3RUAA

Specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
341
structure length
336
Chain Sequence
YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific recognition of N-acetylated substrates and domain flexibility in WbgU: a UDP-GalNAc 4-epimerase
rcsb
source organism Plesiomonas shigelloides
molecule tags Isomerase
molecule keywords WbgU
total genus 128
structure length 336
sequence length 341
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ruaA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3ruaA02
1U4OA 2Y1GA 4OQZA 4NI5A 3RSHA 2NQTA 1PQPA 1KVRA 2IDZA 3S2EA 5JYDA 3PTZA 3MJ4A 3GEDA 1EUDA 1X0XA 4R68A 2P2SA 4XYEA 1VKNA 1RJWA 1DO8A 5TRTA 4I1IA 3S8MA 4CL8A 3SLKA 3WQSB 2BRUA 2O50A 5FFFA 3LF1A 4EITA 3JD2A 5JO0A 4RPGA 4U6SA 3GVIA 3AUUA 2ET6A 5ITWA 4CV3A 4BB6A 3OM9A 4NBUA 1G1AA 2X8LA 1N7HA 5DCUA 4U0JA 1RM0A 4YRDA 3VPGA 3KZVA 1ISGA 1MX3A 1NP3A 4P4NA 4NG5A 1GZ4A 4KUEA 1PWZA 1ZK3A 1UUFA 3E6AA 3DBHB 3Q0EA 4R4JA 4YYZA 3K2BA 5A5FA 1XA0A 1J0XO 3FPLA 1U8FO 4A5OA 3VHRA 4MVJM 1JWAB 3CIFA 1NTOA 3GFGA 4G65A 4IGEA 3WLFA 3P19A 1ZK0A 4YAGA 4D0RA 4BNWA 3TOXA 3MOIA 1K6IA 4DQUA 3ANLA 1NVTA 3PYMA 2QQ5A 2QYTA 5MGBA 1E92A 1PL8A 1LQUA 4NK5A 1VSVA 3KSZO 4XDZA 4XQEA 4D46A 5KKAA 4XD2A 1JVBA 4FFPA 3EMKA 1C1XA 2X22A 1C0KA 1ZK2A 3I23A 5COBA 3VH2A 4N5LA 4AJJA 4CLOA 4PLTA 4B7XA 1SEPA 4W7IA 1JKIA 3E5RA 1ZK1A 4NFYA 4YAEA 2TMDA 4HBGA 3SC6A 1E5LA 5JYEA 4BNNA 2H6EA 2CF6A 1D7OA 4BO3A 4CQLA 5G4LA 3BTUA 4W99A 4YJGA 4XYLA 3I3OA 5HS6A 3PEFA 3GNTA 5A03A 3K6JA 4FFMA 3U09A 2Q2VA 3OJFA 3U4IA 1ZXLA 3PHHA 3TJRA 3JQEA 1G0OA 4M54A 1KEUA 4NK4A 3DZGA 1NFQA 4XR4A 4AJNA 3C1AA 3WNQA 3AK4A 4E5MA 4IMPA 3F4LA 3WYBA 1T1RA 4YRBA 1E0DA 4E2WA 3HWRA 4ZD6A 4IJUA 4QFDA 5A5EA 1XELA 1B3BA 1XIVA 2EKQA 2G1UA 1Z45A 2V6FA 2X9VA 3LLSA 3L4BC 3QQPA 5TF4A 4DBVO 2BFMA 2PKQP 4CL3A 2DPGA 4RQUA 4GH5A 2AE1A 2EG9A 2JJYA 4ESOA 4DXHA 3ZU5A 3QLJA 5L4NA 3BYZA 1B16A 1KVSA 4E2YA 2FZWA 1ISHA 4TMFA 2VN8A 2VZ8A 3GNSA 3WGGA 9LDBA 2ZYGA 2FRDA 4FIZA 1C14A 4GBJA 1W6UA 4BIIA 5CHEA 1I3KA 3SJ7A 4A03A 3NDJA 3ON5A 3PZBA 1P1FA 1VKOA 4J4TA 5KVVA 5KJFA 5EPOA 5LCXA 2JHGA 4IDAA 3KOUA 2RIRA 5JW6A 2Q4EA 2NU6A 3D3WB 1DAPA 2B35A 3M1LA 1N8KA 4TQGA 3V1TC 5L45A 2P9CA 2AMFA 2FR1A 2RHRA 6ADHA 3RCBA 4NR0A 2JD1A 3GVXA 2VHZA 1NPYA 1SBYA 3CZMA 5L7TA 2E49A 2UV8A 5DT9A 2NVUA 2X5JO 4F45A 1N2SA 4UVDA 2GGSA 3F6YA 3BHIA 4TRNA 4J49A 5I7VA 4L4SA 3AW9A 3OETA 3WSVA 4FJ1A 1NNUA 1R6DA 3WGQA 4IMRA 4AJLA 1U3UA 2W2KB 1LI4A 5DBGA 1O5IA 2QRKA 1O9BA 3IKVA 3LC1O 3RD5A 1SB9A 5DCWA 4ZA2A 1ORRA 1YBAA 4OOEA 3UXYA 4CMHA 4HFJA 1DIRA 2CFCA 1PJCA 4IIVA 3ZCXA 5B4VA 2JD0A 1PWXA 1LA2A 4YJHA 1YOVB 2J5KA 2VWHA 5T8KC 2WSBA 3T4EA 3DAPA 1BXGB 3WGHA 1KIFA 4DGSA 1I3LA 3KYCA 2CSUA 4J7XA 1SB8A 4TVOA 4JJGA 2Y93A 4C4OA 4L76A 8LDHA 3MOGA 4WOJA 1DSSG 1BTOA 4JP3A 4W6ZA 4IJWA 4HNGA 1VL6A 2AQIA 4FC7A 4LCJA 2PGLA 3BMNA 5B4TA 3CUKA 4P4GA 3DZKA 4YT2A 4XQGA 1EEHA 3VKVA 3I9MA 1ZNQO 1FDWA 4CM4B 3ROMA 1UZLA 1ML3A 3NEPX 1ZZEA 4JCOA 2W2KA 1T2EA 1X15A 1BXKA 4MVJD 2OOSA 5I9LA 2EW8A 1DXYA 1HDGO 3IJRA 3ZNOA 5IDYA 1YKFA 1DOHA 4UUNA 3WIDA 3QV1A 2ZCVA 5BNFA 3BTSA 5ILOA 4I08A 3PWZA 2RAFA 3JQBC 5U4QA 5ITVA 2PZLA 3ONDA 1XSEA 3NT2A 5T8KA 4Z3DA 5K6AC 3KB6A 4FR5A 1MV8A 4U5QA 1ZO8A 1NHGA 3DR3A 1IHXA 1P1IA 1FDVA 1BMDA 2IZZA 3P7MA 4MIOA 2XF8A 4F6LA 1ISMA 1L7EA 2JFGA 4BNKA 3RUFA 3JD3A 2F1KA 2HK9A 3G17A 3KV3O 4O6VA 3DOJA 4CM8B 3CKYA 1VL0A 1YJ8A 4K9DA 1QV6A 3ZH2A 5KVQA 1T25A 3O4RA 5TIIA 1DIAA 2V6GA 4KWHA 2C2XA 1BSVA 1DJNA 4IDBA 4EUFA 3GPIA 1KBZA 1P1JA 2FMUA 1YB1A 2BGLA 3H9JA 3RIHA 2C29D 4B3HA 1NWCA 1PZGA 1Y8QA 1EDOA 4ZN6A 3H9EO 4UEKA 4DPKA 3ZZNA 2D8AA 3UGKA 4Y67A 2EXXA 3OEWA 4YJFB 3TZCA 4Q3BA 3E5MA 3OEYA 4QUKA 1E1NA 4BNFA 4KZPA 4Y8VA 4Z9XA 1I5RA 4E4YA 3E03A 4UEJA 5JDCC 5TT0A 2VZ9A 4RVDA 4DREA 4J16A 3I4FA 4GWGA 4BMSA 4BGUA 1IPEA 1PSDA 1HDOA 1T4BA 4YBZA 4Q3NA 1V35A 5T57A 3KYCB 1LDNA 2IZ1A 4PG8A 4HP8A 1A27A 1MFZA 4Z9YA 2PY6A 4DC1A 5BNIA 3H3JA 2O2SA 2IXBA 4RJTA 3KSUA 3VPXA 1V0JA 1EK5A 4RPLA 3HQ4O 3SVTA 4CM1A 1F17A 3WIEA 4A2CA 4D42A 2I76A 3DOOA 3EGOA 4BO9A 3DBHA 2R00A 1LRJA 2FOIA 3ZHYA 4L9RA 4AL4A 3WSWA 2I66A 1GQ2A 1MXHA 1P9LA 1U2GA 1UXJA 3O38A 3ZV5A 5KTKA 3BHJA 1O95A 1BXGA 3WQQA 5GZ1A 2PZKA 4WLUA 1JW9B 2X5KO 5CFZA 3ANNA 4PG7A 1KETA 2PKQO 5COAA 5JMWA 3JQDA 2BFPA 3C3XA 3MZ0A 4KUGA 4MO2A 3ROPA 4FGSA 2AEJA 3WJAA 2Q1UA 1T2FA 1I30A 4Z9FA 1M67A 2IRWA 3WB9A 4PLHA 1IY8A 3BMNB 1C0PA 3C1OA 3WQRA 1U3WA 3OSUA 3PI7A 1GUFA 1N1GA 1ZCJA 3ZU2A 1MG0A 3ICPA 3ZWNA 3FNHA 3BMOA 1HDYA 1DPGA 4RPHA 4Q3CA 1F8FA 1UR5A 4WNCA 4MKXA 3VPFA 4FOSA 4ITUA 2NADA 3CZRA 4HKTA 4TKLA 3V2UA 5C7LO 2P5YA 3HB5X 1OZAA 4NDNE 3U4HA 2VUSA 4J3FA 2C0CA 2Y99A 3ENNA 1ID1A 2P91A 2BKAA 1P0FA 1R4NB 1B8PA 4KWIA 5KVCA 2D5CA 3LC2O 1Y1PA 3MJEA 3JV7A 1R4MB 5C37A 1A7KA 3OICA 3HZZA 1DFGA 3CINA 3DBRA 3OA0A 5CG2A 2E6UX 1QORA 4BQPA 3K73O 4JJIA 3WLEA 1IULA 3JQ7A 2ZIZA 5DDIP 2DAPA 3UF0A 1WPQA 4O5OA 3SEFA 3VOSA 2YZ7A 2XPCA 1ZMOA 4IDFA 1WLYA 3MJTA 2VYVA 1X13A 4BO4A 4JBHA 1HE3A 4DYVA 3ZWPA 1YBVA 2QRLA 2DUWA 1T4DA 5TQVA 3HADA 4XYMA 1ADBA 3GDGA 3RWBA 1NASA 2HCTA 4BNUA 