3NORA

Crystal structure of t102s isocyanide hydratase from pseudomonas fluorescens
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
231
structure length
231
Chain Sequence
GSHMAVQIGFLLFPEVQQLDLTGPHDVLASLPDVQVHLIWKEPGPVVASSGLVLQATTSFADCPPLDVICIPGGTGVGALMEDPQALAFIRQQAARARYVTSVCSGSLVLGAAGLLQGKRATTHWAYHELLAPLGAIPVHERVVRDGNLLTGGGITAGIDFALTLAAELFDAATAQRVQLQLEYAPAPPFNAGSPDTAPASVVQQARQRAADSLHKRREITLRAAARLAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ThiJ/PfpI family protein
publication title Evolution of New Enzymatic Function by Structural Modulation of Cysteine Reactivity in Pseudomonas fluorescens Isocyanide Hydratase.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 79
structure length 231
sequence length 231
ec nomenclature ec 4.2.1.103: Cyclohexyl-isocyanide hydratase.
pdb deposition date 2010-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3norA00
3VU3A 5SYAA 1P5FA 4D1YA 3NOVA 1VHQA 2RK6A 1N57A 4P34A 4XLLA 4OIFA 1I7QB 5JZOA 1KWGA 2YWJA 4MTCA 4AJ9A 2YWDA 4RKWA 4Y1GA 4RKYA 1T36B 3ER6A 3UK7A 3F71A 1GPMA 1P7ZA 4UOQA 4OGFA 1CS0B 1S1MA 3MGKA 3PQ5A 4Y0NA 2V4UA 1IZYA 3TTTA 5SY4A 3CY6A 3KKLA 4OGGA 1P81A 4B7AA 1OI4A 1GGFA 1PDWA 2ZUUA 3TTYA 5K4AA 4BFLA 1QDLB 3CZAA 4MGHA 2ABWA 1VCMA 3RHTA 1GG9A 1QVZA 2OR3A 1G2IA 3P9QA 4K2HA 3TTXA 4AUMA 4ENQA 3SOZA 1OX6A 1P7YA 4LGYA 4ZDJA 1JDBC 1IPHA 2RK3A 5IP5A 3NONA 3P9PA 1C3OB 2RK4A 3R75A 3TTSA 3NORA 2R1TB 4JQSA 4UZSA 1PV2A 1O1YA 4AUNA 3UMMA 3B38A 2ISSD 4WINA 2R1VB 4OQ4A 3PQ7A 3EJ6A 4AUEA 2IUFA 4ENVA 3P9SA 4ADSG 2R1TA 4I2NA 1GGEA 1BXRB 2GHRA 4N12A 3TQIA 2ZUVA 1VCOA 2D7JA 1WL8A 2A9VA 5E9AA 5JZMA 1KWKA 2R1VA 1ONSA 4E08A 2FEXA 1FY2A 4HCJA 3B3AA 5SY6A 1PDVA 2NV0A 1OX5A 4ENPA 4ZDIA 1QVVA 1Q2UA 4P2GA 4Y1FA 1L9XA 3PQ6A 1I1QB 2NV2B 1SY7A 3MIIA 1OY1A 4I4NA 4LRUA 1U9CA 1T0BA 2W7TA 5BV2P 1OX4B 1M6VB 3L7NA 1VCNA 3N7TA 3ZR4B 4ZGGA 2VXOA 3UJNA 1I7SB 4UCFA 3UOWA 1QVWA 4Y1EA 4GE3A 4P35A 3ZJ4A 1KA9H 2H2WA 3B36A 1OX4A 3EN0A 5LIRA 4OJYA 2VKTA 2AD5A 3P9RA 1T3TA 2LXNA 3PQ8A 3M3PA 1J42A 1QWSA 4L8FA 4WXYB 2ZUWA 1KXJA 4R7GA 4ENUA 4UNIA 1GGJA 1R9GA 2VPIA 3NVAA 3BWEA 4I46A 3EWNA 3FIJA 4L8YA 4L8WB 3FSEA 2YWBA 3BHNA 4S0ZA 4UOZA 2R1UA 4BIMA 1UCFA 4B40A 4P36A 5SY9A 4Y1RB 4OFWA 4L7QA 2YWCA 3L4EA 3SF8A 3ZJ5A 3PQ3A 3OT1B 3TTVA 1K9VF 4B2YA 4E5VA 1A9XB 3EZGA 3R76A 4ENWA 1KEEB 1C30B 3L18A 4GE0A 3L3BA 1JVNA 4N0MA 4L78A 4GUDA 1SOAA 1P80A 2VDJA 3NOQA 3EFEA 4L95C 4Y1RA 4ZDKA 3OT1A 3GRAA 1GGHA 4PXYA 4QYTA 3R74A 3WFZA 3CYFA 3PQ2A 2XF2A 4ENSA 1GGKA 2GK3A 3CNEA 4AULA 2ZUSA 4B5KA 1FYEA 1IZZA 1Q7RA 3CZ9A 3D54D 4MNTA 3SF8B 3TTWA 4ENTA 2AB0A 1CF9A 2VRNA 3F5DA 2ZUTA 5DFAA 4ENRA 3UGJA 1PE0A 4QYXA 1QF7A 2WJZB 3TTUA 4BTEA 1GPWB 1CE8B 4P5PA 3NOOA 3PQ4A 4B31A
chains in the Genus database with same CATH superfamily
4QDXA 5BMVB 1QQAA 4IIFA 3HFSA 1QOQB 2I4TA 4AN1A 2HSJA 1QXSA 2FW7A 2HIMA 1X87A 3C85A 1TJ5A 4IMIB 1M34B 3WL6A 3O7WA 1P1IA 2OOKA 4HRXA 2PMKA 3D6JA 6Q21A 4D02A 1A96A 1DAIA 5T3YA 3WL3A 1TK2A 3DAOA 4HP8A 5CCXA 3PX7A 1OYVA 3Q1LA 4UBNA 2XCTB 5TJHA 5KTRA 2HT6A 1Y6FA 4DCGA 1O96B 2NLOA 3WBJA 4GXNA 5B3AA 1ZONA 1RJGA 3LX8A 5CT5A 2BV3A 1MRZA 2PRIA 2RHRA 1X7YB 2RHDA 2YWHA 3NH6A 2NTVA 3IDOA 4GPD1 4QVGA 2DQYA 4TMVA 2ABWA 1GTSA 1JAHA 1MAVA 1Q21A 2YOGA 3DMGA 4O5OA 4YV2A 1WHSA 5JNSA 3OD5A 2IYVA 2JI7A 3A1EA 3F2VA 1QB7A 1JDBC 2G07A 2ZB8A 4L57A 3AFGA 5CFQA 5JH7F 4RTMA 1CB7A 1J07A 1L5OA 3PPWA 5CDUA 3NIGB 2O3RA 2C3PA 2EKZA 1Y3IA 4JBGA 3HCPA 2YRWA 2L17A 1W49A 5L4NA 1JGTA 1QGUB 2GBFA 1Y8RA 2F90A 5CAEB 3R0ZA 1US8B 2XDQA 3ZVNA 1AG9A 1TEHA 1ISJA 1TE2A 2B7LA 2H54A 2Z3VA 4M3NA 5CVDA 3T5MA 3ZDQA 3H3XA 3WYDA 2EQ5A 1O77A 3OX1A 4HYEA 2C5SA 1R12A 4HGOA 1JNYA 4NYJR 4QJIA 4OQNA 4R84A 4X0EA 1XCGB 4MWGA 1K3FA 2J9YB 1KI3A 1Z2CA 2OAP1 4OEHA 4A27A 4OGKA 4QREA 3AVUA 1Z7EA 1POWA 4YMTA 4LOJA 3G7NA 4M1SA 3QUCA 4YAGA 4X1OA 1Z08A 1X38A 4HGZA 5EJEA 3A6ZA 5KSWB 4D8YA 3FZYA 1G7SA 1N1DA 3D5EA 4HSEA 1I7LA 1NKTA 3A9UA 4OP3A 1EPUA 4L50A 1IWBB 3R9WA 1AV7A 2CUZA 2GYUA 1U28C 2WB2A 1BYUA 4RTOA 1QLWA 2Q4OA 3KUUA 2NO4A 1B76A 3OMWA 1YH3A 4QDTA 3SZMA 1BD3A 5DI3A 4OB8A 2XXAB 3OZBA 4K9NA 4D4KA 4LKRA 2CV2A 1RI1A 1WZCA 3BTOA 2ZKIA 1UOPA 3Q6IA 2BLLA 4OJTA 4AMVA 2EQAA 2PWPA 2ES4A 2YL2A 1XN1A 1R3UA 4B9EA 5DT9A 2G1AA 3JQ7B 4F9FA 4JJZA 4PC6A 3FRJA 3I1IA 1ZMOA 4BO2A 2C1XA 1C3EA 1BS2A 1TC2A 2GVNA 2I7TA 4O29A 1GZUA 3DL4A 3ZOZA 4D8WA 5CM8B 5I9LA 2X9VA 2UZAA 4TLCA 1E2BA 3OZRA 3VKUA 2AOUB 3ESQA 1QYDA 2V8OA 4Y3UA 2YXLA 1JR3D 2OKGA 1DTWA 2REOA 2J5XA 2VDOB 1AXEA 4KBYA 4M83A 3H16A 3PIDA 3WGLA 4EWLA 3F5DA 4PO3X 1G4UR 3VUEA 3G49A 3W9YA 2D6FA 1C5KA 4BQFA 1EVQA 1X7XA 5EMJA 4CKYA 3A05A 3AF2A 3DDHA 1UJMA 3C3AA 3CKYA 4MVXA 4O4HB 3CM0A 3IT0A 4TL6A 4UFPA 2BCJQ 2NU6B 4LTMA 3TOVA 4MTCA 2GN0A 1RXIA 1XYVA 2VDNB 1B0ZA 2ZIFA 3TLKA 2E4AA 1GPMA 2YN0A 3WGMA 3P9KA 2PQ2A 2LDBA 2Q6LA 4XYMA 3EH2A 2X8JB 3HN7A 1EUDA 3ZZNA 5BV8A 1Q20A 1IY8A 3MINB 4FFBA 4J7CA 3OIWA 4QHSA 5JISA 2A5FA 4JLVA 5B1YA 5KJ1A 4QFMA 5ADWA 5AJUA 3T5GA 3D31A 3R8XA 3UHJA 821PA 3OP1A 1XAGA 2ATEA 1QV6A 3L8ZA 1E7RA 3KR2A 4QPCA 4WVFA 2OYRA 3OPNA 1GKIA 1PJBA 1KI6A 1NQUA 4MS4B 4C0SA 3OAAD 4L76A 3A31A 3MMZA 4P32A 