2CLDX

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gdp (2)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
166
structure length
163
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPASE HRAS
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nucleotide-binding protein
total genus 64
structure length 163
sequence length 166
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cldX00
5FBVB 4KJZA 5DGXA 1R10A 1Z22A 4IJMA 4Q4AA 2YKGA 5TXGA 3K9HA 2RGNA 1KYIA 2XXAA 3VR2A 2DFKB 3ADDA 1FQKA 1FMJA 4HAYA 4H9GA 5FOUA 4D25A 1DPFA 3BFXA 4ITRC 3ND8A 4HLQB 1DAMA 3LBNA 4A0HA 4BWYA 1EESA 4KU4A 1UBFA 4K46A 1H8HA 2GNOA 4EQ6B 4PQFA 5J4KA 4AIIA 1ODFA 3IKJA 1XBTA 1G8PA 2QP3A 3L0IB 4Q1AA 1PLKA 2PX3A 4WAUA 3THXB 4R9UC 1G6HA 4C9BA 2ORWA 1VYUA 3AEZA 3VR1A 1Q0UA 1T9HA 2V4ZA 3X1YA 1P2UA 5AR1A 1U8YA 1O87A 4GOJA 1FW6A 4TL9A 1CJUC 4B2LA 2QRNA 4M0LA 4URXR 1IN6A 2ONJA 1EX6A 2FGJA 3KDSE 1CR2A 1OFIA 5GJWC 2LKDA 2OBLA 4XH9B 4DJTA 3MFYA 1KMHA 3K0CA 2JIZD 4OI1A 2RHDA 3WHLA 3L8YA 4FMCB 4G5RA 4LUCA 3TKLA 2WJGA 4AY2A 2FGKA 3U44B 2XJ4A 3QQ5A 2JIZA 1NBMD 5FPKA 5FR2A 5KTYA 2QBYB 4Q66C 3NHBA 1SQ5A 5EQTA 2GJKA 2JJ8A 5C46F 1W44A 1G7RA 2J0SA 3W8RA 1AS2A 1YKSA 3SS8A 1Z6AA 1SVWA 3A1TA 1JXOA 4QOSA 1Z47A 1CULC 1E2DA 1JR6A 3FMIA 2FF7A 4PQRA 3K9NA 1R8QA 1SVOA 2X2EA 4F92B 1TPZA 4B44A 3LO5A 4RFVA 4CEJA 1EFTA 4W5WA 1E79A 3WP1B 4TYYA 1II8B 1G8GA 1NJGA 4YMUA 3FKQA 2PJZA 3WYFA 2BKUA 1ZNYA 4C0BA 4D0NA 2JAQA 2QGNA 4TYQA 4TLBA 2QTHA 4URUR 4OQLA 2ZI3A 1JB1A 4L8GA 3B82A 2IYQA 3HPRA 3N5CA 1U8ZA 4UXIA 4XTCS 4B3CA 2ZREA 3UG7A 2YC4C 1N5IA 5HCNA 1ZUHA 2ZU6A 2ZS7A 4AWXA 5K8TA 3KFXA 4LJ4A 2VHUA 2XTZA 3AKEA 1HUQA 4B32A 2QG6A 3KXLA 4PR0A 2AFHE 3TH5A 4ZKDA 3AF4A 4FMCF 4MUAA 3PEUA 4FMBB 2YYZA 4BFVA 5FUVA 1G8HA 1R0ZA 2DWQA 3RWOA 4YDHB 3CZQA 1W49A 2QQEA 1X3SA 3ADKA 2WPDA 3ND9A 4R2IA 2IXEA 2OFXA 3M1IA 5KOYA 5JCPA 2XX3A 5JWOA 3GLHA 3ADBA 2GXSA 4MYHA 1U0JA 1S3SA 1CR4A 1Z6TA 3HU2A 4G5OA 4QNMA 3E70C 2V55B 4B3BA 1OPXA 1UF9A 4Y0AA 4OQMA 3KKQA 4LJ9A 1E4YA 1VTKA 2AN9A 5CLQA 4DDTA 2AKAB 1EFCA 2ZRIA 3BB3A 2QTVB 4BZXA 1XEXA 2XZPA 2ZI4A 1OH5A 2C98A 5KSYA 5SZIA 3LFUA 3N2EA 2WICA 2OESA 5G3YA 4P32A 2KB0A 4ABYA 3PEWA 4X8MA 4B43A 3VKGA 2CLSA 3ZYCA 1F6BA 1B23P 1YR7A 2BMJA 3BFVA 4JLPA 1YZTA 4NE2A 1P72A 2HLDA 3DOEA 3SOPA 2ZYTX 4MGZR 4LYAA 2VBCA 5CJ2A 3U7GA 4RZUA 1M7BA 2CDNA 3GLHE 4RZ2A 3K0AA 3SYLA 1ZD1A 2ZRBA 5IT5A 2OLKA 2VRWA 4MYTA 3RSLA 4PPFA 2BC9A 2O8CA 1PLJA 1VG1A 3TK1A 2MMGA 5DYIA 3I8SA 2B8TA 2ZAOA 2V1XA 2H8KA 4IDNA 1ESNA 3IO5A 3SJCA 3B85A 3LBHA 1IN4A 1W4AA 4BGDA 3CRQA 3EZ2A 3DOFA 3EZ9A 1KNQA 3X1WA 2JCSA 3K9LA 1E6CA 3PXGA 3I5XA 2ZJOA 4A15A 2OLJA 1KGDA 1SXJB 2HT1A 2ZUDA 1CLUA 5FUXA 4IKEA 1VECA 1VG9B 1EGAA 4R98A 1IONA 2DWPA 4KFTA 4JYBA 4QBIA 2W6ID 2ZRHA 1M34E 2ORVA 4TQUS 5G41A 4HUQB 2XGJA 3CLVA 4KVAA 1XPRA 3JVVA 2ZANA 1G3UA 1NN1A 1DG1G 1QBKC 3L8ZA 4OHWA 3FMPB 4ZDIA 3AGPA 1VHTA 3LVRE 4HAZA 1AJEA 2GK7A 1KI6B 2RHMA 1OFTA 3QKSB 3EIHA 3E5HA 3CW2A 3AVPA 2FMXA 3CX8A 3DEFA 3PUZA 5AUNB 1E2LA 3KQHA 3T15A 3OE7D 4KBGA 2A9KA 1I4TD 3EPLA 4MGYR 4B2PA 5E7IA 3OE7A 4NCNA 2J87A 4LWZA 1RFLA 1OHHA 2Q6TA 4XOIA 1S9DA 4NCHA 2IS2A 3ZZUA 3H86A 3THXA 4FMDB 2OBMA 2VA8A 2YWEA 4MYUA 1ZCAA 3CONA 4F7WA 1QG2A 1E1QA 4XJXA 4B75A 1MR3F 4IOMA 4A6XA 4IXMA 2CVFA 3X1XA 2EYUA 3IILA 4BFUA 1G7SA 1KK3A 1MOZA 2WAXA 5KNDA 3AVVA 1YZKA 3O8CA 2RGAA 2W2TA 2YOFA 3EASA 3RS4A 4BE7B 5CLLA 3TRFA 3A4MA 5E3HA 2GZHA 4MDEA 4D2IA 1P9WA 3K9GA 1IY1A 1XD8A 1NSTA 1QHIA 2AR7A 3FYHA 2CCGA 3PR1A 1T3SA 5DI9A 3U44A 3EA0A 2Z4RA 4PPGA 1J8YF 1W1WA 1O3YA 4RY2A 1HH4A 5J4VA 2GF9A 2ANBA 2X1VA 4V0NA 4TLEA 1JEEA 1X8LA 1N6LA 3UXMA 1KO5A 1T91A 3A6PC 1KKMA 2TMKA 4PPNA 3LRPA 1ZU5A 1IOZA 1W0JA 3PQCA 1FTSA 1HT2E 1W0KA 4A8JA 2OILA 3HP1A 2Q0HA 3BC1A 4BLPA 4DUGD 1II8A 1G21E 2WWXA 4ZO4A 3OEEA 3C41J 5F98A 1TU3A 2QSYA 4FN5A 5CDFE 2OE2A 2IA5A 1XXHE 6Q21A 2GILA 2HT6A 5F9FA 1YZNA 3IDQA 1DADA 3WP0A 3U61B 1JAHA 2HYDA 1KZGB 5FTMA 1E9DA 3PEYA 2EFEB 4FMDF 2QPOA 4RFSA 4B35A 3U3OA 2QE7D 1NLZA 4OK3A 3FHOA 4TL7A 1GKIA 2QE7A 4MGIR 1Z07A 1LV7A 1W4CA 4TMZA 4JZKA 5DLQC 2REXB 2BEJA 3MMPA 5IK2D 4KV9A 1HURA 3T34A 3GJXC 3T61A 4W7SA 2YC2C 4DCNA 2NOAA 3B1XA 2XOKD 2JDID 1TL7C 1CEEA 2PCJA 4HAVA 4BLQA 1JR3A 4XVUA 2Q9BA 2CL7X 2XAUA 1SVLA 1ZNXA 3EA5A 4L5BA 4F91B 4B33A 1OW3B 4UJ5A 2WAYA 3T35A 4RD3A 5HKKA 2IUTA 1XZPA 4R71A 1N6RA 4RCZA 2CJWA 3LLMA 3T1VA 3EPJA 4G5GA 4DZZA 3RC8A 3EZFA 1NVUQ 4B71A 1P2SA 2IUSA 1ZU4A 1G16A 1B0UA 4XD7D 1S1MA 4QRHA 3X1DA 4YXWD 1PLLA 4B73A 4DVGA 4BASA 5CYOA 4TLCA 4YXWA 4CW7A 4ASUA 1Z0IA 1OB2A 3R7WB 2QROA 5AUPB 5GVRA 3TIFA 4PAOA 3I32A 1SHKA 3VX3A 5JBQA 3TW8B 1Q1ZA 1BIFA 2V54A 4A8JC 1JR3E 3IUYA 1V43A 3BJIC 5JHGB 2KSQA 3QI2A 5DSZA 4M9SA 4GDFA 2WJIA 1DO2A 4QL3A 1U94A 3B7GA 1KNXA 4M21A 1J99A 2AWNA 2OT3B 4Q18A 4HB0A 2WZQA 5DN6A 1F2TB 4IFEA 2Z6VA 1G1MA 4GSYA 4AKEA 4G0NA 2H17A 4JLAA 4HAXA 2I1VB 1Q1EA 1KHTA 4J0QA 2A7QA 3RLFA 4LV6A 5J40A 4A92A 1XMSA 1D5CA 1KDPA 4RZ3A 5P21A 4F4CA 1FZQA 3R20A 3B60A 2OHFA 3K8YA 4KLZA 4AC9A 1PJRA 2Z43A 4PC6A 4HUTA 4AK9A 1JBKA 3SN6A 2GCPA 2QORA 1AZSC 4PZZA 4A0GA 