OA1A 3NXKA 3OZIA 4PY2A 4BMOB 5BWCA 3EEOA 1UP7A 4D8TA 3L0IB 2OV2A 2K4MA 2BFNA 4QG7A 2C7PA 4OQFA 3KHKA 4KMMA 2JCXA 4CFZA 2FSGA 4LNUA 5H4GA 1I7DA 1Q77A 1U5BB 1XKLA 2QLBA 3P2YA 5D5HA 5HMMA 4UM7A 5E1DA 4OHZA 2WW8A 1T2CA 2G4VA 2D3WA 3U19A 1JX6A 1FDSA 1G63A 2N1MA 2ZJ0A 3I9KA 4O4IB 3CY6A 2HA3A 2WWVD 4DCPA 3F74A 4OBEA 4KO3S 4WY5A 2QSUA 1CKEA 1QANA 3KAKA 3TQRA 1FYVA 1GTJ1 1M76A 2UZ3A 1ZD2P 2WTBA 3WLIA 4X65B 2FYTA 2WUEA 4OJYA 4EHAA 4G85A 4GUAA 3HYLA 3D0RA 3ZWDA 4D3ZA 4BQEA 3K09C 4X1IB 5FTWA 4UU8A 1TO1E 2BUBA 1SY7A 4RSGA 3ENVA 2GX6A 5LB2A 2QR5A 1LK7A 1ZGZA 2ID4A 1U2DC 3NDPA 3Q7PA 3V8BA 2IK8A 2ACKA 2P6NA 4JU8A 3TLYA 4D80A 3L0PA 1WBDA 4HZGA 2YH2A 3UAOA 4D6YA 2AD5A 3BH6A 3T5DA 3OOHA 1ZX1A 1G8PA 3L1KA 4MQFA 2XE6A 3SSOA 5AKEA 3U0BA 1B26A 1V8OA 4QA9A 5L3QA 4OJMX 1V8DA 2FCRA 1A4XA 4A6PA 2H1VA 3V8EA 1QP7A 3E81A 3H9UA 4DJTA 3QSYA 1ZMOA 5EIEA 4KMRA 4WBNB 3BDVA 3CLHA 3K1JA 1PNVA 3A4TA 4KN9S 4FDVA 2ZR9A 3BB1A 3B53X 4B2IA 4YRNA 1H93A 3AESB 3ZGOA 1L8OA 1V8BA 3MS4A 2BT4A 3X3HA 5IZCA 3EZ2A 2VRCD 1AE1A 3D6NB 2QM3A 1FNMA 4MWOA 4Z4FA 3NASA 3M4JA 5F7JA 2HMYB 4XOUA 4MP6A 3BRWD 3FDJA 5BQ5A 4S1NA 3PEWA 3L0OA 3ZX4A 1U2GC 3EZGA 2H1SA 3VGJA 3AP2A 4GRIA 3QG1A 5GVSA 2IU0A 4C4ZA 2GXSA 821PA 1NVXQ 5BUQA 1MGPA 2FZKA 2IZ1A 3GFRA 3UHFA 2QBYB 3WGTA 1PFYA 2DF8A 5JVDA 3UK1A 4TWIA 2VHWA 4MICA 5LFAA 4XFJA 4GKJB 4KMOA 1R0YA 4KZPA 1DEKA 1YRAA 2NVUB 5L4SA 3NOQA 4QBFA 4D8WA 4DABA 4J6FA 1P73A 4FHDA 2NU8B 1O9GA 4G63A 5HKAA 4RNCA 3KETA 2DCUA 5J9FA 4HN9A 3COZA 4MWBA 1N5LA 2ZJYA 3DHYA 1BYIA 5EXSA 1P33A 3V8RA 5KTYA 3WB1A 1XDBA 3NUZA 3ZH2A 4TRMA 4CTNA 4EW6A 2QS9A 4QUIA 1E9VA 3NP9A 1A76A 1KKUA 1XF9A 3GRRA 2XDQB 3N0VA 1VRCA 2Y92A 4GLLA 5EJFA 3WFZA 2A5FA 4QNNA 2YIDA 3THYB 3R6TA 4V3BA 