3GT4A 2YY7A 3VDNB 2Q3DA 2I8AA 3FWPA 4FYWA 4UCXA 4QWMA 5HFJA 5LOVA 4U9HS 2JL1A 3VKFA 1QLHA 1Q7TA 1U8CB 3KL2A 2FW1A 3ACCA 3HMQA 4OF4A 1JLKA 2CYCA 5IBQA 3RBZA 4BVAA 3GEHA 1Y3HA 1G5TA 4UMEA 1JNXX 5AM4A 3RTGA 1DX9A 1GN8A 2WJIA 1YNOA 2WIDA 5EPOA 2CWWA 5TY0A 3I9V1 4C5AA 2PTHA 2ZETA 4C4AA 5ALWA 2D59A 3NDRA 3DDSA 5E7IA 5FTWA 4AJLA 3GV0A 4FN4A 4GSLA 4BEVA 1NN0A 2OZPA 2CGEA 2XTNA 5KINB 1SQ5A 4QNNA 3QPCA 2AHRA 4H17A 4BMVA 3PTZA 5AW3A 4HAIA 3NHUA 2Y76A 4RQUA 2AJ8A 4NDZA 5DB4A 2OV2A 4BP1A 3ED5A 1EVEA 1KIAA 3STWA 1KPIA 2O52A 1NBEA 3IBCA 4NBLA 1D09A 3WSVA 4D97A 1KORA 3GN2A 5CIWA 4DRXA 1XD2B 1F38A 3RU9A 4DEVA 2MR5A 3UK0A 3V7NA 5K5EA 2Z6QA 3FBWA 2DSTA 5FTNA 1AU9A 3OX3A 3LPDA 4UUQA 3VX3A 4EFDA 3UMVA 2BBWA 3TIIA 1EWYA 2KBEA 4BNDA 2MSNA 4FQ8A 2WNSA 3A4VA 3GAZA 4IRMA 4NZOA 3A4LA 4X1KB 5SV2A 4BVLA 3Q3VA 4PFQA 1C1DA 2BIFA 5JWOA 1TM3E 4IF6A 2J9FB 1SD5A 5AVTA 1BZYA 1E58A 1F2TA 3ZU4A 4R71A 1WXDA 3FSJX 2ZSBA 5G40A 3L8CA 3I04M 3PPYA 2GEJA 2ZCUA 4F6LA 3W7VA 3W04A 3UCFA 5IAAA 1JDTA 4MDEA 2O2YA 3K2EA 4MW5A 1ZZGA 1NW5A 1N7GA 5DNDA 3NIBA 421PA 3D8NA 3AIMA 4JT2A 4LDPA 3EIUA 1XRPA 4L0QA 1JECA 1RT9A 4BNTA 3JQ9C 1XNGA 1O6FA 4YLGA 3CVWA 3P20A 3PT5A 3T9CA 5KOHA 2QDKA 3COPA 2DFLA 2RBKA 1W0JA 4PTLA 1C8LA 5BYBA 3ULKA 2X5JO 1JKJB 2ONJA 5DGXA 3DC2A 1ZM9A 1EVLA 4HYYA 1QH1B 1ACMA 4PE5B 5EZ6B 3KPJA 4LFAB 1ZN7A 2O48X 4J1QA 3KVYA 4HX2A 2CXHA 3AP2A 4R2XA 4BWGA 4QPPA 2GTPA 3WL8A 5LD2B 1WZEA 3ENNA 1BSVA 3PDJA 3WHPA 4IFEA 1DRWA 1NN5A 3VR5H 1JAYA 4BZQA 1A8IA 5FOTA 5EVJA 1UWCA 2QV0A 4HQ6A 1W4CA 1YF3A 1AN9A 3U13A 5KDLA 5LP6F 4MYCA 4QVKA 2PUHA 2JGLA 1XAIA 4BFXA 3CY6A 4NL4H 4N9WA 3KSRA 3P9NA 5KNBH 2R8OA 2PT7A 3RIYA 2QLBA 4D43A 1E1DA 4C06A 4DJDC 1FRFS 2QDXA 2MINB 3D7RA 5I4KA 1KOLA 1G2IA 1BE1A 2A4MA 2NUPB 1SIBE 1N3BA 5GADl 4X1IA 1C7FA 2WMOB 3F6YA 2Q1YA 4QUJA 1Y48E 1A7JA 3PC3A 4OHXA 1FX0A 3N0VA 2C0CA 5H16A 2GM5A 1N9KA 3PFFA 2XUZA 2ZJBA 2B2XA 3E3LA 1QONA 3RFCA 5KSOA 4X44A 1XU4A 3PFWO 4DEYA 1IC6A 1J25A 2WM2A 4GOJA 2EC5A 4LX0A 5IAEA 1LRLA 2NP6A 2V6BA 4X9XA 1T5HX 4QIHA 1LVHA 4C7OB 3AEYA 1S2GA 2BGNA 1LI4A 1FPQA 2DUUA 1A2QA 2OCDA 3ITEA 3GPBA 3RASA 3I2JA 2OVFA 2ODWA 1N5IA 5UKDA 5TE9A 4OIMA 2AA3A 2YR0A 3ZN2A 3LYAA 4BE7B 2RGRA 2WVGA 2J3LA 3UT6A 1U04A 1VL1A 2QVCA 3ANYB 1J24A 3V6MA 2YKGA 4BE9A 3GRRA 1I3KA 1OSNA 2JASA 1PHPA 4BASA 4TVKA 4WLEA 4WERA 2ZS7A 2EJCA 2VXOA 4M99A 4FKZA 4TUYF 4P86A 5M34A 3J7AC 4EVQA 3BFPA 4Z9XA 3A4IA 2JRCA 2OPBA 2VJYA 3OZWA 2P6RA 1B42A 1GRRA 2B9VA 1A76A 3I53A 5DCYA 1LWOA 4Q7JB 4XKJA 2PWYA 4KPYA 2Z09A 3RTDA 1R0ZA 5GV8A 1H2WA 2RC6A 4S04A 1JU9A 1HEYA 3M70A 3ZGYA 1W35A 3EZXA 1OV6A 1X7ZB 2GARA 2IU6A 1F48A 2QRMA 3RARA 2L19A 1BCSB 3EVCA 1E0AA 2PSHA 3AEQA 4RD0A 1J70A 3KPWA 4B9AA 3WXMA 4FBGA 4L0MA 4D0SA 2GK4A 2R8YA 4WKNA 3MM4A 3OCUA 1IN5A 3HDYA 4B85A 1AUVA 3F8WA 3M33A 5IUJC 2G36A 1ILWA 2REQA 5D3MA 5HCIA 1CJUC 2E89A 3FHOA 2ZBPA 4LXYA 4RK6A 3KKOA 5FUWA 2AVNA 2DHRA 3RANA 1W8DA 1UXJA 5IJZA 3UMYA 5BR7A 1Z68A 3EPRA 4EY5A 3HN6A 1NOKA 2YMPA 2VHZA 4AULA 5C5IA 4ENTA 3CXRA 2IZ1A 2ZSFA 4RTPA 3A6FA 3QYPA 3HJTA 1JQ3A 4KPEC 3WYGA 1L4KA 1LZKA 2C2XA 1B0UA 3A2NA 3TL6A 3OPVA 4D4HA 1DC3A 3DAPA 4JI4B 1U9ZA 2HNKA 3PCRB 4JWTA 5C8DA 3I1JA 1GPNA 3ZCVA 1U7OA 1FXUA 1XLWA 5HIJA 5EJGA 4W5RA 2G88A 3O8NA 4K28A 2FPKA 1S02A 2VNHA 5KNCH 1OB5A 1GDTA 1MXHA 3BTSA 3QPVA 5JRDS 2ZWIA 4AYTA 2O0HA 1CWUA 3ES9A 4N82A 1QR6A 2BFOA 4RCVA 3RKSA 4AO6A 4D81A 2FMIA 1WULS 3BXXA 4MP8A 1ZM3A 3HXTA 4CTJA 1M1YA 3LA6A 4QYSA 3HJNA 5E8JA 1QHGA 1XZLA 3LUCA 1YVUA 3N0WA 5DX8A 1QAOA 1JEQB 1G4HA 2RHLA 1NOIA 5JCXA 3A1TA 5FAKA 4LFBB 1UL1X 1O9GA 4UZEA 2GCEA 5J40A 4A8TA 4HS9A 3SIPA 1V71A 1X9IA 3DZDA 5ED0A 4BL5A 3PEVA 4H1TA 4MA0A 5IJ9B 3CNBA 2CLFB 3A2LA 4KXFB 4RJ2A 4D6PA 4ZALA 4DV0B 4ARCA 4E5YA 1D0SA 3RSCA 2RGNA 3ZH2A 3A7DA 2JZOA 1BAPA 1U8TA 4GRIA 1HDCA 2J3KA 3TRJA 2Q3LA 1U0BB 4TXJA 1XDZA 4P3PA 1ISIA 2BVNA 3WLRA 1XA4A 1C3LA 1ZC4A 2XA9A 4AJKA 1K4KA 1CS4C 5CIQA 3VU9A 1CJVC 4YLYA 4DSTA 1OUMA 1T1RA 1K4MA 3IAEA 5F51A 3EYAA 4GXTA 1QUFA 4R1MA 4DY6A 3B7WA 3HU1A 3ZNPA 4TWRA 4E5SA 2VTBB 3I37X 5D2CA 3BDAA 2A0YA 1UJ2A 2GSDA 5FD8A 1GARA 1Q1BA 1PW7A 2FPUA 4V38A 1E18A 2ZSUA 4JLKA 5HZMA 5JMOA 1KIMA 1DDOA 1HA3A 3JWGA 4M9SA 1NRXA 2YBEA 5KNDA 1SZDA 3UJCA 2J7PA 1ZJWA 3MWEA 3FG9A 4EF4A 2ERXA 4U2KA 5GONF 4KLRA 4ATNA 1TDJA 2V74B 3F3KA 3PD1A 3QKRA 4NP6A 4EF6A 4V0NA 3BWDD 2QI9C 4XPIA 3HJRA 3ADKA 2QX8A 2R00A 3SBEA 1LJLA 1M10A 1HQYE 3BYZA 2O57A 2PNFA 3X1MA 1VZ2A 4YRCA 3U17A 2OXCA 3D0OA 3N6VA 3OEEA 5HIMA 2ZS8A 3IAUA 1NX9A 2RHBA 3RF6A 4ZARA 3BE5A 5C1DA 4NBKA 4RFLA 4FHZA 3BXFA 3UMGA 3T5BA 3E9RA 3T1NA 3WB0A 2WP0A 4QHTA 3IPRA 3O8QA 5H5JA 2Y1LA 4DT1B 2QD2A 1FJGB 1VSTA 1WP9A 2XB2A 2A9FA 2PKQP 4NBNA 3R20A 1FP2A 2R4TA 3A10A 4KWCA 4F4CA 4C0LA 4E7OA 4Q4AA 5JROA 5KYKA 3IELA 3WMWA 4JYPA 2PSEA 1K68A 1BC5A 2PX6A 5K0TA 3OQIB 3OWOA 4U6NA 1J0XO 2JGKA 3X44A 1JH9A 4P0QB 4RGVA 2VQFB 1LRJA 5BNTA 4OI0A 1EGMB 2R5WA 3LBAA 1ZGGA 4FUQA 4MK4A 5FPKA 3HMKA 3QPAA 1A9YA 5IM4F 2C7RA 2BN4A 2CVOA 4XWAA 1N33B 2RJNA 4HQLA 1JXAA 3OY7A 4OAPA 5EZ5A 4ZYYA 1M2VA 3NIWA 1KAQA 4DIUA 2SNIE 2PGIA 3NYQA 4HX9A 4HZGA 1UFRA 2HNAA 2PHZA 2VP6A 5EFOA 1MTOA 4G1FA 4NECA 4B2IA 