4IQGA 5B1YA 4BVAA 3O9ZA 2PA3A 4PLPA 1PX0A 3B70A 4YJFA 2HK7A 1O0SA 1HDXA 3RFXA 4A0SA 3LT2A 5BSGA 1GU7A 2J5RA 2AEMA 2BGKA 4OO3A 1BRMA 4E31A 3DL2A 1W8DA 1RM3A 1V8BA 3GK3A 3U49A 5I7EA 5IZCC 3GZNA 1JKFA 4EW6A 3VDQA 2PTGA 3PLNA 2C20A 2JAPA 2P9GA 3OIFA 2UYYA 4D3FA 5EQDA 3DO5A 2I5PO 4JP2A 1PL7A 5IG2A 4MP6A 4L74A 2C7VA 4Z6KA 2G17A 3TZ6A 1YH3A 1JA9A 1M2WA 4XJSA 2DM6A 4CR8A 3ONEA 1M6HA 4BO2A 1Z75A 1KEWA 1KEVA 5TS3A 3RUIA 1DIGA 3H5NA 1F06A 1MGOA 4UVEA 4D44A 1T26A 1PJ2A 4FPXA 4FGWA 2H63A 3ZI0A 4MP3A 4O59O 5IJZA 2G76A 5G0VA 4BV8A 2I67A 3TPCA 4EGFA 3QWBA 4MVJH 4B8ZA 2GN9A 5DBFA 5K6AA 3C24A 5IDQA 1PZEA 1A4IA 2ZK7A 3JQGB 3B1JA 4Y9DA 3ZW8A 3R3SA 1ZEJA 3D4PA 1EK6A 3GRKA 4PN3A 3WJ7A 4HXYA 1ONNA 3IKTA 3RUHA 3VVBA 4QEDA 4H16A 1GFSA 2LDBA 2HMWA 2J3HA 1UDAA 3I6QA 4B4VA 3VZSA 3KLPX 4S3MA 3HDHA 2X7HA 4BNMA 4M49A 3HNPA 5JY1A 2WD8A 2JFFA 4XYGA 3U5TA 2XAAA 4R5MA 5AXBA 4JK3A 4CM8A 2B4RO 5GZ3A 3WS7A 1EQ2A 2Z1MA 4PVDA 2O3QA 3MWEB 4PG4A 2GN6A 2C82A 1ENYA 2P4QA 3TZHA 1E5QA 3UFXA 5I9NA 2EKPA 2PD4A 1F14A 2LDXA 3U62A 5CDGA 2D5AA 1GQYA 1RM5A 4WJZA 4L0QA 1I24A 4IDCA 2PD6A 4RL6A 5ENDA 4ND2A 2P4HX 5JAMA 3DBRB 2HLPA 2C5AA 2NTVA 3EC7A 3IJPA 5KKCA 4GX1A 3F4BA 2EV9A 1JU9A 1J6UA 1CRWG 2J6IA 3G1UA 2D59A 4J90A 1FJHA 5ILGA 4NJMA 2XOXA 3NT5A 4FFNA 1GPDG 4JNKA 4DLLA 4EZBA 2PK3A 2WE8A 1F12A 3X2FA 4BNTA 1H5QA 3PQDA 4W7HA 1XHLA 4WEQA 2GNAA 3DTTA 1TLTA 3RC7A 1NFFA 1SZJG 5TJ9A 3WMXA 4R5HA 4YAIA 4Z0PA 2NVBA 1E7RA 2Q1WA 3GNQA 3PFFA 2R00C 3TQHA 5BQFA 1LDGA 3AY6A 4GSKA 3FSRA 1Z6ZA 3GF4A 2NU9A 4P4LA 1LU9A 2ZATA 2PD3A 5DP2A 3AM4A 3BTVA 2FSVA 3OJEA 5JCJA 4M89A 3R0IA 4BKRA 4PRLA 1R0KA 2B83A 5JDIC 2Y68A 4ZICA 1V3VA 3ADPA 3FCOA 4ZRNA 4R1TA 3F9IA 5FI5A 1EVZA 2HRZA 2QIOA 4FFOA 4DQVA 2O3JA 2A35A 5CPBA 5L4SA 2B69A 2IE0A 1ADGA 3NRCA 4YR9A 1PL6A 3GGPA 2RBEA 2W2LA 3W8FA 2PKRA 4PRKA 2HK8A 1FDUA 3JQAD 4NPCA 3W1VA 3ZNNA 3NJ4A 3BAZA 5JE8A 4E30A 4GL4A 1EZ4A 4IINA 3AI1A 4R1UA 2P68A 4HFRA 1KOLA 3INRA 3CEAA 4Z0TA 1YBMA 3OJOA 5IZCA 3M1AA 2EGGA 5KJ1A 3M2PA 4ALIA 1GL3A 4LVCA 4ONEA 4S1VA 1P31A 5A06A 2O7QA 3C7DB 3ASUA 3DBLB 1EDZA 2JHFA 3IQDB 3JQGA 4XCVA 8ADHA 1GQQA 1PU2A 3FF4A 4MVJI 5CP8A 1VL8A 3R6DA 4D7AA 5DN9A 4LSWA 3LYLA 2YQ5A 1ENZA 5KJ6A 1H6DA 4TWRA 2NVWA 4GPD1 1HETA 1KVUA 5AOVA 3T4XA 3ITKA 3JQAB 1T2AA 2X9GA 3UVEA 5J23A 5ES3A 3Q9UA 4DL9A 1DHTA 1E6UA 3P5SA 4LRTB 4ZGWA 4ALJA 1EMDA 4RV9A 3BMQA 4TRJA 4YAKA 3QWAA 1HDRA 1E7YA 5JNLA 1AHHA 1U8XX 4XQ9A 3VPSA 1R15A 2ZTVA 3G0OA 3DHYA 3OJLA 1P44A 4OIMA 3EZYA 3OMLA 1N9GB 2ZJ0A 4Q3EA 1CQJA 4IS2A 3WDSA 4TZKA 1DJQA 3L0DA 4DUPA 4C7JA 4CMEC 4N5MA 2BH9A 4EEZA 1Y9EA 4GGOA 3HB4X 4A7PA 5KJCA 1ZSVA 4U6QA 4AJ1A 4RVSA 1Y5RA 2VCYA 1EE9A 3PHJA 4DIFA 3H3FA 4HV4A 3QIVA 3CMCO 1WAMA 2I3AA 2EF1A 2VRBA 2WD7A 3W4KA 5CPFA 2PR2A 3UCFA 5A9SB 1B14A 1PS8A 4IJKA 1KERA 4TRRA 4XA8A 1A5ZA 3Q11A 2AE2A 1A4UA 1O8CA 2AHRA 3P2OA 1PGNA 1UP4A 1YQGA 2NU8A 1VSUA 4RF5A 1F8GA 1EFKA 4I9UA 3WBBA 3EK2A 1WDKA 3DTYA 1P33A 2GR9A 1QSGA 3ETEA 4OSOA 1Q7CA 3VZRA 5ER6A 4FFRA 1LLUA 2ZKLA 4QXMA 2ZQZA 4E5NA 5CAEA 2IYOA 3JQ6A 4F46A 1JQBA 5DOVA 4DRYA 1W0CA 5KCZA 3CH6A 1DC3A 4PG5A 4WPGA 1PJTA 4PG6A 1VC2A 2D0IA 2DBVO 3WYCA 3MJVA 4L73A 4XRRA 4IIUA 3AFNA 5CDUA 5TSDA 2CUKA 4CLRB 1VLLA 4PGFA 1E7WA 3PWSA 5KJEA 3OECA 1YL7A 1OOEA 4PLCA 4UUMA 5ICMA 4EYEA 4WE3A 4FJ2A 2DTDA 5ENVA 3ZHBA 5B12A 4P22A 2HMVA 3BXXA 1J4AA 2JD2A 3CMMA 2YHUA 4RZIA 3UAGA 1YDEA 1JLLA 3KHUA 3ASVA 4B3JA 3CSDA 1KYQA 2FY8A 3GZNB 3L6DA 4CLXA 2EEZA 3O8QB 1GCUA 2W4QA 3ZHZA 1SMKA 2A9FA 1JDJA 1MA0A 3DONA 3INTA 3KEOA 1O6ZA 4E0BA 3GMDA 4DBZA 4LCEA 4GKVA 4RQTA 5DNAA 1BHSA 3OIDA 5KWEA 3ZWYA 3OIGA 2Y67A 4BO5A 4AJ2A 2E48A 1NM5A 1DFHA 1Q0LA 1VM6A 2J8ZA 2BI7A 4WLFA 1VRWA 1NQTA 1D1SA 3ZWVA 2VHVA 2X58A 4RVHA 3FBGA 4E2ZA 2IEDA 2I9PA 1RKXA 2Q4BA 2UAGA 3ZV4A 2DU8A 1J49A 1HE5A 4J9VA 4QX6A 2O48X 4AJ4A 2E82A 1GYQA 3DAFA 3BMOB 3AOEC 3IC5A 1LC3A 2OUIA 1FDTA 3A1NA 3WWZA 4NFHA 4KTTE 3TNLA 4R69A 4JN6B 4WLEA 2XXBA 2ZTLA 3RVDA 5JDCA 1PGJA 2C54A 3IL2A 4ROSA 3FTNA 5IDWA 1LBEA 1N5DA 3BMCA 4J1QA 1XU9A 4LMRA 2WDZA 1G6KA 4Q3DA 2NV6A 1DC5A 3JD0A 2DLDA 3DB2A 4QSMA 4RF4A 4BMVA 3H5AA 3D1LA 3EY4A 4FS3A 4P38A 5EJ2A 4LGVA 2FZEA 2EHDA 4A10A 1XG5A 2RHCA 3Q2KA 1V6AA 3D4NA 1LSSA 4GMGA 4MIEA 1Q1NA 5THKA 1ZKMA 2GSDA 3PFWO 4B4OA 1Y7TA 3KVOA 3E9QA 4DA9A 3GVPA 1DRWA 2VTEA 5CDSA 1RPNA 1WZIA 1Y8QB 4YQZA 4OQYA 3DBVO 4ALNA 2X23A 4J1NA 3PP8A 5H82A 5A3VA 3I4CA 1LSOA 4II3A 2VNSA 2HRBA 1A9ZA 4BQRA 4OXNA 1PIWA 1YO6A 2G5CA 2P9EA 3ONFA 4JGBA 2B36A 3QA9A 5L95A 2DVMA 2RCYA 1NAIA 3PHLA 2Q50A 4C7KA 5IZ4A 4TVBA 2PGJA 4FB5A 2Y66A 1U5AA 3VH4A 1S7CA 1P3DA 4Y6SA 1NBOA 4J4HA 1PJBA 2D1YA 2V65A 4QECA 4BO7A 1E3EA 1LLCA 1H94A 3OH8A 4RZHA 4DTIA 5CDTA 3H6KA 2VYNA 1GAEO 1GYRA 1DHRA 1PGPA 2BELA 3JQ8A 3IP1A 3JQBA 3PIDA 3DHEA 1VJTA 3D5TA 3KBOA 3FR7A 4XJTA 2NUAA 4GLOA 2DPHA 3DZJA 3DZHA 3ORFA 1UDCA 3W6ZA 1OMOA 2HDHA 3FNEA 4E12A 1BWSA 4CMCA 3FN4A 1PQUA 4IQ8A 5GY7A 1EQUA 4MDHA 3DEYX 1LNQA 5THQA 4CMJA 4CV2A 3ZN2A 2HMUA 2YYYA 1CF2O 1E3WA 4XGIA 4AICA 3H7AA 1PGOA 4CM6A 3QVOA 4PIVA 4FW8A 1V9LA 3TF5A 3S2IA 1JKJA 1YGYA 4CLDA 1C1DA 5G0SA 3GY0A 3TWOA 2BF7A 