4C4PA 1GVNB 4HB2A 4CZ2A 2ERXA 4II7A 1XD9A 1LF0A 1CRPA 3UMRA 2CCKA 2ZS9A 2HEIA 3BOSA 2QZ4A 2YWHA 1Z2AA 5EUMA 4EDHA 4OK6A 4MRSA 2IHYA 1SXJA 4IFBA 3W34A 2G0NA 2B7CA 3CWZA 5EUQB 3OIYA 2BHRA 1C4OA 3CRVA 3KJIA 1P62B 1ZM3A 4US0R 5AUOB 2C04A 3MWLA 4EAQA 2FE4A 4D80A 2O8FA 2C99A 4IOKA 1KI8A 3AVUA 1UKEA 4HB4A 2FFAA 2ZTSA 2WWWA 1NMXA 2ZI6A 2VSOA 1E9SA 4ESHA 1A4RA 1ZUNB 4OQXA 1NG1A 1ZM7A 3VMFA 1M6NA 1JALA 4ON9A 4PSKA 5HCIA 5BN3A 5EZ6B 5TVKA 2A5JA 3F8TA 4Z51A 1G8YA 3QKSA 1NF3A 4QJ3A 1NLFA 5L8VA 5BWMA 3IGFA 1Z06A 4URWR 2KI5A 1ZP6A 1MKYA 4EFMA 1RVDA 3ADCA 1SXJE 4DEYA 1E1RD 2AK3A 3VNUA 1N6NA 2ZETA 2G77B 1E1RA 1KMHB 2O52A 4FCWA 4L4UA 2VL7A 1NSFA 4M8NE 1VYTA 3RRNA 5AJVB 1GRQA 2WMOB 3ZJYA 2UKDA 4LI0A 1FUKA 2QM8A 4G5QA 2G9NA 3FKSD 3C7KA 4LHXA 1D6JA 3C16C 1KI2A 5H70A 5C1BA 3SBDA 1P60A 4QC2A 2GVDC 3T12A 3FE2A 2VSFA 1U90A 3L0PA 5FI0B 4MKHA 2IYWA 3VTKA 1L4UA 1RJ9B 4K81B 2GXUA 3SJAA 2GEUA 1Q22A 3A4LA 5FTJA 4W9MC 4CEJB 1RZ3A 1SXJC 2ODEA 1W36D 1J2JA 1AZTA 2CEAA 2ZSDA 4TMWA 2QMUA 1M8PA 4Q02A 1GILA 3B9PA 1X8KA 3EIQA 4F38A 1NMYA 4TT3A 4LHWA 4V0MA 3OAAD 3I8XA 5J5CA 2J0QA 4TL6A 3NEYA 1Z6XA 3AUYA 1KMQA 3H84A 2F9MA 3OFNA 2ZRFA 2RCNA 4JMPA 4JLMA 5KO2A 1WCV1 1XTRA 4DDWA 1HEIA 4F93B 1FOEB 1KAGA 3ZIAD 2R8RA 2RB4A 2ATVA 2GJAA 1N6OA 5B2ZA 1GRRA 1TMKA 3LXRA 4BEBA 4TZ6A 2WSSD 5L3RA 4DLYA 3FGNA 1KJWA 3RYTC 2FFHA 2CBZA 2IYVA 4KSCA 2BCGY 2HXYA 3LAWA 1RRPA 2QPAA 2OCPA 1MO4A 2F6RA 2YWFA 1SVIA 3GP8A 1CJTC 3CNNA 3NH9A 2C9YA 3QKRB 1FQJA 2GEDA 1G5PA 4V0LA 2BCJQ 3EIEA 3ZD6A 2W2XA 2BM0A 2W6JA 1VG0B 3EARA 1Z3IX 1ZIPA 2HJVA 4XWOA 4NCJA 5HR5A 5FL7D 3NDBB 4PAQA 1CS4C 3DL0A 4JJZA 3KFVA 2QI9C 4PHHA 2C9CA 1LTQA 1OH7A 1AKYA 4JT4A 1J70A 4UNSA 3QF4B 4TWZA 3SFVA 2OCBA 2R2AA 1DAHA 2IYRA 4O2LA 2WV9A 4N0DA 5EXXA 1BMFD 3CRRA 1D9XA 2F9LA 4OHZA 3AF1A 1T5LA 1H8EA 1BMFA 4ZCLA 2R62A 2W0SA 3ZVRA 4Q7KA 3RWMB 2VH5R 2CK3D 4BQSA 3ZS8A 5B64A 1L8QA 4D81A 1II9A 5CK4A 5GJBA 1LS1A 3EX7C 4PANA 4URZR 4B76A 1XMVA 4M4SA 3PJRA 1EK0A 1OKKD 1X8JA 4PPQA 3REFA 3NVAA 2AD1A 3K0AB 4BUJA 4GBMA 2DFLA 1FMLA 1GNPA 4Q1CA 1LS6A 1OKKA 1NG9A 5BN4A 1TQ2A 2GKSA 4PO8A 5AK0A 4JLJA 1TNDA 5EJEA 3R7WA 4B6EA 5K8LA 2R6AA 3GD7A 1C1YA 4QGGA 1G41A 2H1LA 2QN6A 2G1KA 2FFBA 3P4XA 3W5JA 2GEVA 4ZI3A 4OHVA 1YHNA 3SEAA 5F9HA 4YLGA 1LVGA 2J46A 3QIAA 3ZH9B 4EIWA 2NO9A 5HPYB 1BYUA 5LDDC 3RAPR 1G3IA 2GCOA 2AK2A 2J7PA 1NLYA 4W5HA 2B21A 2RGDA 1JAIA 2YOHA 1SZPA 2F1HA 1TF5A 5GJCA 3A58B 3BWDD 1P2VA 3OIVA 1ZC3A 1SGWA 1H65A 2CL6X 2YZ2A 4URVR 3QKUA 3K70C 4QHTA 4N0EA 2HUPA 2RKOA 3DZDA 2ZRMA 3K0FB 1MO5A 3SDZA 5KU1A 4B3XA 3B13B 2H92A 4PZLA 4OI0A 3MAAC 2QRZA 1ZINA 1GNQA 2I3BA 3VU9B 4A6PA 1N5LA 2ATXA 2GESA 4BFZA 4YMSA 1Z0DA 1M2OB 2BBOA 2ONKA 2AD5A 2PEYA 1H8HD 1M7GA 1GUAA 1U0HC 4MRPA 5AWFC 2F1JA 1G5TA 2ZI5A 1OJLA 3QXCA 1TF2A 1OH6A 2ZQ5A 1F5NA 2FX3A 2W00A 1YE8A 2MSEB 3NIBA 5CM8B 3TQCA 4EPYA 5IDVA 1HQYE 4G3XA 2R6FA 1KAOA 1KI4A 2IF2A 1LFDB 4JJKA 4M9XA 4Q1BA 2EFCB 3BH6A 4Q19A 1N6PA 4ZDWA 2D06A 1L2TA 2CMKA 2CVHA 4DLRA 1T0HB 1NN5A 5AJYA 4TQAA 3EWAA 3HJNA 4CRWB 3GPLA 2I1QA 3OF5A 2EU8A 3KJHA 3L43A 1QVAA 1Z0AA 1GNRA 1XXHB 2CE2X 3VAAA 2HJGA 3I3SR 1I4LD 1XEWY 2V7QD 3DMNA 1T5IA 3K53A 1NVWQ 1IQPA 2FEOA 2V7QA 1VCIA 1X1SA 2D62A 3HR7A 4JBYA 2P2LA 1CJVC 4A2WA 3QPWA 5K8UA 2VPPA 1P9NA 5TARA 4OQFA 3VKHA 1G7TA 3BS4A 2BBWA 3PUWA 4I1VA 2PT5A 1TEVA 4LPSA 3UMSA 4MKGA 1LNZA 2OFWA 1VG8A 2PLRA 4L9SA 3CNLA 4KLNA 3Q8XB 2XNDA 4A8JB 4LV8B 1E0SA 3TMKA 1OFUX 4NYIR 4P33A 1E79D 1KOFA 1Q57A 1RJ9A 1KTVA 1G291 4PSAA 2IYXA 3EZ6A 3L2OB 4LYHA 5CIQA 5AJZA 1S0UA 2AL7A 2PH1A 2RGGA 2IWHA 4B6FA 2XTMA 1PUIA 2MSDB 2F3TA 2IYSA 1R5BA 1HY3A 3I5YA 1OYWA 3ONWA 4LC1A 2HYIC 2J5XA 4RSGA 1K8RA 4RFSB 3GLGB 2REBA 1OXUA 3EAQA 1KJZA 2BVNA 3KB2A 1OFHA 2EQBA 4C0QC 2WMNB 3QEOA 4WXRA 1D2EA 4WVFA 1XJCA 4I1OA 3WNCA 2O8EA 4DIDA 1KDTA 4D82A 2VHJA 1VPLA 1E2IA 1W47A 5JEDA 1GL9B 2JLYA 1E9RA 3GMTA 3T1TA 2FSGA 3V4RA 1FNMA 2VP0A 3Q7QA 2VP9A 5J4YA 4Q4HB 3DM9B 1IY2A 2YWGA 4D6PA 1DAGA 2J0UA 1RPZA 1UAAA 2XSZA 4D0LB 2WJVA 3I61A 1COWA 4E5UA 2WPDD 3WNBA 3KQNA 2QENA 4Y0VA 3NBFA 3BGWA 4BFWA 2CJWB 4Z1MA 1WE2A 4AG6A 2ZRLA 3QKRA 3UIEA 1UDXA 4P4TA 4OBEA 4ACAA 3SFZA 3SR0A 1QRAA 3W3ZB 3SQWA 1MRNA 4M22A 4C0HA 4TLAA 2CE7A 2XTNA 2Z4SA 3B2EA 3WXMA 1DTSA 1ETUA 1Q3HA 2ZU0C 4IEEA 2HF8A 2X19A 1DS6A 2XB2A 1UBEA 2GZAA 2G88A 1PV4A 1DBSA 2WWIA 1NMZA 3NWJA 3JZAA 4LY6A 4RKEA 3U3JA 2GA8A 3VR5A 5DI3B 4BLTA 2ZUCA 3LX8A 3QF4A 1R7RA 1SVSA 1NL3A 4F4IA 2J7KA 1Z63A 4MRRA 4JL6A 4XVRA 3GJ8A 2NMVA 3WRXC 2HLDD 4I99A 1S8FA 3AKYA 1NRJB 3BB1A 4MYCA 5FFMA 4MKFA 4EPVA 1WRBA 2C2HA 4Q1DA 1G7CA 4KFSA 2WWYA 1R5OA 2IYYA 4KO8A 4L16A 5FBWB 1RC8A 2XNSA 1RIFA 3GFTA 4JLVA 2V6JA 1RKBA 3S1AA 2H5EA 3BK7A 4OK5A 4X8HA 4E03A 1S96A 1A5TA 2O0KA 2ODWA 5EE9A 3DKPA 8OHMA 5EXTA 3AP1A 3ASZA 2QMHA 3CUEF 3DHWC 2ZSFA 1ZMXA 4CYMA 1DAKA 5HE9A 3ZS9A 2QQ0A 3PEVA 4M9QA 4BZQA 3GJ0A 1QHNA 1JPNA 5JJLA 1AKEA 1AS0A 3A37A 5CITA 1BOFA 2PT7A 4Q9HA 1YRAA 1QDEA 4HLCA 3IBGA 3B5JA 5LB2A 4IDHA 2WBLC 3I92A 3KZ1E 4GP7A 4FCVA 3RRYA 2JA1A 3QEJA 2IUUA 4RVCA 2VP6A 4Q21A 2FPLA 2PX0A 3TAHA 3I72A 2O8FB 2JASA 3K09A 3CIOA 