2CLDX

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gdp (2)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
166
structure length
163
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nucleotide-binding protein
molecule keywords GTPASE HRAS
total genus 64
structure length 163
sequence length 166
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cldX00
4HEJA 2IHYA 3NG1A 3FDIA 1R4AA 2FF7A 4NYIQ 3SJBA 4C2TA 4PAQA 4PR0A 1LF5A 3D6TB 4LBWA 4BE7B 4DLRA 2QMEA 5DGXA 2J46A 2ZQ5A 1NG9A 1DAEA 4RFSA 1ANKA 1OE0A 1FOEB 2I4IA 2ZUBA 2PEYA 3RC3A 4A2QA 4NH0A 4EQ6B 2GZHA 4GP6A 4URYR 4V0ME 2R6CA 5E7IA 3O8DA 3QSYA 3QPVA 4PPQA 4TYWA 3TUJC 1LB1B 4TYYA 3WYGA 3EA0A 2GESA 3OIYA 3OIVA 4O2LA 1UKZA 2BEJA 3PUZA 4LWZA 2A5GA 4QJ4A 5EE9A 5HCIA 3R7WA 1Q12A 2FSHA 4FMDF 2VA8A 2WWYA 1EESA 2GCOA 5HE9A 5KHOC 3AF3A 3BFVA 4RZ3A 1AGPA 1XPOA 2WOOA 3PEVA 5F2EA 3DM9B 4ARZA 1SGWA 2ZREA 1VDZA 1TL7C 4TLAA 3BB4A 3DL0A 1FX0B 2O8CB 3TKLA 4RD0A 3ASYA 3LRPA 4DDVA 3NWJA 5JWRA 1MT0A 3ZD7A 3GP8A 2ZSAA 2GRJA 1COWA 1GL7A 1US8A 2V3CC 3DKVA 2VH5R 4BLPA 2ZSDA 3QF4A 4EJSC 4IOJA 1G6HA 1TAGA 2FJUA 2WVJA 3CPJB 4IVRA 2D4HA 5FOTA 2JASA 2VIIA 1Z22A 3N2IA 1OXVA 2WIBA 3PVSA 3QKRB 3RRYA 3T1QA 5LDDC 4IRUB 5C18A 2D3WA 4C0BA 3SQWA 1B0UA 1K5GA 1KKMA 2ONKA 2ZXUA 1XXHB 4Q00A 5JHGB 1AN0A 1S8FA 1Z0JA 4RKFA 2YZ2A 1E79D 5J4KA 2ZVQX 4DLTA 3BBPA 2R9VA 5FOSA 2BMEA 2KWIA 4LZZA 4PZYA 4HAYA 1VCMA 2WM9B 2V1UA 1AIPA 1CJKC 5F98A 2BV3A 2WMOB 4MGZR 4TL8A 4PHTA 4N1AA 1Y63A 2C99A 2VEDA 5A4JA 4Z8XA 4OI2A 1TX4B 1E1QD 2JJ2A 4M1KA 3ZZ0A 5TMPA 3BFKA 1GFIA 2NTYC 3LBHA 4FWIB 2XNSA 3EC1A 2FFAA 2QUZA 3K0EA 4C2UA 4AYWA 1KNQA 2WWHA 4XH9B 2IS6A 2W2XA 2QMHA 4LV8B 2R6FA 2QP4A 2QPAA 1KSJA 4ITRC 1IY2A 3HPQA 3KKPA 1CEEA 2FFHA 3VKHA 1XTKA 2V6JA 1ZNXA 1VECA 3T34A 3K9GA 1XCMA 1YZKA 2YJTD 3Q72A 3M6AA 4PSVA 3CW2A 4HZUB 2CNWA 4PAOA 2H7VA 3QPUA 4A8JA 1JB1A 4A15A 4KVGA 2WBLC 4V0KA 3U7GA 3I73A 1YZLA 1G7RA 1KO1A 4X8HA 3OEEA 4AG5A 4X8MA 2GKSA 3UK6A 4NYJQ 1OHHA 1V5WA 2ERXA 4P4SB 1CXZA 2R65A 1U9IC 4BZPA 3V4RA 4JBYA 3FVQA 4XWAA 5M04A 1Z6XA 1BYIA 3AKDA 4Z8YA 1J70A 4IDPA 3H86A 2DFKB 1KI6B 5EP3A 3RRZA 3TAHA 4CDGA 4DSNA 1Z0KA 1W36D 1IQPA 1E2KA 1E9FA 3RRMA 4TSFA 3TMKA 2QSYA 1TF5A 1K5DA 3HWSA 3P27A 3KQLA 3ZVLA 4XTCS 2RCNA 4Q4AB 3O8CA 1VG8A 5AR1A 4CVNA 1D9ZA 2QNRA 1F2TA 1KI7A 4HB2A 1E0AA 3I3SR 4OI4A 1EFCA 1II8A 2J3EA 1NN3A 1E99A 2IL1A 3KFXA 4R2HA 4XD7A 2ZJBA 4US1R 3F3YA 4AYTA 2WSSD 2WJHA 4QG7A 3FPAA 4Z54A 1KI8A 4Q1DA 1FUKA 1KO5A 2A2ZA 1Z6YA 3AP3A 2LKDA 4LYHA 4A0HA 4II7A 1N2CE 3HR8A 4EDHA 4GI7A 2NMVA 3IKJA 1QHIA 3M4YA 3NTUA 1ZUHA 5JJKA 1NRJB 3CR7A 4I99A 3AVVA 2FPLA 2CXXA 2GZAA 4IHQA 2VYFA 3OFND 4MGIR 2WMNB 1VKJA 1N6RA 2HJVA 4BEJA 2BBTA 2RGCA 3PUYA 4RZ2A 4WZAE 2VO1A 3W6OA 2YNMA 3O47A 5TDHA 1Z8FA 3QBVA 3KQKA 3EWAA 3GPLA 1MABB 3QIAA 3HR7A 1UAAA 1T3HA 1M6NA 5JWHA 1J8YF 3WBJA 1G21E 4XSHA 3NHBA 3RHFA 3EASA 5FFMA 2HF9A 2I3BA 4RVCA 2Z0MA 2ZRGA 2Q3MA 1XU4A 3DZ8A 4MH0R 4Y0VA 4Q01A 3KKQA 4FWTA 4L4UA 1ZM4A 5IK2D 4E09A 4MRSA 2Z83A 3FWYA 1MRSA 4E5UA 2ZYUX 1J2JA 1R0YA 3BXZA 3O8BA 2B8TA 4XIGS 5FR2A 2ZR7A 1G291 1BH2A 2V8OA 1A2KC 3KTAA 4V0NA 5CJPA 2C78A 2R44A 4JLJA 2VF8A 2EFEB 4LOAA 4YQFA 5DLQC 1G5PA 1T8TA 3L0SA 5BN5A 2BJVA 3RNLA 2BJWA 4K81B 2XOKA 2Z5FA 1OLOA 1CJMA 2AL7A 3C5CA 4Y0AA 4TYQA 4BUJA 2DFNA 2ZJ8A 4R2IA 4AURA 4BFXA 4Q1BA 1YKSA 2CK3D 5J4VA 4B3CA 1R0XA 4GZMA 3B1VA 1HH4A 2P2LA 4QRHA 2NIPA 5IHPA 1AS2A 1YZGA 2OBLA 4LHZA 3R7WB 2FSFA 5AJWA 4HLQB 1OW3B 3M1IA 1KAGA 1MO3A 3FKSA 3B85A 2AK3A 1G18A 3PR1A 1VG0B 1Z0IA 5BYJA 1OFIA 3B7GA 3AP1A 4WXPA 3NBYC 1HT1E 4QGGA 5DN6A 4BZQA 2IS1A 1JALA 1Z0FA 3KQUA 1SKYE 2LWIA 4XSGA 4B73A 1W7AA 1GRQA 5E7JA 3EPJA 2G3YA 1H8HD 4O2RA 4B43A 1U0HC 4F4JA 3B9PA 1DADA 3AQ4A 5G3ZA 2F1RA 3VTKA 2PLFA 4B6FA 3QF4B 4MUAA 4LSGA 4LY6A 3L8ZA 3RSLA 4C7OA 4J0QA 3K0AB 4G5QA 2D7CA 5FOXA 2ZSFA 2HDNB 2XZOA 3P20A 5UKDA 1BOFA 1XXHA 4JKYA 3TW8B 4HUTA 1HV8A 2EFGA 4I4LA 1UFQA 5FPTA 4DCNA 4D4JA 3EIHA 2BBSA 2JATA 2X19A 2GJ8A 3GCGA 2JJ2D 4OHVA 3K70D 4M1MA 2JDIA 1G17A 3CLVA 3OHMA 2W0SA 3ADKA 1SXJD 3ADCA 2Y8EA 1TNDA 4B2IA 1RW4A 4C0KA 1U0LA 2QRNA 3GLHE 2WZQA 3LVRE 3X2SA 4EPVA 3ZS9A 2GZDA 5B64A 1KMQA 4NTZA 4O0MA 4FCWA 2O8DB 3LXXA 3LV8A 1G3UA 3GQBA 3R9WA 4OQLA 3ZVNA 2YOGA 3QOFA 3I1FA 1Z63A 2RKOA 5DYGA 2O0HA 3DO6A 4NYIR 3X1ZA 3QJYA 4M1WA 3RSOA 3IO5A 5L3SA 1X1SA 4PPFA 4QKQA 4IDQA 221PA 2HLDD 4XJXA 3T61A 2WSSA 1KI4A 1I4LD 1JXMA 3U3MA 1ZUNB 1KSGA 1E9BA 1TUIA 1Q20A 4LHVA 4JVNA 2REBA 3OEED 2GEDA 3MSXA 3I72A 3GJ7A 5BXQC 4WZBE 4TZ6A 5H68A 4OI1A 4D0NA 1NSTA 1SXJB 4DT1B 4UNNA 4TMXA 2O8BB 5DHFA 2GK7A 4IOLA 2EFCB 2NPFA 2V4ZA 1G7TA 3B1ZA 4W5HA 4M9XA 1L4UA 4IXMA 1CBUA 3TR0A 5TV2A 1FW6A 4DLVA 1OXTA 1ZC3A 2HLDA 2C2HA 1P9NA 2NG1A 5KPJA 1IN8A 4JBWA 1UF9A 1SVMA 1XPUA 4U5XA 2QL6A 4BLRA 4RD6A 1D5CA 1ZCAA 3RWMB 4X8OA 1FTSA 4QFMA 2IEZA 3OEHA 4MRVA 2F1HA 2JLVA 3IIMA 1HE8B 2QRZA 2IYZA 3ZLJA 3L43A 4IFEA 3FTQA 2DFTA 1JPNA 3NH9A 1U8ZA 4OQMA 1MH1A 4NCNA 5IK2A 1E0SA 4KYIB 1KK3A 1IAQA 1F2TB 2ZU6A 1ZC4A 5CYOA 1SQ5A 3A36A 3AF2A 1KK2A 2C04A 3LY5A 4A82A 2NO0A 3IDQA 1DS6A 5JEDA 2PJRA 