5B1SA

Crystal structure of trypanosoma cruzi spermidine synthase in complex with 2-(2-fluorophenyl)ethanamine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
294
structure length
294
Chain Sequence
MPGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase, putative
publication title In silico, in vitro, X-ray crystallography, and integrated strategies for discovering spermidine synthase inhibitors for Chagas disease
pubmed doi rcsb
source organism Trypanosoma cruzi strain cl brener
molecule tags Transferase
total genus 96
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 5b1sA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5b1sA02
1EQAA 1N7IA 4MTLA 2ZBQA 4A6EA 3FUUA 1XVAA 2P40A 2FYTA 1IY9A 4RTKA 2PWPA 4DCGA 2CMGA 1XXLA 4WVLA 2ESRA 4DZRA 3GCZA 2IH5A 4F86A 4HTFA 4RTPA 2NXNA 1X1AA 1KHHA 2IPXA 2NYUA 4ER3A 5GWXA 3KQOA 4GF5A 2BR3A 2GPYA 4XUCA 2OPBA 1R8YA 2OYRA 2LD4A 4KWCA 2P35A 2B9EA 1YUBA 5EEHA 1UIRA 3FPJA 3DXXA 4AZSA 5GINE 2NP6A 4YUZA 4YUYA 3QV2A 2ZVJA 3OU2A 1SUSA 2AOWA 5B1SA 3E8SA 2PY6A 1R6AA 3KPUA 2ZZNA 2B2CA 4MIKA 1QYRA 5K0CA 4YUWA 3BWMA 3PTAA 4QVKA 4YUVA 5DX0A 3E7PA 3OU7A 3FTFA 4PCLA 1WXXA 2OB2A 5EKXA 3OZRA 3OPNA 4GEKA 2QE6A 3EPPA 3KQPA 2FRXA 3RIEA 4YV2A 3R0QA 5EEGA 2Z6AA 5KS2A 1JQEA 2B78A 3GIWA 3M70A 1INLA 3UJDA 2C7OA 4QPPA 5FQOA 4ER0A 3FRHA 2UYCA 4BLVA 1U2ZA 1PRYA 2GAFA 3UJ9A 3X0DA 3GRVA 3HA3A 4HC4A 1KYZA 3PVCA 4RTMA 1RI5A 3EMBA 1X1BA 5T67A 2QRVB 3CJTA 4RYLA 5DXJA 1XTPA 4GC5A 3DMHA 2H00A 3MTIA 2ZZMA 1FP1D 3BGVA 2UYQA 5C1IA 4RTSA 2UYOA 1TW3A 3LKZA 3GNLA 1QANA 3HVKA 3LHDA 1RJDA 4FZVA 3THSA 5K09A 5LQRA 3PFHA 2IIPA 2YR0A 3CJRA 4EQZA 1H1DA 3FTCA 3QOWA 4PYLA 3MB5A 3A27A 3UZUA 4E2ZA 3ELYA 3Q7EA 2O57A 4QVGA 1WXWA 3DTNA 3M4XA 2GB4A 4LG1A 3BGIA 5K05A 4GOND 1XDSA 5FCDA 2YXEA 5K03A 3FPHA 2PX4A 3G2MA 5K01A 1ZGJA 3MERA 1EAMA 2AN5A 1KR5A 1OR8A 3HCBA 3EVBA 4ER5A 5CM2Z 2AVNA 2YX1A 2OZVA 3CCFA 2DPMA 3CKKA 1HMYA 4FR0A 3ER9A 4OX9Y 2FK8A 3UJAA 4C05A 2C7RA 4OA5A 5E2AA 4RSRA 2P7HA 5CVJA 2HR1A 4OBXA 5EQJB 5K0GA 3R24A 2FCAA 5FWDA 2PLWA 5LQKA 1MHTA 2Y1WA 4V0QA 4U7PB 3DULA 3FYCA 4YMHA 1D2CA 3EVAA 3SR4A 2A14A 2IDKA 5LQNA 4C03A 5LQCA 5CUQA 3R6TA 4V0RA 5FULA 5H02A 5C0OE 3FPGA 3G2QA 2UYHA 2IH2A 3JWJA 1I4WA 3DLIA 5JR3A 4RTNA 2C7PA 2O0LA 2EJTA 2ZFUA 2EFJA 1QAOA 4HGYA 1G6Q1 5DRTA 1P39A 4DQ0A 2UZ4A 2ADMA 5FUBA 2ZW9A 3DXZA 5E9WA 3TM4A 4R05A 3GJYA 4P7FA 2JG3A 3CGGA 1JG3A 1JG2A 1R8XA 4KDRA 5U4XA 1RI1A 3TFWA 4KW7A 5K0NA 3DOUA 4OBWA 3EVZA 4MQ4A 1NBIA 2OY0A 2ZZKA 4A6DA 4MHTA 4R6WA 4GOLD 2ZTHA 5EMLA 4NECA 2AOTA 4FSDA 1YB2A 5HIJA 4E30A 4CXMA 5EOVA 3OFJA 2ZCJA 4C4AA 3HCDA 3H2BA 3CC8A 5DXAA 3TPZA 3A4TA 3BUSA 5F2OA 3SSOA 1YFJA 4BY9E 4PGHA 1MJFA 3SX0A 2I6GA 5DM1A 3NJRA 2PVCA 4C08A 5ICFA 1M0EA 1IM8A 3UJ8A 4CTJA 1VLMA 4RX1A 3GO4A 1BHJA 2NXEA 1WY7A 3HA5A 3BZBA 3IEIA 5E1OA 5C9ZA 1L3CA 3C6KA 4XUDA 3EVGA 3M6WA 1EJ6A 2QYOA 3T7SA 4DCMA 1XDZA 1SVUA 4WXHA 1EG2A 2ZIEA 5HFJA 5F2NA 4POOA 2ERCA 3U81A 4ISCA 1JG4A 2R6ZA 2P3LA 1XCJA 5EVJA 3UBTA 4BP3A 2PJDA 2XYRA 5E8JA 4RVHA 5LQUA 3G5LA 2Y1XA 1AF7A 4BLUA 1RI4A 4QPNA 3GRYA 3CJQA 5LQJA 1NW5A 1SQFA 5EZSA 3ERCA 4PYIA 3O7WA 5CVEA 4C04A 3BGDA 3S68A 1Z3CA 1P91A 4GUAA 2OKCA 2V74B 4XUEA 5E8RA 4E70A 2ORED 4F84A 4FT4A 3G88A 3DMFA 1YZHA 1VIDA 3P9CA 3KR2A 3O31A 3I5UA 3GXOA 4RTOA 2ZIGA 1WS6A 3TLJA 2IGTA 4FGZA 2B25A 3PFGA 3T0IA 3I53A 4ZTBA 2VDVE 1I1NA 1AQIA 4PONA 1BC5A 1XDUA 4FSXA 3VC1A 3IYLW 4PGGA 2ZWAA 4R8RA 2Z6UA 2YQZA 1VQ1A 1WG8A 5MHTA 1UWVA 2JHPA 2WK1A 4E31A 1EIZA 2P3QA 4E2YA 3K6RA 2KW5A 3DXYA 1NV8A 3KPYA 3OCJA 5DM2A 4EVIA 4JXJA 1X1CA 5DTQA 1SG9A 4M7RA 3KR0A 3ORHA 4HGZA 3MTEA 4PNEA 3BT7A 5GM1A 3P2KA 3LPMA 1IXKA 1JR4A 4X60A 5EIFA 3WSTA 2BZGA 3FUXA 3HA7A 3QOXA 4H0NA 3KPWA 4FP9A 1JSXA 3B3FA 2AVDA 1ZKDA 5DPMA 1TPYA 3KHKA 2ZULA 2AOXA 5DSXA 2HMYB 1JTEA 2I7CA 5E9JA 2QRVA 5FWAA 2ONYA 2PBFA 3JWIA 4EKGA 2HV9A 1DL5A 3M6XA 4QDJA 3OU6A 5CVUA 5EHIA 3G7UA 5T6BA 5M5BA 3SXJA 3NWBA 1KIAA 4RVGA 2Q41A 1ZGAA 2OBFA 1F3LA 3DUWA 5E1BA 4DF3A 3NMUF 3T7TA 5LR6A 4P7GA 2BH2A 2OO3A 3KQSA 3FZGA 3LCCA 5LQAA 4HG2A 1SUIA 3GRUA 3KR9A 1RJEA 3NVKI 2AR0A 1BKYA 4G56A 2ZBRA 5ICCA 3R9XB 1YF3A 3CVOA 1BOOA 1KPHA 2GH1A 3TR6A 3B7PA 2PWYA 1V39A 1ORHA 3G5TA 3VSEA 5CCXA 2VS1A 3IV6A 3MCZA 3TKYA 4CTKA 3NTVA 3SVZA 1T43A 2N47A 5ERGB 4QQNA 1R00A 4ER7A 2IBSA 4YV0A 4O29A 4PYMA 3SMQA 1SQGA 4HRAA 1P1BA 3TQSA 2G1PA 5EHGA 2JJQA 5DLYA 3UA3A 2I9KA 2G71A 1G60A 1N7JA 1KPIA 2HTEA 5KVAA 3HNRA 3LBYA 5FHQA 3M6VA 5DX8A 5E9QA 2G72A 2XVAA 3KQQA 4KVZA 3SGLA 4PYOA 3BWBA 4QTTB 5CCBA 1KPGA 3GU3A 4E33A 4EKIA 2P7IA 1G8AA 3ME5A 3PT9A 5G02A 3EEYA 4Z2YA 3V97A 2F8LA 4IWNA 2VDUE 2YXDA 3C3YA 3MAGA 10MHA 5GOZA 3GGDA 3RODA 4GOOD 2PX5A 2YXLA 4P7JA 5JUWA 2G70A 2K4MA 3HCCA 3BKXA 4RVFA 2WA2A 1KYWA 3DLCA 2HNKA 2ZSUA 4AZTA 3MQ2A 3BWYA 4OQEA 2P1DA 4QQKA 3FUTA 4LWPA 1FJXA 4PYNA 3R3HA 2O06A 3NW9A 3T7RA 5FADA 1AV6A 4RTRA 1M6EX 2AOUB 3Q87B 1YZ3A 5DRYA 2YUIA 3TKAA 5P8WA 3F4KA 2AOTB 1VE3A 3EEOA 3P97A 4ER6A 4RWZA 1L3IA 3LX6A 4U7TB 1L9KA 7MHTA 3KQYA 3I58A 4BP1A 2GS9A 2H1RA 3PX3A 5HIIA 3TRKA 5BXYA 3ELUA 5CIYA 1Y8CA 2HWKA 4PWYA 1PJZA 4IV0A 