3RUAA

Specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
341
structure length
336
Chain Sequence
YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords WbgU
publication title Specific recognition of N-acetylated substrates and domain flexibility in WbgU: a UDP-GalNAc 4-epimerase
rcsb
source organism Plesiomonas shigelloides
total genus 128
structure length 336
sequence length 341
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ruaA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3ruaA02
3B1JA 1E7QA 4QO8A 5G0TA 4EJ6A 1R37A 4GLOA 2G17A 4KUHA 3D5QA 4Y67A 3SEFA 1BGVA 2O3UA 3K2BA 4PLHA 1P1FA 3BAZA 3DB2A 4BL5A 2Y05A 3RUIA 1KY5A 4KP7A 3ZHXA 1Z7BA 1Y6JA 2CZCA 2OL4A 4IDBA 4Q3BA 2SCUA 3TOXA 3TZKA 3NDRA 3GZ4A 4JXKA 4BNYA 2W8ZA 3RFTA 4TRNA 3FWZA 5DP1A 1XCBA 4ILKA 2RH8A 1Y8QB 1LTHR 1EE9A 4ZQHA 1VJTA 4K26A 1E3JA 3IQDB 4XQCA 2O3RA 3JSAA 1ORRA 4II2A 4W82A 3TN7A 4GKVA 1BTOA 3QA9A 3BMQA 2O4UX 5F1PA 3VH1A 4DPMA 2NVBA 3H8VA 1PQUA 1NFFA 3S1LA 4FGSA 1UAYA 4BQPA 5IF3A 1W4ZA 2JAHA 3V1UA 3M2TA 1N7HA 3OP4A 4XA8A 2OFPA 6LDHA 1MXFA 4NBWA 5TLSA 1IL0A 1P31A 4ALLA 3OMLA 3U4IA 1G1AA 4GX0A 2C54A 4RVGA 3GMSA 3HFSA 4BNUA 4QSMA 2PTGA 2XAAA 3I5MA 4I5FA 4LRTB 3WXBA 1ISMA 4AJEA 2FR0A 3AWDA 4I1IA 1U5AA 1UDCA 4FGWA 3JYOA 4BO4A 4ND4A 1CYDA 3H9UA 1FDUA 3GNTA 3QLJA 2EHDA 5EQDA 4IQ0A 4BNVA 1GEEA 1YL6A 3AM3A 1IHYA 4DIOA 2I99A 4RF3A 1T2EA 4I5EA 2QG4A 4BNFA 4PLGA 5EIOA 2B5VA 1ZW1A 1UXGA 4FOSA 1XIVA 2DT5A 1UDBA 4Q3EA 4GVXA 1B16A 1AHIA 3GAFA 5EERA 5FI3A 3RUEA 5CDGA 1VLLA 1YE3A 3I6QA 3QRWA 4IDGA 2OBYA 2X7HA 3UCFA 3HADA 3RUHA 4Z0PA 2TMGA 4NDNE 1DIBA 1DIRA 5BNIA 4BVAA 4OSOA 1I2CA 2ZJ0A 3LT4A 2VWGA 3KZVA 3MOIA 1JA9A 4MVJE 3DTTA 1J6UA 4PG5A 2ET6A 3F5SA 4KZPA 1PQWA 1BRMA 1SB9A 2AE1A 2BLLA 3F9IA 3Q2KA 4E2YA 3MWEB 3DXFA 4MKZA 3U5TA 2QRLA 3D4OA 5KJCA 3TOZA 1IHXA 1F14A 2JHGA 3W8DA 2AA3A 3QWHA 4L8VA 1P1HA 4AJNA 1IUKA 3KEOA 1S7CA 4H15A 3GC6A 4GBJA 4FJ0A 1E92A 1VL0A 3D1LA 3KVOA 5FF9A 3E9NA 1TT5B 3OEWA 3MJ4A 4EITA 3CZRA 2BD0A 1K6IA 2V65A 4YT2A 2G1UA 5L4LA 3O9ZA 4UUOA 4RPLA 5JAQA 2BI8A 2IYPA 3DMTC 3RASA 2ZB7A 1PGQA 2YQ4A 2V6GA 4QFCA 5TRTA 4PLYA 3WGIA 1MP0A 4HFNA 4UUPA 3A28A 3JQ7A 5JYDA 4OOFA 3JYLA 3P2OA 4PLFA 2AE2A 3FWNA 2QRJA 4ZVVA 5TIIA 4PLZA 2VRCA 3H5RA 3RD5A 1IZ9A 5KVQA 3ROPA 4FBGA 4AJPA 5JSFA 5G0UA 1QYXA 4KMSA 1ISHA 3ZV3A 1EK5A 4HXYA 2X0RA 4QO7A 1BG6A 3FHLA 5TT1A 4BV8A 1E5QA 2HLPA 2OGUA 2HKIA 1PJCA 3PHHA 1VL6A 4GVLA 2YHIB 5JDIA 1TXGA 3DZFA 2AG8A 1PU2A 1GV1A 5JDIC 2WD7B 1JDJA 2CD9A 1QLHA 1PJSA 2VNSA 4XQEA 1Y8RA 1Z82A 2FN7A 2FPPA 2RH4A 1A7AA 1YVEI 3LU1A 1SZJG 1KERA 4R4JA 3DEYX 4CR6A 5IZ4A 2VYVD 4L9RA 4XRRA 3B1FA 4ITUA 3TJRA 3D3WA 4DLBA 2C59A 1ZIDA 4Y6PA 1DIAA 5I7FA 4ALJA 3ONDA 1E7RA 2IZ0A 2R6JA 2WMDA 2ZJ1A 1G6KA 5F5NA 2JCVA 2EEZA 3M2PA 4FFOA 3ICCA 4KUGA 2H6EA 3QVSA 1OMOA 2W4QA 8LDHA 3PFWO 4I5DA 1DB3A 3UHAA 4I9UA 4D44A 1ONNA 3X2EA 2X1HA 4HKTA 4D43A 4WUVA 1RYDA 2HAEA 2C07A 3G1UA 5CG2A 3LSYA 1JWAB 4RF5A 1NXQA 2YV3A 4RORA 1B14A 2ZK7A 3TZ6A 4AJKA 2BGMA 4WE3A 4BNWA 2VRCD 1PL8A 4WKGA 2DQ4A 3I23A 4RV9A 4EUHA 1EDOA 2EIHA 3ZWCA 1PJLA 4NNJA 4UVDA 3S2IA 4CQLB 5COAA 4Q3DA 3G3EA 4RL6A 5ER9A 5K0ZA 2H1SA 2X9VA 2P9EA 1LSJA 2Y1FA 2Q2WA 3LVFO 3RFXA 1P45A 4YA6A 1WPQA 5GZ6A 3WNQA 2PV7A 3V1TC 5FFFA 3ZWVA 3PZRA 3C8MA 2I76A 4KWIA 1AUPA 2VNAA 3AUSA 4UULA 1HWYA 3ZNNA 1NPYA 1WAMA 1BXGA 3GN2A 2UV8A 5A5FA 2GZ3A 3KETA 3UF0A 5COBA 1HLDA 1JU9A 1A9ZA 3IJPA 3PQEA 4XYEA 3EUWA 5L51A 3ZDFA 1C0LA 4YR9A 2QZZA 3WJ7A 5KIAA 3OICA 2J5RA 5L3ZA 1UZLA 4IPTA 1FK8A 4NJOA 3UUWA 2YJZA 2ZATA 4PLCA 3QV1A 3VVBA 4DIBA 4UUMA 3D4PA 5JS6A 3WLFA 1YB1A 1EBFA 1U8XX 5K6AC 4J7XA 3G0OA 4BNXA 1LLCA 1B8PA 2ZCVA 1EE2A 3NJ8A 4NBVA 1Y1PA 3PGXA 1YQDA 1BXKA 2GCGA 3A14A 3GGOA 1I32A 2GYYA 1H94A 3TSCA 1IE3A 1WNTA 3I4CA 2IRWA 2RIRA 2ZB3A 2EW8A 4MP6A 3VDQA 1MUUA 4KDEA 1JAXA 3WJAA 3KB6A 1Q0QA 5B1YA 5A4DA 3ONFA 3A4VA 4L0QA 4A26A 3PXXA 5EN4A 3ZV5A 3H4VA 4XRGA 1YB4A 4GWKA 4J90A 5H83A 3G49A 4W9NA 3HUDA 2JFHA 2UDPA 3FR8A 1IZ0A 3HN7A 1W73A 4W9NC 3C85A 4MIOA 1GQ2A 1WXDA 3NT5A 2X23A 2POQX 2VZ0A 3E5RA 2O2SA 3ROQA 2Y99A 3VPSA 4RVHA 1ID1A 1EUCA 4Y8VA 3JQ6A 3T4XA 1SNYA 1VRWA 3JD1A 3BMCA 3G79A 5HRUA 1C3VA 2FRDA 3JQAB 3ZNOA 2QYSA 4M54A 1I3MA 1W8DA 4BS9A 4CLOB 1MC5A 1UUFA 5I7SA 4ALIA 1ZMTA 1EQUA 4PGFA 1HT0A 1IULA 2DFDA 4EBFA 4D46A 3E9QA 5B4TA 2HMTA 4FC7A 2X58A 4CV1A 3TPCA 2X86A 5ER6A 5L40A 1WMAA 3ZGYA 1NVTA 4MVJF 4FFNA 2BHLA 2ZTVA 4WCDA 1NX6A 1ARZA 3BMQB 4J1NA 1TB4A 3DDNA 1ADGA 3UCEA 5G4KB 1U7HA 3PTZA 1NAIA 1HETA 1AGNA 4DIFA 3RCBA 3D5TA 4R9RA 3IS3A 3MCVA 4CR7A 3GH3A 3AK4A 3BHJA 4OGWA 4INAA 4PG8A 3I3OA 2X0IA 1ZKMA 2RAFA 1KETA 3AY7A 3KBOA 4UEKA 2X0JA 2VTDA 4U5QA 3F1LA 1O89A 2PH3A 2FP4A 4QX6A 3ITDA 3D3EA 4IUYA 4GX5A 3GVCA 4J91A 3T7EA 1H9BA 4E21A 4J1SA 5IDYA 3CMMA 3CXRA 4XR4A 3ITKA 2D5CA 2P68A 3CINA 1DLIA 3GUCA 4DMLA 4CMKA 3PDJA 4RPKA 3BMOB 2GDZA 3GGGA 4AFNA 2WD8A 3ON5A 4CM5A 3DBVO 4IS3A 3K30A 3K31A 4B4OA 1GU7A 4DQVA 3IC5A 1UXKA 1HYGA 1UAGA 5JAMA 3RI3A 1BW9B 4MVJG 1GZ6A 2WWRA 3I83A 1YL5A 2CUKA 4RVFA 1LQTA 3LDHA 3E6AA 1YS4A 1HEUA 3GOHA 3HWRA 1RWBA 1YDWA 