2H2FA 2VOJA 3Q8KA 5KSYA 3RCBA 2QRNA 2ZAYA 1ZY2A 3E1GA 3PUVA 1N2HA 4NKRA 4DG8A 2RHGB 4U5XA 4BLQA 4S2UA 4XR9A 4UTPA 2BHLA 1NR1A 3IEKA 1KMCA 1GM5A 2XMSA 2FW6A 2QZ9A 3TVTA 3S2GA 4IXMA 1MTZA 2A2ZA 4RKEA 4UBMA 3LCMA 1Y8AA 1MT0A 2BEUB 4MA4A 2EQBA 3IFSA 2AC4A 1W36C 2PIAA 1VJ1A 5AK4A 3GD7A 3G79A 2XI4A 1GXSA 4N3GA 2HCFA 4DOMA 1SUIA 1PTKA 3Q6NA 5KKAA 4TKUA 1KE1A 4DNOA 2H4ZA 1X6VA 3DCJA 3DLAA 5EJ8A 4BVBA 3A4NA 1Q15A 3MOGA 5CR9A 1WOYA 2QRKA 3WRWA 4E7PA 3IDSA 1SCNE 1D8AA 1FQJA 4FHGA 4ALNA 2H63A 4BNJA 4MW4A 2WUGA 4IKEA 2CJWB 3KOUA 4ZC8A 2WTUA 2TMGA 3ER8A 1B4DA 2NMVA 1WMAA 1RDFA 4DMMA 4L8VA 1TVCA 1XAJA 3GNQA 2JLYA 5L7TA 2WAMA 2XE6A 1RYHA 3IT1A 4MVJD 4UTVA 4TS3A 1OE0A 1IVYA 2H07A 3RBAA 5HKKA 2QY6A 3KOXA 4BX3A 4ZOAA 1QV9A 2J6IA 3EEQA 4A03A 2AK3A 5BV2P 1TAGA 2VT6A 4HDRA 1JB1A 1C0EA 4ZVPA 2FRXA 3EDOA 1Y3DE 3HCBA 2PSSA 1J00A 4FYHA 1OR8A 1YQ9A 1Z13A 3PVZA 4ALJA 1JEYA 3OE7A 2OV4A 3ND7A 3E70C 4GP9A 4PCAA 5DK6A 5FLKA 3VHXA 2CD9A 5B53A 3U4AA 4KHPB 3PEWA 1R16A 3GOHA 4U7JA 3TLCA 1DU4A 4GLOA 4BN4A 1UXOA 5LIRA 1PT6A 4R41A 1T4GA 1J2EA 2E21A 1B73A 1IQPA 2D2XA 1S3FA 1BS1A 2OILA 2WZDA 5FBKA 5IZCC 4TN1A 4Q9KA 3IAM1 4M9RA 2Q0SA 4QUAA 5JZBA 4GEGA 1SC1A 1J90A 2A5YB 1YUNA 3K3PA 4G0MA 3NBAA 4LIPD 1J5PA 5FBVB 5JUWA 2WU4A 2ZSEA 4R31A 4B34A 2BCGY 4KOAA 4YRNA 3HO6A 4ZAZA 1X15A 5B7NA 4DLSA 2WD7A 4OHOA 4LSMA 4A91A 1WXXA 1V4NA 4IH1A 2UDPA 3OOSA 1DB3A 1ND6A 4URZR 4UU1A 2SKCA 4PY2A 2HRRA 4X8LA 2A67A 3JQ8B 1P31A 3X3HA 3CZPA 1L5GB 3KB1A 1LA2A 2Q9AA 3VU0A 1U8AA 4RETA 1L5YA 1OAAA 1P9NA 3G9TA 4ON9A 1M0EA 4FFLA 4MNTA 3TMYA 2D1FA 2DHQA 1D3AA 3ZWXA 4CKBA 2B1QA 2VRNA 4EITA 4EEKA 1X0XA 2H7YA 2IYAA 2RCNA 4UBIA 4NCBA 4CW7A 2JFVA 2P5UA 4GWKA 3L6RA 4FNMA 4UEKA 3CS3A 3JD1A 1ONOA 3GUYA 1KBQA 3O38A 5LA6B 2FSPA 2P9QA 1JFRA 1BDHA 4Z54A 3M1AA 4ZO6A 5AW9A 2VJBA 5IBPA 5K0JA 1CG6A 4I8XA 1GZSA 1YBMA 3FF4A 5K7SA 5TC4A 1NW8A 5FLXA 1EFVA 1RQPA 4YMIA 3U3OA 5LLDA 3ER6A 4KIWA 1XZAA 5BT9A 3ZZ0A 1CR6A 3IEIA 4UVIA 2EJTA 4QE3A 2NQ2C 3AUYA 3GI1A 2IX3A 2A1IA 5FI0B 2BT4A 2JFGA 2X2PA 5CVCA 5GIPE 3L0PA 4V0KA 3TRDA 3ZCUA 1G20A 3ZZMA 4YIHA 1PR6A 1XVTA 2C7OA 2IH5A 3QFFA 3IDZA 4FKBA 5FWYB 4QASA 3ANLA 3MA0A 3OIUA 1Y37A 5CT9A 2ZB4A 2ZT5A 4NE2A 5DZSA 4EJFA 5LP6A 4TM7A 4KU4A 3HCDA 2EAUA 2V58A 3PNMA 3PT9A 5K3CA 3W2IA 1N5MA 4H6WA 3WJAA 1FPMA 1OFUX 2F9FA 3UC9A 3ZGNA 2GXAA 4DF3A 4N7MA 1IH8A 3GAAA 1EXWA 1GR0A 1WPGA 3DO8A 3KYCA 3PGLA 3P9SA 4I1UA 4C7KA 1KNXA 4DKXA 3AB8A 2P9HA 4NU6A 1MIHA 1C0IA 4Q34A 2XCUA 2HIHA 3C16C 5I7OA 1C4KA 3UK1A 5IKEA 1H4SA 3L0CA 1LUAA 3FLEA 2JH3A 4PVCA 3PE4A 4QFDA 4Y2XA 3TLGB 5JYDA 5TPZA 1AV6A 3IVAA 3IEXA 1FSGA 2DE0X 4HV4A 3VDQA 4DJTA 4CCYB 4X7BA 4DR1B 2P27A 4P7GA 1RPTA 1TRKA 2I4RA 3SDSA 4BLRA 4S12A 3EA4A 1ZXLA 1FYXA 1M6VB 1W29A 3LUGA 4U9IS 4DUZB 1H9CA 4ZP1A 1VPEA 4HUQB 3VSAA 1JDZA 3TUZC 4OUDA 5SICE 3SCZA 6YASA 1NDHA 5COBA 1C30A 2B37A 1ZQ1A 2QRZA 3T5CA 4C21A 2P2SA 2WTAA 3C8HA 3I6MA 4TVBA 3VR0A 1BMTA 3DEKA 4BB5A 1ZSNA 2CLCX 1N2CE 4BKRA 4TUYA 1JEAA 4IHJF 1GQ2A 2PFSA 2IP1A 4IVPA 3OZTA 3PRYA 5EQFA 1RJDA 3D3WA 4DR7B 1YVDA 4BMPB 1P6XA 1KMHA 4DV2B 2V65A 4HNSA 1Q77A 1MX5A 3WGOA 1A9SA 2QLTA 5JNUA 4WA7A 1YCHA 1R18A 3CTPA 3OFJA 1HH4A 3WDMA 5HNKA 1C4OA 1NLFA 5K6RA 3TM5A 4GUDA 3DXYA 5KNCD 1TO6A 5JJKA 4QTUB 2X8LA 3EFEA 5DSXA 5J2UF 3VNVA 3CU5A 4DA7A 2H1RA 3Q8XB 3GA5A 3ZW8A 3ZS8A 1M72A 2MIIA 4C4SA 1MX1A 3L7JA 1U11A 4YCMA 2O3QA 4FSHA 5EUQB 4DV6B 4EQ6A 1C1XB 1X39A 4UHHA 1P4SA 1UDAA 3JQFC 5E9JA 1Q0RA 1A0OA 1JIUA 1UDCA 4KR9A 1JYSA 2XDAA 3E9CA 1G55A 4M89A 1RZRD 3UANA 1K8QA 1E96A 3BG5A 1YBFA 1Z56C 5CK5A 2G25A 2HV9A 1N2EA 5K0ZA 3AI3A 2VT3A 2ZAOA 3N2KB 1HNXB 4HAVA 5ALHA 1VL8A 4F5EA 1F8XA 1IUNA 1K5HA 4QBKA 1RTKA 3S5UA 3E3OA 3L0YA 3ZE8A 2O0LA 3HGQA 3AGQA 2YWJA 5DASA 2VJOA 5I7WA 3C5CA 1SUWA 1GRNA 3DMTA 1GCAA 3BE8A 3W6NA 1T8TA 1QHSA 5LZ4A 2ZBVA 3GLSA 1IJBA 1I6MA 3QXHA 1EX7A 1LCIA 4MX8A 5AUPB 5IULC 3QSYA 3IAXA 4REMA 3L4JA 1IM8A 5BVHA 5AQEA 3X1WA 1GD1O 5DBGA 4NVRA 4NMHA 2CJXA 2Y1XA 1QTQA 4G8BA 4GQAA 3TZLA 3KT3A 3ZLTA 3A6HA 2Q4EA 4TQUS 3GJXC 2V5AA 1K7CA 4TXMA 1CTQA 1YMUA 1W1IA 4BXOA 1TD1A 4MIKA 1SCDA 3BREA 3WLAA 2J3JA 4JJAA 3CH5A 4CG2A 4R1LA 4XGQA 4JD5A 2C84A 2R8ZA 1L7DA 2DBVO 2GYYA 3DL7A 2VRBA 5I8ZA 3TLBA 3ZHZA 2NXJA 3N8NA 1DS6A 2ESRA 3R3ZA 3WV5A 5KWEA 1MB2A 4ZN6A 2OCPA 1TL7C 1KFJB 1XRNA 1IXRC 3U2QA 1Y3CE 4IDHA 3T1QA 4TKVA 5A9TA 2I03A 3MRVA 4J0FA 1UPAA 4PLCA 1VE7A 1QKIA 5IEBA 3RB8A 2UYGA 2A9VA 5AP9A 5TEWA 2BTQA 1HZZC 2Y0BA 4O4IA 3GYBA 4AF7A 4CM7A 4CI9A 3U19A 2BFBA 1YDMA 4MWSA 4ND8B 4RSGA 3QOFA 1OX5A 1Z6AA 4MV9A 1J5EB 1PNOA 4X24A 3EF3A 4B6GA 1RJEA 2IEBA 2MSKA 3QKSB 4TYMA 1T29A 4B74A 5ITWA 2W2VA 3DOFA 3B48A 1BWSA 3CRNA 3IT3A 2JJ1D 3VZCA 5F7JA 2I78A 4JBXA 3OQ1A 2O19A 2BW0A 1YTLA 5AJXA 3TAHA 3PNQA 4WRRA 4TSKA 3AI1A 3CC8A 1ATZA 5J2TB 1PV4A 1HLGA 2K2WA 4EGCB 3ZS9A 3DA8A 4H4CA 3ORHA 5J58A 1FA9A 1RXCA 4O4LB 4QJ5A 1QGDA 1RZVA 2NZ2A 4S0ZA 2FFAA 3TQSA 3PVSA 3QEKA 4YMVA 3DOJA 3PICA 5GONA 1J20A 3L77A 4OU5A 3OU7A 4N0PA 4F72A 1THTA 5BW8A 3CTMA 3TFWA 4ENWA 3FHLA 2AG5A 2WT8A 2OHVA 2QVBA 1TQ8A 5DEOA 3U0BA 1JQKA 3EISA 4XVRA 3LKZA 1CVIA 3O2QB 4EG6A 1O0CA 4G0OA 5G0UA 3KQHA 2ZXUA 3EXG2 4BQNA 4E09A 