5DX1A 5CD1A 2VP3A 2WA1A 4KIFA 5E2BA 3FRIA 4E32A 1KP9A 2Z6QA 3GWZA 2NXJA 4RTLA 1F38A 1G55A 2XBMA 2E5WA 3G8BA 1XJ5A 1QZZA 3EVDA 3MGGA 2PSSA 4GQBA 5F2KA 5EMJA 4M37A 3P9NA 3K0BA 3PX2A 2AS0A 4R6XA 4RTJA 2PGXA 3A7DA 3AY0A 4OQDA 1XCLA 5IH3A 2AN3A 1O9GA 3EGEA 3C0KA 2C7QA 5HIKA 1B42A 3DH0A 5CVVA 2XYVA 5T64A 3KPJA 4X1OA 3PS9A 4GOMD 2BR4A 4HTFB 2VDWA 1KXZA 3GRRA 4DA4A 3FUVA 1VPTA 3UJBA 3EMDA 3LSTA 1M6YA 1WZNA 2VZ9A 1JQDA 2ZBPA 3NVMB 3FPFA 5KQSA 4RV9A 3ER8A 3LGAA 1Q0TA 3ANXA 1L3BA 5DWQA 2O07A 3HVHA 5GM2A 3TM5A 2PV0A 4BLWA 4EK9A 1JQ3A 9MHTA 2CKDA 3VYWA 3HM2A 2PX2A 4K6MA 3PB3A 5EMKA 5HOQA 4Y2HA 4M36A 3LDUA 3NWEA 4DM3A 1VP9A 2JH9A 3P8ZA 4HH4A 1JSZA 4ATNA 5DM4A 4UOEA 4QTUB 5IKMA 1D2GA 3NDIA 3BXOA 5FTWA 1NW3A 1G38A 3BWCA 1HNNA 3A7EA 3HCFA 3KKZA 3M33A 2XYQA 3OE5A 5EGSA 3TOSA 3UFBA 5EIWA 3LCVB 3P71T 4PINA 4PYJA 1YFLA 3B89A 3DP7A 2PXCA 3DMGA 3KR1A 3O4FA 4PIMA 3SM3A 1Q0SA 3G89A 3ID6C 3SSMA 2PXXA 2PKWA 3FTEA 5FHRA 2V7EA 4C06A 1I9GA 1DUSA 2EX4A 1RJFA 5HILA 8MHTA 2IBTA 3OZTA 1X19A 3GDHA 1FBNA 1VBFA 2PXAA 3A25A 3LDGA 4AZVA 3MCTA 1TW2A 2AN4A 3P9KA 5GIOE 4CKCA 3HP7A 2ONZA 4IKPA 1DCTA 3TMAA 1VP3A 3DR5A 1QAQA 4L7VA 3BKWA 1RI2A 5EMMA 4CKBA 5GIPE 3RW9A 2JH8A 2R3SA 1L1EA 2BM8A 3LDFA 3HEMA 1SKMA 1NT2A 1P1CA 3C3PA 5DT2A 5DM0A 3OFKA 4HSGA 2PT6A 3EVEA 3HVJA 2EG5A 2IDJA 5EC8A 4E2XA 3G2PA 2IH4A 3PLAE 5E1DA 5FA5A 3I9FA 1G8SA 1FP2A 2JHAA 4IV8A 4CWAA 4GC9A 4KIGA 5EPEA 5FQNA 4FS8A 3MHTA 3P2EA 3FYDA 5D1HA 2ZLBA 3KQVA 3THRA 3B5IA 1NW8A 3KQMA 3LECA 5DSTA 3LL7A 5EG5A 4YV1A 1ZQ9A 4OA8A 5GP1A 2XVMA 1ZHFA 2AZTA 4Y30A 4LWOA 2AOVA 3G8AA 3P9IA 3IHTA 3JWHA 3REOA 3V8VA 4AX8A 3KQTA 3EVFA 1NV9A 2QY6A 3KU1A 3ELDA 3LKDA 3M6UA 2ZIFA 3FTDA 4X63A 4B17A 3D2LA 4P7KA 4C07A 5HEKA 2B3TA 3GRZA 5K0EA 2G8NA 1R74A 1X1DA 3AXTA 5FA8A 1O54A 2YVLA 3LBFA 3OZSA 1NKVA 4P58A 3UWPA 1RJGA 3L8DA 5K0JA 2QM3A 3AXSA 3FPEA 2CWWA 5K0BA 1JG1A 1N2XA 1JTFA 5KQRA 5K8VA 2NNWB 2DULA 3G2OA 3C6MA 4DKJA 1EJ0A 3AWIA 4PYQA 5EKUA 1O9HA 3KPVA 5D1NA 2FPOA 2BR5A 3UJ7A 3NDJA 2CL5A 1D2HA 5EZQA 5BW5A 4PYKA 4PIPA 4M38A 1RI3A 4YMGA 3UJ6A 4X61A 3CBGA 3HVIA 4R8SA 2FHPA 1VL5A 1NBHA 3B3GA 3ELWA 3LCUA 3KQWA 4X41A 3EGIA 4XCXA 3SSNA 4F85A 2OB1A 3OE4A 2PX8A 3FUWA 4FT2A 5HIMA 4RTQA 4E2WA 2IP2A 4AZWA 2FK7A 1ORIA 2NP7A 5DTMA 3VC2A 3EGVA 4MWZA 4QDKA 2CMHA 1UFKA 2JHCA 5CVDA 4AUKA 5LSAA 2EJUA 1R18A 3E05A 1AQJA 2NXCA 5K0FA 3P2IA 5E1MA 4DMGA 1ZG3A 2ZWVA 2AOUA 1NE2A 3I64A 4KDCA 1FPQA 2H11A 2P41A 5K0LA 3HTXA 3AJDA 1QAMA 2P3OA 5BW4A 3A26A 3EVCA 4PCAA 5BP7A 2GA9A 3HCEA 4CKEA 2BM9A 4RVDA 5KYGA 4GBED 2O05A 1NW7A 3B3JA 3JWGA 3UJCA 2IFTA 2PT9A 3UA4A 4EMSA 1NW6A 2YTZA 5HZMA 5ICGA 4LECA 4KRGA 4YUXA 2GLUA 5DTRA 2P8JA 5ICEA 2I62A 3HCAA 3E23A 2OXTA
chains in the Genus database with same CATH superfamily
1EUDA 1LVUA 3WR5A 1T36A 3QLUA 5HHTA 3AP3A 2K7ZA 3CIFA 1U8AA 3QXGA 1Q91A 1E77A 3A14A 4JEIA 4Y7CA 5F3RA 3UXHA 3VTZA 1ZNQO 4RY8A 3WLQA 1A9PA 1DKLA 1Z5GA 3JYHA 5LQSA 2F1HA 1QHEA 2NYUA 3M8KA 4IO0A 4BMOB 4F4HA 5CVTA 4KH0A 2H1CA 4U2BA 4A16A 5B7QA 2Q99A 1L5QA 2XBLA 2PBLA 4F9FA 3GLGB 3BVPA 4BEJA 2P9FA 1WHSA 4ARIA 1CF4A 3H8JA 5EEHA 2WP0A 3QU2A 3IE0A 1NXOA 2NU7A 3FB4A 1UPFA 2IX3A 2L19A 1A4IA 5GINE 1XEFA 2X19A 5HG0A 2JFPA 3RI3A 2FPPA 2ZE6A 2RE8A 4MGKR 2W5UA 1T0BA 1WPGA 4CM8A 1IOWA 3T9BA 2AFIB 3OHPA 4J3JA 4QATA 4UUPA 4MIKA 3BWMA 1C9KA 1TFRA 3E58A 2YXPX 3C3MA 3IVXA 4NH4A 1EWKA 3D7SA 3ZW9A 3O84A 2IW3A 4UOZA 5B4UA 5KPDA 3FTFA 2J9ZB 1AGRA 1POXA 2D0IA 5IANA 3QMPA 3OZRA 1V8PA 6ABPA 2K6GA 2ZIVB 5COBA 1JS1X 1ZH0A 4OP3A 2V0CA 1GA1A 2HADA 3RRYA 1L8QA 2A1UB 1W0CA 2V6FA 4LHEA 4O2BA 4QYXA 3T35A 5AVSA 5AW8A 2NV6A 3LF1A 5BUSA 1VSTA 3OIUA 1G6OA 3EDYA 4ZMBA 4C0WA 4B79A 1PRYA 2B83A 4MWOA 1KEUA 4ARUA 1GFIA 3GUHA 3K0FB 6LDHA 1U8XX 1KYVA 4XDZA 3ROEA 3JQBA 3WFZA 4GC5A 3UMJA 4CV2A 1QTQA 1RNLA 1CULC 4EHKA 3FNRA 4JKIA 4OMDA 4EUSA 1VG1A 5GZ3A 2E4VA 1J0BA 1AZTA 2AYXA 3IHKA 1QBKC 3HR7A 3KDAA 3P0EA 3PFHA 3FMGA 1WUYA 3JRWA 5KSPA 3ZYZA 5JI3E 1UDAA 2CNLA 4JC4A 4NOMA 2OZPA 4OJQA 4D8TA 2QD3A 3EODA 1QIIA 4U7FA 5JZBA 2NTNA 2VHCA 1GGEA 1R4NA 5JASA 2Y3IA 5KSYA 1M3SA 5ALUA 2ON6A 1P9RA 1ZUNA 3GRPA 4L4ZA 4AY5A 1P6UA 1UP6A 5FWXA 2OENG 2JVJA 4EHHA 2C2GA 3ADPA 1DEHA 4EHJA 2SICE 1A5AB 1PQYA 3DL2A 1S3FA 2CJPA 3PFCA 1P73A 1V8OA 5CM2Z 2VJPA 3X1ZA 2OZVA 2HK7A 4MGYR 3ER9A 3UJAA 1K0FA 4FEGA 3DAPA 4OAOA 4C30A 3AVYA 4WPGA 1IATA 5EZ5A 3ISVA 1H1TA 2ZT6A 3AF6A 1NVTA 1RMQA 1CUHA 5AICA 1RACA 2MDTA 1DO2A 3DWIA 2YQ5A 4I1YA 2FG5A 3OT1A 4KE8A 3V8NA 5DGDA 3WK7A 2C4TA 2DH6A 2VJCA 4IIJB 1BWRA 4Q3DA 2HPVA 2A2ZA 3CF4G 3ND6A 3QVGB 3R6TA 5FULA 3GN1A 3NCTA 5EUBA 5JR3A 1AMNA 4UBMA 2X0DA 5FR2A 3RPEA 3VI3B 1A8PA 3KP1A 2VUTA 3B1YA 4B2PA 2WABA 2IYYA 2WV7A 3F3MA 3TW6A 1BE6A 2IZ7A 3QM1A 1LGYA 5GMOA 5I7RA 1FSSA 4R5HA 1N3YA 1XLTC 2NU8A 1II0A 2ZI9A 3G5AA 3VX3A 2R62A 2VZ0A 2ROQA 3TFWA 4KW7A 4CUZA 3N53A 3ZWBA 4YAFA 1TEXA 2BMAA 3VVBA 3WIOA 4FB5A 1AT1A 1SOUA 4MQ4A 4U0JA 4OHOA 2CF5A 2J30A 8OHMA 4KQHA 2WJIA 4PAWA 5CBPB 1QZTA 3R7WA 5HQJA 2AG5A 4Q4JB 4DSOA 1V9SA 1GN8A 1B6TA 2OG2A 1BXRA 1PZXA 3O8OB 2RGBA 4GD3Q 1EVEA 2I7XA 2A58A 3BUSA 4ZWNA 1E7YA 4UBIA 5TGTA 3KKQA 4UNQA 