1P2GA 5ITSA 5AHWA 5FF9A 1XR3A 2RDMA 3WLTA 4IKPA 4LOIA 4DR1B 4ZKDA 4ZT5A 1PNOA 5HUJA 1DBIA 3TNJA 4EF5A 3HO1A 2NQ2C 4UCXA 2RGCA 4HGPA 4MGKR 2DT5A 1XSEA 2IIPA 4Q6BA 2Y0DA 5ALPA 4LZZA 4EKDA 2OO7A 5E9AA 1GAXA 3JWEA 4KDCA 4KP7A 2PWYA 1QWSA 3K0BA 2FPUA 4JBLA 4PYRA 4DR5B 2QRVA 1TA9A 1ULZA 3FJOA 3WNZA 5AMXA 3B2QA 4AAYA 3WI7A 2AXNA 1EVJA 1ZA2A 3SNHA 3VR1A 1MIOB 2SKCA 1HGXA 1ORHA 2QAGA 3WYDA 4COOA 4QVKA 1BXRA 3AFIA 2Y1EA 1FMFA 1SC1A 5EJGA 1QFSA 1X2EA 5IN5A 3K71B 3WNDA 4AKTA 4MH0R 5C1BA 1NSFA 2ZTSA 1RQLA 2QDKA 4WOJA 1BWRA 3DZBA 1U80A 3NYIA 3JQAD 5NLLA 4A8JC 2ZRDA 4KBFA 2F1RA 2CFTA 2IYEA 1F9AA 4JSTA 1PZHA 3UW1A 2C5LA 3LWZA 1NQWA 2I6UA 2IPAB 221PA 2IL1A 2PBFA 2IKQA 2LR0A 3G2IA 4TVBA 3WBBA 3GOHA 4BZWA 3U7QA 1HC7A 4CMHA 5IDWA 1OXKB 2G71A 1PJ2A 1PF7E 1IXRC 2JJ2A 1Z2PX 1T9AA 3AU8A 1T8SA 1ZFNA 1SVMA 3Q4GA 1W4RA 1QIIA 4IG4A 4KV7A 5AIBA 4L2IA 2BGWA 2IHNA 1VPLA 3FNEA 4RELA 1GGKA 2HO4A 2B94A 4LYYA 1R6TA 2XUPA 1A9OA 1AC5A 4F2GA 4OY3A 1U0FA 2B37A 3SS8A 4C2UA 2X1VA 4RKFA 1FFXA 3ONNA 3GELA 4Y6RA 3H1TA 1GZ5A 3GDGA 3WAKA 2V7BA 1VL0A 5ALTA 4FVTA 3HR7A 2V6JA 1G4AE 3U62A 1AO3A 4GWLA 4M9SA 1JJFA 1YS7A 3G9UA 2TSYB 3PV0A 1UXKA 3REOA 1JECA 1A9ZA 2NM0A 5DP1A 2VPTA 3CJRA 1BE1A 2Q28A 1RYMA 3IQGX 2VNKA 2Q7DA 5JH7B 2WWYA 2CFCA 2IJGX 4C0QC 1RIIA 4BV9A 2QMOA 3ZGNA 5AJWA 3R5XA 3PQDA 5ICSA 1GJRA 2ZBPA 3DULA 5JJ5A 1E3QA 3VOTA 5C1DA 1RHMA 2W2NA 5ESRA 3W7BA 2ZSEA 4GPD1 3IP5A 1C9EA 3Q9NA 4NYIQ 4CV2A 4DSAA 4LW8A 3P94A 2G5GX 4NDNE 3U1TA 5DOVA 5IYZB 1GLNA 1I7SB 5E9QA 1LW7A 2AK3A 3CLKA 3DOUA 2ZWOA 1E2NA 1MG5A 2VJPA 4PGHA 5GTDA 2XOEA 4UTNA 1XRQA 2ZRKA 3AR6A 2DOKA 1OIXA 4FLMA 4PVCA 3OFNA 4DR3B 5JS1A 3MK31 5DNVA 1Y1KE 4M83A 5JSFA 4IDPA 1F17A 5JAZA 1G38A 1GGFA 3A10A 4I08A 2Y0BA 2F3RA 