1H2AS 5MFPA 2B34A 4MRRA 1WB5A 2AWNA 2C4HA 3MMSA 4KI7A 4YUZA 2QTHA 4YDSA 3LQ4A 4R68A 4DDTA 2ZGVA 4BIIA 5BN3B 3TTWA 3QKWA 1KYYA 4DMLA 4CIAA 4NY1A 3RFXA 3E8SA 5DFAA 3TOXA 3V7FA 1UODA 3C3PA 3PC4A 4KIGA 3HY4A 3IV6A 3HZHA 3P9IA 2EG5A 3FPSA 4EI8A 4MUMA 1PT7A 3NT5A 1MT3A 4QECA 4YACA 3TECE 4ZI7A 1ESNA 4F1KA 3T7IA 1QVAA 2QK4A 2B7BA 2V5VA 4O4JB 2CHFA 5JZOA 3Q9LA 1LTKA 1RCUA 2QYSA 3GJRA 4HGRA 4KYVA 2YWDA 4MB0A 4QTZA 3T0IA 3U3JA 2HDWA 3NNDA 1VMIA 3T5DA 3GNTA 4JLWA 3ZW7A 5AQ1A 1WM1A 4B45A 5H9WA 4XVHA 3CKMA 3ZIDA 4BP8A 5IM4A 1Y8QB 3COYA 3KKLA 1CQJB 3I2FA 2JAPA 1SVSA 1D7AA 3GFTA 3TQOA 1LQTA 1GGFA 4EBFA 4EB0A 1MA3A 1SELA 3WKBA 1Y6GA 2KWIA 2LIVA 4O2AB 1Z4OA 3WK8A 1TYEB 2F6RA 5JDCA 2OSVA 4ESHA 2J59A 1KQPA 2PQMA 4K6FA 2QMHA 3WGGA 3AR7A 1O6GA 1GUDA 3K1AB 5HF5A 3TR0A 5K4GA 5G4KB 1J8YF 4UM9D 1W34A 4S05A 5AVUA 3DBRA 1SUBA 2R8PA 5JWRA 4ACBA 4BN0A 3D6AA 3CUEF 2B1IA 1JZTA 3C1UA 4FWIB 5ESWA 1TVKB 3G5AA 1EGAA 3KUCA 4A0HA 1V5WA 3I45A 2ZVPX 4FFPA 4CU5A 2WKQA 1YB2A 3TEFA 5L51A 3QVOA 4PC3A 2Z4RA 4XASA 2ZRGA 3IMKA 1L7NA 5DWDA 3T95A 1PNQA 3C4JA 1B6TA 3CLTD 3UC5A 3WBBA 1WZ2A 3FUCA 3COSA 3VO8A 3OJFA 4GI5A 1Z2AA 1RWVA 1RWWA 4Y6PA 2Z58A 2I87A 4ZQIA 4F56A 4X93A 2CNDA 2HCTA 4KN9S 1EH5A 1EG7A 4NNOA 5JNLA 1KHTA 4JL6A 4Q3DA 2W7TA 4F45A 3GLIE 1F2DA 4C4YA 4XEHA 1L5VA 1UBEA 2WF8A 4NONA 2GEBA 5FL3A 1BFKA 2MSEB 5LUAA 3SZ3A 3TQHA 3NGMA 2WEKA 3NG1A 1BGXT 1E4VA 2YINC 4ZZIA 4U7TB 5DN6A 1M2OB 5KHOC 1U1FA 4ZYXA 4J4TA 1U1IA 2ZQ5A 2WWYA 4Q3LA 1VPVA 3O0TA 2GZDA 5I6DA 5KREA 3R7BA 2EJUA 1UJNA 1GPH1 1VMDA 5JR3A 4FWTA 4UNIA 4EATA 4HT3B 1ZCZA 1R0YA 4R8VA 1TD9A 1X1EA 3BFJA 1QNFA 3SC2B 4I4TB 3AVQA 4TXHA 1SIUA 2JIQA 2JHGA 1LSJA 1GPUA 1O6ZA 3K5IA 3KZCA 2FJUA 5AXAA 1R9MA 3L01A 4CL2A 4K9OA 1OWLA 1HY3A 2WWVD 2FF7A 1N2CB 3DWFA 5H59A 3ZIUA 3MWGA 2J31A 2ZPAA 5KMGA 4RU1A 2H31A 4BLSA 4WK2B 3E8XA 5TGTA 4R0NA 2HF2A 4LRWA 1E4OA 3Q2OA 2OGSA 3ET4A 2I4IA 3K32A 1MO6A 4CM4A 5GZ1A 2OCGA 3WVNA 3QZUA 1V4VA 4E1AA 3CH7A 5DLYA 5MN5A 1DAGA 1T26A 1PNVA 4BZWA 3SLKA 3N3AC 4CF6A 4DYDA 2UZIR 1SUDA 1Y1LA 3IGFA 4H7IA 3MWKA 4RS4A 3ZTWA 4E4YA 3OU2A 4OYLA 5TGDA 3NAGA 5KTPA 2C88A 1P0IA 4DQKA 3FYSA 3Q7SA 1N36B 5JLAA 3RODA 5JTUA 4M9QA 2Z1DA 3LT0A 1C7JA 2FWAA 2Z8ZA 3JQAA 3UMBA 1NXVA 2WJ4A 3RSFA 1T8SA 3ZIAA 3PBKA 5U4QA 2W6ZA 2WPDD 3BVPA 1D2RA 3IOBA 5CJJA 2X23A 4KE6A 2WF9A 3AW9A 3BXOA 5FUMA 2BI8A 1L5NA 3F47A 5FUXA 2WA2A 4Q7QA 3QWBA 3C5EA 4H3HB 4FEEA 1Z7YA 2WAAA 1GTZA 2H1IA 2OFFA 3VRHA 5BWBA 4OQQA 3UKDA 1KK0A 3EFBA 1R50A 3NGXA 2ZJ2A 4YT8A 1BXGA 2ACVA 1HQCA 4QUIA 1T2NA 2C7GA 2WSSA 3W3AA 3GRPA 2GZ3A 2C9DA 2WPNA 3PUIA 4L08A 4MQEA 4W6ZA 5EIWA 2I3GA 3WTCA 1WCWA 5IJXA 1O94C 2DKFA 3C6QA 3C8MA 5EKUA 2QX9A 2O7RA 2D13A 2OAEA 1V8DA 3BXEA 3WG9A 3WLSA 1FQOA 1PZGA 1TIPA 2CXSA 4KE8A 4M0CA 1QRUA 5M29A 3H6HA 2GPTA 4N0EA 1YZTA 4IGFA 3LP5A 1BGVA 2JIMA 4UASA 1D1TA 3EODA 1O58A 1OD6A 1BKYA 1CZUA 4DR6B 1KK1A 1OI7A 1ZUIA 4QXQA 1RJ9A 4QSMA 4D56A 3D2LA 1J22A 2RC5A 3H6GA 4REOA 1U2DC 2QT9A 3RSSA 3PTAA 4JODA 3WS7A 3R6GA 1HLFA 2TRSB 5CT4A 2FEAA 3WGQA 4FB4A 5KNDH 3LP8A 1UC8A 2OL4A 3VYUB 5HR5A 4DJ5X 1VFPA 4HDMB 1T4CB 4CKWA 4Y2UA 5EWLA 1HE5A 3KLBA 3ZXXA 2F3PA 4X61A 2QD3A 1E94E 2E6UX 3A1FA 3I5UA 1P9OA 4CUJA 2SHKA 1EUZA 1Y82A 3A3NA 3GELA 3M6IA 4KFRA 1TKRA 4ECAA 2F7SA 1VYTA 2Y77A 2HK9A 3LRPA 4JBWA 5T3UA 4AO8A 1J0AA 1JWAB 4P93A 5BURA 5ISMA 5F21A 3R5XA 5HUJA 1Q7BA 4ZJYA 3IS3A 4GKKB 2PGAA 4W5HA 1EFKA 4A9AA 4S0XA 4TV9A 4XDYA 2IHKA 5CMLA 5JYCA 5I48A 2NYUA 2FN7A 1I7NA 3WHKA 4ZIRB 2HK6A 1MABA 3NEPX 1AKEA 5AYVA 1U3GA 3DHVA 4Z0HO 3D4NA 1WPXA 4AP5A 2ASEA 2YXDA 2XOXA 1LJ8A 1T13A 2QS9A 3EBOA 4M9UA 4CEJB 4GZMA 1XKLA 4I6EA 3FOWA 3V2GA 4IHJA 4CQMA 3H9QA 3LT5A 4H3VA 3TNDA 3LDHA 1F0NA 1C7RA 4HFMA 4G0ZA 1A9QA 4D0LB 5CXXA 5T6BA 3IIEA 3VTKA 3WBFA 3EZ6A 4JZYA 4H0CA 2I8LA 3B2QA 1K4YA 3HVHA 3R3VA 4KIUA 4Y9DA 2VDKB 2VXYA 4X7MA 3WLMA 4RGYA 4DIEA 1BA2A 1EK6A 3DFKA 3GBSA 1O6BA 4ZEOA 1QZUA 3H04A 1C4WA 3MNFA 1AS0A 2K4MA 1HE8B 5IWAB 2FSIA 3AWIA 3VDXA 3QKUA 2I2AA 3OJLA 2O07A 4G2NA 4NFSA 4CIWA 4IHKA 3EOBI 4G9EA 4C0KA 2YC4C 2ZULA 4HQOA 3KHSA 1W19A 1VJRA 5AK5A 1DADA 2Q29A 5AKXA 3CO0S 3IKTA 1OYOA 1I32A 2IQ5A 2EL9A 3SSMA 4LHSA 1OXUA 1NUQA 3AKCA 4TL7A 3B7GA 1L5QA 5IBCA 4DREA 4QSHA 3X2SA 2BKLA 3N8GA 3WIUA 1S1MA 1YZNA 2GZAA 1Q1ZA 1BRTA 1RMYA 4WGFA 4BCDA 2WKWA 4Q9DA 1Z6QA 5AJZA 3D7MA 4JC0A 1N7HA 4RFVA 3RFTA 4R2HA 1IIBA 1VOTA 3A6KA 2OQ2A 3DE4X 4UNPA 2WHYA 3TQFA 2W2OA 5JLJA 1P8AA 2IYSA 2DJ5A 1G8HA 1G8FA 2H85A 4MIOA 4WCDA 2HHLA 1QYIA 2X6RA 4QYWA 5L45A 3TZQA 3BRQA 3BPSA 4I99A 3PHIA 3OWXA 3F7TA 1N0HA 3ZW9A 3HDGA 2HGZA 1DCMA 4GQBA 4LRTB 4DIOA 2BOVA 2GJSA 4YRSA 1K0FA 4LHWA 4UDNA 3AHGA 4R2JA 4D44A 5JVDF 1EUQA 1OFHA 3ESXA 1EB9A 3PUJA 3D59A 1JXOA 3KAJA 4GKBA 5J59A 5IKOA 3SMVA 4CG0A 3RVJA 2YIVX 4GVPA 4DHWA 4PYRA 2M1ZA 4JOBA 1GTRA 3EPJA 3N5KA 3Q12A 5M7EA 5JXJA 2BMEA 4L5BA 2QMQA 3B7PA 3K0BA 3T0GA 3VSDA 1PNTA 2W2QA 3SFTA 2F8TA 2O8BA 1DXYA 1L7EA 4QC2A 1I1QB 2JCSA 3JY6A 5ICGA 3NVKI 4EB8A 2BISA 2XMGA 5ITSA 3PTLA 2JGDA 2OBXA 4BNKA 5IXJA 4O2BB 4A15A 2PLAA 4OLFA 2B35A 4AJEA 4OI1A 1PT5A 2OGZA 2IS4A 5KYVA 1XO1A 2ZWAA 4PHTA 1I1HA 1EWTA 2IGBA 1OXVA 5BQ3A 4EHFA 4F97A 1SXGA 