2OFXA 3BIFA 2NO6A 2WOJA 4D81A 1XBTA 2ZE8A 3W3ZB 2HT1A 3GJ6A 5EP4A 1IXRC 1ZU4A 3L2OB 5G41A 3ECCA 4NDZA 5B58C 5L3SB 3C7KA 2WKRA 4C30A 1XEWX 2CJWA 3I92A 4M1SA 2AK2A 3THYA 3O8RA 2OM2A 3HPRA 2IUSA 1UBFA 4KI0A 1R8SA 1E79A 2OBNA 3Q9LA 2KE5A 5FBQB 3RVBA 4GZLA 2WICA 3Q3JB 1II8B 1E2EA 4B3DA 2YYZA 3A1UA 3I4LA 4Q19A 1KZGB 4WIAA 4B3FX 4IVPA 2CCJA 3GJ5A 2FDCA 2NZ8A 3MGCA 2Q9BA 2V54A 2J0QA 5TARA 1E9RA 5J47A 2FG5A 1Q3HA 3VKWA 3AM1A 3L8YA 3VR3A 1RE0A 2PZEA 2E9SA 2ZAOA 4LYJA 4BRUA 1E2PA 1M7GA 1NBME 3V4FA 3WHLA 3TVDA 4L9SA 1OFHA 1T91A 2AWNA 2GETA 3A1TA 1AQUA 4Q7KA 1LF0A 2PT7A 1NN5A 2DPXA 2GTPA 1H65A 1QHSA 3AKEA 2ODEA 3KTAB 721PA 1RC8A 1QVAA 2KB0A 4TL6A 2QGNA 1VCOA 1YVDA 1VHTA 5CK4A 5KSYA 2WHXA 1NF3A 1XEWY 5JRZA 2GAOA 3GJ0A 1FQKA 1US8B 3AVPA 1KO4A 3CF0A 3B82A 2GXUA 3PCRB 2CVHA 1R2QA 4B2PA 1KNXA 4Q1CA 3DMNA 4W9MC 3QKRA 2ZS7A 1QHYA 3I62A 1EWQA 1HUQA 3HP1A 2DBYA 3FMFA 4PC1A 4N0EA 4S2EA 1DAFA 1DPFA 5BYKA 4AG6A 5JBQA 3I32A 2L0XA 1NLYA 2DY1A 1TADA 4TN1A 3ZH9B 4DEYA 4ZI3A 1X8KA 4S35A 1H8EA 1DOAA 3DHWC 4CT4B 2OZEA 2GXSA 5G53C 2PZGA 2KI5A 4MRRA 3WMEA 4NMMA 2W2TA 3NBZC 3IBGA 2RB4A 4C4PA 2ZEJA 5EZ5A 1PJRA 1EG7A 5KDOA 2MMCA 5GJBA 2ZRJA 2J41A 3T06B 2PMKA 3AEZA 4XVUA 1VHLA 2ZE7A 3CPEA 1UKEA 3B8HA 1HQYE 1KOFA 3QXCA 3WRYC 4OL0A 5IT5A 4B35A 1NLZA 1T3SA 4DDTA 2OV2A 2IWRA 1RRGA 2XTZA 2ZUCA 2ZJ5A 4R98A 1C1YA 4QHSA 1VG1A 4JIMA 2MSEB 2OT3B 4N3NA 4EJSA 1VIYA 4NYMQ 3MWKA 4FMBB 3RS7A 2ODNA 3TSOA 1W0JA 1XMIA 3CKLA 1CR4A 2V9PA 4PO9A 4YXWA 3CRQA 2YWEA 5JHHB 3GJ3A 4DCTA 4JSTA 1FNNA 3T1TA 4HZIA 2EFDB 4JLNA 2VP5A 2WJGA 2ECKA 1GKYA 1VCNA 1DO2A 1EFUA 3X1XA 1CLUA 4U02A 4G5SA 4LJ6A 2ZRBA 4HB3A 4U7DA 5CJ2A 1ZJ6A 2C98A 1COWD 2D7DA 1W5SA 1XEFA 4IW3B 4B47A 1R8QA 1JJVA 4MDFA 3VAAA 2RGXA 4V0LA 2BKEA 3CB4A 4TQUS 3KB1A 2J7PD 2RAPA 1FFHA 1PLJA 1QBKC 3IBYA 3OF5A 1RRPA 2NOAA 4YDHB 5AUPB 2R6GA 1NN1A 1YZNA 1WRBA 3IIJA 4W7SA 2H5EA 2FE4A 5FPHA 4AIIA 3CONA 4PC6A 1AGRA 4TMKA 1R6BX 5GJVC 3VMFA 5CK5A 1Z0DA 1JAIA 3K0FB 3W5IA 5JMTA 5E3HA 1N0UA 2IS2A 2WWGA 4MYUA 3LDAA 2G1KA 1AK2A 1IBRA 2N1BA 4QBHA 1NL3A 3VKGA 2F55A 1GG2A 4PFSA 4YMWA 1W2HA 2VP6A 5ANRB 1NG1A 1Z6TA 3T1OA 5J4HA 5KYKA 2GBLA 2YVUA 2B6HA 4B3XA 1W4BA 3SU8A 4B3BA 1JNYA 3EAQA 4RJLA 5FUYA 4NL4H 3KKMA 2WIAA 5B57C 3L82B 1GIAA 1E2GA 4F7WA 3BS4A 1T9HA 4JMPA 1ESMA 4TMVA 4ZDWA 1KI9A 1KYIA 1N6LA 1FX0A 2XXAA 1BS1A 4MITA 2JLRA 2ZJ2A 5CIWA 5HPYB 1CJVC 2OEPA 2ORIA 4NKRA 3W8RA 5FTKA 3W3AA 2REOA 421PA 5K8LA 1XFAA 4MYTA 2A5JA 3PEUA 3UATA 1OXUA 2QN6A 4B75A 4O25A 2FEOA 4LC1A 3QG1A 1A7JA 1GVNB 2FGJA 1XD8A 3EX7C 2QM8A 1DARA 3W34A 3PEWA 2XNDD 3P1JA 1N6HA 1YJ5A 3TNFA 2F3RA 3ICQB 2W00A 2H92A 3DEFA 2CNWD 1ZMXA 3SJAA 3RWOA 1TU4A 1X8JA 2IC5A 2EYUA 3VHLB 5FUXA 3T35A 4ACBA 1Y3AA 1E1RD 1Z6GA 4F93B 5JS7A 1G3IA 3K0FA 3WP1B 4CEIA 2IUTA 1IN6A 5IRCD 1U99A 1Z29A 3EZ2A 3JZAA 2QQEA 3M0EA 3KXIA 1GUAA 4A0RA 3MUFA 4P33A 1SVWA 1GNQA 1NJFA 1R7RA 2FN4A 4DRZA 3TQFA 3SN6A 1G7CA 3ZJYA 1S3GA 2VL7A 2FX3A 3MJHA 2Z6VA 1Z08A 1CKEA 2FOLA 2RGNC 3C14C 3B6EA 4Q7MB 2ZM5A 2ZJYA 1OH7A 4TLEA 2GXAA 1FMJA 4D4KA 2ZRKA 1GRRA 3FE2A 5DE3A 1G19A 3LBNA 3TR5A 5JEEA 1PUJA 1GILA 5KNDA 4OQXA 1WA5A 3JVVA 2OCPA 1GSIA 2FEMA 5FOUA 3I5XA 1XD2A 3NXSA 3TUZC 2W6JA 1WF3A 2YV5A 5KOYA 3IQXA 4QL3A 3KJIA 2CEAA 1XTRA 1G4UR 2FSIA 2JCSA 3B78A 3TUIC 1AS3A 1IXSB 2UZIR 2VSFA 3U7EB 2B7CA 3K0AA 1DE0A 1IHUA 1NKTA 3PV0A 2ZI9A 2E87A 5ELXA 1OJLA 1CIPA 3OESA 4HLDA 4EAQA 5FI1B 4DSOA 4TWZA 3A4LA 5AJXA 2R8RA 2A30A 4QNRA 2R62A 2FWRA 4G5GA 4IDHA 1M34E 5EXSA 1E9DA 3TQCA 3UXMA 3UPUA 3IO3A 1TEVA 2SHKA 3F0TA 1NVXQ 2V7QA 5JFGA 4MRPA 2OG2A 3AP2A 3BRWD 3HYTA 1E96A 2GVZC 4UNQA 4F4IA 3RS3A 3R9XA 2F43A 3ZQ6A 1QF9A 1L2TA 2ZI3A 4F92B 2C9OA 3EPLA 1KSFX 4PO1A 2ODWA 2QU8A 3RANA 4AKEA 1ZM2A 2CE2X 3FHCB 1P2VA 4HB4A 1XXHE 4JVLA 2XZLA 3VQTA 4EQ6A 2ZU0C 1KDPA 1E0KA 5CB8A 1DELA 2OCAA 4R7ZA 4BLOA 1F5NA 1TU3A 3KUCA 1KTVA 1S3SA 4WZ6A 1AKYA 4BFWA 4Z51A 2GBLC 1Q21A 4RD4A 4LYAA 2FMXA 5BWMA 5K8IA 1P5ZB 2QTHA 1VPLA 3QUSA 4RY2A 4UXJA 4KO8A 5SZJA 4CRWB 2YWHA 4CEHA 4C0QC 3AF0A 1ZD9A 1NLFA 4JLBA 5CDFA 1OSNA 2WWXA 2GXQA 2RGEA 1LTQA 4HLUC 4BWYA 4DCVA 1A4RA 2J0SA 1XB2A 5CITA 2FNAA 2WWWA 4BFYA 5C2JB 5LD2B 1T4GA 2QPTA 4G01B 3WHKA 1G5TA 1MRNA 3QEJA 2EYQA 3ND8A 3MJRA 5G3YA 1L4YA 4A9AA 5F3WB 1N5KA 2A9KA 2XAUA 4G1UC 2F6RA 3U6BA 2J45A 4AYXA 3FMPB 3CRW1 2G88A 2OXCA 2XB2A 1PUIA 3GFOA 3NH6A 4GMDA 3EARA 5HCNA 4ESVA 2W2VA 5AJVB 2CLSA 2BVNA 2ZI6A 2BIFA 2CVFA 2IK8A 3N70A 3QEOA 4E22A 1LNZA 1KKLA 1OFTA 3GLIB 4NCJA 5GVSA 1KI3A 1II9A 3CRVA 1SKQA 2GCOB 1JR3A 1R0ZA 1EFRD 3K70B 4DXAA 1WB9A 1ODFA 2WAYA 2PLRA 2YC2C 3QXHA 4TT3D 1KI2A 1DAGA 1RPZA 4GDFA 1Z2CA 4KBFA 3AVUA 4KFSA 5JCPA 3A1WA 1ZNWA 1GDDA 1XP8A 3FYHA 3OIWA 3SYKA 1R0WA 4MKIA 1EFHA 5FI0B 3I8SA 2QE7D 4G5RA 1SVLA 1F48A 1LVGA 1PZNA 3NC1C 2ZITA 3VU9A 5EE3A 4FXPA 3W9YA 2QEQA 4HI0E 2K5UA 4B74A 4JL6A 1IN4A 3LH5A 1E1QA 1OIXA 5L3RA 2QAJA 2R6AA 5DSZA 2N42A 3SDZA 4RD2A 3TAUA 4KJZA 4OKSA 1MOZA 5EQTA 4AK9A 3GJ8A 3IHWA 4IXNA 1NIPA 1JXOA 1YZTA 1N6PA 2PZFA 5KNBA 2IX3A 1DBSA 4OK3A 1QHHB 2H8KA 2IXGA 4HB0A 2YC4C 1KY3A 2YKGA 3K9LA 4LJ5A 5AUOB 4TMZA 