2CLDX

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gdp (2)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
166
structure length
163
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotide-binding protein
molecule keywords GTPASE HRAS
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 163
sequence length 166
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cldX00
3HP1A 1KDRA 3RRYA 1NY6A 1DEKA 2ZVQX 1P2TA 3GCGA 3ZIAD 4LBZA 2BDTA 2ZJAA 4PPNA 4A1FA 1WP9A 3GJ3A 3HDTA 4BFTA 4LYFA 1NBMD 3KB2A 1S4QA 2XXAA 5FBRB 5JLJA 3VNVA 4FIDA 3P27A 4PO9A 2H18A 3OEED 5DYIA 5K8IA 1VKJA 2PMDA 1ZU5A 2ZRNA 3GLIE 4M1SA 3BFKA 1JR6A 4PQRA 4TL6A 1DG1G 1J8YF 3PR1A 2G0TA 1J8MF 2BMDA 1UBFA 2HJVA 3RS0A 5KUTA 3WXMA 4V0MA 2PEZA 1LTQA 4ARZA 2YWFA 5CDFA 5FBQB 2REOA 1QRAA 3K9HA 2ZS8A 2B8WA 4UNSA 3CF6R 4JLOA 2HCBA 4MH0R 4V02A 1G4AE 3PVSA 1A4RA 4DLRA 2JLZA 2FEMA 2HDNB 3GD7A 3QF4A 2ZJBA 4XSGA 4B44A 4TZ0A 2BEJA 3O8RA 3T1QA 1S1MA 1E9BA 5GVSA 1MABB 3BORA 3QVVA 1G8FA 3CH4B 4Q4HA 2GTPA 1D2MA 1ZCAA 1CTQA 3RS5A 3AQ4A 1W4AA 2CNWA 2VTKA 1IJFA 2FWRA 2ZJZA 3LQRA 4ZDWA 4TTPA 1E0SA 3GQBA 1D9ZA 2GF9A 4B2IA 2QTFA 3FHCB 1OF1A 1E4YA 2GJKA 3OIVA 5HE9A 4D4MA 4ZV4A 3BJIC 1KK2A 3ETLA 2WWHA 4KCGA 1YRBA 1M1YE 1G8PA 2F1IA 1AN0A 2D7CA 1KO7A 4DDUA 1Q3TA 3QQ5A 4B6EA 3TIFA 4IXNA 3ZVMA 2PX3A 5GJWC 4TZ6A 2NMVA 3NHAA 4GFDA 3IIJA 1OJLA 4R2IA 2A78A 5B30A 1KGDA 4URZR 2X77A 1X1SA 4WBSA 4LJAA 1KO8A 2CHVA 1P61B 5FPHA 2OFWA 1M2OB 2XEXA 2QE7D 3LBHA 4FMDF 3UK6A 4BRWA 3A6PC 5JCPA 3CRVA 4YXWA 2XSZA 2EFCB 2QMEA 3A1UA 3PUYA 4BUJA 3T12A 3LDAA 4CEHA 2ZJ8A 1SVWA 3UIEA 2RGNA 1S3SA 3W5JA 1P73A 1WCV1 5G53C 3GPLA 4KITB 1PUJA 2QM8A 3KFXA 3NBXX 2VF7A 4MGZR 5A0FA 1ETUA 5K8LA 1MH1A 2G1JA 3HPQA 2VHQA 2ZQ5A 2ZUBA 1A7JA 3K0AB 4YMSA 3MRSA 3PJRA 2R2AA 2GK6A 3EX7C 1LVGA 3FFAA 4JZKA 5BN4A 1W2HA 1G3QA 2IYLD 2F1JA 1KSHA 1P62B 1LB1B 1P7CA 3RS4A 1FW6A 2XJ4A 1FTNA 2Q9BA 1YZKA 1E2IA 4BZPA 3CRMA 2C96A 3FKSA 1ANKA 3X1YA 2ZM5A 2FSFA 4AWXA 2CDNA 4I99A 2N46A 2QPTA 3U3RA 4XVUA 5FOUA 4NHOA 3QPWA 4HLUA 1E9SA 2IUTA 4XSHA 1T4GA 3I32A 1XWIA 4EUNA 1K5DA 2REXB 3AKYA 4DLXA 2O8CA 5A5GA 2WSMA 3D7MA 2F1HA 2C5LA 4NL4H 5AUNB 1QZXA 1OFIA 3O8BA 4NZYA 4KSCA 4DDVA 5ANRB 2JASA 2ODWA 4LJ8A 3AKCA 3TKLA 3NDBB 2GF0A 1YHNA 3LX8A 4K8OA 3HR8A 2VP6A 2XTZA 2P6NA 4PPGA 3LBIA 4DLSA 1GITA 3H84A 4BEBA 3SYKA 4GOKA 2O8DB 1JXMA 3PXGA 4GP6A 3TLXA 3VFDA 1Z6XA 3SI7A 5E3HA 1Z6YA 3KFVA 4GRAA 3TR0A 3WYAA 3K70C 1OV4A 1P2UA 1KNQA 2KB0A 3VNUA 4DDWA 3HU2A 4Q19A 2EWWA 3UXMA 2AK3A 3LH5A 3K0AA 1VDZA 4ACAA 4DVGA 4DHEA 4B43A 4OQLA 1Z5ZA 4R7ZA 4Q02A 2BJVA 3E1SA 2ZRMA 4PHHA 5DO9A 2QQEA 4A2PA 2ATVA 2PCLA 2VHCA 1KI9A 3FHOA 4FN5A 1IXRC 1NG9A 2ORVA 5FTLA 2XTMA 4G3XA 1MO6A 3JVUA 2NZ8A 4A8JB 3VR1A 5BN3A 1ZAKA 2D06A 1M8PA 3KUDA 2QP3A 1FUUA 1HT2E 4PC7A 2IHBA 3U6KA 4TMZA 3LLUA 3CWZA 2RKOA 1KDPA 2V6IA 3SQXA 2OAP1 1OW3B 5HPYB 1Z0AA 5DHFA 2W2TA 5EXSA 4BFVA 3AVVA 2AFHE 2YJTD 2F43A 4UQOA 2GAAA 1E1QD 3PG5A 2IC5A 3NBYC 1XD8A 3VAAA 3BC1A 2YNMA 3W6NA 4YQFA 3DPUA 1F2UB 2GK7A 4Q03A 4UNRA 2CBZA 2ZRJA 4D81A 3A4LA 3JZAA 4KLZA 3EZ6A 4E03A 2W83A 1NJGA 1MOZA 4Q1DA 3ZLJA 4TYYA 1UJ2A 4L15A 3VKHA 1IONA 1ZM4A 3LWNA 3QVUA 4JLBA 4C4PA 4WW0A 2J59A 4ZCMA 4LCBA 4FINA 1N6NA 4Q00A 2AD1A 4AG5A 1FQJA 3AKDA 5A4JA 1GL7A 4QGAA 4HAXA 1T8UA 4TLBA 5B58C 1W5TA 4FMCF 3KXLA 4TL9A 2ZRCA 3NC1C 4RVCA 4A6XA 1VYUA 3EZ9A 4UJ5A 1Z0KA 3CLVA 1TQ6A 5IDVA 1OHHA 2SHKA 4V03A 2PJZA 2C2HA 2GETA 1NMYA 1HQCA 3PFIA 1J90A 1CP2A 1H8ED 4PXAA 1NBME 3SDZA 2A5YB 3ZDQA 1WXQA 3AF4A 1D2EA 5K8UA 4DSUA 5FPSA 3ZQJA 4L16A 3BB1A 1Q44A 3ICQB 4E07A 3KJEA 4QNMA 2CEAA 3C7KA 3GJ6A 1T5LA 4LYHA 4OHVA 1KI3A 3KQUA 2ZEJA 5DN6A 4XTCS 4M1KA 4B3CA 5FL3A 4DWJA 5JECA 2AK2A 1R8SA 3UMSA 5AUOB 3PEUA 3VHLB 4DRZA 1QG4A 4CF7A 2IWHA 3I8SA 1YE8A 4PANA 4B3FX 4IKEA 3KKMA 1CJMA 2GBLA 2HJGA 4AIIA 1JNYA 1ZRHA 3K0CA 821PA 4EQ6A 2NO6A 4JVLA 3HYRA 3T5DA 2C98A 5CK4A 4MKGA 1YZGA 4O0MA 4BFUA 2JLXA 1YR9A 1ZINA 3SU8A 1ZNWA 3E2IA 4BZQA 4W9MC 2CHGA 2GRJA 2DWQA 3PUXA 4D6PA 2ZSFA 3KJIA 5KDDA 1LV7A 1IBRA 5FR1A 2IX3A 3C14C 1GP2A 4GZLA 3KQLA 5DIFA 3L0PA 2W0SA 2RGBA 3NXSA 4Q5IA 721PA 2QG6A 5EQTA 4OI1A 1L8QA 4AI6A 3P1JA 5BW8A 2GXQA 4ZDKA 1CR2A 4DB4A 1JI0A 1S1CA 4HLQB 1GRRA 1N6OA 4GDFA 1OXSC 2J7PD 2B7BA 1R5NA 1S8FA 1S0UA 5L3QB 1GM5A 3P32A 4DJTA 4ZO4A 1JALA 2DR3A 4JL5A 1CS4C 5IHPA 3AF2A 4KBFA 3T1OA 1OH8A 1GVNB 2WTUA 4NCIA 4C0SA 4B32A 2ZU6A 5HZHA 3SR0A 1T3HA 1NLFA 5C46F 2RGCA 2E87A 2F6RA 2A5GA 2PZFA 2NO1A 1RFLA 4JIMA 4B2LA 4ACBA 3QIAA 2DFTA 5GJCA 1A2KC 1GFIA 3GLIB 2J3EA 4L9WA 2UKDA 5KSZA 2YWEA 1EFRA 4G5GA 1G18A 4HEJA 4KVAA 2FG5A 2J0UB 5G3YA 4W5HA 4XWOA 3BBPA 4M9SA 4B74A 2JJ1D 3QEOA 1N5LA 3QUSA 2AD5A 1JR3D 4KODA 4F4CA 4QJ4A 3GFOA 3M6AA 3BGWA 3AUXA 2B92A 1O87A 2ZAMA 3IO5A 2GEUA 2QAGC 1KKMA 3K70B 1BS1A 1M7HA 4KVGA 5HE8A 3ZZ0A 1YVDA 1WMSA 4LJYA 4LBWA 1Z22A 1N5JA 2MSDB 2N1BA 4M1TA 1ZM2A 4MYCA 4BLQA 2QBYA 1QHYA 3CF0A 2IEZA 2UZ3A 1BIFA 4D4LA 1BOFA 4Q1CA 3PENA 4M1MA 5DHAA 2IA5A 3AF1A 4MYUA 1AA9A 1A82A 1EX6A 5J40A 4XWAA 5L3RA 2O8FA 2OV2A 1US8A 1CIPA 3BD9A 1P75A 3I5YA 1Q12A 2AFIE 4FWIB 