3IP7A

Structure of atu2422-gaba receptor in complex with valine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
348
structure length
348
Chain Sequence
MDVVIAVGAPLTGPNAAFGAQIQKGAEQAAKDINAAGGINGEQIKIVLGDDVSDPKQGISVANKFVADGVKFVVGHFNSGVSIPASEVYAENGILEITPAATNPVFTERGLWNTFRTCGRDDQQGGIAGKYLADHFKDAKVAIIHDKTPYGQGLADETKKAANAAGVTEVMYEGVNVGDKDFSALISKMKEAGVSIIYWGGLHTEAGLIIRQAADQGLKAKLVSGDGIVSNELASIAGDAVEGTLNTFGPDPTLRPENKELVEKFKAAGFNPEAYTLYSYAAMQAIAGAAKAAGSVEPEKVAEALKKGSFPTALGEISFDEKGDPKLPGYVMYEWKKGPDGKFTYIQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter, substrate binding protein (Amino acid)
publication title A conserved mechanism of GABA binding and antagonism is revealed by structure-function analysis of the periplasmic binding protein Atu2422 in Agrobacterium tumefaciens.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 137
structure length 348
sequence length 348
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ip7A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ip7A01
4WUTA 5B3JA 3RH0A 4H3KB 3Q7SA 4RY8A 5TQ0B 2PL9A 3KS9A 4ML3A 5FWXA 4OBBA 4RZSA 4TMYA 3H75A 4YS6A 5IC5A 5FWXB 3JVIA 3CU5A 2FN9A 3LTEA 2WB4A 3H6GA 3ILHA 4L4UA 1YS6A 4O1HA 1S8NA 3OLVA 3RVQA 4F8JA 1URPA 1F4VA 4EVSA 2F8SA 4N0QA 3DGEC 1SD5A 1FFWA 4RV5A 1JL3A 3M9XA 2FKAA 2DRIA 4F3TA 3CZ5A 2ID7A 2WMYA 1U2PA 1QQAA 4OLAA 4EGSA 4EUKA 3FGZA 3Q7RA 1JYFA 1ZITA 4TN5A 1APBA 3N75A 1PHRA 4Y9TA 2I6FA 2CHEA 3JVDA 1GCAA 3JTEA 5EWJA 3Q41A 5JS2A 5IEJA 1QPZA 1ZHHA 2JVKA 5EWJB 3RVSA 4E7PA 2VYCA 4RSMA 4TLLB 2ZWMA 1ZVVA 1YS7A 1ZH2A 1HEYA 3O21A 4Q6WA 2HQBA 3QLUA 5IEBA 3ROTA 5TE9A 1USKA 5D2CA 5HKOA 3N0WA 4G0OA 5GQSA 3OQNA 3LUHA 3FMVA 3LFTA 3HDGA 1D2AA 4EYKA 5JNSA 1Z17A 1JF8A 4MPTA 1MVOA 4PEVA 3GBPA 3SM9A 1D1PA 2GI4A 4WWHA 4ZYLA 5KWSA 4MS3B 1KRXA 4MQFA 1W25A 2IPLA 3EQZA 4XASA 5JS1A 4MQFB 3C3MA 3D02A 4ETNA 1JFVA 3OM0A 3SQNA 1RXEA 1VLZA 4S05A 3SY8A 4E7OA 4W5TA 3IP7A 4GNRA 8ABPA 4B09A 4CBVA 3C3KA 4P1ZA 3HEBA 1C0EA 4YP9A 1K68A 3H1FA 1XHFA 1LK0A 3L49A 1MIHA 1JYEA 4MLCA 1NXVA 3RVJA 3HSYA 5EWMB 5JNVA 3GT7A 3O75A 4KPYA 1RNLA 1T34A 5GOTA 4RXTA 1TJYA 2E4VA 1OXBB 4ZPJA 2GBPA 3Q7TA 1L5YA 1NXXA 3RVNA 1JFTA 4W5NA 4EYOA 2FQWA 3RVOA 4HYEA 4RK1A 1ZGGA 1QO0D 3H5WA 2QSJA 1EWKA 1Z26A 3LUKA 1DCKA 1KGSA 3DBIA 2Q5CA 3KJXA 4RU1A 4XAQA 3B2NA 3CHYA 2FMIA 4MS4A 4D74A 3P9YA 2QXYA 2PUFA 1QO0A 1DCMA 4Z99A 2R4QA 1QMPA 2GKGA 1ZGZA 3I09A 1FSPA 1SXGA 4MLDA 3VNAA 3LUCA 4GPAA 1U04A 5JNUA 3O1IC 2VK2A 3UKJA 2YHAA 3O2JA 4PICA 2E4XA 3LUGA 4O1IA 4QYWA 3SAJA 3H5TA 1DZ3A 2JBAA 4KV7A 2IPMA 4RK5A 1P8AA 1DCFA 1DC7A 1DG9A 5CNJA 1GUDA 4JOQA 3MQ4A 1F51E 3O1HB 1E6LA 2LIVA 1A2OA 2V0NA 1AB6A 3IPAA 4QICA 1P2FA 1UDRA 4OLBA 4YRZA 4ETMA 4JB2A 4JAVC 3O1JC 3S99A 5HQJA 4N41A 4ZMRA 5ED4A 3RVPA 3QLTA 4MR9A 4FB4A 4HNSA 4MR9B 1E2BA 5DGCA 4YR7A 1OXKB 4ETIA 2BGGA 3QELA 3JPWA 5IBQA 5TPZA 1WETA 2FEKA 2B4AA 2ID9A 3QELB 5IUKC 1FQWA 2B1JA 2JVJA 3H5VA 2HSGA 1M5UA 1Z16A 5CNKA 1IIBA 3C97A 3LUAA 4YCSA 1JLKA 1DBQA 4WZZA 7ABPA 2FQXA 1PEAA 4RDCA 1A0OA 1NTRA 1TVMA 1BVHA 2QR3A 2LBPA 2FN8A 2GX6A 3NNSA 4Z4GA 4F06A 5JNWA 2FXIA 1VPWA 4EVRA 2J48A 1PNRA 1RXIA 2QVCA 1KRWA 2R47A 4LRQA 3Q15C 4NQRA 2GWRA 2YHBA 3OMXA 2AYZA 1Z2EA 2L2QA 3QEMA 3LKBA 3OMWA 4RY9A 5FBHA 3OM1A 3OO1A 1D4ZA 4OTZA 5B3JC 3OQOA 1DBWA 2FMKA 1DP4A 1SXIA 1Z15A 3HUUA 4RK6A 4G0QA 3HJFA 1GLGA 1BAPA 2HQOA 4YO7A 3CLKA 2RDMA 4KVFA 5DLEA 2NT4A 3T95A 4NCAA 6ABPA 4FE4A 1EWTA 3QLVA 1M2EA 3K4HA 3MM4A 1YIOA 4P98A 1R8JA 4N76A 4Z9BA 1PEYA 2E4ZA 4S04A 3GV0A 1GUBA 3L6UA 5DKFA 3HCWA 1QKKA 3O2SB 3CG4A 2IKSA 3F73A 3NHMA 3QX9A 2H3HA 4HNQA 3H5OA 5TQ2A 3O74A 3RVKA 2PAFA 3EAFA 2MYUA 1CHNA 5TQ2B 5BRJA 2CD7A 3KYJB 3T38A 2HPHA 3GYBA 3OLZA 1EHCA 2R48A 3EGCA 2HJ9A 3E61A 4NV3A 3EULA 4DQDA 2PJUA 1USIA 3KLOA 2E4YA 3A10A 1FFGA 1Z18A 2M1ZA 4G86A 2CHFA 4M88A 2P4UA 3HM9A 5CHYA 1NXPA 1ZN2A 2NZUG 3QLUC 2FMHA 3A3KA 3H5LA 2PUDA 3GA5A 2E4UA 4JB0A 1JDNA 1NY5A 1LBIA 3I45A 