4Q4JB 4ZV4A 2AKAB 2Q6TA 3TSZA 3CX6A 1B23P 2J59A 4BLTA 2QPOA 2IA5A 2W0MA 3SS8A 2JGNA 2ORVA 1ZBDA 2W6JD 4DIEA 2ZYWX 5A0FA 4JVMA 2VHJA 4PO8A 1BKDR 2E1RA 4PQYA 2NO7A 4LHXA 3TH5A 4Q66C 2YWFA 3KDSE 1I2DA 1T6NA 4TTPA 3QI2A 1G3RA 5JECA 2A5DA 1Z06A 1E9CA 4FMCF 3GLFA 2DB3A 3KJEA 1S9HA 1UBCA 3PUWA 5H8WA 3EIEA 4BEBA 2ZUDA 4KXFB 2QT0A 1KK0A 1KHTA 2V7QD 3A1SA 5EXXA 2QENA 2IW3A 2QBYB 1RKBA 2GDJA 2UKDA 4W5JA 2J0UA 3RS2A 1SULA 3U7FB 4GBMA 3MMPA 1GKUB 1EX7A 2XXAB 4I1VA 2B8WA 1CR1A 1NVUQ 3A37A 4M9ZA 5EE1A 5D3QA 4XD7D 3QG5A 1E32A 2UVQA 3KZ1E 3THXA 1XD9A 3KL4A 1P61B 2BKUA 1T8UA 1XJCA 4JJKA 4PTLA 3NHAA 2EWVA 2VHCA 4L9WA 3CNLA 3U3OA 2F9MA 4WVFA 1P75A 1W0KD 4HDOB 1NY5A 1R5OA 4EFLA 1N6NA 2ZANA 3IEVA 1XTSA 2WJJA 2VF7A 2IYLD 2ZJOA 1HT2E 4QJ5A 4US2R 4Q4AA 3KXLA 5EE0A 3OEHD 2WWFA 5A5GA 2NPIA 4DLSA 3DKPA 3MRSA 5C4MA 4D82A 2PCLA 4MGYR 2DCUA 1Q22A 4DT1A 8OHMA 3H1TA 5K8UA 1A5TA 5SZHB 5FPSA 1SVSA 1Z3IX 1S96A 2AN9A 1NBMD 1GOTA 4Q9LA 2ZE5A 2QORA 2WKQA 3CX8A 1IY0A 2C5LA 4HSEA 3SFVA 3AH8A 1SVIA 4ABYA 4EFNA 1W0KA 4DEXA 2HYIC 5FH9A 2FA9A 1JAHA 2BMJA 2V55B 3GLHB 5E95A 1EFRA 3IHLA 1QHGA 2HCJB 4LPKA 5FBRB 1Q1ZA 1GKIA 4PHFA 3K0CA 1UBEA 2YOHA 4QC2A 1KK1A 2PH1A 4PX9A 3K70C 4DCUA 1IOZA 3A4MA 2O52A 3GMTA 2AD5A 2W6ID 1Z6AA 4US0R 4V03A 4D2IA 2F9LA 1O3YA 4DUGA 2EVWX 3SOPA 3THOA 2RGAA 5JI3E 3LNCA 3SJZA 3GLFE 1ZP6A 1ZM3A 1W48A 2CE7A 3C4JA 2OBMA 4CIDA 4PXAA 4NU0A 3WRXC 3BORA 1E2JA 3FMIA 1DAMA 1UBGA 2WWIA 1TQ6A 1W44A 3OE7A 3LFUA 1E98A 1Q1BA 2JJ8A 2NO1A 2QGZA 3AUXA 4K46A 2G77B 5AJYA 5AK0A 4R71A 2KJQA 4JT2A 5JRJA 1E69A 2H57A 3BH7A 1R10A 3CH4B 4LBVA 2CHQA 1SXJC 1QRAA 2DYKA 2O0JA 3C15C 1DTSA 4DB2A 3QXSA 3LLUA 1YZUA 2P3SA 5FUVA 1KJZA 1NN0A 1ZM9A 2RGBA 3B1XA 3GEEA 3FFAA 3OAAD 4RCZA 3BH6A 3NKVA 3WMGA 5BW8A 5CIQA 2R2AA 1LS6A 1KI1A 1CS4C 4KSCA 1NMXA 5EXPA 2QI9C 3B5JA 1YRAA 3SNHA 4ZKDA 1ZVQA 1Q57A 4UKDA 2XNDA 4ZI2A 2KBEA 5CYPA 3NDPA 5B30A 1NVVR 2WTUA 1X8LA 1T5IA 5GJCA 2C96A 2ZRNA 2Q3HA 4R9UC 3PUVA 1HEIA 1Q1EA 1ESNA 4C7OB 1FL9A 3RYTC 1M2OB 1W0JD 1E2NA 2VBCA 3QKUA 5D3MA 5J5CA 3KQNA 1G3QA 3WYAA 1MO6A 3AF1A 1DO0A 2VSXA 4KYUA 2AD1A 1M1YE 2PJZA 4RKEA 3G5UA 1AQYA 4KFUA 3REGA 5HR5A 5KUTA 1YU9A 1W49A 3REFA 1W47A 3TRFA 4DCSA 1PLLA 1SHZA 4M8NE 3UG6A 3ZQJA 3MFYA 2ZIAA 4OHYA 1RYFA 2QM7A 3P4XA 2OLJA 2JDID 3CWZA 4HLUA 4OHXA 4D25A 3AVWA 5FTNA 2DWOA 4IDNA 4Q1AA 2O8DA 1VIAA 4DIDA 2LCFA 1VYUA 1XNJA 121PA 1U0JA 4G0NA 4JZKA 1EGAA 2OUKA 3U4QB 3WNDA 3NDBB 4L16A 4POAA 4GRAA 1NJGA 1MKYA 2J0VA 4LJ8A 1ZW6A 2ZYVX 3PIRA 3PITA 1VG9B 1RRCA 1CJUC 2GAAA 3V9PA 2D06A 2VHUA 1N0WA 3GFPA 2EW1A 4F4CA 2GK6A 1ZINA 1OPXA 4QGHA 1YR8A 5HTKA 4F91B 3DMDA 1G8PA 1XMJA 3UG7A 4BFSA 4Q02A 5CM8B 3RLFA 5JWOA 1U90A 4A4DA 4JSYA 3IUYA 4KLNA 1G16A 4L8GA 3A4NA 3EPHA 3RABA 2BBOA 2JLSA 4NBSA 4D4MA 4ILEA 5GVRA 2OILA 2YOFA 3AUYA 1GL9B 1FZQA 2QROA 4MKGA 5DO9A 3TVTA 3KFVA 3LW8A 1E9AA 2HT6A 2PBRA 2BHRA 2HUPA 3KKNA 4RZXA 2FFBA 3LA6A 3E70C 2VP2A 3SEAA 2PL3A 1KGDA 4V02A 3D8BA 4M22A 3SC3A 5CLQA 2YINC 3HU1A 2X2FA 2X77A 2XOKD 2GVDC 3W8NA 4ZIRB 2FPMA 4URXR 3G82C 3OFNA 4M1YA 521PA 2AFHE 4Q1EA 2JLQA 4B32A 1P6XA 3NEJA 2IYYA 4C0HA 4PQRA 1UDWA 4M1OA 1MO5A 4JLAA 4LJ9A 3WNCA 4DUGD 4WA7A 4TTQA 1GL6A 2HXSA 2JIZD 3HU3A 1N6IA 2IYRA 1ELOA 4FMDB 4GP7A 2ZRMA 2OCBA 1HQCA 1MR3F 2AKYA 2GHIA 4CGZA 3I5YA 1L8QA 5FBVB 4MYCA 2ZS9A 4Q1FA 4LV5B 4QBIA 3FB4A 4OHZA 3UMRA 3U61B 3WYFA 3U3RA 1FTNA 4WBSA 1OYYA 3UKDA 3AKCA 5JZVA 5AWFC 3N5CA 2ZJZA 3TW4A 2G0TA 1NVWQ 3IGFA 1OKKA 4A6XA 1GNRA 4CW7A 3P26A 1QG4A 2DWQA 3KJHA 2ODBA 3PENA 3CF2A 4TYPA 1WBDA 2LKCA 6Q21A 1X1RA 1KZ7B 1SZPA 1C9KA 1NBMA 1NP6A 4LRWA 2BC9A 5DNYB 1HA3A 4X8LA 2JLYA 1WE2A 4RSGA 3U3KA 4DSTA 1I4TD 1HTWA 5HZKA 2WV9A 5GADl 1U9IA 4PSAA 1JR6A 3UIEA 1QHNA 3LBIA 2O8FB 1ZIOA 1XTQA 3C5HA 4DLWA 1NIJA 1KJWA 2ANBA 2VHQA 4N0DA 4DLYA 4P3YA 2QZ4A 5LB4A 4IVQA 4MDEA 1VYTA 4TLDA 1XCGB 1HE1C 4QHTA 1X3SA 1AZSC 3AVQA 3Q5DA 1EWRA 2Z4RA 3U44A 3IPXA 3B1WA 1OFUX 3QQ5A 3WXMA 2H1LA 1GZSA 2RHMA 1VYVA 4FMCB 1QG2A 1XX6A 4L15A 2Q21A 3LAWA 3AVTA 1E9SA 4HLCA 1NMZA 5IDVA 1ZD8A 2GILA 2EQBA 2PCJA 3CR8A 4XVRA 3LX8A 4DHEA 2JLZA 3CUEF 5BN3A 5KTYA 3IIKA 3TE6A 2IF0A 3GLHA 4I1OA 1XCPA 4EKDA 1F2UB 3CPHA 4HUQB 1R5BA 1U8AA 3D3QA 3L0IB 1IM2A 1ZNYA 2HJGA 2XITA 3X1WA 3SI7A 4IJMA 5AJZA 4TMTA 4ON9A 1G64A 4UJ5A 5L3QB 1E2HA 1YR9A 1W36B 1YE8A 3DOEA 3UWKA 1YHNA 2R6DA 4EIWA 2W83A 2W58A 3AKYA 1ZRHA 1SHKA 4P31A 3LVQE 2ONJA 2XJ9A 1F6BA 5HKKA 5F9HA 1IONA 1HURA 2Q9CA 3KX2A 4YMVA 4AKGA 1E4YA 1VCIA 2BBWA 2J7KA 2P6NA 3AGQA 4LHYA 2XJ4A 3L0OA 4OBEA 4V0OA 1PLKA 4MKFA 1N6KA 4Q9JA 4BGDA 3K09A 2O8FA 4KFRA 2IYWA 3SQXA 5LBIA 4NYJR 4AWXA 2RH5A 4EPYA 1RJ9A 4KLZA 4B48A 2IYTA 3EG5A 2J87A 4GOXA 3A58B 3TIFA 1KJYA 3BFXA 3CF6R 1UPTA 2G9NA 4YXWD 4LCBA 3U44B 4PHHA 3VFDA 2OAP1 2VPPA 3AVYA 4AKHA 2NO9A 3SJCA 4OJKA 3AB3A 4URVR 3VHXA 2P5SA 1EXMA 2Z4SA 4RZUA 3CH5A 4A2PA 1WQ1R 3DVLA 2AXNA 3MWJA 4URUR 3UMSA 1QZXA 3ZD6A 3ZIAD 5EZ6B 1CP2A 2GEVA 3HYRA 3ONWA 4I81A 4NCHA 3MAAC 2ZYTX 3H2YA 4NHOA 1XTIA 5CM9C 3T1VA 3VR2A 3NBXX 1KIMA 1Q44A 4DDWA 1IJEA 2A5YB 4M0LA 4Q7LA 4Q4HB 3S1AB 5AUNB 3WMFA 1OT3A 4EFMA 