1WNTA 5KIAA 2JFHA 1HLPA 4RCVA 2B37A 3SJUA 1TI7A 3PQEA 2ILTA 2POQX 3N58A 3Q6IA 1AXEA 3COSA 3JCZA 4ZQFA 3GQVA 5EL0A 1BG6A 3CE6A 4YT8A 3DZIA 3GEMA 3HUDA 3KLMX 3NTQA 1HYGA 1LSJA 3KM0A 1XYGA 3A28A 4KDEA 4NBRA 3GZ4A 4HNHA 3LLVA 4CR6A 4O63O 3F5SA 1DRVA 1QV7A 4BO0A 1PS9A 1I3NA 2X4GA 4QO7A 1R4NA 4AJPA 1YL6A 4HUJA 3WOHA 4PLYA 4GX5A 3IP3A 3E18A 4R1SA 1UXHA 1ZSYA 4BO1A 1B7GO 5IF3A 5L9AA 2Q1SA 3LU1A 3BA1A 4CUZA 1A71A 1G0NA 2GRAA 4LK3A 4QFCA 1U3TA 3ABIA 4R9SA 2PLAA 1DAOA 1B3RA 2PWZA 5EESA 4NBWA 1WDLA 4L4RA 4RPJA 1GY8A 4YA6A 1P77A 1UH5A 1H2HA 3VC7A 3EAGA 3OHSX 1SOVA 3PLRA 1K0UA 3LK7A 4J9UE 3K30A 1HYEA 4CQMA 2OORA 4D3DA 5JSFA 1AUPA 3OF2A 3QP9A 1ULUA 2VHXA 1UDBA 4N54A 3T7EA 1PEDA 3VKUA 2EJVA 2GERA 4GKBA 3F47A 3JQFC 1FDSA 2WYVA 4OJNA 3HDJA 3MEQA 4GLLA 2O3UA 3TFQA 3H9GA 1GD1O 2UVDA 3EZLA 4U7WA 1SNYA 5C3MA 5A9SA 5F3RA 1AGNA 3KXDA 4YWJA 5GMOA 2DUUA 3W8DA 3D4OA 1Y6JA 4NU5A 4EBFA 4DLAA 1I0ZA 4NBTA 3S55A 2B4TO 3IIEA 2O2YA 3RJ5A 3GC6A 4MVJA 3L77A 2O4CA 3A06A 4DWVA 4FSHA 4AJHA 5T6BA 2DBZA 1QYDA 4BB5A 1X0VA 3IOYA 3IS3A 2OBNA 1KS9A 2NM0A 3W4JA 5CDYA 1LEHA 1ULSA 5TX7A 4M86A 3I1JA 1LDBA 1XGKA 4ZQEA 4XZ3A 2IODA 5COQA 5IN5A 4BHTA 3DWFA 3D3WA 3WGIA 1SEVA 3SC4A 5JCJD 4M8SA 1PJQA 2H5LA 1H2BA 1U4SA 3G79A 3SXPA 5I8ZA 2AQ8A 1J5PA 2Y0CA 3SX2A 1UZMA 4BGIA 4ZQHA 3PRJA 1L7DA 3TZKA 5JXWA 5L4LA 2WJPA 1LDMA 3PXXA 1Z74A 4YEDA 4AVYA 2BLLA 1CJCA 1FF9A 3LVFO 5DOZA 1E6EA 2QRJA 5JS6A 2Y1CA 3D5QA 2DQ4A 3O8QA 2X0JA 3VDRA 4BNZA 4HFNA 4J7UA 5C7IO 2Y0EA 3DBLA 3QE3A 2EKLA 3VAZA 1GR0A 2QW8A 3PVZA 4ALKA 4NJOA 2W98A 2X6TA 5JMPA 2X86A 2JAHA 3N74A 4HADA 4DIOA 1BVRA 3AJRA 1E7MA 3KTDA 4O1MA 5JAQA 4CODB 1R37A 1PS0A 1V3TA 5CEJA 4RF3A 4BNVA 1EVJA 1OFGA 1ISFA 3RAJA 4OH1A 3LQFA 5DBIA 1E3IA 2O4UX 3ZWBA 2IXAA 3B1FA 4DVJA 4AJKA 4LVUA 2O3RA 1LSUA 5JO9A 2QG4A 3ZWOA 1Z73A 1M76A 1YQXA 2QHXA 3HFGA 3BTOA 5C7OO 3OP4A 1I10A 3UICA 3PHIA 1U1IA 4ZVVA 3WGYA 4H15A 7ADHA 3RI3A 1MLDA 1FXSA 4BNIA 4PLWA 5I7FA 3LSYA 3HDYA 2JCXA 3IDSA 3V1UA 4NNJA 3JTMA 1XQ1A 1MC4A 1FK8A 1LLQA 4I9HA 1LQTA 1CEQA 1NFRA 1UXGA 5HA5A 1PZHA 4ND5A 4CUKA 3V5NA 3WG9A 1WVGA 5HS4A 2YHIB 3FD8A 3K2EA 5I7SA 4CV0A 4CM7A 4XR9A 4CLEA 1YXMA 4CMKA 1HRDA 1IZ0A 4WLNA 4OHUA 4R01A 4CMEA 1ZH8A 2I3GA 3ZWCA 3RC1A 1PGQA 2X0NA 4GI2A 1ADCA 2VRCA 5JC1A 1I36A 4JJFA 3HN7A 3GG9A 3MTGA 3BHMA 3GR6A 3U4CA 5IXSA 3A4VA 3GPDG 4XKJA 5TLSA 1E6WA 2J3IA 2JCYA 1MG5A 5G4KB 2ZB3A 4BKPA 4E5KA 4L75A 3KEQA 4J2OA 4XB1A 4CMIB 3IUSA 1GUYA 3SLGA 2B5WA 1O94A 5TJHA 1SAYA 2XXJA 3KUXA 4RVGA 3JQ7B 1PR3A 1AE1A 1NXQA 3AY7A 3WX0A 3FHLA 1I2BA 4EJMA 4ZHSA 3HFSA 5IAAA 4Z3KA 2O7SA 5A9RA 2OFPA 1R16A 2HSDA 4IXWA 1UZNA 4CLOB 3GVCA 4MVJE 2DFDA 2YV1A 1S6YA 3AFMA 1UP6A 1L1FA 1QRRA 1RYEA 1NR1A 2CVQA 3WTBA 2H9IA 1DIBA 3K8ZA 3E8XA 1OAAA 4WEOA 4IS3A 1ZJZA 2CNBA 2C7GA 4CPDA 4WK6A 1EFLA 1ZVMA 3MJSA 1R66A 4NH4A 5L3ZA 1B8UA 1YB4A 4LN1A 3JD4A 4W9NC 3ZGYA 3FBTA 1QLHA 3NUGA 1HEUA 2OHXA 2SCUA 4GX0A 4OYRA 3MJCA 4XQCA 1HSZA 4F3YA 5AQ1A 2BFAA 4EDFA 1AN9A 1X1TA 1X1EA 2WD7B 2VQ3A 4I5FA 1C0LA 4M1QA 3Q3CA 4GQAA 4XX0A 5L51A 1W4ZA 3L4SO 4D79A 4KQWA 5CG1A 3ZU4A 5L53A 3TN7A 3R1IA 3PHGA 1Q7GA 2PH3A 4K6FA 1EUZA 2VNAA 4FDAA 3WYEA 2X0IA 3JYPA 1NPDA 3ZWXA 5F21A 4XWYA 2DBQA 1I2ZA 3A9WA 4EJ0A 1NQ5A 1GEGA 4UAGA 4YCAA 4YTEA 1I8TA 4A27A 2WM3A 4BGVA 2VOEA 1QLJA 3HSKA 4YB8A 4AG3A 2C07A 2IYPA 1BXZA 2J5QA 3DOCA 3JYLA 1E1MA 2VT3A 4G2NA 4WUVA 5BR7A 1QXSA 3HG7A 1PR9A 4RVFA 4K6CA 4E5YA 5A1TA 1QG6A 1Y8RA 1P0CA 2B5VA 3OQ6A 1E3LA 3OA2A 4HFMA 1PTJA 3QRWA 1EVIA 1A9YA 1KC1A 4YJHB 5JBIA 4FBGA 2PFGA 2YDXA 4W82A 1B0AA 3ZWAA 1JVSA 2VHYA 4MVJP 1Q2XA 4J6FA 5A04A 3FPCA 3GGGA 2BFOA 4IDDA 5ER9A 3GH3A 3GVHA 4WLOA 3JD1A 1E3SA 3UHAA 2WTBA 3VH1A 2E4AA 2HUNA 2W90A 2CDAA 3D7LA 5A3JA 3WR5A 3GGOA 2QX7A 5L7YA 1LDYA 2OO5A 3QVSA 1HLDA 1EBFA 2EP7A 3KO8A 1IE3A 2FPIA 3DMTC 3K92A 4J91A 1YQDA 1PJ3A 3NDRA 3HDQA 2CF5A 3H9QA 5HM8A 1WDMA 3E9MA 3FI9A 4E32A 2Y1EA 4GVXA 1E7QA 1LLDA 1NX6A 3A14A 4XYBA 1LRKA 4PZCA 3PIIA 2EGHA 1E1KA 1TB4A 3NAQA 1LC0A 3C8MA 4J43A 1ISIA 4G81A 4OSPA 4BNGA 1UXKA 2WE7A 5A4DA 2J3KA 4ZU3A 5AXAA 1ONPA 3WWYA 1HXHA 3F1KA 1HT0A 3NKLA 3RU9A 2CMDA 3RBXA 3PZRA 2GPTA 2B0JA 4TKMA 5BT9A 5HRUA 1XCBA 4NMHA 2Y05A 3ROQA 3I52A 3IMFA 5F1KA 4TRMA 4W4TA 3OQ1A 1BGVA 2OL4A 4RDIA 5EINA 1HE2A 1QYXA 4GGPA 2GDZA 1VPDA 2FP4A 4OXYA 3ETDA 4XIJA 3U4DA 3H2SA 5H81A 4KQXA 1H93A 2Q46A 2ZJ1A 4RF2A 4URFA 2D4AA 4CQLB 3L07A 1XDWA 1H6BA 4D3SA 1TT5B 3PGXA 2VWQA 1DIHA 2EERA 3RFTA 2V6MA 4YRAA 4LISA 5EIOA 4AFNA 2NU7A 4JLWA 3H2ZA 3G3EA 1FMCA 2GYYA 2CDBA 4WGGA 1YONA 2YV3A 3AY3A 3ZNPA 3DZBA 1IZ9A 4K28A 4Q9NA 4B4UA 3TZQA 3PYXA 1XR3A 1I33A 1X7HA 2HU2A 3AU8A 3U0BA 3X2EA 4EUEA 1ONOA 4NIMA 4R1NA 5EN4A 3ZV6A 3TL3A 2CVOA 1X7GA 3D64A 4MOWA 4CQMD 4LRSB 2PZMA 4B7UA 4AJOA 4FQ8A 4UVGA 1UAGA 5C5IA 1IPFA 2VUTA 2FWMX 4CV1A 1JAYA 1HWYA 3GHHA 4IDEA 4KOAA 3MCVA 3CXRA 4OGWA 3BMQB 4J1TA 4ZQGA 1M6WA 3UW3A 4QTZA 3ST7A 2DTXA 4FOOA 1DC4A 3LZ6A 4X54A 2NTNA 4J7CA 5MDHA 1B2LA 4R51A 3AM3A 2YY7A 3C85A 2X5OA 3NV9A 3WICA 2Y1OA 1HDCA 4RGBA 3GN2A 1DEHA 2GD1O 3O03A 1NPTO 4XGNA 4F6CA 1D4FA 3KYDA 2YFHA 1U3VA 4Y98A 4EI2A 1QYVA 4ND3A 