1O95A 4DLAA 3RC9A 3DFUA 1LRKA 2C0CA 4J16A 2NTVA 5IN5A 3FBTA 3GPDG 3NX4A 3OQBA 3WGZA 4B8WA 4CODB 3RKUA 5CHEA 5BSGA 4OKIA 1GEGA 4XB2A 4N5MA 3CH6A 1CWUA 4Y98A 4BO2A 5MDHA 4MO2A 1KVRA 4BKOA 1ZK2A 1U9JA 4U6SA 4CJXA 2O48X 4UEJA 1QV7A 1SEPA 2AQ8A 3DOJA 3HB5X 3PLRA 3ZWNA 4D41A 1IPFA 4OXYA 3IKVA 1TEHA 2OMEA 1T4DA 3MEQA 4E3ZA 3HHPA 1PWXA 1I3NA 2CDBA 2NNLD 1Q0HA 2O50A 3F47A 4Y9DA 4HNHA 2W2LA 5TS3A 5KKAA 2BFPA 4JBHA 1A5ZA 1RM3A 3O38A 4MVJH 2CVQA 4DBZA 1U3TA 4MKRA 3ZNQA 4WEQA 4XGNA 2VOJA 1B15A 4WLOA 5DBGA 1QV6A 3KSUA 1MG5A 4LCJA 2EW2A 1IB6A 3HZZA 5IZCA 1BDMA 4BO8A 2WEKA 3TF5A 2VWPA 3OA2A 3N74A 5IZCC 4MIYA 4YAEA 4P4LA 3U62A 4LVUA 1XU7A 5T5QA 3DHYA 4WJZA 5A03A 4PG6A 3AOEA 3B6ZA 2I9PA 3PJEA 3Q11A 1PJQA 1P1RA 2PA3A 1SAYA 1LX6A 4CL3A 5KKCA 4U0KA 3WLEA 4NU6A 5CPBA 1DEHA 2VHXA 4HV4A 4XDZA 1DFGA 2DKNA 1U3WA 4RVUA 5TJHA 3EK2A 3DBLB 3QVXA 1WDLA 4B79A 3FTNA 4A10A 4P22A 4E4YA 4WASA 4GL4A 4ZJUA 1E6UA 3GVIA 5F5LA 4XZ3A 1A27A 3EDMA 1F0YA 5ILOA 2WM3A 3MJCA 4UVGA 1OOEA 3JTMA 4Z9YA 1NASA 4QECA 5EMHA 1J5PA 3OM9A 1BVUA 5JPIA 4DC1A 3ZHZA 4CLRB 1VPDA 3ZU4A 4JBGA 4OHUA 3SC4A 1KVSA 1GZ3A 3DZKA 2VT2A 5JLAA 1Z45A 3VDRA 1DO8A 1JAYA 1EQ2A 3RC1A 1L7EA 2B69A 2G0TA 2X4GA 4EEXA 2GASA 3HDJA 4DPKA 4CMBA 1YQXA 1SO8A 4E5MA 4HADA 4Q9NA 2NVUB 2HCTA 3CPSA 3JQCA 1RJWA 2GN6A 3D3WB 3KSDO 4O59O 4PLWA 4R1UA 4R3WA 3M6IA 4ZQBA 3ZWBA 2ZIZA 4CV0A 2W2LD 5TC4A 2XXJA 3FD8A 1GV0A 3K96A 4BNGA 1GQQA 3A1NA 1EUZA 3GEGA 3OIGA 1OC2A 5F1KA 3DO5A 3Q1LA 1LI4A 2BH9A 4ALMA 4GSLA 4YJDA 1NWHA 4M55A 1M2WA 2O2YA 3GMDA 3PDUA 4U7WA 1KOLA 2V6BA 2V7PA 3HDHA 4ZQFA 3VC7A 4BGEA 1LJ8A 1T2AA 3NTQA 2QW8A 4A2CA 3RBZA 2Y67A 3HSKA 4CM8A 3GG9A 4WLEA 5FYDA 1ONPA 5KCZA 2PKRA 1JVBA 5HS4A 1AHHA 4WOKA 1LLDA 3PI7A 3LF2A 4NR0A 3AFMA 3DONA 2EF1A 1T24A 3IP1A 4RDHA 1VC2A 1E7YA 3MTJA 3VH4A 3GZNB 4CMAA 1A72A 2RCYA 5JMWA 3INTA 3JV7A 2EJWA 3SC6A 2CDAA 3DBRA 1DIGA 4RQUA 5LDGA 3NJ4A 4RF2A 3RUDA 4FOOA 4YACA 1PL7A 4CM4A 1HDRA 4BQRA 3KRTA 3MWDB 1XHLA 4DLLA 4OAQA 1D3AA 5DCUA 1LA2A 1ENOA 5DBIA 3GT0A 2D8AA 1HTBA 3IMFA 2PZJA 2NWQA 4MVJI 4BMNA 5EJ2A 4UREA 3I9LA 3TRIA 4GX1A 3OJLA 5I7EA 1UJMA 1R4NA 1I36A 4BGIA 5CFZA 4ZU3A 1C1DA 2AW5A 3BTUA 5U4QA 1AN9A 4CMEC 3NTOA 3F46A 4RZIA 4CQMA 2B4RO 1BVRA 4CMIA 2Q49A 4RDIA 2JHFA 2ZTMA 2HDHA 3NKLA 3QVTA 4YJHB 1E1KA 1MB4A 2W90A 4R3NA 4EW6A 3ETDA 4EJMA 2YV2A 4AVYA 1DAPA 1KVQA 1KBZA 1NTOA 1NQOA 2NADA 3DMYA 1LEHA 3AI2A 4TZKA 5IAAA 1V3VA 1FDTA 1NYTA 2I6TA 1O6ZA 2CF5A 3NT4A 1LSUA 5JCXA 3FPCA 5G0SA 1QMGA 4L73A 1RM0A 5JCJD 1E6EA 5ADHA 3F5QA 4RO0A 2UAGA 5DULA 2I3GA 5JY1A 2OZPA 1M6HA 1GZ4A 2DBQA 2RBEA 3OJFA 5DCYA 4K1LA 1NNUA 4ND3A 3KUXA 5EPOA 4R16A 1GPDG 3GDFA 2PH5A 5JMPA 1EVJA 3D7LA 1I3KA 1F06A 2EKQA 2Q3EA 3JQ8A 4TWRA 4PFJA 4CLDA 3QY9A 5IDQA 2VWHA 3LT1A 2XPCA 4RLSA 2GN8A 2VZ9A 4BNTA 1V3TA 3WOHA 5JY6A 2HMWA 3U4HA 1E3EA 4JJFA 4PRLA 3ENNA 3VPXA 5HBRA 1NVGA 3JYPA 1E3IA 4O6VA 3PZBA 2JL1A 4I8XA 4ND1A 4NJMA 3WQSB 4ALNA 1H0KA 1CQIA 1UZMA 3ZU2A 1L7DA 5G0WA 1U2GA 2BFMA 4OSPA 2GRAA 1HE3A 5TJ9A 1FJHA 4JJIA 4Y6RA 4JLWA 3V8BA 2R2GA 4UVIA 1KYQA 4B4VA 4ESOA 3DTYA 4QXMA 2O7SA 4NBUA 1SCUA 3KEQA 3KXDA 5THQA 4R5MA 2HUNA 2DBZA 3OJEA 3UICA 1YQGA 1T2CA 5JXWA 4H16A 2RHRA 5KWEA 1ZFNA 1CERA 3COSA 4CUJA 4J0EA 4J7CA 4TRRA 4Z9FA 2AXQA 4OKNA 3WYBA 3S55A 3TFOA 4K28A 5IDXA 2B4TO 1ZK4A 1K6JA 4ZRMA 3CZMA 4B3IA 1FXSA 3VPFA 1LDYA 3ANMA 5A9RA 2A92A 1YH3A 1R0LA 4IBOA 3CSDA 3BMNA 4OQYA 2C5EA 3INGA 3I9KA 3KV3O 3HQ4O 3WFJA 3H3JA 4UEOA 3WIEA 3N7UA 2ZB4A 3GEDA 4YAIA 5AXCA 2PD3A 4HWKA 5HA5A 3WFIA 4KUEA 4AJ2A 4P4GA 1M67A 4DYDA 3WB9A 1DBVO 4XYBA 3BIOA 5DP2A 4YRBA 1MV8A 1D7OA 2AQKA 3AY6A 1BDBA 2GZ2A 2IZ1A 3C7DB 4JX8A 3STHA 4BNKA 2W2KB 3FCOA 1NQTA 1F12A 3JQGB 5B4VA 4URFA 1CEQA 3AU9A 4K6FA 5CG1A 4J4BA 1SMKA 2OO5A 1H2BA 2PD4A 4J0FA 5L4NA 2EP5A 4C4OA 1HKUA 4C7KA 1BXZA 1ZK3A 1BSVA 3R0IA 1ZZEA 3LQFA 2VHWA 2VUTA 1Y5MA 4WCFB 4JP3A 4NFSA 4FSHA 5JC8A 1PZEA 2QIOA 1E77A 3SXPA 3U49A 1H5QA 2IZZA 1KC1A 1XSEA 3KHUA 4N54A 4M49A 3WGQA 2YFQA 3V2HA 3OSUA 2J3IA 1K5HA 3L9XA 4NH4A 4IDCA 4BHTA 1NFQA 1P0CA 4RPHA 3Q9NA 3IIEA 2J5QA 3TZHA 3V5NA 5LDHA 4L4SA 1UP7A 3WQQA 3GK3A 3QWBA 1HE5A 3DZGA 1F8GA 3GRPA 1R12A 3FBGA 1Q1NA 1GL3A 5I7VA 2GUGA 2WE7A 1OI7A 1E7MA 4MP8A 3AM5A 4KQWA 4W4TA 4E5KA 5I9LA 4F6CA 5F3RA 1R4MA 4YJFB 2DAPA 5DOZA 2WE8A 4CM3A 1NVMB 3O26A 4HFRA 3FPLA 4MP3A 5C7LO 4FFPA 3ONEA 1YBVA 3T7CA 5ITVA 2J3HA 4QFDA 1R16A 1ML3A 5DDIP 1K89A 3JYNA 1WLYA 2EWMA 3PGJA 1WW8A 1ZEMA 5I9MA 1I2ZA 5KNLA 2NQ8A 1FF9A 1V3UA 2CF6A 2DUWA 1VKNA 4WNCA 1TVEA 1X7DA 1E3LA 2C82A 3NGXA 2CNBA 2NTJA 1Q2XA 4XD2A 4YAJA 3O8QA 4EDFA 3UOGA 1ZMOA 1QRRA 2DVMA 1DXYA 3HE3A 2Q4BA 5TF4A 1DC4A 3ZWXA 3RFVA 3IAHA 1LRLA 4HP8A 1GUYA 2Q4EA 3S2FA 2I5PO 4NBTA 2NSDA 2G76A 5AXAA 1HSZA 3KSZO 4J3FA 4J4HA 2ZQZA 5TT0A 3RJ9A 3ADPA 4YAKA 1AE1A 4GMFA 3K8ZA 3M1AA 3P19A 2GO1A 5I9NA 3OIDA 3PJFA 2NUAA 1YOVB 1H6AA 4YAGA 1ULSA 2YZ7A 3KYCA 1CF2O 2B5WA 3H9EO 1N9GB 1DC6A 4RZHA 3PYMA 2GR9A 4CM1A 1ADFA 4OQZA 2VHYA 1X14A 2VHZA 4DMMA 2WYVA 2YDYA 3K6JA 4G2NA 1GPJA 4HBGA 1YDEA 1MFZA 1BWSA 2VQ3A 4N5NA 1RYEA 3I52A 5THKA 5BT9A 3C1AA 4YTEA 4OYRA 3INRA 4R1SA 