3QKTA 4UJ3A 4YMTA 1OKKD 1SKYB 3OIUA 2AX4A 3QF7A 2G6BA 4HDQB 4YC7A 4ZCIA 2OHFA 2VP0A 1CU1A 1HY3A 4QNMA 1NVVQ 2Q0HA 2DWPA 1LV7A 3B2EA 1YR7A 2X1VA 2ZETA 2CCKA 5BQ5A 4YMSA 1OV4A 3HDTA 3Q7PA 2BMFA 5JJIA 4B33A 2D2FA 2BM0A 3U60B 2REXB 4BFZA 3SBDA 3QXXA 2AHOA 5DYIA 1UADA 3BB3A 4M1TA 2ZI4A 2ZPTX 2ZRFA 3MWLA 5KDLA 1S2MA 5EUMA 1AA9A 4ZKEA 2G1JA 1CR0A 4K8OA 1UKYA 4MUBA 4H9GA 1UDXA 4NE2A 3VNUA 1NY6A 3TJZA 4FW9A 2CL6X 1JQLB 1O87A 2IYXA 4YLGA 3THWA 3FKSD 4YDSA 1TF2A 4JLKA 2FU5C 2ZRPA 1X6VA 4ASUD 4LUCA 1JR3D 2WPDA 2B7BA 4UQOA 1YQTA 5EP1A 4TQ9A 4TT3A 4ZCLA 4ZIRA 3EPKA 1QVRA 4PZLA 1BIFA 2O8EB 2P0EA 3NBFA 3U2QA 4QGFA 4H1UA 2WJIA 1ZCBA 3R8CA 2ZRLA 3X1DA 1ZAKA 2NZJA 2QP9X 4UXIA 4LYFA 1M7BA 1XRJA 4M53A 5EE5B 4LBYA 3D7MA 1VTKA 2DHRA 3W90A 1KO7A 3RS5A 4I1SA 4ACAA 3QPWA 1G9XA 1XMSA 1TMKA 2QP3A 4RFVA 3BGWA 2CL0X 2IXFA 5DIFA 3ZGXA 1FNMA 4PQFA 3PG5A 3SHWA 4B71A 5FOVA 4TYNA 2A3RA 2XTMA 2XSZD 2FZLA 4PZZA 1JJ7A 5KDDA 2FPKA 1FP6A 2OE2A 1SVKA 2B92A 4UNPA 1E1RA 2I1QA 2OO7A 4D4LA 4KHZA 4DBLC 4KODA 2GF9A 2KBFA 1GM5A 2QQ0A 2J5XA 3WBKA 3Q5EA 4EPTA 5HE8A 2BDTA 3EXAA 3MCAA 5IF9A 3B1YA 3RS0A 1XJQA 1E3MA 1E94E 5TVKA 5AUQA 1W4AA 3UANA 1PVOA 4TTRA 4B3GA 4NONA 2ZSBA 4BQSA 3BERA 4F38A 4A6PA 4GMXA 1TQ2A 4QHYA 3THWB 1CJTC 2IWHA 1QHHA 1UEIA 3ADDA 1N5JA 4RFSB 1D6JA 2QA5A 2GJAA 2WAXA 1G7SA 3CX7A 4DLZA 1XD2B 3EZ6A 1U81A 3GLGE 4QM7A 1MABA 2VQSA 4PC7A 2ZRCA 1CF4A 2OAQ1 3FFBA 2G83A 1Z47A 1E2MA 1P2UA 1RVDA 3U3JA 5BN4A 3GEIA 5DHAA 4M9SA 1G8YA 1A1VA 1EK0A 1ZIPA 4Q21A 1A2BA 2UZ3A 3K53A 3AVOA 4IEEA 621PA 2J1LA 3VX3A 3VR4A 2RHDA 1W5TA 3A1VA 3ETLA 2VHTA 3P4YA 4NYMR 1TTTA 3LQQA 2ZRDA 1SXJE 4LBZA 4ZDIA 5KNCA 1AKEA 1ETUA 2WJYA 4XWKA 2QBYA 2MMGA 1Q0UA 2IF2A 4JLVA 5JSZB 1QHXA 3GFTA 1N0VC 4E03A 1W1WA 4JVSB 2F3TA 3DM5A 3CM0A 3GLIE 4MRNA 1KDOA 2VP9A 1W4RA 4IFBA 1G1MA 1G4AE 1KY2A 1X86B 2OSBA 4NPHA 3U4QA 2IBMA 4MKHA 1CRPA 3P32A 3DPUA 1J90A 5EP2A 3VNVA 4HAZA 2CLCX 3FHTA 1FP7A 5FPKA 1P7CA 4FCVA 4JLOA 1XF9A 4Q7JB 3AV0B 5B2ZA 3MD0A 5LPNA 2C77A 3PEYA 3X1YA 5EXTA 2CJWB 2VTKA 1P9WA 1II0A 1DAHA 1AM4D 2FZ4A 2QMOA 1N25A 2BM1A 2WSMA 1JEDA 1GNPA 1S1CA 4A1FA 4FINA 2OFWA 2C9CA 4DVGA 2XGJA 1R5NA 4LK2A 1GP2A 4LX0A 3QKSB 4URZR 3Q8XB 4IOMA 1RZ3A 2XZPA 3H0KA 1G8GA 2EWWA 4FI3C 3K9NA 1Z07A 3QBTA 3K0SA 3T5DA 4GOKA 1G41A 2GNOA 4LI0A 3R9IA 5JI2E 3EZ9A 1MO4A 3JZMA 3BD9A 3OE7D 4CEHB 2WKPA 5FL7A 1MV5A 2FH5B 2QG6A 4W5WA 3GLGB 3LD9A 3VR5A 5DN6D 1NSFA 2OESA 3BWDD 1S1MA 3ZYCA 2D62A 4AC9A 2VLIA 1T0HB 2HF8A 4QXAA 4BECA 4A0GA 3QVVA 3MWYW 3NIBA 4GOJA 3J81k 4LJ4A 3G0HA 2ZVPX 4C0AC 3K09C 4ZO4A 4D0GA 3ZS8A 2OFOA 4Q9HA 4FCTA 2QT1A 2CBZA 1RYHA 5FL3A 4PC3A 3TSWA 2QE7A 4FIDA 2FGKA 1KMHB 3PUXA 3RC8A 3CRMA 2F1IA 4JLPA 5SZIA 3VU9B 5FTMA 1GRNA 2ZJAA 4KV9A 2A5FA 4PPGA 4Q5IA 1ONBA 1KSHA 1IXZA 3DDCA 2ERYA 2JA1A 3CNNA 4IKEA 5CB6A 4RD3A 1S9DA 4MYHA 4AKIA 2ZROA 5DISB 2CHVA 1A82A 1HYQA 5FR1A 4LC0A 3EIQA 3SYLA 2CMKA 2JLXA 2WPDD 3RAPR 2QY9A 4LV6A 1CTQA 1TUEA 2X2EA 1OB2A 1FPMA 4BFVA 3CIOA 3SFZA 2PX3A 1NI3A 4LJ7A 1T3LA 1BMFA 4EPWA 1E2QA 2O0KA 4ESHA 1BYUA 3MG9A 4Q4JA 4YONB 2ZR0A 5TY0A 1W36C 2QTVB 3PQCA 5TB5A 2EU8A 4D6PA 2HEIA 1CULC 1XEXB 4KCGA 1XZQA 4AY2A 1SXJA 2AXPA 4TZ0A 1AZTA 1P60A 4HAWA 3Q7QA 1DG3A 4CEJB 3JVUA 2ASEA 2J9RA 5E4FA 4B76A 4LPSA 2O5VA 3E1SA 4DB4A 5CLLA 4AD8A 4P0TA 1E9EA 2QAGC 3BC1A 3W5JA 1N3BA 3GLFB 1IY1A 5HKKD 1E4VA 5C1BA 4OHWA 3TGPA 4OI0A 1XJ0A 3LQRA 5D3MB 3EC2A 4EPXA 2HXYA 3GLGA 4O3MA 3K8YA 4A0FA 5JCZA 2O8EA 5E7MA 1OXXK 2C03A 4C9BA 1RIFA 4UXHA 2PT5A 1JR3E 4H1VA 4KVAA 3CRRA 3ZVRA 1GWNA 5KSZA 1TF7A 4RD1A 5HZHA 3U7HB 2XX3A 1FMLA 5JS8A 1PV4A 1WBBA 2GWHA 3QVUA 5DI3A 3TK1A 4UNSA 2PMDA 2GA8A 2EFHB 2V6IA 4GPTA 5FTJA 4GSYA 5FUWA 3I61A 3UMFA 2C95A 5TXGA 4DSUA 4KSBA 4AI6A 4BASA 4BZXA 3L0PA 1TQ4A 2JJ1D 1G8HA 1OH8A 2Z43A 4QOSA 1D8TA 3LXRA 1TEXA 1T0JB 3THYB 2J0UB 4OK5A 2AWOA 1CR2A 1FUUA 2H17A 1OXSC 3TBKA 1DAIA 1K6MA 1WDTA 2F7SA 2JEOA 3VR1A 1XEXA 4JLDA 5LD2C 1U94A 5H1YA 1D2MA 1CRQA 1D9XA 1ZM7A 2A7QA 2GJ9A 3RRNA 4C0SA 3GEHA 2JIZA 4P4UA 3ICEA 1OYWA 4PSKA 1WCV1 3UWOA 4YMUA 2A78A 1D2NA 1RJ9B 2V1XA 4B34A 4XTRA 4U00A 1JEEA 4KAXA 4TLCA 4BFTA 3DOFA 1XTJA 3WP0A 3R8FA 3AGPA 1UM8A 3LW7A 4HZUA 1F3OA 2N46A 2QAGA 5K8TA 2HV8A 2FFQA 2IUUA 2NQ2C 3EA5A 2Q9AA 5KO2A 4HAXA 3IQWA 4NCKA 4LDJA 3SHFA 2QMUA 2RMKA 1M7HA 1Z2AA 3MLEA 4D26A 2RGGA 2YWGA 2P5TB 1G5RA 3F5FA 1RFLA 5G40A 4JT4A 1F60A 4ZCMA 4M9QA 3QE0A 1P9RA 4EPRA 2YHSA 5DI3B 1KDTA 1P3JA 1VMAA 4PC2A 1TQDA 1UJ2A 3S1AA 3QNUA 1OHHD 3BJIC 4LJYA 4V0MA 4CT5A 1Z0AA 1KDRA 3FKQA 2VP4A 3BAFA 4BRWA 5KSOA 5KU1A 1JI0A 1ZYUA 1H8HA 1JPJA 2CCGA 3H4MA 4JYCA 2KSQA 2IS4A 4M21A 4HATA 1XWIA 2ZAMA 5H70A 4EUNA 1N6OA 3W6PA 5JSZA 5FTLA 5DI9A 2GJKA 3T12A 1AS0A 2FV8A 1L7VC 4Q18A 1UKVY 3KUDA 1JECA 4TQAA 3T15A 2H16A 2CL7X 1C4OA 4NZYA 2OLKA 4PHGA 1OH5A 1XPRA 1YZQA 2PX0A 3CO5A 3PXGA 5L8VA 1Z5ZA 4ASUA 4A2WA 1H8ED 3K1JA 3EZFA 5C46F 1I2MA 3V00A 3HJNA 3FGNA 1P62B 1W2GA 3I8XA 4DWJA 1XMVA 3QENA 4BLSA 4QBFA 3KQHA 1V43A 3VR6A 3SYNA 2IHBA 1JBKA 4ZDKA 4DZZA 4MA4A 2RGDA 2FSGA 5J40A 4G5OA 2ZRHA 4P4TA 4HYYA 4Z1MD 4ARZB 3T5GA 3U6KA 2DR3A 1Q1QA 2ZE6A 