1JVNA 1RKUA 4DIDA 3RYFB 3EDOA 1E1MA 4BY9E 2ABWA 2GD6A 3LQQA 4RZUA 4KQMA 1JF8A 1M2NA 4TTVA 2I29A 2PGDA 4MKXA 4IMIB 3KTAA 1P7WA 3CEPB 1SBZA 1N5IA 4AMZA 4EY4A 2P6PA 3IUNA 1C7IA 4BMCA 1FY2A 4XUDA 1XO1A 3B6IA 5ESWA 4BNLA 2QYOA 3AC0A 1NXWA 4MXDA 2PRJA 4R69A 5F7JA 3ST7A 4ZEMA 3PA6A 4A5OA 3WLOA 1DRUA 3GFRA 1K7YA 3BAZA 4EVSA 3KOUA 3CF4A 3BHIA 5EVJA 2LXNA 4J4TA 3QEJA 4Y6GB 4DQKA 1B8OA 1C5KA 2EX1A 2ODTX 1W2GA 3G8CA 5BQOA 2PLRA 2QX8A 4R2XA 1FVOA 1Z5ZA 2AR9A 2Q5EA 3N87A 5EZSA 4PYIA 1L2TA 1ZC4A 2IXDA 2X41A 3CRZA 3BXFA 1I4TD 2OSVA 3P9XA 3QSGA 3F8SA 3I6IA 5D85A 3C7AA 4G0MA 2DKFA 2W4QA 1LSJA 1UMKA 3AI2A 3HHPA 3KR2A 3OP1A 1IBRA 3LAWA 4IM7A 4RTOA 3BIXA 1DFHA 2XUPA 1PO7A 1Z0FA 2B25A 3P4UA 3T0IA 2BZ1A 2NUPA 3W5VA 1G5IA 1I1NA 2JLRA 3GJ4A 1O1YA 3PL1A 2AR7A 4Q34A 4H15A 1MW9X 3V4RA 2P90A 3SF8A 4E31A 1E7QA 2YOGA 4M1OA 5KQLA 2QKYA 1V37A 1VGQA 3B1JA 3LIIA 4MX8A 4R9UC 4EOGA 2QROA 2AEFA 2OXIA 1MVOA 4HQ6A 3IALA 2IUFA 3KPYA 4FFBB 1D4FA 1VYHA 1MJHA 2IOFK 3CSSA 2VK8A 1X1CA 2VATA 3AHJA 4NBRA 1K0UA 4XQCA 2OP0A 1GPJA 1OXBB 5DASA 5DCUA 5SICE 4D3ZA 2FMXA 5ALXA 2J9YB 4YPVA 3SXUB 1ATIA 2AVDA 3ADKA 3IRVA 2Q29A 3NUZA 3UT5A 3DAFA 1X2EA 3FFTA 3OIYA 1K98A 4G0WA 1HTWA 5DP1A 1IHDA 1JKIA 1DL5A 5EHIA 3OU6A 4KSYA 1Z0JA 3O1IC 1EFVA 3GF4A 1E2KA 1K7SN 4AMGA 4BNFA 3OZEA 2VH2A 3NWBA 2JCSA 4KUEA 3HCRA 1F3LA 4O4IF 2UZ0A 1QUEA 4RGYA 3NALA 3SQLA 5BWCA 5LR6A 3PC3A 2MT9A 4D6XA 1A5TA 3B20A 2XGOA 4ID3A 5AIAA 2HT1A 2C2BA 3K32A 3QH4A 2VUHB 3R9XB 1SZDA 3OZGA 3VPXA 1FDUA 3OIGA 1SAYA 4N8SA 5HOEA 1V39A 2RAUA 2VJNA 1GADO 1Z6QA 4QLOA 1ZK2A 2I2CA 2V6JA 4EO4A 3G3EA 2B5OA 4MVJM 2JZCA 2QYSA 5JQGF 2QVLA 5B1IA 5BNWA 3ZS8A 1SCQA 4F12A 4ENVA 2X23A 4GRDA 4JZKA 1D0IA 2FRDA 4YJHB 1YMUA 3EIWA 4XARA 4R01A 3MPOA 4ECAA 1A8IA 4KIUA 5HVNA 1DEXA 4TS3A 2K7FA 2JLZA 2C2HA 3HJHA 3K5IA 4NYJQ 3W90A 4N3BA 2F3RA 2FGJA 1G8AA 3AI7A 1IWPB 1KAEA 4PFJA 1ITZA 4GVPA 4J1TC 4QIHA 3MAGA 10MHA 1CR6A 3RODA 2C83A 3GDFA 1MRSA 2IHTA 1J99A 3ZUGA 1BG6A 3BKXA 1U90A 2XE7A 5JYDA 2XXAA 2BW0A 3GJSA 1PUJA 1O4WA 1ZU5A 1LTKA 1KKUA 4R81A 1DINA 2IYAA 3MJ4A 1WDMA 1SZCA 2QI9F 2F9FA 2WUDA 1E3MA 2JGNA 4HDKA 5BV0A 4P4SB 4EFMA 1TT5B 1VFPA 2O06A 2YZMA 4S24A 3VA7A 1YS4A 3L6UA 4XIFA 5CB6A 1NJ6A 4D46A 4EX6A 5IVKA 1UADA 2CMDA 1EP2B 1YZ3A 4HN9A 2OZEA 5A4FS 1UWLA 5EPUA 3F4KA 4X1IA 2XDAA 3MVEA 1ZIYA 2CHFA 4U2CA 2PZEA 1AKYA 4U7TB 5LXTA 4OUDB 2G9QA 4FUTA 4EHLA 3JARA 4GE0A 3OY2A 2PFSA 4LYJA 2PLAA 3I4FA 4G1EB 4R2LA 4F92B 1F4PA 5AW3A 1U2PA 3IC5A 4KLZA 5IC4A 3KOOA 4XGKA 5AOCA 3PJDA 2VF2A 1T34A 4ALNA 5IBCA 4NAVA 1KFCB 3MINB 3OQPA 5F3WB 1JMYA 1FXWF 4GQBA 1PYGA 4HLQB 2O8BA 3AHGA 2HPHA 4YWHA 4RWEA 4YT5A 1EP1B 3RUEA 2J9XB 3ONVA 5DBOA 4J0FA 3A1UA 4BEWA 3TLKA 5JAHA 1HL3A 1ZM7A 2FW0A 5D3QA 3ZLTA 1ZMXA 4C6TA 4K9DA 4XFKA 5BNFA 1QU2A 4MVWA 5FH9A 1F51E 1GCIA 1E9FA 1TAGA 3DF9A 4RZQA 4LPKA 3TVTA 3EEIA 1ZVKA 4C01A 2QL7A 3CSDA 2J3DA 4IRXA 4QYMA 1KAQA 5B1DA 4TL9A 1X1SA 2RFLA 1RQ7A 3L7IA 4R9NA 3ZI7A 5KWEA 1QWSA 4XJXA 3TRFA 1DBQA 4I5GA 2BEVA 3IJPA 4TMYA 5ECWA 5FBRB 1NULA 1RWMA 1OYYA 2PFGA 2CKDA 2Q21A 3OWOA 1SCUA 4NMXB 5IF3A 1YDFA 2V58A 1TE2A 4M36A 1ECCA 4QDTA 4DM3A 4LXUA 3BF8A 1CY2A 1JSZA 1G17A 1OWMA 2O0KA 1XMPA 1EE1A 2BBWA 3FE2A 4MZDA 4RMNA 4F3KA 2IXTA 2OCPA 3BXOA 1VL0A 1NWHA 4D0SA 4R83A 1T35A 3QFRA 4NCJA 1P3DA 4TZTA 2F3PA 4MJXA 3TSCA 5MGNA 1U28A 1TVKA 4M0DA 1T5IA 3T3NA 2ATCA 4BDSA 1Q0SA 4MKZA 2V7EA 1OGJA 2FOIA 1OH7A 3DUFA 1WXDA 3KM0A 1DIGA 1AUOA 1N9GB 1TUBA 4RF2A 2VP9A 4ZAVA 2X4GA 1TW2A 5GIOE 3DKRA 2GCOB 1JVSA 1TM5E 3JPWA 4AIRA 4BHTA 1O0CA 2C58A 4DIBA 4EEXA 2E82A 4LRQA 5IKXA 3EAFA 3AL0C 4KIJA 2AJ8A 4IMPA 5D6OA 1FSZA 1ZN7A 2AE1A 2G04A 4U00A 2YRXA 3X2SA 4BX2A 1YTUA 3SIWA 4IV5A 1CTQA 2BTQA 1ICEA 3I6YA 5CNKA 4FCWA 1YS1X 5EJ5A 3VOAA 4NTZA 4DPMA 4FZ5A 1US8B 3AR5A 1B2RA 1OJLA 3N7AA 4JZYA 1T2DA 4FS8A 3Q8WA 4DSZA 4Q93A 2J4DA 3S6JA 4TVKA 3OHSX 5KTYA 4DR4B 2I6FA 1A7JA 2REQB 3PWZA 1A77A 2L0XA 4JYAB 1OLUA 4YV1A 4LV5B 3KKMA 1LV7A 1JI0A 4WBSA 2A5LA 4R8KA 1BHQ1 3ZNOA 3C39A 2HWUA 3EZFA 3FPCA 2WJZB 3G8AA 1E7RA 3INRA 4M86A 4HZUB 2I76A 3OLQA 4WKOA 1DFIA 4F6RB 3ICOA 5IRCD 1MO4A 4K5QA 3LXMA 3DZFA 1Z6YA 4DQLA 4W8GA 1X74A 3GDGA 1AKTA 2O8NA 3BFVA 3DZJA 1UBTS 4Q66C 1ZJZA 3FPEA 4G4SO 4UM8B 2DHEA 4LJRA 5GY7A 1G0NA 1DQSA 3QYAA 2NNWB 3TMYA 3ZHZA 2V7WA 2Y0EA 4M87A 4O2BF 4Y9DA 1HSZA 2R7NA 3NNNA 4P83A 3OQIB 1CDZA 3VHQA 4YRRA 1PQWA 2A0FA 4PEVA 3ZNNA 1YDGA 3IQGX 2XGGA 3WIBA 1WF3A 4RD1A 1NAIA 2VA8A 2P5SA 2X0FA 2J0EA 1VIVA 2BVNA 2C5HA 1OI7A 5ALOA 1ZJYA 2NT4A 5KTNA 4Y2RA 4XCXA 4G97A 1Y7TA 1A7KA 4CF7A 2QX4A 3CH4B 4KCGA 3T7EA 4QM7A 3VZSA 3EXFB 2DY1A 3QLVA 5AK6A 3I5YA 1QHHB 3ZD7A 4L8YA 4QOEA 1KSGA 2QSUA 1COWA 2PZMA 4CFSA 4AL4A 5IXSA 2XGJA 3AEXA 5FORA 2PWAA 2R8EA 2QTFA 2ZP1A 5FEMA 1NG9A 3GWGA 3IJRA 4JI3B 3DE0X 2VSXA 3HJFA 4YJ2B 5J58A 1YQXA 3VRHA 3SIXA 2XNCA 1Z83A 2H11A 4GPBA 4D9IA 1LJLA 2B1JA 4E5PA 1UQUA 4FHZA 5BWMA 2JLYA 4ZARA 4RVNA 1A2OA 2Q0QA 3BD6A 3D0RA 3LVRE 5TDHA 4F21A 3H13A 2Q46A 3ZR4B 5ICGA 4LECA 3DV0A 1ZOSA 1VMAA 2NPIA 3B9PA 2QLTA 4URYR 3GX1A 1A1VA 1H6DA 4QE3A 3P2JA 5KQGA 2FPGB 3FHTA 1WEKA 4F71A 1JU3A 4BZXA 4DIMA 4G0VA 3KX2A 