2CZCA 1QMGA 1CWUA 5T64A 1ENOA 1MP0A 3DHNA 4IM7A 1HTBA 3RKRA 3UOGA 1E1LA 4NZ9A 4Y6RA 3GN1A 4XEHA 5EERA 5KOIA 1ARZA 1GZ6A 2V7PA 1VI2A 5U1PA 1V3UA 4MIYA 4R9RA 2FN7A 5DZSA 4Z0HO 5K9ZA 2OP0A 1GV1A 3OBBA 4XDYA 5F5NA 1BW9A 4KUHA 1TVEA 2BGMA 1NR7A 3MWDB 3INGA 4NBVA 3GUCA 4YAJA 5A9TA 4DMMA 5L40A 4NJMB 1ZMTA 3NT4A 1E77A 4RLHA 6LDHA 1B8VA 4II2A 4GAEA 3I6IA 4GMFA 1EBUA 3JQCA 4YXFA 5ICSA 3G1TA 1E3JA 3BIOA 1B26A 1LJ8A 2GN4A 3H5RA 2QZ9A 3FTPA 4IJVA 1XWFA 2ZB8A 1PZFA 1C0IA 3QW2A 2X0RA 4I9NA 1GPJA 2FHSA 4B8WA 1OBFO 1T2CA 2DKNA 2CY0A 1DB3A 1A7AA 2Y0DA 2X1HA 2DTEA 5FEUA 2Q99A 3EVTA 5JFOA 3H9UA 1UJMA 1KC3A 5AYVA 4UREA 1Z82A 4ID9A 3UCEA 3K96A 4BS9A 4ZQBA 1NAHA 3ENKA 5CEEA 2FPGA 3E82A 2W2LD 1ZUD1 2UUOA 2I6TA 3AM5A 3KSDO 5DULA 3TOZA 2VHWA 1HZZA 1NWHA 4FC6A 4JQCA 1SO8A 4J4BA 3ZV3A 1X14A 4XIYA 4J2HA 1NHWA 2OBYA 1N92A 1CERA 3VTZA 1XLTA 2ZB7A 5B4UA 4WCDA 2WMDA 4OXKA 3L9WA 1AXGA 5I9MA 4RVUA 2D2IA 3EHEA 4BKQA 2F00A 2EIHA 1NVMB 3JYQA 4CLRA 3JQ9C 3H8VA 3NGXA 2PH5A 2WYWA 3NDIA 1T2DA 3RUDA 4TROA 3LF2A 2GZ1A 1NYTA 2AXQA 4LSMA 5TT1A 3V2HA 4Q39A 4QT0A 3NTRA 4BV9A 1TXGA 3IAHA 3MTJA 3TL2A 4CM5A 5BNTA 3GAFA 4PLZA 1XQ6A 5G2OA 4B4WA 4CMBA 4RO0A 1HE4A 4LMPA 4E2XA 4OAQA 3ICCA 1ZIDA 5KNLA 4CUJA 5JC8A 5JAIA 1Q0HA 2ZQYA 3TRIA 3PQFA 3QVXA 2TMGA 2QZZA 3CTMA 4U0KA 1LRLA 3HE3A 1ZK4A 3RJ9A 4FJ0A 2VT2A 4Y6PA 5JPIA 4E33A 1K2WA 4BL5A 3RKUA 4DPMA 2HJRA 3E1KA 4EUHA 2HQ1A 3P2YA 4IZHA 4M55A 1MUUA 3R3JA 4N7RA 1E7SA 5G0UA 5AXDA 4NQZA 1GDHA 3LT1A 2AEFA 2YFQA 1GCOA 1I01A 4U8GA 1U7TA 5DP1A 2A94A 4MP8A 4WECA 3WGOA 4CM4A 4CQMB 4R3NA 5JAZA 1D8AA 1W73A 5K0ZA 1VE9A 4D0SA 1TT7A 5TNXA 4EJ6A 4JIGA 3V8BA 3Q9NA 4JBIA 3PJGA 2I99A 1XEAA 1MC5A 4FD3A 3UCXA 1Y8RB 4XRGA 3NJ8A 5BSEA 4HX5A 4IY1A 1D1TA 2R6JA 4UUPA 1P1HA 2AW5A 2D3TA 3VZQA 4BNHA 1K3TA 2BI8A 3I9LA 1B15A 1XKQA 4BNLA 2YUTA 2CD9A 1RWBA 1DLJA 5BSFA 1TT5A 2VUUA 3GG2A 1LDEA 4TSKA 4BKUA 5EQFA 3AI2A 3W8EA 2WYUA 5CEFA 1DBVO 1K6JA 4P8RA 1OC2A 1BDBA 2W8ZA 2HKIA 2JCVA 2ZYAA 4KTVE 1P1RA 4IZIA 1MFPA 3UH1A 1U9JA 3ITDA 1DFIA 1RM4A 5KVSA 2GZ2A 4MVJG 4PFJA 3KRTA 5HBRA 4WKGA 1NVGA 5I8WA 4WNIA 4M87A 3GEGA 3VZPA 3JQAA 3I9OA 4I5EA 1K5HA 2VRCD 4WASA 3B1KA 1WMAA 3D3EA 1GUZA 3QJ5A 1QP8A 3IUPA 4ZRMA 1EUCA 1U28A 2YW9A 2Q1TA 1DRUA 1P45A 1H9AA 4UULA 4DYDA 5JDIA 1M66A 3PJEA 1JWBB 3FNGA 1Z7EA 3NGLA 2UUPA 4PLGA 3VVCA 3DFUA 5B37A 1I3MA 1D3AA 2YHIA 4NHEA 3ULKA 1GEEA 3I5MA 4UUOA 3M6IA 4YDRA 2NTJA 3L6EA 1ZSNA 2H1SA 4TZTA 4I5DA 4OKNA 1JTVA 5AXCA 1R0LA 2C2YA 3SBOA 4L4XA 3BZUA 4HY3A 2IZ0A 4BKOA 3ZW9A 3VTFA 4JX8A 2J3JA 2OGUA 2UDPA 1CYDA 4R3WA 4YJGB 4GX2A 1WW8A 3F3SA 5EMHA 4CM9A 4R16A 1QYWA 1RYDA 1BVUA 2GCGA 4E6PA 2GN8A 2VYVD 3O26A 1TA4A 2OZPA 3WFIA 3LT0A 1AHIA 4GSLA 4AJIA 5JY6A 4RPKA 1BW9B 2G0TA 5F5LA 1ZXBA 3JQFA 3PPIA 4GWKA 4L8VA 2ZTUA 3K9QO 1N1EA 5T5QA 1HDZA 4DMLA 3DFZA 4UVHA 2ZYDA 5TC4A 3TFOA 4INAA 2AQHA 2RH4A 1E3WB 2NACA 1KY5A 3RFVA 3GOHA 1R0SA 1KY4A 2NVUB 4MKRA 5GZ6A 3FWZA 4YQYA 3PJDA 4I8XA 2VYND 3ANMA 5FYDA 1C1DB 2PZJA 2I65A 4UVIA 3RROA 5U9CA 4K1LA 1ZBQA 2Q45A 3JYOA 3FWNA 1LXCA 2HMSA 2PGDA 3GFBA 4GVLA 1JN0A 3QWHA 4D45A 2VWPA 1ZJYA 3FNFA 4MPDA 3KYBA 2AA3A 1PJSA 4OM8A 3NYWA 3EDMA 1ISJA 4N18A 3RUCA 3UN1A 1PQWA 1IYZA 1SOWA 2DFVA 2FR8A 2O23A 4MINA 2AG5A 4YVFA 1H0KA 3OJ0A 4AJEA 4ND4A 3TDKA 1T24A 4D41A 1YL5A 3AUTA 3S2FA 1WP4A 1YOVA 3AOEA 3G49A 1F0YA 1UP7A 1VJ1A 2BHLA 2FPPA 3W4IA 2QYSA 1QKIA 2O3SA 3BMCB 2NQ8A 1M75A 1UXIA 4A73A 4DIBA 4PVCA 1ZEMA 3FRJA 1XU7A 3UUWA 3EYWA 2GZ3A 3I9JA 1H6CA 2ZCUA 5G4KA 1CIVA 4DLBA 1HL3A 3KETA 4R41A 4RORA 5A05A 4CMIA 2X9NA 1C3VA 2G82A 4IBOA 3VPHA 4BUCA 3WXBA 4IUYA 1HKUA 3H65A 4Q3AA 3VH3A 1H6AA 3PGJA 2IEBA 3WMWA 4CM9D 2NWQA 3U9LA 3HN2A 1YE3A 2Q2QA 3L6OO 2JKVA 3DMYA 1Y9AA 3Q1LA 3AU9A 4QQRA 2YJZA 3UKOA 2OXIA 1ADFA 1IL0A 1YJQA 3E48A 3D0OA 4IDGA 3LT4A 2VOJA 3QWFA 2HO5A 2EJWA 2CDCA 1IB6A 1K6XA 5L7WA 4K26A 4G5HA 3C1TA 3NX4A 1GADO 4CM3A 4E5PA 3STHA 1P74A 3C7AA 1HZJA 2Z5LA 1BDMA 1HYHA 4UEOA 1HF3A 4WOKA 1UAYA 4E21A 1U7HA 1OC4A 2PNFA 4ALLA 3RC9A 4BNJA 3ZWWA 5ADHA 3JQ8B 4J1SA 1U2DA 3GHYA 3QSGA 3QVWA 1QYCA 4LW8A 2A92A 4MJLA 1YB5A 1OI7A 3DDNA 4PCVA 5IFLA 3DXFA 3C7CB 3S2GA 1R12A 3E9NA 3EW7A 4ILKA 1DDOA 3WFJA 1CDOA 2GLXA 4B3IA 4BOYA 1ENPA 3I9KA 1IHYA 1VJ0A 3K5PA 3K31A 5TGDA 1U5CA 1GZ3A 3ETGA 5AVOA 4B79A 3RUAA 2NLOA 2B4QA 3L9XA 1EE2A 2FSSA 3JQ9A 4PLVA 1YWGO 3FR8A 5LC1A 2Z1NA 4CMGA 1PJLA 3LC7O 4OKIA 1YVEI 1SCUA 2VTDA 1YS4A 3GLQA 5HWSA 3H4VA 3V2GA 4KDFA 1P1KA 1NQOA 1N9GA 1I2CA 4E3ZA 3QY9A 4MKZA 3AOGA 4BMNA 1Q7BA 1Y5MA 2BD0A 1YDWA 5BSHA 2ZB4A 5HTOA 3N7UA 5G0TA 4N5NA 2YDYA 2RH8A 4YACA 2EW2A 3ZDFA 2NSDA 2CVZA 2GF2A 3EVNA 4OOFA 1GTMA 3AUSA 1HSOA 1YRLA 3F46A 3PDJA 4WCFB 4RLSA 3JYNA 5FI3A 4PZDA 1JAXA 2Q3EA 1ZW1A 3RU7A 4BGEA 3RASA 1WMBA 5LDGA 2AQKA 1KVQA 1EVYA 1IUKA 4B7CA 5A02A 3LDHA 4FCCA 5FF9A 4BNXA 5IN4A 3AUAA 4FFLA 4OL9A 4YT5A 1SC6A 2GUGA 4OMUA 3GUYA 4BO6A 2R2GA 4ZJUA 3B6ZA 3F1LA 2C59A 4NFSA 1GV0A 1X7DA 3TSCA 3B20A 3RBVA 4JXKA 1T1SA 1MXFA 5F1PA 1KVTA 4YPOA 5T67A 3RC2A 4J0EA 1Q0QA 3W6UA 4EEXA 4H3VA 1GYPA 3QHAA 1SPXA 3DMTA 4KMSA 4JBGA 4PZEA 4PLFA 5G0WA 5IDXA 1A72A 2YQ4A 5FWNA 4CJXA 