1E2DA 1BO6A 1DG1G 1KAOA 2C8VA 2XTNA 1YRBA 2IYVA 3GJ4A 1KMHA 4FN5A 5KPDA 2JLUA 4GT1A 1GTVA 3ZIAA 4PAMA 1XZPA 2Q3FA 4B6EA 4NP6A 4B2LA 4RCYA 2PEZA 3ASZA 2P6RA 3C16C 3SBEA 4JLMA 4JBXA 4EJSB 1ZU5A 2P6UA 4DDUA 4MGKR 4TSFD 2BMDA 1AJEA 3ZVMA 3WY9A 2D2EA 4QBGB 4KU4A 4BPBA 1KO8A 3U5ZB 5EUQB 4Q03A 1GAJA 1Z28A 1FQJA 5P21A 4KITB 3K9HA 4HUQA 3SR0A 2AR7A 4QGAA 3IPYA 4LHWA 2ZI7A 4IOKA 3GD7A 2VRWA 5KSPA 3RDPA 4A36A 1YR6A 4ERNA 4JL8A 2CDNA 2ZSEA 3BE4A 3PJRA 4GNKA 4DC9A 3E5HA 4CZ2A 1NMYA 4WXRA 4CF7A 4CEJA 1DVRA 3EWSA 2IYSA 4UNRA 2IYQA 4PPNA 1LY1A 3C41J 1ZUIA 2GCPA 2GF0A 2BOVA 4CYMA 2DFLA 4LGMA 3B9QA 1SVOA 4QJ3A 2J7PA 1EFTA 1N5LA 2IT1A 5F9FA 1JQJC 4ZDJA 3LLMA 4L5BA 1G20E 3KJGA 2RGNA 2CHGA 4XOIA 3R20A 3IILA 4I1UA 1E0JA 4P32A 2CK3A 3WNBA 4A8JB 2ZS8A 3D31A 1N5IA 2GEUA 2ZRAA 2MSCB 2HCBA 1IN7A 3E2IA 1LW7A 5FBLB 4JYBA 4NCIA 3IEUA 1OIWA 1WMSA 4IDOA 4C0JA 5EJEA 3CZPA 3FOZA 4JKIA 3NC0C 4OJQA 3QY0A 3C8UA 1G8FA 3ZZUA 2MSDB 4C0LA 1P72A 5JLJA 2B21A 1WP9A 3GJXC 2JJ1A 1G3MA 2GCNA 1J99A 3CBQA 1M74A 4GFDA 5J4YA 1I4DD 4Q4HA 1NKSA 3GLIA 1S0UA 3K0CC 3EW9A 4XVQA 3AVXA 2ATXA 2C9YA 2AFIE 2QSZA 5FBWB 4M2LA 1GITA 1OF1A 3EZ7A 4JL5A 1M8PA 2G0NA 4XWOA 1OH6A 4OYHA 1EX6A 2W6IA 3NVAA 2HYDA 3BB1A 3B60A 2P65A 4P4SA 5FOWA 3LWNA 4PANA 4CEIB 821PA 3FHOA 3KB2A 3SE0A 2H18A 3QXJA 4TMWA 2BCGY 3ADBA 5GJWC 1ZD1A 2ZR9A 4MQBA 4DJTA 4TLBA 1W4CA 1WXQA 4TL9A 1T5LA 1P73A 2BEKA 1KI6A 4DKXA 2GJSA 1LFDB 3BOSA 1TPZA 3ZZTA 3CZQA 1NNEA 5LB2A 3RS4A 4DLUA 1IN5A 3HU2A 4FD2A 3PFIA 1UEJA 3BH0A 1IJFA 1P2SA 3LO5A 1RRFA 2I1VB 2XEXA 3H84A 3OZXA 4Q48A 3FMOB 3KKOA 2D74A 2QAGB 1DAKA 3DZDA 3Q85A 4Q47A 4WAUA 4Q9IA 3TLXA 3ZDQA 2TMKA 3NEYA 5C4GB 1QDEA 1BMFD 1S4QA 2ZTSA 3CNOA 2F1JA 2XSZA 4Q4LA 3QKSA 4HAVA 1J7KA 4BLQA 2O8BA 2BWJA 2NGRA 4OK6A 4Z1MA 5FL7D 5JJLA 4GL2A 2X8AA 5SZKB 3OAAA 1U8YA 2ANCA 4QM6A 4ZPXA 5L3VA 4KBGA 1DEKA 1W46A 2JAQA 2WJVA 3B13B 1OIVA 1E2LA 2ATVA 2IYUA 1P4SA 4C3ZA 2JLWA 2ZI5A 3A8TA 4B44A 3VX4A 3ND9A 1E2IA 4JJZA 3SZRA 4A8JC 1Z83A 4URWR 1E6CA 4DLXA 1LS1A 2ZRIA 2O8CA 4A92A 1U2RA 4BFUA 5L3QA 4JS0A 5CDFE 1ZNZA 4WOPA 4OQNA 2F43B 5FPYA 4D80A 1J8MF 1U98A 3W6NA 5J4LA 4OQFA 3A6PC 2ORWA 2XB4A 1P2TA 4M4SA 3LX5A 4HDCA 3F8TA 2IXEA 1Q3TA 3N2EA 3AF4A 3KXKA 1G6OA 4TL7A 2QTFA 3THXB 4HAUA 5DH9A 2CLDX 4KFTA 4LJAA 4WW0A 2BCJQ 4E07A 1K8RA 4G3XA 1OB5A 1E2FA 2VSOA 1F2UA 1XDBA 2IEYA 4D0LB 3CWQA 2OCYC 4IEIA 1D2EA 2P67A 3BK7A 2OXRA 4Q9KA
chains in the Genus database with same CATH superfamily
1RCFA 3GU3A 3OF2A 3ESXA 1Q7GA 4XQEA 3RVMA 2FF7A 4MPTA 4NYIQ 2MSWA 4BE7B 4F71A 4EGQA 2ZQ5A 3TOSA 2E4VA 4UM7A 1NG9A 1L1QA 1XZKA 3U3XA 3B7WA 1ANKA 1OE0A 2ZUBA 1KZYC 3NBMA 3OEYA 2XD4A 1ZA1A 4NH0A 4URYR 2XDQB 3NBKA 4M88A 3LUJA 2I4OA 4AWBA 2ROQA 3QSYA 1C1HA 4GD3Q 3I9JA 4TYWA 4ZVTA 3BMCB 3ZDZB 1E3DA 2RK4A 2POQX 3ERCA 4JNCA 4CTOA 1YCHA 4M8IA 3T4PA 2Q1SA 5CCXA 4O2LA 5G4LA 2X5NA 5DVZA 4CMIA 3PJFA 4HN9A 4ED9A 2AJCA 1XAHA 3ER9A 3PE4A 3COWA 2HR1A 5HCIA 3AR9A 4QDXA 1Q12A 3EGDA 3W5SA 3BHNA 1JSZA 3N9IA 1Q7CA 1VBMA 2VPYA 3FGOA 2P91A 1QGUB 1L9XA 4MQ6A 3PEVA 5F2EA 5CA0A 2X0DA 1JIUA 3JQCA 4G0MA 2OQVA 4AJ2A 3A27A 3UENA 3QFSA 3BB4A 1FX0B 3DHEA 4D8XA 2C07A 2GZ2A 2VXOA 1E8MA 3RFCA 1R88A 4YCSA 3Q8MA 2I8CA 1JQBA 2WW8A 3FNBA 3LRPA 1UWCA 2IY7A 4TTTS 4DNQA 2I1LA 4O4IB 2AW3A 4F6LA 1XLTC 4WASA 1T36B 3OTOB 3DKVA 1XG5A 3CISA 2ZSDA 3LOPA 3SDBA 4EJSC 1OAOC 1TAGA 2MYTA 3JARB 2B1IA 3CPJB 1I4WA 3T1QA 2VIIA 1Z22A 3N2IA 3PVSA 3WYNA 2HHLA 2GKOA 4BAUA 4P9NA 1GZVA 5C18A 4GMFA 2P3OA 4IFTA 1KKMA 1XGKA 2OCKA 4QQKA 4UU7A 4DQDA 2OP1A 3F3KA 3HDGA 1SUCA 4ZN6A 2V3VA 4TVBA 4XUEA 2BMEA 2X76A 3FDJA 3R5SA 3GG9A 4S1VA 1ABBA 4PZYA 2WM9B 5H02A 2CT8A 4GVXA 1AIPA 2V1UA 3L84A 1F6WA 3OZBA 3DAOA 1ZJJA 1H85A 4N1AA 2AE1A 2C99A 4YJ3B 1WB6A 1SJ9A 2VP3A 4PFQA 5TQ2A 5I4CA 4X63A 2Q5LA 4EG1A 3DW3X 5CNMA 4EL0A 4OI2A 1MF7A 5HMLA 2WF6A 3SLKA 2YXPX 4QQNA 1GFIA 1J8DA 4MW2A 1JQ5A 4XFJA 2QL5A 3NHZA 2OGTA 1RBMA 2OZPA 1N2JA 1ST3A 2W2KA 3MLAA 3EC1A 3K0EA 2FFAA 2HHAA 2C8JA 3RHSA 3PQ3A 1QIGA 2DF8A 2BSAA 3ICCA 3RYCB 3PHIA 1SG9A 2ZBRA 1LDBA 5FJIA 2R6FA 1QIJA 1Q16A 3BJRA 1KSJA 4ITRC 3HPQA 3KKPA 3W9UA 2DKOA 5AP9A 1JKJB 1K88A 1ENPA 4GLFA 2HO5A 3F7TA 5KQGA 3ZDBA 1NLUA 1TD1A 3G8DA 1EUCA 3T34A 3TXYA 1T29A 1CY6A 1WIWA 3KYDA 2X4IA 4PSVA 4UDXX 4Y6LA 4ZEVA 3CW2A 4HZUB 1W85A 4PAOA 1W6RA 1CPYA 4PGFA 1JB1A 3PXXA 5JNSA 1SR8A 4KVGA 1O95D 1IZ7A 2GEJA 2I78A 3Q7RA 5T57A 5AM0A 3R3UA 5AVZA 1SG0A 1F38A 4L4RA 1Y8AA 5EVJA 1G7RA 3WB2A 1N2OA 3IBSA 4ALMA 2M6RA 4BP3A 2SKDA 4AG5A 4KXVA 3OOSA 3OKCA 5LQNA 3BXGA 2DP4E 3MERA 1OHHA 3MUNA 3QHPA 1PR2A 4P4SB 3ECAA 4UBMA 1DXQA 2EZ4A 3F7MA 1U9IC 3P2YA 4PCLA 5HQ3B 1WXXA 2WVGA 4IDBA 4YIHA 5JR3A 3I9KA 2P9GA 3JQFC 4TV9B 5FWXB 4LA4A 5AK5A 1IJKA 2JGFA 1RM5A 3H6GA 5BVGA 1J70A 3H86A 5EVCA 4ZCTA 4CDGA 3E7FA 1LDYA 2Q6KA 2PZAA 2Z3VA 1E9FA 3TMKA 3N7TA 3V46A 1U80A 2QSYA 4ZGWA 2GPBA 1CZUA 3P27A 3ENQA 3R5JA 2OV6A 2QRLA 3ZVLA 1JBEA 1W4ZA 5T67A 4Q4AB 5EZYA 3ASUA 5AR1A 2JFXA 5C5IA 1P7PA 3OA2A 1RQPA 1KI7A 1XTVA 4XW2A 3WTBA 4B7XA 4H7FA 2VTBA 2E4AA 3TTYA 3I3SR 1X74A 2B1QA 3QJGA 3R1IA 4OI4A 2G7MC 3PQFA 4CFYA 1II8A 