4DC0A 2YFHA 4L75A 1DC3A 4AL4A 4IGFA 1E3WB 1V9LA 3UCXA 4TKMA 3ZWWA 4BGVA 1H2HA 1PZHA 3MJEA 1XR3A 1QYVA 4AICA 2W98A 5EQFA 3OQ6A 1WMBA 3DBHA 1B26A 3BXXA 4YT5A 4BNLA 3C3XA 1I30A 3MJVA 2DUUA 1U8FO 4D7AA 1LXCA 3BTSA 3E5MA 3QP9A 3KYDA 3SLKA 3CTMA 4H7PA 2FSSA 2FY8A 5A9SA 5CDYA 4IY1A 3HFGA 3RUCA 2PGLA 3VH2A 2VYNA 3B70A 1NM5A 3CKYA 4CM6A 2PZLA 1O8CA 5AQ1A 3RBXA 2CY0A 5K9ZA 1ENYA 3UGKA 1E1LA 1ISIA 1DIHA 1EVIA 4L74A 4RCVA 4A27A 2VOEA 4XGIA 2Y66A 4CPDA 3RVDA 3CIFA 4PLVA 1K6XA 1PS0A 4ND5A 3HNPA 3I9MA 2J8ZA 4LISA 2D59A 1A9YA 1GYPA 4FFRA 4RLHA 2ZYDA 4YWJA 1EMDA 3W4JA 1Z7EA 4QTZA 2ZCUA 5CDTA 2WTBA 1UR5A 1PWZA 1GADO 2P4QA 1PS9A 2Y0DA 4RPJA 3TL3A 4UVEA 1VSUA 1GYRA 1SB8A 1LSSA 1DJNA 3FNHA 4TROA 3ULKA 3PIDA 5L95A 3R3SA 4LMRA 1MX3A 4BOYA 2A4KA 3VZPA 3GFGA 4OMUA 4M87A 2Q1SA 1U2DA 3SJUA 4GGPA 2CDCA 4YJGA 4GI2A 5T6BA 3ZW8A 3WR5A 4OO3A 5CAEA 1U5CA 3LZ6A 2BRUA 2O3TA 4YDRA 3DZBA 3C1OA 4MJLA 3JD4A 5L7YA 3QE3A 2B83A 2ZYAA 5AVOA 3E9MA 3JQ9A 1HLPA 1X13A 2VZ8A 1JTVA 1R0KA 3B20A 4R51A 2Q1WA 3U0BA 3ASVA 4Z3DA 4IDEA 1L1FA 5FEUA 5BQFA 1XG5A 4RQTA 1CETA 4EJ0A 4XJSA 4E0BA 1XLTA 5KVVA 4E2XA 2UVDA 2NQTA 2VYND 4M8SA 1I33A 2GGSA 4LN1A 2EGGA 3WYEA 2NVWA 3VKVA 2Y0CA 1XEAA 1HRDA 3L07A 3GUYA 1LDNA 3ADOA 4CLEA 4O0LA 4YQYA 4R54A 1IOLA 4ZGWA 3SVTA 3IKTA 4NU5A 1A71A 5BR7A 2NU6A 3W4KA 4W7IA 2BGLA 2BGKA 3TQHA 4A5OA 5B4UA 4LRSB 1H93A 1W6UA 3ZHBA 2HK8A 1UXJA 1QP8A 1JN0A 3AW9A 2PGDA 4WGGA 5DF1A 4J6FA 1ADCA 1LNQA 4CM7A 4DUPA 1VE9A 1ZSNA 1U3UA 4YVFA 4RPGA 2Y1EA 1Y8QA 4II3A 2F00A 1E7SA 4MPDA 4E33A 1PGJA 4LSMA 2D4AA 4QUKA 2DLDA 3AU8A 1O0SA 2YQ5A 1X1TA 5DZSA 4BNMA 1LUAA 3JQBA 1DPGA 3VTZA 4F46A 5JFOA 4L76A 4XR9A 2X0NA 1FDWA 3GF4A 3TZQA 3JQBC 5BSFA 3ZU5A 3A06A 1HF3A 1EUDA 1SPXA 3JD0A 4TVBA 2D3TA 4D3FA 2VUUA 4FW8A 3KTDA 1PJ2A 3L4BA 3GDGA 1WWKA 2FR1A 4YT4A 3BTVA 5KTKA 4HNGA 1RPNA 2OHXA 3L4BC 4QT0A 3K9QO 2ZTLA 5LCXA 2HO5A 1ZSVA 1T2FA 1Z74A 2IODA 3ETEA 4OXNA 3S2EA 3U4DA 3KYBA 4EI2A 1EBUA 1HYEA 4WEOA 4QQRA 4BUCA 3CE6A 3PWSA 4R68A 1IY8A 2J6IA 2VN8A 3P5SA 5A04A 1QSGA 1PEDA 1GUFA 3EYWA 3ZH2A 4CL8A 3E03A 1P1JA 3C7AA 1YRLA 1PGPA 2FZEA 3GN1A 4WLNA 5T64A 3ST7A 5JYEA 3QWFA 1E6WA 3HB4X 4DGSA 5KOIA 1QXSA 4TSKA 3GAZA 3ANLA 3ROKA 1HDCA 4NG5A 1YL7A 1KIFA 4G65A 3L0DA 2DC1A 1UH5A 1ULUA 4YRDA 3WBFA 5J23A 1XGKA 3DOOA 4WLVA 3FTPA 2C2YA 1XWFA 1P0FA 2B35A 4FDAA 1B3RA 3B1KA 3U09A 3NDJA 4BNJA 4NK5A 4J2OA 1QR6A 1EEHA 3Q9UA 3NYWA 1M66A 4ZD6A 3TL2A 1X7GA 1V0JA 3RKRA 1ZEJA 1GTMA 4MVJM 1B2LA 4I5GA 3VOSA 1NBOA 2NACA 2ZTUA 1S6YA 3JQ7B 6ADHA 2NU7A 3AOEC 1I01A 1VKOA 1ENPA 1TT5A 2NU8A 2FOIA 5AOVA 2E6UX 1RM5A 4GAEA 3RWBA 3WMXA 4E12A 1E1NA 4KTVE 5B12A 4D45A 5IXSA 4CUKA 4E2WA 3E82A 3K92A 4J43A 5TGDA 3ABIA 5G0VA 2B0JA 3EMKA 3LT2A 3AUAA 4K6CA 4ZQEA 5CP8A 3PIIA 3F4LA 5L9AA 4DA9A 4BMVA 1T25A 1ISFA 2HMSA 1KEPA 3FN4A 1FDVA 3F4BA 1Y8RB 5C3MA 1N2SA 2Q1TA 4BB6A 5DT9A 1C0PA 5F1OA 1H9AA 3KM0A 2D1YA 2V6FA 3WTBA 1F8FA 2O3QA 4A73A 4IMRA 3NEPX 2ZQYA 5CPFA 4CMHA 4CM9A 3OJ0A 4AJOA 1MLDA 3SJ7A 5HS6A 1M6WA 1R0SA 4JJGA 2QYTA 2WD7A 1MFPA 1LSOA 1E7WA 1T4BA 1GR0A 1NFRA 2A9FA 3Q3CA 1HDGO 4PVDA 4YT8A 4WNIA 3ZU3A 3ZWPA 1ZK1A 1ZUD1 2I65A 3AI3A 1ADBA 3O4RA 4E5PA 1LDMA 3OBBA 2PLAA 2IEBA 3VKUA 4D0RA 1XKQA 4LK3A 4B4UA 1X1EA 2A94A 3W8FA 4CV3A 5IDWA 2HMUA 1J4AA 1NP3A 1GQYA 3EZYA 3N58A 3GNQA 1ZO8A 1I8TA 1LLQA 4F6LA 3P7MA 4YB8A 4Q3CA 5T57A 4FB5A 3VTFA 2FR8A 4ND2A 1ZXLA 2D5AA 2E48A 1LDEA 2X8LA 1SOVA 4FJ1A 3DZHA 4FFMA 5ICMA 4IJVA 5A1TA 4D0SA 3FF4A 1OAAA 1PZGA 1EVYA 1UP6A 1ENZA 4WLFA 4HFJA 1GAEO 1YO6A 1Q7GA 5TNXA 1BMDA 1X15A 3K2EA 4IMPA 3AI1A 1WDMA 4XIYA 3ZV4A 3BTOA 3AOGA 3RJ5A 2DM6A 1BXGB 4HY3A 1G0OA 1NHGA 3ZV6A 4E5YA 1NR1A 3KLMX 4XB1A 3FNGA 4XEHA 5L53A 3SX2A 5L4SA 1ZXBA 4NMHA 2JFGA 1P1IA 1SOWA 1WP4A 3LT0A 3QVOA 2LDBA 1JWBB 4CQLA 4F45A 1PJ4A 3GEMA 4CV2A 2QHXA 2AMFA 1VL8A 4MINA 1P33A 4R41A 5CDSA 2YV1A 2Y1GA 3QHAA 4B7UA 4CM9D 3ZW9A 1HL3A 4E2ZA 4JBIA 4NPCA 3WDSA 1D4FA 3PJGA 5ICSA 2IXAA 3AUUA 4AJ4A 1QKIA 4PVCA 3L4SO 1PX0A 1HDZA 3GNSA 1T2DA 4Q39A 4R01A 1DRUA 3PFFA 4E6PA 5CEEA 4MOWA 1YKFA 4NFHA 2DBVO 3F6YA 2Q1UA 1VM6A 5A05A 2IDZA 1HE2A 1NPTO 3CEAA 4YYZA 4K9DA 4A7PA 3RUAA 2Q99A 2AQHA 5L45A 4OJNA 2FHSA 2GN9A 5AYVA 5U1PA 4IJUA 4TMFA 4PCVA 4D3DA 4Z0TA 3WQRA 2VWQA 4A0SA 4I9HA 4OIMA 1CIVA 3C1TA 1JKJA 5HM8A 5U9CA 1PR3A 3BMCB 4U6QA 4UAGA 1LC0A 3PHIA 5TX7A 3PWZA 1PSDA 1GFSA 2OORA 2HJRA 1DRVA 2VUSA 1HDOA 4UVHA 1G0NA 2H63A 5CEJA 3VZSA 5A02A 4W6ZA 1DHRA 3H9JA 4J7UA 1A7KA 2HMVA 4GPD1 1XELA 4XQGA 1DJQA 3SBOA 4DWVA 4GWGA 3V1YA 4Y6SA 1I5RA 2BMAA 2J3JA 1R66A 1I3LA 2AG5A 1C1XA 2XOXA 1GCUA 2NTNA 3R6DA 5A3VA 1WZIA 2QX7A 4CQMD 5I8ZA 5ITWA 3JQAA 2HSDA 5DN9A 4CLOA 3NT2A 3S8MA 1DHTA 4EYEA 4AJJA 4IS2A 1UDAA 3ZWYA 1DC5A 2Z1NA 2NU9A 4QEDA 2UUPA 4AG3A 2DU8A 4FN4A 1SC6A 4LMPA 2X9NA 1DDOA 2OP0A 3U3XA 1LBEA 2ZYGA 4GQAA 5KVSA 3RU7A 1ZBQA 2PWZA 5EESA 2DTDA 3BA1A 5G4KA 1J49A 3JD3A 3PVZA 1PQPA 4IQGA 3WNVA 3WWZA 1ZK0A 4I9NA 4ZQGA 3VH3A 2PKQP 1Y7TA 5BNFA 3WSWA 3DWFA 2AHRA 4MDHA 3PQFA 4N18A 3FSRA 3NTRA 4ROSA 2EV9A 3FNEA 4BO3A 1HSOA 4E30A 5LC1A 1CJCA 4CMGA 4XYGA 1HXHA 1R15A 1E1MA 2XXBA 3QWIA 2DBRA 4B4WA 