3PJFA 2HMTA 4A26A 2VWGA 3ROKA 1WWKA 3HHPA 4MVJF 3AWDA 2WWRA 4XB2A 4WCFA 1N7GA 3KYDB 5LDHA 4BNYA 1WXDA 1LTHR 2BMAA 2YV2A 3EUWA 4IPTA 4NU6A 2ZTMA 3PWKA 1PJ4A 3T7CA 2AG8A 1TEHA 3GAZA 2Z95A 5JLAA 3WGZA 3I9NA 1Z7BA 5H83A 3AI3A 3OFSA 2EP5A 1R4MA 4IXTA 4XGKA 3V1YA 3ZWMA 3DQPA 3PDUA 5DCYA 3RBZA 1ZFNA 3I83A 4IQ0A 4CR7A 1IOLA 1WZEA 4ALMA 3DAGA 4DQXA 1O89A 2Q2WA 2GASA 4ND1A 3QWIA 1MB4A 2PV7A 2VZ0A 2EWMA 3QVTA 3WTCA 3GA0A 3ZNQA 4D43A 5IXYA 2OMEA 4I5GA 3JSAA 7MDHA 3OQBA 3PYLA 4E13A 3NTOA 2FR0A 5JCXA 4DPLA 2JL1A 4J0FA 1LUAA 3GRPA 2NNLD 2HAEA 2GO1A 1K89A 3M2TA 5F1OA 4BO8A 3L4BA 1CETA 1KEPA 4WCFC 3ADOA 4CLHA 3GDOA 4DC0A 2Q49A 3WGTA 3ZU3A 4WLVA 4H7PA 4QO8A 3HJAA 2C5EA 1QR6A 4KP7A 1LX6A 1H9BA 3GMSA 1C1XB 3RUEA 4W9NA 2DBRA 4IGFA 4FN4A 3DZFA 3CPSA 3Q2IA 4JROA 1DLIA 3RQSA 2Y1DA 2HJSA 5DF1A 2P5UA 1I32A 4HWKA 3U3XA 3DC2A 3GT0A 3GDFA 4O0LA 1DC6A 2DT5A 2V6BA 4CMAA 2Y1FA 2O3TA 1Y81A 2DC1A 3ZHXA 9LDTA 4YT4A 3PK0A 2E37A 3F5QA 4RDHA 3WNVA 2OP1A 3S1LA 3WBFA 1NQAO 1CQIA 2A4KA 4R54A 4YJDA 2WEKA
chains in the Genus database with same CATH superfamily
1SR8A 3QGMA 4Y2RA 3MMPA 4RADA 2XDYA 5I7UA 2PBRA 3I32A 2JJQA 2CUNA 5EXDA 3P9IA 1UODA 1NJ1A 2YXPX 3LPCA 3MJ4A 5DM60 5I7AA 2P2SA 4NABA 3H75A 1QVZA 3II6X 2HQOA 4PSCA 4PZ9A 1B76A 3MMNA 1D6NA 2Q2OA 5TRTA 4D9CA 4LDJA 1MB0A 1AKMA 3T7KA 5DASA 3WQSB 2WJ6A 1CULC 3LF1A 5FFFA 4EITA 1G3QA 3P9XA 2Y27A 4U6SA 4YRKA 1YTUA 2DHDA 3BSSA 3GVIA 3M6XA 3EFOB 1RACA 2FZCA 4P34A 1PNOA 5E7QA 3DB1A 4CV3A 3AHGA 2C1EA 1G1AA 2X8LA 3FKSD 1DBQA 2QWXA 2P2LA 1QFMA 2GFHA 4CKBA 1TU0A 5J58A 4Y9TA 3UATA 3BRQA 5AK4A 3VBCA 1NP3A 2XVYA 2Y3IA 1SVUA 3SHTA 2WQ6A 5K8VA 5E6RA 1PWZA 4AQDA 2J9FA 1RJDA 3CW2A 1PG0A 3DBHB 4G41A 2IH2A 3K2BA 2WJZB 1TMGE 4OHMA 3FPLA 1YE5A 4A5OA 1RWOA 1TAHA 2PQ2A 4LKOA 1NTOA 5DYTA 1KU0A 2VI5A 4RC9A 3P19A 3WLFA 4NCAA 1JA1A 1VYTA 2J07A 3OUTA 4QULA 3TRHA 4D0RA 2YW2A 1KKUA 1FFEA 4LECA 2VJDA 3ANLA 1NVTA 4PAWA 4C0WA 2QN2A 4LA4A 1UJBA 2Y1WA 2QYTA 4HQNA 2E4ZA 3L4JA 4XTCS 1PL8A 1LQUA 5JNUA 3PQ5A 4XQEA 4D74A 3CNQS 3JY6A 2V3CC 2J3DA 3D6HA 1J8VA 2OKGA 3RS5A 3AL2A 1FXUA 4Z53A 1G5RA 4UBOA 1CUEA 1JG4A 1W36B 3EMKA 2YWEA 4CTOA 1Z2PX 2GVNA 2BCEA 5KSYA 4L5AA 4Z1OA 4WN3A 5KOHB 3DA8A 2R85A 3OT1A 1ATIA 5KNBD 4KXVA 3I23A 2C9OA 2BDEA 4PLTA 4B7XA 1JKIA 4TSFD 2QI9F 3E5RA 1ZK1A 4NFYA 1I1QB 4B71A 5H3HA 1KMIY 1E5LA 5IH7A 2G5TA 4FDTA 2WFMA 2W6NA 2V58A 2H6EA 4K9PA 3ZX5A 1N2BA 2JGMA 2CF6A 4GDFA 1SPBS 2OG1A 4BO3A 3VDNB 2CHFA 1MOZA 3LECA 1P29A 2ERYA 1PK7A 3DT8A 1ESNA 4QICA 3EVDA 4W99A 4XYLA 5FA8A 3FMVA 2V03A 5A03A 2PRZA 1MA3A 1KR5A 4FFMA 1OYVA 4ZVQA 3U09A 4GP6A 3OJFA 2K4MA 3IP5A 1BWRA 3DMHA 1IONA 1Z26A 3JQEA 5IT0A 1Q3HA 3B9RA 2D7JA 1RJ9B 1WXFA 2D2FA 3TLEA 4O4HF 4XR4A 1RPTA 1V8ZA 2PLWA 4AJNA 4B2PA 1Z2NX 1N75A 4MMZB 3AK4A 4YRBA 2F7SA 1U99A 4CTMA 3GCGA 3HWRA 1FFCA 1NOJA 4XCQA 1H3NA 3N0RA 4FYKA 4TLCA 4YJ3B 3RVMA 4C29A 4M9QA 3CEJA 1XIVA 4DKXA 4IO0A 3G2PA 4DBVO 5A7GA 4DV5B 4PPQA 3RC3A 1CZKA 3QY0A 1OIVA 1K7CA 1KQPA 4RQUA 2AE1A 2JJYA 2ZRBA 4AU1A 4P9NA 4C6TB 4FDVA 3LDUA 4DZZA 4MDFA 4KI0A 2P69A 1FVFA 1VMEA 4A15A 2FZWA 3LX6A 2QE7A 1ISHA 5BQOA 3M5WA 2F59A 4PHTA 2VN8A 3C4VA 3EXG1 4ZZ3A 4JI0B 2K2QB 2J9FB 2ZYGA 2GEKA 3ZI7A 3OC0A 4FIZA 3H2GA 3O3MB 3Q3EA 4J16C 4ZTBA 2AC2A 4BVBA 3L2OB 2XITA 4YX9A 1I1OA 2AKAB 3Q15C 4MR9A 4S1WA 4ZOLF 4CIYA 2LP4Y 1M6VB 2O19A 3RLIA 4CU5A 2I2XB 3NDJA 3D7MA 3LFTA 2X0DA 2F8LA 3EWIA 3KTFA 4J4TA 5AKLA 3QK7A 3IIKA 3B7GA 4QDZA 1TCCA 1WKCA 1Y0BA 1YDMA 1SBTA 4P1ZA 5EPOA 4GT1A 3ZE8A 3KKPA 5EXEA 2AT1A 2WWYA 4DRXA 4Z8XA 1Y3BE 3KOUA 4JT9A 4II7A 1Z2AA 3NHJA 1XNHA 2B35A 1N8KA 3FZGA 3A9SA 4K40A 5LZ9A 3L46A 5E7JA 4MARA 5CLIA 2OC9A 3L01A 4LV8B 3K4PA 1JX6A 2JD1A 3D6VA 1KZHA 2HPHA 1FYEA 2R7MA 4ED9A 4H6WA 4YY3B 1T8PA 5AI0A 3QMMA 4YJKA 4F2HA 2UV8A 4F45A 2VQ6A 4FUTA 1N2SA 3FE2A 5FTLA 3MQFA 2XQGA 1PQ4A 4ILEA 5C1IA 1POXA 3BHIA 4L5JA 4AS3A 1KSFX 4CG0A 4OBXA 3UAZA 1XD2A 1QFXA 1ZUHA 3HA3A 4L4SA 3AW9A 1IRXA 3OCUA 3WSVA 2NVOA 2ZAOA 1CU1A 4IMRA 4FONA 4RK1A 4HAWA 3IR7A 4UNQA 1U3UA 4AJLA 3H84A 5BMVF 2QPAA 1FS4A 4JS0A 1LI4A 5JAOA 5LMNB 5FLXA 1F7UA 1O9BA 1SOUA 5AO9A 2B1GA 4OOEA 5F73A 4HFJA 3UBTA 4DKJA 1AGRA 1GCAA 3BK1A 2VCEA 1QANA 2QG6A 2FUNB 4U2CA 4D4LA 1BN6A 1Z62A 1LA2A 1S8NA 2VQFB 1O57A 2VWHA 2D62A 3RBAA 1J7KA 1AQUA 3TR5A 5KC9A 2TRSB 4B3MB 1M0TA 3T4EA 1GDTA 4MZXA 1AURA 2F8SA 1H3FA 1I3LA 4X62B 1OFUA 3EJ6A 5IJ0A 3C6YA 1TU3A 2NV2B 2ZJOA 3LPLA 4QGHA 1V7CA 3OT4A 4WOJA 2NG1A 4Q9DA 4BZPA 5EE9A 4GVPA 1GUBA 4IJWA 1GQSA 1YULA 4LRXA 4FINA 2Q3LA 3GDHA 3L7CA 4FC7A 2Z3WA 3F6SA 3HP7A 4LCJA 5EMJA 1L4BA 3WGKA 3DUWA 5B4TA 3MYRA 3SS9X 3SDSA 1SBCA 3FPEA 2UZ1A 2CMFA 5JCZA 1FDWA 3PNPA 4QUDA 2VSFA 3AL0C 2IXTA 2Q9BA 1ZZEA 4CKWB 2BDUA 2ZI4A 4X1OA 4B7ZA 1AKVA 5CGQB 5JRDS 2YJTD 2RG7A 1F2TA 4MVJD 4N01A 3UWMA 1EFRD 3G6WA 1OA1A 1PEAA 1HDGO 2HJVA 2IDMA 3HUTA 4ZAZA 3R0QA 1FRFS 1YZYA 1GSIA 3R76A 5A4JA 3M4YA 4GYYA 1YKFA 5IDYA 2HLNA 3QV1A 2WMOB 4G4SP 1IB0A 3D0QA 2AD1A 3GP8A 3OZXA 2RAFA 4LS3A 1D2HA 1FDOA 1XSEA 3IBYA 3OF3A 4HX2A 2FUG1 1KFBB 4OQXA 2CYCA 1N33B 3HYNA 2ERXA 5K6AC 4DNQA 4L9SA 4C1BA 2FEOA 2DT8A 3U6BA 1RRCA 