4GMHA 3WTCA 1FDIA 4DR5B 4R2HA 3OZWA 2C4HA 3F3YA 1O77A 4AY4A 2DUJA 5EMJA 3GEMA 4ENQA 5JZOA 4ZVPA 4OLAA 3TQSA 4ETIA 4A2CA 3G5LA 2QD2A 4KXYA 4GI7A 4N03A 3KYIB 3NOQA 4GG1A 1T0PA 5HWSA 4HQ0A 1U2TA 1XRQA 3IRUA 3DCIA 3KHTA 1ZUHA 1NRJB 1DV1A 2VDOB 1IIBA 4I99A 3FBGA 3AVVA 3DTVA 4GHWA 2QN8A 4R1NA 2WMNB 2JLCA 3VR4D 4BEJA 3OMWA 3L77A 4BU1A 3AG5A 4RZ2A 4WZAE 3JZIA 4GEGA 4EI2A 3Q2KA 2C3PA 3O47A 4UHJA 1X39A 4MSUA 5E6RB 4OX9B 4JASB 5DM1A 3JAWB 5EESA 1NFQA 4LGYA 4N39A 2JIPA 1T3HA 1Y3DE 4Y2JA 5C7IO 3WBJA 2VF5X 1U7OA 1DSSG 1N75A 2A7XA 2QLBA 3IT3A 3QRWA 4QOEA 4XSHA 4MNTA 3WBFA 3K9QO 5KOHB 3LTNC 4N7MA 4I0WB 2VDPB 1MORA 3ELDA 5H83A 1GCOA 2OHOA 4RVCA 3U40A 2WYVA 3WB0A 3DZ8A 5ECDA 4Q01A 4BKOA 2WEKA 1Y3HA 1MC1A 1AE1A 3OCVA 3OUZA 4E09A 5DTQA 1MRSA 5ER6A 4DG8A 3T0IA 1TJYA 2B8TA 1X19A 3NJRA 3FD8A 3NYQA 4XIGS 4EARA 3O1JC 3QX8A 2V8OA 4WESA 3FVWA 5I9MA 2OQ2A 1QB7A 1YB1A 3OX2A 5EIWA 5EXEA 1Q50A 1ZQ9A 5FLYA 4YAEA 2K7FA 2EFEB 3TLKA 4YQFA 3PVZA 1QQ6A 3K6SB 4MEJA 2NUTB 2CXNA 3TSYA 2XMZA 3KKLA 1SCKA 2Z5FA 4H1HA 1MH9A 1CJMA 2AL7A 3C5CA 4KXNA 1OLSB 4TYQA 3BDVA 5IYZF 4IMPA 2ZIVB 3O3NB 5GP1A 3WLOA 4R2IA 1K86A 4EKGA 4M8SA 1Y1LA 2F9FA 4PRLA 1IL0A 4Q1BA 2HCRA 2WU3A 4JYPA 3D6NB 4B3CA 4EA7A 4EGSA 1YC5A 4Q16A 5JNWA 1OZ0A 4U2FA 1TJNA 1FXWA 3BVPA 1G2OA 1MXHA 2H2AA 1AS2A 3GDFA 2NU7A 3R7WB 4LHZA 3M1IA 1JGTA 3FKSA 2O2XA 5B3JA 1MPXA 1T1EA 2IEAA 2YASA 4FFPA 1VG0B 1D1SA 3ZV3A 2C2OA 5LFAA 5IFKA 3CTMA 1UBNA 1CUVA 2BUCA 1HT1E 1LNSA 2PRJA 3AP1A 3O4HA 4R8SA 3VR5D 1I1NA 1Z0FA 4BMZA 1JYFA 1R0KA 3P0FA 2D5IA 2ISQA 3A6JA 4G5XA 1PI3A 4O2RA 2XCUA 5F9MA 4B43A 2CXUA 1YMVA 2Y0PA 5BMVA 1MEOA 3L4SO 1U0HC 4F4JA 2HNKA 3B9PA 3AQ4A 1L5MA 3ZTWA 3OQMA 2VHEA 3RSHA 4CDRA 4XI9A 4NX2A 2PLFA 4ZTUB 4MUAA 5A3SA 3I9FA 4LY6A 2GM9A 3ZWVA 4TQGA 4WNAA 2TECE 4KREA 1EFKA 3SP1A 1UMBA 3EQZA 3C7AA 2ZSFA 4OQDA 5DK6A 4LMBA 4AJEA 3AWDA 3TW8B 5UKDA 4Q3BA 2EFGA 1HV8A 1B16A 3G8BA 2IOFK 2VBIA 2A14A 4I4LA 5KAMA 3VZDA 3QVOA 2OGZA 3FH0A 1UWVA 3AL2A 5F35A 4M1MA 4BNZA 4ID9A 1OWPA 3F4KA 1Q6YA 1MJ5A 3ZV5A 4UD2A 3ADKA 5CX4A 2F67A 1O0BA 2AI1A 1PJLA 5B1YA 1TNDA 1WXDA 5HJ2A 3O74A 1ZJZA 2GFQA 4UM9B 4JI4B 1CUSA 1JG7A 1KMQA 1KQ3A 1Q95A 5F3DA 2AQIA 3SIXA 1MAHA 3A0RB 3RSSA 2DFPA 3UKJA 4C2TA 2C5GA 3QOFA 2LUOA 1TCAA 2G5TA 5DYGA 3VPFA 4PYLA 3QJYA 4UFPA 5KOJB 3W5HA 1RI5A 3OM9A 1T26A 221PA 2H1FA 2HLDD 4K6KA 3OT5A 1BCSB 5DZSA 3O2QB 1ZUNB 3H9GA 1QE3A 1B6TA 1Q20A 4LHVA 4NK4A 2BONA 2J3IA 3LZCA 4QDZA 4XB2A 4YMHA 2WD7B 1R4MA 3ZWCA 4F3RA 4CLOA 1P4GA 2B20A 3GJ7A 2OZVA 5BXQC 1C4XA 7GPBA 4O5OA 2WHYA 2LRHA 3GMIA 2OB2A 3VUEA 4DT1B 3LC7O 4Y2PA 4Y7CA 5ESDA 2RAFA 5DHFA 2O59A 2O8BB 2QX6A 3ZE0B 2L2QA 4BKUA 2GK7A 3IJPA 4YUYA 3B6KA 2WYUA 4CMBA 4HRXA 1SRRA 2VJCA 3K8OE 3B1ZA 1JNXX 3TRJA 4Y9SA 2J9FB 2G5GX 1IIRA 4M9XA 4Y98A 4AZTA 1JHXA 4OFWA 1CBUA 1HFEL 3TR0A 3HFSA 4OLJA 2JI6A 3HLKA 4H0NA 4X64B 3LZ6A 1IEQA 1BHQ1 1R0LA 3E5NA 4F8YA 3TFQA 1QBGA 1IN8A 4Q12A 5FULA 1ADYA 2ZDHA 4BLRA 2MU1A 4PIPA 3EBPA 4E6PA 4QFMA 2JLVA 3OEHA 3PA8A 3WX0A 1GAEO 1YH3A 4A23A 1GLGA 3O0DA 3ZLJA 3L43A 4PINA 2ID9A 1JPNA 5C8ZA 4RXTA 2Z2KA 4L7QA 4XX0A 1K75A 2JH8A 4OM8A 5GONF 5IK2A 2AA3A 1LVHA 4LEIA 3UAXA 1KK3A 2PSDA 1F2TB 1YU6A 1XSEA 1WMBA 1ZC4A 1D2HA 1U3UA 3A9TA 3E61A 1N1EA 2ID8A 1K7EB 2N47A 4V3CA 4WGGA 3QUTA 1JA9A 5C3UA 3IDQA 1E4EA 2EBWA 1SCAA 4K05A 3WZMA 2NO6A 3EFBA 4XQ9A 1HK7A 1OX6A 1YZFA 2B30A 3ORRA 1XBTA 2ZE8A 3W3ZB 1HNNA 1N92A 3G2OA 2FLVA 1MW8X 1ZU4A 3KEMA 1YDWA 3ECCA 3ZVKA 1CV2A 4X6XA 3X1MA 3GJYA 4IUDS 4HVCA 4V1CB 3M6XA 3L7IA 4DPKA 1SBCA 3CA8A 3D6FA 3BDIA 3NWPA 3UMVA 1YKGA 3O8RA 1A9TA 2F48A 2IUSA 1XU9A 1UBFA 3ZOZA 2XMDA 4P0PB 1KMNA 3DLHA 3Q9LA 2KE5A 4UDYX 1SCQA 5FBQB 3RVBA 4D02A 4BP1A 4GZLA 2WICA 2Y4OA 3K92A 5EIOA 4B3DA 5JXGA 5HIKA 4UNIA 2CXQA 4GXRA 2W37A 2AOXA 1LPAB 1YDMA 1ZGHA 2VATA 2D5CA 5DOZA 3S5JA 3GLRA 4FKZA 1KQNA 4UD6A 3GOHA 4ANFA 2OL4A 2ZIWB 5IUKC 3G7SA 3LNTA 1U1DA 4HYEA 3OT1A 5FUBA 1Q3HA 1E92A 2Z2YA 3PHBE 2PZEA 4GUAA 4LYJA 1KYXA 2FAXA 4MVJA 1T9KA 4YIKA 1RZVA 2QJTA 3U13A 1WO8A 1C1XB 2EIHA 4L9SA 4K26A 1OFHA 4PQEA 3TVDA 1T91A 3K2EA 2PT7A 4I50B 2GTPA 3AKEA 1QHSA 1VOTA 3A3OA 3QPAA 3ZDYB 1WTCA 1DC7A 4E2YA 1LBQA 3GV0A 4GYWA 4HQOA 3KLPX 1YVDA 2HMAA 4B6PA 4BPRA 5CK4A 3AY6A 5IBCA 3SSOA 3NBAA 2WIGA 3F73A 5F33A 5TT0A 3LA8A 5CR9A 2B4KA 2GXUA 4M0UA 4CNQA 2Y1XA 1W30A 4JCCA 1EP9A 3RTDA 1N2CB 3DFIA 3LKBA 3T99A 3UUFA 4DFDA 3DMNA 1EK2A 2H4WA 2ZS7A 3ST7A 1IY8A 1Z5NA 3FMFA 4N0EA 4FT2A 4S2EA 3A9CA 4URHA 3ZEIA 1FBNA 3H7IA 4AG6A 1VP9A 4DEYA 2H4YA 1NUUA 1YA4A 3IUNA 1WABA 1XQVA 1WUYA 2AG5A 4CF6A 1I3KA 4ENUA 3DL4A 3F97A 3KPWA 1RJDA 2QVBA 1W35A 1PR0A 4FE7A 5IAJA 2GXSA 3FWKA 1YACA 2PZGA 5BT8A 2UYGA 4R54A 3HN7A 4NABA 1P7VA 1MVNA 1NUHA 1XZBA 3GEDA 1Q1NA 4RO0A 5EFOA 5I9BA 5EWMB 4IKOA 4OSEA 1I6WA 1ODJA 2ZEJA 5EZ5A 3L8MA 4YV1A 5KDOA 1ZWKA 4UOEA 5GJBA 2ZRJA 1V41E 3T06B 3AZOA 2VNJA 4JNKA 2C5FA 2ZE7A 1UKEA 3B8HA 1HQYE 3CPEA 3WRYC 4OL0A 1NLZA 1J56A 1TKBA 1J21A 1RRGA 2ZUCA 4UHFA 2ZJ4A 3L9XA 3ZE8A 1ZI6A 3DUWA 4MRMA 2JHPA 1QORA 1CRWG 4B79A 5KQLA 3KK0A 4AS3A 1ZK1A 2Z8YA 2CEKA 3OQPA 3WK9A 4CL3A 2ODNA 2WJWA 