5B1SA

Crystal structure of trypanosoma cruzi spermidine synthase in complex with 2-(2-fluorophenyl)ethanamine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
294
structure length
294
Chain Sequence
MPGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermidine synthase, putative
publication title In silico, in vitro, X-ray crystallography, and integrated strategies for discovering spermidine synthase inhibitors for Chagas disease
pubmed doi rcsb
source organism Trypanosoma cruzi strain cl brener
total genus 96
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 5b1sA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5b1sA02
3ANXA 3B7PA 3HVJA 3SSMA 1NKVA 2AN3A 2XBMA 4LG1A 2PWPA 3HCAA 2NP7A 1XTPA 1ZGAA 2ZSUA 4OBWA 1L3BA 5CD1A 3P2KA 4GQBA 4BLWA 4CWAA 5E8RA 5T6BA 3NW9A 1O9GA 2ZWVA 3FYDA 2UYCA 1AV6A 1ZHFA 3O31A 2OXTA 4X60A 3GWZA 4MQ4A 4C08A 1SKMA 3Q7EA 4DKJA 3OZSA 3DLCA 3UWPA 5BW4A 2HTEA 1BKYA 1L1EA 1X19A 3GRVA 4YUYA 3CKKA 2PKWA 5EZQA 3E8SA 5FWAA 3UJCA 1NBHA 5FULA 4PYJA 3FTFA 1QAMA 3P9CA 5GM2A 1BC5A 1NW3A 3B89A 3P9KA 3FPEA 4CTJA 3CJRA 2HR1A 5MHTA 4CXMA 5CVVA 4RTMA 5CUQA 4M37A 5FHRA 1DCTA 1RJDA 2FRXA 2G8NA 3G7UA 4Y30A 3G8BA 5E2BA 3THRA 3DLIA 4AZTA 4NECA 4MTLA 3TOSA 1XJ5A 3PS9A 3FPJA 5K0LA 2DULA 3MHTA 9MHTA 4E2WA 5DM1A 4F86A 2XYVA 2IPXA 1H1DA 1KXZA 1VP3A 4A6DA 2XVAA 4RSRA 5CCXA 1IY9A 5DTRA 4DA4A 1I1NA 1SUSA 5FUBA 5ICGA 5LR6A 1NW7A 3M70A 3V97A 2B25A 3R6TA 3BWCA 3TM4A 1QANA 3UJDA 4XUCA 4IKPA 4M38A 2PGXA 1RI3A 2PLWA 2K4MA 1SQFA 4PYMA 3GRZA 5DX1A 3RODA 2BR4A 2ESRA 3MQ2A 2GA9A 2JH8A 4QTUB 5LQRA 3AWIA 4DM3A 1KPGA 1T43A 1R00A 5DX8A 4BP1A 2QY6A 1EAMA 3E05A 4GOLD 4FSXA 4QDJA 3OCJA 3MCZA 3HCBA 4R6WA 2Z6AA 5FADA 1INLA 2BM8A 3PT9A 2Z6QA 4MHTA 3KR1A 4RVHA 4C03A 1YFJA 2FK8A 3CGGA 4QPPA 2FPOA 1G8SA 5P8WA 3M6XA 2PWYA 3KKZA 3B3GA 3A7DA 5D1HA 4EKGA 1NW6A 1UWVA 4GOND 2PX4A 3T7TA 4DF3A 3AJDA 4FT4A 3KQYA 1PRYA 2B9EA 3IHTA 3M33A 1YB2A 5DRTA 3NVKI 5E2AA 1EJ0A 4E2ZA 3M6WA 2C7RA 4E2YA 2P1DA 3SXJA 1FP1D 1VP9A 3AXSA 4ATNA 1O54A 2YVLA 1XVAA 4OQDA 1XDUA 5HIMA 1IXKA 4PIMA 1G60A 3NTVA 5CVUA 4QQKA 2NXJA 3JWGA 4FR0A 3BWMA 3GXOA 3UJ6A 5HIKA 3EEOA 1G38A 4DCGA 3G2QA 3HA7A 4KIGA 4PWYA 4KDRA 5HILA 2H1RA 3PLAE 4PONA 2P3QA 5E9QA 3LSTA 4KVZA 2YR0A 5KQSA 2JH9A 2WK1A 4PYKA 2QYOA 5EMKA 1FPQA 4FP9A 3LDUA 1Q0SA 4OA8A 2UYHA 2ZIEA 1RJFA 3OFKA 4P7FA 5E1BA 4PGHA 4EQZA 1RJEA 1YF3A 2YXLA 2ERCA 3G2MA 4CKEA 2IFTA 5CIYA 3TQSA 5C9ZA 4HH4A 4AX8A 3G89A 3KR0A 4E33A 1OR8A 1JSXA 1M6YA 3K6RA 3UJBA 3B3FA 5DT2A 3FPFA 5ERGB 2P35A 2WA2A 2E5WA 4HGZA 2PY6A 3BWYA 3KR9A 4HTFB 2OPBA 1XDSA 5F2OA 3DXXA 2P40A 4RVDA 2LD4A 8MHTA 3EMBA 3HVHA 3BGVA 4QTTB 5E1OA 3A27A 2PX8A 4CKBA 3GCZA 3WSTA 4ER7A 3KQWA 1R74A 3CBGA 2IIPA 3EGVA 3KQOA 3OE5A 3ORHA 4FZVA 5DSTA 5K0NA 10MHA 7MHTA 5LQNA 5KVAA 3UFBA 3JWHA 1ZKDA 4PCLA 4OX9Y 4QPNA 5FQNA 1X1CA 1X1DA 3NWBA 3U81A 1SUIA 3A7EA 2ZIGA 3EVAA 3FUWA 5EMJA 1KYZA 2AOUA 3SX0A 4E31A 4R8SA 3MERA 2YX1A 3IEIA 2R6ZA 3LX6A 3OE4A 2VDWA 3M4XA 3NDJA 3P9NA 3CCFA 1JG3A 5EHGA 2HV9A 4P7JA 1NW5A 2QM3A 5GM1A 1EG2A 5GWXA 4AZWA 4X61A 2YXEA 3UJ7A 3TPZA 4A6EA 2CMGA 2ZWAA 3HCCA 5JUWA 3HCFA 5CCBA 3KPJA 5DWQA 3TKYA 1RJGA 2AOXA 1N7IA 2P3LA 3DMFA 4U7TB 5GP1A 2PSSA 1TW3A 3ELUA 4LWOA 3O7WA 3UZUA 3S68A 1NBIA 2PVCA 2ZULA 5FWDA 5FTWA 3OU6A 4ER0A 3GNLA 2EJUA 4E32A 3OU7A 3L8DA 4YUWA 2Z6UA 1SVUA 4RWZA 1I4WA 4LWPA 5DX0A 5K09A 5LQUA 5HIIA 4U7PB 5EGSA 4P7GA 3NVMB 5ICCA 3I58A 3UBTA 2UZ4A 1X1BA 1AQJA 3DP7A 5FCDA 4WVLA 3DXYA 5GOZA 3EVGA 3KR2A 4KW7A 1JQDA 5C1IA 4KWCA 2N47A 5DLYA 2GH1A 1ORIA 4V0QA 1G8AA 4R05A 2ZCJA 2P7HA 5EIFA 2ZZNA 3UJAA 2AOVA 5KYGA 3KPWA 1NE2A 5EKUA 3UJ8A 4E2XA 5DM0A 2PBFA 5T67A 3FUUA 2HMYB 2PXXA 3EVCA 4MWZA 1KP9A 3C3YA 3HNRA 3KQQA 1QYRA 4RTPA 1QZZA 2NXEA 1SQGA 2BM9A 2CWWA 4RTRA 2G70A 5EKXA 3QOXA 5E1MA 3HCDA 3R3HA 2UYQA 3DR5A 1AQIA 2FYTA 2ZLBA 4FT2A 5F2KA 3V8VA 2CL5A 3LCVB 3T7SA 2V7EA 5DM2A 1M6EX 5HIJA 3BUSA 3IYLW 3P2IA 3F4KA 3GIWA 3LCCA 3MAGA 4RTJA 4CTKA 4YMGA 2ADMA 1VE3A 1WZNA 3BGIA 1RI5A 3KQMA 1JG1A 3LHDA 1SG9A 4OQEA 3BKWA 1V39A 3B5IA 3IV6A 1P1BA 4RX1A 3G8AA 3BWBA 4L7VA 2OBFA 3G2PA 3TR6A 3KQSA 2PXAA 3GDHA 3KPYA 2JG3A 2B3TA 1P1CA 4C05A 2OY0A 2EX4A 3SMQA 3G5TA 2AOTB 3KHKA 1ZGJA 3PX2A 3OPNA 1D2HA 2OO3A 2EFJA 4ZTBA 4YV0A 1WY7A 4YUZA 5GINE 4BP3A 1YUBA 5FHQA 4E30A 1VLMA 2PT6A 4YV2A 1XXLA 3LKZA 3FPHA 3C6KA 4R6XA 1TPYA 4QVGA 5M5BA 2GAFA 3G88A 3B3JA 1NT2A 2B78A 3VC1A 2EG5A 1U2ZA 1QAQA 5K0BA 2G1PA 2A14A 5LQAA 3EVFA 3AY0A 4RTSA 2GB4A 5K0JA 4RVFA 4PYIA 5CM2Z 2C7PA 3REOA 1RI2A 5H02A 3P8ZA 1VPTA 4BLVA 3UJ9A 2AS0A 1YZ3A 2JHAA 5ICFA 1P91A 3TM5A 5FA5A 1X1AA 4ER6A 5K05A 1JQ3A 3H2BA 1R18A 2UYOA 3JWJA 3R24A 5E9JA 3TFWA 2BR5A 3AXTA 5D1NA 3KU1A 4C04A 3E7PA 3KQPA 3OFJA 2GLUA 5DPMA 1WS6A 2QRVB 3KQVA 1JTEA 3LBFA 4PGGA 3UA4A 3VC2A 3ELYA 1UIRA 2ZTHA 2ZW9A 3EVZA 3KQTA 4WXHA 1UFKA 5CVJA 2PXCA 5JR3A 4Z2YA 2NXNA 3CJQA 2AN5A 1HNNA 2O07A 3MTEA 4GC5A 4UOEA 3KPUA 2P3OA 5IH3A 2XYQA 2Y1WA 3P97A 4IV0A 1KHHA 1I9GA 1WXWA 1F38A 2CKDA 2HWKA 2QRVA 2YQZA 3FYCA 2PJDA 5EHIA 4HTFA 1R8XA 3TMAA 3X0DA 2BH2A 2H11A 3FRHA 3HA3A 2IDKA 4P7KA 1EJ6A 3MGGA 