4IVRA 2IEYA 4YONB 2YWGA 2IYWA 2D62A 2H92A 4O2LA 5CJ2A 1JPNA 2A5FA 3M1IA 1FZQA 5FUVA 3IQXA 4NCKA 3CPEA 4C0KA 5G40A 1G7SA 1CBUA 4QBGB 3K70D 1MO5A 1E4VA 2KJQA 2BKEA 1KSGA 1E2MA 3OZXA 3ONWA 5CIWA 3U3KA 1CJVC 1EFCA 1BH2A 1DAEA 5LB4A 1E2GA 5EZ5A 3WBKA 5KDOA 4K46A 2WWIA 2IUUA 1E3MA 1R6BX 3V4FA 1JAHA 2P65A 5M04A 2O0KA 1CEEA 3AM1A 3Q7QA 3BS4A 1UBCA 1N0UA 1Z8FA 2QI9C 5DLQC 4HYYA 3CZQA 4CEJB 2AXPA 3C5HA 2J46A 2F55A 3DKVA 3K9NA 5BQ5A 4QFMA 2JJ2A 2HYDA 1W0KD 4D0NA 4DCVA 1E6CA 1DELA 2RB4A 4E22A 2WKQA 4DIEA 1Z6AA 4QG7A 2G6BA 3I8XA 2BCJQ 3THWA 2RHDA 2CJWB 3PIRA 2ZI6A 3MGCA 1G7RA 4RKEA 2FPKA 4V0KA 3MJHA 3NG1A 4FMBB 4XOIA 2PLFA 4C0AC 1IQPA 1KZ7B 4AKIA 4KV9A 4QBHA 4XD7A 2LKDA 2A5JA 3FFBA 5KU1A 5FOVA 4PC1A 2REBA 4XWKA 4PC2A 1TF7A 2RGAA 1XTQA 2IYUA 1EFUA 1F6BA 1Z2AA 4LUCA 1YZQA 5DI3B 1U98A 1G8YA 2O8BA 4OHXA 4AKHA 2JLRA 3B1VA 3FYHA 4NE2A 3QPVA 3H4MA 4OQMA 1XMJA 1COWA 1HH4A 3C41J 3GJ7A 4IFEA 4KFTA 4JSTA 1KI6B 1NIPA 4CYMA 2ERYA 5JEDA 5EE9A 4NYJQ 4RCZA 5DNYB 4H1UA 2A2ZA 3RC3A 1SULA 1T0JB 4RFSB 621PA 4YMUA 2R6GA 3I61A 4CEJA 3QY0A 1GUAA 3VMFA 3CPJB 5HR5A 4G1UC 3FE2A 4KI0A 2XNDD 4D82A 1IN8A 4PPFA 3OFNA 4TSFD 2GHIA 2QTVB 3TH5A 3R7WB 3W6PA 3THXB 1QHSA 3L2OB 3BXZA 3EW9A 4Q7JB 4IRUB 2CLDX 4HLUC 1GKYA 4NDZA 5JHGB 1G41A 2ZE5A 3DO6A 4FXPA 4Z8XA 3SZRA 2VYFA 4TYWA 5KOYA 1D8TA 2CK3A 2OCBA 4AKEA 3CBQA 3GJ8A 2IXEA 4URWR 1SVLA 5UKDA 3REGA 1DG3A 4RD0A 1ZM7A 3TSWA 2VEDA 4LV5B 5J4VA 1UDWA 3FHTA 4URYR 4TT3D 3ASYA 4RCYA 2AX4A 4B48A 5KSYA 2NQ2C 1G3UA 4DUGA 1II8B 4TN1A 5B64A 3DKPA 2VSOA 3D8BA 1M74A 5HCNA 3MCAA 1UFQA 2QU8A 3LNCA 3GLGA 1Z06A 3EG5A 2HF8A 3LVQE 4DBLC 4ILEA 4KFUA 1HE8B 1ZBDA 2BV3A 4KSBA 2Q3HA 3X1WA 4MKFA 5TV2A 4IW3B 2G88A 3P20A 1RC8A 4M21A 4M1WA 3EPHA 5SZHB 2BBWA 2HUPA 3VR2A 4E09A 2BVNA 1H8HD 1RJ9B 2WWXA 5E7JA 2OLJA 1DAMA 3B9PA 2FGJA 5CLLA 5FFMA 3T1TA 2ZANA 3IEVA 1NSFA 4Y0VA 2CCJA 2CL0X 5FR2A 2JA1A 1VHLA 1UF9A 2YOFA 3MJRA 4B34A 3THXA 1XFAA 2A9KA 1VG8A 3BOSA 3MWYW 4O2RA 4LJ4A 3QF7A 3SHFA 1S96A 4JSYA 4LYAA 4O3MA 1CULC 5G41A 3QXXA 3Q72A 2OG2A 3K53A 1AJEA 1OT3A 1XTKA 1E9DA 1U90A 3W3ZB 4JS0A 2I3BA 2Q3MA 4JJKA 5J47A 1KHTA 1KSFX 1ZUHA 3G5UA 4U7DA 4LHVA 3ZD7A 4EJSA 3ECCA 3LV8A 5FI1B 4M2LA 1XDBA 5AJXA 5H68A 4D25A 3NBFA 3L43A 4PQFA 2R62A 1J70A 1KI2A 3RRZA 4F4IA 2ZJ5A 3U4QB 4DT1B 1IHUA 1FNMA 2RGDA 1JEEA 4HB3A 2C78A 3WMFA 4MDFA 3BFVA 5D3MB 1YR7A 2ZRKA 1CR1A 4N1AA 2OLKA 4LC0A 2Q3FA 3KTAB 1VYVA 4ON9A 5CK5A 2IUSA 5DSZA 3GLHA 4IDQA 2F1RA 1FTSA 1DBSA 1R0ZA 2WJHA 1RIFA 5AUPB 3EZ2A 3U44B 4DB2A 1JR3E 2FZ4A 3C15C 3IILA 3CR7A 2NO7A 3PITA 1QHHA 4LWZA 2UZIR 4BFXA 1KJZA 2EFDB 3ADKA 3KQKA 1GAJA 5DH9A 4BLPA 1X8JA 2P0EA 5JRJA 4F93B 3QG5A 1G5PA 3Q8XB 2QP4A 1ZIPA 2MMCA 4DDTA 2V6JA 1EGAA 1JXOA 3IO3A 2QGZA 3CIOA 3WMGA 1TEVA 2NO9A 3FMOB 1P9RA 2ODBA 2W58A 3U3MA 1JPJA 1M34E 3ZIAA 1W4RA 3DVLA 3O8CA 3B5JA 4FD2A 5TB5A 3ND9A 3QKSB 1IY2A 1U94A 1E2KA 2RHMA 1X6VA 5F2EA 4MKHA 4Z1MD 4URVR 5KYKA 2A30A 4WXPA 3TMKA 5EXTA 4YDSA 4HDQB 4PO8A 4JYBA 1FP6A 3GLFE 1KMQA 1P6XA 3ASZA 3OEEA 1T3SA 1NKTA 1ODFA 5BYJA 3NDPA 3RYTC 4NTZA 4CT5A 3AVOA 3BH6A 1N6KA 2VQSA 3PEWA 1TTTA 3K0CC 4A36A 1FX0B 4FWTA 3U5ZB 3UKDA 4QL3A 3N2EA 1BYIA 1NF3A 2PLRA 5FPTA 2CL7X 1NMXA 3DDCA 3NKVA 2JLYA 2GXUA 3KDSE 2XB4A 2IXGA 3V4RA 1RPZA 5L3SA 4QNRA 3THOA 3H0KA 3K9GA 1KO4A 1ONBA 1XNJA 1U9IA 1ZJ6A 2OT3B 3HJNA 4OJKA 2BM0A 4P4UA 2CNWD 1G3RA 4J0QA 5IK2D 2FSGA 1CJTC 1X86B 2FNAA 2W6ID 4LJ5A 3CRW1 4R98A 3L0SA 1NJFA 4PSKA 4URXR 2ZUDA 2RGGA 3ZQ6A 4EPXA 1XJ0A 2Q21A 1KK3A 1EWQA 2OXCA 1NRJB 1PV4A 4LY6A 4BECA 1E9AA 1NVVQ 4TLDA 4D0LB 3R8CA 2CVFA 2ZR9A 2OXRA 3LW7A 5KPDA 3G82C 1K5GA 3NVAA 2G77B 1WQ1R 2ORWA 4PX9A 2VP9A 3KL4A 1E0KA 3WP0A 2IW3A 2W6JD 3RWOA 4EDHA 1J7KA 5TY0A 3U61B 3FMIA 3VR5A 4A92A 5IT5A 3BB3A 2VRWA 3N5CA 1R0YA 4WOPA 1GZSA 3DZDA 3QPUA 4YXWD 3CNOA 4IHQA 2C04A 5DI9A 1I2DA 1DO0A 1UKZA 1DOAA 1MT0A 5EP1A 3R8FA 3SJZA 3FMPB 1KK1A 1IN6A 1Z0FA 3SJCA 5JHHB 2J1LA 1UADA 2PCJA 3BB4A 1S9HA 2GCNA 3UWKA 1MABA 2QE7A 1YZLA 3AVTA 1KJYA 2ZSBA 1UDXA 3C16C 4CIDA 5FBVB 1FP7A 1W0JD 4LJ6A 3VX4A 5L3VA 5TMPA 4LJ7A 1N0WA 2JAQA 4KU4A 1E79D 1HEIA 4PC6A 1C4OA 3ND8A 5JRZA 2Z4SA 1XTSA 4HAWA 5TDHA 2ANBA 4ZI3A 1UKVY 5KPJA 1IOZA 3RSOA 4JL8A 1AK2A 3KKNA 3EZFA 4A15A 1NL3A 4AK9A 1FUKA 3THYB 2WPDD 3LX5A 2QSYA 2DHRA 4PQYA 2X1VA 2ZRFA 4MRSA 4YMWA 4Q7KA 3RRNA 4F38A 1ZW6A 2FZLA 1GDDA 5EZ6B 3VKGA 4XVQA 2XITA 1BMFD 3I92A 4EPYA 2QY9A 2VPPA 2I1QA 2GKSA 4HZUB 1QDEA 1P3JA 3FMFA 3U3JA 1I4TD 3TSZA 2ZS9A 2QRZA 1G6OA 1OFHA 4IFBA 4UJ3A 1U99A 4M0LA 4ZCIA 4FMDB 1GNRA 4LRWA 4ASUD 1S3GA 3ZVNA 1OPXA 4WA7A 2OESA 3JZMA 1VYTA 4P4SB 1NMZA 2VHJA 3BAFA 4GP7A 1E69A 4G5SA 4B76A 3RRMA 4I1VA 2XOKD 4QXAA 1NLZA 4N0DA 1U8ZA 2R44A 1QHNA 1KAOA 5LD2B 4AD8A 2MMGA 4B71A 1L7VC 4M22A 4DLTA 3AVXA 4JBYA 1ZUIA 2VIIA 1XCMA 1OKKA 2QROA 3LLMA 1JJ7A 4MRNA 1HY3A 5FOTA 4UNNA 1LFDB 1G3IA 2JLQA 1KNXA 1GG2A 1XJQA 2ZETA 3K0FB 3NTUA 5BWMA 4DSNA 1AZTA 1XEWY 2GILA 4GI7A 1VECA 4DEYA 1PLLA 3HYTA 5E7MA 2PX0A 3CRRA 3ZZTA 2D3WA 2V7QD 2VP0A 4W7SA 1N2CE 5BXQC 5B2ZA 3THYA 3ICEA 5AJWA 5FTNA 1W4BA 3VKWA 4Q9JA 2GNOA 1G16A 4R71A 3A1VA 4QHYA 