3GIWA 4HGZA 4LG1A 3E6AA 1CR4A 5CD9A 4DADA 5JHHB 5LQAA 4HG2A 3SF8A 3GJ3A 4CM8A 4GL4A 1GO2A 3T1TA 5FV4A 3ROKA 1MRZA 2VP5A 1V45E 3IRVA 2ECKA 1NONA 1DO2A 2XRFA 1RABA 4WFIA 3LRXA 3K35A 1NMEA 4Z1OA 2FRVA 2VYNA 4LJ6A 3KD3A 1J8QA 3NT5A 4HX5A 3AY3A 4HB3A 3ZV6A 5LSAA 3FOWA 4N5HX 5CFZA 1ZJ6A 4JKOA 1T6ZA 2ETXA 2C98A 4JMLA 4MX8A 1NW6A 4QPJC 4PR3A 4UAUA 4AZ3A 1A8HA 2G9ZA 3IKLA 3OTWA 4FOLA 1R8QA 4U0KA 3VAAA 3PGJA 1C9JA 2ZBDA 4QOGA 1C3OB 3PCTA 4V0LA 4V3BA 4JSRA 1NYQA 2G67A 3OF5A 4DQVA 2Q2VA 2APJA 2AX3A 4LTDA 1DB3A 4L8FA 1QIEA 3MJEA 5BSVA 3IIJA 3MBOA 3EJWA 4N8SA 4NU8X 2CNOA 4R8KA 3PCXA 2JIQA 5FPHA 3RRXA 4L76A 2R4TA 3BD6A 2NWQA 4PC6A 3THRA 4MR7B 4MHTA 4L9AA 1PV2A 4MV1A 5KOIA 4RABA 1Z0DA 3V1MA 1BEUB 1E8DA 2LPMA 2Q3BA 1ITZA 3K0FB 3Q40A 2HWKA 4GECA 3MWFA 2QN2A 2QK4A 5HXAA 2HWWA 2WWGA 2IS2A 3ESRA 3LDAA 3ZK8A 2G1KA 2N1BA 4E2FA 1O6FA 2WM8A 4YMWA 1Q0ZA 2PTHA 3C7CB 1XK7A 1UAGA 3B2QA 3NONA 1NG1A 2O3UA 3ESQA 2WQZA 5CU7A 5DEOA 3T1OA 1E66A 2JF0A 4BIMA 5J4HA 3ZI0A 2P62A 1Z7BA 2B6HA 4BLUA 3HB1A 3UWMA 1FPQA 1JNYA 3EEBA 2NU9B 4DC1A 1ZSNA 2MSLA 3R6DA 2WIAA 3VNBA 3WMWA 3JSAA 3L82B 4ZQEA 3JQ9A 4F7WA 2O06A 2J5BA 3CMMA 1T9HA 3GA5A 3G2JA 4O8ZA 4LKRA 4PNPA 2A67A 2EKDA 5HFNA 2ZYHA 4HDMA 2C2KA 4P84A 4BNWA 1RQLA 2RD2A 5EJMA 1TCCA 2PWZA 5CH3A 2OXTA 2CXOA 2VK1A 3U0BA 5JISA 3QELB 4D9MA 4PGAA 1VHWA 1QOZA 4W5QA 5KJEA 4UVEA 1E7YA 1R6DA 4PY2A 2NZYA 1RWPA 3PGA1 2H63A 2ZJ2A 3MWEB 1NPDA 2V8BA 3R7NA 1I13A 2ZZNA 1I01A 2DUNA 2Y27A 3W8RA 1R0SA 3SYTA 3TQHA 1SBZA 1ODCA 2IELA 1PX2A 5K8LA 2A5JA 3DGEC 3PEUA 3RRBA 1OXUA 2GCIA 2FEOA 2MWMA 3N5KA 1E7SA 4RSRA 3T94A 5K0EA 2FUEA 1GVNB 2H65A 1XD8A 4YS6A 3EX7C 3GARA 5KYXA 4P38A 3W34A 3PEWA 4QDUA 4R51A 1GGFA 2BFFA 2L42A 2PZBA 1SK8A 1XQXA 3DEFA 3C3XA 3STVA 3RWOA 5B12A 2ZBPA 3RR2A 3KHSA 4TWBA 5FUXA 2WABA 1IQ0A 4F93B 2BHLA 4H7JA 1T6BY 1YK1A 1O5OA 3HJHA 1IN6A 1SKAA 1U99A 1Z29A 4ETWA 3EZ2A 3ZY3A 1R00A 2G9QA 3L0YA 3H3JA 4LC9A 4A0RA 4H6PA 2R00A 3T5AA 3ZNPA 4K7JA 4MW4A 2O2JA 3EVCA 3NIGB 1ZG3A 1YVEI 3EGVA 3HMQA 1AHNA 4OJMX 1C30B 3SN6A 3EG9A 3TQFA 1S3GA 1XRRA 4DRZA 2VL7A 2A35A 2ZWMA 3FRIA 1I51A 3CCCA 3ESZA 1WD7A 2FG7C 2Y2UA 4FDVA 2P3LA 2Y1DA 1LSSA 3A25A 3QPCA 4Y9TA 4Q7MB 2B78A 2HWXA 3WV5A 1UBTS 4YCBA 3WFZA 2ZM5A 3DBRA 4YJ2A 4TLEA 2GXAA 1F9AA 1FMJA 2AFHA 3EGEA 2EZ8A 3FE2A 3G2QA 1G19A 5DE3A 3FCXA 4RZHA 3RBXA 4XGQA 3TR5A 1GILA 4IZIA 5DTJA 4OQXA 1E6WA 4MRAA 1L4KA 3UJDA 2DZDA 4HEA1 4E1BA 4E32A 1XD2A 3TUZC 1OWLA 3W79A 2A1IA 1WF3A 2YV5A 4FGUA 3T52A 2XUHA 1GAXA 4J2TA 1XTRA 4UUQA 1G4UR 5C8YA 2D2XA 3C4QA 2E85A 1ABEA 3QE4A 2VZLA 1M2VA 3T3OA 5BWOA 5KTRA 1Y8QA 2HU5A 4XX1A 1FLDA 3U7EB 2B7CA 5BN4B 1YONA 2Q46A 1M1ZA 2ZGVA 3DG9A 4WK6A 5DGIA 1VPWA 5ARBA 3DEJA 3EUFA 3ZWKA 1PZEA 3H2ZA 2FWAA 3LY7A 3INRA 3OESA 4TSRA 1DWOA 3DUFA 5T4FA 4EAQA 1H2BA 4DSOA 1SUEA 4TWZA 5AJXA 4ZRDA 4BO9A 3QVKA 2DGDA 2FWRA 4AWAA 5MN5A 1XE3A 3IO3A 4MW9A 3D4BA 2PIDA 3ENWA 1NVXQ 2V7QA 2AV6A 1KZ6A 2OG2A 4WCDA 3H1FA 3V1KA 4UNQA 2GEKA 3O8NA 2GVZC 4F4IA 3F9IA 3N0TA 5CXUA 2SNIE 5DX0A 4JQOA 4KC0A 3ZQ6A 2ZR8A 4G56A 1L2TA 4I1IA 3RTEA 3C1AA 2CJYA 1O1YA 3AZQA 4BVHA 2FP3A 3TGLA 1TMYA 4AKEA 1A7AA 3FHCB 1L7AA 4ND5A 1XXHE 1P80A 3KUKA 3O8QB 4CKCA 2R7KA 5GQSA 2ORYA 1KDPA 1Y98A 1H1LA 3IE0A 4HGQA 4X71A 5CB8A 2MR6A 3TTXA 3OCCA 4MUXA 2V98A 3IMGA 1U2EA 2B99A 4G6ZA 4BLOA 1CDOA 2F8SA 3FW1A 4K1XA 4MS4A 3QTTA 4WZ6A 1T5BA 4AFNA 5JATA 4I7EA 3HYLA 2GBLC 4KX3A 3RIXA 3RYHA 5KOJA 1PWHA 4LYAA 1YL7A 3PKIA 2JCVA 3MJCA 5BUSA 1P5ZB 1Z7WA 1IEWA 4RY2A 4KO8A 3DBOB 4N5NA 3S6JA 3S29A 4CEHA 3UK7A 1N4DA 3AF0A 1V8OA 3OOJA 1T2EA 2WHQA 3LIIA 5IX8A 3FSEA 4C0XA 2P2NA 1UMCA 2RGEA 1XNHA 2Y77A 3D3WA 5D8DA 4BWYA 5TS2A 3JALA 1Z74A 2AVDA 5H82A 4D4HA 3WGVA 1QK3A 2VQEB 1PJ3A 3AJ9A 1NYLA 2FNAA 2A5LA 3SE7A 4EJ2A 3Q41A 4XZ3A 1T4GA 1NXXA 1W5FA 3I6YA 3H5TA 3ZD9A 5CB0A 5LD2B 4M86A 1G6Q1 1QPGA 2X13A 4YT4A 1J22A 3ND8A 5G3YA 4H6VA 4MIOA 2XAUA 5CG1A 3UFXA 1GT6A 1PNVA 3G9XA 1L1EA 2UZ1A 2Q3CA 3HQ4O 4LQLA 4IIXA 3U4CA 4AYXA 1GUYA 3CRW1 2ENUA 5BYAA 2AH5A 3P2OA 4JGBA 5ALZA 1G0NA 4E5NA 5ADUS 4GMDA 3EARA 1PBNA 3USZA 2ZI6A 2QYOA 5KEIA 4P7GA 1NVKA 1FS6A 1T8RA 2GRUA 1YQ9A 1KI3A 5FA5A 3IESA 4AICA 5AT1A 5ALVA 2GCOB 2I2WA 1L5FA 1H22A 3K70B 4DXAA 1WB9A 1U8TA 4TT3D 3WSWA 1DAGA 4KBFA 2X5KO 4IIFA 4A6EA 3A1WA 1LLQA 5C1PA 4OBBA 4IUCS 2IU6A 2IBTA 1EFPA 1VIDA 4JI0B 1R0WA 2C29D 4MKIA 1U8UA 1ZPDA 4DBLE 2PSFA 4NU6A 4P6VF 1F48A 1P5HA 3NC1C 3VU9A 2ZITA 3AR2A 4LZJA 3WJ2A 4Q1VA 4HI0E 3EXIA 3CMCO 4JB2A 4B74A 1YI1A 5L3RA 3F90A 1J1ZA 3QVLA 4YAGA 2QMZA 3ABZA 2R6AA 2ZT6A 3B3GA 2Z8YM 3QWBA 4KKXB 4RKQA 1U65A 1K27A 1YBFA 1T4BA 1Y9JA 3N2ZB 2N42A 5AVSA 3E22A 3SDZA 4RD2A 1Q0SA 5LLDA 1MOZA 3W4IA 4S2UA 1E60A 3LHFA 5AVTA 4MUNA 2PZFA 2VAPA 1BMTA 4OOEA 3RU7A 3S8YA 4CKBA 4F2HA 1R6XA 3AEYA 3W9SA 2C97A 2IXGA 1EWVA 1NBEA 3DNPA 2VSQA 3V8EA 3W9BA 5CB4F 2J48A 4Q4JB 2Y0BA 1F0YA 4IJ6A 2PFKA 1B23P 4FPXA 4Q6WA 2JGNA 2ORVA 4DV0B 2RK3A 3C6KA 3NVDA 5DXFA 1WW3A 3KSDO 3K3PA 1X14A 3IR5A 3TE7A 1SD1A 1JHYA 5J3JA 1LU9A 4PO8A 4F9EA 5IAOA 1BX3A 3HY3A 2IH2A 4ZT2A 1KAEA 3RYCA 3H2SA 1T1GA 1G3RA 2VF4X 5JECA 1EGQA 4EITA 5L7WA 