2VHVA 3AY3A 4UUNA 1KVTA 5EL0A 3VAZA 5BSEA 1I0ZA 4IJWA 2Y0EA 2DPHA 4Z9XA 3OJOA 3BMOA 3FNFA 4J9VA 3TWOA 1XA0A 4DQXA 4HUJA 4Z6KA 3GVHA 1VJ0A 2XF8A 3L77A 1QYDA 3H5NA 3NV9A 4ID9A 5FWNA 2Q50A 3UKOA 1BW9A 4NIMA 1NR7A 1V6AA 2EXXA 3JQAD 3L9WA 1X0XA 2IXBA 1V8BA 3ROMA 5DOVA 3V2GA 2Q46A 2PY6A 4C7JA 2I67A 2G82A 2YUTA 3D64A 1GYQA 4WOJA 2PGJA 2WDZA 2VTEA 3OEYA 3LF1A 1DFHA 4GGOA 1DFIA 3QW2A 1XU9A 2H5LA 3VPHA 2ZB8A 2CVOA 4RGBA 3FRJA 1NQAO 3O03A 2X9GA 4X54A 2EKPA 3G1TA 1LLUA 2AEMA 2PNFA 4FJ2A 3VZQA 5A06A 3R3JA 2VYVA 5KJFA 2OUIA 1UP4A 1ZVMA 4TRMA 4EUEA 4HFMA 1N1EA 3PPIA 4TQGA 4IIVA 2CMDA 4I08A 3GLQA 4IXTA 1N7GA 4CLXA 2LDXA 2EJVA 4Q3AA 4AJ1A 4PLTA 1YONA 1ZCJA 2FPGA 3C7CB 1IYZA 3QSGA 2IE0A 3DL2A 2FPIA 3IUSA 4BNHA 3DMTA 9LDBA 4GH5A 3RAJA 1T26A 3IOYA 1LRJA 3ZWAA 1K0UA 4ZICA 2A35A 5JO9A 4PN3A 3IL2A 1EK6A 4BO6A 3GG2A 1GUZA 2JKVA 2P2SA 1D1TA 1ZJYA 3ETGA 5T8KA 2O3SA 3DHEA 1K2WA 4CMCA 4BMSA 3JD2A 3H2SA 4NZ9A 4U8GA 5T8KC 3VPGA 3MOGA 5KJEA 4WECA 3UFXA 2E4AA 2DTXA 2PZKA 1OBFO 4MVJP 4OL9A 5BSHA 2HJSA 3DR3A 3DBLA 4LSWA 2Y93A 2YW9A 1Y81A 2C2XA 1HDXA 3AJRA 4N7RA 4IINA 1LDBA 3PYLA 1JQBA 3HDYA 4JROA 2Y1OA 4AJLA 1KEWA 1YWGO 4TKLA 3MJSA 3OFSA 2Q2QA 3AUTA 4D42A 5L7TA 3JQEA 4G81A 3AFNA 1NHWA 3H65A 4CLRA 4FPXA 5DNAA 3P2YA 4KQXA 2EG9A 4NK4A 4BKUA 4IIUA 3VVCA 3G17A 2D2IA 2GZ1A 2AEFA 2R00A 4WK6A 3H3FA 1OZAA 4BB5A 4BO0A 3H6KA 4R1NA 2DPGA 2R00C 5HWSA 1ISGA 3IJRA 3PJDA 4E32A 1HE4A 4CM8B 3RU9A 2NVUA 3JCZA 4IZIA 1BHSA 1HZZA 4IZHA 2I3AA 4LW8A 3U9LA 3ZNPA 4P8RA 1R6DA 4R9SA 5BNTA 3I6IA 1LC3A 3GVXA 5ENVA 3OHSX 5JBIA 1P44A 1PJ3A 2Z5LA 1Q0LA 1D1SA 2C7GA 2GD1O 3DFZA 4PLPA 4TVOA 4DQUA 2V6MA 4CR8A 1PTJA 5ENDA 1WZEA 3H5AA 1EFLA 1RM4A 1XDWA 4DVJA 2P5UA 3DBRB 2VT3A 3W6UA 3F1KA 5KJ1A 4R1TA 4YBZA 1KEVA 1QYCA 4AJHA 1TI7A 1ZNQO 1CQJA 3WICA 1KY4A 1I2BA 2FSVA 3UN1A 3WS7A 2P4HX 4BGUA 1ONOA 4FC6A 5H81A 4CM4B 4FQ8A 5AXBA 1UXIA 4BNZA 1DSSG 4ZHSA 2PKQO 4PIVA 1UZNA 2Q2VA 3BHMA 5I8WA 3H9GA 5GY7A 3UW3A 3BHIA 3RIHA 1JKIA 3KOUA 3LC2O 3DZJA 5MGBA 3A9WA 2FMUA 3QIVA 1T1SA 4GLLA 2BI7A 3DHNA 3PHLA 3PQDA 1VSVA 3GZNA 2D0IA 2C29D 4Z0HO 5JE8A 3RSHA 4BIIA 4DXHA 2OOSA 2ILTA 3L6DA 3LC1O 3PHJA 4GX2A 4OM8A 4Z3KA 1R4NB 5JAZA 1N5DA 3PWKA 3RC2A 4G5HA 5G4LA 1C1DB 3NAQA 2GF2A 3GGPA 3HG7A 3PK0A 4IM7A 4YCAA 3ZN2A 1LU9A 3QQPA 4B3JA 4NFYA 4CQMB 4AJIA 2C7VA 4NBRA 4CMIB 5JDCA 3KO8A 4JQCA 3W4IA 4EUFA 4NI5A 4XCVA 5JDCC 5FI5A 4ONEA 2HQ1A 3GFBA 4E5NA 2PR2A 4CMJA 1OFGA 4MKXA 1I24A 5JW6A 3VZRA 4DPLA 3JQDA 3DOCA 3E18A 4KTTE 3I9NA 1MG0A 3GDOA 4JGBA 5C7IO 4D3SA 5K6AA 5A5EA 4KOAA 2B37A 3AM4A 3GHYA 4H3VA 1QYWA 1MXHA 3IP3A 3GVPA 4YJHA 3WX0A 1PR9A 4ZN6A 3JQ9C 5CEFA 1O94A 3EW7A 1U4OA 1PL6A 4ZRNA 1FDSA 1GD1O 3MJTA 4P38A 1ZJZA 2QRKA 3ENKA 3JQ8B 4JK3A 2JAPA 3GPIA 4XDYA 1MA0A 3WGOA 3Q0EA 3IUPA 4DREA 1SBYA 5A3JA 1W0CA 3RUFA 1O9BA 1N1GA 1XQ1A 2BELA 4XQ9A 4BKRA 2YDXA 4WLUA 9LDTA 4TZTA 1M76A 1HDYA 3LLSA 4NJMB 3GQVA 4O1MA 3VHRA 1E5LA 1P3DA 1C1XB 3EHEA 4LCEA 2ZKLA 1TT7A 4CLHA 4OH1A 4BNNA 4D79A 3RQSA 2G5CA 3CMCO 4BKPA 4J9UE 2C5AA 3DQPA 2P9CA 3DC2A 3E1KA 2Z1MA 2YYYA 3PLNA 1IPEA 4JCOA 1XQ6A 2J3KA 4XGKA 4S1VA 2E37A 4BKQA 1KEUA 2O3JA 2O23A 4XYLA 5A9TA 3NUGA 3RBVA 3W6ZA 1PGNA 1OC4A 3DAGA 3QWAA 3EC7A 2GNAA 3EY4A 4L4RA 4PZCA 2UUOA 1Y9EA 5L7WA 1QG6A 2UYYA 1P77A 3LLVA 3BZUA 1P1KA 1MGOA 3WBBA 3BMNB 2GSDA 4DBVO 2X6TA 3E48A 3GR6A 3TFQA 1LQUA 4FIZA 3WGYA 4PRKA 4EZBA 4U0JA 4DYVA 1MC4A 3BYZA 5KVCA 2P9GA 2P91A 5AXDA 3U4CA 1YBAA 4MVJA 5TSDA 4CUZA 1A4UA 4HX5A 3WSVA 4FD3A 1Q7BA 1UXHA 2X5JO 3EAGA 5GMOA 3ZHYA 2IYOA 3HDQA 3GY0A 2Y68A 3I9JA 2WSBA 1FMCA 1Z75A 3DAFA 3R1IA 3HJAA 2JFFA 1JW9B 3LK7A 2OXIA 7ADHA 1GY8A 2VCYA 2OBNA 3ZZNA 2VRBA 3MZ0A 4RVSA 1PJBA 4YPOA 4EGFA 1NAHA 3PYXA 5DBFA 1D8AA 2GPTA 4B7CA 2AQIA 5JO0A 2HK7A 3WGGA 2AEJA 2EKLA 3F3SA 3GRKA 4OOEA 5B37A 4BNIA 1T1RA 2WYWA 4YXFA 2JD2A 1B7GO 4KWHA 1Q7CA 2J5KA 2X22A 4XIJA 1XYGA 3I1JA 5IJZA 2P5YA 2W2KA 3JQGA 1SEVA 4J2HA 1M75A 1Y5RA 4FS3A 3HN2A 2E49A 1V35A 3GHHA 4ALKA 3T4EA 2IEDA 1E0DA 2GN4A 3WG9A 5IXYA 4M86A 4WCFA 3ANNA 3NGLA 4L4XA 4XWYA 2I66A 4BO9A 2YY7A 4DRYA 2Y1CA 1R4MB 3OA0A 1C0KA 3C24A 1TA4A 4IJKA 4WCFC 3WYCA 5IG2A 1EZ4A 1DOHA 2JJYA 5DCWA 4DTIA 1PGOA 2CSUA 1CRWG 3ASUA 2O7QA 4R69A 3V2UA 1U1IA 4S3MA 1ISJA 2PZMA 1YBMA 2DFVA 4O63O 3H2ZA 3ORFA 2FWMX 2B4QA 1B3BA 1B8VA 4WPGA 1KVUA 3TNLA 1DLJA 4XYMA 4MVJD 1EFKA 1JKFA 2Z95A 2B36A 3Q6IA 3H9QA 3WGHA 3O8QB 1GDHA 4YJFA 4EEZA 1ZH8A 3W8EA 3DZIA 3EGOA 2BF7A 3E8XA 1ZSYA 3NRCA 4RJTA 4IQ8A 5KJ6A 1JVSA 4MIEA 3ICPA 3ZI0A 1X7HA 3WGTA 2PD6A 3OF2A 4R5HA 4O5OA 4JP2A 1Z6ZA 3RC7A 2WYUA 4M1QA 3IDSA 2BKAA 1KC3A 1YJQA 5COQA 4RVDA 4YRAA 2EP7A 1E3SA 1C14A 3KYCB 4GMGA 4IDAA 1QORA 3L6EA 3ZWOA 1U3VA 5IN4A 4FR5A 5C7OO 1I10A 1TLTA 2X5OA 3Q2IA 3UH1A 1DRWA 2YHIA 3WWYA 3QVWA 4J1QA 4B3HA 2JCYA 4W99A 5JC1A 1Y9AA 1NPDA 2PFGA 2TMDA 3WTCA 3K5PA 3UAGA 4JNKA 3ZWMA 4J1TA 1U28A 3GA0A 1QLJA 4XX0A 5C37A 1AXEA 4B7XA 5H82A 3UXYA 1Z73A 1B0AA 4FFLA 4E31A 1YOVA 3OH8A 4IDFA 1H6CA 3JQFA 3NDIA 4TRJA 2NLOA 3LYLA 3OECA 2H9IA 1N9GA 3OQ1A 4JN6B 4PG4A 1HYHA 4YEDA 5EINA 3JQFC 2EERA 5ES3A 2NM0A 4RF4A 5JNLA 5F21A 1CDOA 1PZFA 3DAPA 