1YS7A 2XB9A 4YRBA 1PLLA 1IRXA 1AKVA 1YR3A 4N01A 3GLGE 3BKXA 4TLDA 3ZY5A 4PN7A 2AD5A 2A4KA 3LL7A 5DTRA 4A8JB 1W88B 4NG5A 3GLIB 2WJJA 3AOEA 4DUGA 3QOWA 2R11A 3DBLB 1NUSA 2C5EA 1SVMA 1VHLA 3F90A 1RHUA 1FLAA 3EWNA 4KKVA 5HK9A 5KJFA 2EFJA 2RGEA 3Q7IA 4RLHA 5LQNA 1SKMA 1UBUS 3QWIA 1F8UA 1BG6A 2WE8A 1JE0A 2YFYA 2YWCA 3JQGA 1HL3A 4LNHA 4L4ZA 4QD3A 5ICMA 1QE0A 2VNAA 2V4MA 4NHEA 5J4HA 1DKUA 4LMBA 3ICOA 5LQRA 1L4BA 3MD0A 2YNMA 4IDOA 3FTCA 1L8OA 3KKMA 3ZCXA 1O2DA 4RFSB 4U1RA 2FEPA 3QJYA 6GPBA 4JJ7A 3JAKA 3I8XA 3MHTA 3EFOA 3L1IA 4BFWA 2C0QA 2PY6A 3IVGA 1UXKA 2FSVA 4XCVA 3KZ1E 4FE4A 4UHFA 4Z0PA 3Q7RA 4AK9A 1E3WB 1MJGM 2XIJA 1WOMA 1PWYE 3E0QA 3FA2A 5KDOA 5KJCA 2IK8A 5EMMA 1ECCA 3QVJA 2Z9DA 3HR7A 4UAJA 3L7CA 1P1JA 1PCXA 2PLNA 4GX0A 5CXQA 4BEJA 5I45A 4BO5A 2OBBA 2ZCJA 3EXHB 4CQLA 1BROA 3FDXA 4GQIA 3R6DA 5L7YA 1E7YA 2RG7A 4C08A 4HXYA 1DI0A 5IXYA 2C5BA 1UJCA 3OF2A 1KP3A 1Z37A 2IYZA 4FDMA 4LW8A 3WO1A 2XAAA 4HAYA 2JHAA 1IN6A 1ZRMA 3EPLA 4C6RA 2JLZA 1RADA 1CC1S 1TQ4A 4KAXA 3GG2A 4PX9A 3P0EA 1J8MF 2JIRA 5E0KB 3VNAA 1DIAA 3AY0A 4HZUB 4XQGA 1Q74A 3FUVA 4IV8A 1COZA 2XD4A 4YJ3F 1EWQA 3VNRA 1L5WA 1WVIA 4F6RB 1JDNA 1EBFA 1HYQA 3W2EA 3EZYA 1HRDA 4Y67A 2IEYA 1Q0LA 2AFIE 4HSGA 4PQGA 3OUUA 3IQWA 4INZA 1E2HA 2GI4A 5DM1A 1XL0A 2IHZA 2RD2A 3FKSD 2Z5FA 4PLVA 4RWZA 1L5LA 3VC7A 1ZLXA 1TZJA 1HO3A 1OX6A 2PN1A 2XPCA 2PMEA 3UBMA 5F98A 1Z0UA 2VPWA 1G8PA 1V1MB 3TTSA 5KQSA 3Q98A 1ZSYA 3AFNA 1FDWA 3N2YA 5E1BA 3KKEA 1DV1A 2D1YA 2ISQA 4GX2A 2DKNA 2EWVA 3BEDA 5BO5A 3ZQ4A 4G65A 4F7WA 2BH2A 4IXTA 3KJIA 1PUIA 1LLCA 4AUEA 2XUAA 3HLYA 2QVXX 4H7JA 1H6DA 4L2IB 3TW4A 4Q3OA 4CIXA 1MMFB 1BW9A 4TTPA 1OBHA 5F1OA 1E5DA 4P38A 4TGLA 3PE6A 3HV0A 1JWBB 5E4TA 3MPOA 2PO7A 1V95A 2E7ZA 2NZYA 4UUOA 5A6SA 3KQPA 3U4QA 3SQMA 1Q0QA 5EXXA 4ESOA 2FR1A 1NVVR 3UA4A 4P82A 1ENZA 5EZYF 4MR8A 4KSYA 2XUJA 2R79A 4E70A 2PA3A 1L5RA 4MUAA 3HL4A 2J0UB 1FMLA 2EJBA 2RBGA 1DEHA 1ID1A 4CLEA 3D43A 4IH9A 3QX7A 3NWEA 1JEOA 4NFYA 4U0JA 2ZSIA 1YZLA 4H7EA 5JADA 2HF9A 4RE6A 5KTKA 2C97A 3CA8A 3MWDB 4W6QA 1E8MA 3MMPA 5DN9A 1ZO8A 5I8PA 1ZUNA 3DONA 3GVPA 4D41A 1KYTA 3G5MA 4LYHA 2FEOA 4MQBA 3DZGA 2FOLA 4AY4A 1RE1A 3MTJA 4GR5A 3GCXA 4I46A 4JLOA 5FL7D 3RHZA 1UF9A 1MV8A 5T4BA 2X7JA 3UUWA 2XSZA 3UFBA 4IIJB 5J47A 4JLMA 5IYZF 3CSSA 1XQVA 2V3WA 1A8SA 2OB2A 4BJ5A 3RC8A 2E9SA 3B9PA 3M0EA 4L0DA 2ZAIA 4MW9A 4UM8B 5THQA 2FZLA 3MUNA 3A2MA 2WJPA 1SOWA 1QP4A 4GT1A 1AKNA 2FQWA 2R66A 2ZBUA 2IS1A 1L5MA 2FKNA 2CB9A 3PDIA 3PJFA 5DWVA 5IJWA 1IULA 5BQPA 1JIKA 1HR0B 4RK0A 1KERA 4LECA 3LHDA 1HNNA 2PO5A 2QMZA 3K0FB 2C78A 3M6FA 5JSUA 4WGGA 1VLMA 2OBLA 1AUPA 3AZQA 4O5AA 2ZJZA 3KKKA 5ES4B 2R8BA 1E0JA 2CXNA 5EERA 3REQB 2AZMA 1L4MA 1RWKA 4K9KA 2HK7A 3K9BA 4R2IA 4RV9A 2QGZA 1QC5B 4P3OA 3PQ4A 3PLAE 1PQYA 2VDMB 4CR8A 3BF8A 2D54A 4GUAA 2VAWA 5IJ0A 5H9VA 4H60A 1EP3B 1YJAA 1J56A 1Q1NA 1U1CA 3KNZA 4HLUC 4WW0A 3V2HA 5IVHA 2XZPA 3OO1A 1DOHA 5EIXA 2UU9B 3K8YA 4LQDA 5B1DA 3FCAA 1MCZA 3Q87B 5B4UA 2HYIC 1XTTA 3AZOA 1C80A 2P68A 3K70C 5LMUB 1JFSA 2P41A 3CBGA 1QIKA 2WYIA 2O2IA 3E48A 5HF9A 5TGZA 2O8DB 4XLZA 1X2EA 1AS2A 1DBPA 2J5KA 5D5QA 1XCOA 2D8AA 2X4GA 4CEIA 4LYYA 3MWYW 1RBYA 1FZQA 5F64A 1BMFD 5TMBA 3W7AA 3H83A 4AUMA 2AQKA 3D4OA 2Y71A 1HI9A 4XUGB 4AQDA 2JFXA 4DCNA 1NIJA 2O2GA 3ELBA 4RBNA 1UFVA 3DXFA 4V0SA 4GKJB 1YONA 2PKWA 2R1VB 3GOQA 1YR6A 2TMKA 3K16A 4RORA 1D6NA 1EBUA 4NENA 4DB4A 2CE2X 1XFDA 3SJZA 2A0UA 1BXRB 1VMEA 3Q8WA 1JRLA 4CTMA 3UA3A 2H59A 3PGJA 1U81A 1YFKA 2BONA 2ROQA 3PNKA 4LJ5A 3SEZA 4EQZA 1Y5LA 4BPBA 5CLQA 4NMWA 1ZH2A 2QXUA 3B2EA 4WFIA 1G0OA 1RRVA 3T7SA 1OXBB 2VF8A 1R10A 1TCBA 1NUPA 4BMCA 3JQDA 5B7QA 3FN4A 2C29D 3GDFA 3CLKA 1FYFA 1L0BA 1WUIS 3MJEA 5AICA 1V0JA 2AYXA 2V03A 4LG1A 2HO4A 1R0LA 1TLLA 1UMKA 2KB0A 2SKEA 3OMLA 4W1PA 1YS6A 3PGXA 4ZTBA 1KYWA 3O9ZA 3SD7A 3MT0A 5T41A 3F97A 5GY7A 4DNPA 1F06A 3AVPA 4O2LA 2I29A 5BXYA 1HFWA 4PLTA 4WJKB 3DAHA 1E1KA 4WCFC 1YZHA 1RYFA 4EX7A 2V6MA 3IBTA 4CFZA 2BAGA 2E18A 2SKDA 2I2WA 4B2LA 6NULA 3BM5A 1A69A 4YJFB 2ZUCA 3L84A 3WAKA 1LF5A 1ABFA 4Z7NB 2IZ0A 1PGOA 4OYRA 3TPZA 5T5QA 4PIMA 1VXRA 3VOAA 4YRJA 5KCMA 1CLEA 2PYDA 5GTDA 5CK4A 1XVVA 4L8WB 1B2LA 2TSYB 2EDAA 4AL4A 2VP9A 2MTBA 2H2DA 4HBZA 4RJJA 5GPBA 3QXGA 3WOHA 2F3UA 3SJAA 3WWOA 2GN9A 3GLGB 1TU3A 2IF0A 3EHEA 3GRVA 3OT1B 4E5VA 1QQ5A 2AI1A 1ISHA 4C6TB 2AFRA 4O6VA 4TL8A 1WZIA 3EEFA 2CHGA 4Y8VA 1W85B 4IGKA 3R40A 5K99A 1CUYA 4DLPA 3CCCA 1B1CA 2AOVA 3K0AB 2WW8A 3VC2A 2JEYA 3E58A 4V1CA 3OI7A 4ES6A 3GGJA 5HHTA 5EIBC 1QTNA 5C5EA 5EHXA 4K6MA 1DEOA 1CUXA 2ID4A 3MFQA 4NAUA 1GUAA 3G88A 2H2HA 1JDVA 2BF4A 5A5FA 5FR1A 3N2LA 3SM9A 3EMBA 4FMDB 3PHCA 4KTVE 5YASA 4KZPA 4DDUA 4ZCQA 2F8LA 1K89A 2FCAA 4OM8A 4P5PA 4WTOA 3U5ZB 1O9HA 4KDFA 4IDCA 1H0SA 2C4NA 1KARA 5JPCA 5B1IA 3KQSA 1ZHHA 1NU6A 4YRDA 5C0OE 2JGAA 3EIHA 4MINA 1IVNA 1LDGA 2P5YA 4PV7A 5KWIA 1LPMA 3MERA 3O8LA 4KBFA 4PHHA 3CR3C 3RUDA 1NNLA 5G3ZA 2VP2A 2PA0A 1KAEA 5BMVA 3NHKA 3MK31 1DBSA 5DGTA 5DIFA 2HLDA 3OPXA 4ML3A 3RGWS 1ZJ4A 4J7AA 3RRMA 4IMPA 3KXDA 4EENA 5F7OA 4EG3A 4MKHA 5LM3A 1KZ4A 1SVUA 1G6HA 4E4TA 4WLUA 3LRXA 4B6RA 2HYDA 1QK3A 1J0CA 5BRJA 2ZJ0A 4GP7A 3SXPA 2O2XA 3VGPA 2UXCB 1FYWA 3A1DA 