3R0JA 4LE2A 5C5CA 9ABPA 3HXMA 1ZY2A 4RS3A 2PMCA 5FWYA 3F6PA 1DRKA 5FWYB 4YGXB 2PKXA 3HVRA 4LDAA 2PUAA 4Z4HA 2IYNA 2RJNA 4D6YA 2IPAB 5F64A 3KTOA 1Y1LA 3H6HA 1USGA 1EWVA 3HZHA 4EY3A 4PZ0A 4MS4B 3IP9A 2WRZA 3N0XA 3M9WA 3TMYA 3UUGA 4MR8A 3BREA 4Z4EA 3N53A 3T8YA 1E6KA 1Z13A 4MS1A 1BDJA 1JBEA 4MR8B 4MR7A 1P6QA 3G85A 2RGYA 2P9HA 1VRVA 4MR7B 1U8TA 2WWVD 2FW0A 2A9QA 1NXWA 3N0RA 4RKRA 2OQRA 1XWWA 2JK1A 2PUEA 4Q6BA 4F11A 3KCNA 2FEWB 2ZAYA 1CEYA 4KK3A 3GWGA 3LUDA 2NT3A 2QVGA 4G0YA 3CRNA 2PLNA 4ZJPA 5T7BA 2JBAB 3Q9SA 3KYIB 1NXOA 3C3WA 3O2QB 2L18A 1D1QA 3KG2A 1P6UA 4KREA 3OLXA 2FLKA 4NICA 1BA2A 4N0PA 4LZLA 2PE5A 2A9PA 3MF4A 3A0RB 4OATA 5KQLA 4Z4IA 1JWLA 4WT7A 4MYRA 3IP5A 1JH9A 1FFSA 2E4WA 5TPZD 3I5AA 1TM2A 3KHTA 3CKMA 1Z2DA 5DCLA 1DJMA 3CS3A 4KZKA 1SXHA 3T6KA 2AYXA 2WJWA 5EWLA 1RPJA 4O5AA 1NATA 3RVMA 3ILYA 2FSPA 3RVRA 4QPJC 5TPWA 2NZVG 4FE7A 4WXEA 4MGEA 3CG0A 1MB0A 2QV0A 5C5EA 2FMFA 4LE0A 3NNDA 3GBVA 3TO5A 3CTPA 3JPYA 5BQ3A 3EQ2A 3HK2A 1LJLA 5TQ0A 1YTUA 4IF4A 4IMIB 5PNTA 4TLMB 4EYGA 2WY2D 2R25B 5BRAA 1QNLA 4IILA 2QW1A 3LUFA 4IMJB 2MYPA 3M6MD 2F8TA 4N03A 3QEMB 2MSKA 3HS3A 5KQPA 1TLFA 4W5OA 4DADA 2PUCA 4IRXA 4WXMA 2JB9A 3HO1A 5TQJA 5HSGA 4KMRA 3RVLA 3KKEA 4MAAA 5KI6A 3FFTA 1VKRA 5FBKA 4XXHA 3VNBA 2JVIA 4Z4FA 3LMKA 2XDYA 2FEPA 1NXSA 4OG2A 1U0SY 1JHZA 3SNKA 4G0MA 1W9HA 3H5IA 3N8IA 2A9RA 4N47A 1GCGA 4G0XA 2VUHB 1MB3A 2MYNA 1YMVA 4G97A 4H60A 5IUNC 3IP6A 1NXTA 1RZRD 1XHEA 1YK0A 5BR1A 1B00A 3OO0A 1KMIY 1JDPA 3MA0A 5KC9A 3N6VA 1D5WA 1LJUA 1ZAYA 4XLTA 1RZRA 4F12A 4RY0A 2O20A 2H0AA 5KQMA 2WJAA 3GL9A 4Z4CA 3H1GA 4L85A 4KRFA 3F7NA 1M5TA 3LUJA 3OQMA 4JASB 1ABEA 3D8UA 3QEKA 3E3MA 3MYYA 1QP7A 3QLVC 3URMA 3OLWA 4RK0A 1U2QA 2CWDA 1DC8A 5KC8A 1C4WA 2LUOA 3BRSA 3LKVA 2N9UA 4MS3A 2VUIB 4KFCA 2JRLA 3A0UA 2TMYA 2LP4Y 3W9SA 4EYQA 1QP4A 4Z9AA 4RXUA 3CZCA 4Z0NA 2IDMA 5IUJC 1H9CA 5I4CA 2M98A 3IPCA 5ABPA 2X7XA 1YK1A 1LBHA 1BDIA 3G1WA 2PL1A 4KQCA 1JX6A 1A04A 1E6MA 1AB5A 4RXMA 4D6XA 3MIZA 4ZMSA 4LE1A 5EWMA 2L19A 4YWHA 3HV2A 4W5RA 5HM6A 3I42A 3HUTA 4XARA 3RQIA 1BDHA 5KQGA 4W5QA 3LOPA 2W42A 4Q7EA 1L5ZA 3K9CA 4RWEA 4MS1B 1I3CA 2KYRA 2PUBA 1ISSA 3SG0A 4LDZA 1CYEA 2QZJA 3DZDA 4KNYA 2FVYA 2PUGA 5IX8A 1J56A 2MSWA 3FFXA 4MRMA 1ZESA 5E3JA 4DN6A 5JNTA 1QP0A 3DLBA 3EDCA 1PUXA 3HDVA 3IDOA 3NNNA 4MRMB 2OENG 5CNIA 4NCBA 1ZDMA 4JP1A 3KSMA 5JNRA 3JY6A 5CNMA 3F6CA 3EJWA 3NBMA 4PE5B 4KK4A 3NHZA 4RK7A 2RJOA 5T3YA 1YMUA 3JS5A 2FLWA 1EAYA 3GRCA 3ROFA 1JFSA 3C6QA 4G0ZA 4G0PA 2MSLA 1Z25A 3TD9A 5DTEA 2QU7A 1DBPA 1MAVA 4YLEA 1SRRA 4HNRA 1Z12A 3TB6A 3FFWA 4UHJA 2FQYA 4YV7A 4UHKA 3QK7A 1K66A 3TX6A 3EODA 1ZH4A 4H3HB 3QX8A 2IOYA 2L17A 5EWLB 4QYMA 4KQ9A 2HQRA 4MQEA 1YVUA 3UK0A 3CFYA 1M2FA 5TPWB 3DLHA 3BBLA 3FDFA 4MQEB 5IULC 4PYRA 1EFAA 4LX8A 2JCGA 2FTKE 3KLNA 4RKQA 1ISRA 4EVQA 3CNBA 4JA2A 1TMYA 3BRQA 4XFKA 1PNTA 3BILA 2LPMA 2NUBA 3H1EA 1QQBA 1ABFA 1DRJA 4IGAA 4RK4A 2A9OA 3DGFC 2IPNA 3MMNA 6CHYA 2MYTA 3OLYA
chains in the Genus database with same CATH superfamily
4L8VA 1H1DA 3LIIA 1YHYA 1F1BA 5LWQA 4RZSA 1Q7GA 4L08A 4WCVA 5IC5A 4LMAA 4F2PA 4OJNA 4NZZA 1JA1A 4UEQA 1NYQA 2BV3A 3A9SA 3MT0A 2WT8A 3TZLA 2JAXA 4L4UA 2C7VA 2C1XA 5F2EA 3SP1A 5KTTA 1Y34E 1SFRA 1YI8A 2VYVA 1BWSA 1BO6A 1DAMA 4IHJB 1UDWA 4EH1A 4QYXA 2Q9UA 3T7CA 4GRAA 4R2JA 2CT8A 4ZO7A 3ABQB 2NUTB 3DP9A 1SN7A 1R9MA 3IV9A 4HDRA 3WMRA 1FTGA 4EECA 4ZI7A 4R3UC 4F3TA 3WI7A 1JAIA 3CPHA 4ZTZB 4BFXA 1THTA 1U2PA 2C92A 3R0VA 3EC2A 3ZU3A 4OLAA 4UUMA 3OE7A 4MUHA 2CCGA 3VPAA 4YRIA 5D3QA 1ISIA 5HUJA 4DR5B 1OBFO 1GZHB 3I9FA 3O0TA 4HH4A 5K45A 2B5WA 4N3AA 3ZV5A 4OSEA 5DI9A 4OI1A 1ZYUA 2BPOA 4BMPB 3EY9A 4ITVA 2R1TA 1T5BA 3K0HA 3TCXB 3LBHA 3UOAB 3ZHOA 1V6AA 4HDCA 4REQA 2JFBA 2H1WA 4U8GA 3NV7A 4RESA 4BKPA 3NV9A 2O6LA 4LRSB 3IVAA 4MRNA 1KOJA 3T94A 4KCGA 2W90A 3OTIA 1KU0A 1QCDA 1ZG3A 3IKMB 4DNPA 1XZQA 2CZQA 5J1TB 1EI9A 1KKLA 1PJBA 3NRBA 1AXGA 4M7WA 4MCIA 3JALA 2G6BA 4GLBA 5BYBA 2P9GA 3NTQA 3S5JA 1ZHFA 4UAUA 4XX0A 