3BD9A 1CU1A 2FPMA 3MWYW 1QHXA 1VYVA 4AYWA 2X2FA 3ZZTA 4S2EA 1YR6A 2ZE8A 2ORIA 1KJYA 3FDIA 1RRFA 3MRSA 5EP3A 3VFDA 2UVQA 1ZM4A 2ZJZA 2BMFA 4DCVA 1UM8A 1WP9A 5AUQA 1JQLB 3RSOA 3K0FA 2QSZA 3KKPA 4P4SB 3VU9A 4L9WA 4U5XA 1QHGA 4EPTA 3HU1A 3KUDA 3NH6A 4X8OA 4NYMR 2FFQA 1UKVY 1L7VC 2FN4A 3A36A 3Q5EA 1AGRA 4DLUA 3AP3A 1HV8A 5L3SA 4IXNA 1BH2A 1JXMA 3K0SA 4XSGA 3ICEA 3U5ZB 4B34A 1OHHD 1UBCA 2YHSA 1VCOA 2RGBA 2BMEA 2BKEA 2L0XA 2WVJA 1NJFA 1D9ZA 2HF9A 5FBLB 1PUJA 3MLEA 3JZMA 1E1QD 5DHFA 2G83A 3W6PA 2QMOA 1KI3A 3WYGA 5JI3E 3A1UA 5LD2C 1AIPA 3KKOA 2IF0A 3TSOA 1MO6A 1XMIA 1CIPA 1HT1E 3QXSA 3SZRA 4KAXA 2DB3A 4QBFA 1KIMA 4R7ZA 2WIAA 3VKWA 3TE6A 4Q5IA 2BMDA 4A0FA 1TAGA 1II0A 2HXSA 4V0KA 3T5DA 1N25A 5CDFA 3KXKA 3FVQA 1XXHA 3A1VA 4C2TA 2ZJYA 2D2EA 3K0EA 3AVWA 1E2FA 4WA7A 2CHVA 3IHLA 3IIMA 1J7KA 5CJPA 5CK5A 3ZDQA 3K09C 3H2YA 1AN0A 5HTKA 1NN0A 2DCUA 2HCJB 4KODA 5JFGA 1IAQA 1W0JD 4CVNA 1W0KD 2PBRA 5UKDA 1D2NA 1UADA 4URYR 1TQ4A 1DARA 3GJ7A 1R2QA 4EPRA 3QY0A 3AVXA 2HDNB 3PITA 1A2BA 2DWOA 1OXTA 1HTWA 1YVDA 3OEED 3Q9LA 4DLWA 5BXQC 3SYKA 1KDRA 2SHKA 1UDWA 4PQYA 2IBMA 2P67A 2CLCX 1KZ7B 3N2IA 4ZPXA 2EW1A 4LJYA 3TUZC 4I1UA 4NZYA 5DO9A 5EE0A 2Q9AA 3WBJA 1FTNA 5A5GA 1E3MA 3GLGA 5DIFA 2PLFA 4GFDA 3VR4A 1G20E 2WHXA 3V00A 1DOAA 4D4LA 2ZRAA 2HV8A 1KO1A 1R6BX 2QU8A 3TR0A 2NIPA 4KFUA 4UXHA 3T5GA 4PHFA 3FB4A 3MD0A 3GQBA 3QPVA 2H57A 3U6KA 1GKUB 1JR3D 3W6NA 3K70B 5FBQB 2BDTA 3VHLB 4Q4HA 2C95A 3D6TB 3H1TA 3PFIA 4LSGA 3C4JA 1JJVA 1CR0A 5HKKD 2C03A 4Z8XA 3HDTA 4GI7A 4DXAA 3NDPA 4I1SA 4U02A 1E9CA 2MSCB 5H1YA 2G6BA 5BW8A 2O5VA 2N46A 1S2MA 4NP6A 2NTYC 2LCFA 1TADA 4LPKA 4GNKA 2Q9CA 3WMEA 5EXSA 4ZIRB 1IXZA 1E0KA 1F3OA 2WIBA 3DDCA 1D2MA 2V3CC 1UJ2A 4LC0A 3CRMA 3GLGE 1HQCA 1NVXQ 2JATA 1VKJA 1XTKA 3O47A 1TUEA 4IVRA 4DRZA 5FTKA 1YZQA 2FOLA 4TQ9A 1IJFA 1Y63A 4ASUD 1KI1A 2GWHA 2G1JA 4TL8A 3OEHA 5DI3A 4HLDA 2O8BB 3LH5A 1JI0A 1GFIA 3OIWA 4HDCA 1W2GA 5JJIA 3AGQA 1N6IA 3GLFA 1P6XA 4D4JA 3BERA 3MCAA 4A4DA 2D2FA 3AUXA 3RVBA 5DN6D 1KY2A 4LJ7A 5DISB 4C2UA 1U81A 3NBYC 2QMEA 3HWSA 4C0AC 1FX0B 2GCOB 4Q7LA 3TSZA 3GEHA 3HYTA 4ILEA 4FWTA 1NY6A 4OKSA 3TUIC 4E07A 3BIFA 2X77A 2GK6A 4LRWA 4Z8YA 1G4UR 2ZRDA 1DAEA 1XTQA 3DPUA 5AJWA 4DDVA 1R5NA 3THYA 1T3HA 3PUVA 4LOAA 4PAMA 1PVOA 1HE1C 2F7SA 5KPJA 2GAAA 1E9AA 2ZSBA 3K1JA 3IHWA 4V02A 2ZVQX 1P9RA 4YMVA 4GMDA 2XEXA 2BBSA 5BQ5A 2VYFA 2ERYA 2ZJ8A 4Q7MB 1WXQA 4M1TA 1EWQA 4JLKA 3GLFE 1SXJD 3LQRA 2A30A 2EVWX 1Z0KA 4HEJA 4DB2A 1R0XA 3TR5A 5JCZA 4FWIB 3C5HA 4I81A 3REGA 3UANA 2C96A 2B8WA 3WRYC 1KY3A 4EJSC 1ANKA 5E7JA 2OV2A 1W4BA 1ZNWA 2FSHA 3ZQ6A 5H68A 1NNEA 4BFSA 2FSFA 2ZRNA 1D8TA 1SVKA 1DO0A 1E99A 3BFKA 1M1YE 2BEKA 2D7CA 3P4YA 3BAFA 1I2DA 3A4NA 5LB4A 3QENA 4PO9A 2DFTA 2IEYA 4KITB 3DM5A 1JECA 3T1QA 2OSBA 5EP2A 3OIUA 2WOJA 2JJ2A 2W0MA 2BBTA 1TX4B 4EUNA 1IN7A 5KNCA 4CT4B 3WY9A 3W9YA 1VIAA 2FH5B 3EXAA 2IWRA 4HAUA 4P4SA 2QP4A 3TVTA 3MJRA 1N5KA 3TGPA 1FP6A 2JLRA 1F2UB 1C9KA 1GIAA 1KDOA 4NHOA 2JLVA 1DE0A 4D26A 1V5WA 3AKDA 3GJ6A 3WMGA 1ESMA 1E9EA 1YZGA 4HDOB 5BN5A 3CH5A 2C77A 1XZQA 3N70A 4QHYA 2V9PA 1DAFA 1ZNZA 1Q1BA 2FA9A 2OO7A 4TMKA 5JSZB 4TTQA 4C7OB 3I1FA 4ZV4A 3LWNA 2GZDA 3HU3A 5F3WB 5EP4A 2FPKA 2A5YB 5B30A 2VHCA 1KSFX 4QGAA 4HAWA 3A8TA 1JNYA 5GVSA 3CO5A 1BKDR 2P6UA 5DNYB 1GDDA 621PA 1R0YA 3BXZA 3CX6A 3VHXA 1Z29A 3I73A 2NZJA 4QBHA 1XB2A 2AKYA 2Y8EA 4OL0A 4BFXA 4BLRA 3TW4A 5IRCD 1ZAKA 2IYTA 3FTQA 4TT3D 2J1LA 4KXFB 1N0VC 4FXPA 1XEWX 4JSTA 1GRNA 4EKDA 4B3DA 1MT0A 3OFND 1BYIA 3ICQB 3X2SA 1IHUA 1E32A 1MO3A 1FFHA 3UK6A 2OCAA 1P4SA 2VHQA 2P5TB 2Z5FA 1L4YA 2O8EB 2FZLA 1CBUA 1UEJA 1W2HA 1Z2CA 5FTNA 3UG6A 2JJ1A 2QUZA 4ARZA 5LPNA 3ECCA 4PX9A 5FOXA 5JWHA 5CM9C 4IVPA 2AXPA 4JVSB 3U7FB 3CPJB 4KHZA 4BECA 1WQ1R 1QG4A 2ZR7A 1EFHA 4MQBA 3SHWA 2J0UB 3TVDA 4GZMA 3V4FA 1ZD9A 2O8DA 3EPKA 1GITA 1YQTA 2ZYVX 3AVTA 1HE8B 4DC9A 1ZYUA 1XCGB 4ACBA 5JZVA 4WIAA 4BLSA 4CF7A 2W6JD 3G0HA 4QBGB 1JEDA 5C2JB 1Z0FA 3T1OA 3EC2A 4BZPA 3K70D 4M1WA 2Q3HA 3UATA 2ZM5A 1TQDA 4NKRA 3NEJA 4DWJA 1BO6A 5CYPA 3BORA 3P26A 2P6RA 1KO8A 3TQFA 2GHIA 2QEQA 3QXJA 1IY0A 1E2KA 1N6KA 3LQQA 3AP2A 3O8RA 3F3YA 1E0JA 4C3ZA 1G64A 3MJHA 3IQXA 3D8BA 2PZGA 4DLVA 4PSVA 4QGHA 3VNVA 2BIFA 1GWNA 1H8ED 4M1OA 1OXXK 1TTTA 4M9ZA 4TYNA 1YR8A 2AFIE 3VQTA 2VIIA 4LDJA 3RC3A 2GVZC 4V0OA 2AHOA 3L0OA 3NBZC 4ZIRA 2MMCA 4LV5B 4WZ6A 2QM7A 4TSFA 3KXIA 4HDQB 2VP2A 2JEOA 2ANCA 1PZNA 1DELA 5CIWA 5DHAA 2VQSA 3S1AB 3DO6A 2OG2A 3B1WA 5LD2B 1YJ5A 5BYJA 3LA6A 3MWJA 1KI9A 2ZEJA 3GJ3A 3IEVA 2ZJAA 2O8BA 2WWHA 1E98A 4QKQA 2FDCA 5KSPA 4NMMA 4O3MA 2RAPA 3CR7A 5TDHA 2QL6A 3E1SA 4MRNA 2OAP1 3LW8A 3RNLA 4A1FA 3QOFA 3D3QA 2GXQA 4QHSA 2J7PD 2V8OA 1YZLA 3TNFA 4AKHA 2FNAA 1WMSA 2ZRJA 1E2GA 1RE0A 1FX0A 4Q9KA 4GT1A 3BH7A 2BM1A 1GG2A 1QVRA 2JLZA 4MH0R 4A2QA 4TZ0A 2ODNA 3TBKA 1TU4A 2ZSAA 3GCGA 5C4GB 1XD2A 1CR1A 4B48A 1R4AA 2ZVPX 4OQNA 3QKTA 4ZKEA 4CDGA 4NL4H 1E69A 1KK0A 2N1BA 3KJGA 4P4UA 2J3EA 2D7DA 2O0HA 2Q3FA 4E09A 3GFOA 4TLDA 3GEIA 2W58A 3KKMA 2AX4A 1EXMA 1AGPA 2VHTA 3W6OA 2R9VA 4I4LA 3BB4A 3U2QA 1QZXA 4BLOA 1A82A 4TMVA 4NYJR 2WJJA 3UPUA 4Q1FA 1E2NA 3R9XA 1G18A 