1DELA 1LK5A 2Z6AA 4DCSA 1GGHA 1NHGA 3MTIA 2QORA 4S1TA 3RFUA 4JI8B 1BMDA 2IZZA 4MRAA 2WABA 3P9RA 4MIOA 2RBGA 3DKPA 3ORYA 4KMOA 1JMKC 1ISMA 1CUWA 3A37A 1L7EA 2I0FA 3PFHA 3UHOA 3WO0A 4BNKA 3LO8A 1YOBA 1V96A 2CT8A 1YC5A 2HK9A 3LXMA 4EY6A 3EAFA 3ESDA 3CA8A 1UWCA 1YJ8A 2IIQA 4NOJA 4BX9A 1RQ7A 5TIIA 1T25A 4ARIA 3W2TA 1DIAA 2V6GA 4PYLA 4XE5A 1G21B 1VHQA 4CDGA 2B1QA 4ZV9A 1MF7A 1NL3A 4Y9SA 3EH1A 3I61A 3UC5A 2XQVA 1PZGA 2WG0A 5KWIA 1YGPA 4OP2A 2M1ZA 1M6YA 5IK2A 4UEKA 1HQDA 3NYIA 3W9UA 3LCCA 3WC4A 1VPTA 4PY2A 4MUAA 3EZ2A 1Z0KA 2MU1A 2AMVA 3DMGA 3CWZA 3TZCA 4BCCA 4FX2A 4Q3BA 3IXQA 1NW4A 2Q62A 4BNFA 3DZDA 4CF7A 1XZMA 3CF0A 4KZPA 4AQ7A 5H3CA 4DDHA 3E03A 3TIFA 3K8QA 3ZY3A 2YNMD 4RVDA 3OM8A 1EVEA 3BA6A 1CVIA 3LGXA 3Q7IA 4A16A 4PR0A 2FZ4A 4BMSA 2IDJA 5TV2A 1CNEA 1FL9A 1PSDA 1QKKA 1T4BA 2PT6A 3K2QA 4V0RA 5DLQC 1LVHA 1O97C 5A3QA 1FJGB 1TZBA 2PS1A 4QDTA 1U2TA 5EEHA 3X1KA 2QSJA 1GAQA 1A27A 1MFZA 2YWGA 4WXEA 2PY6A 4DC1A 2I4IA 1D7AA 3H3JA 1FQOA 1W25A 3VZCA 3PR1A 4P82A 2JVJA 2IV2X 2IXBA 3OURA 1E5DA 4ID3A 3KSUA 4ITRC 3VPXA 1EM8A 4HZIA 2RC5A 3NDBB 4LFBB 1P7ZA 1PNVA 3GLGB 4LBZA 3M81A 3N5CA 1DG1G 2QKYA 2VJBA 3FB4A 3G2NA 1LRJA 4QOHA 3DGEC 4L9RA 3N9IA 3NU1A 3B1XA 1RPJA 2NO1A 4F3KA 2CXRA 1JTEA 3BHJA 1KDZA 2BGNA 4C87A 2HLDD 2PRJA 3T4PA 1JZQA 2B4KA 3QPDA 4Y2TA 1M2VA 5GZ1A 2HN9A 3ZYZA 2GBLA 4UM8B 4ZCPA 3DGFC 5JMWA 3WL8A 2WSYB 3UMYA 4NARA 3C3XA 1TW2A 3MZ0A 4MVCA 1XMJA 4KUGA 4OGLA 5H7XA 3ROPA 4A8HA 3E05A 3PF8A 1MJ5A 1NRJB 2HMYB 1TPZA 5AK3A 1AMNA 1T2FA 4FDUA 4CBVA 1X80B 1IY8A 1C0PA 3CKLA 3C1OA 3CNEA 1UEJA 3WQRA 3OSUA 4O5AA 1N1GA 3FX2A 4RL4A 5DLYA 1OKKD 3CE9A 2CHEA 3HCNA 4LYYA 4X44A 3LDGA 3HA7A 3FNHA 2X14A 2DECA 1WS6A 3BMOA 1PV2A 2AG1A 3DFMA 1HDYA 4FGUA 4RXTA 5FHRA 1EEXB 4RANA 4HAUA 3M3DA 1UFOA 3LX8A 4URZR 4P7JA 4HPXB 3VNSA 5K0JA 4WNCA 1RVDA 4MKXA 3V7WA 3VPFA 2NADA 2WF8A 3NH6A 5K3AA 4TKLA 2VF8A 3RO7A 3V2UA 4Q18A 1PFWA 1TK3A 2P5YA 1OZAA 3B2EA 5E6SA 2R87A 2KHZA 4NDNE 2VUSA 2Y99A 3ENNA 1ZD5A 1XX6A 1XZFA 3U44B 3DLCA 1C9MA 1E1QD 2G36A 4L72A 1AIPA 4LZNA 2R8XA 3O8LA 4KWIA 4LY6A 4IDUA 5KVCA 2D5CA 1SC3A 3SZ3A 3LQ1A 4QQ8A 4U7HA 4BFLA 3ZDDA 1R0WA 2BOVA 1W5EA 2LW7A 3REQB 4JNCA 2JI9A 3D1JA 3MCWA 3R7AA 5TEVA 1D6MA 1SIWA 5JXJA 3EZGA 1GOTA 4GPZA 1DFGA 3CINA 2O05A 3DBRA 2AC7A 3CN7A 3KKMA 2V9CA 1IBCA 1YK0A 4NJEA 1QORA 2CMKA 4BQPA 3K73O 1JRLA 3WLEA 5BN4B 1IULA 3QIAA 3ZWQA 2DAPA 1WPQA 3U3RA 4ZP1A 3VYRB 4B6SA 1I3OA 5I4BA 1NNI1 3A70A 5BUQA 3D4LA 3MJTA 2VYVA 4E3WA 1LQ2A 1KAQA 3V97A 5K0FA 2ZJ4A 4QBIA 1JAHA 2J6CA 1YBVA 5K8JB 2F3UA 2YIVX 5CUQA 1W47A 2Z2ZA 2B4AA 5CX1B 4YCSA 3GDGA 3E7XA 1NASA 1PW7A 1YRAA 1NXVA 5B1YA 3DMDA 1P5RA 1SC1A 4FR0A 1M83A 4PF1A 1T0HB 2GCNA 4G8JA 3W5VA 4YJFA 3C8DA 1O0SA 4IVNA 1DAHA 4X41A 3RFXA 1PDOA 1Y6RA 3CLSC 1GU7A 2FDXA 3TGWA 4A0SA 4YUWA 5PNTA 4W5OA 1VL2A 2VHTA 1BRMA 4V0NA 1KK3A 4KO1S 1RM3A 1V8BA 2D1RA 4B40A 3T0IA 3TSYA 3HSSA 4JLUA 5A4FS 3OIWA 4S24A 3LUCA 2QZSA 3O0DA 1PV4A 1WKVA 2P2NA 3DH0A 1OKKA 1ABFA 4EHHA 4DIEA 4UEWA 1CUVA 2G67A 4X1KA 3GLIA 3RODA 4I3FA 3OQHA 2PZFA 4PNHA 4D3FA 3FY4A 5EHQA 1CRPA 2XZTA 721PA 5EQDA 3UJ6A 3ND7A 4RYLA 1RHMA 2BBSA 4D8WA 1PL7A 4TL6A 3D6JA 4HX9A 4U2BA 2QM3A 2DMRA 1G2QA 5DMHA 5FWDA 1YZLA 5TGZA 3S1AB 2P6RA 2R8ZA 4YRSA 4XWGA 2HGSA 4RMIA 3DV9A 2ACVA 4N5IX 3CSSA 4TV8B 1AO0A 3ZLJA 2G17A 4K3UA 4RULA 4P7KA 3TZ6A 1JA9A 3EDYA 3TLGA 1BFKA 2Z1DA 4WGFA 5LKRA 3QEBZ 1N6HA 4BO2A 1KEWA 3V2IA 4OHWA 3NG1A 4ZI5A 4D44A 3AKDA 2VNKA 1T26A 4HDSB 4FPXA 3P5BA 4ZYXA 3OUZA 5B5SA 3IHWA 1DXQA 3P9SA 3HKDB 3SU8A 4N3NA 3I2JA 5IJZA 2I67A 3TPCA 1LPNA 2GN9A 3CBQA 5DBFA 3RGWS 4BFZA 1EINA 3FDFA 2YZGA 4W1QA 2J0UA 1UMKA 3B1JA 3LCUA 4EPVA 4N8SA 1EK6A 1Z22A 3QTLA 3TSOA 1XVLA 3A4MA 3DXYA 2XY4A 4XIFA 4JKYA 4HXYA 1MO5A 1XLUA 3WZLA 3RUHA 4A2QA 2N0SA 3U17A 5DYIA 4QEDA 3G9TA 3L8YA 4H1TA 4ND7A 4D8UA 2HMWA 1QIMA 1UDAA 1EX7A 4S3MA 1GITA 2X7HA 4I1SA 4M49A 2NTEA 3HNPA 5BMVB 4L7VA 2WD8A 2B0CA 4ZVRA 4IDOA 4EGSA 4LF5B 4XVUA 4JJ4A 4R5MA 2BVNA 2H51A 4CM8A 4IICA 1GGKA 2UYHA 3WS7A 3I37X 3ICOA 1J20A 1EQ2A 2Z1MA 2QLJA 2VYQA 2CHUA 2XWBF 2ZRPA 3OQIA 5J4HA 1TYEB 2BI4A 4PG4A 2AMLA 4DXDA 2C82A 1ENYA 1FUIA 1GQRA 4FGLA 2O57A 3TZHA 1I7PA 4EG1A 5I9NA 5BMOA 3K09A 4C4SA 1F14A 3U62A 4KFUA 1A50B 4P86A 2W71A 3O93A 3C4JA 4RWZA 1F2VA 4WJZA 1XVIA 3EWAA 4L0QA 5BN3A 1QE3A 3LK6A 3ZXUB 2PD6A 3BL5A 1XRSB 3EGXA 1N0UA 5B57C 1ZD4A 2G40A 3KLBA 5HKKA 4BN5A 4P53A 3IAM1 5EE1A 3EC7A 1ODSA 3KS9A 2C3UA 4F60A 3IO3A 4KV7A 2REOA 3R24A 2EV9A 3VJMA 1WA5A 5E3IA 1XWIA 3IPCA 4RTRA 1CRWG 2WWVD 2C5GA 1UAAA 4OHYA 3H4TA 2Z08A 4HNUA 3GAMA 3G1UA 4J90A 1H5UA 4QDXA 3QU9A 1AV7A 3ZK7A 1FJHA 1HNXB 3NT5A 1GPDG 5REQB 1U0OC 3OWXA 1RBMA 4DLLA 2PK3A 3PCRB 1WTAA 4X66B 3HUUA 4EUNA 1VKZA 5I4KA 1H5QA 2FYTA 3PQDA 6REQA 2VJMA 5H16A 3ZIDA 2H2HA 3T5DA 1UKEA 2J4DA 3G2JA 3RC7A 1SZJG 4ZIRB 4YAIA 1Z4IA 2QL5A 3IT2A 4HN4B 3ESQA 1E7RA 4KE8A 4U39A 3PFFA 4IX1A 2NAPA 4TL9A 1RKQA 3VR6A 1L7QA 2H1WA 1E6KA 1Z6ZA 2NO4A 5C4MA 1P61B 4XLLA 1FDIA 5LA6B 2VL7A 2ZATA 4RY0A 3W0LB 2HHAA 4PANA 1JJIA 3BTVA 4J0KA 5JCJA 4B6OA 4M9XA 1OI4A 2E4UA 1YQ9A 1R0KA 2ZJ6A 2X76A 2B83A 2XLCA 2BFNA 4QXQA 