1JTFA 2AR0A 4YV1A 5ICEA 3C3PA 5K0CA 3HEMA 3FTCA 3FTDA 1N7JA 4HSGA 4C4AA 2NP6A 2O57A 1B42A 1Y8CA 2YXDA 2ZFUA 3I64A 1RI4A 3CJTA 2I7CA 4ISCA 5DXJA 1ZG3A 2I62A 2OZVA 4B17A 3PVCA 4EMSA 3ID6C 3KPVA 5HZMA 1FP2A 2DPMA 2VS1A 3JWIA 3LECA 5K0GA 4HRAA 1MJFA 1G6Q1 2VDUE 2ORED 2HNKA 4QDKA 2P8JA 1FBNA 2ZZKA 4GC9A 1KPIA 2NXCA 1WXXA 3CC8A 3EMDA 4RYLA 4GBED 2H00A 4KIFA 4RTOA 3HP7A 3ERCA 3M6UA 2F8LA 4R8RA 3EEYA 1JR4A 3VSEA 3BKXA 3NWEA 1NV8A 4RVGA 3PX3A 5EOVA 3GU3A 4PIPA 5DRYA 3TRKA 4O29A 2PT9A 4JXJA 2O05A 3GRRA 3FRIA 3PFHA 1VIDA 2JHPA 2AVDA 2G72A 4DQ0A 3FUVA 1DL5A 4Y2HA 5EMLA 3DULA 3D2LA 4EK9A 4F84A 3PTAA 3OZRA 1Q0TA 4HC4A 2Q41A 1BHJA 1YZHA 4MIKA 1D2CA 2PX5A 5FA8A 1KR5A 3THSA 5E8JA 1VL5A 3T0IA 1VBFA 1YFLA 1R6AA 4QQNA 4X1OA 3O4FA 5F2NA 3MTIA 2ZVJA 1Z3CA 3UA3A 1JQEA 5K0EA 2GPYA 1JG4A 1P39A 2O0LA 1EQAA 3I9FA 1VQ1A 1DUSA 4M36A 2JHCA 5LQJA 1N2XA 3LPMA 5B1SA 3R9XB 3ELDA 3HCEA 1KYWA 2ONYA 3NDIA 4XUEA 2IBSA 4HG2A 4GOOD 5E1DA 3T7RA 5EQJB 4RTKA 2QE6A 3TKAA 1ZQ9A 2P41A 3P9IA 5LQCA 3RW9A 5CVEA 3GRUA 1XDZA 2G71A 5EIWA 2PV0A 4F85A 2WA1A 3BXOA 3LCUA 3LDGA 4PNEA 3EVBA 3NMUF 3DTNA 4X63A 3FUTA 2PX2A 1M0EA 1RI1A 1NV9A 1HMYA 2IH2A 3OU2A 5K0FA 1PJZA 2VZ9A 5DSXA 5EC8A 3HVIA 5IKMA 3A4TA 2V74B 2JJQA 2OKCA 3GRYA 4FGZA 3FUXA 4IWNA 4H0NA 4POOA 2NYUA 4OBXA 3SSOA 5CVDA 4EKIA 4G56A 5EMMA 5GIPE 3A26A 4YUVA 1KIAA 4EVIA 5HFJA 3BZBA 2AN4A 3I5UA 4DCMA 5BW5A 1QAOA 3OZTA 2ZBQA 4C06A 5G02A 4YUXA 3EGEA 3ER9A 2I9KA 3ELWA 3QOWA 1TW2A 3HA5A 4PYQA 3GGDA 4GF5A 4P58A 1XCLA 5C0OE 5FQOA 1JG2A 2XVMA 4ER5A 3LDFA 4GOMD 3DXZA 3PB3A 4XUDA 5DTMA 3DMGA 2IP2A 4LECA 1AF7A 5EPEA 4ER3A 5DM4A 3DUWA 3SSNA 2FHPA 4RV9A 3K0BA 5EEHA 3LKDA 3NJRA 4V0RA 4DZRA 2AOWA 2AOTA 2EJTA 2C7OA 3LBYA 3FPGA 3EPPA 3EGIA 5T64A 1KPHA 3LL7A 3G2OA 1IM8A 3HM2A 2R3SA 3Q87B 3MB5A 4QVKA 1WG8A 3MCTA 5E9WA 5K03A 3A25A 4FS8A 2C7QA 1XCJA 3R0QA 4IV8A 4PCAA 5LSAA 4CKCA 4RTNA 3ME5A 4GUAA 4C07A 3M6VA 3QV2A 2OB1A 5DTQA 4PYOA 3HVKA 2NNWB 3DOUA 1JSZA 3G5LA 5DXAA 3LGAA 4PINA 2BZGA 4AZSA 4PYNA 3DMHA 2AZTA 3C6MA 2YTZA 5EVJA 3CVOA 4YMHA 2ONZA 2ZBPA 5K01A 1MHTA 2ZBRA 2OYRA 5U4XA 5GIOE 2AVNA 2YUIA 3GO4A 3SR4A 2IBTA 2OB2A 1L3CA 4RTQA 2BR3A 5LQKA 3SVZA 5EG5A 5BXYA 2Y1XA 3RIEA 3GJYA 3PFGA 4KDCA 1G55A 4X41A 2FK7A 3C0KA 3BGDA 3TLJA 3E23A 1F3LA 4OA5A 4PYLA 4E70A 2GS9A 2IH4A 2IGTA 2VDVE 3EVDA 5HEKA 4AUKA 4DMGA 5KQRA 2ZZMA 2VP3A 2KW5A 2I6GA 1EIZA 4RTLA 5EEGA 4HGYA 3SM3A 5KS2A 1L9KA 4BY9E 1NW8A 3DH0A 2B2CA 1ORHA 4XCXA 4AZVA 2O06A 4BLUA 5K8VA 3HTXA 2IH5A 3FTEA 3EVEA 2FCAA 1R8YA 2IDJA 4FSDA 2XYRA 5EZSA 3P71T 2ZIFA 3I53A 3SGLA 2CMHA 1BOOA 1O9HA 3ER8A 4KRGA 5BP7A 3FZGA 3BT7A 3P2EA 1D2GA 2P7IA 1L3IA 4GEKA 4K6MA 3VYWA 4M7RA 2AOUB 1FJXA 5HOQA
chains in the Genus database with same CATH superfamily
3B7PA 2JGDB 1QQAA 2OFOA 1ZIOA 4JCCA 1GZHB 1MB0A 4HMQA 4IFIA 1ZO8A 4XQCA 2ZUEA 2R87A 1ZH2A 1QK3A 2CZGA 2HZ7A 1DX6A 4LC0A 3D4IA 4KR7A 2QTMA 4CKWA 1OA0A 1U1IA 3NW9A 1JEYB 1C0EA 1NXQA 1X86B 3I4CA 3I01A 3HKBB 3Q8XB 5TE9A 4JI1B 4NTZA 4BVHA 4EFDA 1XMIA 5C51B 4C29A 1HE8B 4X60A 1NVUQ 4CTMA 3OZIA 1C3LA 4KQMA 5CA1B 1J1UA 3TRIA 5TT1A 4KWIA 1ACLA 1RAHA 3WKEA 2YBEA 3D8HA 5A06A 2JLVA 2EZ4A 1TCCA 2NM0A 1T8TA 5T8KC 1NBHA 1KJNA 3L84A 1XZBA 3UPTA 1TVKB 1C7JA 2QN6A 5GM2A 1ZJWA 1GAEO 1PQWA 1T5OA 4TKVA 3I39X 2JGIA 3TRHA 1NBME 5ALNA 4JYBA 1OZFA 1F8FA 3KD3A 4DARA 2WNHA 2JA2A 3LOQA 1KU0A 1R0SA 4Y30A 1Y8RB 4MMZB 5KWIA 2AV6A 4J0GA 1Z34A 4JUIA 1TU3A 2CNWA 4AO6A 3L6BA 5CFZA 1XLUA 4NV0A 4TX1A 1E9DA 4E2WA 2JK1A 4YAGA 4CDGA 1TJPB 1RHQA 4HYQA 1DC8A 3IKVA 4A6DA 4ZYVA 1YRWA 2YZ7A 4CM8A 4K9QA 1DJNA 2WBLC 2JBAB 1Y7TA 3RJ5A 1ZD2P 2B25A 1L4BA 1SXJD 1W87A 2B30A 1N8KA 2YMQA 4L3OA 3ZU2A 1PNVA 3X1XA 5DNCA 3GLTA 4DTCA 3F6YA 1XKLA 3I2GA 4NENA 1N6IA 2HXGA 4ZCRA 4ABTA 5FFNA 5CRIA 1FNDA 3CH5A 2E2WA 3PGJA 4C0WA 1ZGHA 2XCSB 2JH8A 3BYZA 3QXJA 4OAQA 4TM7A 3M3HA 3KUXA 1OILA 1Y9AA 3IPAA 2GTHA 4JEMA 2PTHA 2VKTA 3G9QA 1K66A 5DM60 2OD9A 3HABA 4MUXA 3E05A 3IOBA 3WK8A 1Q2XA 3EARA 4R1PA 5B3JC 3IV7A 2Q8QA 1MR3F 4R31A 4Z99A 3TEMA 1CIPA 3HBAA 3PNQA 2Z6QA 4D5EA 1LW6E 1TMGE 3DTVB 2UZ3A 3QVUA 4U2EA 5KSOA 4U2FA 2XB2A 2XNHA 2XF2A 2I3BA 2I6TA 2YFYA 1WAMA 2V7TA 2OCBA 1F48A 4US1R 1IUNA 5DB4A 3E4DA 1PRYA 3DOFA 3LP6A 2R8PA 2GM9A 3MRSA 1E1KA 1VE5A 3PGVA 3QUQA 4I5GA 10MHA 2O4UX 1BEZA 1XP5A 1EJ0A 4Z9XA 3UOAB 4GOJA 4CU5A 2FLWA 4M76B 4BO0A 3WA6A 1J2JA 4WERA 4WECA 1EM8B 4MYSA 4MKRA 1ZMTA 3QSGA 3AYZB 4GPAA 4ZMSA 1LW7A 1N0IA 4ZJUA 1CY7A 4KDRA 2YWDA 4OUDB 1W581 1VG8A 1Q7RA 2CBXA 3OKFA 4NFSA 4CHTA 2PL5A 1BAPA 5EMKA 2AXNA 2JFUA 2P5UA 5BW8A 3OUTA 1GSHA 1YE3A 5HYVA 2DY1A 7YASA 2PUJA 5D5QA 4PEVA 1K7CA 1YMUA 4ZD6A 5ELLA 3ZX5A 1PK7A 1NQ5A 2HBYA 3CLTD 5FBRB 5ICMA 1XNRB 1PFKA 2ZBGA 3VRHA 5K6TA 1SOWA 1H2EA 1GL9B 4I14A 2QRQA 4ZEOA 5GQSA 5J4YA 1NDQA 1WW2A 3D8UA 3WLSA 2F55A 5DT2A 2IHVA 1DKPA 3HFGA 1RJ9B 1K4KA 4OREX 3D02A 4RA6B 1W5TA 4F9TA 1NF8A 1O2DA 3P52A 4MVCA 1XDSA 3G0IA 1C30A 1Z7GA 3CF4G 3DA8A 3VNBA 4BUJA 4F11A 1E79A 4W5TA 4BFWA 3HCOA 2AR9A 3L4BA 1Y7HA 4G1MB 1HFJA 4RADA 5HG0A 4RSMA 2XXAA 3S1AB 1IB0A 3D0QA 1CQXA 1NOIA 3V1LA 3P4UA 5CVTA 4F4HA 1UBLS 4H9KA 2ZI7A 3ZDAA 