5TQVA 1PS8A 2FZWA 3DBHB 3LC7O 3UVEA 1AXGA 1RKXA 2HK9A 2QZ9A 8ADHA 3CUKA 4KDFA 5JAIA 4LGVA 3FR7A 2HU2A 1DAOA 2JD1A 4BO5A 5ILGA 3JYQA 4NQZA 1B8UA 3KYDB 4PZEA 1NQ5A 2HRZA 1JLLA 4LVCA 5HTOA 1VI2A 2DTEA 1GCOA 3OETA 4P4NA 5A9SB 3L6OO 2JD0A 2QQ5A 2O4CA 2PK3A 4GKBA 1E3WA 2E82A 3PRJA 5JCJA 4F3YA 1C0IA 3EVTA 2RHCA 1U4SA 4BO7A 4Q3NA 1N8KA 2EGHA 4XJTA 3OIFA 1P9LA 1EDZA 4BV9A 2Q45A 4A03A 4B8ZA 3I9OA 4PG7A 3EVNA 1H6DA 4W7HA 3PEFA 4FCCA 4J49A 3W1VA 3EZLA 4ZA2A 4DL9A 4E13A 1J0XO 4IGEA 2GERA 2YHUA 2CVZA 5GZ3A 1U7TA 1P74A 4IXWA 4PZDA 2OP1A 4N5LA 3WIDA 3M1LA 1PIWA 3ZCXA 3PHGA 4IDDA 1PJTA 5C5IA 3PP8A 1EVZA 4YJGB 5T67A 2NV6A 3FI9A 1KS9A 4XKJA 2JCXA 4CMEA 1YXMA 2Y1DA 1YB5A 1A4IA 1HZJA 2BFAA 1X0VA 2HRBA 3SLGA 7MDHA 1F17A 2WJPA 2F1KA 3D4NA 3I4FA 2X5KO 4JIGA 3D0OA 5IFLA 1H6BA 1O5IA 4YQZA 3K73O 3S2GA 3MTGA 4BO1A 1LDGA 3QJ5A 4J4TA 3WMWA 3TZCA 2BFOA 3H7AA 4M89A 3KLPX 4OXKA 2CFCA 4GSKA 4NHEA 1WDKA 1VJ1A 1NWCA 1WVGA 1YGYA 5G2OA 3TDKA 1YJ8A 1K3TA 1N92A 3RROA 2C20A 3X2FA 2GLXA 5GZ1A 5CDUA
chains in the Genus database with same CATH superfamily
1AUQA 3RV4A 2P75A 2P2NA 1WUJS 1Y9JA 3H1FA 3CH5A 2OM2A 3GJ4A 4EJ6A 4JI2B 3UC9A 4RQBA 1OFIA 2G17A 4GLOA 4KUHA 2OORC 1VFNA 4Q1EA 3OOJA 5CX1A 1Z4JA 1PN3A 2QRNA 2WKQA 4M9UA 1XFAA 2V03A 3TSOA 1BGVA 4I5IA 2V55B 2CL5A 2NU6B 3KPUA 1CLEA 1CK4A 2BDTA 4ZV7A 1KFKB 3BAZA 2VQDA 2VK8A 4QGAA 4JR1A 4B84A 5BXQC 5IU6A 1KY5A 2B21A 2QTCA 3QM1A 2O5RA 4AWAA 1LJLA 1XRMA 2GNOA 1FFAA 1Y6JA 1OVMA 3CLSC 4JSRA 2BTOA 2SCUA 4HH4A 4PEVA 1UBEA 4JXKA 5JQWA 1L7RA 3KOMA 3CJRA 3HKBB 4BNYA 1U1EA 5HGXA 4DMKA 4TRNA 2C7OA 3QVMA 3D7KA 4ILKA 2CKDA 4P35A 4HJXA 4QASA 4BCDA 4G0ZA 1GTZA 1N6HA 1COWA 3VNRA 1D6SA 1RAEA 1W5FA 4KLAA 2FDXA 4NZPA 4ZQHA 4F91B 5J5CA 1VJTA 3TB6A 4X20B 4B82A 1XMPA 1KK1A 2A7QA 2MWMA 3BBPA 3QHQA 5FOQA 1JXQA 1QIMA 3HJBA 4II2A 3GLGA 3PQ6A 2H07A 1QK5A 4PZAA 4NE7A 2O4UX 1DWPA 5EXDA 5KNDH 4NULA 2X77A 2JCSA 3QBEA 4CODB 3OX1A 1V48A 4FGSA 5DT2A 3S1LA 4BQPA 4CKCB 2I91A 2TECE 3BIFA 2AFHE 3CBQA 1C30B 2DH5A 5BSWA 5B5SA 2OAQ1 2XGMA 1BKDR 3OMLA 1G1AA 4QOSA 3CZ5A 3K0AB 1EWKA 5FCDA 1HRKA 2DG2A 2ZREA 3HFSA 3Q88A 1LI7A 2JEZA 2PTGA 2R97A 3OOEA 4LRTB 1ISMA 2FR0A 4I1IA 3UMCA 2W93A 1JU4A 2EZ4A 4N82A 3BRSA 1UDCA 2NUBA 4QAJA 4FGWA 1JSLA 1WV1A 1XZCA 2YMLA 4KLNA 5FUWA 3EDYA 3IKJA 4U3JA 2QVLA 4WNAB 3O91A 3TH5A 4RK4A 1FW8A 1C9MA 4DIOA 1YB6A 2IP2A 4RF3A 1PT9A 4PBRA 1JYSA 3VISA 3QK7A 1T2EA 4I5EA 5CA0F 2FB9A 2QP4A 1DELA 2QY9A 2OBBA 3D6AA 4HO1X 4PLGA 2AXEA 4ETWA 2XNDD 3RC3A 1UXGA 2O8NA 3CJQA 3FOAA 5AVJA 2CXUA 2DT5A 4FKMA 1NSFA 1B16A 2B6HA 2Q41A 1YACA 2OHFA 4Q3EA 4BWVA 4Q93A 1VLLA 1EG2A 5FOSA 3UTCA 4PX5A 1KWKA 4IXDA 4CTOA 3UCFA 3HADA 3OZAA 3DF9A 3DMFA 3ETLA 1DIRA 2MMCA 3RYHA 4COKA 4D82A 4OSOA 1TZMA 1EJ6A 1NU8A 2QVGA 2ZYTX 4V2IA 1NTRA 3V32A 4EG3A 4EGAA 3MOIA 3DTTA 3L46A 4JLNA 2PTHA 4U7HA 1GA6A 1XMOB 4A2WA 4L7QA 2ET6A 3EXHB 2CBXA 2G9QA 3S6JA 2R6DA 5DJ5A 1ZVKA 3CCFA 3KQYA 4MKZA 1GQOA 4MYDA 4C4AA 4DNPA 1A4XA 2JRCA 3D4OA 1TKBA 4KPGA 1IHXA 2JHGA 1ORHA 3H83A 3W8DA 5B64A 2G88A 2VSXA 4LRXA 5CM2Z 1WDTA 1CZHA 3ZU6A 4EOGA 5IX8A 3SKVA 4UE2A 2NU7B 4WT7A 2IU4A 1E92A 2QAGB 4YX9A 4G23A 3VR0A 3Q9LA 1R64A 1IN1A 4Z86A 4EQ6B 3NLLA 3A6ZA 3QYJA 2HC9A 3TBHA 1K6IA 5D00A 2G1UA 1ZLYA 2RSLA 3O9ZA 4KAFA 1XEFA 4RPLA 3DMTC 2IYPA 4UHBA 3IFSA 5F5XA 3RASA 2WQ6A 1PGQA 1XDBA 2V6GA 2WUDA 1JG3A 1TJNA 2ADFA 4KB5A 3PX3A 1OU4A 4XWWA 2R3SA 4G0PA 3VR1A 1OFHA 1XDUA 3I2GA 5K0NA 2HNKA 4HFNA 2PSSA 4JL5A 1T8YA 4YRGA 1S4QA 4OOFA 1YZGA 2AI2A 2O8DA 2W58A 4PLFA 4ZVVA 4X00A 2NZYA 6GPBA 4F7WA 3E0XA 1LTKA 1G1MA 3A8TA 2XEDA 4BECA 3PQ4A 3D8UA 3RYCB 2J31A 3GRZA 3HXTA 2H9AA 1U0OC 1QYXA 1ISHA 3ZV3A 3ZHUA 5BP7A 3LQ4A 1BG6A 1YE5A 4MV5A 4HH0A 2I7XA 1E5QA 2HLPA 2QJWA 2ATEA 4NOMA 4X7PA 3AP3A 3PHHA 5EMNA 3RG8A 3FFXA 3HMQA 4GYWA 1Y3AA 2YHIB 1HLFA 2H00A 4ZV9A 4PPGA 5EIBC 4Z4IA 2AG8A 1PU2A 2PT6A 1QGUA 2GPYA 4Y2SA 3D2CA 1TOAA 1ZX1A 2GTHA 2CD9A 5K0FA 1NC1A 5L3RA 1Y8RA 2FPPA 3C14C 4KRGA 4X1YB 1A7AA 1YVEI 1AKYA 2P11A 4J0GA 2MCFA 3TVTA 3QJYA 5ANRB 1QP4A 3MLAA 4CL2A 3H2GA 2P7HA 5HE8A 3ZW7A 1D5WA 4L9RA 2ZWPA 2XQJA 5LYYA 1SRQA 2WWTA 4ENUA 2BUCA 3TZLA 4DLBA 4QXRA 1ZIDA 4CF3A 1STOA 1V16A 4IICA 1U8CB 5CCBA 2JLXA 2R6JA 3L1JA 1Z8NA 2JA1A 5DGXA 5BVGB 3WADA 1IHUA 2VPZA 4NYMQ 3RSQA 3VOTA 3SHQA 1N9KA 2FLWA 1IK6A 2JCVA 2PL1A 3M2PA 1OLOA 3I5YA 1E1QD 3QVSA 3IV6A 3ZJTA 8LDHA 2R5FA 3F6PA 3RDPA 4QELA 4YGXB 1UJNA 1WJGA 4OCZA 2CKMA 1EESA 3LO5A 2OQIA 2VNJA 2EJUA 4D44A 4EGSA 1IJBA 4OX9Y 4DMUB 2CHVA 1BJRE 1EFHA 5BXYA 1RYDA 1OREA 2PH1A 3BDAA 4R9UC 3RVNA 4TLCA 1G21B 3NR2A 1B14A 2ZK7A 3BJEA 3W5JA 2BM1A 4F6RA 4WE3A 3N9IA 2F3TA 2G9ZA 2VRCD 2VNIA 4WKGA 3SX0A 4PC2A 4ZI7F 5HKKA 2DQ4A 1XRSB 1E2LA 1E2FA 1XTBA 1RXIA 1L5HA 4OF4A 1PJLA 3AF1A 2PPLA 2G5GX 2FFAA 1EFRD 4KIFA 3NONA 4Q3DA 4V03A 5ER9A 2OB1A 2XDQA 1E2BA 2P9EA 3A1FA 5H4HA 4U39A 5KOHA 2EP8A 2JBAA 3KOOA 4UBKA 2GAJA 2OAGA 4QUAA 1RADA 3KG2A 2V58A 2NAFA 1PT8A 2ZR0A 1JP7A 3ZWVA 1TU4A 3KSRA 5EJGA 1NV8A 3PZRA 3FDXA 1EZ1A 3QVJA 5CT4A 3NIBA 1K98A 3B3AA 1PNVA 1NPYA 4WOBA 1EFVA 1WAMA 3A1EA 2K5UA 5A5FA 2GZ3A 1G3MA 3LHDA 3WISA 2AL7A 