3RNLA 1HTWA 2C9YA 3CNLA 2X8AA 2RCNA 4PTLA 2GVDC 1L2TA 4QBIA 4Q4JB 4DCUA 4FCTA 1E2LA 1RYFA 3RS3A 4B73A 3J81k 3SHWA 1W49A 3WNCA 6Q21A 3LD9A 3LRPA 4H1VA 5JJKA 1XEFA 4RSGA 1EK0A 1IN5A 1W2GA 2ONJA 3UMFA 1ZNYA 2DPXA 3EC1A 3K09A 1GRNA 2GVZC 3C4JA 1R0XA 1UBGA 2ZREA 3NH6A 4P4SA 1IAQA 1OYWA 5FTKA 4EFLA 2O8DA 2PL3A 4EFNA 1K8RA 5JMTA 3S1AB 5FL7D 3EC2A 3O8DA 1SVMA 2IF2A 1E1QA 1NVVR 2JATA 5AR1A 4BRUA 3KB1A 3REFA 4WVFA 1XTJA 5CB6A 2WM9B 2QORA 3O47A 4MGIR 5EP4A 3TSOA 1OFUX 1SHKA 1XD2B 1TF5A 3TR5A 4ESHA 1NSTA 4IDPA 1Z6GA 2VP4A 3GFTA 1KI8A 3IHLA 4B33A 2FSHA 4KAXA 1TX4B 1KI7A 4A8JA 4Q4AB 2Z6VA 3ADBA 4GOJA 2ECKA 5JS8A 2IHYA 3U7GA 4LZZA 1OHHD 3DZ8A 2P5TB 1WE2A 2PZEA 1ZNZA 1IY1A 5F9FA 4OK5A 1ELOA 2IL1A 1F2TB 2C77A 2WIAA 1OSNA 1N6HA 3TUJC 2NZJA 2OFXA 2BMJA 2GZHA 1VPLA 3IIKA 4P3YA 8OHMA 1HQYE 2BBOA 1V43A 1L4YA 1MRNA 1F2UA 4G0NA 4QM6A 1SXJC 1H8EA 2ZVPX 4LOAA 1CRPA 1XMIA 2GESA 1SZPA 2IS4A 3CX6A 4V0ME 4LI0A 1ZMXA 1U0LA 4LYJA 5CDFE 3N70A 3V00A 1CR0A 3B85A 2FJUA 4A2WA 4B3DA 4NP6A 2E1RA 5CM8B 3WNBA 4XIGS 2J7KA 2NGRA 4LPSA 1AKEA 2ZRGA 4NYIQ 2XAUA 4AYXA 4TMKA 3Q5EA 4C0BA 3SNHA 3U7FB 4FMCB 1YRAA 1P2SA 2FA9A 4A0FA 1ZU4A 2RMKA 2ZYWX 1SVSA 2WOJA 3QXCA 4Q18A 4Q4AA 2ZUCA 1MRSA 3CB4A 4K81B 2IYVA 3TQFA 2JDIA 5C1BA 1W46A 2BM1A 4RZXA 2C95A 3GFPA 1TNDA 1X8KA 4Q1EA 3WRYC 1F2TA 4HUQB 3EASA 1E0JA 2ZJ2A 4POAA 1DAGA 1NI3A 1RRPA 2GEDA 4JLAA 2BIFA 5EUQB 3NIBA 2FOLA 1X1RA 4IDOA 3VX3A 3NC0C 4JLNA 4ERNA 1PJRA 2BJWA 2DBYA 4EJSC 3SFVA 4GMDA 1U81A 2PMKA 1OYYA 1JECA 2J7PA 2ZE6A 3A4NA 1UM8A 1GNPA 1W5SA 2WSSD 3HR7A 3UATA 1S2MA 1KMHB 4AYWA 3DM5A 4QC2A 4NMMA 2R8RA 4FCWA 1QBKC 2JGNA 1QHIA 4O25A 1U0HC 3FDIA 2CCKA 4HB0A 2KSQA 1B23P 1VTKA 2FFAA 4M53A 1E32A 4QKQA 2FH5B 3KJHA 4NYMQ 2V8OA 2FE4A 2FFHA 4TL8A 3QKRB 5J4HA 1NKSA 3B6EA 3M4YA 1PUIA 4EPVA 1Z3IX 3A4MA 4PZYA 1TUIA 1AKYA 1VG0B 3GLFB 4OI0A 2YHSA 4D4JA 4DZZA 4C0HA 3BWDD 3L82B 1E0AA 4LBVA 4CW7A 5FI0B 3I1FA 4Q21A 5EXPA 4ABYA 4WZBE 5JWRA 2DWPA 5EXXA 4MGYR 3W9YA 1IM2A 2HLDD 4BQSA 2Q0HA 2IWRA 1D5CA 1KZGB 5EE0A 4M8NE 2JJ1A 5P21A 3QEJA 4HB4A 4D80A 2H1LA 1JR3A 3L0OA 3SFZA 3PEYA 1NVUQ 5L3QA 3AVPA 4JKYA 1E2PA 1Z47A 1AS0A 4TLCA 5IRCD 3K1JA 3QSYA 1J99A 1ZD9A 4B3BA 4A9AA 2LCFA 1QF9A 2IBMA 4OQNA 1AIPA 2B7CA 1LW7A 1OIVA 1EESA 1OXVA 4KJZA 3WRXC 1G5TA 2DFKB 1G9XA 2X19A 3GEHA 4CRWB 1DAKA 1U8AA 3QENA 5TARA 3GLIA 3TW4A 2B8TA 2A3RA 3A1TA 4MITA 3AP2A 4PAQA 5H8WA 4BPBA 2J0UA 1XJCA 4BE7B 2V3CC 4QJ5A 2WV9A 4CEIB 4MUAA 1RW4A 4OK6A 4AYTA 1LNZA 3CKLA 4N3NA 5C4MA 2XTNA 2F9LA 4IXMA 5AWFC 3K0SA 1UEJA 1U9IC 1TU4A 4NKRA 3PV0A 3OAAD 1EG7A 4M1OA 4TQUS 4OKSA 3B82A 2WKPA 1XBTA 4V0NA 1KDTA 4Q66C 1KO5A 2CMKA 4JYCA 4HZIA 2OCAA 4Q4LA 4IJMA 1DVRA 4DC9A 4H9GA 4BLTA 4NCHA 4Q48A 2VHTA 2DWOA 3VHXA 3LXRA 3EIQA 3IEUA 1MV5A 4NYIR 4LGMA 4OHZA 2VLIA 1T3LA 2JIZD 1E9RA 2GEVA 2YINC 1N3BA 3QNUA 4PAOA 5KHOC 4PZLA 2GAOA 1XZQA 1HA3A 1OXUA 3ZJYA 4C7OB 4KO8A 4Q1FA 1XU4A 2D7DA 2JLUA 3UPUA 4BZXA 2RGNC 1TF2A 2YWHA 2OO7A 1OH6A 4AC9A 4V0OA 2IYSA 1ZD8A 1Q3HA 4HLDA 4QRHA 4B2PA 2G83A 2AN9A 2BBSA 1XZPA 4LV6A 2ZE7A 1A5TA 2CHQA 4LK2A 5EE3A 1OE0A 4FCVA 1E9FA 1W1WA 2H16A 4TL7A 2I1VB 2BKUA 2V1XA 1E1RD 4PC3A 4A0HA 1OH5A 1U8YA 1YQTA 2OAQ1 4WIAA 2MSEB 4UXIA 2Z83A 2D2FA 4G5QA 1VHTA 1BKDR 2TMKA 4IEIA 2YVUA 4JVSB 3VTKA 3TVDA 4PSVA 2IYXA 4M1YA 4Q01A 1P5ZB 2VF8A 5JSZB 1XMSA 2WOOA 1TU3A 3FB4A 2R6FA 1DAIA 5LBIA 3OFND 1W44A 4JVNA 1ESMA 3TBKA 2OZEA 4GT1A 2H8KA 1VCIA 4JVMA 5SZJA 5FPKA 2WWYA 3NBZC 3BRWD 2QPAA 1F3OA 2CJWA 4LC1A 4NYMR 1HUQA 4C3ZA 2XGJA 2O8EB 4XTRA 1TAGA 4L4UA 2FMXA 1LS6A 5JJLA 2AKAB 5DE3A 3I5XA 4OK3A 4TYNA 3DM9B 4TSFA 2YV5A 4QOSA 2V4ZA 3X1DA 1ZM9A 2WMNB 4Y0AA 2GDJA 5TXGA 1PVOA 4TTRA 5AUQA 1SXJD 2AWOA 4JBXA 2AHOA 5DI3A 2ZAOA 2HEIA 1UEIA 4DUGD 1KI1A 4Z51A 2GCOB 2IYZA 2ODEA 2V9PA 5JS7A 4OI4A 5FBLB 1WB9A 3MMPA 1DARA 3U7EB 1CR4A 3W8RA 4TT3A 1NP6A 2NPIA 4XJXA 3W6OA 1CU1A 5HKKD 4RD4A 3EA0A 1E2EA 2QM7A 1R7RA 3IPXA 1KI6A 3ZS8A 3R20A 4HSEA 3SC3A 4IOMA 4QJ3A 2GXSA 4OQFA 4U5XA 4RFSA 5FPYA 1AGRA 3IBGA 3B78A 2JLVA 2OUKA 5FOWA 1N5KA 3FTQA 3AV0B 3OIYA 3GJXC 3LXXA 3R7WA 3SYLA 4JKIA 1P60A 2HF9A 1EFHA 2R6CA 4URUR 4DIDA 2R6DA 1E94E 3B2EA 3WYFA 421PA 4MUBA 3SJBA 4F7WA 3WYGA 1H8HA 5EUMA 1FPMA 2UVQA 1PZNA 2XX3A 1NN3A 5LDDC 2EWVA 3TAUA 3EPLA 3TJZA 2WBLC 4ZKDA 3OF5A 4RD1A 4DLVA 3MD0A 1YR8A 1Z08A 2QMOA 2W0MA 2ZE8A 4LSGA 4QHTA 2OILA 2ZITA 1II9A 2GJAA 3HPRA 2WJIA 3B1ZA 3OE7D 2QT1A 4IVQA 4BLRA 1II8A 2QAGB 2WAYA 1MR3F 2X2EA 3OEHD 4UXHA 2XXAB 4RFVA 2CL6X 3W34A 4ZCLA 2KBEA 1LS1A 3R9XA 4LHXA 2QN6A 4RZ2A 1Z29A 5GJVC 1S9DA 2OCPA 5JEEA 1ZVQA 5HCIA 1U2RA 2EU8A 3A1WA 4JLVA 1QVRA 2AWNA 5TVKA 3TK1A 3CX8A 3KQNA 4E5UA 3GP8A 2IS1A 1RJ9A 4WZAE 2IS6A 1RKBA 3TGPA 2VP5A 4ARZB 3FVQA 1GKUB 3CONA 2HT6A 1Z0IA 1OLOA 3B1XA 2GJ8A 2WJJA 1V5WA 2OSBA 2ZSEA 3SBEA 1C1YA 1WA5A 3Q3JB 3QF4B 4OQXA 2K5UA 1B0UA 1TQ4A 1HYQA 4YMTA 5GJBA 2ZJYA 4V0LA 1ZD1A 1NY5A 4N0EA 4MRRA 4U02A 3RS7A 1TUEA 1FOEB 4Q4HB 5FOXA 1ZIOA 1Y3AA 3T15A 1KJWA 3RSLA 2PBRA 2WIBA 3GJ5A 3ZD6A 1EXMA 2YOGA 4EPWA 2VP2A 1JAIA 2ZRIA 3KUCA 2JEOA 4NYJR 4US2R 1A1VA 1NBMA 2QNRA 4HAZA 3ADDA 1CJUC 1PLJA 2QAGA 