1I3NA 4MVYA 4RJTA 4Z3KA 3BBLA 2FJ0A 3F1KA 3PHIA 1KRHA 4MWTA 1IY9A 1WIWA 1XRLA 2FWBA 2YV1A 2BKEA 4DCGA 4NV3A 2ESRA 2J7PA 2IH5A 4O6VA 4BTLA 3CF2A 1X1AA 2IPXA 4EMBA 1XAGA 1KMNA 1CLEA 1UDWA 2CNKA 1LC3A 4IGFA 4N18A 4DV6B 3N2LA 3OT5A 1K06A 4IXMA 4P1ZA 2PRSA 1FLAA 4EO7A 1YUBA 1EHCA 4RENA 1T3LA 4J9UE 1J0DA 3UH1A 1UBKS 1JGTA 2XR1A 3OU2A 3KZNA 3QFTA 4Z0NA 5B2FA 2V1XA 4HGOA 4BNWA 2A1TS 2BKAA 3ICCA 4LXGA 4YUVA 1PV1A 4BZWA 4EAAA 4EYEA 1ZNXA 3MJEA 4KYVA 5FLXA 2IU4A 3QOYA 3IOMA 1K97A 2YHIB 3L4JA 1W29A 5FPTA 2VPZA 2QE6A 5F9FA 3RHZA 1XNHA 4BN4A 4ZCRA 2O2YA 3QFCA 2VHJA 3NHAA 1SB9A 3ODGA 4M8LA 3KUKA 3ZQJA 1EFRA 1F17A 1N6KA 4LJ9A 1C9MA 2OLKA 3X0DA 3UAZA 1FRVA 5JBQA 3PVCA 5KYTA 3E3OA 3A4VA 5BRAA 3G68A 1R9GA 1XX6A 4RACA 5DXJA 1VIYA 2XOXA 3BGVA 4F9TA 3U9LA 3IMGA 4Z0HO 4CCWA 4LC9A 4WERA 1YJBA 4C0JA 1WL8A 4GP7A 4TRNA 1THGA 1N1DA 2O7RA 2ZT8A 3M3PA 2Q8PA 1OILA 4UUQA 4FOTA 1T29A 4JI8B 2YCLA 2CVPA 3CEAA 2FSHA 3GUUA 3Q7EA 2XVXA 3DTNA 3IUEA 3GLRA 1PG0A 2R86A 4OHKA 1PZFA 4CBVA 2WTAA 3VJRA 2G8LA 4EYOA 3QA3E 2FNAA 3FPHA 2PX3A 2QJOA 1PR4A 1Q0HA 4TXHA 1RABA 2QEQA 3RU7A 1C8LA 3UUGA 4REOA 3NJ4A 4ND5A 2PKQO 3SSAA 1V5FA 2AVNA 5L7YA 1RYFA 3NOXA 4AF8A 3IPYA 1SA0A 3NAMA 1ZS9A 4UU7A 4XVUA 1JHXA 4H4EA 1RAAA 3W5DA 3FYHA 1COWD 4Q4LA 5C31A 1KI7A 16PKA 1J21A 4ZAYA 5IK2A 1KJWA 1UZMA 2F3SA 1RZRA 4L4SA 1VHWA 5DB4A 5LQKA 2A8YA 4Y2QA 5EUMA 1E98A 3QU7A 2HGSA 4DILA 1UF9A 1DHTA 1PF7E 3DLPX 3KS9A 1WLYA 4J2HA 4NAHA 1OV4A 1NURA 2J6HA 3WZ2A 4UEWA 4IOKA 4BO0A 1GWNA 5KWSA 3G2QA 3H1AA 4FR5A 3IMEA 5IWCA 3LLCA 1MDFA 2FVYA 4KX3A 4RZ2A 3MBKA 4BUZA 3ZX4A 1QK5A 5JS8A 4JR1A 3D7LA 1ORWA 3AU8A 5L7WA 1T5TA 1KY3A 3BSYA 3ON5A 1RT9A 2FUNB 2DX7A 2N0SA 2VNIA 4PPGA 4C9BA 5CP8A 1ODCA 3R0IA 4HGRA 1MEEA 2IUYA 3UJHA 4YBRA 3ZHQA 2ZXUA 5A5EA 2NZJA 1NSYA 4F3RA 1NN0A 3LHKA 4H7KA 5KYYB 1KEPA 3OM1A 4JI2B 4OHVA 3CZPA 3COVA 4F3CA 2J3IA 2D1RA 3WLAA 2QRMA 1NBIA 2J7PD 3LTNC 1P9WA 1N0UA 3UUEA 4DR7B 1T3TA 1HTTA 3OICA 4LJ8A 4G0UA 2O5EA 4QICA 2FLKA 4QUAA 1U3GA 3CNNA 1YB2A 3FVWA 1NMQA 3WZLA 2R84A 5ELMA 4XXHA 4M8NE 4OQNA 1DBVO 5ABPA 5H9WA 3N8GA 4LXIA 3MOIA 2PBZA 5LWQA 2D3TA 3ANSA 4HPXB 4A0RA 4BATA 2O14A 1TIBA 4DBVO 3RUHA 4HAVA 4OHPA 3VGJA 2ZYVX 3JYQA 5TXGA 1HT1E 2VNSA 4OPMA 2I1QA 3UH0A 3WLFA 2PVCA 3WLPA 1L7PA 2X3FA 2TSYB 2YYSA 4WJZA 5B57C 2NUAA 1BHJA 1P0FA 2M98A 2R1TA 2V5AA 1FVFA 1ZZGA 1K08A 4Y6SA 2Z4TA 1FE8A 3QE3A 2O3UA 2XMPA 4A3SA 1MHPA 1JXQA 4KR7A 4KO2S 4DJEC 3N2NA 1SVUA 2JFQA 1R4MB 4GMFA 4LZZA 4WGGA 5EGNA 4RZHA 1KU6A 1KI1A 4RMJA 1H94A 1UJ4A 3GFTA 3NYQA 1GUFA 1NU8A 1XAIA 1EFRD 1DJNA 3IAAA 2VJBA 3JQ9C 4S2UA 5FOUA 3C8ZA 3KLMX 1VMEA 4KTTE 3WRYA 3H5TA 4G65A 1YGYA 2POQX 3TAHA 2OZLB 1LWOA 5AKYA 2YMPA 4QT4A 3VYSB 3K35A 4FDLA 3ERCA 1Q7RA 4XRRA 2BLLA 1IFXA 4NNOA 1QPGA 3FDXA 4F45A 5E8RA 2EU8A 2VF8A 1EB9A 3E3MA 1FUUA 4FT4A 5EWMA 3P0JA 5LDDC 2CDRA 1CD5A 1C8KA 4RQAA 3F6RA 5TMEA 3SEAA 4BJ1A 3AJRA 4GZ5A 3RTCA 3BEDA 1ZQ1A 4B40A 1U2QA 4J3FA 4BMYA 2Z8XA 2IGTA 2H3EA 4ETIA 4FFVA 1M67A 4PZ9A 2O8FA 2ZE8A 3RQIA 2VXOA 1XCGB 5LXTF 2H51A 3HB1A 3DOFA 4ARVA 4I6EA 3CRNA 2WWHA 3R5KA 5EI5A 1BWQA 1WG8A 4CKCB 1O5IA 2H4WA 2WFZA 2H0RA 3CH5A 3EC1A 3WV5A 5IEJA 4XUGB 2RGUA 3GH1A 5JZMA 4CKBB 1JE1A 1NVBA 2CYCA 3C98A 2GTHA 4MPTA 4ZDWA 2JLXA 3JQ8B 1AN9A 1DX4A 4X64B 3WWZA 3ECCA 2HTFA 3ELBA 3QA9A 4OSOA 5IK2D 2BLNA 1MFPA 3F0TA 4P7FA 1RZRD 1UPUA 1YCFA 5EZYA 3WLHA 1M2WA 4RHEA 1U2EA 4Q21A 4XW2A 5LKAA 5ETJA 2ZULA 5DNEA 4DR6B 1IZ0A 1E20A 1HC7A 1NKTA 2PZGA 3ENVA 4EKGA 1CRPA 1DC6A 3KK0A 2NU6A 4W7IA 2BUBA 4R7ZA 4E07A 1ZJ5A 5BW8A 4JJAA 4B80A 2JHFA 3V46A 3TQTA 1Q1NA 2RJOA 3E5MA 5AYVA 1U0SY 5A0VA 4TMFA 3NU1A 4F38A 3CZCA 2MSWA 4C20A 1BN6A 4YRSA 2OO5C 1O0BA 3CG0A 3I6MA 3EHEA 1RBZA 3N2EA 4NCHA 2FAXA 3AZPA 4QARA 1ORDA 3EXG2 1PJTA 3FHLA 4GXQA 2GH1A 4U0KA 1O97D 4MRNA 1DJMA 4EY6A 1F0PA 2VC2B 1H2ZA 4WW0A 3VSEA 5CH8A 4CV3A 3W2HA 4A8HA 4C4YA 1VI6A 1UQRA 2RBKA 1QU3A 3SVZA 2BGJA 4FWIB 4IX9A 2N47A 3HNOA 5CDSA 2UYYA 4R9SA 1PWZA 2EHJA 1AS3A 3D31A 3K8YA 2XMBA 5CB4B 1YDMA 1AO0A 3HNRA 3DHWC 1N0IA 3IP7A 3L7LA 4GRAA 2JLVA 4GHWA 4M46A 3JX9A 4I5EA 4E1AA 2UYGA 2OAGA 3AEKA 2PO5A 2XVAA 5EJ7A 1TQ8A 1WD7A 5CCBA 2VWHA 2FPWA 2X40A 1OWNA 1QPZA 3M6FA 1R88A 2DWCA 4BQPA 4DCOA 5T5QA 3ZZNA 3ME5A 1EB8A 2O2XA 2XMCA 3Q85A 3RSQA 2BFAA 2NVOA 1B3BA 3B53X 2IHKA 4FZRA 5K8UA 1Z0AA 1JAXA 4M60A 5DNCA 2Z5GA 1NE7A 2WA2A 1C0LA 2FX2A 2VUIB 3D2BA 1DWPA 1M1XB 4JB8A 2ZSUA 4YT4A 4UUBA 4DE5A 2C84A 1M7GA 3L43A 4MKGA 3DHEA 1Z2OX 2YFHA 3U3MA 4PYNA 3NW9A 4AN1A 4ZQIA 4MR8B 3EEQA 1J9ZA 3E2PA 1M1YB 1L0BA 3NANA 3Q87B 5P8WA 1IN4A 1E8NA 2C3YA 1Z7YA 3WQQA 3DE4X 3BREA 3DP9A 3L0YA 2R60A 3LPDA 2A5JA 3PPWA 4PBRA 1V5IA 1Y8CA 2H1LA 3NG1A 1GTG1 1J00A 2CY0A 2DYKA 3PNMA 3JYOA 3A70A 5H80A 5F52A 4EDHA 2NXJA 4Z4HA 4C1NA 2H52A 2II6A 4OXNA 1AXGA 3T5GA 5K5EA 1UAYA 4BGVA 4C4RA 1OW3B 2GEVA 3DEKA 1SEVA 3IMFA 1R5NA 2X7XA 3NC4A 3GD5A 4C6HA 1OT5A 2QUBA 2BISA 4TN5A 1RKXA 1T9GR 5EE1A 2GCEA 3V8MA 2EBUA 2HF2A 1H1LA 4XQ0A 3U0VA 3HUTA 1UM9B 4R9VA 3ZCSA 3Q9SA 3R5SA 4HADA 4A0SA 1XD2B 3PS9A 3W77A 5EJIA 4UQLA 1QOPB 3O8BA 2B4KA 2DT8A 3UTDA 3UANA 1OWOA 4P35A 2HF7A 3UGQA 4BNJA 5A0TA 