1XRJA 2HCBA 5F2EA 4LHZA 4Q9LA 5L3SB 2NGRA 1Z6YA 1G8FA 2PL3A 4LBVA 2QAGC 3CF6R 5KYKA 4ESVA 4TMTA 4CEIA 4LYJA 5A0FA 3UWKA 2KE5A 2F3RA 3FFAA 1VDZA 1YR9A 3KJEA 3P32A 2BJWA 2WM9B 5FPSA 3RRZA 4YMWA 4RJLA 1VHLA 1WBDA 1ZUIA 3B1ZA 4QFMA 4YDSA 5E95A 4IEIA 2ZAMA 1FL9A 4NYJQ 1WF3A 4HI0E 4LZZA 4RZXA 4CT5A 4DHEA 5KNBA 4DSOA 4L15A 2ZS8A 1E2JA 3KTAB 2RMKA 3R9WA 4LHYA 4O25A 4LJAA 5FH9A 2J59A 1CP2A 1F2UA 4PC7A 4KFRA 4NTZA 1NN3A 3RHFA 2R65A 2IHBA 1Q1QA 3U4QB 4NONA 821PA 2GF0A 2PMKA 1MABB 1WDTA 2KJQA 2WWGA 1NVVR 2J41A 3MGCA 2GETA 1P2TA 5BYKA 1R0WA 1GKYA 3UKDA 2IYUA 1T4GA 721PA 1CF4A 2ZYUX 3NG1A 4KI0A 1T8TA 5JSZA 4C7OA 3X1ZA 3LXXA 4LJ5A 4YC7A 5JJKA 3R9IA 2XJ9A 2R6CA 2XNDD 1JQJC 2ZROA 4C0JA 3QVVA 1P3JA 1WBBA 4CEHA 2J45A 3EPHA 5LBIA 1X1RA 3NTUA 4IVQA 4N1AA 1NVVQ 1MV5A 4P0TA 3RABA 3H4MA 3MG9A 2F55A 1E4VA 4ZCMA 4OYHA 4KYUA 1N2CE 5D3QA 5A4JA 5JRJA 2PMDA 2QA5A 2CL0X 521PA 1W4RA 4U00A 2ZITA 2KWIA 1NBMA 3QE0A 3ZVMA 5FPTA 3T06B 4DBLC 3KX2A 3ZGXA 1J8MF 1XTSA 4PHGA 4AYXA 3JVUA 2YV5A 4US2R 4BPBA 5EZ5A 2AWOA 3MWKA 1NIPA 1TF7A 3KKNA 4TN1A 2FG5A 4DCUA 4XIGS 4NYIQ 4PC1A 3B9QA 3SI7A 4ERNA 3NHAA 2RGNC 2A78A 4GPTA 2B92A 1ZRHA 4WXPA 4PFSA 1SVMA 1CRQA 2YJTD 2GBLA 3HR8A 4C0LA 1ZD8A 1SKYE 1ZCBA 2XSZD 3OHMA 1SKQA 5FOWA 3TUJC 2IS1A 2CHQA 1QHHB 1COWD 4EJSB 2ZJBA 1SHZA 3FMFA 4GOKA 3A1WA 5DH9A 4WZBE 5FR1A 4DKXA 1DG3A 4JVLA 1T6NA 4Z1MD 4GL2A 1EFRD 3PUXA 1GL7A 1NBME 2FU5C 2QGZA 1XCMA 4WZAE 3F0TA 3GFPA 1Q3TA 1EFRA 4JL8A 1A7JA 3AH8A 2JLXA 3AQ4A 1RRCA 1OXVA 4LX0A 1DVRA 1OV4A 2FWRA 4TTPA 2FSIA 3B1YA 3IIKA 2GJSA 3THWB 3KUCA 4UNRA 4AKIA 4S35A 5FTLA 1E2QA 1Y3AA 1T0JB 1M74A 1ZIOA 4RD1A 5GJVC 3LY5A 2NG1A 4Q9IA 2IX3A 4DSTA 1XJ0A 2XZLA 3U60B 1U9IA 3Q7PA 3Q3JB 5JI2E 4TYWA 4XWKA 3K0CC 3GLFB 4BEJA 5GADl 2ECKA 4Q4JB 5L3VA 4UNQA 4X8LA 3UMFA 2ZRPA 2PCLA 1T3LA 1GP2A 1KSHA 1YZUA 2D74A 3G5UA 4FW9A 4HLUA 4WBSA 121PA 2YOGA 3QBVA 2VEDA 3B78A 4DCTA 4DT1B 4PZYA 2QAJA 2QNRA 5SZHB 1CXZA 1QHSA 2GXAA 2BOVA 3GJ4A 4JLBA 4Q7JB 4PXAA 3THYB 1UFQA 3D7MA 1OSNA 4MA4A 1FPMA 3M4YA 4LHVA 3SE0A 4B74A 5IF9A 1GZSA 2PZFA 1XP8A 4IDOA 4DLSA 2ZE6A 4NDZA 1KSJA 4R2HA 1ZVQA 2WOOA 3BE4A 3RANA 4B3GA 4TYPA 2A5DA 421PA 2GBLC 1HYQA 1MH1A 4HB3A 4PC3A 1TQ6A 3EWSA 3C14C 5JEEA 5DYGA 4DDUA 3ZVNA 5JECA 1A2KC 1IXSB 3F5FA 2LKCA 2IT1A 3LW7A 5FOVA 3ASYA 2IK8A 4JLNA 4JKIA 4OJQA 3IO3A 4QGFA 5EE1A 5EXPA 3VX4A 1VIYA 2VO1A 3U3KA 3W3AA 4JVNA 3C8UA 1CKEA 2C78A 3LNCA 3QJYA 2R6DA 3BRWD 1K6MA 3EC1A 4C0SA 4Q1EA 3EW9A 5ANRB 5EE5B 1RRGA 4D0GA 2WKRA 4AYTA 3AV0B 1Q12A 1QF9A 1I2MA 1US8A 1MRSA 4U7DA 1P7CA 4MKIA 4JVMA 3WMFA 5L3QB 4AI6A 3DVLA 1GTVA 2ZUBA 5E4FA 1U9IC 1XX6A 1IN8A 5FUYA 1UBGA 3OESA 3QG5A 3IEUA 3SBEA 4HZUB 1EG7A 3I62A 4NU0A 4RCYA 3QPUA 4HATA 5EE3A 3EZ7A 2IW3A 2W6IA 2IXFA 4HLUC 4C0KA 2P65A 1W5SA 2ZR9A 4A9AA 2IS4A 2J0VA 1ZJ6A 2R6GA 3L82B 3VR6A 2NO6A 4CIDA 3MSXA 1IBRA 2EFHB 4AG5A 5IHPA 1J90A 3WNDA 3CKLA 3CF2A 1G17A 1U99A 2ZRGA 5B58C 3LVQE 4Q03A 3CBQA 1DAIA 221PA 4EPXA 1W46A 4NYMQ 1UKZA 1G5RA 2DHRA 3WBKA 3KTAA 5J4HA 4FCTA 1XWIA 4JLDA 2GRJA 4EQ6A 1S4QA 2DYKA 3CB4A 4UQOA 3U4QA 1XTIA 4GOXA 4B2IA 2RGEA 3SQXA 1IXRC 3EG5A 1MABA 4JYCA 2EFGA 3FHCB 4Q47A 1OLOA 2V6IA 1E2EA 2DBYA 5FL3A 1N0UA 4DSUA 2A2ZA 3HYRA 4FIDA 1P5ZB 4BFYA 1ZW6A 2OCYC 1G9XA 4IDPA 4G5SA 1E2PA 3ZZ0A 1E2HA 3BBPA 1K5DA 1JPJA 4NH0A 4LBYA 2I4IA 1HA3A 1VMAA 3E2IA 3TLXA 2JGNA 3PVSA 4QM6A 4GMXA 2CNWD 2X8AA 4ARZB 3CZPA 3P20A 2ZRKA 1OYYA 1RYFA 2CNWA 1F48A 3ETLA 4B3FX 3B8HA 2NZ8A 5C18A 3OZXA 4H1VA 2ZI7A 3Q72A 2WKPA 1W36B 2QBYA 1WA5A 4Q00A 2OEPA 1X6VA 4QM7A 1NP6A 2C8VA 5HE8A 5TY0A 2O8DB 4LCBA 3QXHA 1E96A 1ZBDA 1KO7A 2CLDX 4A2PA 2P3SA 3FMOB 5TV2A 1U0LA 4PO1A 2BJVA 1TEXA 1G19A 1ZM2A 2R44A 1S1CA 1XDBA 2H16A 1LB1B 1GM5A 3SC3A 4MDFA 3CRW1 4XTRA 3AKCA 1CTQA 1KO4A 2VP4A 2ZIAA 2C9OA 4QG7A 4BRUA 4DUGA 1Z5ZA 3IPYA 4EFLA 3GLIB 3CPEA 4ZDJA 1QHHA 1E94E 4EJSA 1Q20A 4LGMA 1XEFA 4OHYA 1U2RA 2IL1A 4H1UA 1XU4A 1Z0JA 4MRVA 3WYAA 1CJMA 1Z6GA 2ZYWX 1OB5A 2VLIA 2Z83A 3AVOA 2D3WA 4UJ3A 5D3MB 3CX7A 2QAGB 2QTFA 1Z83A 2G0TA 1OIVA 1AK2A 4D4KA 1XMJA 3THWA 1IJEA 2FZ4A 3AVQA 5IK2A 4AKGA 2NO7A 3O8DA 3OEHD 4WOPA 2XOKA 2GJ9A 2JDIA 3NC1C 3D31A 1Q21A 1P73A 5FPHA 1T8UA 1M7HA 4IOLA 5TB5A 4UKDA 4DLTA 1KI7A 1UPTA 3CWQA 4D4MA 4RD6A 1R8SA 4QJ5A 4W5JA 4AD8A 3NKVA 2F43B 4Q4JA 1XNJA 1XJQA 1QHYA 4OI2A 1U98A 3Q5DA 3QVUA 4O2RA 4UNNA 2CHGA 4NCIA 2ZI9A 4NBSA 2NPFA 2OBNA 1IN5A 3QG1A 3B6EA 1GL6A 3SYNA 4DT1A 5KUTA 4XD7A 1CJKC 2Z0MA 4FD2A 4M2LA 2EWVA 2ZXUA 1FP7A 2B6HA 2K5UA 3SJBA 2GTPA 3U7HB 3FHTA 2ZE7A 2WTUA 3PCRB 3A1SA 2F1IA 4ZCIA 3H0KA 1XD2B 3CR8A 1OIXA 4A82A 1OT3A 1LY1A 4YQFA 1NKTA 1NKSA 4Q9JA 1G4AE 2DY1A 2E87A 3RS5A 5JWRA 1N3BA 3FOZA 3C15C 3KB1A 4GP6A 1XFAA 2XB4A 5KHOC 1KKLA 3LD9A 4O0MA 1WB9A 3FWYA 3DMDA 1XPOA 1G3QA 5B57C 4GRAA 1OXSC 4Z54A 2P6NA 3CF0A 3U6BA 5C4MA 2UZIR 1OE0A 4JL5A 1LF5A 1NY5A 2WKQA 2XITA 1NI3A 3KL4A 5G3ZA 2GCNA 4CEIB 5KDDA 3KQKA 3DZ8A 3ZVLA 1SULA 2DFNA 1LW7A 5KPDA 2JJ2D 2BWJA 1XCPA 2C5LA 4JSYA 3IPXA 4Q4AB 4LYFA 4CGZA 2OUKA 2RGXA 2IXGA 3LX5A 1YU9A 3U7EB 3ZD7A 2DPXA 4PHTA 4C30A 5L3QA 2XXAB 2VTKA 3TSWA 4DCSA 3RS3A 2UZ3A 