4RMNA 3U37A 1X7YA 3IQGX 2NM0A 3LE8A 1AH2A 1DHRA 2AFIB 5FFMA 1TYCA 1RZUA 3GT7A 2C9OA 4UPEA 2C4TA 3PNPA 2BGUA 1Q3TA 3RS0A 4OYHA 2WB4A 3UXEA 4RHEA 3ABQB 4X41A 1MO2A 1O7JA 4JT4A 3LY7A 3WRXA 1RQGA 4KVAA 3NTUA 2EHJA 1P2BA 3ZY6A 2BFCA 1T2CA 1X8XA 2XCLA 3M6LA 3EG9B 1QGUA 4L4YA 1S8FA 2X15A 3C6MA 4JQZA 5HBGA 2QSZA 3R6WA 5IVIA 1ZGHA 4OAQA 4OHBA 1NF3A 2QE7A 3WSTA 1CW2B 5CAEA 3W8RA 3ENQA 4OX9Y 1US8A 4OVKA 4S24A 1DT5A 3OE4A 2BZ1A 4FFOA 4B6QA 4Q6BA 2XAUA 3S5JA 5JI3E 5HVNA 2QXTA 4J91A 3DTYA 4KQEA 5EUBA 5H3CA 4F46A 3CW2A 3RS3A 4HNVA 1QP0A 1KDOA 4XM1A 1RKQA 3CNLA 4RW0A 1DARA 2AZTA 1XMSA 2IOFA 2YRXA 3K6KA 4RYDA 1J9EA 4R3WA 2VEDA 4XIYA 3UWPA 3K05A 3ZUPA 4MRNA 4H27A 3LPLA 2BZSA 4C0HA 1DAHA 1EA7A 1UWKA 4QJ4A 3CG0A 3RDPA 2AN3A 2P2CA 1Y6QA 2CFCA 1MKYA 3QP9A 4YXWD 1ZW6A 3AJEA 1XR3A 2F4NA 1SVLA 2HC9A 3BRCA 4RL6A 4TRMA 1X7HA 2COUA 1E2NA 2QI9F 3T3HA 3PGA1 1XLTC 3SHWA 1FFBA 5HSGA 3DVAB 5HQTA 1Y7TA 1L5HB 1PAUA 3ZJ5A 4G01B 3NHYA 1YVRA 4IPTA 4EABA 3PNOA 4QGAA 2AE2A 2VWGA 2XYPA 2XXAA 1JXQA 1SOAA 4AROA 2GBCA 1X9HA 3ETNA 3S40A 5BVGB 2Q2WA 3LBHA 4MITA 1C2YA 1PBTA 4ZI5A 4DDMA 4LCBA 4UOEA 2I3DA 2E82A 2WYHA 2FPXA 3DTVD 3ITKA 3QG5A 4I36A 2WSBA 3NRCA 4RPGA 1AK2A 3JQ7A 3HXOA 3ZJVA 2ZE6A 2P0EA 3CEAA 3T41A 2X0RA 1BHJA 2ZR9A 5SZIA 2NZUG 1C7QA 3I1FA 4KZKA 2I6SA 3NFRA 5AJVB 2YYZA 2IU3A 3NBQA 1W4ZA 2B25A 2BM0A 3LX4A 3NGLA 3V80A 2AOUA 1SXQA 3NOOA 4XEUA 2GCOB 1OT5A 2X1HA 3NBMA 1G5QA 1RCFA 3KE8A 2XDYA 4KQIA 4IICA 4PQYA 4RA6B 1KBOA 4II2A 2FYTA 4CDNA 1ACLA 5MFZA 2GM4A 4P34A 1QGYA 2Q1TA 5EJFA 4BO0A 4XWKA 1HM5A 4KACA 5IFLA 3W3AH 3R09A 1F0KA 2XQKA 5H02A 1Z4PX 4XDHA 4YI3A 3C7CB 4BDSA 1BQ4A 4BMYA 4H7PA 4O4HA 4HVLA 4IO0A 5LMZA 5DIZA 1GKKA 2NU6A 4MEJA 5IABA 2IEIA 1MGOA 3Q3GE 4NU8X 4QATA 4EELA 3T9EA 4ARZA 1E77A 1CYEA 1G5RA 1NC3A 4R8LA 4M9CA 4CV3A 4EI7A 4PYOA 4YJ3A 2YZMA 4GOND 3I28A 4Q03A 3KJGA 2X8JA 5JNTA 4L5YA 4ZRMA 1CHNA 3L6BA 3SNHA 3MINA 2H06A 2FMUA 2I6GA 3R41A 2C8KA 1JG4A 3N8HA 3QW4B 4WBNB 3S68A 3UXHA 3FCUB 4NQZA 3BT7A 3B1VA 1DOZA 4KVFA 3ND6A 5JALA 1MB4A 2BGKA 3ZEAA 4NX2A 1NVBA 4OBEA 3WNDA 4HGQA 1EA5A 2PQ0A 3HFRA 4TSFA 3JR3A 4RCZA 1P9RA 1ZP6A 2QTFA 4F92B 3O75A 1LVGA 4JKYA 1OFGA 1S2LA 4TV8F 2QV7A 5AKIA 3W6ZA 1FFDA 1ZPDA 3K0CA 3HHPA 5EMHA 3L1UA 5FTKA 2IZ7A 1V6CA 1PJTA 3GZJA 4EM6A 5KYTA 1XKTA 1W9HA 5A4KA 5DXAA 2WKPA 2Z5VA 5AUQA 1AKYA 1E2PA 1ISMA 3M8KA 4HAOA 1ZSVA 4G4JA 4YCDA 4IX9A 4PNZA 2EOAA 2XNHA 4NBVA 4C04A 1X7GA 2Y4NA 3ICWA 2OQVA 3D1JA 1YZ3A 2BUCA 5KOJB 2C7VA 2PWZA 1QVWA 3AFIA 3DKRA 1F4VA 3JZFA 3R6TA 4KJZA 3V4RA 3U7FB 5K0CA 3AJ8A 4EX6A 1UXIA 3M9LA 1Q1EA 3NP9A 4I5EA 5H83A 3ZQJA 2IUSA 3GF4A 2AFVA 2YV4A 4BV2A 1EXVA 1XKQA 4XX1A 1MBZA 2ZPTX 3QE4A 3EULA 1B23P 5JNWA 4NYMR 1P1KA 4RVGA 1XD2A 3F2IA 3WMXA 2C58A 5KO2A 4PTZA 1MZPA 2ZDQA 1L1EA 2W93A 3KVRA 4YC7A 4ZK2A 2QUJA 1NBWB 1PN3A 3PRKE 4EMUA 3PLNA 3AZPA 3RK1A 1K7SN 4OH7A 1QMGA 2FGJA 3LVQE 1TLFA 5FO0A 3VA7A 4P36A 4MRPA 4JJKA 2W9XA 1OTYA 3U39A 4ITVA 3IP7A 1J0BA 1K66A 2J9FA 4CMIB 1R8YA 2RKBA 1M67A 3HA5A 3FPBA 4EA6A 1CY2A 4M0EA 1JVNA 2R6AA 2W00A 5K3DA 5KHAA 2AVDA 2HJVA 1K5PA 1XP5A 1Y4ZA 2Q41A 4G0PA 4W5WA 2QQEA 3JTMA 2EVWX 3OPYI 3SC6A 4EAAA 1QYWA 3IQIX 3ZDEA 3TBKA 5IYZA 1YIOA 1DFHA 5K01A 3MS2A 2QLNA 3EVFA 2QJFA 3TX2A 3ZV7A 4LE2A 5B1SA 5LWQA 1U0LA 1IZ9A 2JJQA 5BR8B 4TMWA 1SH7A 4BV8A 2OTCA 3G9UA 1RQLA 4PPQA 3E7XA 1E9EA 2WJZB 4LWOA 4UM5A 2CDAA 4JJIA 4NE7A 5JQGB 3GDWA 2FPIB 3UCXA 2W6IA 2AMYA 2XDWA 3AF1A 4NMLA 5TF4A 1NL3A 1TF5A 2B1GA 2V3CC 3JQ9A 4IJMA 5HKOA 2WG1A 1CR1A 5EYPA 2IXBA 5C1PA 2F55A 1Z47A 1XDGA 2NVOA 1XG5A 3DZIA 3I92A 2C20A 5CD9A 4D3FA 1ISRA 2E1RA 1CS0B 2BBOA 3JCZA 2O2CA 5TVGA 1NNSA 4AZ3B 2V4UA 2WHPA 2Q7OE 1EI9A 1H1DA 3GLUA 3W6OA 2PZMA 3AUFA 3FCCA 4WCFB 2VF4X 2OHHA 2YUTA 4KN5A 2BJHA 4WOCA 5BN5B 1SHKA 2C54A 2HX1A 3KDAA 3VH4A 2W6NA 2DULA 2Y0EA 5FA5A 4EOGA 3ZNQA 1RBQA 1NVFA 1BU8A 4HNHA 2SCUA 1TGVA 5D5HA 1AZLA 2V59A 5B1EA 3M82A 5CFPA 1JLLA 2BDUA 2FN3A 1WNFA 3BA6A 2YXPX 5FUQA 4B3RB 4U0KA 4J0QA 2G1PA 2MINA 4YP5A 4DFDA 5JI2E 4ZT2A 4L0CA 3LWDA 2NUPA 3R5JA 5JIBA 4QODA 1R4NB 2BSXA 2GR9A 1QPGA 3AP3A 3DQPA 4EEZA 4F12A 1RAIA 4G0UA 3WIBA 3H7IA 2R6DA 1FDSA 3KV1A 3G2LA 3B5JA 4LWPA 4Z4HA 2A86A 1LF0A 3VYTB 1LS6A 3D8BA 3PKJA 3EDYA 4TVOA 3I04A 2H9YA 4HYTA 4W5TA 1TEXA 1NE7A 3VH2A 2P9ZA 2V7PA 4WAUA 1AMOA 1T6NA 1U9IA 2QL7A 2D0PB 1GT91 4P2GA 4ONEA 3COJA 3KLOA 5F9MA 3UH1A 3ZLJA 4C7OA 1IOZA 2BKVA 3IA7A 4NCHA 1OXXK 3WGZA 5L4SA 3RKUA 4QM6A 3NFYA 4RQAA 1M1UA 4OP2A 4RY0A 3CB2A 1MQ8B 1EP9A 1JJBA 3VBCA 4PPNA 4PLHA 3U7QA 5CITA 4RPIA 1FSFA 4P83A 4WECA 3PSAA 3GMDA 3MYYA 5DE3A 3F6RA 3I9V6 4GE3A 5J63A 5T57A 4HVTA 3V4PB 1R37A 3GJQA 1DZ3A 4K7JA 4ZV9A 1D04A 5JXWA 3TLAA 1YZKA 4Y6SA 2AJBA 1OW3B 3Q5EA 1XNQB 2IPMA 5JCOC 5CCEA 5FJJA 4U3JA 3FJYA 3HSYA 2HIAA 2Q6KA 5AHXA 1VPDA 5J4YA 1VKNA 2ZITA 3QLUA 1AX9A 2EIHA 3V8RA 1AZTA 1EK2A 2WSIA 4JJ6A 4Q3CA 3LLSA 1U5BB 1M1ZA 2EWWA 2FN8A 1FTWA 1GZHB 2ODTX 2VXCA 5H70A 3JASB 3L2OB 5EZSA 2MWMA 4IFTA 3DMDA 5JJ5A 4ZYZA 5LN1A 4IIGA 4PPFA 3KVVA 4U7WA 2BI7A 3INYA 1PR3A 4BTVA 4XWWA 3R0JA 4N1AA 3U4GA 1BCSA 3H9CA 4X7PA 3AR2A 3FNFA 4UEQA 1DHTA 4KPUB 1QH8B 2JKVA 3FNQA 1DJQA 1NURA 4DKJA 2AN1A 4RVCA 3GEBA 4F21A 