4K9LA 2WNHA 2DH5A 4RLQA 4UFOA 5DW0A 1BX3A 4CMJA 4JEMA 3U6KA 3DD5A 3WMFA 3TZKA 2XEDA 2XJ4A 4ZALA 2QSJA 1HT0A 5LZ4A 3AKZA 2X8JB 2GPTA 1USVA 4IILA 3NH9A 4HOYA 3C74A 3VPBA 1U2DA 3NHZA 4KGXA 2AQIA 3P9RA 3LO8A 5CCXA 3S5JA 1TT5B 3CVUA 4QDJA 2GAOA 4OH7A 4XQGA 4IP0A 5AJYA 2H4HA 1DO0A 2YNMA 3V7NA 1UOEA 3DPUA 2FFBA 1W88A 3OLCX 3T95A 3JTEA 1LH0A 1WTAA 3AINA 2P1ZA 1M1XB 1SNYA 2QF7A 1SXJC 4PSUA 2FFHA 1XALA 3QXJA 4NBRA 4D9MA 2J31A 2I6QA 5CD1A 4Q4JB 1JHDA 1SBYA 3MFYA 5LQUA 4FT4A 4M86A 3DPIA 3FSGD 4WCFB 4CG2A 4E1BA 5L4NA 1NVMB 2H48A 3BXPA 2BC9A 3KFLA 1RQ7A 1D8TA 1DLIA 1NONA 2WTMA 3ZIAD 3JRXA 4WQMA 2XE8A 4S04A 1FC0A 3AVOA 3EDOA 5I9BA 3ZHVA 4IIHA 3VDQA 3PEUA 5BXQC 5KQMA 1R4NA 3BFPA 1ZL0A 2Z43A 4B45A 1AN0A 2XCTB 2WINI 2PVSA 4YP6A 4ZU1X 1QAQA 1E58A 4I1YA 1ZOLA 1Q22A 5BWLA 2GERA 5BQOA 4Y0VA 2GJ4A 3WGIA 3AIMA 2B4QA 3OEHD 1FFSA 5HA5A 1PVDA 3JATA 1PT9A 2PHZA 1CQXA 3VTFA 1UPBA 5LZ5A 5TT1A 2GRUA 5ERGB 2ENUA 4IDOA 4Q82A 5FBRB 1E59A 2PKQO 3I32A 1K8RA 1WQ3A 4M7OA 2MSEB 5EESA 1HXHA 5KCMA 2NUAB 1NVFA 1WDTA 2P5UA 2VJLA 3EZ9A 3HADA 4TTVA 5COAA 5FUQA 2GCNA 1T3GA 3NHAA 2C7OA 4YRLA 2I1LA 3C4VA 3I28A 4NMXB 3JQPA 1K89A 3QOFA 4KQ9A 2AG1A 4JDUA 3CUEF 2FPXA 3Q11A 3E5RA 4WLVA 1DRKA 1GPMA 2EJTA 5FIUA 1OXTA 1WBJB 1F4VA 2J5XA 3FWKA 2AFVA 2RK6A 3GEDA 3UF0A 1FJ2A 1IHPA 1RACA 5EN4A 1K0FA 2AJBA 4YDHB 4H4CA 3SLRA 4EB6A 2IRWA 3OBBA 2JAUA 3SJUA 2PZKA 3D31A 3LCVB 3V34A 2R4TA 1MX1A 4CMKA 5I01A 1JW9B 3N0XA 5C18A 4IMPA 3GEEA 3ON5A 3VM6A 4W9MC 3WV4A 1RAEA 3B3AA 1V26A 1XZQA 4ZOAA 5EE3A 3R3UA 2AUMA 3UMJA 4RFVA 3B1FA 3V00A 4LNUB 3MLEA 3GMSA 3ITKA 4MO2A 4RA6A 1C7FA 2ZPUA 2OY0A 2G07A 4WK6A 4HJRA 3UXHA 1SZJG 2A7XA 2UVQA 3O26A 4MRNA 5EAIA 3WR5A 1SOWA 2ST1A 4A27A 1ZA1A 1T5HX 4I19A 4QPPA