3ZBTA 3ZGZA 2B8JA 3LSTA 4NESA 2GM5A 2HMUA 4AY4A 2XKKA 2VZ9A 4GGMX 1OAAA 3EXHA 3MW8A 3YASA 4EGJA 3TGLA 5F51A 3M2PA 2O3QA 4INPA 1U0TA 2BUCA 3BCRA 1KKMA 4K9OA 5EPOA 3ZWQA 2CLDX 2EBHX 5D87A 1EUCA 3HM2A 4A0FA 3K71B 3PB3A 3PZRA 3S2IA 5HOQA 1JA9A 2H29A 2AW3A 2FXVA 3N3AC 4WBXC 2X9NA 2W70A 4FB4A 3B7WA 1OOEA 1QXSA 1WMEA 5CIWA 1G38A 3A9RA 2JD0A 1DWUA 2OK8A 1WX1A 2XYQA 1NYTA 5IC6A 4YJFA 3QEBZ 2D2IA 1GN9A 4NYIR 5EIWA 1N5DA 1P74A 1PD0A 2GBLC 5SYAA 2C82A 4I6GA 3P4YA 4XDGA 4BX3A 1LVGA 4NU6A 1UJMA 3C3AA 4FNGA 1KIMA 4TKUA 1I9GA 5LP1A 5FA6A 1HLPA 3FBTA 2ZRIA 1NHGA 2I55A 3GOQA 3JALB 1JAHA 2WFMA 2XJ9A 1M5RA 5TE9A 1P7VA 4OLFA 3JZDA 4AZVA 3D5QA 3QWHA 3AI1A 5AKXA 1I2AA 5ALGA 2AN9A 2IYFA 1FJGB 1UAGA 1ZMOA 3K31A 4W99A 3QYFA 4B44A 4PCUA 3IT2A 2DT5A 4ZHQA 3DJYA 4RS4A 4RS3A 1JB9A 3EBOA 3OEHA 1I7SB 3RW9A 1EZZA 2ACWA 2FP3A 4EFNA 3L4KA 1R50A 2R6HA 1OB5A 2GPNA 1ZJWA 2CBZA 3FWPA 3ES9A 4IX1A 2VZLA 1Z17A 1HZZC 5EXDA 5JMTA 5GONB 1JMKC 2UUAB 4LFBB 4DL9A 4A15A 2C57A 3UFXA 2JCGA 4CWAA 3N7UA 5DLDA 4A27A 3P2EA 3ZE9A 1PS8A 4E5NA 5LDGA 4NYMR 4QTZA 4EVRA 2WD9A 5DBFA 4Q1EA 3AVVA 2YN0A 1JNYA 1Z13A 3R3WA 2IT1A 4JP1A 1KSHA 1I6LA 1M2FA 1Z47A 2EZTA 2X1VA 4IH9A 2YVAA 3Q0EA 3HJUA 2RGYA 3GEPA 3K94A 3MFQA 4IG9A 4KFRA 4KQCA 4OH1A 2VH1A 3N8DA 4XM1A 1R5OA 3UXEA 4B09A 4CV0A 3IHTA 3NWJA 4BKRA 5I7EA 3EVNA 2HJHA 1LDGA 3RVJA 4AECA 4I4LA 3JQFC 3BTVA 4IO1A 4ARZB 1FSGA 1KAHA 1M1NA 4EW3A 2ONKA 3QHAA 3ZGLA 4AB1A 3QEMB 5BT9A 1TAQA 4E0BA 1UMDA 2GGSA 2E4AA 3GROA 4EA9A 3QMMA 1DTWB 1NKVA 3GEHA 3QVUA 5I3ZA 1JIIA 1DB3A 4PLYA 1HDCA 3KE8A 4HFJA 4WFQA 4OMCA 3F9IA 4CCAA 3SHQA 2RARA 2DTEA 3FDIA 4BJHB 1WCV1 4FGSA 3AB8A 4KQ6A 4CU5A 1QFZA 1O9HA 4RPIA 4ZYXA 5JJKA 3TXYA 4CIDA 4DM4A 3W7AA 5TV2A 3PXEA 3LY5A 2NN3C 3LY7A 2L42A 3ND5A 3GEEA 4HKTA 4P7BA 1ZICA 1ZPDA 4ZO7A 2P9EA 3QUTA 2DFNA 4HQOA 3AV3A 4KYIB 3QVLA 4QPDA 3E9NA 3CBGA 4DR3B 5AJYA 1JEYB 2NW6A 3O7MA 4HWTA 4TTQA 1X8XA 4Y2SA 3TLZA 3HO8A 4H4CA 2JJYA 3BIJA 4RADA 1KJJA 5CEJA 4FT2A 3BEOA 4L6IA 2W93A 3DG9A 4RY2A 3UATA 4B6RA 4IEIA 2WRZA 1L4FA 1UOPA 1YQUA 3HYCA 1MTOA 3O4IA 3RT7A 2J9FA 1WOMA 1QC5A 4TRMA 4ARZA 5JS6A 5H16A 1HEUA 2B21A 1E5TA 3JZFA 1JHZA 2YZGA 3CX7A 3NBZC 1W44A 4UTZA 2PA3A 1ZITA 3I01A 3AIMA 1J22A 2X8LA 3JD0A 3KU4A 1L5MA 4AWAA 5JTTA 2ZWVA 4FBLA 3TSAA 3TZ6A 1MEOA 3I64A 4OI2A 4DSNA 2Z58A 3GA5A 4X45A 1WVGA 1ZRMA 4ZU3A 4K1XA 4B3SB 3EVCA 2BM9A 3N28A 2DZDA 2ZT5A 3OQ6A 3CKMA 5DYNA 3B3JA 2QRJA 2BGGA 1B6RA 5BN4B 4H7HA 4LOHA 1VCOA 3IQDB 1UDXA 2HJVA 4K03A 4XWOA 2GN2A 4N0MA 3FSEA 4ZOLA 1NMEA 4BFVA 3D3QA 2I62A 2B6HA 4G09A 4Z3OA 3BH0A 5L9AA 2OXTA 4TMKA 1GEEA 4O2AB 4WK6A 4Z9AA 2P9BA 1VLZA 1K75A 4XX0B 4JI5B 2ZUWA 3NHWA 4UASA 2FPRA 1SXJA 3CHYA 5E4YA 4D8YA 4BO1A 4C0BA 1IONA 1RPAA 2ZROA 2RGEA 4M0MA 5D3ZA 2A9PA 3DT9A 1YNSA 5C8ZA 3CZ9A 3OEHD 3PJFA 5HUJA 1A4RA 1BFUA 1F9EA 1L7MA 1WP4A 2F3TA 2GFIA 1Y33E 3BE4A 4RQTA 3GLFA 5AIBA 4QPZA 3QE4A 3FX2A 3AGPA 3F6EX 5ECDA 1ZVQA 1TJNA 1ICIA 2GF2A 4QREA 3TTYA 2F48A 4W5WA 1HEIA 5C8XA 3T9AA 5SZKB 2XD4A 3H04A 5GQSA 2J9RA 5B1SA 2QLMA 2CFIA 1GP2A 3WICA 1V45E 2BP7B 3AF0A 3S2ZA 1GRRA 5K3OA 4QGGA 4LHSA 3I8XA 3MAJA 5DCYA 3NM4A 3O3CA 1D0SA 3ITKA 4RHXA 3RT1A 3DDCA 3U7RA 4CLDA 3ZU4A 4W9NC 1K4MA 1NBME 4HDNA 5EKXA 1GLNA 4G4GA 1JQLB 1MPXA 3FYUA 3HXLA 1MOPA 4IXWA 2G5PA 3ESYA 1P18A 4HNQA 5DHTA 4WAUA 3I8SA 2BTEA 2DCUA 1U81A 1E0KA 2ZI5A 3KKOA 1V1MA 2IEYA 1DJOA 4QPPA 3P9PA 3A4YA 4YT2A 3C8DA 2IU0A 1QYXA 5EIXA 2IEZA 2RK6A 2YS7A 3ILHA 4XR4A 3ROTA 2P0YA 4Q9JA 4A03A 1E5XA 2DKOA 1CZNA 1IUNA 1KP3A 2NO6A 3I8OA 1KK0A 2GRAA 3CJTA 3QY9A 1A9QA 3QMWA 2X5NA 4IOJA 3WGZA 2C54A 3OE7A 3AKYA 5K8IA 1IM5A 1NVWQ 1AK9A 1PLJA 3DSRA 2QUAA 1D2RA 1HYEA 2UYOA 4N0QA 4L6AA 2J45A 3HVKA 2TRSB 1SXHA 3UNXA 3D4NA 1ISGA 1JZQA 4B4UA 1U4OA 2YASA 1OH5A 3A27A 1QBGA 1PR5A 2VZ8A 3N6XA 1KGDA 2ODEA 3EZXA 3JAKA 2O8EB 1G8FA 2I6QA 3BGIA 5K05A 4MGHA 1WB5A 4N41A 3EOAI 2O2GA 4TLDA 3H7AA 2ZUEA 3GA0A 4JB3A 4FM9A 4ADSG 5HM8A 4GI2A 1PNOA 4NJEB 4O4HA 4QKQA 3ZBQA 4ER5A 3LWNA 3RS5A 2OORC 1IN8A 2VBCA 5ENZA 3WLTA 3WMXA 1G4AE 2I1WA 4BYMA 2YWXA 3FM9A 1FUKA 3TLAA 5D3KA 2ZPUA 5J5CA 3RFCA 4K8OA 1H4VB 5AKHA 1XJWA 3MRSA 2O23A 1S9DA 1ZK1A 2IXBA 3MTAA 3L7OA 2PQMA 1PT7A 5AM2A 4XVCA 1WHTB 3A1WA 3Q1KA 4AY3A 1HKUA 3ZDQA 2ZIXA 3W5AA 3NBXX 4ZODA 2ZYWX 3B3AA 5C0OE 1MP0A 5HIAA 3AYZB 4H0FA 1E9EA 4UVIA 3TE7A 4O3MA 1G291 2CLEB 3D7RA 3UUWA 3TUJC 5LMZA 1KK3A 2FZ5A 1KFKB 3QEKA 4QYTA 3TLMA 5A9RA 1XLWA 3JVUA 4YR9A 5CA0A 1Z75A 3TDKA 2GZ1A 1RLOA 5EZYF 1TLTA 3QSYA 3KJNA 1JWLA 1RM5A 3BQMB 4DZTA 3N1UA 3DXZA 1RJWA 2M1XA 2YYZA 5LWHA 4Q3CA 4RC9A 1JG2A 1NFRA 1P1RA 2DR0A 2QX6A 4Z9FA 2W2TA 3TBFA 2QZPA 4HQNA 1QQBA 1RVDA 2CFOA 4N40A 5CD9A 2FFHA 4UUOA 1SXJD 4WOPA 2G7ZA 3DE6X 3GBPA 1VA5A 4L51A 1VJCA 3RJZA 3U26A 4OLHA 2XUDA 1JHUA 4YRCA 2F00A 4TZ0A 1YZVA 4F5DA 4EM6A 1IHXA 5I9NA 4YJGB 3OFJA 4F4JA 3DQPA 2VHYA 3O4RA 3KWJA 2EL9A 1RM0A 2LUOA 3H7IA 4DOMA 4RL6A 3EGDA 1JA0A 1ZI6A 2PCJA 3IUSA 1X7HA 1EMDA 3JZAA 1JIVA 3OOYA 5AVRA 1U8ZA 1XWFA 4GQAA 3G2IA 5ICFA 2G5TA 1TYCA 1OFHA 1VHQA 2GZHA 3CT6A 3F8WA 3HCWA 1Y1RA 1YZGA 4E3ZA 4TMXA 2NXEA 3KNZA 5F5LA 2EF0A 2OAEA 2WR8A 2JFHA 4BRUA 