3O9MA 1MG0A 4UXJA 3TN7A 2I7VA 1UT6A 1YNSA 3CUTA 3G5MA 4Z54A 2UVPB 1KI3A 5C2JB 2BR4A 4OKIA 2FV8A 4FGKA 4IH4A 2WAOA 3D31A 3U4DA 2JATA 3PHCA 3ADKA 1KA9H 3ANSA 1TYBE 4MS3B 3TGPA 1CHDA 3W4JA 4ZHQA 2Z30A 4PYMA 4U7HA 1E69A 2VG8A 4C0JA 3OM0A 3C2QA 1NSFA 1TYAE 2YJGA 3Q1LA 5FB3A 1JHYA 2HF9A 5HCIA 5M04A 2Y1CA 2F4NA 1PR0A 1E0AA 2R7LA 3HFGA 4LRWA 1S2DA 2HTEA 1XZKA 1JV2B 3GRYA 3FYDA 3PUKA 4LXHA 5CTJA 3IKVA 3AVOA 2I67A 1E9CA 3NHWA 3QU9A 4J7XA 4DJEC 1ZQ1A 2OCPA 5H83A 2I2DA 3C7DB 3U9LA 2ZIXA 4G5QA 2ZSFA 5G41A 4BV2A 4C0HA 2XY4A 3NIBA 3MMXA 5ENVA 4G9GA 3V4ZA 4CT0A 1NFQA 3JZMA 3D4NA 4LZZA 5CDHA 2ZYAA 2ODAA 1WCYA 4JI6B 1GL7A 2HBQA 4MB0A 5K0TA 3UXMA 5B1EA 1UBMS 3BIXA 4UTNA 1F6DA 1UMDA 4KDCA 4D57A 1G2PA 1PW5A 2FUG1 5CT5A 3Q7EA 1T6NA 4UEJA 3VYUB 1OASA 4RF4A 1CRZA 3DONA 4ZMBA 1XU4A 3OZUA 4CCSA 3VKHA 2IK8A 3C8MA 3M49A 5C35A 2JGKA 4TTPA 4NU0A 3C6YA 1WZEA 1T1JA 1NIPA 3A6FA 2ZBDA 2CL7X 4R84A 2H1IA 4ZPXA 3VNAA 3OTWA 1MUUA 3K0AB 2PX4A 3MJHA 2ZUTA 1E58A 4YJ2B 5DIZA 1Y4DE 1V6SA 4CLHA 4MVWA 1A7AA 3D9QX 2H7CA 1JEYB 3G8DA 1MT3A 4OREX 3ML1A 2YFKA 2Z1DA 4U02A 4NX2A 4UNQA 3ZVNA 1DQSA 2IZ7A 3ACCA 2J8ZA 4PYKA 2DAPA 4RA9B 3S4YA 4DYDA 2IPMA 2XKAA 1P17A 2ZJZA 1X7WB 4ZQIA 5IM4A 1ISMA 4BB0A 2ZW9A 1ZK3A 4HF7A 4JOQA 4Z2AA 5T4FA 3UHFA 1O4WA 1QYRA 2QRVB 2QRLA 4W5WA 1Z2PX 2HBZA 4N82A 2CKMA 2YWDA 3K8QA 3S55A 1V7CA 4D9NA 3BE5A 5BSHA 1RZUA 1W5AA 4Y1RA 4EGCB 2FU5C 4UPEA 5BSGA 3I61A 3SJZA 3CLTD 3QWAA 1X80A 5AOCA 4DSZA 2UXDB 1FVHA 1PCXA 3D0KA 4U2KA 1ZU4A 3BD6A 3L8GA 1QFXA 3AQIA 5LQKA 1QVVA 3EIFA 3V48A 4BLWA 1WETA 4NAHA 2B4AA 5EVJA 3FCUB 4BFLA 5ITZA 2RK4A 4LGMA 3WOHA 1LVGA 2ZRFA 1JMYA 1M5UA 1CERA 2Y27A 3M1AA 1CJMA 2OBXA 2EWMA 3R8XA 5LCXA 4WJZA 5AJYA 3SJCA 1C4OA 5LM3A 2L69A 2F3QA 1Y82A 1NVTA 5T8KC 1Z39A 3M6UA 3RAJA 3W2HA 4BJHB 4O2LA 2ZPAA 2Z08A 2E21A 3RBAA 4X7MA 1DBSA 3MOIA 4PVCA 4ID3A 1U8ZA 4YLGA 2JW5A 2BHTA 2BM1A 4DA7A 4M55A 3QEMA 4FLEA 4XVQA 3HEAA 3W1EA 4AJNA 1J25A 3SE7A 1VLQA 1NBEA 3NOVA 4QDXA 4Y6LA 3A6JA 1TU0A 2NUAA 2ORIA 1DBWA 4FQ8A 1ETUA 3ESYA 4BKMA 5B7QA 3QEJA 3S44A 5KDDA 4DLKA 2VRWA 3EZFA 2RDMA 4U2DA 2Q2WA 3T95A 3SZRA 3UJ7A 2NQTA 4KYIB 3MM4A 1F3OA 3OBBA 4CM3A 1CQJA 1NI4B 1VG8A 3EB9A 2E4ZA 2WOOA 4U00A 2D2IA 1C9NA 4LBWA 4NBNA 3GV0A 1LPOA 2ERYA 1E3JA 1RABA 3JTMA 4S12A 4XJXA 1PDOA 1E2HA 2CFTA 2VZ8A 3SSMA 4QAJA 5FI5A 1J8YF 2QUAA 4A0SA 5K7SA 1R9GA 3G2MA 2FF5A 4REMA 1UBCA 3D4BA 4YJGB 2YYSA 3H5OA 5A04A 1FTQA 1XP5A 3HGTA 1F4PA 4MDEA 4N49A 1PGNA 1DWUA 4N5LA 2K5UA 2Z2XA 1HH4A 3OFVA 2X8WA 3IRUA 5L53A 2DBRA 2C5SA 2HPHA 2IKQA 4Z0TA 1YQWA 1RM3A 3COYA 1U99A 4MW4A 3KXPA 5KTSA 2LXNA 1DKQA 3K8YA 4IFBA 3LYLA 4RKWA 3DAPA 5EAIA 5D1HA 4UTZA 3C7CB 1JLMA 1RDFA 1NMXA 2E1PA 3R4CA 2PWBA 4IGEA 4LXQA 3ZY4A 5JISA 1FLNA 1UBFA 4JQOA 5ED0A 2XUQA 1B15A 1X94A 5LYJA 3UTCA 2NUPA 3R0JA 4P4LA 4O08A 1S2IA 2EL7A 1KZGB 3GVXA 4WLOA 5KAMA 3RD5A 4MV3A 2GT1A 3HU3A 2IY7A 2RI6A 2WF8A 4WNAA 1TCAA 3WJ1A 2RKOA 1H8EA 2YFQA 3FNFA 5ULLA 2YNMD 2ENUA 1KZYC 1FDOA 3I30X 5BW8A 3ZIDA 2IPAB 5AVVA 2A1TS 3NHUA 4G1EB 4RH3A 5DU2A 3ZHUA 5C8YF 1GJRA 3AFMA 1U0BB 4J4HA 2O7QA 3D6FA 3U17A 1I32A 1RYEA 4JP2A 1NW3A 2JGDA 4PO8A 4ZQCB 3T8YA 4LRTB 1M2HA 3SS9X 4MR7A 3WNQA 5JC1A 1Q92A 2EV9A 3EWSA 2Q9AA 2CDNA 4LQ4A 1VRVA 2R5NA 2ES4A 2Z4TA 4BE9A 4PHGA 2CLIB 3SC3A 2FDCA 3A2LA 1WW8A 4EEZA 1IK6A 1Z47A 3TLBA 4BB9A 2J0QA 1E60A 3IHTA 1ITZA 3ZQ6A 3DKKA 3STHA 5JD6A 2B98A 2UZ1B 2J3EA 3FPCA 4G5RA 3TL2A 3W5VA 3EZGA 1LWNA 1SVSA 2G7ZA 4KFUA 1QSGA 3ZW8A 3VVMA 4YCNA 5AHRA 3OQ1A 4TKUA 4J0HA 4JOCA 4Q0MA 4XZ3A 3S70A 1VL2A 1BA2A 1YQ9A 2PE5A 1GHTA 5LA6F 5FP0A 1NC1A 4KTVE 1RP7A 1QLHA 1P2VA 5EUMA 2R751 3JU3A 5AI9A 5FHQA 4D8XA 3HBMA 2OHIA 1L1QA 1IOLA 4MYRA 4GZ3A 3CLUD 2IC5A 1WQ1R 2C4NA 4EELA 1O0BA 2E4WA 4YQYA 1TM2A 2BGIA 3C43A 3GNLA 4Y2RA 4MHSA 4JI5B 3ZX5A 1YBFA 3BJRA 2FWBA 1W2GA 3NDIA 2Q99A 2DQKA 2XSZA 3HVIA 3WBFA 2IEGA 2EZ9A 2ZT6A 2QTGA 5HMLA 3GJTA 4EJFA 3GLTA 3H2KA 4EZIA 1AKWA 1JE0A 2H5IA 1GTVA 3UK7A 2RIPA 3FG9A 1WZUA 