1QHYA 2V6FA 1W36B 1J2JA 4O59O 2JAUA 4EARA 5MHTA 2H18A 4OQPA 2JPDA 2QZ4A 1Q50A 3EFHA 3AHEA 2CHQA 2KLBA 4BMZA 3B85A 1II9A 1N1EA 1Z29A 3B1XA 1T9GS 3ZE2B 1DAEA 4LUCA 5FPPA 3AIOA 4ZVKA 3KJZA 4AWAA 2VPZA 1NVUQ 1Z6TA 2JAQA 2YWRA 1T9ZA 4OQEA 3E5RA 3DMNA 5AW8A 2XGGA 3GEMA 4PZEA 3V9AA 2XTAA 1BKDR 2GPAA 2GRAA 2RFLA 4LQLA 3R3SA 3GD5A 3PQ5A 1P2SA 1WBJB 4K1XA 1EM6A 2PKCA 3CF4G 4MKIA 3DDUA 1D0IA 1QVRA 4C0AC 1HK7A 2LIPA 3BH6A 4ZCIA 3USZA 3KCQA 5E2BA 2GX6A 3E22B 5EMKA 4UTZA 2AFHE 2JA2A 2ORWA 3PFKA 1SXJE 3UAGA 2XBMA 3KT8A 1M3SA 4K0RA 5CUQA 4B3XA 4EA8A 3NHLA 3R0XA 3OLWA 5B3JC 1QZZA 2C2YA 3DE3X 2CL7X 2CK3A 5JRJA 4N65A 3JV7A 3V4OA 4M46A 1EGVB 4CN9A 4D42A 2JA1A 4V1CI 4QVIA 2AHOA 2H17A 3LUKA 4JNKA 3MWFA 4D3DA 2VZEA 4B6EA 4CE6A 2QVZX 3BMOB 5IJ9A 3J80A 1CUIA 4GECA 1L5ZA 5HZKA 4YFYA 1MIOA 1T0HB 1BIFA 1P60A 4OXIA 3WA6A 2EL7A 3OLQA 4NBRA 4Q05A 3C7KA 3DHWC 3OE5A 2VI5A 4UBLA 5FTMA 1SVIA 2Q3HA 2VJCA 3I2IA 3IUYA 3KR9A 3U6KA 3Q3HA 2HREA 3IJEB 1V16A 4JBLA 4Z3OA 3LA8A 1P1FA 3O91A 4OGLA 4D99A 2J32A 3TNFA 4GD3Q 1RRFA 1T0JB 3ISTA 3SHOA 1P3Y1 2GQ0A 1USGA 4D6XA 4ZEXA 3ZJ4A 1G63A 1ND5A 2VTBA 1WQ1R 1BVUA 3BBLA 1E9FA 4CDRA 5AVQA 4C3ZA 1SU7A 3O8CA 3CX7A 1RIIA 3KKPA 1MF7A 4OQMA 1T5BA 1GN9A 1PFGA 3R2JA 3ILSA 4S2EA 3DV2A 5J4VA 3FVWA 1YR9A 2CF6A 3V1NA 2EG9A 2P35A 3ZZTA 4LA4A 2JHCA 2AEJA 1NBAA 1GFZA 4EH1A 2XE8A 5A4IS 5ERXA 1NXXA 2VAXA 2ZRBA 3SQDA 4L7QA 4M1ZA 4ZEVA 2NUTA 1Q57A 1RVV1 1ZGJA 1J1UA 4QDKA 1PFVA 4KR6A 2OYCA 1NP6A 1OC2A 2Q5FA 4YRFA 2GF0A 1IBLB 5HZHA 1VZ3A 5CH8A 1GRCA 4JC5A 4QHYA 1QIJA 4YFVA 3DNFA 1U7UA 3WWCA 2CUTA 2O8VA 2C9BA 3AM5A 3C1AA 3GRAA 3ZPXA 4QYTA 2ADFA 3AUJB 1QDUA 2K7ZA 4H4EA 4XCQA 4DEXA 5JEDA 5AI9A 4ARUA 3GJYA 2CCKA 2ZXEA 3K0KA 4C7MA 1SQSA 2GSWA 4NYJQ 2UAGA 3NDPA 4HB0A 2XGJA 4DT1A 1CRPA 1S9HA 3ONNA 3H11B 5DLPA 3ZQUA 2P6MA 2FJPA 2VTKA 4KXNA 1UDRA 1ZK1A 2EU8A 1UWLA 2JI8A 3AR9A 3TQRA 3UAVA 2DOKA 3CFYA 1I2ZA 3PJEA 4ZQGA 3L8FA 3UB3A 5H8WA 1FFGA 1NF2A 5JFGA 3OQIA 4UXHA 4DJFC 2QPOA 5CB6A 2OV3A 1CEYA 3BMNB 4ZD6A 1XZJA 1YZUA 1GTG1 2CF5A 2V7QA 3KQNA 3F1LA 3D3EA 3N6RA 3WGYA 2YY5A 3Q3CA 1K7XB 3TKLA 2ZSKA 5JSKA 4OFXA 2QRVB 2ZI4A 3M4JA 5K8IA 1AKWA 1ODJA 1R0CA 4QXAA 3I5YA 3RC9A 4BFLA 2VATA 4X7RA 4NCXA 3ADOA 1R0KA 2AN5A 2JLRA 2HW8A 3ZWPA 4D3ZA 2ARKA 1PX2A 3QE3A 1N8KA 1P74A 1N2JA 3NANA 4KQ6A 4C0QC 5K8VA 3LWZA 1EFLA 1I01A 3G85A 2PPLA 3O2JA 4IQGA 4INAA 4HN2A 4IIBA 1ORIA 4Z3DA 1U8UA 3ZKWA 1JR3E 4EJ2A 1V5FA 3QOXA 2BEUA 4OD0A 2EV9A 1U3TA 3Q15C 2HDOA 5K4HA 3MRSA 4M9ZA 2JAHA 5ALVA 1X92A 4F3NA 4JI0B 2Y9PB 4NR0A 1EFTA 5H82A 5GJCA 2HU5A 4QBFA 3WR5A 3D6VA 4IIHA 4DZZA 3BAZA 1TZ2A 3D2AA 2DLDA 1YWGO 4GPEA 4ZZ2A 3IERA 3SN6A 3IKLA 5FR2A 3X2EA 2JI9A 4LF5B 2CJWA 4BAUA 4MROA 2CLSA 4H4DA 2PRKA 2ZRFA 4W8OA 5J5AA 3KR1A 2VUHB 5F3WB 2QP4A 2RJ3A 1KI9A 3NP7A 3RT9A 4D9NA 3K9NA 3D5TA 1TQDA 4V3BA 5FOQA 5KTTA 4IDAA 5PNTA 3EVGA 3IO5A 1ORVA 3IVRA 4EL5A 2VUUA 1NAIA 1X70A 5CP8A 4B6SA 1SHLA 2D0DA 2IV3A 3UT0A 2CNWD 3F5MA 2H92A 1H05A 3BB4A 3SAJA 3SX2A 6ADHA 4QO7A 2FQYA 3KQVA 4RY8A 2RB5A 3HXQA 2AOTB 1YFLA 3M3PA 4IIYA 4CDMA 3H9JA 5ILOA 1ZM2A 1PZFA 3REOA 2ISCA 3GX1A 2NYVA 3EWSA 3L5OA 4A6EA 1XZHA 1ZWKA 1MJFA 3A1VA 3FTNA 4J4HA 3ZV6A 2GN1A 3ZE1B 4A16A 1XMXA 2B92A 1ZGAA 3NXKA 3HA7A 1MEOA 1EFRA 3QE0A 2G80A 1JF8A 5DHQA 1QBKC 4LVNA 1C14A 4RE5A 3HA3A 3SKXA 1NAHA 3TRIA 4AJOA 4HEQA 3G82C 1FFXB 1XEWY 4N5IX 5AI8A 4LDNA 4DDWA 1SMKA 3K9GA 2O8CA 2J09A 1T5TA 5HS4A 2AUMA 1UT6A 2C98A 4C2AA 5A03A 4TZ6A 2XNJA 3DYIA 4BVEA 2IHYA 3G0OA 1RWBA 2OD2A 1XEAA 4XXHA 4OKNA 2OXIA 1K5GA 1PYOA 1YULA 2D5AA 5EIFA 1D6JA 1F6WA 4U2FA 4C7VA 1PVDA 3JQ8A 4O1MA 4P4SA 2HPHA 5DU2A 4G9BA 1DJMA 2H4WA 1VTKA 2ZJ8A 4KODA 1NLZA 1UEIA 2PFKA 2OP1A 4L8GA 4X5OA 2PMWB 2GJ8A 2Q5IA 3JU3A 5F52A 4E03A 3X1JA 4ZTUB 1QPZA 2IS2A 1UKBA 1G3QA 1TJ4A 3FGPA 4M4SA 1IM2A 2DT8A 2ZRJA 2GDJA 2QRLA 3WL5A 2YOFA 3I0MA 1TA4A 1T36B 2Q9UA 2CFSA 5FOUA 1C2TA 1A97A 1A7UA 2ZT6A 1NFQA 4JGBA 1C8VB 5LA6A 3TXXA 2OO5A 3CUVA 3V33A 4D8TA 5L3QB 1QSGA 1PLKA 3UHPA 3EQZA 2HPZA 3FTDA 4D96A 4RZUA 5L40A 2DU8A 3ZCRA 4U2BA 3THOA 1M6HA 1JJAA 4B71A 2BKAA 2ZREA 1RPAA 3I62A 1PZNA 1MAHA 2WICA 4YRRA 1UZUA 1YCGA 2R65A 3QBJA 5B4TA 1IPHA 2IYQA 1Z5UA 1XB2A 5KHLB 2EZ9A 3H9BA 3MGCA 3WI7A 4BPRA 3I4LA 4PPYA 4X60A 2I4OA 5FWYA 2QPLA 3UAZA 4OUKX 5HP4A 4LJKA 1NT2A 3P9CA 4K9QA 1GNSA 1P77A 3C3DA 4LV5B 4WDRA 5KTMA 1ZVQA 2IBSA 1G7TA 1SXJB 1GLGA 2QTTA 4R7ZA 4EW3A 3T7RA 1B8UA 5BSTA 3LUJA 5E9AA 1X1RA 1RXVA 3FB1A 1TUBB 1VKHA 3ANMA 3WJ7A 4U7PB 3RBXA 1T5LA 3OVMA 1HFJA 4I4CA 5KWVA 1B1AA 2IEZA 3ZHBA 1O6CA 2IYXA 2VQ3A 1MLDA 1RJWA 2ST1A 4IXNA 2H1HA 1M74A 3DEIA 3EIXA 1I3MA 1MNAA 4MV6A 5F2OA 2XEDA 4RANA 3BQMB 3LOUA 1IBRA 1W5AA 1WW2A 3SY8A 4EYSA 2H2GA 2CFOA 4TKZA 1Z73A 4QPDA 4FDTA 1LKZA 2G4CA 1UH5A 1ZGBA 3LCJA 3JYOA 3V8NA 3VTZA 1F0YA 1XCLA 3T3OA 3LBIA 4UARA 4IJ6A 4J6EA 3RU2A 2ZVQX 1JHXA 4Z9AA 4ZVTA 3TD6A 4CCYA 3LVRE 4UEJA 1B6RA 5FI3A 5BSWA 5K8JB 3BB3A 4YAEA 2A0FA 1M6VA 4LZNA 2W6OA 2Z0MA 4WK4B 2X9LA 1AKMA 2YQ4A 2NT3A 4YWHA 1TYBE 1A7KA 3TIXB 2FZGA 4B80A 1ESZA 4EJSB 5JSFA 1MJNA 1E5XA 1Y1RA 4B4VA 5B2EA 1C0LA 1OASA 2GUWA 1YQQA 5KYWB 2AE1A 3BXPA 3SXJA 3EUAA 1EDOA 1KJ9A 4G63A 5A9SB 2EDCA 4ZAWA 