3ORRA 1M6HA 1TJPB 3W6ZA 3QPCA 1Q14A 3IKTA 4IDAA 4JB2A 5F1PA 3ZTWA 1CW2B 1DV1A 2IYNA 4YQFA 1R27A 1IUKA 2ODAA 1KQFA 2OWDA 1WDKA 3LPAA 4G0QA 2QU8A 4OJMX 1K9VF 2CD7A 2NSDA 4BGUA 4DCNA 2M32A 1P77A 2NZWA 1RWNA 1XKQA 1V11A 3DBIA 3QKTA 4G23A 3UHOA 4B9EA 3GLQA 3D6UA 1AX9A 1VIMA 1W4AA 3MUEA 4RGQA 3AQIA 1KEKA 1N8KA 2Q3HA 3OAAA 1NMZA 2PAAA 3O7WA 3OE7D 5GAJA 4AFNA 2Z5LA 5BMVA 4P2GA 5C1BA 5EJMA 5I51A 1DX6A 3QPVA 4GUAA 4WH0A 3WLMA 2IPAB 4KAJA 4B6EA 3HXMA 3W79A 1YQEA 3TNDA 1ZHOA 3QUSA 4ML3A 4G9EA 2OHVA 1N2OA 1ZCJA 2KI5A 3KUDA 1L5KA 1M2OB 4UNSA 4MAFA 1CE8B 5E4TA 3A6JA 3P9ZA 4G81A 2O2IA 4PQEA 4CLHA 4DWVA 4EELA 4UUNA 4KFCA 3EEBA 4KO8A 4UZFA 5IVDA 5F1KA 3HL4A 4HDSA 4TKVA 3E9YA 1L4HA 4BNDB 2B98A 4MUXA 5IVIA 4UBNA 4E2YA 3JPYA 1Y1LA 4YUAA 1PFVA 2Q9BA 1VJTA 2RKOA 1PQPA 1MO5A 3GUZA 3K0CA 1ZFNA 4JBNA 4HAUA 1OAOC 4MHTA 1Y9ZA 1BTOA 4LF8B 1QVWA 4B5LA 5GM1A 3P2KA 3N70A 1SG0A 2VNHA 2VG8A 3AWDA 3AFHA 2JAUA 3KPWA 1JSXA 1ZBDA 1GZ3A 5L4SA 1ZIDA 1ZKDA 2AYYA 2F8MA 3ANLA 5B4VA 4GOXA 4NMLA 1RLIA 3GEBA 2YBDA 4I1IA 4AJ9A 1N5OX 3ZFPA 1ZMRA 2JEOA 3JSAA 3G7UA 4ZI5A 3UO8B 4CMIA 3EISA 4HR7A 2X42A 5BNZA 1L6IA 2X8JA 3DUWA 1Y1QA 4K3VA 4HF7A 3NMUF 1T9KA 1K86A 1Z2PX 4WNIA 4FFNA 1F06A 1T6NA 1KAMA 2BEWA 5F3DA 1JUDA 4I0WB 1FMCA 3PXXA 3NBKA 5IYZA 3SQOA 3IQXA 3NBQA 2NM0A 4LBZA 2VWPA 2JRLA 3CVOA 4MUYA 4D9MA 3TR6A 1Z4MA 5BN5A 1CQIB 5T4HA 4L73A 4C4ZA 1VCIA 3MCZA 1XNGA 1L5NA 4US1R 4C7KA 1IIBA 1L5HB 2XH8A 4DBLC 4HVAA 5ITVA 4X66B 4WKCA 3TAXA 4JJ6A 5KYVA 1G5TA 1FQJA 1ZAYA 4YCCA 1X1EA 1ZISA 2J3JA 4HDOB 3PITA 2XKBA 5DX8A 3ZE0B 1N92A 4KYUA 3L8GA 5AKEA 4ALJA 4BKOA 3TEFA 2NO7A 1ZXXA 1D2MA 4I2VA 1KOGA 3FOFC 4OJKA 2AFVA 3KAKA 5ARCA 3SJCA 2NZXA 4ZHQF 4JBHA 3LL4A 1YB4A 4UDYX 2QP3A 4OATA 4BX8A 4H9GA 4FEYA 1V48A 2WSSA 3OBBA 2B6NA 1ZBQA 1Z29A 3OX4A 4NPAA 2ZJBA 1BCSA 1G20A 3HJNA 3GGJA 3JD3A 1PS9A 2WWIA 1EA7A 2PUTA 3MQ2A 1DPFA 1RVV1 1ZL0A 5KYWB 1GRVA 1NIPA 2WYUA 1BX1A 2Y77A 2ZRNA 2WJPA 1Q19A 3FJ1A 3GJXC 3IX7A 4GKBA 4X7BA 4Y1GA 5DXFA 1JDUA 2BFDB 2UUOA 1NVGA 3MIIA 2G9VA 2QTTA 4XVRA 1GZVA 4UATA 1V6AA 3DD1A 3E70C 3TKAA 1RWKA 1X15A 1VE3A 2HFKA 3R7WB 3X2FA 5J4YA 1V2GA 2AC4A 1UBGA 3K1AB 3OAAD 1R9MA 1T1JA 5F7ZA 7MHTA 4L9SA 4XGQA 1SKQA 3MTGA 5CD1A 2Q1SA 2OKGA 4MS1A 2VPYA 3P9SA 2NTEA 3JR3A 2WLSA 4YRLA 1GCGA 3E1SA 4E32A 2OHOA 2WD7B 2BHNA 3E7DA 1TQ4A 4FYWA 2JKZA 3I2FA 2JCBA 3FZQA 5EL0A 4EKYA 2JGDB 3K1JA 5DWVA 2C00A 4JU8A 1XTRA 4MS3B 1JE0A 3RJMA 1MW8X 3O8DA 4CM4A 4E03A 5F98A 3A9CA 4UBLA 4RF3A 1PNQA 2IDMA 2BGRA 2JIDA 4L4RA 5I47A 3V4LA 1AXEA 4E5KA 5ERXA 4RLFA 4RCVA 5GJVC 4NLLA 1SK8A 1EXWA 2C98A 2WSLA 3BCUA 5FTKA 3VM6A 4RUKA 3PIIA 3ZCTA 4UPEA 5K3AA 5JNVA 1T5BA 3HH8A 4TT8A 3RBVA 3K70D 2DLCX 3ER8A 3LGAA 2Q6TA 3PQ5A 1I2DA 4BLWA 3GFOA 4U9UA 3MELA 3OPYA 2CXQA 2C0PA 4V0LA 1CX9B 3IQHX 3SS8A 4ND3A 2GVDC 4R1NA 1R6VA 1K6XA 4A0QA 1EAYA 4HH4A 1UAAA 2Q2WA 3W1WA 3WBBA 3N8NA 4Z4IA 1D2GA 1NI3A 3I76A 5FPSA 5FTWA 4BUJA 1H4SA 1ECPA 2F1RA 2ORVA 3DV2A 3G2NA 3LCVB 3Q1LA 1Z06A 3MLBA 3NHKA 3BMOB 3DVSX 1XLTA 2XADA 1O6GA 2ZOSA 2Q6IA 2PXXA 3W0LB 1JHMA 4LSGA 1DUSA 2FW7A 3M4JA 4YQEA 4RK7A 2IBTA 1JQ5A 1F0NA 4WASA 4J6FA 1RFLA 3ZLBA 1GUZA 5JZ9A 4ITVA 1RCFA 4DNOA 3P9YA 4YDRA 3EW7A 2AYZA 4XCQA 5HRCA 2BFPA 1J0XO 3PGJA 5F9HA 2NSYA 3GC6A 3NHBA 4FFSA 4ZOLF 2R4UA 3ZGYA 4CL0A 2H07A 3ZE7A 5ILQA 3WGLA 3G9XA 2WWWA 3IP5A 2J4CA 1ZGZA 3BIWA 3I5AA 3F6YA 1MN6A 1O6CA 1R8SA 4M1YA 1C30A 5CURA 1YB1A 4MP6A 4CDNA 3ASZA 2ZDHA 3ZV4A 1TMGE 3T12A 5EPEA 2C5BA 1EFVB 4IIVA 1HQCA 1Q0PA 1CDOA 3B5IA 4EZIA 5AVXA 5FBWB 2NVWA 5FFNA 4EW1A 3K6SB 3GP3A 3F5DA 4IQ4A 4D7AA 2Y1GA 2LGJA 3KT0A 2WSSD 1EXMA 2ETVA 2WJGA 1FFCA 3QTTA 1JNXX 3MJVA 3THWB 1R4ZA 3RVQA 3DKKA 3ED1A 3P9IA 3SZGA 3DNFA 3O2SB 3REOA 4LEIA 4ENUA 4F91B 2HA4A 5LIRA 4LRWA 1NV9A 1ACJA 2CZCA 5KKAA 5CLJA 1ONBA 2R44A 1I0IA 2ENUA 3FKSA 1QF7A 1QIGA 4E7PA 1ZD8A 1O54A 4PGMA 3RM3A 4P0QB 4DDWA 1GZDA 4L7QA 2ZVQX 5MN4A 2FFJA 2XE6A 4RA9A 2FUCA 2QTHA 3O90A 1JG1A 4QOSA 2JAQA 2HXSA 5IT5A 2HSGA 3E7FA 2HK8A 3W2FA 4F4FA 5EKUA 3UHJA 2A84A 3D59A 2PZKA 2BR5A 1UJBA 4B4WA 4YH1A 1C0KA 2DH5A 2ZG6A 9LDBA 4Q1AA 4DJTA 1USGA 1GPLA 4M38A 2EKQA 2YJTD 3AERA 3MCUA 5EWJB 4D41A 1Y9EA 3QPAA 1KFEB 4IINA 3KSMA 2FHPA 2X15A 1JHOA 3DONA 2EWWA 3O8NA 4Q37A 5KTPA 3PI6A 4Q0MA 4PV7A 4X41A 5ED0A 5KSOA 5EJAA 3DPSA 3WHPA 3QVMA 2P2YA 1Q6ZA 5B53A 1KZYC 3AEZA 4D4GA 2ZRJA 2AMVA 2V7QA 5BN3A 2HBRA 4ZJYA 3WK8A 4OQPA 2G4VA 1SBNE 4I1SA 3KUXA 1T4GA 2EYQA 4HDKB 1HRKA 4CN9A 4NXNB 5BY2A 4DSTA 5LJLA 3EGVA 3L41A 2ZUCA 4TPKA 2I87A 2QLBA 1OXMA 3CE9A 2V5UA 3BE8A 2FU5C 1ZRSA 2NXCA 3PD1A 4X1IB 4LVUA 5AJUA 5AKIA 5TEWA 4DMGA 4ZZ3A 4KODA 1N7HA 1XMXA 3CTMA 2ZQYA 3HGMA 4GT1A 4O4HF 4FTWA 4K2HA 4WDQA 2B4YA 1XMIA 3JARB 3A37A 1CPYA 1BYUA 1IWBB 1Q2UA 4ANFA 2DFTA 2JB9A 1J39A 1Z15A 3Q6NA 4DJJA 2JFZA 1BROA 2C8KA 3WOHA 1C7RA 4B3XA 3L7KA 1SK9A 3WYEA 3OJLA 1XL1A 3D4PA 3ZGXA 4U7DA 4DV2B 3SI7A 1N6IA 3RC3A 5H59A 2HLNA 4DMMA 3UJDA 1EPUA 1W25A 1M5TA 1Z35A 3AESB 3GI1A 4S12A 4TMVA 5EXSA 4MTLA 3B13B 2QT0A 5CDFA 1CS4C 2GAJA 1U6IA 1W96A 1W5SA 2P9HA 2WQZA 1J24A 2P9JA 1Q12A 1TYBE 1ECJA 3PNSA 4GXRA 2XZPA 4A91A 1OY1A 4DZRA 2XZLA 5CA0F 