5COBA 4ZTZB 2NO4A 1E62A 1PJ4A 2IWHA 3DBIA 2R65A 4JUFA 2PUGA 2DBQA 1BHO1 2G80A 3LKVA 5BQ5A 2WUWE 4A8HA 1H2YA 2A4MA 1KNQA 4YMWA 3QHQA 4KU4A 4E31A 2XB8A 3SZMA 1ZUWA 2Y4OA 3GDGA 3M4YA 4K6FA 4CQLB 5H82A 2BGNA 4Q6BA 1YJAA 4UDXX 1NW5A 4C30A 1PUJA 3ZWWA 3VPXA 3HUFA 1AXGA 1JF8A 4YRNA 4JXKA 2P2CA 3IIKA 4ARIA 1GSOA 2OBLA 3DHVA 3E9ZA 3JZMA 5KYWA 3CPHA 2FWRA 4W8GA 5A0FA 3OO1A 5FA6A 2WW8A 4U7TB 3H8JA 2P79A 1CJMA 3EDQA 1U90A 5KYYB 1ETUA 1A4XA 1NBIA 2K7ZA 2JD2A 2R8YA 3B6ZA 4G41A 4G4IA 3ZTYA 3ROEA 4R1QA 4DM4A 1KYTA 2YNMD 4R2JA 5EE3A 5B58T 1NXOA 2Z6UA 4DY4A 2ZANA 5BV8A 1K89A 4ZZ2A 5TPWB 4N5DA 4D8YA 1GN8A 3I2YX 2WKQA 2E4AA 4AJEA 1T13A 1T5SA 4P7GA 3IQWA 5JI3E 1JZTA 2DC1A 2VPPA 1LLDA 2PH3A 4Q3BA 5DISB 1SRRA 1W5SA 3DXYA 3LT1A 2D4AA 1G8PA 4LW8A 5EL0A 4BO4A 4UOZA 4ZDIA 3U7HB 3K05A 4DOMA 3NOQA 5C1IA 1GQQA 2C59A 4M9UA 3OLQA 1C0KA 3R7LA 3INYA 2JBHA 5EIFA 4JT4A 3O03A 1NE2A 3P9SA 3HBMA 5TARA 4KFRA 1JAYA 2WRZA 3K73O 3AU8A 5JJBA 1POWA 2D1FA 2SCUA 5B7PA 3BTOA 3JAKA 5EKXA 2PD6A 4YJ2B 3HCDA 4LPKA 4XWYA 1AXRA 2DTDA 3DR5A 4FT2A 4KBGA 1TF7A 2VYCA 2ECOA 4KKVA 4KXLA 3ABRB 4MYTA 4X90A 1KI6A 3ZKAA 4E51A 1SIOA 2YWXA 3UMRA 1QTNA 4YMGA 4M1SA 2EKLA 4RULA 3AK4A 4D3SA 1K8RA 3PTLA 4HDKB 2A94A 4EHDA 2JKVA 4XDGA 2GJSA 2P0EA 1FSFA 5DTIA 3JWPA 5A5EA 3OOYA 4ES6A 1TTTA 1EK1A 2OBFA 3ND9A 4UEQA 2XBUA 1W88A 3LTEA 2XY4A 4J94A 1P1CA 5IJXA 1KKUA 3TSZA 1K6XA 2Q46A 4MEBA 3GBPA 4P82A 2DWQA 4ZOLA 4FMDB 7ADHA 3JX9A 1TAGA 5BV0A 3V1KA 4UTXA 3RQIA 3V8RA 2X4GA 3NYRA 3OQ1A 4M7PA 3RJZA 1A76A 1IUKA 4F8YA 1G21E 4MB6A 3IE1A 1BMFA 4CMCA 3AR2A 4AJNA 5DMXA 1Q12A 4XIIA 1NP3A 2XDWA 3FNIA 4JU8A 2V55B 3OM1A 1WBBA 4W1QA 3IEXA 5EJ6A 3TUJC 2HI0A 5JV5A 1QHXA 2LDXA 2VRWA 4PSUA 2GB4A 4RVFA 1X13A 3N76A 5JNRA 2QRGA 1E7SA 2Q5CA 1UJNA 2VF5X 1DWUA 4FLEA 4JLPA 1CZUA 2JHAA 2ISSD 1P91A 3G0GA 4ZXFA 4OO3A 5B37A 4A9AA 3DBOB 5TEWA 1JQ3A 4JY7A 4OKSA 1GLGA 1G1MA 2EZTA 2KLBA 1RRFA 3KBOA 2HK7A 2HLNA 3MIZA 4J0CA 5FTJA 1CQWA 1M6WA 3TW0A 4F60A 1RQ7A 2QLLA 2E82A 2FF5A 2V59A 2D06A 3B9BA 3PEVA 1DZ3A 1SR8A 3LQRA 2JI4A 1P0PA 2HHCA 1GKKA 4Z49A 1ZRNA 5IH3A 4LZLA 3TLCA 2P3OA 1BE0A 3N5KA 2JC3A 4Y98A 2C2OA 3FWPA 5EJMA 1UJCA 3OJXA 1WXWA 2JFYA 5IAGA 4EABA 3C8DA 1U5CA 3K9FC 4PLHA 2BJWA 2XUOA 5CA1F 5CJPA 1TKCA 6ABPA 3OQPA 4B79A 3HYSA 5K8CA 5IF9A 3HEMA 1C9DB 3FTCA 4XDYA 3AY6A 4YALA 5HZHA 1TKAA 3BJEA 3KM0A 3D4NA 3L93A 5IJAA 1PLKA 3I64A 2E3JA 1I10A 1Z08A 5EXEA 3TKLA 1M33A 2PD3A 2QX7A 1Q1BA 1KAGA 2PH7A 4XCQA 4L73A 2QTVA 3E6AA 2UZAA 2JHGA 1C4WA 3JWIA 3LECA 1G6Q1 2FWPA 2I99A 2FEWB 2R68A 4NBKA 1K7SN 2X5XA 4TL7A 3M3DA 5BRAA 3WAGA 2P8JA 1PJBA 2AJLI 4F2DA 1YB1A 4CKWB 4BLOA 2IHTA 3NBAA 5AKXA 3O90A 4GBED 3C6QA 2H00A 2XCOA 4Y6LA 1RYBA 2OV3A 4YP1A 2V5AA 3HP7A 3WV4A 4C7BA 1VPWA 4EGQA 3ND6A 1H9CA 4HWPA 5DI9A 4NH0A 4ALMA 4RK6A 3PX3A 1WUTA 3GU3A 3HDTA 1G8JA 4TLBA 5JDCA 3R7FA 3HYCA 5JNSA 4YMIA 1TTPB 3DTTA 1Z06A 1QPZA 1GNPA 3PJDA 3RJMA 3WL4A 1Q0QA 4DCUA 2XQGA 3VBEA 2FNAA 1MAVA 1XHFA 1HOXA 4HGOA 5ALYA 4IX1A 1N2BA 1YZHA 3AHJA 2I2AA 3NZEA 3D3KA 2IYTA 2CMFA 2PL3A 3U7EB 5HHTA 3WLHA 4XM2A 3U7IA 4A10A 1ZCJA 4LVNA 3W9BA 3T0IA 1M8JA 3M5CA 4DUGA 3DDZX 4IV5A 1JG4A 2Q6TA 2ANCA 4W4TA 4CM7A 5ENVA 1FZTA 2QMYA 2NVOA 1D0SA 1QLWA 3G9ZA 1ZK3A 4RVNA 4L95C 3VH3A 1MN6A 3H99A 3HCNA 5LQSA 2QT1A 1E1YA 2BUAA 2RJNA 4CM8B 3IURA 3Q3VA 1FQKA 4GPTA 1GU1A 3UUEA 3NORA 2Z8YM 1ZW1A 1MH9A 2Y1KA 3UGQA 4ENRA 2WWWA 5L7YA 2Q1SA 4EKDA 3G1UA 2PKQO 2A1TR 4FFRA 1U2RA 3ORFA 4MJXA 3K53A 1LNQA 4PR0A 2FR8A 3AUFA 1NV9A 1G21A 2BHLA 2DFTA 1HC7A 4FNAA 1KO7A 5K3EA 4UQOA 1VPEA 1S89A 2QSJA 2B8EA 1K6EA 1Q16A 4FYMA 4B48A 2SKEA 3MWJA 3WBFA 1AU9A 3EIHA 3SSOA 4KWEA 3URMA 3WWCA 1A50B 4RD1A 4ZOQI 2MIIA 1K27A 2QU7A 2HA0A 4LE2A 4RMHA 4YUVA 1YGPA 4N5MA 2ODWA 4RPCA 3M6MD 5IC5A 5B6IA 1GZ7A 2FPMA 4E7PA 1NSTA 4HVCA 5AW1A 2P6MA 4O2LA 2GEBA 2O1SA 2WKPA 3KOMA 3SZOA 3ZD8A 5ARCA 4CLOA 2I9KA 1N4AA 3CXUA 4MI1A 2F3PA 3FI9A 3TYXA 1A7UA 1W1UA 3OEHA 3W2TA 5F2NA 5JDIC 4G0VA 3DXZA 3RRMA 1W6RA 4C6HA 4YCMA 2PMDA 3CLSD 2CMDA 3AY7A 4WKCA 4YTEA 5AW3A 3DDUA 4EWLA 3LF2A 2C7OA 1IFXA 5T64A 3U40A 1HNWB 1FRZA 3T94A 1NI4A 2P9GA 3T9CA 3BFKA 1NKTA 3LS2A 3VZQA 5CURA 3HWSA 4FW8A 3O1IC 2WTUA 1P29A 3DHYA 4E21A 4HUTA 3IIJA 4H1UA 4Q48A 4G1BA 1WO8A 1T8PA 4BCDA 2J9ZB 2F8SA 2DERA 1U7UA 2N3ZA 2DPGA 2HK9A 1NXWA 2BZGA 4NNJA 1J9GA 3N58A 2Z95A 3OURA 1KEZA 4UULA 5EVJA 2OLKA 3SBOA 4MI9A 2Z3ZA 5DLPA 5AT1A 4YMHA 2XOKA 3WGVA 1Y9ZA 2ST1A 1P4GA 1WZCA 4NHEA 4W1RA 4HNRA 2DM6A 1YHZA 2ZKIA 4DM7A 1PR4A 2B2XA 2YMMA 4I5FA 1KOGA 4G23A 4ND3A 1NNI1 2NQ8A 4HEHA 1QCZA 4WY8A 1XP8A 3ZY5A 1KEKA 1ZOPA 1EX6A 1E5DA 2BFPA 2HMTA 2XKAA 2B92A 1QZ3A 2ZOSA 3BF7A 3G1WA 5BXYA 3PFGA 1E1CA 2MSDB 5L6LB 2QD1A 1M6VB 5ALWA 3ZE7A 2O3SA 4BB5A 1G17A 2ZWIA 4G5HA 2J31A 4DMGA 4IDQA 2FXIA 1L7MA 4D0NA 2JCSA 2ZDQA 4JB0A 1Y8ZA 1WZ2A 4GDMA 5FOWA 2C3UA 3T9AA 4N6OA 1RYFA 1BS2A 1OU4A 3OE1A 3TQQA 4EGSA 3CTMA 1BOOA 1HE5A 2GTIA 3BHMA 2P65A 4H35A 5LYJB 4A0FA 4F9EA 1IQ0A 2ZYRA 5ISMA 1UBMS 2EW8A 1NJ6A 1KK2A 3RH0A 4ZMBA 1TLTA 2VYVD 1X15A 5CNJA 3R7NA 2YY6A 1B1CA 1MAAA 2O2SA 1PEDA 4B3GA 4QRHA 2DHQA 2XI4A 4EQ6A 2NP7A 3S8EA 1WMAA 4HVAA 5T6BA 