4MYHA 1GOTA 3UMRA 3VU9B 3U4QA 4DT1A 4US1R 3GEEA 4BFWA 1G21E 2GBLC 3ZGXA 4RD2A 5KSPA 2BHRA 4RD6A 5D3MA 2WWFA 1YU9A 4EAQA 4AY2A 1AZSC 1RE0A 3C8UA 4X8OA 3KTAA 1Z0JA 2FGKA 3B7GA 1GWNA 3EA5A 4IDHA 4AG6A 4Z1MA 4BFSA 1SGWA 1NG1A 2LWIA 2ZRPA 1G3MA 4HAYA 2G9NA 1ZC4A 2NG1A 1AQYA 1OB5A 1UBEA 4II7A 3B1YA 3TUIC 3U44A 1KSJA 4TYQA 4CZ2A 2YZ2A 1P9WA 4JT4A 5FUXA 2ANCA 3LAWA 1OXTA 3RDPA 1GL9B 4CEHB 3T06B 3RS2A 3KZ1E 1Q22A 1Z0DA 3D6TB 1G291 3SN6A 1XXHE 2IYYA 2QSZA 4RKFA 3AVWA 4P31A 1Z83A 3DMDA 2ASEA 2WJGA 1NIJA 2YC2C 3ADCA 2J5XA 4NONA 2YYZA 1N6LA 3CZPA 3N2IA 3LW8A 4GOXA 1YJ5A 1KYIA 4QGFA 1VCMA 4PO1A 5IK2A 1SVIA 1E2QA 1VG9B 4D2IA 3QKSA 1RRCA 2W6IA 4EFMA 1FFHA 2CE7A 2FEOA 2WWGA 2BCGY 1E9EA 3QJYA 3VU9A 2ZRAA 3U60B 3EPJA 1KOFA 4ITRC 4C9BA 1JBKA 1VIYA 2XSZD 2ZI7A 4Q9IA 1Q1ZA 3E5HA 3CW2A 2W2XA 1FX0A 5CLQA 3PUZA 3RABA 2O8CB 4KXFB 4IOJA 1LY1A 3IKJA 3CRQA 2W6JA 1A2BA 3SJAA 2ZI9A 1XMVA 4GBMA 1GTVA 4CDGA 2ZSDA 4PHTA 2KBFA 4BGDA 1T0HB 4KHZA 4LHWA 2DFLA 2L0XA 2AL7A 3A58B 2ZYUX 2H5EA 2QMHA 4EPTA 3QXHA 3B8HA 4ESVA 1VG1A 1SKYE 2ZS7A 3NWJA 4NPHA 2Z4RA 4OYHA 3IGFA 1Z07A 2BBTA 4JJZA 3FKSD 1N6IA 3PUVA 1DAFA 4TWZA 1JEDA 3Q85A 4HAVA 4OI2A 4CVNA 2J0QA 1E2DA 4HUTA 5DYGA 3EIEA 2GCPA 2DFNA 4FI3C 2J45A 2BEKA 1W0JA 3AF3A 4JT2A 4RZ3A 2ATXA 2DYKA 2WKRA 5E7IA 1NNEA 1XPUA 2XB2A 1UPTA 1GL6A 1Q1QA 1E79A 1CRQA 2CVHA 3AH8A 5CJPA 5C2JB 1WDTA 3PEVA 4OBEA 3WHKA 1SKQA 3IBYA 3DMNA 2NPFA 2KE5A 3SS8A 3PUWA 1P4SA 2QZ4A 1N5IA 1G1MA 3W3AA 2C99A 2HV8A 1CLUA 4S35A 1T9HA 3UG6A 2ZI5A 4DLYA 2ZI3A 1R8QA 2WPDA 2C03A 3K9LA 3TAHA 2J41A 4QBFA 4S2EA 4Q7LA 1R10A 3LBNA 4NBSA 4X8HA 5KNCA 1BMFA 2ZSAA 3VR4A 1SXJE 1CF4A 2YKGA 1ZUNB 3W5IA 3RANA 4EKDA 2GWHA 1OB2A 4PPQA 4TMWA 4XH9B 1ZYUA 4D26A 2GZAA 1R0WA 3R9IA 2BWJA 1X8LA 2CE2X 3T1VA 2KI5A 2HCJB 4GL2A 2EW1A 1YZTA 3SYNA 3AEZA 4G5RA 3GLGE 2C8VA 2F43B 2ZPTX 4CT4B 1OKKD 2FF7A 4ASUA 1M6NA 2QT0A 1EX7A 2AXNA 3TUZC 3MWLA 1YZUA 4W5WA 2F3TA 2Z0MA 1WRBA 1SQ5A 3GMTA 3SE0A 5FBWB 2FPLA 2XOKA 1Q0UA 4TQ9A 4MDEA 3FGNA 4GMXA 4L9SA 2VH5R 4GSYA 3U7HB 1NN1A 4WAUA 3GJ0A 2OE2A 2ONKA 3TE6A 4HB2A 2V55B 1RZ3A 2QA5A 4Q1AA 1HT1E 1OFTA 4TMVA 4MKIA 2X2FA 4TQAA 2O52A 4HZUA 4A0GA 4D4KA 1NLYA 1XCPA 1TPZA 2O0JA 2W2VA 3TQCA 3KJGA 2Q6TA 4G5OA 3AF0A 2BMEA 5LPNA 4M9XA 2V7QA 2QRNA 3B60A 3I3SR 1PLKA 4KLNA 1WBBA 2R6AA 1G20E 1E96A 4TLEA 5JWOA 2IS2A 1T6NA 4KYIB 1TMKA 3MG9A 1KKLA 3X1ZA 3NH9A 3WNDA 4F91B 2QENA 3NHBA 1VMAA 2D2EA 3LY5A 5D3QA 2J9RA 1Z63A 3TW8B 2CXXA 5H70A 1XB2A 3EIHA 4A82A 1G5RA 1P9NA 3RHFA 2XZPA 3K0EA 4F4JA 3KKPA 2P6UA 2FU5C 5JFGA 2JLWA 4PAMA 3EPKA 4PZZA 3T35A 3MAAC 1Z28A 121PA 2F3RA 3GLHE 3P4XA 3K0FA 3HU3A 5CITA 1RRFA 1IN7A 2ZRHA 2J0SA 1G8HA 5E4FA 5FL7A 1W7AA 3IHWA 4B75A 1KTVA 1DTSA 2ZRLA 4JLMA 1MO4A 3U6BA 1KK0A 4LHYA 1GRQA 2IT1A 3VQTA 1WBDA 1H65A 4US0R 2IYQA 1XP8A 3OESA 2H57A 1QVAA 2IYRA 4EQ6B 2ZJOA 3A1SA 3NEJA 3SQWA 1F5NA 2A7QA 3DOEA 1C9KA 4Q4JA 4I1SA 4JLDA 4I81A 1R5OA 2XNSA 3AUYA 1IJEA 3Q7PA 4ZKEA 4LX0A 3SBDA 1RRGA 1KY2A 2FX3A 2YOHA 4OHYA 1NVWQ 1KO1A 1BO6A 2WHXA 2VO1A 3AKEA 5SZKB 2WICA 5AK0A 5C4GB 1G19A 1G7TA 4C0LA 4HAUA 4PR0A 1FMLA 4NCNA 4PHFA 1AM4D 1XCGB 2WMOB 3BH7A 5DN6D 2B6HA 3CX7A 5GADl 5JWHA 4M9ZA 5EJEA 4F92B 4Q9HA 1JQLB 1NVXQ 4W5JA 3CR8A 1ZP6A 3QKTA 3S1AA 4LDJA 3IDQA 3QI2A 4D0GA 1TL7C 4CGZA 1IXZA 4A4DA 4FW9A 1AGPA 3SEAA 1KI4A 1E99A 1JJVA 2PJRA 4TTQA 5LB2A 5C18A 3RC8A 4IEEA 2BC9A 1XD2A 1L4UA 2Q9CA 2ZI4A 1E9CA 2QGNA 4C2TA 5CIQA 3OHMA 3PCRB 1J2JA 4BFZA 2V54A 2ZROA 1GILA 4I1UA 1DADA 2RGEA 4WXRA 5FTMA 4B35A 2GZDA 3IIMA 4IOLA 5F98A 1N0VC 1YZNA 4Q1BA 5J4KA 2OFOA 1LF5A 3X2SA 2PZGA 221PA 3NEYA 2G0NA 3MSXA 3VR6A 4KYUA 5FOSA 2JDID 5AJYA 2IK8A 2DB3A 3C5CA 3T5GA 1GIAA 3IQWA 2FPMA 1W36C 3AB3A 4P0TA 1G4UR 4PSAA 4UKDA 4Q9LA 2WJYA 3QKUA 5CYPA 2W00A 3F8TA 4C2UA 2HXSA 4TYPA 1VCOA 3HU1A 3DL0A 5FTJA 4A0RA 1SVKA 1JQJC 1Z2CA 5CM9C 1UKYA 3LO5A 1XD9A 2D4HA 2RH5A 3GJ4A 4U00A 2EQBA 4EPRA 2R9VA 4DCTA 3CO5A 5KNDA 2ZYVX 2CCGA 2Y8EA 3B1WA 1QHGA 3CWQA 2V1UA 3RWMB 2E9SA 3E70C 2WJVA 5B57C 1G7CA 2FFBA 2NIPA 3BFXA 1G6HA 5JI2E 2FSIA 1AS2A 2PEYA 2C9CA 1UAAA 1N25A 2QBYB 4DKXA 3I72A 1FNNA 1EFRD 4M9QA 2PT7A 3AP1A 4AKGA 3MWKA 2YC4C 4RJLA 2WSSA 1NN0A 5EP2A 2EYQA 2O8FB 3A36A 1P2VA 2IYTA 3GEIA 1US8B 3H1TA 3WP1B 4MQBA 2EFEB 2VSXA 2FFQA 1W48A 3A8TA 1N6RA 1F60A 1E2HA 1Z6TA 1I2MA 2ERXA 3EWAA 1LF0A 1G17A 3LVRE 2VBCA 1WF3A 4TMXA 2QUZA 4HUQA 2C9OA 3RAPR 4ZPXA 1FMJA 3D31A 2ZU0C 1II0A 3UWOA 3G0HA 5CYOA 4Z8YA 3T34A 1T91A 4ZDIA 3ZH9B 4NH0A 3MFYA 1XEWX 3AGPA 3TRFA 1CXZA 5EP3A 3W90A 2HLDA 3T61A 1XXHB 2PH1A 1G64A 1MKYA 3I4LA 1VCNA 2EFGA 1SVOA 3H2YA 4DCNA 2OHFA 2RGXA 3QXSA 1IXSB 1OIWA 4HLCA 3QBTA 5G3ZA 2J87A 4DSOA 3KXKA 1IN4A 4DCSA 1XF9A 5BN5A 2FV8A 2GA8A 1KMHA 2WVJA 1KIMA 3DEFA 2WWWA 3EWSA 2BMFA 3PQCA 2ZR7A 4R9UC 3THWB 1HURA 3A37A 4KBGA 2P2LA 4LBYA 3QKRA 4QGHA 4DLUA 2B21A 3HWSA 1TADA 4HDOB 1XX6A 2N42A 1N6PA 4M4SA 4HATA 3GLFA 2QAJA 3FPAA 3Q9LA 5KO2A 3ZZUA 1E2NA 3CPHA 4B3XA 1OH7A 4HDCA 1Y63A 2EYUA 2QPOA 3F3YA 3IPYA 4UNPA 5EE1A 1EWRA 3F5FA 1ZM3A 2O8BB 2ZRBA 2BOVA 4GPTA 2F7SA 5SZIA 1T8TA 2XZOA 5F3WB 5H1YA 1FQKA 4ZIRB 2VL7A 