5JDIC 4PHFA 1WUYA 1CY1A 1V3VA 4ZRNA 1XZQA 4YO7A 5CBPB 1B41A 4NRDA 2OFFA 2RH5A 3JASB 3L1KA 3R7WA 1OLXA 1ZVQA 2HRZA 2R1UA 4C6SA 4ZVLA 5LQJA 4IKEA 2O3JA 4IGAA 4PYNA 1VYUA 3COZA 3R3WA 1SQGA 2ZE5A 3ZDYB 2PKCA 3KLNA 2HNKA 3DEFA 3S44A 4WY8A 2HSJA 3D7RA 4B44A 4YR9A 2RBEA 1OB5A 4RIFA 1HLFA 2PKRA 1K8ZB 3CX3A 3L41A 4PRKA 3AERA 3JQAD 4NPCA 1EXNA 2GJKA 5FBZA 1WPXA 3ZNNA 2P1ZA 1U0BB 4KAAA 1NE2A 3CZCA 3LY8A 3R4CA 5DBEX 5DHAA 1P7WA 3O84A 1EZ4A 3PEVA 3M4NA 5CLGA 4WAUA 5AOBA 2BEUB 3TXAA 4RETA 4HFRA 1C7EA 1H4QA 3CEAA 2AD5A 1IJBA 3ILHA 1MTOA 5IZCA 4IJSA 4YLYA 3TB4A 3UWKA 2FQWA 5KJ1A 1G20E 2FETA 3M2PA 2QAGB 4L4UA 2VHUA 1WJGA 2HXSA 1YI8A 4LVCA 1ORWA 4S1VA 4ECEA 5J4YA 4RQAA 5G02A 1A0OA 4JI1B 3H18A 3ASUA 3DBLB 3JQGA 1R4ZA 4XCVA 2RKWA 3IDFA 5EIHA 2SHKA 3FF4A 2A5YB 4MR8B 3K70B 1X1RA 4CIDA 5DN9A 3JVEA 3SBEA 2WRZA 3O2SB 3STUA 5BWBA 5EI5A 1KBOA 5FUBA 4OX9B 3VC1A 4HYEA 3TQFA 1LKZA 2HO4A 3QU4A 1KVUA 4WKBA 4YRGA 1JDUA 3ITKA 5J23A 5ES3A 4DL9A 1HA3A 1WY7A 4HF7A 1E6UA 2PKWA 2HHHB 4IKPA 5LPNA 3KPJA 2VC2B 1U63A 2G09A 4V2UA 4PXSA 5JRZA 1JKMA 2XHZA 3AKCA 3LO5A 1PTJC 1T4GA 3BMQA 4TRJA 3WLNA 5ILQA 5B6PA 4D6XA 1GTSA 4DDMA 1HDRA 1E1RD 2F3TA 4XD7A 1QO7A 4ZVSA 3TSZA 3M6AA 5JNLA 5KSOA 4EG5A 1AHHA 2E4WA 3NPAA 4LJ8A 5DO9A 2C7PA 2WFLB 1KNQA 1ZRNA 1E18A 3DHYA 3OJLA 1P44A 2OFXA 2XD9A 3IP8A 3EZYA 4IFIA 4OIMA 5ED0A 5F64A 2IV3A 3H42B 3TNDA 1YQUA 2XA1A 3IH5A 4ZZ2A 2G4LA 4Q3EA 5SICE 4IOMA 3WDSA 2AZXA 3CNLA 3R8CA 3BJIC 1DJQA 1W94A 3L0DA 4QYSA 4DUPA 4C7JA 1GGNA 4WZAA 5IAJA 1DMRA 2YR0A 4JX9A 2UYGA 4OQ4A 1JEYB 3GUZA 4ZT7A 3HB4X 1HQKA 1ZSVA 2APJA 5AOCA 5H80A 3F4KA 5L3SB 5AJHA 1SVNA 3WIOA 4YRFA 1K92A 3GLFB 2CLSA 1WAMA 2EL7A 2ODQA 1NUTA 2IPMA 1PFQA 2B6NA 1G9SA 2I54A 3CH5A 4GQBA 5AJUA 2IUUA 4B0OA 5A9SB 3HO1A 1CUDA 1PS8A 1TF5A 3G88A 2IIVA 5IKPA 4RKQA 1OLXB 2PEYA 2VBFA 3A1FA 4XA8A 2C5FA 5CT4A 1A5ZA 4CKWA 2Q6VA 2Y8EA 2AE2A 2FSVC 1Y7IA 1K2VN 3DDUA 3IA2A 2FPKA 1X8XA 4LJKA 1EFKA 4I9UA 5ALTA 5KVAA 3IUBA 4TM7A 1WDKA 4CKEB 3ZBUA 4DTCA 2YOGA 3IALA 1RAEA 4EARA 3D6NB 1YZQA 2QF7A 2D2XA 3D0RA 1ZESA 1Q7CA 1GUAA 2YMPA 3O8DA 4BFSA 4UCXA 1GTVA 2QD3A 2ZKLA 4QXMA 4KRGA 4E5NA 2IYOA 3JQ6A 4EB6A 1JQBA 4KGVA 5KCZA 5ALHA 3ZJYA 4LJ4A 3CVXA 3Q8MA 1WOYA 5JD3A 2PX8A 4PG6A 1BEEA 4L5BA 5DTQA 2VPTA 1RAFA 4EAAA 3MJVA 3HBMA 4L73A 4EVIA 1WXIA 2B98A 4A5SA 1NM5C 1U90A 1HQYE 2WWIA 4IIUA 4RVNA 3AR4A 2CUKA 1MVNA 1PJRA 1C3XA 5ECDA 1YL7A 1NLFA 1Z0DA 1OXUA 2O2GA 4QSHA 1N2IA 3FW1A 4GZ3A 1JE0A 4FJ2A 4WE3A 4CU2A 5B12A 5C8YB 4DQKA 1GPYA 3U7FB 3PUZA 5DB4A 1J4AA 3CMMA 5AD1A 2REXB 5IWCA 1P7PA 2Q9UA 2I7XA 3SHOA 2IYFA 2ZSJA 3L04A 4BFUA 2M9MA 3DJFA 3KC2A 1M2HA 1JLLA 4LZWA 4NMLA 1XK7A 2BZSA 4JSRA 3AEKB 1KYQA 3UBMA 2OY0A 5BORA 1SWWA 1XTPA 4NBLA 5BYAA 1LPPA 2LCIA 4BB9A 5JC1A 3EPJA 2ISQA 2H4YA 3OD1A 1W0JA 1V8FA 2P6OA 3T3GA 1ISSA 3CLRC 3PVCA 4PTLA 4FZ5A 1YR9A 4YIHA 1TVKB 2XXAB 5ILOA 4DBZA 5DNAA 5FULA 3DMNA 2WWTA 4KE6A 4A3SA 2WTUA 2DKOA 4OI1A 5KWEA 2BCGY 3QLTA 2Y67A 5AVXA 1TJNA 4AJ2A 5JS7A 3IKLA 4QTUB 2E48A 3AQ4A 1MW8X 1XJQA 6GPBA 4RJKA 4ZJUA 2J8ZA 1QP4A 5DN6A 1NQTA 2VF5X 3GXBA 3N6RA 4UQPA 3ZWVA 2VHVA 4X3CA 1Y7LA 2X58A 3N3AC 3BS4A 2IE8A 2ORYA 2ODTX 4IX9A 3FBGA 4EI7A 4O4LF 3IT0A 3MYYA 4LDAA 1RKXA 4MPTA 4FFWA 2UAGA 3SMVA 5BWNA 1B0UA 2XDAA 1C7IA 1F0NA 4Q5IA 3H1TA 5AVWA 4EUKA 2O48X 3WMRA 1V9SA 3BMOB 1E66A 3PE6A 1O95D 3IC5A 1KK0A 2OUIA 4RPCA 3KQOA 4NFHA 4KTTE 1EK0A 3GL9A 3Q72A 3QFFA 3L8MA 3GFFA 4UBJA 4C2TA 1PGJA 2C54A 5D87A 4RLQA 3P9KA 2HFKA 4HEQA 5IDWA 1FSFA 2CFIA 1N5DA 3I04A 3TGLA 1CQWA 5TPWB 1DC5A 1TQ8A 1FTGA 2BTQB 4H1VA 2DLDA 2LTAA 3DB2A 4QSMA 1X7XB 2RGAA 3H5AA 3EFBA 4O4IB 5A0FA 2PGNA 4A10A 1X6VA 4XVCA 2RHCA 1KA9H 2WM2A 2EP8A 3MMZA 2ZWOA 2BZ1A 5FUQA 1DKQA 3D4NA 5EY5B 4X3PA 4GMGA 2PH7A 1SCDA 5THKA 5BSKA 1PJ8A 3THOA 4B4OA 1ID8A 1OFHA 3USCS 1Y7TA 3PXBA 2MSLA 3KVOA 4E15A 2WSIA 3QW4B 1DRWA 1X38A 4M1TA 2VTEA 5CDSA 1C7FA 1RPNA 1OIXA 1TL7C 2OVBA 1W2WB 3E5HA 4YQZA 3DBVO 2FCAA 2QU7A 2PZAA 1H8EA 3KVVA 4YRTA 2P7HA 4XSGA 1ZCZA 1QOZA 2GWHA 1QGDA 2VNSA 1O5TA 4B82A 1KDOA 4BQRA 4OXNA 5A0TA 3B6MA 1PIWA 4DILA 3FAKA 4DF3A 1RWQA 1R18A 3HJNA 5A6VA 4N41A 3K3PA 4QWMA 5CX4A 2QX6A 3JWPA 3ONFA 1M5RA 1G20A 2I4TA 3QA9A 2QTMA 5L95A 2VDNB 4N12A 4O8ZA 5C3UA 4UAVA 2QB5A 3P96A 3JAWA 4TVBA 2Q7DA 3F7TA 3HRIA 1BS9A 2AXNA 2JLVA 2IYSA 1XFAA 3RPEA 3B1WA 3U19A 3QVVA 1Q1AA 1I6WA 2DKFA 4JR0A 2V65A 2FW8A 3PR3A 5G53C 4W8GA 3OH8A 1F60A 2IH4A 5GONA 5CDTA 4NULA 3H6KA 2VYNA 2FX5A 4TXHA 1GYRA 1RJFA 3RS4A 3HCFA 2C5LA 1RRMA 3SZOA 3IP1A 5IJWA 3DHEA 1VJTA 2XX3A 3D5TA 3KBOA 4LEIA 4Q1VA 1MJFA 4KXLA 2FLKA 4HZGA 4QXPA 2ORVA 1Z5ZA 4H7DA 1ULTA 3RV4A 3DZHA 4QFMA 1UDCA 2OM2A 2YYZA 2W43A 4YMTA 1PQUA 1C2YA 5FPHA 3V8PA 3SYLA 5C8YF 3R7WB 2DUJA 2YVAA 1LNQA 4CMJA 1PHPA 4NOLA 4CV2A 2XMDA 5K03A 2P9BA 3HVKA 3UG7A 5DWVA 3WDLA 2YYYA 4PPFA 1PVVA 2H85A 3RS9A 3EMBA 2YCBA 2YN0A 1JHRA 2JLWA 4PIVA 1CXZA 1TKAA 3TF5A 3S2IA 2W2MA 5DSTA 1GKYA 1RDFA 4B0PA 5FOVA 2A1UB 2MINA 2CBGA 1IOZA 1XF1A 2QRPA 1DAFA 4D99A 5KIAA 5H59A 4AW9A 2J46A 1HLPA 3I01M 4J07A 3PUHA 1TI7A 4Q4JA 1BFUA 1M1NA 1UC8A 2YC4C 1KEZA 3PQEA 3N58A 1EWYA 5TR9A 1TYAE 