4KQCA 3FDJA 4IIVA 3SQWA 2JIZD 2P2ZA 1KI2A 5K3FB 2AQIA 2XUOA 3B1FA 1EE9A 3BTVA 4K03A 2O2JA 4BWFB 3L0IB 1ZLYA 1A5ZA 2ODEA 4AD8A 3U1BA 1QP8A 5CVUA 3IAM6 2WR8A 4H08A 1F2UB 4XB6B 5JATA 3AVYA 4FINA 4IHAA 4TTTS 4B0PA 3GJ8A 2NSJA 4FHCA 3NIDB 2JVKA 1KH1A 5CIYA 3WQRA 1C1XA 4DG5A 1ZEJA 1CJBA 1GZ5A 8OHMA 4KR0A 3P9XA 5G1OA 3C1TA 5AVKA 1UKZA 2R7AA 5HW0A 5ITZA 3IXQA 4ZYVA 4URWR 1T1JA 2R6GA 3TRKA 5IT9A 4X95A 4J7UA 3VR2A 2PU5A 3PFIA 4J3JA 5CLIA 5DM4A 3UK7A 3QLTA 3OIFA 1LV8A 4BBJA 3CJQA 1VJCA 2ZR0A 3QWHA 1KZ9A 4RHXA 1I0IA 1CU1A 1VYUA 4BQQA 4MUIA 4EHBA 1YS4A 4DMRA 4NMXB 3B1YA 4K2AA 2AF4C 1WBDA 1NASA 1IBKB 3HTXA 1CP3A 2ZRKA 3ZV4A 2R00C 5EUCA 1GKUB 2PBFA 1Q0PA 5KVSA 1XJWA 3OH8A 3OZUA 4P4UA 4ZHQF 3NV7A 2XUHA 1PGQA 3TVDA 5IT0A 3QITA 3F8SA 4RULA 4OU4A 4P7KA 5TRTA 2OB1A 4D9CA 2JJ2A 4HGNA 4UUAA 1YL6A 3EGOA 4J07A 4XD7D 1XWIA 3I23A 3PITA 4L75A 1ZRHA 1JQLB 3AVOA 5DNWA 2Z2YA 5F3RA 2HHCA 1ZK4A 3T15A 1T34A 2P3QA 3FDFA 1GAEO 2HTFA 1N2XA 4MQ4A 1NHWA 1U4NA 2V6JA 3RSOA 1KWKA 3DFIA 2CB0A 1N0IA 4RK5A 1ONSA 4MRVA 2R97A 1ZDMA 3PHHA 1WCIB 5F7XA 2VSOA 3W2TA 2DX7A 3TK1A 1SUPA 1TAQA 4RPKA 4Y1FA 5P8WA 2PR2A 2GHIA 5LKAA 1BEZA 1SY7A 1DJOA 2X0KA 4Q66C 3H1TA 1L1FA 4MHTA 4ABTA 2V0NA 2XMRA 1OX4B 1V3UA 2P4SA 2C0PA 2O6LA 1DQPA 2WTBA 2OM6A 3P8ZA 3IQEA 4UHJA 3ZE6A 1CJMA 3KR0A 3ZU2A 3CF6R 3MCWA 4EB6B 5JTTA 3MWJA 1AHIA 4IEIA 1J8DA 1ONNA 4YJHB 1L3CA 1KGDA 3INTA 5K45A 1GL6A 3QKSA 2ALJA 3FTPA 5FIUA 1ELOA 3N76A 4PGGA 3UT5B 2E55A 2PXXA 2VKTA 4MCJA 2ORVA 4MR9B 1HFKA 2VNKA 3FZEA 3HU5A 4NJEA 3L46A 5AW0A 4DABA 3BCUA 3EXAA 3N28A 4KVZA 4XWGA 3UK2A 4B3IA 3K71B 1MO5A 2IY9A 4N39A 4BVKA 2JNWA 3ILYA 4LYFA 4QM7A 2JVJA 1VRCA 3GQVA 3FDZB 3BULA 2YW2A 1N2OA 4WKGA 3TCXB 4QEZA 4AWXA 1RLMA 1YOVA 4GLLA 1ADYA 1XRRA 4LS3A 4RHYA 1PUJA 1SQGA 2XLCA 3FI0A 3RG8A 3EMKA 3VNSA 5AJWA 1WDMA 2M1XA 3U4DA 3B6IA 2IYYA 3LYHA 4KNVA 2QGNA 3PC8A 1M54A 5IVKA 4GGPA 3WWZA 2ZVDA 3ANSA 1AGNA 4OV6B 2QTMA 4Y2YA 5C4IA 5K8UA 3WAGA 1Z5VA 1K92A 1JSXA 2BH9A 1A9RA 5EXDA 2AKYA 3IIKA 3MELA 3BRSA 4L85A 5CHYA 2H5JA 3WIEA 4BNXA 4MKXA 4C1NA 4DDVA 2LUOA 4URUR 5JO0A 3P26A 3MCZA 3NS7A 2WFZA 4ZU1X 5FULA 1M76A 1M8KA 2BTOA 5B55A 4LX8A 1YRYE 5CB4B 3GBPA 3FUUA 3HB5X 2PH3A 1ATIA 2Z8XA 5B3LA 4CF3A 1AXRA 3MAGA 1CUJA 1OTXA 3FD8A 4OOEA 1MFZA 4EO7A 4QDJA 3N70A 4P4GA 2J0VA 3DLCA 5H80A 1PTJA 4C1BA 1D9XA 1VA5A 2PQ6A 1Z0AA 2PZBA 4YQZA 1RZ3A 1TQHA 4I14A 4Z3KA 3UGQA 3VDRA 3PNVA 1WV0A 3ED1A 3TUJC 4AZ0B 4TMKA 2RE8A 1NJGA 3GGOA 1CUFA 4FFRA 4JN6B 1FS5A 1AKRA 4O4JA 5BNIA 3HCEA 4AF8A 4BB9A 3NT2A 521PA 4BB6A 4Z5XA 2I7XA 3O6VA 5BNZA 4C4XA 2YZKA 4J4BA 2YMMA 2P1DA 4RK1A 1MRSA 1EBBA 3BSWA 4YCJA 4AX4A 3GGDA 4EHJA 2AUNA 3ET5A 3K2BA 3OQPA 3UJ7A 1B8OA 1XMJA 2LKCA 4Z1MD 5KX5F 5I7SA 2F17A 3W8DA 4ZTZB 3N86A 1WP4A 2Z8YM 2IOHA 2XJ9A 1CQJA 3E27A 3PHBE 3FNGA 1Q92A 3QPDA 3PWKA 5LIPA 1R1DA 2DKOA 3AXSA 1J23A 2QD4A 4O2AA 1L4FA 4PAQA 1LX6A 1UPCA 1CR4A 1X1BA 2FPLA 3HKCB 1C9MA 4JBNA 3SNKA 3TG8A 1P9LA 1XTBA 1NG9A 4RNCA 1O95A 4GMFA 1IN4A 4LISA 1V1RB 4Q93A 3HUUA 3ICCA 5EXPA 4E3WA 3ZE9A 3MZ0A 1DLJA 1AHPA 2DG2A 2IYOA 2OSBA 2GEFA 1VB3A 1MD9A 3G0CA 4DMGA 2W6JD 4DLYA 2YW9A 1PJ8A 1Q44A 3LXMA 1JDPA 3N8IA 1TVKA 4M9XA 4R0VA 4R51A 3SZOA 5BSEA 2O8FB 4TTQA 4DCOA 1FRQA 4FJ0A 3A4YA 1R5BA 4HWKA 2YWEA 4TSRA 5JFOA 4LXIA 1RHMA 3FUWA 4L28A 3W4IA 1F5NA 1DAMA 3ADPA 3BA1A 2QN9A 1JEEA 2CNKA 3KAPA 4I55F 5TQVA 1I6WA 3JVUA 4AN0A 5FWNA 2VP4A 3TWOA 4W4TA 5CW2A 3UJNA 1DUSA 3L6DA 2BKEA 3KOZA 3E15A 4LGMA 2IX9A 3O90A 3D1LA 1IWPB 3K8QA 3BCHA 3WQQA 2X0JA 2QL9A 5FFNA 5CG1A 1DFGA 2D1SA 3RUCA 3PQ8A 3HGMA 3QVTA 3QLEA 1YS1X 3KSMA 1DFIA 2MSDB 4CMGA 2DERA 1TOAA 4NAVA 3U4CA 4EECA 1NVEA 1HDIA 2EZ8A 2VPIA 3LRTA 4MS3B 4AXXA 4BHTA 3AEKB 1M2OA 4YR7A 3ESRA 1UWVA 1JS1X 3ZI7A 4YAIA 5M5BA 1VSBA 1Q0HA 1UPBA 2XVZA 3RYHA 2AKEA 1U8EA 3WWEA 3NPAA 2Q5JA 2IZ6A 2QVYX 1XWWA 5FBQB 4YDRA 1FDUA 2Y67A 5L53A 4YAKA 1W9MA 1OZGA 3IOMA 3SC2A 2F1IA 4I4TA 3GA7A 1R15A 4HDQB 3SMQA 7AT1A 1AA6A 2RHTA 3A9WA 3OM0A 4MVJE 2Z08A 5A2GA 2F4VB 2IDMA 4NQRA 4UCQA 4GMXA 4M76B 1HF3A 3ZLUA 1CEEA 1XZKA 1H9BA 4P3XA 4TTJA 1WSDA 4GS5A 3UYLA 3W6PA 1ODIA 1QS0B 1NN3A 3FSGA 3GHYA 3ZWVA 2GA9A 2QUAA 4M0MA 2MU1A 3VV3A 3NCHA 1ZD5A 1E32A 1LJUA 2VHWA 1SKUA 1KZHA 5CBPB 3A26A 1ULZA 2CLHB 1PEAA 5DBIA 5DHPA 4KIFA 2IPXA 3S2FA 4PX2A 1FMTA 5EVCA 1GVHA 1V7CA 1DO8A 3TL3A 3TZ6A 1N6LA 4TKMA 3NC1C 3ROPA 4FYMA 1IHDA 4OIFA 4B33A 2ZT7A 3AYXB 4WNCA 5BOVA 3N2EA 1BNCA 2PMBA 2WTEA 4MO9A 5GJBA 2OP0A 3IURA 1WDTA 2WHXA 4O08A 2FN4A 2WJ3A 3ESCA 1D5CA 3LY8A 1Z0DA 3LQ2A 3WDSA 9GPBA 5DPMA 3WYEA 1ICIA 2YYAA 2I1LA 3HKBB 4NULA 3TYXA 3ZNNA 2VHQA 4CGYA 2PX3A 2QQ5A 5JS2A 4KR7A 3OUZA 4FC7A 1L4HA 3IUNA 4QQKA 4GWLA 2IOFK 5E1OA 5ICSA 3IQZA 5FA6A 1D1PA 1JAZA 1ML3A 1CDDA 1ZD4A 2FUCA 1WKCA 1JSRA 3H0KA 3PRHA 1S3GA 3DVLA 2XUQA 2ZYGA 3A32A 2BZ0A 3GLTA 3IMGA 3QMVA 3BK7A 5B3JA 4B87A 2IXFA 1WKVA 3OFND 1OQAA 4HXFB 1UKYA 4WLNA 2H2AA 1A5BB 3KIPA 3M6AA 4MR7B 4J0KA 4AIRA 1S1CA 2CYAA 4N7BA 2XVYA 5TF0A 4M8NE 1LBQA 3F67A 3UJ8A 4P84A 4LYEA 2FDCA 2QM7A 4MAMA 3Q7TA 1V47A 3AHCA 2HU7A 5F5XA 3DO6A 1DQNA 2GPYA 4Y2TA 1RE0A 3A70A 2W0SA 4QUEA 4Y0AA 5EWMB 5TQ2B 3OCXA 4Y9RA 5JXGA 1YL7A 2Y99A 1UM9B 2GLUA