3O8QA 2XE6A 3EODA 1NJSA 3EZYA 4UQLA 2HBRA 3JR3A 2D00A 3DPIA 4XWTA 4D6PA 1JAHA 1XN1A 3L0OA 5JCZA 3ZJUA 4URUR 4L4ZA 1GNRA 3ASUA 1M2HA 4B2YA 2W48A 3ZDQA 4HDMA 1N1EA 4DCNA 4KUHA 2B5VA 1BSVA 1XD8A 3NAQA 1YR6A 2HJ9A 3ZWXA 2YVQA 4QHTA 4ACBA 4YJ2F 2CJYA 3GD7A 2FWAA 3P9KA 3I62A 3OPYB 5MHTA 4C87A 1KZGB 3L40A 3LHFA 3R20A 1EXMA 2BT4A 2FRXA 4R8KA 1ADGA 4ZCPA 3SX2A 1QYVA 4WE3A 1NVVQ 2JGMA 1YS6A 4X44A 1R4MB 2DULA 1WCXA 4TRRA 4MR9B 3JYHA 4OFZA 4R2LA 3N53A 5L51A 2C4UA 3BOSA 5IAEA 4J1QA 3TIIA 2ZYAA 1VPVA 1PTJA 1TMYA 4FMDF 3ZBQA 4FM9A 3V97A 3VPAA 4IZHA 1SEVA 1DS6A 5D00A 3RAEC 4HPJB 1P2UA 5EJEA 2ZRFA 3JAKB 2YV1A 1GRQA 3CX4A 3Q9LA 4PF1A 2PZLA 4P32A 1MQ8B 5DVZA 1EA5A 1IZ9A 1KI6B 1W5BA 4HWKA 3K9GA 4X84A 3IP6A 1S8FA 4HFMA 4RAQA 4GXRA 1GXSB 4GOLD 4FSXA 4ZCSA 1P3Y1 4Y2PA 3DAYA 3G13A 1RCUA 5A4KA 1IBKB 4AY2A 1WDTA 4A26A 4E08A 3VTAA 3CX8A 2BMVA 2OCXA 1LK0A 1UJ6A 2VQ3A 1YQTA 2YFQA 1RPTA 1DC7A 3PWTA 2XT6A 4W6QA 3E3LA 1FW6A 3WYFA 1UWVA 1P0IA 4RCZA 3TPCA 2QF7A 4NNPA 8MHTA 3LI2A 4QARA 3F7OA 1Z5UA 3KQYA 5LQDA 4KB5A 4LWQA 4DNXA 1JFRA 5AOAA 1HM5A 4AN1A 2XUKA 5JFGA 4UBOA 1VA4A 2F64A 2V0NA 2EFHB 3B6KA 3BL6A 5D3ZA 1QRRA 5A2QA 1W7AA 2QXUA 1Q3TA 1QP4A 3WL7A 5I4KA 3BTVA 4IY1A 5FT9A 2ATVA 5L6MB 2OG2A 5CHEA 1UXKA 2HMUA 4U5QA 3RUDA 2IYOA 1W34A 1JXOA 3WRYA 4NDNE 1AO0A 1X94A 1Z2DA 3IXMA 3LA8A 4N0PA 4KREA 3TUIC 3ZU3A 3C87A 3UATA 2B7LA 4E6PA 2J9FA 3FHOA 2QM7A 4EHBA 4K9RA 2HJHA 1UDRA 3LU1A 4JGBA 4DV2B 3IDAA 4M53A 2XYHA 4A0GA 5HQ3A 3OCZA 2FMUA 3TEJA 1KO8A 1Y37A 4PAOA 4BKOA 3B1FA 1AGNA 4B87A 4I1YA 2KX7A 3V4ZA 1Q17A 4ITUA 4CKEA 3LZDA 2XMDA 4Y0AA 4RQAA 4YRDA 4JBNA 2WTAA 4Z1MA 1QK5A 3EY4A 2OXFA 4KR2A 3PDHA 1SEPA 2BBOA 3HR4A 5EIBC 3UT6A 4AJPA 4DW8A 2A9RA 1RIIA 3H11A 2EKBA 3W6NA 1PT8A 5B1YA 5F2OA 1DKLA 3PRKE 3SXUA 4DDTA 4IP0A 3AJAA 4NX2A 4CV3A 3FHTA 3D1JA 3GCZA 1QE3A 3M0EA 2AT1A 3QJGA 4IOLA 5AH0A 3ZE2B 1FFXA 4N5IX 3UW3A 1VJ5A 1M34E 2FMFA 2BM1A 4MHOA 1CZRA 4RLFA 5T8KA 1DAKA 4FD3A 4EHJA 4IDDA 4F2PA 4FBGA 1WQ1R 5AESA 2JI6A 1M5UA 2ODNA 4YVFA 4YB8A 4IYRA 4QUEA 4U1RA 3KSBC 2QTVB 1UF9A 3EAQA 3IT3A 1OWOA 3KHUA 4U7GA 3U81A 4CL2A 4DLAA 1J0BA 5J1SB 1PQUA 1JKIA 4DLZA 1WOYA 3K8ZA 2CE7A 3WSWA 1Z0AA 3DCNA 3CRNA 4RKEA 2ZSAA 1HQDA 4M1MA 4UHKA 1Z5GA 4MA4A 3M4XA 4D4JA 1V1RA 1JG3A 1J7KA 2V7UA 4BMNA 4G89A 3S70A 1XRJA 2VP2A 2Y93A 4JH0A 4KAJA 1EK0A 1G5HA 3DFFA 3SN6A 2IS6A 1G42A 3AKZA 1NSFA 3TKYA 3E7DA 3NP9A 1K5HA 1BXGB 3DMFA 4Z0TA 4A4DA 5B2FA 3LVFO 3JYNA 3LDAA 1U5BB 4PZZA 3HFRA 1GKYA 4CTOA 4TUYB 2F59A 3OU6A 4ER0A 1FUKA 2O1XA 2OHFA 3NBFA 3IUNA 4EUKA 4LI0A 3IT2A 4H7PA 1I4WA 3TNJA 1Z0KA 2VQ6A 3EH1A 3SHOA 5K09A 1PNRA 3W34A 3SF8A 3DL0A 1FFGA 4KO1S 5B3JA 3THYA 1JFFB 1DIGA 3GHYA 3DHWC 3CZCA 1RSZA 4I1UA 1HR0B 1XZMA 1WM1A 4OLHA 4YT4A 3IXQA 3VR5D 1Z37A 4BJ3A 1JQDA 3PF8A 4ITRC 4P84A 1SU6A 3ZC3A 2OZLA 2QHXA 4XAQA 4GW3A 1MG5A 1ZKMA 3OX4A 3KEQA 2P9ZA 4IHAA 4TLAA 1PZNA 4J3NA 3JASA 3O2QB 5EKUA 3B1XA 3BK7A 3IVRA 5FOUA 4E5MA 3C5CA 5HQTA 4HXEB 3OQMA 4DUYB 4WAUA 1EZZA 1G21B 4A36A 3UO8B 1DE0A 1KU6A 2HOQA 2DWOA 2V6IA 1D6JA 2VDQB 3HC7A 5IVPA 1XAIA 3B2NA 2VEDA 1ZJYA 1O5TA 3S2IA 1U3UA 4FNMA 5E1MA 1XNJA 2ZLBA 2PK3A 4YP0A 3JD1A 3AVOA 3IIIA 5FB3A 1NZFA 3CF2A 3OC0A 2X5NA 1GKIA 6CHYA 3O83A 4BCBA 3L7AA 4G3XA 4N7JA 4QOIA 3SX4A 1J24A 1KSFX 1LSSA 4P2BA 1J25A 4IIYA 1NKSA 2O7RA 1ID8A 1KDVA 3SMQA 4O4HA 1VHDA 2AJDA 1DELA 2VYQA 3T8YA 1L8OA 4NLLA 3BMCA 5BNIA 5ELXA 1QE5A 5F51A 1NI4B 4ILKA 2QL6A 2PN1A 4NU5A 3L4EA 1CPYA 1FRFS 3O4VA 5ER6A 5CBPB 1IJEA 2JJ1A 1DMSA 3OCCA 1Z6ZA 2OHOA 2Y27A 1O08A 1WOMA 5JEEA 3H2IA 1TPYA 3I01M 4Q3EA 2ZE6A 3TD6A 1VB5A 4XYMA 1YU6A 3TR5A 1JTVA 3ROFA 2EG5A 4I4TA 4PG8A 2G1PA 5JECA 3EVFA 2VZ8A 3GJ3A 3IQDB 5ETJA 4RH1A 1R0ZA 3P9QA 3WRXC 4EJ6A 1NUTA 1ZGCA 1RI2A 8LDHA 4OHPA 3BMOA 2WP8J 5B3KA 1U0BB 2IJGX 3D7LA 2PH1A 1M34A 2TRSB 1FIUA 4OCZA 5KOHA 3TXAA 3DDNA 4GOXA 5CXUA 5LYJF 3VHXA 4XR4A 4BQOA 4DLBA 5E9JA 8GPBA 1L4KA 1JI3A 2XE4A 3AXTA 3E7PA 4UHEA 1B2LA 2VSYA 5JBIA 1IUOA 4FE3A 1KAEA 1N3BA 3O9MA 3HN2A 2I2BA 3ELYA 3PNOA 5CFQA 4YYEA 3R3ZA 2PXCA 3GGGA 2FPRA 3L6RA 4CFZA 2FDRA 3U5ZB 1WNFA 1P81A 1E1NA 5A4JA 2V0GA 1G5PA 1OZHA 2XYQA 1QG2A 2Z1DA 2AG1A 2ZYUX 3RIHA 4D0GA 1N5IA 3WICA 2R79A 4TXNA 2ZE8A 4P4UA 4OFXA 2C3MA 3HFSA 5NULA 4A73A 1QHGA 4OB7A 4AQDA 4BBJA 3OZGA 1ST3A 2IDKA 3EUWA 4V24A 5E2IA 3WK7A 5DHPA 3GYGA 5M3BA 1QC5B 3ZFQA 2GZMA 3NTXA 3GK3A 3HZZA 5BOVA 3RIXA 2MYNA 1VKNA 4TMKA 5LM3A 3OECA 3ETJA 3I5AA 3ONEA 1YJCA 3PPXA 3AF5A 3IPRA 2IOYA 3V8MA 4CM1A 3KTAA 1T5DX 2HUPA 4P92A 4AN4A 2JEOA 2W6NA 1KIMA 4C7JA 2GAOA 1KERA 1LVHA 2QYSA 4NOJA 5FWXA 1LBEA 3WWDA 5JSYA 5JRJA 3VR3D 4XQ9A 3VI3B 1IAQA 3TE6A 5AI9A 4JOCA 2DY0A 4P83A 1XTJA 4Y7CA 3O8QB 1SUWA 1GCGA 4LJSA 1R8SA 1SXGA 2GETA 1EDOA 1GZDA 4WL0A 2Y6UA 4HZGA 4BV8A 3BXGA 2IWRA 4BO2A 4ESOA 2PLRA 1B23P 5DBFA 1VRVA 3DV0A 1IL0A 3EDYA 3AI1A 4IRMA 4KXWA 4TTVA 1E4YA 4HDMB 4MVJP 1ZXXA 4KNWA 3BJRA 2MSCB 3VPHA 3BMQA 4AP6A 2ICAA 4HJXA 5KYKA 1Q0LA 1S1CA 5LMCA 1U5AA 1Z07A 1YZNA 3ND7A 4C5AA 1R6TA 3IA2A 1RIFA 4LYEA 4HC4A 4IFEA 1FDVA 2QLMA 5D5PA 3UMFA 3SQDA 1D2CA 4KQ9A 4TWRA 4XEHA 1ZCAA 2WVAA 2E18A 3IQFA 4JASB 3OY2A 1VBFA 3O4FA 