3NJ4A 4QAQA 4WXEA 3DR3A 4JBWA 2C29D 3N74A 3OPNA 4IX9A 3UICA 1C9YA 1MO6A 3KYCA 4L02A 2IEYA 5AI5A 3QI7A 1N7JA 1K8QA 3UYKA 4F2DA 3VV2A 3OCXA 3KOUA 3T1HB 2PQ6A 3MPOA 3NQ41 4EUNA 3G2JA 5A3VA 5DTRA 5BPFA 4CKXA 1WPGA 1ID1A 1E9AA 3DKVA 5B2EA 1CZLA 1MA0A 4FMCB 4RACA 3MBKA 5ALYA 2FUCA 4OQQA 4LK2A 4RPJA 5FJIA 2WY2D 2WYHA 1QNLA 2B8JA 3CXRA 5TT0A 5IYZA 1ZM4A 1KHHA 3PQ7A 3RAEC 4BHTA 2MYPA 2VAPA 4HRXA 4HDNB 4UDOA 2FK8A 4WA8A 3F7MA 3BTVA 3M4XA 4IEFB 4GWKA 2AJDA 4DLUA 4IXDA 4FEYA 4K9KA 4ARUA 2XZOA 2HCFA 5L6MB 1ZW6A 3CURA 4XOUA 5DLQC 3ZV7A 4J1TA 1E1RD 1H0HA 3QRWA 1RQLA 5F3RA 3EQ8A 1AKMA 3WB0A 1XD2A 5KSWB 2PX8A 4MWEA 4RJJA 3BIJA 3OICA 3NX4A 1C9KA 4XI9A 4WACA 2H0RA 3I64A 1O97C 3NIDB 3EXEB 2PMKA 5BV7A 3K35A 1XZHA 4ZJZA 3N8IA 3AK4A 2PAAA 3E27A 3KWMA 4G97A 1R0SA 3AFOA 3AY0A 1L4NA 2FRVA 3HCNA 2IIBA 3RK1A 1FRVA 5ARBA 1AH2A 1HKHA 4D79A 4X1OA 4G5YA 4Z2YA 3LC0A 4NAVA 2O20A 1YZVA 4LY6A 1Z34A 1RVV1 4E5NA 2GUGA 5KYTA 4JQZA 4URFA 4YXWD 3W9UA 2NO4A 4O63O 4KRFA 3U39A 2IDJA 5IMSA 1I0ZA 3RFVA 1N5LA 1TF7A 4US2R 1E9FA 1X2EA 1X42A 3CX4A 4BEVA 4JB3A 4AO8A 3DHVA 2NX2A 5FULA 5BV2P 3FOZA 1XRJA 2PXAA 4YROA 3AW9A 3JVVA 1CZRA 4JXKA 4PZ9A 4CCYA 1A9QA 4N9WA 4R6WA 3WLAA 5DTMA 5FPKA 1NUQA 1VLJA 2YYZA 4KFTA 4BNVA 1HYQA 2X0FA 3OT1A 2IDMA 3PG5A 3I23A 1RYYA 1TU4A 1LEHA 2M98A 1I7NA 1F2TB 3DSRA 3I4CA 3PITA 1BE0A 2EFCB 5FQOA 5JDCC 5HZHA 4XJVA 5JZMA 2XGMA 2VTEA 5FX2A 4KRGA 1HTBA 3PVZA 3QOYA 1IOZA 3V4RA 1YA4A 2XYVA 3KB6A 4QARA 3EZ2A 1E9VA 1H4QA 4DREA 1XA3A 1I9GA 2QTTA 3NIGB 5C1IA 3W5JA 2X0RA 4BKQA 4XARA 5JCOA 1VFNA 2GR9A 2W42A 1H65A 5EIAA 3JQFC 2IXFA 2BHRA 2VI5A 4BGUA 3PHIA 5FIUA 2AW3A 4PLVA 3EMBA 1Z63A 3ZG6A 2I66A 3VR1A 5HM8A 5B2FA 1XT6A 2XCLA 3JRWA 4LSWA 2AEEA 2YIMA 4UW9A 2HMAA 3O91A 4MV7A 2G9NA 4YQZA 2G4LA 3R9IA 4RHCA 4MVYA 3ZTWA 4BDTA 3IUMA 4HAZA 2Q5IA 4KYTA 3TTTA 3UB4A 5EESA 5CT8A 2BE7A 2EJUA 3EXHB 1KF0A 1Z2CA 1E3TA 2AOVA 1YNOA 3KHUA 4G81A 1VE3A 1GRNA 1W4RA 1Q84A 5DNVA 3SZMA 1T9HA 3MRTA 4BKRA 3IQWA 2VHYA 1DZIA 4V03A 1KBQA 1HYHA 2PMWB 3HWSA 5EMLA 5IVDA 3DDWA 3I34X 3DHWC 2AEFA 3TD9A 3N7UA 3OOHA 1T8WA 3ESAA 2O0KA 3WL7A 3B20A 4JY7A 4OMCA 2WWHA 2MMCA 1LNQA 5A4AA 3RHTA 3H9JA 1DQNA 2XUKA 3GXBA 4PX2A 3ZNPA 1QAQA 2AC2A 2C59A 2HFKA 3RR2A 3THXB 3H0EA 3OMLA 4EABA 2KBFA 3BL5A 1U0GA 4XWGA 3KKZA 1HL7A 1Y5MA 1Z8DA 4CF7A 2R2AA 4Q4HA 2HQRA 2V03A 4MQEA 2BTQB 4C4OA 2YZNA 1SIBE 3WHPA 5I7VA 3S7ZA 4E2FA 3ND9A 1DVRA 4XQ9A 3L8HA 3WK8A 5A6VA 4UMEA 5TY0A 2Y99A 13PKA 3C6BA 4N6NA 4ZEWA 2ZSBA 5SZJA 1AQYA 4RK4A 1RKQA 3SQMA 3VV3A 2V8BA 1W6RA 1ZJYA 4YEDA 1N7GA 1ONNA 1UK9A 1XNJA 3CNOA 2YY5A 5G4LA 3VKWA 3A14A 3OPYB 3R3JA 4NENB 1MBZA 1KMHB 1EDDA 5I5GA 3ZJ4A 4RVNA 3G9UA 4AX4A 5HJ7A 3Q12A 4S1WA 3KS9A 3W5AA 1PTJC 1T2NA 2XJ9A 4FE3A 5LBUA 4M8SA 4I3HA 1XDDA 2X77A 4GEKA 1G6KA 4I19A 4UVHA 4BE7B 4D02A 2YHIA 2DQSA 1WUJS 4UNNA 3ZHXA 1AZWA 1R5JA 3AFIA 3D2BA 4JU8A 1RAIA 1X3LA 2ECPA 5SYNA 1VQ1A 1U0NA 2FSGA 3ECAA 4R2XA 1MNAA 1YRAA 1SD5A 3PRJA 4M3NA 4OHVA 2YRXA 1JL3A 1GGKA 3PFWO 4UAJA 1PGPA 3U37A 2FKAA 1OY1A 4BNLA 5EPUA 1TM5E 2JLXA 2PFKA 1JU9A 3QEOA 5EG5A 3NEYA 5F3DA 4DJTA 4L5CA 5EXSA 5JZOA 4AI6A 4D3XA 4RPHA 3DYBA 1W5EA 2IXBA 3DLBA 1L3IA 3BE4A 4PWYA 1YRWA 2AJLI 3OP1A 3ODPA 1DQZA 4PGMA 2WJ6A 5ALXA 3EVZA 1DKUA 5FTNA 2ZUUA 2K87A 3EF3A 3G2LA 2P27A 1X1TA 2PU5A 3PXCX 3DQQA 2LKCA 1GAXA 2HC9A 2P6RA 3BT7A 4QKQA 4KQIA 3RC9A 2C4KA 3S2ZA 4ENUA 1C81A 3JCZA 4ZOCA 4ZQHA 4JFAA 3FSRA 4KSYA 4PLZA 1ZRSA 3OOEA 2OGZA 4RGQA 3BGVA 4K40A 3OUUA 4AVYA 1BHSA 5D7NA 4CR6A 5HKKD 2PPVA 5HDQA 3PX2A 2UUOA 3WNVA 3EFOB 2C03A 2XUDA 3D4LA 2WDPA 3LUHA 4FX2A 4CMIA 3UBTA 4UD6A 5EIEA 5ER9A 1YR8A 4DW8A 3LE8A 4Q9JA 1AKYA 4V1CB 2LTAA 1YJQA 1I6MA 5BO5A 2ST1A 3NRJA 4QSHA 4HNVA 3WRYC 1KAHA 2K2WA 1M6YA 1R4AA 4AAYA 4YUAA 3LK7A 2KWIA 5EVCA 1XO1A 1ZUIA 2FUG6 3VTKA 1U8AA 1Y81A 2ZRMA 4W1SA 1W9MA 4M8KA 3GMSA 2NZJA 2RE8A 3IP7A 3S5UA 4GQIA 3R3ZA 1ZL2A 4DV6B 4KR3A 3K2BA 4LZAA 4K28A 1EU1A 1GNRA 2Q5JA 4Y9RA 1US8B 1T2FA 2VEDA 