4X8MA 4BEJA 1XRJA 3M0EA 2JJ2D 5J4YA 2ZRDA 1VIAA 3AVQA 3FWYA 4WZ6A 4TLAA 2EFHB 2CLSA 3DOFA 5EE5B 2G1KA 2OM2A 2O0HA 2ORIA 3OAAA 1SKYB 4Q7MB 2LKCA 4RD3A 1Q1EA 2Q9AA 1XXHA 3L0IB 4JLJA 4PHGA 4BWYA 2EVWX 2QEQA 5IF9A 4P4TA 1IY0A 3KKOA 3X1XA 1W0KA 4UXJA 1QG2A 2P67A 1P72A 1ZNXA 3B13B 2HT1A 4XD7D 5L8VA 2ODNA 5KTYA 2QQ0A 4OHWA 2IXFA 4XVRA 1Q1BA 2QL6A 2Z43A 3F0TA 1DS6A 1G8GA 1AQUA 5FUWA 1E98A 4I4LA 4OJQA 3H86A 2JIZA 3ZVLA 4MRVA 3FOZA 4NU0A 1KAGA 1M7GA 1R4AA 5FUYA 3RVBA 5BYKA 4CEIA 5ELXA 3CF2A 3KXIA 4YC7A 1D6JA 4JLPA 1GNQA 2G3YA 3BERA 2P5SA 4DLWA 3FKQA 3EAQA 1COWD 3EZ7A 1SXJB 3SOPA 2FDCA 1KDOA 1YR6A 3ZS9A 2VA8A 1Q57A 5HTKA 1RVDA 2ZYTX 2VSFA 1CJKC 4Q9KA 3BE4A 1XPRA 1KY3A 2GJ9A 3JVVA 2ZXUA 1ZCBA 3TNFA 4ZIRA 3EARA 3GLGB 1TQ2A 2J0VA 1E1RA 3TVTA 2CLCX 3U3OA 1T5IA 2F9MA 1I4LD 4KFRA 3LA6A 5J4LA 3R9WA 1XPOA 1O3YA 5JZVA 1HE1C 4JL6A 4GNKA 4YLGA 1UKEA 1E2JA 2VHUA 1DE0A 1DAHA 4YMVA 2NTYC 2GJSA 1Q21A 3LFUA 2CK3D 5HZKA 3AVUA 1D9XA 4JLKA 4RZUA 4G01B 3L8YA 3BH0A 1SHZA 1RYHA 2XNDA 1NN5A 5DISB 1OIXA 1E2FA 4C7OA 4HI0E 5JBQA 2ZR0A 1EFTA 2AKYA 3MLEA 1U0JA 2HXYA 4BLSA 4YDHB 1I4DD 4MYTA 4KFSA 4LJ9A 2HYIC 4BFYA 3ZYCA 3OIUA 1DPFA 3QBVA 3WBJA 2WAXA 1W36B 1R5BA 3OIWA 3UANA 1JB1A 2XJ9A 3QXJA 1GSIA 4B47A 1YKSA 2KWIA 3KKQA 3WMEA 4BASA 5CB8A 4RY2A 3CM0A 4LPKA 4C0QC 2H7VA 4QHSA 1HV8A 5F9HA 1TQDA 1QHXA 5JI3E 3U2QA 4EJSB 5E95A 1SXJA 1F48A 4A2QA 4C30A 4B6FA 1W4CA 3KQHA 2P6RA 2FN4A 3AGQA 3QE0A 3QG1A 3MWJA 5GVRA 1XEXB 1XTRA 5JSZA 1ESNA 1X3SA 3P4YA 3BIFA 2JLSA 4MRPA 5HKKA 4ZDJA 2D74A 5KNBA 2ZIAA 4B3GA 3CNNA 2DY1A 2QP9X 4EIWA 2I4IA 4Q47A 3GLHB 4DSTA 4P32A 1TEXA 2DCUA 3EXAA 3V9PA 1R2QA 3AP3A 4R2HA 2O8EA 4P33A 3RLFA 3Q5DA 1GKIA 1W36D 2PT5A 2NO0A 4DLZA 1D2NA 3BK7A 1QHHB 1AS3A 2MSCB 4NCJA 5J5CA 1XTIA 2NOAA 5AJVB 4OL0A 2AR7A 3K09C 2OBLA 3W8NA 4QM7A 1DO2A 4JBWA 2QTHA 3MUFA 4TMTA 2JJ8A 3WY9A 3UG7A 2GCOA 3DHWC 5LD2C 3L8ZA 1K6MA 1BYUA 2JCSA 4X8LA 4AURA 5JCZA 5K8TA 4DEXA 2OEPA 3I73A 2OCYC 1Q20A 3CUEF 521PA 5JJIA 5FH9A 4Z54A 3OE7A 2R65A 4IVPA 2RAPA 3CH5A 1CKEA 4MA4A 3LQQA 3OEHA 2OBNA 4QGGA 2XZLA 4MGKR 4GZMA 2H17A 4C0JA 5KSOA 3D3QA 4LHZA 4ZI2A 3ZVRA 3QOFA 5KDLA 2QMUA 3VR3A 4A8JC 1XEXA 1ZC3A 2A5DA 3K8YA 1FL9A 2IF0A 3IUYA 3KX2A 4L8GA 4UNQA 5DGXA 2OBMA 1M7BA 2GXAA 4LV8B 1OXXK 2O5VA 4IDNA 4PFSA 5AJZA 2Z5FA 3WHLA 4DXAA 4JMPA 3P26A 4I1OA 1W47A 4L5BA 4A6PA 3AVYA 4BLOA 4IOKA 2P3SA 2ZTSA 3I62A 1MO3A 3B9QA 5L3SB 2WZQA
chains in the Genus database with same CATH superfamily
3U16A 1MP0A 1I3LA 2GHTA 3RRYA 2ZVQX 1IPFA 1P2TA 1SKBA 4MVJE 3ZIAD 4ZVSA 4EG4A 3IVGA 3MS4A 4PPNA 3TPZA 1WDMA 2Q5LA 1WIWA 1RRKA 3M6WA 3JQRA 3KB2A 1YXMA 2EG5A 2JFYA 2XXAA 2PX4A 3TIVA 1DKQA 4JP5A 3VNVA 2JA2A 3NYWA 4YJHA 3RFFA 3OEED 1BX3A 4HCJA 4IILA 4OM7A 2PMDA 1ZU5A 1U9YA 1NUUA 2A9OA 2HNKA 4UHDA 4B46A 3GLIE 2PUFA 4R1TA 4I5DA 5AHRA 4GI2A 1XKXA 5KX5B 4JBNA 1DG1G 4UU1A 1SD2A 2G0TA 2HJVA 1B41A 4X41A 2X7XA 3PGKA 2PEZA 1ULHA 4CUKA 4ZREA 4ARZA 2P68A 3FWZA 1MTZA 3BCRA 3S8EA 4MQMA 1QRAA 1JYFA 2XGMA 2ZS8A 5BQXA 1EFPB 3EGVA 2HCBA 3ANMA 3N3AC 5J2UF 1A4RA 2EC5A 4KNYA 2FEMA 2ZJBA 4B45A 4TZ0A 1QS0A 2VT3A 4BKOA 3DDWA 1NC3A 4G4IA 1L4GA 1S1MA 3T1QA 3WZLA 2JLAA 1ND6A 3ZHYA 5BWNA 4CQMD 1YV9A 4RK5A 1FRQA 2EBUA 2G80A 3L6DA 1Q16A 1D2MA 2QD4A 1CTQA 3ZXSA 2OHHA 2P9GA 3AQ4A 1F8XA 3W7VA 4C0BA 1W4AA 1Z12A 1E0SA 1TZ2A 2LIVA 4RHUA 3FDXA 4G1MB 5IM4A 4BNYA 4RTRA 3NM6B 5ER6A 3NQ41 5BWLA 2IUFA 5CT8A 1E4YA 3DVQX 1SHLA 2C4KA 3OIVA 2EBFX 4ZV4A 1KK2A 3EQ2A 3UC9A 1VPDA 2R8BA 2A9VA 1M1YE 4EJFA 2F1IA 2G9RA 3MJVA 1KO7A 8GPBA 4DDUA 1T4BA 1Q3TA 2WINI 1FP1D 1Z7EA 3FCAA 1JSCA 2GEFA 1M5TA 1JA0A 3I28A 4LWPA 4P2BA 3TIFA 3OC0A 4IKOA 1SMKA 3PIDA 4BNTA 3ZVMA 1YMVA 5DU2A 4CDMA 5A03A 1EHCA 3D3EA 3MK31 5CHYA 1GCGA 4L28A 5B30A 1UPXA 1YQUA 1PRYA 2EZ4A 4URZR 3DCJA 4NCAA 1IBKB 2Z6UA 1X1SA 2H8GA 3BGDA 4WBSA 4EHKA 1EXDA 2CHVA 3KELA 1JBQA 3HN7A 3HP4A 1U2DA 4WX2B 1V8FA 4H7EA 4LNUB 1LCIA 2UXCB 5CA1F 4ZRMA 5KYYB 4JJFA 3RODA 3A1UA 3TLJA 4FNMA 4H6WA 4R1MA 4ROSA 2NUTA 5BORA 2PUCA 1TT5A 1TYZA 2CLMB 4HQ6A 3OTWA 4GGOA 4KN6A 4QUBA 3AETB 4JC0A 4W8OA 4D5EA 2J9FB 5E8RA 4KITB 1UP7A 4O4LB 3NBXX 5FX2A 3T1YB 2B2XA 2VF7A 2QPLA 5A0FA 4MHSA 3GIWA 4ESEA 1YHYA 1HL3A 3BK2A 2DR0A 2ZQ5A 2ZUBA 3GH1A 4KE9A 1N77A 5HJ5A 3MRSA 3PJRA 1RQNA 1QPZA 2WHRA 2P77A 1BW9A 1THTA 4BWVA 4J1NA 8ABPA 4EY7A 1KYQA 1RABA 4JZKA 4U7FA 1N9KA 1EJ6A 3COYA 1LPOA 2A94A 5IX8A 5I8WA 3GI1A 3U19A 3BF7A 1YS9A 1E2IA 3RBXA 1T8PA 2I4LA 2J5RA 3GN1A 3M1LA 4RGBA 4ZU1X 5IAGA 2BKAA 2DQSA 3KE8A 3IE1A 2IIBA 4AWXA 2CLKB 1KYZA 4TXNA 4KOEC 1RHJA 4N3CA 5CB4F 3ZNNA 2OY0A 4CR8A 3Q15C 3D0QA 3F49S 3V2GA 4I50B 1Z8HA 4M89A 4NBNA 1PFVA 5B4TA 1E9SA 1T4GA 3G49A 3I32A 1I5OA 4EUNA 5JCJD 4B17A 3SK0A 5IKOA 2NVBA 3T3EA 2O8CA 3KQOA 4OVKA 2BFEA 3FVWA 4MW0A 1WUTA 2JHFA 4PNPA 5DNVA 5AUNB 1QZXA 3O8BA 3QVLA 3VPAA 1ZVMA 1MTOA 2KYRA 4D02A 2Q6VA 4OXNA 2ODWA 4PCVA 4BE9A 5JZSA 3AF6A 4BC1A 3AKCA 3WXBA 1RXIA 4LNUA 4H60A 4QXPA 3WKDA 1NVEA 4PPGA 4YUVA 2DPGA 3H84A 5IS2A 3WGKA 1JLKA 4F5ZA 2GPJA 3FR7A 2VRNA 3SHOA 3TLXA 4C4AA 2UVDA 4EO9A 2XUIA 1P8JA 2HREA 3CH7A 4GRAA 4JOSA 1P2UA 