1E9CA 1ECLA 3Q88A 5LP1A 4B3MB 3KJEA 1S9HA 1YIAA 1UBCA 5H8WA 3LT5A 1SN7A 5ENDA 1Y7LA 2VT2A 1VIVA 4G23A 4QWWA 3KAKA 2H4HA 1O94D 4UU0A 3A1SA 2OC9A 3SR3A 3FVRA 4D3ZA 3DYBA 4J03A 4ZALA 2XBMA 1RKBA 3PFHA 4LISA 1O95C 3DE2X 2J0UA 3U7FB 2PKQO 4GBMA 1NJ6A 4J0IA 3MMPA 1PS9A 1O0CA 3R0QA 1EX7A 3OUUA 4PG4A 4B0OA 5EE1A 3ROTA 2OV1A 4XD7D 2RHRA 4BHTA 1W75A 4E1AA 1ZOLA 4MQ5A 1OWOA 1LPBB 1SOWA 2R5FA 1CY8A 3LLSA 2E4ZA 1WZCA 2Q6VA 2YMQA 4PLCA 4Y30A 4I5EA 4AO7A 4Y6GB 4XPIB 1JG4A 1GV1A 2W6PA 3HKEB 5CBPA 4AJOA 4B4DA 5T3UA 4ZJZA 2VHCA 3HL0A 2YV3A 3CNLA 2O19A 2QD1A 2VQ6A 4WVFA 5AM5A 4OG2A 2PXCA 4F6CA 1W0KD 1FRNA 3W5BA 3C1TA 1CY2A 3CEJA 2VF7A 2O4CA 2ZTMA 1F6DA 1U0SY 1HT2E 2C0QA 2GEFA 2Q3EA 3LHKA 3CNEA 3PNSA 4RLFA 5D5QA 3SLGA 4EWLA 4Q4AA 2VK8A 1Y80A 2B69A 4YECA 4PYMA 5HJEA 1H3NA 4K6MA 2NPIA 3VJKA 3CF4A 3DZJA 1GV0A 4F6RA 4YAWA 4U39A 2E4YA 3HY4A 3HKBB 4H60A 1VM6A 2QTMA 4MJXA 1N2XA 1BWPA 3AOEA 3RD5A 1A5TA 2ADFA 2NVUA 5FPSA 1IB6A 1SVSA 3QHAA 2X7HA 5ALKA 2VSNA 1VI6A 2AN9A 3SQNA 1NBMD 5BO5A 2VH1A 4Q9DA 2JGRA 4Q9LA 5L45A 2ZE5A 2WKQA 3DWFA 1VLZA 3EGIA 4HSEA 2GAIA 5CNKA 3AH8A 3E27A 4ABYA 4KOEC 4EFNA 2AC7A 3PNPA 2X8BA 4RWZA 3GOQA 4E08A 5LA6A 3EOZA 1WM1A 2W8ZA 4IRXA 5TS3A 3TSAA 1EFRA 2GSWA 2I6UA 5FNVB 4BMDA 4TROA 1L3BA 1E18A 2DLNA 2OFPA 3MMNA 2C4WA 2V5UA 1HETA 4QC2A 1E7QA 2PH1A 1L5NA 1KU6A 3VSCA 5C5DA 3LUKA 3JAMA 3DL2A 2HSDA 5M3BA 1IWBB 1ONNA 1PCXA 3GMTA 4OU4A 1ESEA 3QU7A 2WYOA 4MOWA 3PDIB 1L4BA 2I2AA 4D2IA 5ITZB 1KDVA 1AV6A 5FV7A 3VDQA 5KQRA 3THOA 3SOPA 2O1XA 5JFOA 5JI3E 1U7DA 3LNCA 2GZMA 1U3TA 2IYEA 3SJZA 2NSHA 5F7JA 2RIRA 3MZ0A 4MS3B 1YR2A 3ZKWB 5J2UF 3NRJA 4R0NA 4Y67A 3RRFA 4EB0A 4Z3OA 2OBMA 4CIDA 4UEWA 1JIXA 1OY1A 3WE7A 3BORA 4Q3LA 1NNSA 1DAMA 1UBGA 1Y7IA 2C2GA 2G36A 2GN1A 2WWIA 5B53A 1Q1BA 2NO1A 3AUXA 2CXSA 3QMWA 4FFOA 4HOYA 1YJCA 2C2MA 2VDWB 4K46A 5AK0A 2EBFX 1FU4A 2D1SA 5P8WA 1N32B 4YASA 3JYNA 1K0FA 4FUQA 3TD2A 2Q2OA 3ZCTA 4F46A 1CUEA 2SCUB 2PGJA 5CDTA 3MINA 3O1HB 3LLUA 4K0KB 1YZUA 2P3SA 3JWPA 2H7YA 3HGTA 5FUVA 5BQOA 1FDWA 1BDBA 3OAAD 3WMGA 3R6WA 4RCZA 3F8WA 4HWSA 1PG2A 4OJNA 2F3QA 3IV7A 1KI1A 4R1TA 4Z0NA 4XM2A 4LHSA 4E11A 2X22A 3W2HA 4QUJA 5E6UA 3GT4A 3DVSX 3EXG1 4PEVA 4N9WA 3DKKA 2JB9A 5JH7F 1ZVQA 2QTNA 4U7HA 4RVNA 2GZ1A 3HVHA 3TAXA 2XMBA 2JEYA 5DKFA 3MJFA 3DDUA 4JITA 1JL3A 3A05A 3HZZA 4CHGA 2M32A 1WHSB 2PX5A 4D3YA 4LF7B 1Z68A 2ZRNA 2FPIB 5EQDA 3KNZA 4HH3C 3WV4A 4AXXA 2YV4A 2XTAA 1UBRS 1W0JD 3G2MA 3NM5A 2EZUA 4P34A 1CHDA 1LJ8A 4L75A 3E0QA 2EKQA 5D3MA 4DR7B 4N76A 1G3QA 1MO6A 1NBAA 3PP8A 1MDBA 1DTWB 3AF1A 3Q3CA 2AD1A 1T34A 3FYUA 2GX6A 5ULLA 4IXDA 4RYDA 4B8YA 3REGA 1YU9A 3QELA 2CMDA 4L08A 5KC8A 3UG6A 3M9LA 3MFYA 2J32A 1JEAA 4C7JA 2QM7A 1BVUA 3CINA 4C04A 5LQSA 1SD5A 3G9QA 2FP4B 4CU5A 1TTPB 3CWZA 3WLMA 4O4LF 1URPA 2RI6A 4D25A 1ZRSA 2QIPA 3BHIA 5FTNA 2VAXA 1ISGA 1D0VA 4DRXB 2DBZA 1Z62A 3KVNA 4L8LA 1X7YA 4UUBA 1XCBA 1DXOA 2LCFA 1R4NB 1VYUA 2P9ZA 3TDKA 1UFVA 3W6ZA 1QLHA 4BYGA 5AM3A 1EGAA 3JQAA 4RS3A 4TKZA 8AT1A 4L16A 3U4QB 3NDBB 3KV1A 3PXCX 4J2HA 3WIEA 4YCCA 2C2WA 1YJAA 5TIIA 3BWYA 1VG9B 1EFVA 4ZEWA 1CJUC 1IOVA 3ZOKA 3S7TA 4BUCA 3A6KA 3V9PA 2I62A 3HRKA 4RJIA 4FR5A 2DQZA 3SOZA 2VHUA 1HE5A 4FILA 5M2QA 3ICWA 3LVFO 1OPXA 3LPNA 5HTKA 3CLHA 2AR9A 1ZW1A 2C42A 3VU1A 3V48A 5IASA 1QLWA 4P98A 3U4AA 3CT6A 1X9HA 4IFIA 4Q02A 4IHJF 3RLFA 4L5CA 1MX9A 1OA0A 3BZBA 1VE9A 4YJFA 3UAGA 3WYBA 1Q7TA 2ZJ1A 4KLNA 3NUQA 4AIRA 2WKSA 3A4NA 5LOVB 3IALA 4NBSA 3LECA 4ILEA 3F96A 2OILA 3FNEA 4MV5A 1IWPB 1GUFA 4MKGA 3HN6A 3TVTA 3RH0A 2WB2A 3LW8A 2VG8A 2WJAA 3PPXA 4U2DA 2HT6A 1N9ZA 4GIBA 2HUPA 3KKNA 1VP3A 4G4GA 1PYOA 4RETA 1AGYA 2EFYA 1KGDA 4GMKA 4V02A 3D8BA 4M22A 3BM5A 5CXSA 4DLPA 4KJXA 3UJ8A 3BXEA 4G8JA 2X77A 5GINE 5TPZD 4OATA 1VLVA 1BXRA 3G82C 3T4EA 1EP3B 4QYXA 5K3EA 1Q1AA 2X3YA 4KOAA 4P53A 3EF3A 1NTRA 2YS7A 1ZVVA 1N9GB 2IYYA 2QQ5A 2FLKA 3BXHA 4FDLA 4GW3A 4PQRA 4LJ9A 2FRXA 3WNCA 4Z49A 1ACJA 4DUGD 1W29A 5C7LO 3W1VA 2HFJA 1N6IA 1GPUA 2C54A 2IYRA 1A95A 3AFMA 1A8UA 3BE8A 3K30A 2E82A 3KZKA 4Z0PA 4DIFA 3PE3A 3G6KA 3ETJA 2VEOA 2GRAA 3HR4A 4G63A 3RVNA 4MYCA 3KOXA 4Q1FA 1QONA 2QV7A 3JARA 1J2YA 3FB4A 4LV5B 5D85A 3TTUA 2GS9A 3B6MA 3JD2A 5CTAA 1FTNA 4WBSA 1GGHA 1ZK2A 3EEIA 4RKYA 5AWFC 5JADA 5JZVA 4ZAXA 1NVWQ 3IGFA 2HK6A 3MOSA 3N28A 2OYCA 3SEFA 3WYEA 4EJ6A 4BQQA 5IBPA 2EL7A 3LYHA 1EDZA 1QG4A 4UFOA 4X93A 1HNXB 1C29B 3LX4A 1VJTA 1DXYA 4TYPA 3VTZA 1WBDA 3QBJA 2PGOA 1GTZA 1X1RA 2QZ9A 3OZTA 4WCFC 1UM9A 2LW7A 1T8YA 3T3IA 3TZKA 3ZE7A 1QRSA 1AC5A 2X1LA 2QV0A 5AVJA 5DNYB 1G20A 1KRWA 1JDVA 5EMHA 1DFIA 2BHNA 2PAFA 3ZLTA 2ODPA 2O3RA 4IZ6A 1W52X 5JT1A 1QCDA 5CB4A 1Z2NX 1U9IA 4XWWA 4LXYA 3NPAA 5LZ8A 1JZSA 2FSVC 2P41A 1DLIA 3KDPA 2NN3C 3O75A 3QLEA 3RSFA 1L5YA 1QDUA 1NIJA 1H2YA 1K3FA 1TT5A 2ANBA 4EGCB 4DLYA 1UJ5A 5J4YA 2QZ4A 4G2NA 2DR2A 5LB4A 2IOFA 1XCGB 1MA3A 5FLKA 4ALLA 2GUWA 3U44A 1T2CA 3IPXA 1QQ5A 3QQ5A 3U31A 3WXMA 3N2GB 4RQBA 2RHMA 5CUQA 4FMCB 1UT6A 1MJNA 1QG2A 2H2FA 1B6RA 2IP4A 3A9VA 4GPEA 4ME6A 5F73A 2HT1A 5K8JB 6REQB 1UZUA 1UUFA 2NACA 3R3JA 4WACA 1E9SA 2EW8A 1ONOA 4AMUA 5HNKA 1GYQA 2XPCA 1NMZA 4NFSA