2XOKD 1Y8ZA 1O5TA 3O73A 4FZJA 4O6VA 1IXZA 4C6SA 1KKMA 2ZLBA 4DM4A 4CEIA 2Q3JA 2PD4A 1GA4A 2PJDA 3HKDA 4RD0A 1OFVA 4UVIA 1PHPA 1M67A 5FNVA 4MTLA 3LBYA 4OJMX 1T34A 3T12A 2E4VA 4JC5A 3R5TA 1UJ6A 2GBPA 3WL4A 4JWKA 1PKEA 3RS8A 3HUFA 3DFMA 3AP3A 4H7HA 1H42A 2GBIA 4NH0A 5AJHA 1L5RA 2LR0A 1O94D 2H1HA 4AIIA 2PY6A 4CEHA 3UOWA 1QONA 4HJRA 1UBJS 3OJLA 3OQHA 5H59A 4DF3A 4A9AA 1CUIA 3HKBB 2VCYA 3P9YA 3MGAA 1QO0A 1CNMA 4RTMA 4QU5A 4V3BA 1BVRA 1PL7A 5E4TA 5T4HA 3H4VA 3N7TA 1NA5A 3Q87B 1HT2E 1JR2A 3I09A 4YMIA 4TKVA 1COWA 2BCGY 2WYIA 1RWPA 2IWRA 4QDKA 4H7PA 4B84A 1J0XO 4ND1A 1Q74A 1WF6A 4EPTA 4GZ6A 2IYXA 2P3QA 1JKMA 1ZJWA 1P72A 3SU8A 1GAQA 2VK2A 3SX4A 3R7BA 1KYWA 4CU5A 5IZCC 5LOVF 3JQBA 3LCCA 2OUIA 1AXEA 3HRHA 5DYWA 1U9YA 5ALKA 2PWZA 4LZOA 2YV5A 4ZHSA 2ACVA 2GZRA 4JLDA 4OHYA 1DZ3A 3B85A 4BO1A 3R3YA 4HN9A 1P8AA 3DMHA 4BO0A 4DAEA 4JQCA 3BD9A 4NJOA 4DHWA 5JVDF 4LXGA 3L4KA 1U63A 1MP0A 2ECOA 3KCQA 4K9LA 3VYRB 3B1YA 3QVGA 2W2KA 4LSZA 4UTPA 1C7IA 4MV9A 3FUVA 4QBKA 3TKYA 4NFLA 5FI0B 1Y89A 3RC7A 2Z3ZA 4IINA 4YRZA 5LC1A 5MHTA 2X3YA 3TW8B 3C3JA 1H0SA 1R0XA 3K9WA 4H3VA 1N32B 3UXYA 3DA8A 2A0FA 3AIKA 2G4CA 3N2ZB 1N2JA 1Y7PA 2IHNA 3IV7A 4HMOA 5IKXA 3MERA 1BXRA 3ZVMA 1SIWA 3EWIA 3QNWA 4IG9A 821PA 2QVLA 4J90A 3T4EA 3BXGA 3V1LA 3QVVA 5EUQB 2NU6B 4E6EA 4LOLA 1QGED 1X9IA 3SJ7A 3K5PA 1JXOA 4AFNA 2OV8A 3OOWA 1CUJA 3DFFA 3HVJA 4GP9A 4B43A 2E82A 4X3CA 2WAXA 3QFRA 2VJMB 4PAQA 2D59A 4Y9DA 1TUGA 1RMYA 2H0QA 1TVMA 2J6HA 3T5TA 5AVZA 4B3SB 3E5MA 2VNJA 5L3QB 2I4NA 3CSUA 4D43A 1O95A 2FZ5A 2ISSD 1YO6A 5KOHB 4NQRA 4WBNF 3E7WA 4OL0A 5GM1A 4BO2A 1ATZA 4RTJA 3K70B 2I3BA 2G07A 3I3SR 3MS7A 1CS4C 3PQ6A 5A1JA 4EB6B 5J2TB 1TA0A 4DMFA 1E5TA 4GU5A 4AUNA 1R4MA 2GPJA 3E5NA 2GXUA 1SPBS 2Z2JA 4MRVA 2JIDA 4U1RA 3FA2A 5EXDA 1Q1AA 4ZVTA 1WXEA 5TGZA 3H9UA 4AY5A 3SOZA 5K8UA 3QLVA 4CM7A 5FTJA 1Z0FA 2P2LA 3PS9A 5BQOA 4B8YA 4Q24A 2DR2A 2BGLA 4X92A 3ZCVA 4BNZA 5IWAB 4G07A 4S04A 5MFPA 1JWBB 2DWPA 1QFSA 4M7RA 3K30A 4C4AA 2NTYC 2PUTA 2CL5A 2RHTA 1W8IA 4FIZA 2ZI7A 4HH3C 1IBCA 1FMLA 2P9EA 2WIAA 2OC4A 3OOYA 4PO1A 3COZA 2PRZA 3O74A 5TQ2A 3RVKA 4QJ4A 4PZDA 2C9BA 3BB3A 3NJRA 1DKNA 1KVTA 2I2CA 2OB2A 4HPJB 4TLDA 5D86A 3WL6A 1SKBA 3K20A 1KOGA 3QP9A 1LI7A 4R9VA 2V7BA 2WJGA 3TFWA 1FVXA 4IS3A 3G8BA 2AG5A 4F3NA 4QTYA 3G59A 3OQOA 1KE2A 3EA4A 3HUEA 3FF1A 3NTVA 4FD2A 4O4IA 1OXSC 2XEDA 3KJQA 4HGNA 4L4ZA 5G0UA 4BV9A 1ISPA 3R3VA 1I94B 2NXWA 2C7BA 4JEUA 2XCTB 1E3DA 2TECE 1SVIA 3NVAA 2HRZA 1UBTS 4BNTA 1NY5A 3EEBA 4ZYYA 3QWHA 2ZBVA 1S4MA 1DTWB 3PQ2A 4PZAA 2A9JA 1TOAA 5K0BA 2A7XA 2PKXA 1PBNA 3OHPA 4MCAA 4ZJUA 3OFJA 1KEEA 3K0CC 1XAIA 1ZMXA 5EQJB 2VDVE 2XT0A 3TECE 4JMPA 4KVGA 3IT3A 1KJZA 3E9MA 2XMDA 3HYNA 2X5XA 1CC1S 1QE5A 4W6ZA 5BR4A 3DH0A 3B82A 4UQLA 2X5OA 1X7XB 1RAFA 2AFHA 5ECDA 2NGRA 3ABZA 3DLAA 2WD8A 3G85A 4GEGA 3L1KA 1ZMBA 2XMPA 5NULA 3BZWA 3BD7A 2GBLA 5E4YA 2V3CC 3N0RA 2FK7A 2LNDA 1E63A 4N3NA 1Z4OA 1EEXB 2BMDA 2PBRA 4KAAA 4NQZA 4V24A 3VR4D 3G5UA 4CRWB 2W6PA 4CG3A 4DR6B 3GZNB 2H51A 4F11A 3H83A 5IT9A 1LPNA 1BE6A 1Q20A 2FEWB 2ZAYA 4E1BA 4XW2A 4Z6KA 3G88A 2JGLA 4D3FA 5F51A 4BGEA 2AKYA 5TJ9A 4J2TA 1J0AA 1Q16A 4RX1A 2I8AA 1E1KA 1QTNA 3NDRA 2R8PA 3KG2A 4L5IA 4M0CA 3SI7A 2ZG6A 4P4NA 3DL4A 3AZQA 3OZXA 4RAOA 1EPUA 1KNXA 2QJFA 4OATA 3RFCA 1AQIA 1BH2A 4NR0A 5THXA 1F4LA 1BGVA 2HEGA 4WT7A 3O4VA 5AR1A 2HMSA 1TA4A 4P58A 4V0LA 4NI5A 4C3OB 2QT9A 1DJMA 1OLUA 1UPFA 4K6GA 3Q7PA 1GUFA 4PTZA 1NPTO 4HAUA 4IOJA 3NR2A 2OV3A 2VXBA 3ASUA 4N48A 1Y5LA 2WSSD 1K3TA 1T2EA 2IYLD 5JRJA 4PN3A 1WHTA 2O8CA 1RWXA 2ECKA 3CG0A 2ENWA 1REQB 1UM8A 2I2AA 3BXHA 4H7FA 2C4VA 1WCIA 2VF7A 4KVAA 1DHTA 1N2XA 1EE2A 1L3CA 1W75A 1Y4ZA 2GPTA 2AXNA 1AS0A 4GX5A 1Q1GA 4FDMA 3TK1A 3TRIA 1J5EB 3ZH2A 1H8HA 1ZS9A 4DLLA 1LK5A 4NPHA 1E79A 1E2DA 1EFPA 3I2IA 3EIUA 3H1BA 4ZCMA 1K89A 5KAPA 3D59A 3ZWAA 1F14A 2X6TA 1T8YA 4GICA 1BJTA 1ID8A 1QRTA 4FYKA 1J90A 5SV2A 4U9HS 2R6GA 4IILA 3C3PA 4HFMA 1VPTA 4YNBA 4G5SA 2FR1A 4IMJB 5CTAA 2JJ2A 