1TK3A 2NXNA 3C2QA 4M9RA 3V4ZA 4DRXB 5CLGA 2BR3A 4DQDA 2P9CA 4DJAA 1U0OC 1NUSA 3ZKAA 3NDBB 2BC9A 2C0CA 2L2QA 3FLEA 4BKUA 1KAOA 1EK0A 1FTGA 3SKXA 3VVCA 1TF2A 4JCOA 5AI5A 1QV7A 3LZ6A 4JP2A 4WOCA 4HXEB 1BN7A 4J1TA 5IUKC 2XMRA 1PT9A 2COUA 1UODA 4ZHSA 5A6SA 1Z73A 3ZKWA 1VCMA 2H57A 2Z3WA 1OX4A 2PJZA 3QJ5A 3E7PA 4KH1A 3U56A 5K4AA 1LB1B 3LKVA 1NPTO 3HR8A 4HH0A 4L74A 4MUGA 4M9UA 4UJ3A 4BN5A 2ZAOA 2CCKA 3KQKA 4RIEA 2W83A 3U19A 1U4SA 1ODLA 1XL0A 3E35A 1UMBB 1TUGA 1F2UB 1I3OA 2RB4A 5TJ9A 2BFBA 3UB2A 2OV3A 2Q3DA 3EBLA 5LP6C 3FKSD 4M0EA 5JXIA 4NZMA 3WL4A 3M5DA 3WV4A 3QX3A 2VJDA 2FWMX 1Q57A 2FZLA 2RGXA 1YASA 1HE2A 5I4KA 1U3WA 5L45A 2VSYA 2B7CA 1YK1A 4RTSA 1Q0RA 1QANA 4E5UA 3LLSA 3VVLA 2IIPA 3QRWA 3RAJA 1B2LA 1H9AA 3HGQA 2UVPA 1RWBA 3H6GA 4YB8A 3H2SA 4G63A 3MN1A 3WXBA 2P1ZA 1U94A 1S3IA 3KALA 1P1KA 1T4DA 3DEAA 5GV8A 4DBZA 2ZJYA 1PFUA 4JVMA 5K6RA 1OLUB 1N77A 3FWHA 1ULAA 2D06A 3FW1A 3VZCA 4KQ9A 5BMVF 3V7NA 3D8HA 4EG3A 2RONA 4J0HA 1D9XA 1UDBA 1DHRA 2JFOA 3COPA 1JP7A 4Q1DA 4C0SA 1KR5A 4EA8A 2DU8A 3BRWA 2BFCB 2BBSA 2V7QD 3AR2A 3HUEA 4EATA 2Y68A 2YX1A 1QLWA 2BFFA 1A2KC 2P27A 1VGRA 2IXEA 3DGFC 3TTVA 2P8SA 2W00A 5E2IA 2AHRA 4KRXA 3H11A 3M82A 2Y4OA 1Z5PA 2QX7A 1YR2A 1CP3A 1QHGA 3OUTA 5GJWC 3EVAA 3B38A 5C18A 1M0TA 1E6LA 3OIWA 3A6ZA 1SY7A 3OUUA 2C8VA 1CJUC 2NU9B 3ILVA 2OBLA 5I7SA 4Q82A 4W9RA 5AM1A 3RS3A 3A0UA 3DFZA 1DXQA 3EPJA 3QKIA 4KFSA 3RGGA 3GPBA 2ZUUA 4NEQA 5CAEB 3R9WA 1IRIA 2G3YA 1P39A 1J8QA 1VKZA 2J32A 4S1OA 2V3CC 2QGNA 4QYWA 3MJHA 2G1UA 3IR7A 5BT8A 1TADA 1VL1A 2I22A 5IZCC 1KERA 4GLJA 1T8TA 1NI4A 4JJKA 4AVYA 2MYNA 3FHJA 2BFEB 3GW8A 4LMAA 2YYYA 4HUTA 1WUTA 2GD1O 2NZ8A 4GGOA 3EZ2A 4J91A 5EY5B 2ZTHA 1Y6JA 4AF7A 1GQFA 5DK4A 1FXSA 2QD1A 2J7KA 4ON9A 4CXMA 5FLYA 1YB6A 2C95A 1OTHA 3DDUA 1Z82A 3BMNB 3CF0A 3F2IA 2QQGA 2R6CA 3A4TA 3HY6A 1WMAA 1CXZA 3SSOA 2XAUA 5D3MA 3SX0A 3TKLA 1XJCA 4C08A 4X7MA 1WPRA 1DRKA 1LI7A 4ZT7A 1QPBA 4OMFG 2QDKA 1Z6AA 3HY4A 3HA5A 3U4AA 1AKEA 1E5VA 4LGVA 4PHFA 4ZD6A 2PEZA 4BQSA 2CWDA 1J2UA 3F5FA 2L82A 3FN4A 4P8RA 3F3SA 3AUJB 1JIUA 1BVUA 2ZIEA 3DEIA 1YVUA 3G1WA 4F5WA 5HJEA 4C7XA 3BB1A 2ERCA 3L84A 5HYVA 3E4CA 2R6ZA 4N7MA 3LQKA 3WWOA 2P3LA 4OL9A 4QBHA 5GADl 3Q5DA 5E8JA 5JAZA 1UEXC 3BK7A 1W94A 2ZQZA 3MILA 4QX6A 4KR2A 2V7BA 3RR2A 3COWA 3MWFA 5I9SA 2AT1A 3FNIA 5IZ4A 3U3KA 2OPHA 2GAIA 1ZIXA 2HF8A 2LTAA 1AF4A 3ETNA 1DEOA 3DFIA 4HYEA 4CEJB 1YHYA 2M9MA 4PXSA 2R1VA 4G1BA 1ECFA 3PXBA 2REBA 2EWVA 1QKKA 1YNOA 4GBJA 4FD2A 4L9WA 1WVIA 3IXMA 1GL9B 4NZZA 3O74A 3Q7RA 3RUIA 3AUFA 1NRJB 4E21A 1QB7A 1L7VC 1M83A 2NG1A 4EUEA 2QYTA 4ZRMA 3I3OA 4WKNA 1OB2A 2ZPAA 3EIHA 4PICA 5A03A 2FSSA 3O26A 2C7GA 2OM2A 4TTJA 2WK1A 4Y7DA 3BRWD 4D9HA 4JLWA 5F5NA 1RR6A 1VE5A 1V71A 1LEHA 3SHVA 5FBZA 3C3CA 1CV2A 4HXFB 5THQA 3OA2A 3W5BA 4ESHA 1BO6A 1SG9A 2AG0A 3IERA 4PNEA 3T1OA 1KMHA 3BT7A 1JT2A 2OHHA 2PIDA 3LPMA 2JIOA 3AKEA 1L4EA 1WZUA 2W4IA 2R8PA 4H31A 1A9XA 5JJLA 1EVZA 3IBYA 3G0BA 2LNDA 3A6FA 3PK0A 4RKQA 1KRXA 3B9QA 1NJSA 1IJEA 1OBVA 5JAOA 4B84A 4UHKA 2QRVA 1LBSA 1ZOIA 3P26A 4ZCSA 4OHZA 1L4KA 1K7FB 3P2MA 3HRKA 1C1XA 3DYBA 3G79A 4CQMA 4QUKA 4MLDA 5BSVA 1G21E 4MCAA 3DBVO 1MH1A 3THXB 4CQLA 2PL1A 3VC7A 2P3SA 1BA3A 2VQSA 1AKNA 1VFNA 4FS3A 4HWPA 4L72A 2WMYA 3QUQA 1KTIA 2BELA 4FYJA 1YF3A 3AZQA 1EX7A 1TQDA 3G9QA 4NR0A 5IKEA 4GDFA 3ROFA 4KE9A 4QGAA 4JLBA 4Q4HA 4G89A 4RD4A 4YASA 1X7ZA 3QUAA 1Y1TA 4NBKA 3H5RA 2WMOB 5DHRA 3RKSA 3ZNPA 3SYKA 5ERGB 4X8LA 5FPHA 4RZ3A 3ROPA 4PYMA 3TQSA 2PANA 4B3JA 4HRAA 2O2JA 3FPAA 4XLLA 3W2GA 4RMHA 3UA3A 3OOHA 3P5BA 2G1AA 4EFKA 1UBJS 4TXNA 5CJ2A 3L1VA 5U4QA 2JRCA 1AY0A 3IUJA 1TM2A 2G72A 5BSUA 2WFLA 4NHOA 3BWBA 5J5VA 1HZJA 3OQMA 1GNLA 1W9HA 3WNQA 2FE1A 3KAQA 4FSHA 4TWAA 1S2MA 2YVUA 1Y8RA 3K8ZA 4Q9DA 3ZGVA 5BWNA 1BJRE 1Z8HA 4JLVA 4WCFB 3VFDA 4KHPB 4KMMA 2JLCA 3HACA 2FMTA 3GGDA 2WNIA 4GEGA 5HZGA 4P7JA 2A0UA 1YDHA 1U80A 2H7VA 3DA8A 3EH2A 4FK8A 2IXFA 4PSKA 5FO0A 5SY6A 4BMSA 3BIFA 2GBIA 2UZ1B 5AHKA 1DQRA 1XBTA 3NHLA 3R0JA 4NBNA 1PG2A 3T4XA 3ASYA 2P30A 4OV6B 3PXGA 2CSXA 4KLRA 3K4HA 2AJDA 3KJGA 1PEAA 2VYNA 2FDRA 2IIVA 4KZPA 2QM8A 1X1RA 5I9MA 1W0JA 2Z8ZA 4FZJA 2X1LA 2BWJA 3ESCA 1VSBA 4I1RA 4RTRA 2IYRA 4X44A 1PJLA 4KUHA 3VDMA 3EA5A 4S04A 1VZ3A 3RVRA 4BL5A 2AB0A 1HG1A 1VG8A 5KYKA 1Y98A 3ZWKA 1XTVA 3R3JA 4MRMA 2WYWA 3J7AC 5DTJA 1GGMA 2P9QA 4HB2A 3NTQA 4DIFA 1SBYA 1CJSA 2D0PB 1G55A 1KOFA 2GHTA 3EVDA 4ZCPA 1LF0A 1XKLA 1YR8A 4XZ3A 4Q12A 3U37A 3U4DA 2P6OA 3KJFA 4X84A 4LWQA 3SF0A 3PFBA 1KWGA 1LBIA 1I14A 2R1TB 3EJWA 3L04A 5LYJA 3A3YA 5EHNA 5C3UA 3VR5H 4INJA 4JA2A 4I2NA 3OIDA 2MHCA 4LNAA 1B42A 1Y5NA 4CI9A 1N6PA 1Y1SA 1G7TA 2VBIA 3PNBA 3G13A 2HA2A 1QGZA 4Q9NA 5ALIA 1E2BA 3AL3A 4B43A 4O4LB 4IZ6A 4N03A 1CIJA 4URHA 2H63A 2WIKA 3G2JA 3VJKA 4EGCB 4MKIA 2WJJA 4HGQA 4CTOA 1ID1A 3BFPA 3I73A 3DM5A 5EP3A 3F9CA 4RV9A 4HMQA 4IS2A 4LBVA 4Q3OA 3PR2B 2H18A 3TM5A 4LJ4A 4DWJA 1I13A 2MSNA 4L8WB 3MUFA 5F4ZA 5E9AA 1VBMA 2QTCA 4ARAA 9ATCA 3C7CB 5EWMB 2PDAA 4AO6A 1K5HA 2M6KA 4CQMD 3SICE 5FYQA 2ZJZA 4AJKA 4R9RA 3G7NA 3HDYA 3VU3A 2FF5A 3NX4A 2WT9A 3TB6A 4EB6A 4MKRA 4Y2JA 4B3CA 2DR3A 4R2IA 3VOBA 5NLLA 4A1OA 2PKWA 3CUEF 