2CXXA 4KCGA 4XWAA 5H8WA 3LLUA 2A5FA 1E9BA 1E0AA 1AQYA 4PTLA 4HZUA 3W5IA 4FI3C 4IW3B 2E9SA 3MUFA 1RYHA 2NO0A 3M6AA 4HUQA 3AVYA 4N3NA 4OHXA 1VCMA 4TTRA 4AURA 4YONB 2E1RA 3VR3A 3THOA 3U3RA 1EFUA 3PUYA 3SJZA 4LJ8A 4DEXA 2EYQA 4HSEA 4ZI2A 2Q3MA 2OAQ1 2EWWA 2J9RA 1KI6A 2NPIA 2JLQA 2PJRA 3RDPA 4OI4A 4ZDKA 3NC0C 2IS6A 4QJ4A 1A1VA 1KK1A 3CM0A 4G01B 4DB4A 2QP9X 2WSMA 4DSNA 5E7MA 2RGCA 4TMXA 4DLXA 3BH0A 4CEHB 2B7BA 1S9HA 4JS0A 1SKYB 3W90A 5J47A 5FOTA 4MGKR 5FUWA 3W8NA 4G1UC 3G82C 5FBRB 2ODBA 2ZR0A 2EFDB 5G53C 1RW4A 2D4HA 2ZE5A 3LV8A 4LBWA 1U8AA 3RS0A 3U3MA 4EPWA 1EX7A 3RRMA 1N5JA 4JT2A 4QNRA 3IBYA 1X86B 2OZEA 1AQUA 3AF2A 3CNOA 5KSOA 2GAOA 3FKSA 2W83A 4RKFA 1KK2A 2PEZA 3QXXA 3QSYA 3NXSA 3V9PA 2ZPTX 1UKYA 2A3RA 1BS1A 2Q21A 4JKYA 4K8OA 3PENA 1GSIA 2JJ1D 4P3YA 3Q85A 2WWFA 2AXNA 4DIEA 2ZRCA 5DE3A 2RH5A 1FNNA 5CB8A 4M53A 5ELXA 2JLWA 1E9FA 1W48A 1W7AA 3AM1A 4Q4LA 1G6OA 3GJ5A 4IRUB 2IC5A 3L0SA 3QF7A 2QY9A 5G40A 3PG5A 4KSBA 2OM2A 4E22A 1ZC4A 1I4DD 1OIWA 2NO1A 4IHQA 3ZQJA 5SZJA 2FEMA 3LBIA 3OAAA 1DEKA 4A0RA 1N0WA 5M04A 4A36A 3FFBA 2P0EA 3ZLJA 3AB3A 1OF1A 1ELOA 4XSHA 3ZIAA 4M1SA 2ZSEA 2WJYA 1NIJA 4NPHA 4POAA 5HZKA 1TUIA 2FJUA 2O0JA 4IOJA 5KSZA 3J81k 4V03A 1FUUA 2G3YA 3GLIA 2WSSA 1JJ7A 3PV0A 4LBZA 3UWOA 2KBFA 1IM2A 2KBEA 4M1MA 4BRWA 2QPTA 3QNUA 4V0ME 4M1YA 5JLJA 4TSFD 1ONBA 4B47A 2OXCA 2QT0A 3GLHB 3HPQA 2VSXA 4IDQA 4LJ6A 5D3MA 3SHFA 2QAGA 3KQUA 2OXRA 3C5CA 2YNMA 1P75A 2ZJ2A 3QBTA 5FPYA 5HZHA 4RD0A 2VF8A 5JS7A 1Z8FA 4FINA 4UXJA 5SZKB 2NQ2C 5FOSA 4EFNA 2YVUA 5AJXA 5FL7A 1XEXB 1EWRA 1KSGA 3SNHA 4BFTA 3TAUA 2IYLD 4HYYA 4M1KA 3R8FA 3O8BA 5J4LA 5JS8A 2V1UA 1Z08A 4QXAA 1W5TA 1S3GA 2IYZA 4UNPA 1VCNA 4MUBA 3GLIE 4KYIB 3CPHA 2F43A 2P5SA 2VP5A 3FPAA 2OFOA 5KDLA 1P61B 2WJHA 5K8IA 1ZM9A 4OJKA 1AM4D 4JIMA 2ZJ5A 2CCJA 2CK3A 4Q01A 2PZEA 2LWIA 1W36C 5EP1A 2BV3A 4JLOA 3PIRA 4NCKA 3TJZA 3KQLA 1G3RA 2XZOA 4PC2A 2JLUA 2ASEA 3I4LA 2FV8A 5KDOA 4JBWA 2O8CB 4GZLA 5JMTA 3P1JA 1XTJA 4YMTA 3M0EA 4WW0A 1OH8A 4Q48A 2A5GA 3QUSA 3IQWA 1K5GA 2YINC 2H18A 5TMPA 2REOA 1XF9A 2VF7A 1Q44A 3AF0A 3AF3A 4RD2A 1YRBA 3RS7A 1Z28A 1GAJA 1N6HA 4JBXA 2H7VA 2IEZA 1E2MA 3CH4B 5JHHB 1US8B 1F2TA 1AA9A 4MITA 2F1RA 2W2VA 3B1VA 5FI1B 3DKVA 3NBXX 4LK2A 4KVGA 4XVQA 3RS2A 1G3MA 1GOTA 1UEIA 1XPUA 4RD4A 2JLSA 1AS3A 1F60A 4KBFA 4P31A 3WHKA 3SU8A 2N42A 3R8CA 2GDJA 3IIJA 4HZIA 4US1R 4F4JA 5CB6A 2QT1A 3P27A 2GJ8A 4DLZA 2DR3A 5JRZA 3GEEA 3LDAA
chains in the Genus database with same CATH superfamily
3G88A 2WHPB 5FBVB 3QEAZ 1JZQA 1ZH0A 2QUHA 3RS8A 2A0YA 4Q4AA 5C32A 3DDSA 2YKGA 2Q4OA 4R7GA 1KYIA 4NFLA 3AEQA 4ALMA 3TCKA 3HMKA 2XXAA 4FYMA 1KFBB 1Q1AA 3O3MB 1A98A 2PANA 2X41A 4N49A 4ZTUB 1DPFA 3BFXA 3UUEA 2H7XA 4BWYA 3C3WA 3HUUA 2XGSA 1PW5A 3B53X 2GNOA 2QLFA 3EBPA 4DV7B 3K72B 1DEOA 2L19A 2GRAA 3NCHA 3ONFA 3UV3A 4F9EA 4MV9A 2PLAA 4TROA 5FQOA 4DKJA 5AOVA 3S7TA 5IDXA 2XQGA 1B6SA 4C9BA 4C6TA 1NW9B 4RULA 5EIAA 3OZBA 1VYUA 1A5BB 4RLQA 3ZTYA 3RV4A 4FS8A 2JI9A 3OJOA 3G0IA 1O87A 3QUTA 4GOJA 2ZBFA 5HF9A 1FW6A 3IVAA 2QRNA 3F5MA 2HB6A 1JAZA 3QBJA 1T1JA 4JQCA 4R5HA 2ONJA 3DQQA 1OLSA 4EI9A 2CMDA 1CR2A 2QR2A 3OOYA 5GJWC 4F96A 3MFYA 1Z15A 2JIZD 4OI1A 2RHDA 2Y4OA 4C29A 2WJGA 5ILGA 4TN5A 4KO4S 5B1DA 2AEJA 3RSHA 3U44B 1QV7A 2ODAA 3ZCQA 1NBMD 1TC1A 1U5CA 4D3YA 1H5UA 3F6CA 1TPYA 1V5FA 3O0DA 1ABBA 1MORA 1PZHA 1MX3A 5C46F 1BE8A 1W44A 1EB9A 4MQ4A 1KQNA 3SS8A 1V5IA 1WPGA 2P2SA 3QX9A 5FWDA 4HQLA 2WB4A 2MYNA 2IDKA 4H17A 4ZC8A 4IS2A 1N2BA 3PEEA 2NP6A 2C7OA 1KQFA 1G60A 2FF7A 3K9NA 4PQRA 5HMMA 5TX7A 4F92B 5MF6A 2JLCA 3LUAA 1XKXA 5I4CA 2NM0A 2AFHA 4PNEA 4NESA 5BSRA 2QQGA 4PO3X 4RFVA 4XQEA 2C7PA 1EFTA 4W5WA 5GIOE 2HD4A 3PQ3A 1Z5WA 1YOVA 1NR5A 3IA2A 2JIQA 4WLOA 4YMUA 4YT5A 1RZRA 1XKLA 4FEGA 3FCYA 2Z6UA 5TF0A 3RM3A 4ID9A 2CMFA 3DD1A 4WLNA 1H2RS 1ZNYA 3KQVA 4ME6A 2HLHA 4RTKA 1MQ8B 1HDYA 4OQZA 3A31A 2QGNA 4TYQA 1LBEA 2WVAA 3IT0A 4GEKA 1HG0A 3AR4A 3C6XA 3JVEA 4TLBA 5F52A 1CQJB 1GZ6A 4PVCA 1FXWA 1I4EB 1TO1E 1JB1A 4X1OA 1K0FA 1K89A 1KR5A 4FYXA 4LVNA 1P81A 3ACBA 1P19A 4UXIA 1V45E 3C7DB 4EL5A 1HSZA 3N8DA 3ZN2A 2I2DA 2D2XA 4GQBA 3AJ9A 4OBWA 3LRXA 5I8PA 4XRGA 1INLA 5I47A 2R00A 5K8TA 3PIIA 3D8HA 4PGHA 1OLXA 2VHUA 3WWPA 3VO2A 4DPLA 5E4TA 2GZ2A 3A9WA 2QG6A 1PDWA 2E4ZA 3DE1X 4UM9D 3VU0A 2AFHE 3TH5A 5LUAA 2NUPB 3AF4A 3CUWA 4FMCF 3EMBA 4MQMA 3SR4A 2XCRB 3PEUA 4FMBB 2YYZA 3IOMA 4GE0A 4L57A 5FUVA 3UEOA 1E8MA 1AQJA 4GZ5A 3UFXA 1I7QB 4WA8A 3RWOA 1FU8A 3V6LA 1Y6ZA 2GCIA 3FPHA 3LQKA 1W49A 2QQEA 1X3SA 5KWEA 1Y42X 2WPDA 4L2IA 4CMIB 4ZT2A 5JWOA 3Q8MA 1TZBA 1Z6QA 3IQFA 3NCTA 3Q3CA 1V3UA 3ADBA 1C0PA 4JYMA 1U0JA 3NIGB 1S3SA 1SQGA 3WJ7A 1PD1A 2AQIA 1D0VA 1IEQA 3B70A 3WFIA 3E70C 3BREA 7YASA 2V55B 4KDFA 5BW6B 4U6SA 4B3BA 1OPXA 2GSWA 1L5SA 3M4JA 1Y6RA 1M8GA 4AS3A 4XLLA 1P17A 2AN9A 4ZTBA 3V4LA 3CKMA 4F56A 5K9ZA 1EFCA 2J32A 5AVQA 1SOUA 1WXEA 4J3NA 3WIBA 1ADFA 1U8UA 4P2GA 2ZT5A 4PLYA 4YRTA 5SZIA 3NTVA 5JIBA 3VPFA 2DEUA 3LFUA 5G3YA 2EKDA 2NV6A 4IZ6A 1NQAO 4GR9A 3VZQA 4HFRA 4B6OA 3DLCA 3VKGA 1F6BA 1F06A 3H99A 1B23P 1FLDA 4UM8B 1G9TA 1RIIA 1P72A 2O3SA 4QXOA 3K6SB 5LZ8A 3OKAA 