3ZCQA 5ED4A 1MX5A 1P39A 5TF0A 1ISSA 1OY1A 2CXSA 4QO8A 1NY5A 2CHUA 3PLNA 1HKUA 1BTOA 1UKCA 2FSUA 4BO6A 4D4MA 4UCWA 2P9TA 4DADA 2IBSA 2PL9A 5AW6A 4ZQHA 3VHLB 1U1CA 2XA2A 3OX2A 1I8TA 1Z6QA 4BVLA 1NPYA 4A7PA 1MTOA 2PRJA 1MA0A 3L82B 3TLMA 4Y6OA 1CD5A 1KDTA 4WY2A 1JBEA 3LYUA 3LCUA 1EFUA 1PWZA 5AKKA 3AUKA 1LTQA 4AKEA 2R7AA 5F3RA 5CT6A 2QL9A 4II7A 4UUAA 3U9TA 2CXRA 3V4SA 1KI8A 3G2LA 4CFSA 2ZYDA 3CB4A 1RHMA 1V25A 3D6JA 3M1AA 5DTJA 1N57A 4CMJA 1ZRHA 3GQBA 2AI1A 2XMSA 2JD0A 3HGTA 4MV8A 4QSHA 3ZFUA 3RYIA 1NVWQ 1WKBA 4FR2A 4BWVA 4DZTA 5D51S 1Z75A 4MS4A 1RWKA 1N8SA 4KAAA 3EGEA 5FNVA 4ZJZA 3ER9A 2E1PA 2Z8XA 1W48A 3K4PA 4ZVUA 2JAPA 5A1TA 1OFVA 4IVPA 4N8DA 5IAAA 3RQSA 4FN5A 3VQTA 2WF5A 3LQ2A 4K9OA 4HHEA 4TXMA 2Y0BA 5L3QA 4B32A 4N6GA 3P9ZA 3I1IA 1WKCA 1V6CA 4AG6A 3EUEA 3N8DA 1MOQA 1OAKA 3MD0A 4AG5A 4NBRA 1PI3A 2WHPA 3T12A 1YUMA 1N36B 3BTSA 1PF7E 1V7PC 3A25A 4FUTA 4O6VA 1E6UA 4Y6RA 5CJ2A 3CNNA 2W8BB 1YBHA 3UANA 1POXA 3FDZA 4GM4A 1I32A 1VJRA 2JAQA 1KY5A 4PC7A 3ZH2A 5L4NA 2J9FB 4RJTA 2CXNA 1AB5A 2XB4A 4G4SP 4BQEA 2QVCA 3E3OA 2ZUWA 5CX1A 1GL7A 1I5RA 1JSZA 1Z4MA 3EIWA 1QH0A 5AM2A 4A6XA 2BFDA 5IZ4A 2WQZA 1I3MA 3IJ5A 2DPXA 2ZIZA 2X2PA 5H1YA 1ULUA 4XOUA 5D84A 1RHKA 1XO1A 5CTJA 3R7WB 3TL2A 2QRLA 4Q9AA 4EELA 4ZT6A 2YHSA 5EKDA 1F8UA 1XZQA 4H1WA 1EPUA 2ZRLA 2XGMA 1OI2A 4LXTA 3GH3A 4CM6A 1GPH1 2P9FA 3H11B 3Q7TA 1VHWA 2VF7A 5DGCA 5ITSA 5M29A 3GJYA 4L28A 5CX4A 5BN3B 2QUAA 1USGA 2QR2A 2JZNA 2YS6A 3D7MA 4WKPA 3SXUB 4HS4A 1C2TA 4WK6A 4OA5A 3WI7A 4CKYA 5CB8A 4W9MC 3GLGE 1AS3A 2PCLA 3KB2A 4WXPA 3ZDBA 4FQ7A 2BFOA 3WLFA 3WMFA 3HQ4O 4PX9A 4DLSA 3RUCA 1FFXB 2VQEB 3H9GA 1M9NA 3TECE 1IWOA 3FOZA 2W6JD 2HLDD 4AIIA 4JQOA 1WU7A 4XLLA 5CJJA 3IDZA 2J3EA 3DVAA 1AUVA 4TUYF 5FV7A 2E4ZA 1ZEJA 2P67A 5KNCA 4DR1B 4LHEA 5HBRA 3Q8KA 3N0RA 5KI6A 1NJ8A 5DCUA 3TLYA 1IXZA 1P5ZB 3O2NA 5A7GA 4CIBA 5AJUA 1CR6A 1S9DA 2D1QA 1T6NA 2JF0A 1E8NA 3QEJA 3R5FA 4QWMA 4RFSA 1PGNA 2QX8A 1ARZA 3Q7IA 1S2LA 4I5IA 1JLHA 2O8EB 4WZAB 2O8FB 1NC1A 2YJGA 4I0WB 4FS3A 4RCVA 3RUFA 3NV7A 4KL8S 4YMVA 5K0SA 2J41A 3D0OA 2Q2VA 2UYCA 5P21A 2CF6A 5SYNA 1S2NA 3L41A 3LHIA 4ID9A 1U28A 5JMPA 4HFNA 5JS2A 2PO7A 3BN3A 5BPHA 1C0PA 1IIBA 1YQUA 1PT6A 4L3VA 1MEJA 4OGGA 4TN5A 4TSFD 4TT8A 4XB2A 1PVDA 3JW8A 1X8XA 4YQFA 2R1VA 4QFDA 2BBSA 5C7IO 2AKYA 2IT1A 5MDHA 1VCMA 2VF8A 1AQUA 2C1ZA 4HL6A 3FMPB 2XHEA 2O3TA 3U13A 5L4SA 1E9FA 3CLUD 3EF1A 3R3WA 1P1JA 2ZTSA 4ZYXA 4XQEA 1EVYA 4MRSA 1F60A 1FVFA 1U6JA 3Q7QA 5FHRA 4Y67A 4HNUA 3G7UA 1VM6A 3O3OB 2OOSA 3SQXA 1UMCA 2HQOA 3PS9A 1DTSA 3KSZO 3KB1A 4W7IA 1OFUX 1WW8A 5A2GA 3TUZC 3X2FA 3KAKA 2GA8A 4RL6A 2K87A 1J42A 3W3AA 3O21A 4F1KA 4F86A 4PZ9A 2R25B 4UUPA 3GLUA 5LBTA 1FNBA 2PEYA 4FFNA 1E2GA 3GOQA 4HDSB 2W6ZA 4Q3LA 5H4HA 4NULA 1QKIA 3BSYA 1PGOA 3MLBA 5F7ZA 3E1GA 4Q5IA 2PMBA 1QANA 4XJSA 2O3QA 3BULA 3TNYA 5CEFA 3D6TB 5KJCA 1FMFA 4JA2A 3GBVA 4MQBA 5CTAA 4YI5A 5ESDA 3LT0A 3DE0X 1D8TA 1JMVA 2XE8A 4FFDA 3JD4A 3U7QA 3PGMA 3VR4D 4NZ9A 1L6IA 4FYYA 4YA6A 4QGBA 3ZGNA 3ZQ6A 1P9LA 4PQYA 4JJAA 3P9XA 1M2JA 3KJZA 3K09C 4N8SA 4F72A 3NR2A 5AM3A 4O33A 4R6WA 2Z6AA 3WDLA 2B4KA 2FR1A 3FKJA 4KBFA 1YFJA 3DEJA 4MRNA 1QIJA 4RKYA 3B3GA 3U1BA 3ONDA 3PL1A 2OAGA 1H0KA 3BMCB 2OTCA 2AGVA 3KEFA 3K15A 1WBJB 3AEQA 1AT1A 3H2HA 3ICPA 4FT4A 2ZIVB 4FZ5A 1JKFA 2PMFA 3KEMA 4YXFA 3TFQA 5JSUA 1NF9A 3FX2A 3Q40A 3VU9A 1XWWA 3VPSA 2IELA 5CITA 1C8BA 3DHNA 3GVCA 5J2UA 3E1KA 2A9PA 4MV3A 5IW8A 2QOEA 3E5NA 4I4TB 3TINA 1JI0A 3M9LA 3GLGA 1L7OA 3HJAA 1O57A 3ZGLA 3DTVD 1ZMRA 2PR7A 1K0FA 3TE7A 1OYWA 3FMOB 4Z8XA 4WOCA 4DCGA 3NDBB 3JVDA 3BMOB 4L72A 3SC4A 2ATEA 4Q1EA 1M34B 3EWSA 3MILA 1XRNA 4BMZA 1LI4A 5KOHB 4Z8YA 1NJGA 5ALOA 1P2GA 3GP8A 1G20A 2C61A 3DD1A 3VHXB 4UNRA 1B8UA 2GN1A 2DFVA 2GSDA 1X3LA 4OXKA 4Q3AA 4P7FA 2OHVA 2YC2C 3OFKA 4I36A 4TQGA 2O2DA 1NRIA 1RJEA 3BTUA 3G23A 4QJ5A 1N2ZA 4Z51A 3K2IA 1NC3A 1JAIA 5AICA 5E6SA 5FUQA 2RH9B 3UMYA 2EVWX 3LGXA 2I1LA 4F12A 1K3FA 1TVFA 1BWSA 1CS4C 1Z4OA 4R7GA 4ZMRA 2VZLA 1JSXA 2JLAA 3DE1X 4QBGB 3ASZA 5EQDA 2UUCB 2DZDA 1XZEA 2XDQB 5M04A 4ZQBA 3LQ1A 1GSIA 1T8YA 2VK1A 3EASA 2X42A 3E3NA 1F8XA 1AMNA 1G7TA 4YMUA 3L9WA 4KYVA 2OPHA 1RQXA 5J40A 2XQIA 3NYIA 4YXWD 3H17A 3VZPA 1W9HA 1UPCA 2JANA 4D46A 3IV9A 3I9OA 4EW6A 2ET6A 3WNDA 3OJEA 7MHTA 2WJVA 5LQNA 1M5TA 5KVAA 5HRUA 1Y1RA 4FSHA 4P31A 1ORWA 2W2QA 1IZZA 3HBJA 1XK6A 3O8LA 3NHYA 4R81A 3BWDD 3FZEA 3L1VA 4KX3A 2I4NA 4B44A 1DMRA 5FWXB 5JZSA 2WU3A 1XE3A 1D1TA 1FXWF 2CNLA 1PVVA 1JHDA 2M98A 4BGUA 3THWA 2PUBA 1WP9A 1Q0PA 2EIXA 2X23A 1M0SA 2RH8A 1GYQA 4EKEA 5BQXA 1E3TA 4S1WA 3QXXA 3MRTA 3N8HA 1EWTA 3OZCA 1XV5A 1MAUA 2AG5A 2F2TA 2GCOA 2J5RA 1R0RE 2IVFA 3DV0B 5GM1A 4C2UA 1VCOA 5IK2D 2OYSA 4F6CA 2MT9A 1QYCA 5B30A 3GLFE 3GP3A 5I9MA 3BMQB 2ZTUA 3AEYA 3V46A 2AOXA 2HJRA 1CY6A 3MOIA 4DNPA 2KI5A 3KKEA 4TYYA 3KZVA 1ECFA 3K70D 2MSEB 4BN4A 4C6TA 2C03A 5F35A 1H8ED 5JJLA 4UBNA 1MJ5A 3EZXA 5DDIP 4UTPA 1DO2A 4NYIQ 3Q98A 3L1UA 4Z2AA 2R47A 1TJ4A 2AN9A 2FKAA 4XE5A 1KJZA 5L95A 4DV5B 3SE0A 5LQUA 5JQWA 5ALTA 2OCIA 5CM9C 3MPUA 5CA0A 1KZ9A 2XCTB 3IAAA 5IAKA 2QVGA 3TZKA 3O8DA 1BD4A 2CVHA 4MAMA 1TVMA 1FQJA 4KQCA 3B78A 1NASA 