3EWNA 4LDRA 2ZRMA 1QK4A 1I7PA 2Z1NA 3K1ZA 4RE5A 2FN8A 2WUVA 4NDNE 1ZH6A 1X19A 5KZMB 1VBFA 1NI5A 3H1TA 1AS2A 1DV2A 1H6AA 2AN4A 1DMRA 2CXNA 3IAM1 3NI2A 4P38A 3U3ZA 3SKYA 4UNRA 5JCPA 3H65A 1DCTA 3UWMA 1TIPA 1ZM9A 2HLHA 4N1AA 1UZLA 1Z34A 1FJ2A 2H9IA 3C6YA 3DLTA 3M1LA 2DLNA 4YCJA 3N59A 3VR3A 2HIMA 1A9ZA 2A67A 3K9QO 4M7OA 2PMKA 2Z43A 5FWYA 1NT2A 1P1CA 4NFYA 5EZYB 1QR6A 2FN4A 3OFKA 2PS3A 1Z6XA 4DLNA 2EG5A 3R0XA 3GH3A 4QPJC 3SDSA 1O95C 4XLZA 1YZQA 3EY4A 3C7KA 3TNFA 1GO2A 3ZFNA 1IQPA 2JHAA 2RG1A 1DBRA 3NGLA 2QTAA 4ZOQI 4OX9B 3GJRA 3AOGA 1EM6A 1WU7A 1E3JA 1Y9JA 1C9JA 4WY2A 5JMOA 3ZFTA 1PYDA 4NZPA 4OQFA 1XVTA 3PUIA 4LBYA 5TQ2A 1K6JA 2I2DA 4RFSA 4BVLA 3S8EA 3IR6A 2IS1A 4L5YA 2JLBA 3EGXB 4ZVVA 1NL3A 1PGQA 2G4CA 2HT6A 2I03A 4A0HA 3RYCA 3ZXUB 2C5EA 4QHTA 1OX6A 3LGXA 3JQ9A 3O95A 1JEQB 2ZIFA 1FC0A 2VK4A 4Y8VA 5HEKA 2Q1WA 1W2HA 1W7AA 2VYND 4ETNA 1EINA 1QNLA 4ZREA 1W0JD 1X8JA 1THMA 3FFXA 3ABIA 1L4BA 3DPUA 2YY6A 3L8DA 4G8CA 4IJ5A 4DXAA 1J2EA 5A9SA 2M6RA 5IUJC 2BFNA 1GPH1 2GZ3A 4D92A 2DULA 1DKQA 3OH8A 1C3JA 4HRYA 2VQFB 1IHOA 1TZJA 3TW4A 2CLFB 2FZCA 1CQWA 4JL6A 2YRWA 4R8VA 1FP4B 3SC4A 1NUPA 3HKDA 2DM6A 4Z4CA 5I5EA 4MB2A 1K8XB 1OBOA 3VH2A 4JH0A 1PL0A 4YMGA 2O8VA 2NOAA 4NEGA 3K0AA 2VQDA 1KJYA 3HVIA 4EJSC 4G2NA 4EB0A 4NOKA 1NBAA 3ASVA 3EIFA 2X7HA 2QV0A 4QUBA 3HPRA 4U5QA 3RRJA 1ZCZA 2C2ZA 4IJWA 2VYVA 3RRZA 1I36A 2B4TO 4RK5A 1SRQA 4KTVE 4PZEA 3WFIA 5CFNA 3BK2A 1H3NA 2R5WA 1RS0A 1Y5IA 2VPPA 3AM5A 3GVHA 3N5KA 4ND4A 4B8WA 4ZCMA 2WWYA 4RBNA 4AZWA 4BRZA 1QRDA 3RFUA 3BYZA 1UBNA 2I8LA 3E27A 5KJEA 5JATA 2XODA 1D07A 1KI3A 2M2IA 3E9MA 3GXBA 5LSAA 5PNTA 3U5TA 3HRIA 4D8VA 2JI8A 2CL6X 3DQQA 3BE6A 1BU8A 1XDWA 4NQZA 4OH7A 2Y1CA 1AQJA 1VJ1A 1YJQA 3BG5A 4F04A 1PNRA 2B35A 1BGWA 2OGWA 4LVNA 4QRHA 3G8YA 1BEZA 2BE9A 4LX0A 2CNBA 3T7DA 1ESZA 4IGEA 4ARBA 2KB0A 2O48X 3PQ7A 2ZYIA 2FZWA 4HTAA 4KN6A 1PUXA 3C1UA 1AZWA 2Z2XA 5FOQA 1G7SA 1J8FA 5JOQA 3AU9A 2FA9A 3HYTA 4IHJA 2SHKA 3PGXA 4OVKA 5DDIP 3BDVA 4OHUA 6REQB 1LA2A 4NG4A 4EMSA 2GVNA 4RCZA 4V0ME 4UHJA 3UA4A 3GHYA 1PT6A 3TQQA 2RHLA 3UN1A 4OLBA 4WZBE 2OO5A 5CJPA 5FV7A 4KGVA 4C87A 5KTOA 3K2QA 4DHWA 2OM6A 4YJ3B 1MLDA 5KSZA 4IDNA 4IILA 4ZO8A 1CFZA 3VPCA 1U9ZA 4RIIA 1Z4PX 1SBIA 3JQ7B 3MWJA 1E94E 3NT2A 4P3NA 5CK4A 5REQB 2NO1A 2PBRA 1ZL2A 1F1JA 4GP6A 4IAOA 3TZQA 2W6MA 3KWFA 1Y3AA 1JQJC 5IAEA 3O0TA 4WVLA 1KJNA 3T0FA 1GARA 2GEJA 4UM7A 4F86A 1DAGA 1IIRA 3FNHA 5JAIA 1G5PA 1NJ8A 3A2MA 3VR3D 3KQOA 4PLPA 2R8BA 4CI0B 1S2GA 5IU6A 1ONSA 1YT5A 5JDCC 4LK3A 1P2SA 1P44A 1M1UA 1CEEA 3IPLA 3R75A 2P35A 4U1RA 1GJRA 1RRGA 2CFCA 3LPNA 3EYWA 4F3TA 1CEYA 3MF4A 5DI3A 1G5QA 1W36B 3ISJA 1E1QA 1NG1A 2R8YA 3FR7A 2ZZNA 3RRMA 4LYGA 4PLCA 4Y0AA 5DT9A 3V7FA 3S2FA 2FR0A 3UVEA 2WPNA 2O1WA 4JQCA 4DYHA 2ENWA 1YQWA 4ZQHA 2IJGX 1MC8A 2KJQA 4Z4GA 3HDGA 4LC0A 3KQPA 1AOXA 2JGKA 3V80A 2FEOA 1XMSA 4XGNA 5EFOA 3V1LA 2Z6AA 3O3NB 1PJ3A 3P19A 1E66A 2NP7A 4MUEA 4CUKA 4ER0A 1B6SA 4HNSA 5U9CA 1AMUA 1QG6A 1N5LA 3DAOA 4ZV4A 3HA3A 2H4HA 1MF7A 1KAGA 4XM0A 2FSFA 2OAQ1 4GDMA 4JYMA 3MTIA 3Q7QA 4LN1A 5EWLB 1B3RA 5TQ0B 2WKRA 4MW5A 3SYRA 1F8XA 1U9IC 2FSIA 3Q2KA 4B8ZA 5AM3A 1QFMA 3P0FA 4JYPA 3Q7PA 3W8RA 1YSCA 3KOYA 2GUWA 5A9TA 4R51A 3WGIA 2YW9A 4FD3A 4RMIA 3CVUA 4DADA 1ZUIA 2VJOA 2VJYA 3QE0A 1ADFA 3UOWA 4FWTA 4BJ5A 4MUJA 4Z9BA 2GB4A 1MG5A 2VSQA 5A05A 1GQRA 3ZZMA 2EYUA 4ICIA 3F1LA 3F7OA 5EYPA 4D0NA 4J07A 2A3RA 2CJYA 2AD1A 2VYVD 1J2TA 1JL3A 1UXOA 4BCCA 1B73A 2F64A 3GFPA 2H8GA 3CPJB 3JZMA 4KVGA 5CYPA 3RAGA 4EPTA 5FUMA 5IULC 3QEAZ 3HMKA 1TZMA 1TKAA 1WF6A 1V5WA 4MVJH 1N2CE 2H59A 4PLHA 4NABA 1DOAA 3D0KA 3BD8A 2FMIA 3DD5A 1DT3A 1IU9A 2P7HA 3IEUA 4GWLA 3R24A 4BKPA 2FG6C 2QN3A 2JK0A 3NNSA 1OXXK 3ZFUA 5AK3A 4PLWA 1FZQA 4BO5A 3D6TB 5FPPA 4UM9B 5AUNB 821PA 5FUQA 2KBEA 4D99A 2RI1A 2W2QA 3E0QA 5DTQA 4ZYTA 5CUQA 4Y18A 1ZGGA 3ZW8A 3T99A 3DO6A 4NATA 3V55A 2ARKA 3PUXA 4RTNA 2OD2A 2O4UX 2XQFA 4HGYA 1QAOA 3NTRA 4I08A 1QYDA 3TR0A 1QB8A 1SOMA 5KYXA 4LXHA 1S5PA 1ZI9A 2C4HA 2NZUG 3LP5A 2VN8A 1Q1GA 3UW1A 3W4IA 3F67A 4WINA 3GJYA 1R6UA 3DE2X 3AETB 3DMTC 4X8OA 2WNHA 2XXBA 4KDRA 4ZEWA 2B1IA 2H65A 2Q28A 2GXQA 4G0NA 4JUBA 4Z4FA 3EN0A 4BBAA 2AHOA 4H4DA 4MB0A 2HMVA 4X1YA 1C2YA 2A9JA 3ZCRA 3IR5A 1RXWA 2ZZKA 2YWJA 1LLUA 4RFVA 4DWWA 1TPZA 1REQB 1A4UA 5HMLA 2JD1A 2R85A 5EMLA 2BGNA 3VDQA 3ONNA 4HVCA 1E2GA 4IEEA 3SZ3A 3ITDA 3HADA 1TZCA 1HZZA 4KQWA 5EOVA 2C3MA 1CLUA 1DXYA 3QX7A 4LCBA 7REQA 2C5GA 4MP3A 3A1TA 3W7BA 1KMQA 4CTMA 3V3KA 1YFJA 1UXJA 3KYDB 3RRFA 4FX5A 3PC8C 3LVQE 1E1QD 5IDWA 1BAPA 1C41A 2G36A 3N2KA 3EG9A 2RSLA 1Z28A 4CKXA 4G5RA 3OF3A 3WJ2A 1ST3A 1U99A 5C9ZA 1FNDA 2W2VA 5JSZA 1E60A 2NQ8A 4N5MA 4URWR 1O96A 2PSFA 2VDWB 3JQFA 5K3FB 1QRUA 2D2XA 1XDZA 1XFDA 4D02A 4Q3LA 1XVLA 4FOSA 4Z9YA 4PQYA 4RVCA 3CUTA 3TQFA 1J8MF 5JNSA 1VRVA 3NAQA 2F1OA 4H6PA 4ZAWA 2XUGA 2RK4A 4HDQB 3LHSA 5FUXA 2V8OA 3F4LA 2NXWA 1P1FA 4KX5A 1J25A 2P2SA 3O75A 4U8HA 2VL7A 2JKVA 1YIOA 4UU1A 3RF7A 5TF0A 3KJHA 2V7VA 4QPNA 4TLLB 1N9ZA 2GERA 2MJLA 3FOZA 3GLFB 4PNHA 3RC1A 3SHWA 1P5ZB 4AO7A 2DTDA 4HN2A 1CJCA 4YQZA 4IJ6A 1OX5A 2OKCA 3HZOA 4E70A 3GLGA 2Q1UA 4EG5A 4X24A 5CJJA 4U8GA