1J9ZA 2LTAA 3S2UA 1R18A 2FSVC 4BNXA 4A6EA 2VBCA 1J00A 1RCFA 5CJ2A 3LJKA 3B1FA 3QRWA 3TTTA 4DXDA 1HLFA 4G36A 2CDNA 1YNSA 4HXFB 3I9JA 1VE6A 4PX5A 3ZEAA 4DC0A 2P4HX 1B1CA 2P3LA 3RRXA 2TMGA 2VRWA 3RHZA 3WSWA 1RXYA 3O2QB 1E4EA 2MYTA 3WGKA 2D1TA 3OD5A 1VG1A 5K8JB 2C7QA 2HA7A 4ZO8A 5DYIA 3I8SA 2ZAOA 5REQA 4EKNB 2V1XA 5BWNA 4QWWA 1SN7A 3N8HA 3QVTA 3EQZA 1ZRNA 2JFXA 4L7QA 1SOWA 4KFSA 4NS1A 3SJCA 4X63A 2NV0A 1DZ3A 4FZRA 1WOMA 3TQHA 3FN4A 3DFUA 3DOFA 2BMAA 3EZ9A 3Q8KA 2YWBA 1TFRA 1Z4MA 3VNRA 4RQUA 1KIFA 2X42A 1E6CA 1X7WA 3A6HA 3M6FA 1T1EA 2ZJOA 4Q3BA 4HYEA 5GOZA 2FFJA 2HT1A 1CLUA 2DUNA 3HXOA 3EYAA 5FUXA 1SBIA 4IKEA 2NXEA 1VG9B 2AEFA 2WUGA 2DWPA 4FZ5A 3IMFA 2OV3A 3L6EA 4MKRA 1MJGM 1DU4A 1L7AA 4N0PA 4KXQA 4AY6A 2P4UA 1OWMA 4HUQB 4P3NA 4Q3CA 2HOQA 1SBTA 3A9RA 3O1HB 1OPRA 4GUDA 5EKSA 2XE8A 3EOAI 4FLEA 3PQ5A 4ZEOA 4JV5B 1JI3A 2X5OA 1DG1G 5E6UA 2O7NA 4Z4CA 3L8ZA 3ZQKA 5LQAA 5BN3B 4OHWA 1NTRA 1C2TA 1UJ4A 4ZDIA 3DXXA 2B0JA 2ZYSA 4NU5A 1IEVA 2AIRA 3AERA 3ET4A 1CZUA 3PE6A 4YCNA 3F97A 3M9XA 2GQ0A 3SHQA 4JJGA 4G26A 4KQMA 3ONNA 4YUVA 1GPBA 3UKJA 1IVYA 1JLKA 3PYMA 5AUNB 1E2LA 1MGOA 3PFCA 1SD1A 3QU5A 3F3KA 1T4MA 3OE7D 2DSTA 1VB5A 4MWGA 4ZVSA 2QTCA 2PIAA 5H0IA 1WHTB 2O20A 2PV0A 2HM7A 4L5YA 4QULA 1RFLA 4XOIA 1WSDA 2IS2A 1S9DA 4U2FA 3W8FA 3HXKA 5TPWB 1A8HA 2VA8A 1EVKA 1I3NA 1T9CA 1ZCAA 3CONA 3MTBA 1QG2A 2JH8A 1ECLA 4H7HA 5CH3A 4BLWA 4NHEA 4DTCA 1XZAA 4K28A 4PEVA 1W5EA 4A6XA 1DCTA 2DJ5A 4GOND 3WLRA 1KK3A 4IIDA 2WAXA 1Y4AE 1B73A 1V3QE 4B6RA 3EBOA 3HBFA 3PNKA 1N9ZA 4NSNA 2AEEA 2YOFA 2CXRA 1UPAA 2CFCA 3N9IA 5CLLA 5CT4A 3RS4A 1H2HA 4TM7A 3WADA 1B26A 1X77A 1F4VA 3A4MA 1T9BA 3CX4A 4FFVA 1P7VA 5D51S 4D2IA 4XX0A 5DRTA 2MTBA 2PKCA 4HEQA 3O83A 1HF3A 1NSTA 1XZNA 2AR7A 1YK0A 4O2AA 4M60A 3UPDA 3DYIA 3SG0A 1T3SA 4IHAA 1KYZA 4TV8B 3VAYA 3HZZA 2VYCA 2Z4RA 3G3EA 2FWJA 4LDZA 3SX4A 3SLKA 1W1WA 1C4KA 1P39A 4U2CA 3WKAA 2AI2A 5DYWA 1O2DA 1X15A 2VDRB 3EHDA 3HNRA 2ANBA 3R5FA 2XD9A 2A92A 1Z74A 3RYCB 1HETA 3TBFA 2GK4A 2XDQA 1W35A 5D86A 5CCEA 5JROA 3KDAA 4RH1A 4E11A 4P34A 3LRPA 1H2BA 2I6QA 3S29A 4BNWA 1QQBA 2KS6A 3ME5A 2MDTA 1FTSA 1W0KA 3OIDA 4FYVA 4GKAA 4D4HA 4OF4A 2A7XA 1SVNA 2D2IA 1SNYA 3BMQA 3A1NA 3OC0A 1Z4QA 3C3BA 4LMAA 2RH4A 1V39A 4DUGD 4X65B 1II8A 2GFIA 2V97A 1V0JA 4FN5A 3DF7A 1JZTA 4J4BA 4CQLB 2Z1NA 1PGOA 3I9NA 3VYRB 1MA3A 3OKPA 4OXQA 4D9NA 6Q21A 5I3ZA 2XF2A 3U61B 1QIJA 2C2WA 2VXCA 5IWCA 1KZGB 3OOHA 5FTMA 3II6X 3A1EA 4C88A 3ILSA 4DA9A 4LVCA 4W1QA 2RIPA 1GR0A 1IATA 2W2PA 3NATA 1QGZA 2Q99A 5GZ1A 1ISSA 2CLOB 4HVAA 5A4KA 1Q0QA 4TL7A 3ZH2A 1GKKA 3M5CA 1JBQA 4C43A 5T4FA 3F6EX 3H9UA 2Y99A 1Z07A 3QA3E 1N7HA 1KY5A 4RF3A 5DLQC 2CLMB 1Q2XA 3R41A 4O6VA 4RHEA 3ZV3A 2CT8A 2WD8A 4H7FA 4IMRA 2G80A 2HK6A 3NVMB 3OZFA 4BIIA 2JDID 2ZUTA 1TYZA 4HAVA 4WACA 2PUDA 2O7SA 1JR3A 1Y8QB 2QDKA 2VN8A 3DUWA 3K20A 4K9DA 5DU2A 5BOVA 3S55A 1ZNXA 4EMTA 4ZRDA 3AL0C 1F1JA 1Q15A 3N0RA 3T35A 1BS9A 5ILOA 5HKKA 3UCXA 3WGMA 2PH5A 4CQMB 3BGOS 1Z6ZA 3LLMA 2GRUA 4DILA 5HK9A 3IHTA 4G5GA 5KNLA 1C3XA 4M46A 5EIWA 2VZ8A 3TLCA 3FYCA 1P2SA 1P3Y1 4UREA 1X7DA 1ZU4A 1QLWA 1G8SA 4KPGA 2HADA 4XD7D 1BW9B 4IJ5A 5A5DA 1VJTA 2HJWA 2CV2A 2ERCA 5CD9A 3C3YA 4G1BA 4P3KA 3C3JA 1QTRA 3N87A 5CYOA 2BPOA 3MPUA 5LP1A 3I37X 1ZVJA 4XPIB 4YXWA 4CW7A 1JIUA 1H3NA 3R7WB 2QROA 1L3IA 1N9KA 1LH0A 4ND7A 4XYLA 2NNLD 5DYTA 5AUPB 5CDFE 1U0RA 5I9LA 4PAOA 3VX3A 2IODA 1UPCA 4A8JC 1YMVA 3E4DA 1JR3E 4BUCA 4C03A 2YMPA 1K06A 4S3MA 4RK4A 5I9TA 1LQUA 3M7IA 5DSZA 1ACJA 4M9SA 1EB8A 3MGBA 3P9IA 1YSCA 1Z7BA 4OL9A 1ODSA 3T52A 4M21A 4I14A 4MVJH 4XR9A 1BWPA 4HB0A 1DIAA 1JQDA 2WF5A 1QLHA 5DGTA 2YZNA 1OZ0A 9ABPA 1ZH4A 3H4TA 2FG6C 3K15A 4O02B 4OGGA 4UMVA 4IYJA 2KX7A 2H17A 4JLAA 4MO9A 5E3JA 6CHYA 2EKZA 1Q1EA 1ZH8A 1XLUA 3OCZA 4RGBA 4J4HA 1N5DA 4KQCA 1O03A 1HI9A 1U5AA 3JZIA 4RJTA 3O5AA 3R20A 3ZHYA 3L5KA 3B60A 2ZB3A 2OHFA 1YTLA 5KI6A 3DMHA 2Z43A 4AC9A 4AAYA 1RAEA 4FYPA 2VQ6A 2JGEA 3SN6A 2GCPA 3BGDA 4BCCA 4YV7A 2IOQA 1U1FA 3LYLA 4GQIA 4R5MA 3VXKA 1ATIA 3EFOA 2OCXA 4Y98A 4N5IX 2QZ4A 3JQBA 1Z2AA 2P0YA 5EUMA 3HKBB 1NVGA 4IFBA 4DV4B 2G0NA 2E4WA 1SK8A 3ECAA 5EUQB 4ZJYA 1N3YA 1NRIA 5TPZD 1Z8HA 2EBWA 3CRVA 1UWLA 2YVQA 1ZM3A 2Q45A 2C04A 4RV4A 4JBIA 1P5JA 1G2IA 3TPZA 1J5EB 2XODA 4IOKA 1KI8A 3QOYA 1KARA 2IOFK 2Z04A 4O08A 1HNXB 1UP6A 3EVFA 3U4MA 1H23A 2WWWA 1I24A 4N18A 2ZI6A 2QHXA 4RETA 2FMUA 2Z08A 4JMLA 4OQXA 3EZLA 2VNSA 3PCXA 1Z4PX 3VMFA 1Y9JA 2YMMA 1JALA 3K1YA 3T1NA 2HSDA 3ICPA 1U7ZA 2DFDA 4REQA 5DF1A 2I6SA 1Y4ZA 4Q6BA 2BKLA 2A5JA 3H19A 1VHJA 2E3JA 4UUNA 3ZCPA 2R60A 1NF3A 1NW5A 2BT4A 3EGXA 3QELB 5KVCA 2AZTA 4I4IA 1Z06A 2XB8A 1T0PA 2LRHA 5DOVA 1ZP6A 1MKYA 1EA5A 1IZ0A 1QFYA 1AXEA 1U3GA 5GV8A 3SMQA 3ADCA 4DEYA 2F1OA 4D5GA 2D6FA 1WDLA 4WKOA 4C4TA 4XCXA 2G77B 4NEQA 4Y6GB 3RARA 1R0RE 4FXOA 2O52A 1DIRA 1LK5A 1YHYA 3RYHB 4DM3A 2OQVA 1R0CA 1NSFA 3RRNA 3ZI4A 4E5MA 5IUNC 5AJVB 5DTEA 5HJ2A 2WMOB 4UMEA 2UKDA 3DPIA 3KOYA 4LI0A 4G5QA 4P7GA 2FLVA 3GAFA 3FKSD 3N2NA 4RTLA 3IESA 4PCLA 2HCFA 4EF5A 1CG6A 2VDOB 3C16C 1G5IA 4R01A 2B6NA 2P2YA 2C0PA 2LDXA 3LI2A 3OZTA 2MHCA 1VL2A 3FUWA 1IG3A 1TLFA 3EGVA 