4BNDA 4HN2A 4XUGB 5BNIA 5KQPA 3P52A 2NU8B 4H4DA 3ZZMA 2OP0A 1H85A 4YFVA 3PPYA 1BDBA 2XNJA 3ZHYA 2C7RA 2XQKA 1FP1D 3IEKA 1ZSVA 2FX5A 3RVLA 1XXHB 3WWYA 1H0KA 2B3DA 1IOVA 1IUPA 5K1ZA 1MB9A 1TJ4A 1VKNA 2D2VA 3C87A 2WIDA 1TLLA 4U3JA 3K5WA 5NLLA 1IJKA 3EXFB 3RJZA 4OG2A 4F96A 1JHZA 3KAPA 4JA0A 5CCXA 2JHPA 1IMOA 3HE3A 5CDTA 3GJ5A 1ZOSA 2CLKB 2W6OA 2A9RA 4ND5A 4JP8A 4UTOA 3FMIA 3VHLB 3EZ9A 5ANRB 2ZRGA 1N0WA 1ULHA 2YQ5A 3KLBA 2O1EA 3X0DA 1FLDA 4W4TA 3GIDA 2ODBA 4CQMB 3DHNA 5LP6F 1GKKA 2RAPA 1KYZA 5GJBA 3JWHA 1QQTA 5DW3A 1Y9JA 3U19A 3SYLA 1A5BB 3DLCA 1CVIA 2QIOA 4HC4A 2ZQYA 3TSAA 4ER6A 4F12A 3GRFA 4I08A 5KQMA 4DCUA 3IR5A 3LLSA 5LQJA 4C0LA 1O1YA 4J0IA 1A98A 4KLRA 2GD2A 1V3VA 4ZZ1A 3PXUA 4WXRA 1C3XA 4B8ZA 4DMLA 2GA8A 5DK6A 5ERYA 4Y2VA 3TW6A 2CWDA 3GEPA 4TXJA 2HB6A 3DLIA 1G5HA 3PSHA 3TG2A 1WMDA 2UZ3A 3F97A 5LVAA 4WFJA 1E5XA 1M2WA 2REXB 3MQFA 4MUFA 1AZTA 4OX9B 2EGGA 2X5KO 4EYQA 2OZPA 2DHEA 2ZIWB 3GJ4A 2PQ2A 3B7WA 1GTJ1 4BCCA 4CLXA 1JHUA 1IQ0A 3WWOA 1SUAA 2YHSA 3PIRA 3WSVA 1H2FA 1LBHA 4LA4A 4NTZA 3CMCO 4XD7A 1PG5A 3CF4G 2VSNA 2BMFA 2YVUA 3W3AA 2NU9B 2YY7A 2COKA 2Q7OE 4DMGA 1ZIDA 5DDIP 3LQ1A 1AKNA 4AS2A 1P61B 1ONBA 2ONJA 3UXEA 1XMSA 4ITUA 1N5DA 1TO6A 1XVAA 4NEQA 1IEQA 1TZMA 3PL5A 3RAPR 4E4RA 3N2GA 1N8KA 1IJFA 3LXXA 4RWEA 5KREA 1J8QA 1LS1A 1A8SA 4JCCA 4D3ZA 4Z7NB 2IS1A 3QMVA 3UFXA 2P0EA 5JLAA 2B34A 1KJQA 4AN4A 2ZRBA 3B1JA 1E64A 3BXEA 5E6SB 3HJNA 1QZXA 4P8RA 4V0SA 2PSFA 5FI3A 4Z49A 2QTCA 1N2CA 4I8IA 1MOZA 5E3JA 4WFKA 4EJSA 2IHJA 2ZB3A 1V11A 4NCIA 4RPLA 3WMFA 2QM3A 2ZJBA 5IH3A 1GGHA 4M7OA 4X3PA 3TZBA 4EFNA 1LI5A 2XBUA 4O02B 4P34A 4EMSA 1UXGA 4NS1A 1DS6A 1U11A 2AC4A 3U81A 2Q1TA 1D2HA 1Q19A 4UXIA 2Y0PA 4I6EA 2XMZA 3EZ6A 2XTNA 4BQIA 1KO1A 3FOAA 5FBVB 2OHFA 4RL6A 5K8VA 2UUCB 4RDHA 4H77A 4PLWA 4XWWA 4IVRA 2AOUA 2QU7A 4J0QA 4PIPA 4BLTA 4QYIA 3SC6A 4CV0A 1J0DA 4V0ME 1EK6A 4A82A 3PNQA 3FM9A 1T26A 2QENA 2A5LA 3OOJA 1KZ1A 5HA5A 2VTBB 2CK3A 3AHCA 4ONEA 1P5ZB 1K5HA 1G17A 5C8YB 3IUNA 5F5LA 1Z4MA 3NEAA 2LGJA 3HR7A 1PU2A 1HDXA 3FTDA 5E9QA 3GLVA 4TLCA 4F8EA 1ULSA 3DCIA 3I1YA 4DB4A 3TQRA 4BZPA 3UWSA 2XWQA 2Z6VA 3OSZA 1PZXA 4JZKA 3KLNA 2VXOA 1PNTA 3VDNB 4CV3A 4MQMA 3KAQA 3I5MA 2CL6X 3FGNA 3HP1A 5THQA 1G21A 5GONA 2AOTA 5D5HA 3UA4A 4EGAA 2WQ7A 2RGRA 2QAGA 4KE6A 4WUTA 3ETEA 4XOIA 1V2HE 3DKIA 4P86A 3D6JA 5REQB 3VISA 1NVDA 2NO5A 3AHEA 4ID9A 1T2DA 1JEJA 1I5OA 4YS6A 2C57A 3AEYA 4QOFA 1A5ZA 4PWZA 3PX7A 3GLUA 4RMHA 3EXG2 4MO2A 3A4VA 2F43B 4XGKA 3VOTA 3IAAA 5DZSA 3WWDA 3DGEC 2ZCVA 2I4IA 2D2EA 3FNQA 4FFPA 4NZOA 3NCTA 5LA6B 1U7WA 5FUXA 4HZUB 3QVMA 4F5WA 2SNIE 1GUZA 3ZWDA 1B23P 4BWGA 1RHJA 3RWMB 1S8FA 2IYUA 4TMKA 5CJJA 4CLEA 4I6JA 1GFIA 1CJBA 4G63A 1YZYA 5BNZA 1MT0A 4XRRA 1OBOA 3NEPX 3LLMA 1G6Q1 5HCUA 4EUKA 3AV3A 4F4IA 5IVHA 1IXSB 2R00A 2FR8C 2VHTA 2W0SA 5EMHA 5K0LA 1PHRA 1LD3A 3CPJB 4IXWA 1E3EA 2OCKA 5UKDA 2I87A 1CS0B 1YDFA 2IYSA 4YXFA 2FN7A 2HI0A 1Y6JA 3TEFA 2HIAA 5E7IA 1SQSA 1OMOA 4UHCA 1KZ7B 1RXYA 3V1MA 2Q6TA 3OBIA 4NFHA 3WNBA 2GHTA 1FSFA 1LX6A 1ORWA 2V4ZA 3F4BA 1IPEA 3KQVA 4NP6A 3ILVA 2GYVA 4B40A 3OQIB 3OCCA 1QWSA 2ADOA 4DV4B 4NMMA 1ZD2P 5AKJA 5ELMA 3RQSA 2Q1SA 3U7IA 4S1NA 1KY4A 1LW7A 3DZFA 1MRZA 1MVOA 2NN3C 1XEXB 1F9AA 4JR2A 2X23A 2VT6A 3ENZA 1XMQB 2I6SA 3BSFA 4FYIA 4QUBA 3AOEA 4M7PA 1KRXA 2DH5A 3PNYA 3OTGA 2W22A 2OKCA 1P39A 1NURA 2O05A 3IQGX 4DZRA 1VMEA 2QRHA 3ZCXA 3JATB 4UE3S 4A73A 3B52X 5U4XA 1DINA 4U6SA 3CGGA 1XFDA 4OQNA 4ZDWA 4FGLA 1GP2A 1IZ8A 1LNZA 1QFZA 1ZVMA 1HC7A 2YH2A 1LK0A 2OCIA 3GJRA 3AR4A 3K0FB 3MZ0A 4LY0A 2ZYUX 4BP9A 5I7HA 4IIJA 1EFUA 3D3WA 1QFYA 1J23A 4PHFA 2C2XA 3EE6A 2VC2B 1U3VA 1A9PA 1L5SA 1P1RA 1PVVA 5A4DA 2VP4A 1XX6A 2JAWA 3O47A 1R6TA 4PIMA 4CCAA 1JPNA 3ISVA 1ZGGA 1E2QA 1S4QA 3RK4A 3NT4A 3GLRA 3LUKA 2ZE7A 4MICA 4XAQA 1MAWA 4AP6A 2UUPA 1ODSA 2BKLA 3LT0A 3LWBA 3ZNNA 1PQPA 1ZA2A 2I6XA 2CEAA 1KI6A 2VA9A 1ZMTA 4A8JB 4TMWA 4Z3DA 1IVSA 3RUIA 5JZ9A 3KR1A 2P77A 3NCHA 3C6XA 3NHFA 1F20A 2OXFA 1QHNA 3LUCA 