1A9ZA 1NY5A 2ZJ6A 2HY7A 3ZCVA 1E99A 3IJPA 1E4EA 4JMPA 2BEUB 2C3UA 3F5FA 1XF1A 3IXMA 3IDZA 2ZRKA 1GGEA 3UG7A 3VR6H 2IXDA 3BHNA 4ZK6A 2CLFB 3AW8A 4PXAA 1R5NA 2RGCA 2WKSA 4G5GA 5L3ZA 3WAJA 1CG6A 4WXYB 1QBGA 3UUWA 1QHHB 3MTQA 3Q72A 2YJZA 3P20A 2ZJFA 1K8ZB 3PPYA 2NNWB 1CFJA 2ODPA 3L1UA 4UUMA 4DIBA 3WLFA 2C1ZA 2XVAA 5EE3A 3RHFA 3P9ZA 1K3UB 2BFDB 4NLLA 3G0OA 2CNDA 3H13A 4WBNB 2PGNA 4NBVA 3D59A 3FSGA 2P2CA 4URHA 4RKQA 3PA8A 2PMFA 5PGMA 4FHZA 2QUJA 3CG4A 1EPUA 4A16A 4MUMA 4MRMB 1QAMA 2X1VA 3KT8A 4I9GA 1QH1B 3I4CA 2IRWA 3KT6A 4FHEA 4N1AA 5THQA 3VDQA 1CQXA 1U31A 3IHTA 3I3SR 4G6ZA 1JHUA 2JASA 4MUXA 3W1WA 4YRPA 1M0EA 4Y1EA 2CCJA 2E2WA 5A4DA 3P52A 4IKEA 3A4VA 4L0QA 5ULLA 1ZD9A 2P3SA 4P58A 2SKDA 4YJ3F 4AY5A 1QZTA 3FYDA 3BXEA 3FPEA 3G49A 2QLMA 3M6XA 2UDPA 5H83A 4C29A 1FP4B 1X80B 3BXFA 4MWSA 1NBMD 3S2SA 1YRYE 4HK4A 4EB0A 2PKWA 3C85A 4B32A 2AWOA 5K09A 1NSYA 3N3BC 4MIOA 1WXDA 4CKEA 1D5CA 2X23A 2XIQA 3M5DA 4MHOA 3I28A 2XWQA 3FFAA 4UW9A 3EG5A 3VPSA 1V47A 2FPOA 2H9YA 2IYSA 3G0CA 4Q7KA 3TG8A 1RI5A 1YHNA 2KW5A 4C06A 1SNYA 1SCIA 3BMCA 3DLPX 4OUKX 1C3VA 1Q22A 2QYSA 1YA8A 3OO1A 1KRHA 1W8DA 2VVTA 1MC5A 2Q3CA 2X8JB 1Z6TA 3IYLW 3ZE2B 4CLOB 5CCEA 4YJ2B 1P9RA 5EWMA 1Y5IA 3GUHA 5DSZA 5B4TA 3C4QA 2HMTA 4PPNA 3AEKB 2FQWA 4QPPA 2X86A 3QW4B 1USKA 3IBFA 2CMKA 2W4IA 5L40A 3ZGYA 1KQFA 1NVTA 3RNOA 2BP7A 1LTQA 2ZTVA 2W2MA 3ZY2A 5FBZA 1ARZA 2R1TB 4TMTA 3FX2A 2O0MA 3UCEA 1TAHA 2H59A 4G5QA 1H8EA 5EJMA 4GKKB 1HETA 3NALA 3ZEIA 4M9QA 1AGNA 2D2XA 3CVXA 1H23A 5BPFA 5HRAA 4KK4A 5JIBA 1TFUA 3IS3A 3PQ8A 2G36A 1NURA 2GARA 4MARA 4E1BA 1IZZA 3DNPA 4G0VA 1U8YA 1O57A 3WGLA 1X92A 3GEPA 2RAFA 3AY7A 4LZWA 4UEKA 3OJCA 3OE1A 2JCBA 1IPHA 4AO6A 4X94A 4B9AA 4YMSA 3MUOA 5IYZA 4LRYA 5F1YA 5LIPA 3F1LA 3ZYCA 1KJYA 3J80A 3HA7A 1KOGA 5GOZA 1ZIOA 1NOKA 1TYCA 4FYMA 2F3PA 4QVGA 1G4UR 5FQNA 3WV5A 3EEFA 4IUYA 3SSMA 1YZNA 2IP4A 2Q4DA 4P31A 1EFCA 1C4OA 2I55A 4G0YA 1H9BA 3CXRA 1CD5A 2POCA 4BCCA 2P68A 4POAA 3X44A 4IIYA 3PNSA 3X0DA 4F38A 4HAXA 4AFNA 2E4ZA 4IJQA 3A31A 3IVXA 2CFRA 1UANA 1HMYA 3GLGE 3OE7A 5F2NA 1WCXA 4MWGA 1X7XA 4HXEB 1UKZA 3IC5A 4J94A 1UAGA 5A6SB 5JAMA 1NI4A 4L5AA 1BW9B 1DEKA 3WAGA 4G9BA 3LXUX 4U2CA 4L02A 1KYXA 1GZ6A 4WXHA 3L92A 3C5WP 4QUEA 2H65A 5SY9A 1KRXA 3OIUA 3V1LA 5MN6A 3HWRA 1C7FA 4O0MA 3SSNA 4KAXA 3DFUA 2ZG6A 1VHDA 3PFBA 3A6PC 3CVVA 2NTVA 5IN5A 3AJEA 1PF7E 3OQBA 1AY0A 4RV4A 1P2BA 1P4GA 2KSQA 1CY6A 3N0WA 2M6LA 4NMXB 1K92A 4BLWA 2VJLA 4H1TA 4J0KA 2GM9A 1JEQB 1LBHA 4EYSA 1ZK2A 4B48A 4IJSA 1FYFA 1NG1A 1NVAA 3DE1X 4KNWA 5E3IA 1SBNE 4BFXA 2O48X 2JLVA 2Q8PA 3PLRA 3G0BA 2IUSA 3IULA 4M1TA 3WWPA 3WLKX 3IKVA 1TEHA 3C6KA 5I01A 3JAKA 4BJ5A 2BGUA 2I6XA 3OKFA 3L8CA 2CDBA 4RKRA 1Q0HA 1ZY2A 2NNLD 1BEEA 1NZFA 1ZKDA 2O50A 3SC2B 1N5JA 3W05A 1Z4NA 2W2LA 3KVYA 5KKAA 5TS3A 5KHLB 3PEVA 4NCHA 4QYTA 3EGDA 4MVJH 5A62A 1ZUNA 1IATA 5EAIA 4IUDS 1QFMA 2FPGB 4UU0A 4MKRA 5HK8A 5K5EA 3CVYA 4QU0A 2IHYA 4C6RA 5MFZA 1EP1B 4BE7B 1FRQA 3L1HA 1B15A 2YIMA 1N8TA 2YV4A 3T7IA 1QV6A 2AYYA 1PD0A 3DVAB 3P2EA 4LCJA 2NPOA 4GICA 5FPTA 4GL2A 1BDMA 4QOGA 4BO8A 2WEKA 3TF5A 5K0EA 2Q8NA 3GCWA 3OQJA 5BUQA 1NNI1 2XADA 4EB6B 3OZGA 4ZZ1A 1RWKA 2ZRGA 2C9DA 1XZFA 2C5GA 3FIUA 4LVUA 5BMVF 2IV7A 1OH8A 5EPUA 1C8VB 4KNVA 1M5TA 3KFXA 4R81A 3QI2A 5LP6B 1DAGA 3KOWA 3PF9A 4TTPA 3WLEA 5KKCA 1II8B 3EF3A 4NU6A 5KVAA 3HK2A 2VHXA 3R44A 3IMGA 3U3DA 2AF3C 2CYCA 3NRJA 5EWJB 1G98A 4JB0A 1WDLA 4Q7JB 4TUYA 5ICEA 3D6FA 4BDTA 3FTNA 4A10A 4Z1MA 3F6RA 1QK3A 4GL4A 4WASA 4ES6A 5F5LA 2F62A 4QDTA 1YMQA 2CLKB 1R5JA 3A6DA 3E7FA 3EDMA 2YWDA 3L01A 4LYAA 4PONA 5DMXA 5B1SA 5LJLA 1AKEA 5HMMA 4RY8A 2MSLA 4B6OA 2QRZA 4Z9YA 3OESA 1NASA 2EFJA 4FKZA 4QPCA 5CD1A 4QECA 4C3UA 1J5PA 4GOOD 1XXHB 5AVZA 2UVQA 3PIRA 5HKBA 5EJAA 3BSWA 1FYEA 2PSEA 1ZJWA 1KEZA 2V96A 4JBGA 2R8XA 4OHUA 2PRYA 2L17A 4Y6OA 3IOCA 4XWTA 5IAEA 2CZQA 4PCAA 1NVUQ 1JKXA 3B5JA 1EB9A 2V6JA 1F6BA 3DZKA 1PHRA 1Z45A 2GPBA 3GEIA 3H0KA 4G1UC 1HDIA 3ET5A 4MR8B 2DUJA 2B69A 4MROA 4EEXA 4DPKA 2BONA 1OT5A 7YASA 1N2EA 3O0DA 4KR3A 4G1VA 3IUJA 4R8RA 1C2TA 1IEWA 3KSDO 4R1UA 3VR4H 4DCVA 4H1UA 4TT3D 1JF8A 5K0JA 2ZIZA 3KKKA 4I8DA 4LPSA 4P83A 4IJ6A 4PFSA 1GV0A 1G6HA 4IH9A 3RTGA 2RGRA 1V9SA 3R5KA 1EUZA 1ACLA 3GEGA 3OIGA 3PLAE 2JC3A 5D1NA 1WXIA 3THWA 1OC2A 1GA4A 5F1KA 1XPRA 3UJBA 1T8SA 3FCYA 2BH9A 3DUFA 4ALMA 4GSLA 1TADA 2VDNB 5JNUA 2WV7A 3MF4A 5EQTA 1M2WA 2O2YA 1G3IA 4C22A 3T3NA 4RQAA 1W1IA 1IHPA 2HRQA 2JIDA 3C8ZA 4RETA 3U80A 3U48A 3VC7A 1A97A 5D6OA 4ENPA 4YRJA 2QW8A 2COKA 3HSKA 4WLEA 3PFNA 4REMA 2AC7A 2FSFA 3H2JA 1T9CA 1ONPA 3IP6A 1XZLA 5E1OA 3HZOA 5HF5A 5KCZA 4HAUA 3ZYZA 3LF2A 3LG2A 1EHCA 5C34B 4LDPA 3MTIA 3DONA 4ZODA 3OAAD 1I1HA 5LXTA 4G0OA 2NUTA 1ZH2A 3KJIA 1QYIA 4A8PA 2QD5A 1PR0A 3FPKA 1NVVQ 5DNYB 3GZNB 3FE2A 2XH8A 1A72A 4RS4A 4KOEC 3QITA 4CMAA 5JEEA 3LTNC 4TKVB 4M3NA 1X1RA 1J8MF 1JDBC 2QE7D 1NP7A 4K1XA 1G16A 5ALPA 1NKVA 3M6UA 1ZS9A 4ZEOA 3B6KA 1OAOC 4O25A 2PMEA 3D6HA 4KR9A 3ZHRA 1M1NB 1PL7A 3JALA 1AKQA 4CM4A 1E32A 1HDRA 1OE0A 5BMOA 3MWDB 2EFDB 1XHLA 5TPWA 5SZKB 3B1VA 5AK0A 2HTFA 3AHGA 5FO0A 2GYUA 4YQFA 5KNCH 1EFPA 1XQWA 3RJTA 2RIPA 