4X1YA 1ZGJA 4PE5B 2EWWA 3CIFA 3HUDA 4LRQA 2X8BA 1VQ1A 4FYXA 2CJYA 1GZVA 5ICSA 2Y9MB 4OQLA 4XLZA 3CRZA 2BJVA 5AVTA 4RTSA 3DXZA 3CHYA 3TWOA 3Q0IA 2H06A 2Q62A 2D7JA 4RJJA 3ZG6A 4KR3A 1X3LA 3DE2X 1IXRC 3GDHA 2VNIA 5CVEA 1FF9A 3H04A 2B30A 4HP8A 4B3SB 5LXTF 2HBZA 2I76A 2ZRQA 1MO6A 2EARA 2OR3A 4ITVA 1PJSA 4P7KA 1P39A 4J6EA 4A8JB 3VR1A 4BV9A 1D1TA 2D06A 1S7CA 3IP7A 3LP6A 4UW9A 4AMZA 1HT2E 2FRDC 5HX7A 2VT2A 2QRGA 2NO5A 3SQXA 2V6IA 5BSGA 3ULKA 4EF6A 3QK7A 4GI5A 4B09A 5HPYB 3BKWA 4NOJA 2G5CA 3QUCA 3AR8A 3WJAA 4RACA 1WQ4A 2HIAA 1QWSA 1Y80A 3DMYA 3LQYA 4BFVA 2G9UA 4DDMA 1RTTA 4IYRA 2F43A 2PZAA 2GAAA 1E1QD 3PG5A 4GKAA 1Z18A 5K0LA 4QFBA 1S2LA 3WYEA 1HL7A 1QP7A 5JTUA 2VSNA 3BC1A 1TRHA 2JIOA 3WIVA 4OA5A 5HVNA 2QRPA 4O1HA 3E8XA 2J5QA 1B93A 3GGGA 3INGA 4KLZA 2W83A 3FB1A 3DB2A 3WNVA 2WAOA 3ZTTA 2CZGA 1EGVB 1RI2A 2QN1A 3VKHA 4IUYA 3QKWA 1ZM4A 3FPHA 3M82A 3VO2A 3VZPA 4PZDA 5LQSA 4EEXA 1U9ZA 2C9DA 5E38A 3W6UA 4HNQA 4J0EA 4FINA 1R9JA 4LCBA 2VFAA 1T1GA 1O5TA 1X74A 3ST7A 4AG5A 4NENA 4D8VA 3Q3IA 3O2QB 3LT2A 4PBRA 1AKQA 1A27A 2Q3CA 2X1LA 1QJ4A 4FMCF 3KXLA 3U0BA 1KE2A 1YOVB 3AJ8A 3LA8A 2ZRCA 3NC1C 3NFYA 4RVCA 4ZVKA 1FJGB 2JAWA 3QYFA 4G85A 5DHRA 1EXWA 4YPFA 1BC5A 1Z0SA 2XI4A 1KERA 2QN3A 3Q3GE 4FX5A 1T5HX 5BO5A 1E1YA 2FR0A 1U2SA 1QMGA 1Y98A 2X9LA 1VLJA 1DFIA 2L17A 4KQKA 3PT5A 4TPKA 1J90A 3EXHA 1D6NA 2RBGA 3RC1A 1H8ED 1MG5A 1NBME 1JE1A 3ZN2A 1FSZA 4Z4HA 5JJBA 3A2NA 4GICA 5K8UA 1KRHA 4K88A 1MB4A 5E2BA 5FPSA 3TW8A 3DZJA 3V97A 4A27A 1MAVA 4E07A 3KJEA 4RTLA 5K3EA 4A23A 1L7BA 4ZT6A 5BR1A 3PC7A 4OHVA 1KI3A 3D1LA 3FWKA 2ZEJA 2ZYSA 2HSEA 2MYNA 2XMPA 1AGNA 2Y0EA 5DN6A 1DHRA 1OX4A 3KD3A 4QYTA 5EA2A 5FL3A 4YMGA 2YXLA 5JECA 1R8SA 1QH1B 2ZSIA 1PNVA 3PKJA 1NASA 4C5CA 1QG4A 3D3WB 3HXOA 3ZDRA 2PPVA 4B3TB 3DOCA 1FFCA 4TS9A 5DM2A 2YMLA 4BNWA 1M76A 5JUWA 4EG0A 4QOFA 4G0UA 3OLYA 1V3VA 3MINB 3LY7A 4P0PB 3C6ZA 4CBVA 1O6BA 4EGSA 1CZRA 2C2OA 3MQ4A 4EQ6A 4S04A 2C1EA 3NUQA 3HYRA 2C98A 2BKXA 2BFWA 3RPEA 4MKGA 2BGGA 1YZGA 3P9SA 3QVGA 4BFUA 3SU8A 5CXUA 1TZCA 1ZNWA 3HMKA 4W9MC 2GRJA 2HBQA 2P8SA 5EIWA 3NLLA 2ZSFA 3KJIA 4IQ4A 1IBRA 2HA6A 2QTNA 4A3SA 3FGOA 2NZUG 3EY9A 5K7SA 2EG9A 1UAYA 1FDTA 1WMFA 1EFVB 5DIFA 3E0QA 2RGBA 2VCYA 4OI1A 1L8QA 4LOHA 4Z4EA 4AI6A 3NC4A 3VVCA 3IJ5A 5BW8A 4Y98A 3QPCA 1YB6A 1GRRA 4PV7A 5TPWB 4QA9A 5F21A 1ZMBA 2CDAA 4MI3A 1CJBA 3BSYA 3H2IA 4FQ5A 3GP5A 2Z5LA 1CUJA 3DTVB 1OR8A 3DE7X 4PXSA 3P32A 4MQFB 4ZO4A 2ZULA 2X4DA 4DJTA 5FP0A 3TOVA 2DR3A 4F4FA 4JL5A 1DNPA 4R0NA 4Q9DA 5JH7F 3N8NA 3AF2A 2WK1A 3V8QA 4OXKA 4WSOA 4X0EA 2WUEA 1TM3E 2J3HA 4YAUA 1QH1A 5K99A 1KMIY 2QAIA 4MR9A 2RKWA 1NXWA 3NONA 1SIOA 1YH3A 5C46F 4E3WA 5CFPA 2RGCA 2E87A 3K5PA 2GZMA 4D41A 2A5GA 4EHFA 5M2QA 1PBNA 2O3TA 1YIDA 5IYZA 1VBMA 1N4AA 2A0KA 2FQXA 4NDNE 1I14A 3KALA 3LPNA 4FHDA 5F1KA 4N5NA 4KXVA 4L27A 2UKDA 1C5KA 3F5QA 3NV7A 1GZ3A 3AUSA 2QVLA 4R8SA 3VOAA 4ER6A 1PDWA 1I1NA 1Z6ZA 3BBPA 4ZO7A 3OTOB 4GPEA 3RBZA 2JJ1D 2XYRA 3QEOA 4ZT5A 1YK0A 3D1JA 3H2ZA 4ZEWA 5C32A 1O4VA 5GPBA 1T36A 1STOA 3NJRA 5T41A 1YR2A 3M6AA 2M6RA 3D7RA 1YDHA 3DS8A 3AUAA 2B92A 1O87A 3ZK8A 2XUHA 3DUFB 4CGYA 3AY6A 3RVSA 4AZ0A 4ALJA 1WVIA 5FNZA 4CNBA 2WTMA 1VSVA 1BAPA 3OPXA 4UBJA 3PXEA 3DMGA 4AJOA 4H2DA 3HJTA 2BM8A 1YVDA 3JYNA 3PNYA 4PZCA 1HO3A 1WMSA 3FIJA 1SXPA 5EHNA 3SZMA 4LBWA 1B3RA 3OCZA 3PHIA 5EPOA 1N57A 1Z22A 3I9OA 4HWRA 1ZM2A 2YXDA 4MIKA 1J00A 1QZ3A 2QBYA 2JVKA 3CF0A 4RZHA 2IV2X 2PVSA 2CFSA 1W34A 1E59A 2H4ZA 1BOFA 4D4LA 3NFRA 2MJLA 3L02A 3VOSA 1XQ9A 1GO2A 2XXJA 1E7MA 2IA5A 1I3NA 2ZYAA 5DHAA 5KYUA 4DM7A 4WNCA 3FFTA 1KXZA 3LT4A 1AA9A 1A82A 4ABTA 3BE8A 3ZI4A 4OCZA 1N5DA 3JQAD 4XWAA 3B9BA 5L3RA 1V7PC 1K8YB 1SFRA 2FSSA 1DFGA 3PP8A 4YRMA 4ZZ0A 2AFIE 5ICGA 4HL6A 2JH3A 3UTCA 4X90A 4BGUA 4YTEA 1XNHA 2H92A 5CJ2A 1FDIA 1JPNA 4KMMA 3QMVA 1I9CA 4TUYA 1EUCB 2EJUA 4II2A 4C0KA 3LK6A 3EVZA 5G40A 4PW0A 4QBGB 4YRRA 4AN1A 5DCYA 5IZCA 1KRXA 1MNAA 4ND6A 1ONOA 2I1WA 1BA3A 4MS1A 4MZDA 1UZNA 4DUYB 4G0YA 3CUSA 1QGAA 2YRFA 3GG2A 2FYTA 5ENZA 3U3KA 2SECE 1XZAA 3K6JA 5HFNA 3B12A 5HJ7A 1E2GA 3EGDB 1EDOA 4K46A 4ZVQA 2JBWA 1R6BX 3BGVA 3IH5A 3DCIA 2IHKA 3ZCSA 2H7YA 5DCUA 1H1LA 3V4FA 1U2QA 2P65A 4S0XA 3Q7QA 1WTCA 1OJ7A 1Z8FA 4NXMB 4HYYA 2OV6A 3CZQA 1NNI1 4CEJB 2Y67A 4GQAA 2QX7A 2J46A 1V2GA 2X0NA 3I6BA 5DN9A 1YBAA 3NBKA 3K9NA 3QTLA 4J0CA 3ZV6A 5HZMA 5KTPA 1QOPB 3L4EA 3LECA 5KTKA 3DDHA 1X39A 4OP3A 5ALRA 5AXBA 3GLUA 1YC5A 3QUQA 1QH0A 2CLOB 1C9EA 1D0SA 2IW1A 4XE5A 3LCVB 3QBJA 1GGFA 2XGSA 3ZEAA 5JNUA 3KFLA 2NZYA 1H9AA 3FZQA 1AKMA 1C3OA 4J16A 4KIGA 4ZQGA 1V3QE 1AF4A 3FCOA 3UGKA 2BSQA 3NG1A 2PLFA 3OZFA 2H5JA 3NRBA 4KV9A 2WVAA 1LRJA 2LKDA 4BNUA 5K0EA 4Y2UA 3CUUA 5FOVA 1XL1A 2YVAA 5CLGA 4JUIA 3V6LA 3OTQA 5AVYA 3GZNB 2JS7A 2PWZA 5NULA 2RGAA 4UCWA 4AKTA 5EJIA 1O6CA 1YOBA 1TA4A 4NH4A 1SC6A 2WYWA 2AJ8A 5DI3B 1KS9A 3I09A 3FDJA 4FZJA 1DTWA 3JYQA 1Y9DA 3O3CA 1P9LA 4J3FA 4MV5A 5LZ8A 1E2UA 1YUBA 1LK0A 3QPVA 2IH5A 3E9MA 3R7DA 4BAGA 1WLYA 4GKKB 1HE5A 2LZ0A 3GRYA 1XMJA 4DCPA 4JWKA 4O4JB 1COWA 3EGDA 3TDNA 9MHTA 2XUKA 4KFTA 2HGSA 3P5SA 1MQSA 4JSTA 4L8VA 4CYMA 3B3JA 4RTOA 1ULSA 3LF2A 