3MJRA 4FFSA 1U04A 3O8QA 1PV2A 3EZLA 2PBLA 1H4SA 2BMVA 1MVLA 1V39A 3AO0B 4FFBB 1UBRS 1JG7A 4ZKEA 1VB5A 1CSEE 1YB5A 2XKKA 2YVLA 3D7KA 2XVYA 5A9TA 3RUDA 1FDIA 4CG0A 4JCOA 4ESOA 3BGSA 1GYRA 4Y7CA 4COOA 2DT8A 4BBZA 1ZKDA 3EY4A 4N3GA 3ZXSA 4EA8A 3SQWA 1NWHA 4CPDA 3RU2A 3ZX4A 2K7FA 4WZBA 2BRUC 2H4XA 1GUDA 4LVNA 3EOAI 3L8EA 5CNJA 2F55A 3O1HB 4WNIA 3L5OA 4DCOA 5ALJA 5EE0A 5FF9A 3E6AA 2XV1A 3AXSA 1M1ZA 2BI4A 2J0VA 3KPYA 1UOQA 2OAEA 2J9FB 3PDJA 2QVYX 3LQ4A 4KGZA 5CBPA 4BLQA 2J6CA 4W8GA 1MQSA 4AKEA 1MV5A 3SZOA 2XQFA 4JC0A 4Q9NA 4YV2A 3DDZX 4M38A 4B3FX 5JQGA 2ZZKA 3OPXA 3BE8A 3AERA 3DNPA 5BV0A 2NWQA 2HJVA 3REGA 1E2BA 1QH1B 3A6LA 4FHCA 1P18A 4J0DA 3V4SA 1QO9A 3OX3A 5DRTA 4N7BA 4AUKA 4YRTA 2CV2A 3UJCA 2IZ0A 4FXPA 4MWTA 3N59A 2HQ1A 3EK2A 1IPFA 1HO3A 2HBYA 2O0JA 3H5VA 4HTFA 3TYXA 1KK2A 1IBRA 4DCMA 1Z16A 4CL0A 1IIBA 4WKPA 4PF1A 5ITWA 2CLEB 4KR7A 2GNPA 3JQPA 5JSZB 3O8NA 2QM7A 1EZ4A 2ZUFA 1OFUX 3EZYA 3UHPA 3K70D 2GX6A 1E3SA 2I6GA 3PUVA 2NO0A 4ILEA 4Z4GA 1XMIA 1T91A 1AQUA 4G8BA 3VR2D 4RMGA 1ZH6A 2GB4A 1KRWA 3B6KA 4IV5A 4ARAA 1QF7A 5F73A 1I1OA 4D9GA 1MPTA 1N6RA 1E18A 1T5OA 2IXEA 1B3RA 2XYQA 4OFXA 4D4LA 3LKBA 5K3FB 5B3KA 5JANA 1OFIA 4PLFA 4L5JA 2DM6A 4C2AA 1AUQA 1BWRA 3JQ9C 3T0GA 1D4ZA 1AO3A 1Y7IA 2G6TA 4OQEA 3TDMA 4EI2A 5HXAA 4E2ZA 2QYOA 3W6OA 3HN7A 3AX6A 4J7CA 3H17A 1R5BA 4L5AA 3GR6A 5ALNA 2FOIA 1YZQA 2D5LA 3CLKA 2DBYA 2VDUE 4H35A 4LCJA 3T3HA 4LY3A 1QHXA 4RTPA 1VJRA 2HMWA 1L5WA 4XQEA 4AN1A 3Q8MA 3DD5A 1O54A 1BS1A 3DAFA 4ZVUA 2JHFA 5T4BA 3LHSA 1VLVA 1X2BA 2QVBA 2ZJ5A 4JJFA 4CT5A 4EL5A 4TV8F 4XFDA 5DKFA 1NN3A 8ADHA 1KSJA 1BRTA 1LTQA 1J0EA 2CFSA 2HSZA 3PQ4A 2IDKA 1X87A 2PZGA 3K1ZA 4IHAA 4OU4A 4ZV4A 1ABBA 1DMRA 2RC6A 2H2GA 4QU9A 3DW3X 3USZA 1QIDA 1A7UA 4O4JA 1YB7A 1G8JA 1TYDE 2VK4A 3PTAA 3T38A 1DKPA 1U1CA 2NYAA 2ZE8A 1IVYA 1OKKD 4TMTA 5DWVA 3AUXA 3VVBA 4KN6A 4ZOLF 5G1OA 3WDKA 1ULBA 3FVVA 1UBKS 5EGNA 3IQHX 3DOCA 5TVKA 1KC3A 1PGOA 1JTFA 4DSTA 1TAUA 1F17A 1T0BA 3MXOA 1ISJA 1RXUA 3ESXA 1N2IA 2FETA 4OO3A 5CW1A 1T5SA 3NVKI 4B17A 1ZN2A 3GJ6A 2WJVA 2FMHA 1JPUA 1MKYA 1RRKA 3AR5A 1RWQA 3KZVA 4HNAB 1U0JA 3GA5A 4GR4A 2OBMA 3I6BA 3ESZA 4V02A 1U2EA 2E48A 2NVUB 3ETCA 3WLPA 2NU7B 2AG0A 1ODCA 4MVJA 3FBTA 4WXYB 3E18A 3WSTA 4E2XA 2PMCA 4PM4A 3UB3A 3QU4A 2GN4A 3INNA 1GCIA 1JBKA 3M7IA 2VHWA 1JVBA 3PDUA 1VXOA 5AESA 3C4JA 1VJGA 4H6XA 3SS7X 1HE3A 4PZPA 4L6CA 1SHJA 4Y98A 5LLDA 1W0KA 4OU5A 1I7DA 1T2AA 2Q46A 2EVWX 3GFPA 4YDRA 3QSYA 2FW7A 2SKDA 5LU9A 2GEVA 3WO0A 3O8RA 4QEKA 1Y6ZA 4ATNA 1OWMA 5J4KA 2D8MA 3LCMA 2VBFA 1HURA 5GWXA 1QVZA 4Z4EA 4IEEA 2NNLD 1GL6A 4TM7A 4OI0A 4EA7A 5HX7A 3R0XA 2P9HA 3AVPA 3D6AA 2O2EA 1G8HA 3P0RA 4X1IA 4CGYA 3RBVA 5JADA 1Z8FA 5JRDS 3Q3JB 2D74A 3VR3A 2H3EA 4D3DA 5KYWA 2PX2A 2ZBGA 3WBBA 4CM9A 5FPYA 4FFDA 3LPLA 4PXYA 1KGDA 4Q02A 3U3XA 1NP6A 3U5ZB 4JGIA 4ZT2A 1CEYA 2IUEA 5JAMA 2E7ZA 1YONA 3K73O 5GJCA 1HTWA 5KS2A 5BR7A 3W5BA 1T0UA 1AXRA 3PEUA 4OGKA 1D03A 3O2QB 2XGGA 5CH8A 2PZ8A 1QIFA 5JO0A 3OI7A 2D5IA 2G83A 4DNXA 2HK7A 4B9AA 1OT5A 1G7SA 1XMVA 3A0RB 3F90A 4G1FA 4S0ZA 4MINA 1L5HB 3EBPA 2I9KA 2PO7A 1BEZA 1TJPB 4Q3EA 2DPLA 4OHBA 4ZVKA 3A70A 4M8LA 2XI4A 3DBRA 1T6XA 3ACBA 3R3SA 2G7MC 1ECLA 1XXHE 2FQ1A 4CN8A 5CXQA 5HZMA 1JKXA 1L4KA 3JZFA 3LC2O 3Q72A 3VZPA 4ALJA 5JAZA 5TR9A 3MTQA 4MK4A 2A84A 4KE7A 3T6KA 4BUCA 1N6IA 1W36C 4O5AA 2X9LA 4H0FA 1E2MA 1TM1E 2DZDA 2FPLA 4JGGA 2IL1A 4Q93A 5JPIA 1N4AA 1TUBB 2QV0A 2XGOA 3W05A 1B2LA 1Y7LA 1BEEA 2JJQA 4LMRA 3B6ZA 3HKEB 2P5SA 1E7MA 4HAIA 5FLKA 3RIGA 4EOGA 4QQKA 2C8VA 4A27A 2AXPA 5BQ3A 5EE3A 4UM7A 1K8RA 5LOVB 1HLDA 1Y1PA 2ZYIA 1TTHA 3U7JA 5A2GA 4DS3A 3KQLA 2G1PA 4XCVA 1P4AA 3RE1A 1U2TA 4MDHA 2ZXUA 1PX2A 1FP4A 1YC2A 4MW9A 3ROPA 4EYGA 2C2MA 1IM2A 2X8JB 3MRXA 4IDNA 3DQZA 1UH5A 4RIFA 3IQDB 2QLMA 3K9BA 1E2GA 5IAGA 4FGZA 5JVDB 2NSYA 3GXOA 3I12A 3IX7A 3OA2A 4AJ9A 4BFVA 3ETNA 2G4VA 4KNVA 4NWIA 5FFNA 4XLLA 5CM9C 5KI6A 4CETA 1KI4A 2OBLA 5JWRA 2H6EA 5FBKA 3FPBA 1YVPA 2W2TA 1KAEA 3PC3A 