1JHYA 3L0SA 4M1YA 4YRIA 2NXJA 5J47A 1B8OA 3O4IA 3VKHA 3ESAA 1FQJA 4DKJA 2B1GA 2JAXA 5H3LA 3DMDA 2JI7A 2WUEA 3DD1A 4M8IA 3IAAA 5HFNA 3WYDA 4PBSA 2PUTA 4BMNA 5JH7B 1I7QB 1GAWA 3I9LA 1JX6A 2E4XA 2IIPA 3B78A 3TRIA 1CJSA 1GNPA 1SQ6A 1ZU5A 5KQMA 3OFJA 1YFJA 5I7EA 1T0IA 4QATA 1J1ZA 4ZO9A 1ZN9A 5KTYA 4RHTA 2RGUA 4OAOA 5BSUA 4AG5A 3G2IA 3NTOA 4DUGA 3KIPA 2N42A 3PUXA 1GLGA 3HBMA 5GJWC 3YASA 3V4SA 1W0KD 4YJHB 2BW0A 3G9ZA 1M6EX 1MB4A 1ZMRA 2W90A 3Q1KA 4R3NA 4X91A 4EW6A 5ITZA 1Q57A 3ROZA 3O84A 4N5DA 3HACA 3QA3E 1SUPA 1X1AA 1Y98A 2XAUA 4R8KA 1FQKA 1QDUA 5IW8A 5IUKC 2NADA 1W5SA 5D86A 5CFLA 2NYUA 3KQSA 4HLCA 3OFVA 1U6KA 2VI5A 4IFIA 4KODA 1NYTA 1TF5A 3FPCA 4BFCA 2IIVA 4L73A 1RZRA 1RM0A 3EZ2A 4FKBA 2RAUA 4IW3B 4L8GA 5HMLA 4R2JA 3WB2A 1I6LA 5DULA 4IHAA 3T6KA 1SU4A 2OZPA 1A1SA 1P0PA 4FWBA 3JRNA 2OVFA 4NHOA 1U7OA 1TCBA 4K1LA 1NNUA 2JFWA 3TX2A 4ND3A 3WLSA 3O5AA 3AXSA 3KUXA 2ISSD 3Q10A 1VKRA 4R16A 3II6X 3ORSA 4TMVA 5AJUA 4GPAA 5IARA 1ODIA 4LC9A 4FGJA 4A2CA 3R9XB 1T5LA 4B6SA 1TLLA 1EWYA 1NY6A 3GDFA 3RK0A 4NENA 5F76A 2JZNA 2QE6A 2RHMA 2PH5A 4HRAA 1VI6A 1EVJA 5K3AA 5H80A 4OKSA 3AUXA 1F06A 4S24A 3LNCA 4M83A 5JALA 4KXUA 2C1XA 5FIUA 3INNA 2WSSA 4CNBA 5DM0A 2RDMA 2XPCA 1J20A 4JI4B 4P3PA 1DQPA 1QQAA 3EIHA 1S89A 4BNTA 1Q50A 3MBOA 3CVJA 1KFBB 4MULA 3ENNA 3M9LA 3G89A 3W9SA 4F5DA 2QGFA 2X14A 3LPCA 4QU9A 1E3IA 2PL5A 4TKUB 3LHFA 4B33A 4CQJA 5KTPA 4O6VA 1R8YA 1XD2A 1ZUWA 1Y7PA 1U9ZA 4I8XA 3CKLA 2IELA 4NJMA 1H9CA 4AZWA 2V7EA 5AKHA 5BYBA 1XEWX 2I7CA 3HABA 4F2WA 3AIMA 4CVNA 4OL0A 4ALNA 2IS4A 2E85A 4KE8A 2QTBA 5EEGA 1CQIA 3UMVA 5LLDA 1UZMA 4AW9A 2MSNA 5G0WA 1VE7A 4EKEA 2QSZA 2GLUA 4IX1A 4LZJA 1PKEA 2BFMA 1QHIA 2GKOA 3TMKA 1M7HA 2GRAA 1FJHA 4IOLA 3V8BA 1RE0A 2XF2A 2AH5A 4HVTA 4UVIA 4B4VA 3E3OA 4OHKA 3TD2A 3WQHA 1QIHA 3AF0A 1AKWA 3DTYA 3MWJA 4GPBA 4PSKA 2NZJA 1EK1A 5EE9A 3B2EA 2WM2A 3OJEA 3VXKA 2DQKA 3T54A 3PITA 4ZMBA 5JXWA 1QS0B 4ZVKA 5CIYA 1KK3A 5MGNA 2XXAB 1KI7A 4ZOBA 1CERA 1VQ1A 1XMVA 1XTJA 3NEJA 1KMNA 4TRRA 1XZBA 3O73A 1ZQ9A 2FSHA 3CN9A 3WYBA 1L4HA 1UK8A 5A4JA 5B53A 4C4PA 2W6JD 1J56A 1ZK4A 3PCTA 1TC2A 1O6CA 2FEXA 3ANMA 1YQTA 1IQUA 2F3RA 4V24A 5FTKA 4OQYA 1PRYA 4HDNB 3T7RA 2AZXA 5EYPB 1ZVJA 3PB3A 1GKYA 5CMLA 1DJPA 2I3BA 2WF9A 4J0JA 2IGBA 1OX5A 4TLDA 2ZI5A 5BOVA 2PD3A 3IX7A 2V4ZA 4KUEA 1TA0A 3DJFA 3HY3A 4ZOEA 5ECWA 3UMYA 4DYDA 4BPBA 1E4YA 3NXSA 2WVAA 4GSYA 4QQ8A 1QNFA 3B36A 1QKJA 1M0WA 1BDBA 1J97A 5ALOA 1KTIA 4JX8A 2GA8A 5JCOC 1N34B 2OLEA 2GTPA 4GMHA 2H2HA 3PKIA 3W6PA 3GPLA 3ZEAA 2XGGA 1GNLA 2IGTA 4FU0A 3LQ1A 3IE1A 2Z04A 4YFYA 2AJCA 2D3WA 5CB0A 1ZU4A 1BSVA 4XXHA 3WYAA 4D8WA 1BFDA 4RIEA 4NDAA 4AKEA 2D1FA 4JWTA 4AQYB 4OUDB 4BUJA 2QIOA 1GQFA 2WG1A 3NC4A 4OTZA 3U49A 3V33A 2QVXX 2B8TA 3EXFA 1TZKA 5FBRB 3MUEA 3OKCA 4UZFA 8GPBA 1L4UA 2RGEA 1EXDA 4NH4A 1XPOA 3BORA 1SXHA 5I45A 3ZCPA 3DJYA 3HV2A 1IM8A 1N4DA 3V55A 3V5NA 2AHOA 1ECJA 4MS1A 4ZAZA 4URXR 2XQFA 2FPWA 3DZGA 3K6RA 4C3OB 4KN9S 4DV5B 1O77A 1W29A 3N0RA 3OI7A 5DRTA 4UDOA 4HVCA 3SVLA 5A7FA 1IDOA 4F9GA 3E9RA 3NOOA 5SZJA 2XVXA 2H5IA 2WE7A 1OI7A 1E7MA 3AGPA 3AM5A 3NZEA 4L4YA 4MP8A 5F3DA 4R71A 5I9LA 4F6CA 5IKPA 2BEVB 5JWRA 1E9DA 4NC9A 2XDAA 4KFCA 3GLHE 4P7KA 2IBMA 1QPZA 3KYIB 5BWMA 3OEEA 1ULBA 3PT5A 2XT0A 4P5DA 3WXMA 4QFDA 2CJYA 2QP9X 1R6XA 1Z6YA 3O8DA 1V8FA 1KO1A 2I22A 3BD7A 1G41A 5JAUA 1WLYA 1UJ6A 5JARA 1WW8A 1ZEMA 3N2ZB 1NJ1A 3IV7A 3D3JA 5I9MA 4A1OA 2YL2A 4L3VA 1U1CA 2Z4TA 3V3TA 3VRHA 3WRXA 3V2IA 3SEQA 4C78A 3C3YA 4WCVA 2DUWA 4FUQA 2VJMA 1VKNA 4WNCA 4GP6A 3V80A 2LPMA 5GAJA 2BFCA 2QLJA 2JFPA 4XIIA 2EJTA 1YVRA 4EDFA 4EPWA 2BZSA 2GCOA 4PZ0A 5C80A 1Q3KA 3DLHA 3AVUA 1DXYA 2QTHA 1JMKC 4MI9A 3RFVA 5ALZA 3RYFA 2WT8A 1GUYA 2ZT5A 3M6VA 3CZPA 4JKYA 1YA4A 3S2FA 1RFGE 4L5CA 4EATA 1JHVA 4O1HA 1JXOA 2CN1A 1K6EA 2NSDA 4OB6A 5AXAA 2JJ2A 2KMLA 2ONKA 1Z6XA 3EGEA 3HUFA 4X6LA 4F1KA 5FBQB 2A9JA 4YAKA 2BJHA 1AK2A 4GMFA 4P3KA 4E4RA 2A1UB 4KIGA 1FU8A 2WIDA 1JHAA 1KR5A 3G8CA 2JI4A 3GUVA 1KZGB 3OIDA 2PSDA 1KSGA 1JNXX 2X2EA 1G4HA 3WA6A 2B99A 2IEGA 2ZUTA 4BBZA 2AUTA 1H6AA 4ASUD 3GBSA 4YAGA 1N2CA 5BR8B 1ULSA 2X5NA 3IXQA 4PIMA 5BSTA 3R4VA 1P7YA 2H51A 1CIPA 2IHTA 2WABA 3FKJA 2A9PA 3HL4A 4OFBA 5FJIA 3RO7A 5KOJA 4RZHA 2RHBA 2Z30A 3DYVA 1CCWA 3FI0A 5EUMA 1WE2A 5KAPA 3UH0A 2ZVPX 4JUAA 2XGSA 1GCAA 3I2HA 3MXTA 2BKUA 4F4JA 3TLGA 2FW9A 3DWEX 1OXBB 3IILA 3C3KA 1RYBA 2RGNC 1T8WA 1HOTA 4NCBA 2VQ3A 4N5NA 1ZINA 4KLZA 2H1VA 4E2FA 1Z08A 1OSNA 3VM6A 5C1IA 5BT9A 1NE2A 5LZ9A 1E0JA 1G5HA 2PBFA 3JVEA 4I50F 4ZMSA 1BX1A 3SDSA 3WNBA 4IIJF 1NMXA 2IL1A 2IWHA 4ARVA 4DC0A 1P0IA 1D2CA 2D2VA 4AL4A 1VZ3A 3FVQA 4BGVA 4MJ3A 4RMGA 1T5OA 4Y2GA 1XR3A 3E05A 1XKXA 3HS3A 3OQ6A 4WACA 1WMBA 2FF5A 3COPA 2ZRNA 2QMQA 1YK1A 4HUQB 3R0XA 2G0NA 1XEXB 4GZ3A 3BTSA 2NUPA 3BC1A 5A4IS 4KSCA 3KYDA 2BISA 3BE5A 4IIGA 1DP4A 4ARBA 4IVNA 4IY1A 1C4KA 3R24A 2JIRA 5BW8A 1W36D 3ACDA 4JEIA 2VYNA 4U9IS 1NM5A 3CKYA 3IPLA 4CCWA 5DRYA 4L08A 4J1GA 4Z2AA 2E4VA 1L5WA 4ETMA 5K9ZA 1ZJ4A 2GBIA 3LA8A 3VU3A 1KR2A 2M6KA 1ISIA 4A6EA 5D8DA 5CFPA 4FZ3A 1PYDA 4WESA 4L74A 2EW1A 4YGYA 1UQTA 2R8OA 2VP5A 2VOEA 4AG6A 4ADSG 4ZCSA 3FPJA 