5EE9A 4I3HA 2A2ZA 3CX3A 4KQWA 4R7GA 1P5FA 3EJ6A 3GWGA 4ZQBA 1O9GA 3RC3A 4YMUA 3PK0A 4CEJA 2CEKA 4H31A 1V39A 2NLOA 5HR5A 4HDNB 4OXYA 1IN8A 4PPFA 3W6PA 1VA5A 2GHIA 1Y1RA 3L6RA 1E3EA 2IVZA 4YBRA 1BXGA 5EHXA 2EF0A 3ISVA 5DCLA 2IYNA 4BMYA 4ZCSA 4UUNA 1L7NA 1JLRA 1FLDA 1RI5A 2CNNA 2VVTA 1RWOA 2IHVA 3CBQA 4TV8B 2IXEA 3G59A 1DUIA 4AKEA 2H0AA 3OFVA 1SVLA 2TYSB 1OLXA 1MMFB 2I4NA 1KAEA 5UKDA 1F0NA 1Z34A 2AZTA 2X5XA 4RVUA 2WZBA 2RKBA 3GUCA 5IM5A 4EBBA 3NX4A 2NNWB 4KV7A 1JS1X 4NAUA 4E94A 4JXKA 2WDZA 1L5QA 2HA4A 3ASYA 4TT3D 1N5OX 4JNCA 1GA1A 2LXNA 2VEOA 2ZBGA 2M6KA 3UB2A 4MWTA 4RCYA 1PAUA 2IZZA 1YDMA 3KYJB 4IQ0A 2ICAA 2CXNA 1GPJA 3L05A 3QWIA 4J1QA 4MVCA 1KEVA 5JY1A 1G3UA 1VE1A 4DUGA 2JHAA 4QOHA 4UHEA 1JPUA 4F85A 5KTSA 5L7YA 1RPTA 3K2IA 3NAMA 4LKRA 1SCIA 3AIKA 1MDBA 2JFUA 5HCNA 4ZN6A 1UMCB 3TI9A 5L7WA 1QGED 4PLCA 1K5PA 5AW9A 2IYAA 4I4CA 2P2NA 3OUTA 5F3DA 2B0JA 4ND8B 5AKXA 1BA2A 2HF8A 3WGHA 1DRWA 3MQFA 2CBGA 3N2KB 4KFUA 1HE8B 3EUWA 4O2AB 3B2QA 3KAPA 3CSSA 5AVXA 4NR0A 1W87A 1XZEA 3DVSX 4IW3B 3P20A 4YR7A 4WY8A 4M1WA 5HGXA 3EPHA 4AJJA 1GY8A 3NIGB 4E09A 1Y8ZA 4ZV9A 1K6EA 1L5KA 1RJ9B 2WWXA 3S81A 2WUDA 5E7JA 3UO8B 1J49A 1EFDN 2FGJA 2JI6A 3U3DA 1W76A 1ZVVA 1ECJA 2ZZKA 4M7WA 4X97A 1V5EA 3FUWA 2YQ4A 2A1UB 3TRDA 4HYEA 2CCJA 4P36A 4I8XA 1HF3A 2JA1A 3KVVA 2J3KA 3GJQA 3NNDA 3C7AA 2ORYA 3OPMA 5EKXA 4ENPA 2J30A 4MNTA 4YRZA 2RC5A 4EYGA 1UOEA 2DTEA 2A1TS 1USUA 4B5LA 5TJHA 2Y1FA 3MIZA 4A5SA 5MDHA 3U4MA 2AGVA 4TV8A 2DERA 5FA8A 1EXNA 4NPAA 4ALMA 5JO0A 2PUGA 1W30A 2R00A 4RK4A 3MD9A 4ZJUA 3ZE1B 1HT3A 3RVPA 1OYVA 2ACWA 3DZKA 1RWNA 3K3PA 4ZC1A 4JJKA 1TOAA 2Q99A 3WLLA 1HPLA 1KSFX 5T5QA 5J47A 1ZUHA 3G5UA 2GCGA 3HKCA 1GAEO 1P7YA 4EJSA 4WH0A 4NQZA 3MWDA 4X1KB 4WZZA 4D25A 3NBFA 3ANYB 3C48A 2R62A 1F3LA 1KI2A 3M3HA 3RRZA 4CFYA 4ZCRA 3E05A 3ENNA 1FNMA 1D4OA 2G36A 2RGDA 2VNJA 4D98A 1R15A 1NUHA 3WMFA 4YUAA 2PGDA 5KHAA 1CERA 2XVZA 4DJ5X 3OLZA 2ZWPA 2VRCA 1RKVA 4KO4S 4BQIA 3EEYA 4N1AA 2OLKA 4EI2A 5E4YA 3KTAB 1EI9A 4ON9A 4ES6A 4M60A 1JMVA 2IUSA 3GLHA 2EW8A 2F1RA 3Q3CA 5F51A 4UAGA 4DV3B 5AUPB 1FC0A 2DBQA 3EZ2A 2DKNA 2SKCA 3W9UA 2CMFA 3U44B 2FZ4A 3IILA 4MULA 1TK3A 4S1WA 3CR7A 3G88A 1Q6ZA 4DWWA 2C2MA 3R44A 1VBKA 4JBGA 4U7PB 2OBBA 3F5SA 4BCCA 1GG8A 4DCOA 1X8XA 1QGYA 5K3CA 3ANTA 2RHWA 3NYIA 4BLPA 1TKCA 1X8JA 3DE0X 2ODAA 3DHVA 5JRJA 4PLZA 4ND7A 4DMHA 4MW9A 2P90A 3RSZA 1Y7LA 4Q4DA 1ZIPA 4DDTA 1OROA 2N47A 2V6JA 4I1RA 1TECE 4IH4A 3JW8A 1TEVA 3O4FA 2OXTA 2OORC 4DIBA 6LDHA 1V1RA 1GUFA 2OD9A 3O8CA 1YAJA 5FNVA 3JWPA 3ND9A 3K30A 5FI3A 4WOKA 1D4FA 2ZQZA 1A96A 4HN2A 4MLZA 4MKHA 4X1KA 5F2EA 3RVQA 4URVR 1V47A 1WY5A 1J0BA 2A30A 4WXPA 3TMKA 1JAYA 4HVTA 1IATA 2AC4A 4YP9A 4AT1A 4D9NA 1K6XA 1OBHA 3WWYA 4PO8A 4AMUA 4Z7JA 1SZJG 4E1BA 1R6TA 1QAMA 4HGZA 4OHOA 5ALZA 1T3SA 5BYJA 3WL4A 4BL5A 3GBPA 1VGQA 3NDPA 3S7TA 3EZLA 4NTZA 1LI5A 4CT5A 2WY2D 4F8EA 4HADA 4P53A 3SIXA 3OZDA 4FWTA 5A62A 4M0MA 2IHZA 3OC6A 3UKDA 4DW8A 3RADC 1EBBA 3ZHCA 4LVOA 3TVTA 2VR1A 2CV2A 2HSWA 2CL7X 1NXOA 1EJ0A 1OLUB 1P2FA 3E3NA 3H83A 4RTQA 3KDSE 1EDDA 1IG3A 3T4XA 2I66A 3TM5A 1SU8A 3EXFB 5BV7A 4EUFA 5CPBA 5B3KA 4D9JA 2A88A 2JIRA 4XQ0A 1KO4A 2VXOA 1ZJ6A 2Q1YA 4LXGA 3JQ7A 1KJIA 3GCDA 4J0QA 4BC0A 1DDGA 2FSGA 2CWDA 2JAUA 3WQBA 2J5BA 1NBEA 3UJ9A 3W2EA 2FWJA 4R98A 1NJFA 1Z5NA 3AHJA 3GLQA 5K45A 2RGGA 2I6XA 3KVOA 1O95A 1TVEA 3QP9A 4NFYA 1GGKA 2I8CA 4C20A 4JDPA 4L02A 4OQZA 4EPXA 5JAOA 2NAPA 5ECDA 1JA1A 3JD0A 4RANA 3ZKAA 4LY6A 4FMPA 4NG5A 3Q0TA 4AROA 1ABFA 2VTVA 3P9CA 3R8CA 1QTQA 1CUWA 3REQB 4I6JA 4ONEA 3P9XA 5D51S 3AI1A 1JR2A 2OXRA 4C08A 3NVAA 3BL6A 3WGJA 3R6TA 1DKMA 1JJBA 2ORWA 1WQ1R 2TMYA 4UTPA 1ZGAA 5AXAA 4EHNA 1BCSA 1E0KA 2IW3A 5DYNA 1SRRA 3QE2A 4RDIA 3BDIA 3GA7A 4EDHA 1IEXA 3M6MD 1NR5A 3L40A 3FMIA 5IFLA 4R5HA 3WAGA 5HSGA 1C81A 1G8MA 1NQTA 3DZDA 2WIFA 3WWOA 7AT1A 3TG8A 4DMRA 3CNOA 5JVDF 4IHQA 5DI9A 4CF6A 4MGHA 1U7WA 2DQ4A 3N39C 2CKMA 3SYTA 3R8FA 3BXOA 5TMDA 1KK1A 1IN6A 3DO8A 1Z0FA 3CA8A 3DHYA 3Q5GA 2BFDB 3H3FA 4JFRA 4RLQA 4YP1A 3BB4A 3QTBA 1O94A 1ZIYA 3RUFA 4L2IA 2ADFA 4EVIA 4TSRA 1L5MA 2QE7A 3OQBA 4OP1A 4Z49A 5FBZA 1NATA 4CIDA 1RI1A 4ZA2A 4ZOEA 3ROZA 1W0JD 4RWZA 3E22A 4LJ6A 3VX4A 3LIIA 1I6KA 2YHBA 3FTEA 3E81A 1MFZA 4KU4A 1E79D 1AXRA 1HEIA 1YK1A 1C4OA 2UUBB 5G02A 1XTVA 1JT2A 4L76A 3TNLA 4FB5A 3F2IA 1UC4B 1XTSA 1TB4A 3PUKA 4HAWA 4ZI3A 4QGSA 2XQFA 5ADVA 4YYZA 2Q4DA 1W85B 5DBEX 3KKNA 3IKLA 3W3AD 1NL3A 1DLIA 1ZK1A 1WOYA 5DHTA 3THYB 5C1DA 3OZIA 3TQSA 3OURA 4AS1A 1XFDA 1FW8A 2H1FA 3BCSA 3OPYI 1OWNA 4PQYA 4Q7KA 4YMWA 5A3VA 1XCLA 3LYUA 4PGFA 2VATA 2CD9A 1UBUS 1BMFD 2XITA 4W1QA 1JAXA 1Q7BA 4MWCA 1QDEA 4HGQA 1P3JA 1YCDA 4FGZA 3FMFA 2Y0PA 1V4BA 2WMYA 3MWEB 1DIOB 3FTDA 2RG7A 4G4GA 5EAIA 4EG6A 5CXQA 1G6OA 2XODA 1U99A 3WLJA 2AI1A 1WHTA 2BPOA 4M0LA 4H7KA 1CZUA 3WK7A 1O89A 1J1UA 4Z6KA 4CV0A 1HOXA 1HQKA 3Q98A 3V2HA 3CT4A 2WSIA 5BSVA 1NMZA 2C20A 3BAFA 1DRKA 4B76A 1J2TA 4DG8A 3ZV3A 2GO1A 2XOKD 3HO6A 1X7WB 4HQ0A 4KAAA 1XQYA 4N0DA 4QXAA 1QHNA 1CDZA 3I2HA 1K6IA 4CODB 5FB3A 1E3DA 1L7VC 1Y5IA 3MAGA 3R0QA 2PZ8A 4M88A 3G5LA 5F5LA 4YXFA 1XCMA 3PDCA 1AUOA 