4NOKA 3DE7X 3PNQA 2QZ9A 3GRRA 4RM3A 3FCXA 1RJ9B 1DSSG 2HV9A 1SBNE 2K7FA 2GEUA 3A4LA 4DMRA 5KVSA 3GRCA 2HA4A 4MW0A 5LJIA 1ADGA 2ODEA 3IAM6 3U16A 2IHNA 1EINA 2A33A 4IIEA 4WZZA 1WX1A 1ECJA 1M8PA 4F38A 8LDHA 1NVAA 1Y9ZA 1WMDA 3OAAD 2JFUA 2J0QA 2JKVA 3G6WA 1Z6XA 4TL6A 1QGUB 4OLJA 2ZRFA 2RCNA 4JMPA 5A3QA 3B7WA 2Y2VA 2O0MA 3ORQA 4S0XA 2BFEB 4R1UA 1QC5B 1VC2A 3EZGA 1S8AA 1BCRA 4GR5A 4PLFA 1U0EA 5JJBA 2ATVA 5T57A 4XGIA 4ALLA 2XE6A 2JGDA 3KK0A 4AU1A 4K0KB 1XIVA 3LSYA 5LQJA 4HMPA 3W8DA 1JEOA 4CV3A 2WSSD 4HAOA 3UA3A 4A10A 2VKTA 5L3RA 1SIBE 1MX9A 3R0IA 4ZYVA 1FP2A 4KIJA 2FFHA 1K4YA 3TQIA 2HU8A 4N7RA 2HXYA 3LAWA 1CUCA 1KRXA 1X39A 2F6RA 2YWFA 1SVIA 1X74A 3CNNA 3C5EA 2H2WA 2AR9A 2BD0A 1F0PA 2YVAA 3BSWA 1RWWA 4DG9A 1AH2A 4YRNA 1G5PA 4F5EA 3H9CA 3M81A 2H51A 3FI9A 4ZAWA 2BM0A 4CKWA 1VG0B 4G23A 1CZKA 1Z3IX 4OCZA 3QMPA 1EHCA 1ZIPA 4M1QA 1L8XA 1WXWA 3OWOA 4NCJA 4TOIA 3RQSA 5LWQA 2UXCB 4DJJA 4EB8A 5HIAA 2OD7A 2QI9C 3JQ9C 2Z95A 1Z12A 2V4MA 3T9BA 1OH7A 2JANA 5HUHA 3N7UA 3X1KA 2OCBA 2R2AA 3IE1A 1DAHA 3L18A 4MPDA 3WMRA 2WV9A 1A7KA 3E3MA 4N0DA 3U40A 5A3JA 2HA5A 3EXIA 1BN7A 1BMFD 2NW6A 4MR8A 2UUAB 1MPXA 1QGYA 5IN5A 3AF1A 3LKDA 5BR4A 1C3JA 1EE9A 3CRZA 4O8CA 4NAUA 3GT4A 4ZCLA 2R62A 4F5YA 1BXGA 1WW3A 2I8LA 4Q7KA 3AHGA 4CF5A 4BQSA 2ADFA 3ZS8A 4L5AA 4M9RA 4V1CB 1II9A 5GJBA 1TQ8A 3NR2A 3PJRA 5BSGA 1EK0A 1WVGA 4YA6A 2DPMA 3NHMA 1CVIA 2O57A 2WIFA 2XNJA 3CF4A 2DFLA 3IE0A 5TR9A 4Q1CA 3G2QA 1USGA 1LS6A 1M5TA 2J07A 1XQ9A 3BMCB 3WZMA 1P1RA 1RACA 2ES4A 2GKSA 4PO8A 1QH8B 4R31A 5E2AA 3SVLA 1Q7CA 4MGEA 4EH1A 2R6AA 4F1KA 5F33A 2Q1UA 1G41A 2H1LA 2P9YA 1FP4B 4P7JA 2UUBB 1YHNA 2PMFA 4E1VA 4F3CA 1RJFA 1WHSA 3EVBA 2P0AA 4N9QA 1DQPA 1AURA 4YLGA 5GM1A 2XUPA 4IIHA 3EQ8A 3H17A 3HB9A 4UM5A 2O48X 2RAFA 1P74A 5SYAA 1LLDA 4KPFC 4ARBA 1Y4UA 2NTEA 1XNHA 1NYQA 2PG3A 2RGDA 3KHTA 1P0MA 1T36B 3QFFA 5CLJA 3ZWNA 1ZONA 4BNUA 4MEJA 3IAEA 4JP5A 2XCOA 3I0ZA 5GJCA 1KXJA 5HCUA 4E13A 4JXXA 3GFBA 1CEYA 1TK9A 4XKJA 4UFOA 2QY6A 3OIVA 1T9GR 3EEQA 8ATCA 4FD3A 2C5AA 3WA7A 3IQGX 3VDXA 3CLTD 5C53B 1ACMA 3UHFA 3VU3A 1E6WA 5C9ZA 2VXYA 3QKUA 1ODCA 4UTPA 1I1NA 4QHTA 3U4AA 4EFDA 1IXYA 5K0SA 4F2GA 1Y1RA 3VKFA 5A05A 5KYYA 1TT5B 2AEMA 3NFYA 3G0BA 3L77A 1JIVA 4UM7A 4YALA 2JAPA 4OI0A 1QU3A 3MAAC 2V03A 3R5HA 4A6PA 1FXUA 1N5LA 2YJGA 2NU8B 1R9MA 2ATXA 4YO8A 2E5FA 1Z0DA 2BBOA 1RM0A 3ASVA 2PEYA 3NJ8A 4IR7A 3K6JA 2ZWVA 4O4IA 1GUAA 3OTHA 2NU7A 1G5TA 1U7TA 1I1HA 2QQFA 1TF2A 2W8ZA 3QXCA 4RKWA 3RE1A 3ROXA 5EIXA 2ZQ5A 1M1NB 3EF0A 1KQGA 3H5AA 2WTEA 2MSEB 4LDNA 3DMYA 3TQCA 4CU2A 1H9CA 4XIIA 1AQLA 1XVIA 2W22A 2R6FA 4OBBA 1BFUA 2FRVA 2JBHA 2LXNA 3ZWVA 1JDZA 2NZUG 4N5HX 4CU5A 4R7TA 1PS8A 3DULA 3WLOA 3AL2A 1MN6A 1X0VA 2Y67A 3B36A 3E9NA 4OQPA 3UXEA 5EL0A 1NN5A 2N75A 1C9YA 1SURA 2HBZA 2BFOA 4PZPA 2RAUA 2G1PA 3F2IA 2BSAA 3BXOA 2YS7A 1I33A 4CRWB 4J91A 4EG3A 2V7VA 5K03A 2QAIA 1EDOA 3DV2A 4ARAA 2FRDA 2EU8A 3H2GA 4FKBA 5IULC 3E3AA 1MB3A 1Y4DE 1MD9A 2VJOA 5DM1A 1B3BA 2H52A 5EWJA 3LKZA 5AXAA 2HJGA 1QMGA 3I3SR 5CW2A 1I4LD 5DT2A 1MPTA 3PJEA 1VKZA 2BGMA 1T5IA 3K53A 4OXKA 3EPPA 1IQPA 3PC4A 3HR7A 2D62A 1DJOA 2INGX 2OO5C 1SCUA 1ISRA 3F6BX 1ZQ1A 2WJWA 4HTFA 1P9NA 2J48A 5BR7A 3U3XA 3HFRA 3VC7A 4LPSA 3KE8A 4E3ZA 4MKGA 4G0VA 1CUWA 3IH5A 3MLBA 1VG8A 3CCFA 2L18A 4TSRA 4BJ6A 1UXIA 4KZKA 4D3ZA 3WWYA 4JYZA 4EUHA 1ZD5A 2XNDA 4LV8B 4P86A 2C0QA 3TMKA 1AUVA 1GN9A 3FTDA 3MF4A 3WRXA 1CPYA 1XDSA 2IYXA 1C41A 4FT4A 5CGZA 6GPBA 3P2JA 3K4QA 1DUIA 2AL7A 2AOUB 2PH1A 1YXMA 2RGGA 5EQDA 2IWHA 2FSVA 2XTMA 4L5JA 4M6WA 4OG2A 2I3DA 5CM2Z 1R5BA 1U5BB 2R6ZA 1HY3A 3TR6A 3W2GA 1V8BA 4B3TB 4LC1A 3ONWA 3RVRA 2HYIC 4DM4A 1QCZA 3M6XA 4QU5A 4RFSB 3NLLA 3OSZA 3EEOA 3A6DA 2REBA 1CETA 1EYZA 2O2CA 2QTAA 4QA9A 1OFHA 1GPMA 4FHCA 2EQBA 2VDUE 4XVHA 5GONB 1YZFA 4DABA 4CTMA 2IPOA 4M7WA 1V25A 4X97A 5IF3A 1UXOA 4AWAA 3CWCA 2VHJA 2F8LA 1VPLA 5BWLA 1K5PA 5JPCA 3MCWA 5JEDA 2R25B 3MRXA 1X2BA 4B4VA 5CPBA 3T1TA 1RP7A 3V4RA 4CM4B 4FEYA 1GUDA 3Q7QA 2QPLA 1H9AA 4UW9A 4L72A 1N2XA 4ZARA 1LRJA 2C2KA 2CZGA 1U80A 1COWA 2WPDD 2YZKA 2ZWOA 4U3JB 3WNBA 4TSKA 2QENA 4EUEA 4C22A 2R2GA 3KQNA 3BGWA 4A03A 1VA4A 4PXSA 2QE6A 1KPIA 3P5SA 1WE2A 4I55F 5ICFA 2ZRLA 3QKRA 3R09A 2ZJFA 1UDXA 3RBZA 4CL8A 3D8UA 4I4TF 4MCAA 5ALZA 1QRAA 1RI1A 4MS4A 4ZVTA 3SR0A 4C0HA 5I4KA 1Z8DA 2CE7A 2DU8A 2Z4SA 4WHMA 1KKUA 3FDXA 3RJ5A 1JDSA 1Q3HA 2AMYA 2X19A 4IEEA 3TIIA 1S02A 2NYVA 1HPLA 2EZ8A 4FM9A 1PSZA 1DZIA 3V97A 3KYDB 4OY3A 1G98A 3VBEA 4XM0A 1R9GA 5HFNA 3FAKA 3VR5A 1EFAA 2PWZA 4MWBA 4KDCA 1JYSA 1T2UA 3LX8A 4NPCA 4TXHA 4BX9A 4CHTA 1N34B 2CDBA 5JNWA 4F4IA 3KUKA 3GX1A 5IT9A 4UOEA 4BHTA 3BIWA 4L02A 1L7QA 1AMOA 3P9CA 1JL3A 4MQEB 5BQXA 5I7WA 4PICA 2NMVA 3DL4A 3INGA 2MR6A 2W7TA 3BB1A 1L8LA 3JPYA 4Z3DA 1SUSA 1XXLA 3F6YA 4KTVE 1DQRA 4LXXA 3F96A 1BXKA 1T4CA 3BIOA 2ACVA 1G6Q1 2G4CA 3HBNA 2WU4A 1RQ2A 2IYYA 5M2QA 2WWYA 3GFTA 3ITKA 3C39A 2V6JA 3A06A 1U8FO 3CCCA 5JCJD 3NHSA 5L95A 4OK5A 4ZT5A 1S96A 2R7LA 4Z0TA 4NOJA 5DTQA 8OHMA 5DYNA 1PQUA 3AP1A 3CUEF 4QYXA 4WCFA 4X6UA 3FNEA 4CYMA 3PR3A 4XQGA 3SMVA 5E6SB 1LLFA 2QQ0A 3PEVA 2EJBA 3SGLA 1K7CA 3ZS9A 