5IS2A 3AVQA 2LCFA 5AVOA 1FTGA 2GK4A 1TA4A 2HJGA 2N47A 1LQ2A 4R2WA 4S1PA 2GYYA 3OX3A 5DXFA 3WGYA 1FMLA 5J5VA 5CH8A 2D0DA 2RB4A 4JB8A 5G4LA 1IE3A 4QUAA 4U7DA 3ZDRA 5TQ0A 4ZI2A 3ANLA 1E9EA 1EK5A 1QYRA 2WR8A 3GVXA 4MUAA 3QVTA 3VJMA 3ROTA 1L7XA 1G64A 4JX8A 4E5DA 3GQBB 2FYTA 3LCRA 2UYGA 4HAVA 4XD7D 3VJRA 4I4CA 4EX7A 4H3VA 5EE5B 4F38A 5I4IA 3P2IA 4MS4B 4E0BA 3HN6A 4G1VA 4MLCA 1OI4A 4RUKA 4D97A 1R9JA 2PQMA 3PQ2A 2AK3A 4MGKR 4ZKDA 2CLDX 2J9RA 4M2LA 3VM6A 5FUYA 4H0CA 2GBFA 3FFXA 4I1IA 5DYTA 5C3UA 3C3KA 1NI5A 3IBTA 4E7OA 3ZHSA 2RIPA 1TUIA 5IXYA 1JHRA 1RKVA 3KSUA 4LZOA 1YKGA 3DD5A 4MGHA 3W7AA 1MDFA 3L7KA 4Q4JA 3WLTA 1DCFA 4G0UA 3O3NB 4WD3A 1D2HA 4LDZA 5PNTA 5J4VA 3CE6A 3EEIA 1HYEA 1WWKA 1X0XA 3EZLA 1CRWG 2AE2A 3H9QA 3DEFA 1HDRA 2ZIAA 1T6XA 3JQ7B 4C1BA 1F1BA 2D2EA 1GQSA 2CVZA 1YVRA 3EFEA 3FDZB 3A1WA 4QYIA 3GEDA 5J5CA 1JVNA 3RFUA 2GAFA 5T7BA 2K2WA 3QLJA 1YVEI 1RE0A 3B1WA 1EWVA 1DJMA 2CCGA 2R4TA 2XF8A 5BNZA 1W85B 5IARA 2IHZA 5FBKA 3TX2A 4FHGA 3T54A 2BFDB 3CONA 5JY1A 2C7PA 5H02A 4EVQA 3PC8C 2GXUA 4PG4A 4EYQA 5F21A 3QI2A 3M4NA 2R6AA 1YC5A 2EJBA 3OIYA 2CYCA 1XKQA 2C4WA 3NALA 2D6FA 1VDMA 1XRMA 2YJNA 3AL3A 4EMTA 4OL9A 3Q8WA 3BREA 3SXPA 4FGUA 1JTEA 1K6JA 1PWXA 3H9JA 3OTWA 4LGYA 3EVZA 1UIRA 1NYRA 2F3SA 4GGOA 4MK4A 2X9VA 4RA9B 5CVJA 1CTQA 4F6LA 1XVLA 1W59A 3OQNA 3BGWA 5IJWA 4JDUA 3CVWA 3MTEA 5KMGA 2GXSA 4UOEA 1NVMB 3PDWA 5JNWA 1E0DA 1STOA 3H7IA 3NETA 1Z25A 4RMJA 1I9GA 2QRVA 1E2LA 5K0ZA 1EXDA 2CLCX 2GHTA 1OLXA 1RZRD 3QNWA 3V4FA 1X7YA 1A4UA 1PDWA 3HA3A 3VZSA 4QZVA 2IYYA 3A9WA 2IS4A 4J1NA 3ZOKA 1X8LA 3GN2A 4X66B 1G41A 4KFTA 1AOXA 1Q1NA 2O5RA 5CD9A 5KC9A 1NTRA 4PIVA 2O59A 2J5QA 1W0JD 3PXUA 4HGPA 1WXEA 1T8WA 2VXBA 3FJ1A 3H16A 1ONPA 1AN0A 3NT2A 4MMXB 2YRFA 1TJ3A 4RFSB 2H5LA 3MJRA 3ZIDA 5K0GA 4HPXB 2AH5A 3P32A 2LZ0A 3EG9B 1JE0A 4YUAA 3FN4A 4XFKA 3CG4A 3KRTA 2PM8A 2QN2A 5B7QA 1FBNA 1NAHA 2F1HA 3HV0A 1U9IC 4Q4CA 1MC5A 2W2XA 4K6CA 4PO9A 1O94D 4FKMA 1GCIA 5F5XA 3TCXB 4IDAA 4BO8A 2ZB2A 3NH9A 3WQQA 2OSVA 3VVCA 3AF0A 3OCXA 3FYSA 1DIAA 4KN6A 1SHJA 2YXPX 2NU8B 2BFCB 1XTVA 2C9DA 2R1VB 2I87A 2NZWA 3HJNA 3NUGA 4AYXA 3HKEB 4F3TA 1OBFO 1VIDA 2G09A 4RCYA 4UUQA 2AVDA 4QJIA 4DMKA 1QE0A 5ALXA 4O4JA 2PU7A 4CCSA 2QRJA 4HX5A 1CY1A 4QECA 2ZSKA 3ZY6A 1IIRA 5FA8A 4REQA 1RMTA 2Q1TA 5J47A 3SWWA 1TVEA 1E0AA 4Q24A 3AILA 4DC1A 1ZI8A 5BSWA 4J7CA 4TYNA 2C00A 2BGJA 2X8WA 3A1EA 4C4OA 5GGYA 1RQGA 1ZESA 4UTOA 3ROXA 3FTQA 5KYYA 1Z0ZA 5IUKC 3MBIA 4ZI5A 1T3LA 4RH3A 4W5WA 4M9ZA 3GRAA 2HA2A 1OV6A 3EXIA 2DQ4A 2PKCA 4HWGA 1O97D 4NZNA 1Y4DE 4QU8A 4CMHA 4UARA 1EP2B 2X13A 1O5IA 1CLUA 3KJEA 1E7QA 3QIVA 4YHBA 3TRFA 2G9RA 2IGBA 2BEJA 4DAOA 1DBQA 5KAPA 3TD2A 5JYDA 3U7QB 1GDTA 1QZTA 4D8XA 3EVBA 3G02A 5B2EA 3ZHZA 4HYEA 5AVQA 1F2UB 3X1DA 4LHSA 3W2GA 4TQAA 1ODTC 4D6XA 1U8FO 2FUG6 1KYXA 2IEBA 2JIQA 3RFCA 1VRWA 1O6BA 1RQPA 2AEMA 3A4TA 4I4TF 3E2IA 4MIYA 4UXIA 1TX4B 3FUXA 3IA7A 3LFUA 3OO0A 2P9CA 4IWNA 1PR1A 4C0KA 4D3ZA 4RSHA 5JBNA 2EWMA 5JSQA 5MF6A 1EUYA 1KBQA 1PHRA 1PNQA 2A86A 2BEUA 2RHGB 4N0MA 1KI4A 2YFKA 1IWPB 4URYR 3VPGA 3WRXA 4CRWB 5LJLA 2W42A 4I3FA 1JHYA 3I5UA 3G2HA 4AWXA 4R83A 1VPDA 3WIOA 4P80A 1WRBA 1FU7A 4MRRA 4EA7A 4DBVO 2FW8A 1BQ3A 2Y99A 1FDSA 2G1UA 1TW2A 4MJ7A 5DW3A 1SXJC 1T1GA 3I37X 1U9ZA 3AWDA 1Q14A 4LRWA 1QGYA 4QUIA 2X41A 4MVJF 1RYNA 2FDXA 3VU9B 3G79A 4OY3A 4TL8A 2FW7A 4IIBA 1ZN2A 3UQZA 4IMRA 2G5PA 2DH6A 5GY7A 4B2IA 4TZ0A 1OFUA 1UXJA 1HYGA 2UAGA 3AR7A 3CUSA 5EJ5A 2QIPA 2F9LA 1DBVO 2PSEA 3E58A 2MCFA 4MUJA 3EQ8A 3D0RA 4B1FA 1XCJA 3L9XA 4MWTA 4YRGA 3CEAA 2BW0A 3WIVA 4O2AB 4UPDA 2JATA 4YPFA 2W7TA 4UHFA 1CB7A 3OIDA 5IX8A 3HY6A 2W2LA 3DOUA 2Z1NA 2V9ZA 2PR2A 3U48A 3NS7A 1AKTA 1Q95A 1TRHA 2BFMA 2EZ8A 2G3YA 1Q21A 4UVDA 4C01A 1IK4A 2Q2WA 5CYFA 5FBWB 1I7QB 4U2KA 1R8JA 4P33A 5AK3A 1PG0A 1C2YA 5U4XA 1VMKA 4AAYA 1ZYUA 2ECPA 4NV3A 5LDGA 3GJZA 2X0FA 3L0ZA 1GGJA 4EA9A 3GMTA 4EYGA 1D07A 1E9RA 1U63A 3IAXA 4RY0A 2HIHA 3SSAA 3TNDA 1E3WB 1PSWA 2OCYC 1U3VA 3WIBA 4CLRB 4GLOA 4HFRA 3T7JA 1OCEA 1A8HA 2NN3C 2YHUA 3CTPA 4IUDS 4ZVNA 3RPEA 4AY4A 4DJ5X 3FFBA 3U3KA 5BYAA 5I7VA 3VFDA 1E3SA 4B0OA 1R5JA 2VHTA 4IILA 1NXTA 2AXQA 1KZYC 1O8CA 1C9EA 2M6LA 5JNVA 4ZHQA 4OI4A 3GLRA 4IJWA 1JR3E 3W8NA 5C80A 2GRAA 3ZD9A 3MA0A 4MV5A 1W19A 5KS2A 4BY9E 1N2JA 3GRKA 2MU1A 4Q1FA 1XRSB 1TO1E 3HTXA 2O06A 1N6PA 5BSUA 1IPHA 3LPAA 4ZVTA 4ALNA 2FX2A 2H1WA 3HGQA 3NBYC 1B76A 4EIWA 2IZ5A 2QM0A 2JGEA 3C4VA 3FW1A 4HWTA 3AFIA 1H2AS 1O9HA 1BW9A 1YAHA 3OOWA 4EBBA 3THWB 4KRGA 1TMOA 2RGUA 5FBZA 3FYUB 5HRCA 2V96A 4DRZA 4CM5A 2YOFA 2ODAA 2DLDA 3RUPA 2P11A 2ZYVX 5HOQA 1LLQA 3ACCA 3DOEA 3V8EA 2AN3A 1OREA 2C1XA 3UV6A 3ZGZA 2GCOB 3ICCA 4MYDA 4MS3B 5IDYA 2PSFA 2XRMA 3DOOA 2ZBEA 2EFGA 1AKQA 5A3RA 2PD4A 3GGOA 3G5AA 4CWAA 2ZWMA 4JNCA 3WG9A 5CLJA 3TRDA 4L6AA 4V2UA 3HDGA 3KOUA 1ZJ4A 1BH2A 3GWZA 4KI7A 4MQ4A 1GFIA 1US8A 1UC4B 3WKBA 1NBMD 3IUEA 3ILVA 4MKGA 3FSGA 3B20A 3WL8A 3E82A 3EZNA 3U3JA 4ALJA 1IVNA 1YQWA 4X6UA 5EJ4A 2GUGA 4DN6A 4DDMA 4M4SA 1QAMA 4D2IA 1D4ZA 4X41A 3F71A 4LY6A 4Y0VA 4Y6QA 5CVVA 3I6IA 3HBNA 3DE4X 4QVIA 4KMRA 1I6WA 4M37A 2YBDA 2P2ZA 2R751 2F62A 5E2BA 3ZD7A 1WVGA 1XROA 