3MUNA 3WBKA 5CDFE 2KWIA 3AKYA 3DAYA 3E3LA 1QQ5A 3JCZA 4E5VA 1WHTA 3GQBA 1CJKC 4I0WB 5L3VA 1BG6A 3NVKI 4OB7A 4HGZA 4F9FA 3HPRA 4L3OA 3DZIA 3KLMX 3NTQA 1HYGA 3TVTA 4UTVA 1XYGA 1C9KA 1SN7A 1W93A 3E61A 3LLVA 4MR7B 1Y3HA 4O63O 3B9PA 16PKA 1PS9A 4CKXA 5JSZB 2V0GA 1R4NA 4LYDA 4MI9A 4GX5A 3OHMA 4KQ6A 4QL3A 2ZBEA 2G5GX 3HV0A 4HVLA 1B7GO 3V4SA 3HWSA 4KR7A 4UBIA 4CUZA 4LK3A 5K5EA 3ABIA 2PLAA 1Q16A 1DAOA 2DFTA 1L7VC 3NANA 4NBWA 1F0PA 3PBKA 1E9BA 4D9NA 4H3KB 1R9NA 1O77A 1GPLA 1T2NA 1UH5A 3ZLVA 4C2BA 4EW2A 1PTKA 3EAGA 1JF8A 1VLVA 2VT6A 5DXAA 1ICIA 1DS6A 1NXOA 5H9VA 2E1RA 2HJ9A 1HYEA 1OH7A 4CQMA 3OMWA 2BM9A 4ZT2A 2OORA 1IUOA 2Z6QA 1U0GA 2C94A 4LOKA 5JSFA 3ELUA 5GJWC 1HC7A 1AUPA 1OWNA 2ZB2A 3OF2A 5JQGF 4J3NA 4YNBA 1KI7A 4KYVA 3T7EA 4MMXB 2BL4A 3U7QA 3I2YX 2X6RA 4YROA 2ZI6A 1G8SA 5D5QA 5E1MA 3LH5A 3QMVA 1KRXA 2UUAB 4GLLA 4NFLA 2AMYA 3AEYA 5AKEA 3TFQA 3VUEA 4HAIA 4C0KA 4PYKA 1AGNA 3KXDA 1RI3A 9MHTA 5C18A 4NCJA 5AHXA 4UDXX 3BERA 2UYCA 3PNSA 4FWIB 2D5BA 1UPUA 3GWGA 1QGED 3BDVA 5EJ4A 1XO1A 4D97A 1JNYA 1PSWA 3CF6R 1I0ZA 3BL8A 4LE0A 4KR6A 2B4TO 1OBCA 2PJUA 3HY3A 3RJ5A 1NN3A 4HMQA 3EW9A 1APBA 1GU1A 1K7YA 1BS2A 3CIOA 3HL0A 4FSHA 3BB4A 3SJBA 1HEIA 3VMFA 3DSRA 1NTRA 1P8AA 1CDZA 1OB2A 2BEKA 3IS3A 3MIIA 1M8JA 3AV3A 4PZAA 1RWMA 2OBNA 1C9NA 1Z3CA 3DWIA 4V39A 3W4JA 5EFZA 4BFXA 5CDYA 2F43A 3QLVA 1T8RA 2BGJA 1TQ2A 2FEWB 3QF4B 3KAKA 2ZUSA 2PX5A 2V7UA 1G5FA 3IUJA 4KQCA 4JBXA 1UFKA 3RTCA 1XZJA 4EI9A 4ZMBA 2IODA 3WGIA 3H05A 3IQWA 5F98A 3P4UA 4EYGA 2XBMA 1PJQA 2AFHE 2H5LA 1UPCA 1U4SA 2XKAA 3GRZA 4UNSA 3ZGXA 4PN7A 4B09A 5I8ZA 3KZKA 3EQ2A 4ZEMA 1G5IA 3TLZA 2QUBA 3PRJA 5CVDA 3HVUA 4ZQHA 5LB2A 2V0NA 1CR4A 3FMIA 5J2UB 1CJCA 2XJ4A 2XGMA 1W9MA 1WUKS 4C5AA 1S2MA 2FPMA 1MQAA 5LQMA 2HA2A 2QRJA 4PW0A 3D5QA 3VSCA 2X0JA 5K4AA 4HFNA 4BNZA 4M1WA 2VHJA 2Q0HA 4C6RA 1XN4A 3FPKA 1HH4A 2I8CA 3LVRE 4UHJA 5FOXA 3VAZA 3FMOB 2CLMB 3H0CA 3E0XA 2AKEA 2I3BA 1D5CA 3ZDBA 3RYIB 3WGNA 1I1HA 2GKOA 3PVZA 3R3ZA 1SKYE 1D0SA 2GM3A 4HADA 3V4PB 2XKJE 3ES9A 5LLSA 1BVRA 4XUCA 3ZIAA 1FFSA 4O1MA 3NEYA 1R37A 1PS0A 2FW9A 3F90A 4YAFA 1TM7E 1PLJA 5CEJA 1UM9A 3QV2A 3HNOA 1NF8A 1RBYA 3TTTA 3B1FA 4DVJA 4LVUA 1RXEA 5JTUA 3E3MA 3QYFA 4YRRA 2HZBA 4KVZA 4DR1B 1E4VA 5BYKA 4M8NE 3W04A 2QG4A 2ZRCA 3GJ5A 5LN1A 4GC9A 3KR0A 2XQJA 1M76A 1YQXA 3V4OA 3WWPA 4QUBA 3HFGA 5C7OO 3W9YA 3G5TA 3L7JA 5IXJA 3ZEAA 3EVEA 2BLNA 5JRJA 4C08A 3LPAA 1FXSA 5EMLA 1JMYA 1XD9A 1Y4SA 2ZU6A 3CUTA 3HDYA 4Q9JA 5GQSA 1IFXA 4NNJA 3JTMA 3AB8A 1UJNA 2CL6X 1NSYA 2C2ZA 5DNVA 2QQFA 3A2NA 1FK8A 1TGVA 1JFTA 3K35A 4ENPA 1YBFA 4MS4B 5DTEA 3WG9A 2ZUEA 2FX2A 4UFOA 2ZM5A 2TYSB 2ZDGA 3OF5A 2UVPB 3I09A 3NMUF 1W19A 1XZ8A 2IYXA 4CMKA 3HXKA 1A2OA 4WLNA 3WZ2A 2C9CA 4OBEA 1L7AA 2REBA 4QDOA 3H5OA 1ZH8A 1E1CA 2I3GA 2IP1A 3T3MB 4DB4A 1CY6A 1PGQA 1XP8A 4OP1A 1XQVA 1ADCA 1EG2A 4H59A 5D6NA 1YCFA 2PL9A 1J0AA 3MTGA 3TSAA 3BHMA 2GFIA 3MPOA 5LUBA 3T1NA 4LJLA 3FH0A 4JC4A 3A4VA 2C88A 4XKJA 4DR5B 3NALA 1UBOS 1ZRHA 2J3IA 3ZXYA 4A6DA 5K20A 4BLPA 1NUHA 2X13A 2ZYIA 5G4KB 2ZB3A 2I62A 1T9ZA 4BKPA 1DKOA 2ZRNA 4LDNA 4E5KA 2J7PA 3KEQA 2JC3A 3QA3E 3TNYA 3RFCA 4DJ5X 1DXOA 2XHEA 2E5FA 4PICA 2XXJA 4JVSB 2VDOB 3JQ7B 3KU4A 1PR3A 3DBIA 3AY7A 3UMRA 2FSFA 2PUWA 2SKDA 2O8NA 3NUZA 1I2BA 4OU4A 4R2IA 4EJMA 2P9YA 2X5XA 1FP7A 2B2NA 5A9RA 1DZ3A 1R16A 1U2GC 2OFPA 4C4RA 1UZNA 3KPWA 2DFDA 2YV1A 3AEZA 2DH6A 3DYVA 4MLCA 4EHBA 2PUHA 1QRRA 1RYEA 1MCZA 4UPVA 3NASA 3ONWA 2YXNA 3WTBA 5ERYA 5EOVA 2H9IA 3BJRA 1KYXA 3CG4A 1DIBA 3FCXA 3IQIX 5IEJA 1ZY2A 1U1FA 3H1EA 4PAGA 4WEOA 5LZ5A 1ZJZA 4AIIA 3CLTD 3TI9A 1D2NA 3DULA 4OUKX 4Q34A 5A5DA 4HDCA 3NTVA 1KARA 4PGMA 2ODWA 1S9DA 1C29B 4ADSG 1NI5A 4BV2A 3GLGA 4RK5A 1YB4A 2ADOA 3AESB 1FP4A 2J48A 5JHGB 2EARA 3KZXA 4OYRA 5AQ1A 3NV7A 1HUQA 4WFKA 3TAHA 2HA4A 4EDFA 1AN9A 1NVXQ 5IJXA 2WD7B 3HB0A 2NXWA 2HSZA 1JXMA 4HAYA 2JJMA 4KVAA 2OGTA 1IZZA 3SQMA 2PAFA 1A4RA 1VLZA 2A5FA 1SKUA 2Y1KA 2ZRIA 4GQAA 3U7HB 3ICQB 3FYHA 2Q9CA 1W4ZA 2D6FA 4ATNA 1YASA 1U0FA 1QZXA 1V9CA 2JFUA 1U11A 1EA5A 3LM8A 3ICWA 1IHPA 1KO5A 4IHJA 1JPUA 3VNRA 2FTKE 1CY2A 2YJ4A 5JQWA 1IJFA 5LQKA 4H17A 4UBKA 4MPJA 2A9VA 4EJ0A 1RLJA 3ANYB 1HNZB 4O2RA 2GAAA 3CZAA 3MWEA 2WM3A 3ECAA 1SCKA 3UIEA 3HSKA 4I1YA 4AG3A 2M6SA 1BXZA 1JQDA 4Q9LA 3U3DA 4G2NA 4CFSA 5FQNA 3K8YA 3G6KA 1QXSA 1RABA 3P2KA 2H9AA 1FFHA 3HKDA 3WXMA 2ALJA 3EGCA 2B25A 1USVA 2DWUA 4PC6A 4G01B 1QG6A 3OZCA 4DWWA 2O5RA 1P0CA 1REQA 2B5VA 4M8KA 1VJCA 4HFMA 3E2IA 3C3DA 2V7QA 3GROA 2BFDA 1UWLA 2AWNA 2PFGA 4FBGA 5EE0A 4C0QC 1B0AA 3IMEA 4MVJP 3OZSA 1JLLB 2RIPA 1OXSC 2ZAYA 1YU6A 3A6HA 3AHFA 4Q3LA 4OQQA 5JJKA 2HCFA 3J7AC 5ANRB 1EGVB 1ACJA 1B4DA 2HRCA 3UXEA 5LUAA 4LC0A 4I2NA 4HXGA 3R5KA 4KQIA 1DQSA 3PC6A 2B3TA 2HEIA 1JFRA 2VPIA 3LL4A 4OMFG 3ETNA 2CDAA 4KI7A 3WR5A 2P5TB 3LTNC 3UAXA 1ZUIA 3EF3A 5L7YA 2OO5A 3ZX4A 4QM7A 1V1MB 2FSGA 2PGIA 3EVCA 4A8JB 4PO8A 1EBFA 2XR1A 2FPIA 2ONKA 2WVJA 1CRQA 1Y1KE 3DMTC 1YQDA 3JR3A 3KO8A 3RS0A 4ARSA 5CM2Z 2XZDA 3H9QA 4AS2A 1YR8A 5FNVF 3TX6A 4RTJA 1DWPA 4GVXA 3TI7A 1DTWA 4GEGA 3WL5A 1VECA 3PIIA 3EBOA 1CR6A 1UJ4A 2EGHA 5F77A 5IH3A 1NBEA 1FFWA 1FU4A 1IBSA