3QY0A 1ILEA 1U2SA 4KQMA 4IWYA 3DH0A 2GD2A 3HKEB 4QUHA 3SD7A 3HNPA 4CF7A 4AQ7A 4M1MA 3VU9B 3F5DA 2J8ZA 2B78A 1WLSA 4IF4A 3BFXA 4UC0A 4ZFNA 4MV4A 3E5NA 3QKSA 3T8YA 3W4JA 3N70A 3WSTA 5CDTA 2B4AA 2Q3DA 3OLZA 4JI7B 2Y0DA 1CQPA 1DE0A 1GADO 1PWZA 3K1AB 3FRHA 3P0RA 3WHLA 4EF6A 5B30A 4K6OA 1N6OA 4U6NA 5CB4B 1O97D 2JDID 1UBCA 3UJ3X 2HNBA 3ZDRA 2VTBA 1SQ0A 1XB2A 3R3SA 4RMIA 1MX3A 5FPPA 2A4KA 5IHXA 2PSHA 4E6EA 5B36A 3G2QA 3EXG2 2CDCA 1M7BA 4GI2A 3ZBQA 3ZXXA 3O2NA 4JOQA 4R84A 3ZW8A 3KSAC 2HYIC 3QXJA 4MEJA 4TQUS 4WY2A 3ZDBA 2JLQA 1U5CA 1QOZA 4TV9B 2DFTA 2D0OB 3OHMA 4FEEA 3UGQA 2O3TA 4M9RA 1JZQA 3QUSA 3VNBA 3AEQA 3DZBA 3VPCA 3MRVA 3HCFA 5CTAA 4C89A 2RGWA 4MJLA 2BRUC 2PS9A 5CVCA 1SKUA 1TDJA 3IBTA 4E14A 1CDEA 5BN5A 5K99A 3DFIA 3E9MA 1PVVA 2HHJA 4GWLA 1R0KA 2J7KA 4W1SA 4R51A 1T1IA 2QBYA 5KYWB 3K6SA 2D2FA 4Z3DA 4IDEA 2F2TA 4EPYA 5FEUA 3PR3A 5FB3A 1GNQA 3EIWA 3R7WB 3ABOB 4EJ0A 2JGNA 4W5JA 1XLTA 1D7AA 5LB2A 1DEAA 4E2XA 4AF8A 4Z9BA 4CT4B 2FEWB 3AVTA 5DLQC 3PXGA 4M8SA 4JXZA 1L5YA 7AT1A 1MDBA 1JFRA 1ETUA 2D5IA 4HQLA 4G41A 2JHPA 2NVWA 4MUAA 2C9OA 3IUQA 5IVDA 3VKVA 4EG7A 1HRDA 1THMA 4YRKA 3GUYA 4PX9A 4TLMB 4DIMA 4DWOA 3VZBA 2BHTA 3U13A 4ISCA 3CT6A 4I8IA 3H75A 4JJ7A 2VPYA 1B6SA 2VPQA 1E9RA 3IKTA 3LE8A 4W7IA 2BGLA 2CNNA 4TYMA 1W76A 2VO1A 3LBYA 2VXOA 1W6UA 1D2MA 3PE6A 3ZHBA 4YECA 2EBFX 1ULTA 3CLVA 1JJVA 4LPKA 4ABYA 5K8LA 5CNIA 3QXSA 1JN0A 4HGOA 1VE1A 3CUEF 4WGGA 5DF1A 3WMFA 3S2YA 3IDAA 4OJKA 1VE9A 4EO4A 2AMJA 2PIAA 1T13A 3IAM6 4PN7A 2P6PA 1EIZA 4P7FA 1PJ8A 2FPRA 4JAVC 3BCHA 2MINB 4P3NA 1YDHA 3MBIA 3PRKE 4RPGA 3UAWA 1Y8QA 4F11A 3VOSA 6REQA 3GEHA 4MPDA 4MRNA 3CX3A 5EHZA 3OZ7A 4W5RA 4DV0B 1HDEA 3QEKA 2JH3A 1OB2A 2XB2A 3SFTA 2HIMA 2JGRA 3GRFA 2D4AA 2Z56A 4C7OB 3A11A 3EMVA 3AU8A 3R4CA 1JR3D 3OCWA 2ECPA 2M6SA 4BASA 4E94A 4JU9A 5C4IA 1DPGA 3VTZA 4EKGA 5JFOA 1WF3A 2X0NA 1QM5A 1FDWA 1GUAA 5AI6A 3JQBC 3DVRX 4NOLA 5C8YB 3A06A 1HF3A 4D3FA 1U0NA 2D3TA 1X19A 2FWNA 2LVBA 4O2AF 1PJ2A 3L4BA 3OZWA 3GDGA 2FR1A 1DMRA 1OH6A 2QQ0A 1KI2A 2A9RA 4HEQA 4HEJA 4W8HA 3RLIA 1B1AA 4RSHA 5HQJA 3AL0C 2C03A 1AXRA 1ZSVA 2XYGA 1EWTA 3EFOB 3WMRA 1SZDA 5JVDF 1T2FA 3REOA 1Z74A 3ETEA 4YFVA 1WTAA 4P7BA 3KYBA 3NIFB 2BPOA 2FETA 2NSLA 5GADl 2VAWA 3QU5A 4WEOA 5CFOA 4I1OA 1EAYA 2I6QA 2WF8A 3PWSA 4ZKDA 1S2NA 3QX3A 3DTNA 5ICCA 5M29A 1CY1A 2OD9A 2WIKA 4G1FA 1IJFA 1F60A 1GG9A 5B3AA 2FEKA 3GLRA 1KJ9A 3RE1A 2ZWMA 1HG1A 1ZH4A 3I5XA 3HDVA 1L7OA 1YRQA 2VXYA 5TMDA 5LA6F 1MOPA 1D2EA 1QSGA 3OTIA 4QBIA 2YJ4A 3EYWA 4BXOA 4TS4A 1S5PA 1MR3F 1PW5A 3AHEA 2M6RA 4WLNA 2HQBA 3GN1A 4BB0A 2BOVA 3QWFA 2VDOB 3VDMA 5C5DA 5L3VA 2XLCA 2APJA 1OT3A 4BNDA 3TQOA 5TVGA 4LFBB 1G9TA 1TM3E 3HKDA 1UPBA 3OURA 1OR8A 1UK6A 4I6EA 3ROKA 1HDCA 4NG5A 221PA 1NI5A 2AMYA 3FDZB 1S3IA 3R5XA 3L0DA 3I62A 4FFDA 1RLTA 4RIGA 1GXSB 2DC1A 4JDUA 1UH5A 3F7NA 3FYUB 3K0SA 4YRDA 1CP3A 1W49A 1X87A 3DOOA 4YCJA 1U5BA 3DKIA 3NEAA 1TGVA 4H1HA 1R0YA 2OV8A 2VTKA 1XWFA 4FYHA 4LJ6A 4MW0A 4O4LB 3RVLA 4AKIA 1ULHA 2B35A 4YS6A 3CY6A 1AD2A 3B1KA 1DKPA 1KZYC 3L02A 3QOWA 4FFSA 4BNJA 1J2TA 3U09A 3A3NA 4YBRA 3A9UA 3MRSA 2AC4A 4BZZA 2FFRA 1M66A 4ZD6A 4JC0A 3EXHC 2JARA 4HQ6A 3IPCA 4ZAGA 4EENA 1W2GA 2BTQA 2TMKA 2GCNA 2P30A 3GQBA 4MVJM 2B1RA 1NBOA 1WO8A 2PCLA 3NHKA 3Q5DA 2ORYA 3TIVA 1YC5A 3JQ7B 1M2KA 3V4RA 4LJSA 3K0FA 4B4DA 1ENPA 1TT5A 2CLOB 2ZETA 3MB5A 2QAGC 4M7RA 1RM5A 1Z36A 4E12A 1CF4A 3C3JA 1E1NA 1QNLA 2ODAA 4KTVE 1A8PA 2GJKA 3G6WA 4BZPA 1VPEA 3P2KA 3TTYA 3WL3A 4B85A 4PX3A 4R2HA 3NUZA 2VJOA 3LMKA 4TVKA 3C3DA 3NHYA 1BD3A 4C5AA 3CRQA 4RD1A 1N7JA 3W5VA 1YZQA 3FSEA 1SKQA 2IV3A 4GRAA 1SD5A 4HLUA 1NW3A 4CKYA 1P2VA 3EGXA 3K3PA 4BMVA 3W7VA 3C87A 1K27A 4AJ9A 3WLHA 2Q7OE 3FN4A 4N3GA 5J2UB 1OF1A 1CS0A 3F4BA 2VDQB 1Y89A 5C3MA 1HM5A 3WLOA 1N2SA 2Q1TA 5DWDA 1G8PA 2OILA 4UJ5A 3KM0A 1AMNA 3U4QB 1U7DA 4BUZA 3ZY5A 3LLUA 1M1YA 2PMKA 3IBYA 3NEPX 3JZIA 2ZQYA 1NZDA 2OC9A 5CPFA 3M9XA 4NMLA 3DKPA 4NZMA 5B1HA 3VZCA 4CM9A 3FAKA 1M8KA 4P7JA 1E9FA 4W5OA 2VJDA 4JZYA 1MTOA 4QC2A 2XTJA 4HWSA 2WT9A 3Q6NA 1R0SA 3BQNB 1B6GA 1LSOA 3T3PB 2ZJ5A 1RJFA 1BFUA 1G20B 1VG9B 2QJRA 3RK4A 3X1XA 3HB9A 3Q3CA 5DM2A 1J21A 4A92A 4OYHA 1ILWA 2XEXA 2HM7A 2FWRA 1ZD2P 2R87A 3BE6A 3N2KB 3NEYA 3QKWA 4HB4A 3ZWQA 3ZU3A 1C3XA 3RRXA 3ZWPA 3AI3A 1ADBA 1X7ZA 4KSYA 5TV2A 5CA1A 1E6LA 2FDRA 2EKZA 3VUEA 4CKBA 1XKQA 5ELXA 2X4IA 2W83A 4U5XA 1R0WA 1ZD1A 1NP3A 3EZYA 3EAFA 4HC4A 3Q7SA 1TZJA 5IPFA 2R84A 2QL6A 2J48A 2HU7A 1CJTC 3QF4A 3EWSA 4C08A 5T57A 5KMGB 2E48A 2EKDA 3PI6A 4RTQA 5MFPA 4N47A 4FJ1A 1N2CE 4FFMA 5CLJA 5LIRA 2R0QC 1JAZA 1QPGA 3OM0A 3EBOA 1OAAA 1PZGA 5LNK6 1N75A 2YHSA 1JFSA 1UP6A 3LT5A 4QQKA 1T6XA 3OD1A 1K8XB 2QAJA 2XCIA 1LY1A 3KEMA 3N5CA 4FGKA 1OIVA 5JEDA 1O3YA 1X15A 3K2EA 4FYIA 1GPBA 2V54A 1ZNXA 4Q1VA 4RACA 1WDMA 4XIYA 1JEAA 3HYNA 3GL9A 1OZGA 3AG6A 2RE8A 3H99A 1MF7A 2BHNA 5GP1A 3AOGA 3RJ5A 4JR2A 2YXPX 1BXGB 2FKNA 5FORA 1G0OA 1NHGA 5REQB 4XUCA 3VGJA 4D8UA 1FTQA 4CWAA 4C2AA 3KT0A 4CFSA 1HV8A 4JOBA 4QTUB 5L53A 3Q0IA 2Z43A 4FXOA 3QVOA 3UKDA 1JPJA 1SQ5A 5FUMA 2WVJA 3ESZA 1D2NA 2WIGA 2X7XA 5ALSA 3TKLA 3U7RA 1EX1A 3W9BA 3GEMA 4Q4LA 5GGYA