4DWVA 3DLTA 1U3WA 2UZ1A 4RF5A 1KVTA 4EG1A 1ZI6A 1EVJA 1MIHA 4JQCA 1Q77A 2Q3CA 1GM5A 1HORA 1BGVA 4WCDA 2BLLA 1KXZA 3RVOA 1ZLXA 5BUZA 2XVAA 1KTIA 1QCDA 2P3SA 3WMEA 5TQ0B 4M7WA 3W8FA 3T1NA 1L8LA 3LPLA 4J3JA 2QD3A 1C3OA 2YNMC 5BO5A 2AUTA 3RV4A 4YMTA 4E4RA 4IQ4A 4ZEMA 3W5SA 5JWOA 4RTPA 5JBQA 3OT5A 3ES9A 4BAGA 4RHXA 3GRZA 4R9VA 3AIMA 4LJAA 6PFKA 7AT1A 4B6QA 4M1WA 4M1ZA 1S01A 2ZCUA 3BAFA 5DCLA 2A1UA 4MB2A 1Q6ZA 4XFJA 1WULS 3ZCRA 1AX9A 2ZE5A 4LSGA 3KYDB 5FPKA 1NVXQ 4EW2A 2JGFA 4R68A 4BKRA 3IE2A 3K0CA 4GWLA 4H4CA 1MVLA 3DLBA 2DQYA 1YDGA 1WUYA 1ZQ1A 4FX2A 3IX7A 3MWDB 4NQZA 1LQTA 1FYWA 5KTMA 2ZAOA 2QORA 4ZEVA 1TM7E 4EKGA 4IJ6A 4G85A 3QPAA 5ITVA 4QEKA 4D9HA 2M1ZA 3VO8A 3SEAA 1DEAA 3IRUA 1V8PA 3W2IA 3PVZA 1JSCA 5AJYA 3V4LA 4GRIA 4QYIB 4YAOA 2NPFA 3SXJA 1C1HA 3I9LA 3TXXA 5A4AA 5G1PA 2FCRA 1XVAA 2OL4A 4O4IB 4OQDA 1K7YA 3ICOA 4Q1AA 2EOAA 1UEJA 3T95A 3OLZA 1TK2A 4FR0A 4DNQA 5GTDA 2FN8A 3T6KA 4EUSA 1S3IA 1GV1A 1JR3A 1V43A 2BV3A 3L3BA 1UJ2A 2REQB 5HILA 4PONA 3MYYA 2INGX 2NOAA 4XLTA 2JIZA 3LSTA 1IZ0A 4XZ3A 3DE5X 3TB6A 2DEUA 2C3PA 5TQJA 1K4YA 4IICA 1RC1A 4XRGA 2A8YA 3PQ5A 3STVA 1XMQB 1G2QA 2C5GA 4AW9A 2BYTA 1HL7A 2GEFA 1OH6A 2Q5IA 3T3NA 1IOLA 1WX1A 1UADA 1DOZA 2MDTA 5F5LA 3SY8A 1DEHA 1Z62A 4LFAB 3QPUA 3FIJA 4HH4A 1NJFA 4AK9A 4AX8A 2GPWA 3QHAA 4QDZA 4EB0A 5FJJA 4F4IA 1S2OA 2HSEA 3PFKA 3UJBA 5KMGB 1NOJA 4NNOA 3FPFA 1OT3A 4F3CA 5ERGB 1BX0A 2WMYA 1XQVA 3T7KA 3GLFB 3SDSA 4RESA 1PK8A 4J16A 4C7OA 1KWGA 2VOJA 4G63A 4JJIA 4OHXA 1DUVG 1LBQA 2P40A 5D86A 5AKGA 3RREA 4EG5A 3RYCB 4JWKA 4UDOA 1Z2CA 4LTMA 3G0CA 3GFSA 3V55A 1U2EA 3WSTA 2AR7A 2IEGA 2FGKA 4FZVA 4JJ7A 2BSAA 2JCXA 1DIHA 2IOQA 1MU0A 1SCBA 4JOQA 4OX9Y 1EXNA 4QPNA 3NAMA 1QF9A 1VMAA 3PC2A 2H5JA 2Y0CA 3DNMA 1QNFA 4Z6KA 1DEXA 2QUIA 1CG6A 5JD3A 3FWHA 2PE5A 1T3HA 3BCSA 1QB8A 4PZPA 1M0WA 4MEAA 2QW0X 1NFRA 4HATA 4PZCA 4D99A 4D0SA 2GPTA 5KNDD 1B8PA 1MT3A 1AKVA 4FGLA 3N28A 3EQ6A 4ZAYA 4DCMA 4QLBA 3SP1A 2CNBA 3R44A 4KR3A 2HV9A 2RBKA 2ATXA 1Y3FE 1H0SA 4UMEA 4EG7A 3GFOA 5BUCA 1NIPA 2AQ8A 3AM3A 5CHYA 2V7BA 3UAXA 1W1WA 3WGOA 4QOGA 3KK0A 4A6EA 1Z83A 5J3JA 2GFHA 3RM3A 3T1QA 1FF9A 1Z35A 1UM9A 1WVMA 1ONSA 1YNSA 3FZYA 3QF4A 2XKJE 3N2GB 3ZKWA 2O5EA 5CT4A 2RK3A 2H4JA 4AMGA 2ZJFA 1ND5A 1LKZA 1X42A 2HCTA 1QGED 4QOSA 4B3TB 4YMLA 4REQB 1H9BA 2E6UX 2ZITA 1BXRB 5AJTA 3RVBA 2WJJA 4BMYA 2CYBA 2WPNA 1LX6A 3BB1A 2LW7A 2Q1XA 3A0RB 3OQVA 4TQ9A 2J1LA 3R2JA 4JQSA 5DASA 3ZCXA 4Z5XA 1NWCA 4HUQA 1ZR2A 4L51A 1TRKA 1RYDA 4FGJA 5ALLA 3BJZA 2FUEA 3OIFA 5HK8A 5IFLA 1X1RA 3CYFA 3L46A 4RIFA 4O0LA 4I9GA 2VF2A 1UKAA 3R1IA 1ST2A 4US0R 3KR2A 4OPMA 1MC8A 3EXIB 4BQQA 1TQ6A 3AX6A 1G6KA 1HSZA 1KSHA 1S8NA 2PMCA 3LY8A 5DLYA 2J08A 4EG3A 1S5PA 2QUKA 5JD4A 2OCDA 3P7MA 4KBYA 2ZZNA 2CUNA 1XXHA 1JA0A 3BHIA 4NV1A 4KTTE 1NQTA 3FGPA 4PYRA 1GYRA 4Q3DA 4DUGD 2Z2KA 1KMHA 4JL6A 1AKYA 1WV1A 2J6HA 3PIRA 3NHBA 2VWPA 4P6VF 4CF3A 2VK4A 3VPDA 5KSWB 1I6KA 4CCYA 2NYVA 2BEUB 3LD9A 2EYQA 2YCLA 3I2FA 4O2AF 4GP6A 4L5BA 4B8YA 1PFUA 4RZIA 4MXDA 3FPKA 3TLAA 4YLYA 1Q3HA 3RS2A 3IESA 1G5TA 4FX5A 1JFSA 1E8DA 1UAAA 3TLGA 3AR5A 3R9WA 1RXIA 4HSEA 2EU8A 2MR6A 2ZKLA 3DAGA 3JARA 3OUZA 1RCFA 4JODA 3JQ6A 2I9PA 1QRTA 2VYND 1DWQA 5FR2A 5KOYA 1P2FA 1DAFA 2A7QA 3LRPA 4EX6A 1KVRA 3C6ZA 4OHYA 3H5NA 3TQTA 1QWSA 3Q3EA 3NPMA 2H1HA 3FPSA 4ZTBA 1P31A 3HL4A 3P9PA 4YDHB 4CMAA 2ZIWB 3HJHA 2ERYA 3KYCB 3HNOA 2FUNB 3PUIA 2WSIA 1GGEA 2VQFB 2JLUA 4JVLA 1M8PA 1UFOA 1JB9A 1ZP6A 4WFQA 2O3UA 1P9RA 2QE7D 5G0TA 1G5RA 1X1QA 1PEKE 4JT2A 1LX7A 3EDCA 3PNMA 3I2IA 4YGXB 4D25A 4MW7A 4Y6SA 1NOKA 2COKA 3MT7A 1EGVB 4EM6A 3F90A 3T5DA 5KUTA 5IULC 3B9RA 2X22A 1V2GA 2G4CA 1YHYA 4DDWA 6ADHA 3UJ9A 5B6JA 4DG5A 2FN4A 3BH7A 3EFHA 5F5NA 5H0IA 1TTHA 4L75A 4ZT2A 4LISA 5FA5A 1X1AA 3TK1A 3TM5A 4MO9A 4X7PA 4YPVA 1Y6FA 2BKVA 1R18A 2CFTA 3I6QA 5CMLA 3BD7A 4CMGA 5DN6D 1QJCA 3QPDA 1T1JA 1SKYE 4PG6A 4CMIB 3HJUA 1A9XA 1B00A 2IUSA 2VJOA 3KXLA 2VT6A 3LBFA 2E1RA 1OAAA 3S8MA 3UA4A 4X54A 1Z8FA 4AT1A 2A58A 1IPFA 2V6JA 5MN4A 3M5PA 2GGSA 3CJQA 1YR7A 4CEIA 5KVSA 2JKYA 3GPIA 4P54A 2C99A 2AG8A 4OQQA 1V3TA 1T6YA 2JK0A 5DOVA 1D8AA 3O0DA 2VN8A 3FYCA 5JSFA 1XFDA 5K2OA 4OSPA 1J33A 3AUJB 1AKNA 3DEYX 4LOKA 4OF4A 4ZI3A 4J43A 4IWYA 2DXIA 4P86A 1LTHR 4LXIA 3H1AA 3F78A 3O26A 4DBLC 4CDRA 4E4YA 3V7UA 5C4GB 4BYGA 1MC4A 4K40A 3RUIA 2OESA 3IDFA 3TXYA 3T5AA 1ZMOA 2ABWA 1WE2A 3LWZA 5AK6A 4DYDA 5B7GA 4QUBA 4AJ4A 1V8ZA 2F4VB 4YAEA 2VXOA 2PMEA 3WLEA 3U3XA 3FJOA 3PVCA 4TROA 3VVLA 2PRYA 1FP2A 3IQIX 2PKYX 1Z28A 3ZR4B 4XWOA 4Z7JA 1DO8A 5HGXA 1I2CA 2IPAB 3EHDA 2NXWA 2ZYHA 2QTTA 2WU8A 1SIUA 4HB4A 3I4LA 5DLEA 1WXXA 2P9BA 3RRJA 4C2BA 3FXAA 1CQZA 4TZ6A 2IXBA 3TTYA 3FSEA 4R8RA 1R27A 3EGWA 2H8GA 2YMPA 2P4HX 5F12A 1U8UA 2R6FA 2QJTA 1MIOA 2YHIA 5EOVA 4NJOA 3NT5A 4IG4A 4TLMB 4H15A 1DGQA 3AZOA 3L5OA 3QXHA 4Y1FA 4X8MA 5CW1A 3A1FA 4MQEA 2DUWA 1UR5A 3H5WA 4QREA 4DQ0A 4C3ZA 3M4JA 1H5UA 1CX9B 2PQ6A 3HG7A 1ZM9A 1BHJA 2C9OA 2YL2A 4RELA 1FNMA 2N42A 3C3XA 2W6PA 1G8MA 3PEWA 1QTRA 1E1RD 4KXQA 1IOWA 1UANA 1Q7GA 1TL7C 2KS6A 1S96A 3EBLA 1QH9A 2AHRA 2X8AA 3ZW9A 1EFDN 4L0CA 1KVQA 4NMMA 4DIKA 4NI5A 3DZHA 4HFJA 2Q3DA 1GQFA 