3DEIA 3ES9A 2XDAA 1JJ7A 2Y93A 4MRNA 4YECA 2RHLA 1BQ4A 1JUDA 1O54A 4KR2A 1CUZA 3GV0A 1IJKA 3KHSA 2GN4A 4INZA 2JLQA 1D7OA 1ID1A 1X7ZA 3M4XA 1GG2A 1XJQA 3CVYA 1JIKA 2CXTA 1XVAA 2P6MA 2BM9A 4MQ4A 1O6GA 3RAEC 1JZQA 3DBOB 1SKUA 4O4IA 2QYSA 5GWXA 4GI7A 3LUPA 3QOWA 3WYNA 4DEYA 1JQ3A 2SKEA 3D9QX 5E7MA 1P3DA 4GR5A 4BO3A 4DIOA 1B73A 2D3WA 3OICA 2VP0A 1GYRA 4X45A 4DR3B 3LOPA 4ZOLA 5BXQC 3THYA 3ICEA 3AZOA 1W4BA 4E4TA 1KJQA 3PUIA 1FPQA 3HB9A 2P9TA 4JR0A 3A1VA 1LXCA 3IDZA 4IR7A 1HGXA 1HTWA 2C9YA 3CNLA 4RZIA 1NNUA 2CT8A 3FUVA 2AJBA 2H3HA 2GVDC 4PTLA 1O97C 3EQ8A 2ZJFA 4QBIA 3F3MA 1SELA 4IDGA 4Y1RA 1E2LA 3RS3A 4DV4B 2V58A 3TLCA 4B73A 1XVLA 1XZIA 3J81k 4J16C 3KEFA 3QU9A 1PVVA 3EVAA 3IP3A 2V9ZA 1XRQA 3LRPA 3PWZA 4DIKA 2YV1A 2QUHA 3L6BA 1S3FA 2P9HA 3JS5A 4FUTA 5LBUA 1IHOA 2ONJA 3UMFA 1ZH8A 5LU8A 2BFBB 2YRWA 4L78A 2GVZC 5T57A 1R0XA 2O2DA 1JEAA 4MRMB 4M8IA 1LBSA 4IH9A 4LDQA 4PYLA 4DNFA 2PL3A 5LIPA 3O94A 3DYIA 2VHWA 2YMPA 5DIZA 2EL9A 5FL7D 2JCYA 3B1KA 1SVMA 4E5VA 3EYAA 2JATA 4BGIA 4EG1A 5KIAA 1UK8A 4BRUA 3U7QA 1MB2A 4WVFA 5CB6A 1PHRA 5J2TF 3HBNA 2P1DA 3S29A 4ZI7B 1C1XB 4QAJA 3TSOA 2WP8J 3GAAA 5LYJA 1J8DA 4HOYA 2IEDA 1PR5A 5FTWA 4DTIA 1FBNA 1GSAA 3T6KA 1U4SA 1PKEA 3GAZA 5A1JA 4U2FA 2XCIA 4ZQIA 2JCVA 4JJ4A 1RPNA 4GOJA 3RAJA 3WO1A 4QRIA 4WNYA 1DOHA 3KXDA 3O9ZA 4M37A 1AHIA 3O21A 3J7TA 4W6ZA 4XRGA 3KQPA 3TLZA 1JEOA 1IY1A 3BJZA 4DR5B 1B43A 1ELOA 4FHEA 2A59A 2YY5A 1BU5A 2H1SA 3AFNA 4ZT3A 4OGFA 3KPYA 4YO7A 3HJBA 5KVSA 3NMUF 2B8EA 1LPSA 3R3UA 4MJ3A 1E3JA 3FSGD 3JXEA 5ESXA 4G9EA 2MYUA 3TXAA 2OBYA 2QTAA 1W5EA 5BURA 4AJIA 2R4QA 4CQJA 2BMJA 3DF9A 3ONFA 4IX9A 4P3YA 2MCFA 8OHMA 1QB8A 4M54A 5I3ZA 3PNBA 1F2UA 1YONA 2BFBA 1SXJC 3G1TA 5C1IA 2Y0DA 2ZVPX 3FAZA 4HGNA 2IIVA 4W4TA 4Y9DA 3I01A 4G63A 2HQ1A 2J3MA 5LJLA 4MCIA 2Z6AA 2EJTA 4BNLA 2O9JA 4TYMA 2IH2A 3CX6A 4V0ME 1POXA 1P1HA 1U0LA 4HMOA 1JSZA 5DBHX 4HXYA 3V00A 4YRCA 4AF7A 4WJZA 1CR0A 3B85A 4UULA 2E1RA 1LI7A 3IJEB 4B4WA 4U7WA 1S2GA 4ZT2A 1AKEA 1SKAA 3DAFA 3RHTA 2OK7A 3UKJA 3MTJA 1BN6A 2UDPA 5TQVA 3FLBA 1TD1A 1CUAA 4NYIQ 4B84A 3R7FA 2R6ZA 4CKBA 3W4IA 4WXYB 1AZWA 1J23A 1YRAA 1UMKA 3SSNA 3QWBA 1P2SA 1TDJA 3A7EA 3NXKA 4BJ5A 3R3SA 3M3DA 2C31A 1SVSA 1K3UB 1ZG3A 2WOJA 5AXCA 1B14A 1SBTA 2ZUCA 2QR2A 3CB4A 2JANA 3LPAA 3LGXA 5DMHA 4F6LA 1YBMA 1W46A 2REQB 1PYDA 2C95A 3GFPA 1L5VA 4L8LA 1TNDA 1X8KA 3L0DA 5NLLA 3S28A 3ZY5A 1RHKA 1Q14A 1LQTA 2HSGA 4Q1EA 2XR1A 4PEVA 2P9FA 1KZ1A 2P2DA 4TMYA 6AT1A 3EASA 4DCMA 4FHZA 3DEHA 4POAA 4Q3AA 3DSRA 1NI3A 1IYZA 2FSPA 2GK4A 2HNAA 3NIWA 3QLUA 4RA6A 2Y9PB 1NJ6A 1MAWA 3EW7A 4AJKA 4JLWA 1WPRA 4E5NA 4PXYA 4IDOA 1X1RA 4ERNA 1LSOA 1PJRA 2BJWA 1ICIA 2FZEA 3I0ZA 4EJ6A 3BCUA 2FQ1A 4EJSC 3UJNA 3MNFA 2PMKA 1JYSA 3GX1A 3T7CA 3LP8A 4KXNA 3KJZA 4EGQA 2J7PA 3G79A 2XDQB 3JPYA 4UREA 4OV6B 3HZRA 4WY5A 3A9UA 2V5UA 2YXEA 5K0NA 4Z0NA 3I9KA 2GHQA 3W0LB 4DDHA 4IWXA 4AYWA 1MIOA 1KBQA 3N0WA 3AKZA 3E5RA 4QARA 4K6FA 3TTSA 3C1TA 1B23P 2YASA 1KAQA 2FH5B 3KJHA 2WTXA 3F9CA 3KDPA 3C3BA 2FE4A 3DV0B 3LHIA 3JQ9A 3WLNA 3WGQA 4QXQA 1P77A 2O3QA 4YVFA 1PUIA 1XZLA 1QU2A 4IPTA 4ZTBA 1IUKA 1Z3IX 3A4MA 1TUIA 4TV9A 3GLFB 2QJTA 3L7DA 3NTVA 4KQHA 3CZCA 3LKZA 4BX8A 3OO0A 4D4JA 4W63A 5FI0B 4Q21A 2C9MA 5EXPA 2HRBA 3BXXA 3RSGA 3RYCA 4H1TA 4FEGA 3HXPA 2DWPA 1SCUB 1A9XB 1PG0A 3A27A 3WE7A 2NYUA 2JVIA 1Y3DE 2Q0HA 2G76A 3KJQA 2JAPA 1KZGB 1TC2A 4I9UA 4LCJA 4M8NE 5EE0A 2JFOA 3QEJA 2O50A 2Y1XA 1RMTA 3G7UA 3SQDA 5DMXA 1A5AB 1M72A 1ZRSA 3PEYA 4M99A 4X1IA 1CIJA 1NVUQ 3S68A 4M0PA 4F71A 3IV7A 2SICE 5K3FB 1AURA 4EB6B 4F2WA 4Q3NA 1UJBA 3PYMA 1AKTA 4AMBA 4WD3A 1J99A 3RAGA 1I6LA 2AG1A 3RBVA 5GV7A 5THKA 2LCFA 4HY3A 1GYQA 1C7EA 4B3BA 1T3TA 4CM4A 5KINB 4N48A 1Y6JA 1V5FA 3JQQA 2IBMA 4OQNA 1EEHA 2IHNA 3UQZA 2H08A 3VNRA 3ZCTA 1XA0A 4YT5A 2BFNA 3MMSA 5CPFA 1UPAA 3L8GA 2RI0A 4MYRA 3HN6A 4W9RA 1G9XA 1Q1AA 1CZLA 3N8IA 3WKBA 4CRWB 1DAKA 2JFXA 2PJDA 2PRZA 2GT1A 3I9V1 3QENA 5CT5A 5TARA 5BT8A 3GLIA 1M34A 4KXWA 3A1TA 4RY8A 2R2GA 1ZK4A 3A14A 3AP2A 4PAQA 5F23A 2GUGA 3P2EA 2ZBEA 5ECGC 3F5DA 2HMYB 3C3CA 1SXGA 3ZWCA 4U5QA 1XJCA 2UUAB 1B0AA 3O1JC 1GQ2A 1VHWA 3IQEA 5FYQA 4G5HA 5C34B 4PLFA 4QJ5A 4MUAA 4Q3BA 4HV4A 1E6EA 2BCEA 3HM2A 1GLGA 3SEQA 2HRCA 3ZI7A 1QFYA 1S7GA 2VDMB 1VPWA 5AWFC 1QLWA 3K0SA 4RPIA 4LGVA 4ZHQA 2E49A 1TU4A 1BFKA 4NKRA 3TOXA 3AG6A 4IXDA 4B31A 3LWDA 1EG7A 2QZPA 2I3AA 3KYCB 4M1OA 4OKSA 2WKPA 2O7SA 4PG7A 1XBTA 3UJPA 4XFKA 4Q66C 4E70A 2G70A 1VB3A 1S02A 3JWEA 1O95C 5FAKA 1AKRA 3IT3A 4L8WB 4ECEA 1NQUA 2OAGA 4IJMA 1NYTA 3B9RA 1DVRA 2WFLA 3WZMA 4LCEA 4DTCA 4C5BA 1I94B 2C4VA 3QUTA 4I6EA 5CXXA 2DHDA 2PH5A 4QBKA 4BLTA 2VZ8A 4EF5A 2PAFA 3P0EA 1Y3FE 4HS4A 3NKFA 4V0QA 3LXRA 1T8YA 3ZPXA 2FPOA 5DGTA 1GKKA 3QFCA 1O97D 2JIZD 2QXTA 4ZZ3A 2GEVA 1M1YA 3KB6A 4PSUA 4PAOA 2RHOA 3NAZA 1OXUA 2EKDA 5AKZA 2D7DA 2XIJA 1I33A 3N74A 1P0MA 2XA1A 3HDGA 3PGMA 3ZHQA 4ARCA 3FROA 2RGNC 3AUKA 3CF4A 2OO7A 4X65B 1A95A 2C2ZA 5ERYA 1T2EA 4V0OA 1PCXA 1RAIA 2WM8A 5B2EA 1TM5E 2GJ4A 3LO8A 2G83A 3ZGOA 4ZOAA 3Q8LA 5C35A 3A11A 3G0CA 4YV7A 3GPDG 1ZDMA 2ZT5A 3VUEA 2I3GA 4HO1X 1UXHA 2A9RA 1S8AA 3UK0A 2H9YA