3O74A 1AKEA 2WD9A 2O2IA 5G1PA 2AYXA 1DRVA 1ZCJA 2CUZA 1YRAA 3QYFA 4HLCA 4Q9HA 1DCKA 2D0OB 4HUJA 1YRQA 4YEDA 5L40A 3IUMA 4IDHA 3KZ1E 4FCVA 2QTGA 4TRRA 5EMHA 3E8MA 2O2YA 2IU4A 4GMHA 4IHJA 3QEJA 2PD6A 5LC1A 3RRYA 5B7GA 3D3WB 1KZ9A 1X19A 1ZN7A 3DF9A 4KMMA 5IT4A 3E35A 4RMNA 2CFTA 5D2CA 3K09A 4ZEMA 1AQIA 1FYXA 1T2DA 4DUZB 1W1IA 2BE9A 3DV9A 5A9TA 1QHXA 4AYWA 4YH1A 1M54A 1KJYA 1SUPA 3FDIA 2GPAA 1ZM4A 2B37A 1V5GA 4DCVA 4JR2A 5AUQA 2NSHA 4Q37A 5KOJA 2HWWA 3RSZA 3AK4A 3KKPA 4P81A 5FNVA 2ZJ0A 4G86A 4QOEA 4U5XA 1KEEB 2QL9A 4JLWA 4JUFA 2FW8A 1QIDA 1HEUA 3KUDA 2ZJ6A 3BSFA 3PQ7A 4X8OA 5DYYA 3FB1A 4MK4A 5CA0F 2W8BB 5P8WA 1L7VC 2FOIA 5IZ4A 2P6MA 1HV8A 4JHLA 5L3SA 1Q95A 3K0SA 4PNZA 3QWHA 3ICEA 3U5ZB 4B34A 3R76A 4QTYA 4KN9S 4XVCA 2C8LA 3ITNA 3B9RA 2X0NA 4MZDA 1OI4A 2QL7A 3T5BA 2L0XA 4PG6A 4B7ZA 1QFJA 4HGRA 4M76B 2GA9A 1NJFA 1RWNA 2HF9A 3EODA 2DETA 2KLHA 3JZMA 2IV7A 3JRNA 5DHFA 1HWYA 2BY4A 3WYGA 4AWBA 4N41A 4Z9BA 1JG4A 1N2GA 3KS9A 3N7TA 5SY6A 3KKOA 4G84A 1MO6A 1XMIA 5FWXA 4GKKB 4MV7A 2RI1A 3QXSA 3RTAA 2I3AA 1WZNA 4KQ6A 4HN4B 1AMUA 3PUKA 5BT9A 1ZOOA 3PUJA 1QFXA 4X3PA 3RFCA 5IAOA 3I6BA 2WIAA 5DZSA 1LNQA 1A9QA 4QXQA 3PX2A 5LA6B 2IQIA 5ICSA 4RIIA 5F4ZA 1G2PA 1DV2A 4WD3A 2IXDA 3S6JA 4A0FA 1TAGA 4PZEA 3M5WA 5JMWA 4CKCA 1BJRE 1ML3A 1TTPB 3KXKA 4EUKA 3DL2A 1V71A 5A7GA 2D2EA 2CC2A 2PUWA 1T8RA 5AKZA 2IH4A 3K0EA 3LG2A 4TKVB 3UBTA 3AVWA 4JI5B 4M89A 5AKHA 5G4KB 1E1NA 1BFDA 4FFWA 2P4SA 3AINA 3H2YA 3LP5A 4BC0A 1NN0A 3KD3A 3TXYA 2FY8A 4WJZA 2DCUA 2TMDA 1T35A 5DCUA 3ANXA 4AULA 3WL5A 4DM7A 3D3KA 4LISA 1B8NA 3K1AA 4FHZA 3O8NA 1W0KD 3H6HA 1UQUA 2QN2A 5UKDA 1AKQA 1VLVA 4R1TA 1YVEI 4URYR 5HBRA 3RCBA 3DTNA 1CUVA 3FBGA 1IEWA 5KYWB 2I99A 2PGIA 2G5PA 2C9MA 2YV1A 3RHSA 3JARA 1DXHA 4C89A 3I9KA 1ZGAA 2DY0A 4YRJA 5KJFA 1A2BA 1AK1A 1TJYA 2XRYA 2UZ1B 4DLWA 3RBAA 3IR7A 3GRPA 4H1HA 2C88A 3SYKA 4DSZA 2SHKA 4L4XA 2OHXA 1YAJA 2OV8A 1UDWA 2DULA 1OLUA 3KYBA 2P67A 4PF1A 2YR0A 1BA2A 2HU5A 5LL6P 5CAEA 2EW1A 3RSCA 2LE0A 1TYAE 1XHEA 5DO9A 2D1YA 3WBJA 5A5GA 2J9FA 2WJAA 4H31A 1WSAA 3LXUX 2Q8PA 4GGMX 3PXBA 4GFDA 1O5IA 4GM0A 2JFVA 1HMPA 5F21A 5AVOA 3VR4A 4BQIA 3V00A 4CL2A 5JW6A 2OHJA 1UP7A 1L4MA 2IV3A 4P54A 4DFDA 3ZXYA 3OPNA 3QVGA 2ZRAA 1R6BX 3U3DA 1FDIA 2E55A 2BFMA 1RLOA 3AJ8A 3AI2A 1LBQA 5JSHA 1ZJ5A 3MD0A 3N0WA 3QPVA 5DNEA 5AVRA 3U6KA 1JR3D 3R7BA 2AS0A 3ER9A 1Z2OX 3B3GA 3K70B 1PFVA 2BDTA 5FFFA 3D6TB 1MW9X 3H1TA 2P1ZA 4HG2A 2XVYA 1CR0A 2HQ1A 5HKKD 4JJ8A 1OILA 4XJTA 3HDTA 1T1IA 3P5BA 1ZCFA 1E9CA 5H1YA 1EVJA 2G6BA 4BMYA 1U31A 1WMBA 1C3VA 3DUFB 4ZIRB 3V7YA 1IXZA 2VJMA 1E0KA 3DDCA 1VHWA 4CR8A 1OBOA 1UJ2A 5F76A 3RUDA 1XTKA 5DP2A 4ERXA 1JDBC 3HBLA 4XB1A 5FTKA 2OLEA 1IBCA 3KC2A 2BGTA 3GRVA 2HPVA 1IZYA 4HGNA 4IBOA 4EHNA 1QNLA 5HJEA 4RELA 3OEHA 4OV6B 5DI3A 5CX1B 1KETA 2QLJA 1GGNA 2ZIFA 3T0IA 3VH4A 3IBFA 3AIKA 3GLUA 3PTZA 3G23A 4J0DA 4DMCA 3AGQA 3DFIA 3KJNA 1BRTA 1N6IA 4U7TB 1B8OA 4DA0A 1N1MA 1P6XA 3E9MA 5LXTA 2C7GA 5FDFA 1CVLA 1SCQA 3QBDA 1N36B 3FGPA 3K92A 3GPIA 2D2FA 4PWZA 1WUTA 4JI8B 1P1FA 3ZNPA 1QORA 3PYLA 3G7SA 2WQZA 5AJUA 2A86A 4LVUA 2QMEA 1WKVA 2R1UA 1Z75A 4WXYB 5G0UA 2JD0A 4GU5A 2D5IA 1NY6A 4OXNA 3RYFB 3TUIC 5JNSA 4MB2A 5KQPA 3UFBA 3N2ZB 4JJ6A 2X77A 3H8SA 1TECE 1R3UA 4GPBA 4LRWA 1SXPA 1G4UR 2ZRDA 3INRA 3SXUA 5CYGA 2FZ5A 5LWHA 3F78A 5AW5A 3INYA 2QNIA 5KPJA 3IPRA 1D5WA 5HG0A 1AB6A 2GAAA 5CBKA 4QT4A 4IWXA 1PV2A 2GAIA 1L7XA 1FJXA 3EXEB 4R2MA 5B1EA 3EF1A 2EIXA 2GLXA 4N54A 4ECAA 2XD4A 3UY4A 2ZFUA 4GP9A 1R0XA 1Z5PA 3UANA 1U3VA 3WRYC 2B8WA 2BMVA 1KY3A 2GAJA 5HQJA 3SEZA 3SP1A 4BIMA 3TF5A 3G0DA 4Y3UA 1PJ8A 3IEPA 2FSHA 3ZQ6A 4NJMB 3H1AA 5FB3A 1YQGA 3GCWA 1D8TA 5FUBA 3BFKA 1CY2A 2D7CA 3KYCA 1B15A 3UAWA 1E3QA 4JC5A 1I2DA 3A4NA 5C8ZA 2HLPA 4JNKA 4PO9A 4KITB 1FUIA 3DM5A 1PN3A 3AHCA 2O4UX 3A25A 3B52X 3NHWA 2MT9A 2OSBA 3OIUA 3L9WA 3T1QA 2DR2A 1X94A 1I36A 1Y1QA 3CMCO 2O2EA 1J2TA 1XCOA 2OCIA 4EUNA 5K0JA 4WFJA 1VLHA 3EWNA 2HRQA 3W9YA 2OQRA 2PR7A 3WY9A 2GPWA 4P4SA 4I8DA 3SJ7A 2QP4A 2PUFA 4IX1A 2YDYA 1EG2A 1WCIB 3MJRA 3P71T 1VLQA 1TVKA 2JLRA 3I9V1 4CGYA 1UZUA 2IY7A 3FX2A 2DFPA 2COKA 3BXHA 4IRMA 1IY9A 4S24A 1DE0A 1NNUA 5HOQA 2CVPA 2A8YA 2R7AA 1VFPA 3MJEA 3WMGA 1OWOA 1YZGA 3ENQA 4C3UA 3CH5A 3AF5A 4AM8A 1VP3A 4GOOD 2JD1A 3WX0A 2ZIEA 1JEYA 4QHYA 3UWDA 4XWYA 4TMKA 1ZNZA 1Q1BA 1TK3A 2GNPA 4TTQA 3L7KA 4ZV4A 3KQQA 3F6SA 5JISA 1YACA 3HCPA 5ER9A 5F3WB 2E89A 4GGOA 5CDHA 2VHCA 1KSFX 4XYEA 4C08A 1DIBA 1IUOA 2PJUA 5HKLA 4CIXA 1JNYA 2GYVA 4PINA 1XCJA 2WYVA 3U56A 2HJ9A 3DSRA 4I6EA 3OZEA 4M38A 2HWKA 2VPTA 3HZRA 3ZK7A 5KNCH 1PR0A 2ACWA 1NI4A 1TKAA 1XDGA 3R40A 5KTMA 3CNHA 2XCIA 4I6GA 2Z5VA 1J2RA 1K88A 4XDHA 5HK8A 4D3FA 1XB2A 4OL0A 4BLRA 4CI0B 3AETA 2Y1OA 1NVBA 4QWMA 5AICA 1Z82A 2Z30A 4XUGB 4IDFA 2BGJA 1R27A 4EKDA 2J3MA 3TKAA 1LA2A 4B3DA 1FFYA 1KJIA 1YL6A 1MO3A 1I80A 1NC1A 1OXMA 1TEHA 1SO8A 2VHQA 6REQA 4OB6A 2P5TB 3GOHA 4YS6A 3WLSA 3PI7A 1KP9A 3IUQA 5FTNA 1Z2CA 1Q0LA 1EXVA 1HKHA 4IJ6A 3T95A 1ISGA 3HACA 3I3OA 5LPNA 1YCHA 4PX9A 2L69A 5K3CA 2FPPB 3CN9A 4JVSB 3H2IA 3CPJB 2P77A 1WQ1R 1QG4A 1PZFA 1ZO8A 2BUCA 3B6MA 2H9YA 2VF5X 1NPTO