3O94A 3OIVA 2B99A 2J45A 3RSOA 1JXMA 1N2XA 4C4SA 4ZZ0A 2FG6C 4ETWA 2X2OA 2PQ0A 2NU6A 1HYQA 1Y5NA 1M2NA 2V65A 3T7RA 1FFSA 1R9GA 2QVXX 4RLQA 3BILA 3IQGX 4DSNA 4DLVA 1RHUA 3QVGB 1AB6A 4L0DA 1ZXLA 3GRUA 1XDZA 2G71A 4B6RA 1KYIA 1YOBA 3ETHA 4U9IS 5CP8A 3W5IA 4NWIA 3LDGA 2XRZA 2C58A 5TVGA 3C5HA 3SAJA 3T4PA 2FDCA 2P1RA 3ZV6A 4B3BA 1I1OA 5D7BA 4DQUA 1XK7A 3F5DA 2UVQA 1P18A 3TIGA 3RHZA 5BWOA 4O4IF 5KYUA 5IKMA 2O14A 3F8TA 2D4HA 1G8GA 1XTQA 3DMTC 5J2TB 4NBSA 3K9QO 2CEKA 3MMXA 4M86A 2JIRA 5JWRA 2HCJB 2CNNA 1BVRA 4LA4A 2ZRKA 2AN4A 4JLVA 2BM0A 4YUXA 3F5QA 1SXJE 3AB3A 4KK3A 4WW0A 5G1OA 3K1JA 1DXOA 1CY4A 4X1IA 4CIAA 1CC1S 3OJWA 1G7CA 1YT5A 5T4FA 3LDFA 3PB3A 2AEEA 4LECA 1RD4A 1AF7A 1V8DA 4KLCA 3K0BA 2P6PA 3E48A 3F6EX 2AOWA 3ZV5A 3K96A 1HG0A 4B4DA 5B1HA 1H2WA 4YJHA 3QKRA 4KXXA 2O20A 1F1JA 4CT5A 1I24A 2G9UA 5IT0A 3LCMA 4WJZA 1DAOA 3ENVA 3PFCA 5DXJA 4XQ0A 3VKHA 3GI1A 4PSVA 3RVLA 3HUNA 3CZRA 5EHZA 3HA2A 3TAXA 5AUOB 4Q4HB 4FI3C 1C7IA 1P77A 1TM1E 5KHOC 2XCQA 2YWJA 3G5LA 4UUBA 4AS3A 2AZXA 3B70A 2HU5A 4PGAA 2H1CA 2MMGA 3PKIA 5DZSA 3RSHA 4PYNA 3VA7A 3K0FB 3INRA 3REQB 2VAXA 2WT9A 3RO7A 1SKBA 1MHTA 4XX0A 5HKAA 3K92A 2BFBB 1G3UA 3GZJA 4OQXA 3GO4A 4GQAA 2IBTA 3OTOB 5JHHB 1TC2A 1XCPA 4GL4A 1H2XA 1ISRA 4EOGA 1U9IA 3ENQA 5HSGA 1BVUA 1P17A 1Z6YA 3QLVC 4IDEA 2HO5A 4RHTA 2ZU0C 1KORA 1J0XO 2QG9A 1OC2A 4Z3OA 3C0KA 3B5JA 2ODQA 4EFKA 2X0RA 5C18A 1I14A 1A4RA 3AHFA 3IB3A 3NANA 4PC6A 1WB4A 4EW1A 3DOHA 1Y5RA 3UTCA 2ZZMA 2F43A 3WY9A 5JPDA 3EFOA 5C7LO 4RTLA 5EEGA 2ZATA 3AUSA 3IHWA 3WB9A 3EC7A 4R1LA 3DL7A 3IBSA 4BC0A 1FDOA 1PKXA 1Y6ZA 2WUDA 2YJ4A 4NG4A 2VDPB 3HJTA 4FU0A 1YB7A 2V7PA 3EZ7A 2RGXA 4BWFB 3NHKA 4ROSA 2YZNA 3IKMB 5KPJA 3P2EA 5JAQA 2IXGA 3EW9A 4HB0A 1NY6A 1C3EA 4K6KA 1V96A 3H9EO 3AP3A 3MVEA 3NV9A 1NZDA 1YJQA 4B43A 1KOLA 5BSHA 4L76A 2PWPA 2QUBA 2ZSUA 2OUIA 3CRVA 4IF6A 3P2KA 3Q1KA 2XZTA 3QU9A 5AKYA 1E4VA 4M8IA 4BLWA 3B3QA 5F33A 3T41A 2C20A 2H1SA 4QXRA 3CT6A 3FYDA 3N6RA 2FFBA 2DQZA 3ZKWB 3U09A 5G4KB 1Z18A 3MCVA 1T9KA 1ZL2A 1ACJA 4KQIA 1PJ3A 2O2EA 3RFFA 1WSWA 2W58A 5T4EA 3T1YB 4PY2A 2Z2IA 1RAIA 4AUNA 4Z4HA 1VIAA 1VGRA 1F7VA 4I50A 1NMEA 3E03A 2YASA 4C7MA 2RBEA 5DLDA 5HFNA 5FULA 4RGYA 1IHDA 1W5EA 2O7NA 3K9BA 3QA9A 4RJLA 1CXZA 4UM5A 4E1AA 3IVXA 2HR1A 1LRKA 2BJHA 3CVJA 1ZRSA 1ULSA 4Q16A 3SIWA 2OV2A 4ND6A 3VKUA 1RJDA 2BHTA 2G8NA 2WE7A 1M3SA 3DBRA 3DG9A 3BEOA 4MTLA 1ZGBA 2VF4X 1GRCA 1WP4A 3AR6A 3I9JA 3MTDA 4KXVA 1KI9A 3RC8A 1Y1PA 3W4IA 1SXJA 3TI9A 2G08A 2XRYA 4JROA 3KOZA 4J7UA 2NO9A 2XRFA 1H1DA 1SUAA 2A9JA 4IGFA 4PVCA 4WMLA 1G4AE 4JT9A 5TX7A 1HOTA 2NVBA 4XGIA 3GUHA 4FDMA 1E8MA 5K45A 1SKQA 1H6DA 2C54A 1AO3A 2OBBA 2WJGA 5A6VA 2I3DA 2O7VA 1KRWA 4UDNA 1VSVA 4LDNA 2JFVA 4FDTA 3WB0A 1B3RA 3WYEA 5H9WA 1NG9A 1EX7A 1T4BA 2L42A 2BL4A 2OBMA 4JBXA 2BZ1A 4MQUA 1DQRA 1Z0IA 4X0EA 5F3WB 1HTBA 3AB7A 4ZQCB 2HWWA 2P62A 2DG2A 1D5CA 1F51E 4F5ZA 3UC9A 1XALA 1QO0D 1UDWA 1KPGA 4YO8A 1G3QA 1WY5A 2PPLA 1CR1A 4JLJA 1SCIA 3ANNA 5TJ9A 3TLGB 5JAUA 2F1KA 2DFDA 2I0FA 1X7ZA 2Q6IA 3AZPA 2RKWA 1IBSA 3QWAA 4PHFA 4W5QA 4DIOA 1C3JA 3KTOA 4IOKA 3L4KA 3LP8A 2XEDA 1M2KA 3KKZA 4JYMA 3A7DA 4DJTA 1NW6A 1VI6A 4NDAA 4F96A 3OZWA 3GRFA 2GJ4A 2VUIB 5CAEB 1E1DA 3NOXA 4BFXA 4GM1A 1XRRA 2O6HA 1YB2A 1V3QE 1TCAA 2GJAA 4L2IA 4EJMA 3A3OA 1I7DA 5BRNA 2J6BA 5BSFA 1P2BA 1NE7A 4U9UA 1SWVA 5KSPA 4ATNA 4JKIA 5HDBB 4PZDA 4P4LA 3RUEA 3IR5A 1PZFA 1J70A 2XUZA 3WK4A 4EW3A 3ZIAD 4DVJA 5FFMA 4BPRA 3PR3A 1KTVA 3IEPA 1PTKA 3NT4A 5I9TA 2RGCA 1X70A 3EXAA 3R0XA 2C5HA 2BKUA 2RGNA 4JSYA 4LBWA 4MW5A 5A1JA 1ISHA 5IZCC 4BMOB 1XZCA 4D8WA 3TAUA 3FOCA 3KZOA 1HSOA 1CQIA 4JENA 1WLSA 1WD5A 1Y1LA 1A9XB 1YS9A 3NCHA 2BTEA 1P1HA 2O8CB 1DOHA 2MHCA 3BE5A 2R8OA 4OHZA 4HDRB 4YRKA 1TJYA 4DB4A 2Q21A 4OYHA 3PEYA 2BN4A 1T9HA 3AVVA 1RZVA 3LO8A 3BM5A 1JDZA 4QC2A 4P53A 3MLEA 4Z7NB 4CEIB 3MFDA 1S4MA 1M6YA 1S7CA 2DUJA 2QG4A 3FFTA 3FYTA 3IP9A 1N7HA 4EH1A 3X1KA 3GPLA 2ROQA 2FU5C 2JJMA 1SBQA 2ID4A 2WA2A 3FNEA 1RU3A 2MINA 2OGWA 3Q7SA 4LCEA 4MLDA 3W90A 1TZMA 2EG9A 3C2QA 1OXUA 4JLMA 2A0FA 3V4VB 2VPQA 3ZXXA 4JI0B 1SQSA 1OSNA 4QTTB 2L17A 1MP0A 2Q8PA 3A27A 5E1OA 4EHNA 2EZUA 2YWCA 4F4DA 4M1YA 1UBTS 4MVJD 2P27A 1V9SA 4CGYA 3KTFA 3RU9A 3B1VA 2HEGA 3T15A 4H1HA 3E2MA 4D3YA 5F7OA 1LPOA 2NU7A 4UOQA 2QPOA 5CFRA 5B1IA 1JEDA 2DBRA 3PZBA 3EGDA 3OCUA 4R8LA 4ZAXA 1BEUB 2P2NA 4MVWA 3IMGA 1SUIA 1WQ3A 5JYEA 1ILEA 4GDFA 1U0OC 2JI8A 4B74A 1M8GA 1NYTA 3PUVA 3N2IA 1K2WA 4TYPA 4MRAA 3A4IA 3UAWA 3H5RA 3E81A 4I1OA 5HKOA 4OBEA 3D7RA 4RANA 5GWXA 1IHUA 3CB2A 1PZXA 2F8MA 3Q0TA 3QKSB 3ILHA 3TPZA 4B7ZA 3VXKA 2PZAA 3K0AB 3A2NA 4C4PA 3MOSA 5CCBA 3P0EA 1UM8A 4HI0E 2AUMA 1I30A 1DT3A 4OXQA 2YNMA 4MQEB 4BXOB 4U7HA 2BMEA 3KC2A 4GM0A 5YASA 1OROA 4BX9A 1U0HC 4BNKA 2B4YA 1TJNA 2C88A 4LWOA 5JMTA 1LNZA 2BEKA 3TF5A 3HI4A 2E87A 3O7WA 4IM7A 1DRWA 4O4LA 3ZWOA 5FLXA 2R6CA 1ZM3A 1F14A 1FDRA 3N7UA 4I5EA 5AK0A 3SYNA 2G9VA 1WMDA 1XDBA 1JJBA 1OLSA 1VMIA 3GFBA 5J2TF 1NP7A 4LWPA 5DX0A 4D8UA 4JI5B 3GLIE 1N5OX 3BBPA 3VOAA 4MW6A 5L3RA 1L1RA 1UFRA 4B6SA 2QP4A 3NBXX 3I72A 3L06A 4L57A 4OM8A 1RPZA 3C3DA 3JWEA 1E3QA 4Q9NA 3HUEA 2C5AA 3D5EA 3CO0S 4KQKA