5CM2Z 4AU1A 1JSLA 5DEIA 5KSYA 1WB9A 4BO6A 3T7KA 1DL5A 2XBLA 4CQMD 4JELA 2OA0A 1ZMRA 1USUA 2OQ2A 4KIUA 3KYDA 3SVZA 4IUCS 3LW7A 3ZWVA 3GYGA 5I9LA 5CFOA 4E6PA 2C1EA 4G25A 5LFAA 3TSOA 4FN5A 1Y6FA 1E32A 3EQ7A 2Y1DA 2P6NA 2WHPA 4MUKA 2IQIA 4L0MA 2D0IA 3THWB 3JR7A 4JEIA 1IZZA 3SYNA 1AKVA 2PZLA 3DV2A 1Q2UA 3N2KA 1UMBA 2OKGA 2WJAA 4LN1A 2H7XA 4Z4CA 3JQAA 1JTEA 2ZIGA 4GFDA 1R37A 2RSLA 4J1TC 5GOZA 1XQYA 2VRCA 2BP7B 3OZFA 3OFND 1E7SA 1HA3A 4O2RA 5JD3A 4WBNB 4DR1B 3D7RA 1DC8A 3KHKA 2Z43A 4C0QC 1N9GB 1V16B 2N9UA 2P2NA 5JI3E 1F0NA 4BPBA 3OKAA 3IB6A 1JSRA 1T0JB 3AM3A 1CFZA 1S1CA 5DOVA 1A96A 3TVTA 4ALIA 5KHLB 2YYAA 1XTIA 3KQSA 2BGTA 3FE2A 4Z0NA 4CL2A 5IUJC 4UQPA 1M7HA 1Y5NA 1YK1A 3QF4A 1ZGBA 4FDAA 4UBJA 4Y1GA 4QHSA 4MIOA 4KQCA 3TQHA 5FUMA 3E22B 4DLWA 2P4QA 2I76A 1OW3B 3LP5A 1A04A 1NNI1 3V00A 2ZRLA 1QCZA 3D0QA 1MHPA 1Z7EA 3IO5A 3QKTA 5EWMA 1JJIA 1IHOA 5JLJA 2DX7A 5EYPA 1YQXA 4WK2B 5IFLA 3LQRA 4LRUA 1G8GA 3D7MA 1UPBA 1Q6YA 1TM7E 3AKCA 4YWJA 1EP2B 1K5GA 3O8BA 2NP7A 5JXHA 2FPSA 1NASA 2IYWA 3DW1X 4Y6PA 2H17A 4I9UA 2NAFA 4LTMA 1CYEA 1LKZA 5DNWA 1RWBA 2NYRA 5AVKA 4ER7A 1XRSB 1J56A 3DLPX 3IILA 5BSKA 4NXMB 3KUCA 1YDEA 3T7DA 4JLKA 3HP4A 2AEJA 3HDVA 3W2FA 3SQXA 4D56A 1ZDMA 2QTRA 4D44A 1L5LA 3U6KA 5CNMA 3I9OA 3VMFA 1EK1A 2XMCA 2Y0CA 3FTNA 5L7WA 2HD4A 3CWQA 3NWPA 2O8DB 1D1TA 3O7MA 4Y0VA 1NKTA 1A1VA 1DQYA 1KJ8A 1YMUA 3PGVA 2PT6A 1EG7A 2M1XA 3WQSB 3HYSA 3GLIB 3VO8A 4G0PA 1WXGA 2ALJA 1ZK2A 3PNKA 1PBTA 2WU0A 2ZFUA 4ZODA 5L7YA 5JCOC 4M1MA 3GEIA 4NH4A 4QUHA 3A3PA 3TB6A 4MIKA 3VFDA 4EW1A 4ZI7F 4GXNA 3IOMA 2AD5A 2YIJA 1NW8A 1SCUB 1M0SA 3L18A 1R0YA 2EWVA 2GBCA 1CRQA 1N2GA 5B7PA 3VI3B 2V7UA 4TM8A 2O1WA 4NYJQ 2GPWA 4KQ9A 2JFZA 4QXQA 3MQ2A 5ADUS 1Z3IX 3ONVA 3JAWB 1YVUA 3NC0C 3QE2A 1ML3A 1IBMB 3BHJA 9GPBA 1DG1G 1NW7A 1WU8A 2F2TA 2NTNA 3DVAB 3IPYA 3SDSA 4RKQA 5B4UA 1H2AS 2P3OA 3O4FA 2PJZA 3R3XA 4JA2A 4BNKA 5BN3A 5AW6A 3BRQA 2WNSA 5H82A 5JDIA 2NPIA 4MJXA 4NHOA 1JP7A 1G3QA 5HMMA 3B53X 1XNGA 3BERA 1SKQA 3TH5A 4MZXA 3OQ6A 2H4JA 3GCGA 5TMEA 1PQ4A 4U2EA 4R7ZA 2OAQ1 4KH0A 1U5BA 4D9JA 1QIHA 1XTZA 2IU3A 1RQNA 3SOPA 1BXGB 3V8QA 3NG1A 3LTEA 2EX0A 3FNGA 3BMQB 4W6QA 1KJJA 1UZLA 3T99A 4ZHQF 1I80A 4TTAA 5HIMA 3VR4H 3WV4A 5EHZA 2HJRA 2FVXA 2NNWB 4IDFA 3EPKA 1EH5A 1ZNQO 5EMNA 1N5JA 3GRRA 4R05A 2H2IA 1JR4A 5AOVA 5JASA 1ZCJA 2Q8NA 3ETDA 1SBQA 1QIGA 4LG1A 3FB4A 1PLJA 1D4OA 3CCFA 1W94A 2JASA 5BT8A 1JG3A 1GA6A 3G9TA 1A3CA 4C43A 1XAHA 2CNNA 3N3BC 1KO7A 1Y42X 2HA0A 4PZUA 1U90A 4DJDC 2EFYA 2ZRCA 2ZRKA 2GHRA 2P5TB 3TQOA 1TO2E 2XRMA 4U2FA 5BY2A 4GPBA 3RWOA 1PJ8A 1THZA 1X1EA 3QE9Y 3IQZA 5B7NA 1TX4B 3FSGD 2D8AA 4FNGA 5E0KB 2GZSA 3I6QA 4Y2SA 2GEFA 3ROTA 4MJLA 3KK0A 3GVCA 4FOSA 5D2CA 3V3KA 5K0JA 4GL2A 2XWPA 2R6FA 3UH0A 3L1IA 5JNSA 1BX0A 2V5VA 1N36B 3PFGA 4KU4A 1HI9A 2QTZA 3IE2A 3LRPA 4JLBA 5L95A 2DBQA 5INTA 5G4KA 1Z5OA 1U80A 1P4RA 4AKIA 1U81A 3M4NA 4ZYLA 5CVTA 1DUVG 1YF3A 4DA8A 4AK9A 5C0OE 3DDNA 3EPHA 3VKGA 2I91A 3GHYA 4P7JA 4BTVA 3C3MA 4UU7A 4BXOB 1QX4A 1C30A 5EP2A 5EZYA 2CXHA 2PKQO 3VH1A 2HYIC 2N75A 5KNCD 5DBEX 3IC5A 3RTAA 2BFDA 3O3CA 5ARDA 3I4LA 2OV1A 1QJ4A 4Y1EA 1CR6A 1RWVA 1BMQA 2YVAA 2J9YB 3W06A 4DIOA 2JI6A 4GMFA 4GKAA 2J4DA 5IM4F 1UBUS 2GAFA 3QBVA 2PMEA 3GT7A 4MHOA 1SUPA 3PUYA 2VTDA 4IV0A 1TJYA 1U1FA 1WMFA 3THOA 4A15A 3PP8A 2DE0X 2IYFA 2PTHA 3Q88A 1NMQA 4L8WB 4ON9A 4Q66C 4WCFB 2VNIA 4TMFA 5F4BA 2FQWA 3STWA 1J2RA 3RVOA 6PFKA 5KYGA 5ILOA 1RM5A 2XMQA 1NVMB 3B38A 3IP3A 1WXWA 4CQLB 2B3TA 3QUCA 4ISBA 4M37A 3K6SA 4DXDA 3ZIUA 4J7AA 2BMEA 1UINA 2CBZA 3DR5A 2WIFA 3GJ8A 4KO2S 1IBKB 1NPDA 3LLUA 2IUUA 3RT1A 4ENQA 1ZGZA 3OM9A 1HG0A 4M0LA 4M9RA 1TYCA 1LH0A 2OFFA 5TS3A 4BKUA 3QENA 4QC2A 3DXZA 3P9QA 1BCSA 1XD8A 3GUZA 4JROA 2IDZA 5TJHA 1XCLA 4D8VA 3PLNA 3L7NA 3VBCA 2EKPA 3KSZO 1ADBA 1YAJA 5LQUA 4B6FA 2IYTA 4L72A 3THYB 2C7OA 4YIKA 3ZDQA 3D5EA 4ZO8A 1TT5A 1FSZA 3ND8A 4MDYA 4O1IA 3LDAA 5H4GA 4KLNA 3P8ZA 4C20A 3RK0A 4ZI2A 3PHBE 4W7IA 2GK6A 1C41A 3DTNA 4PLPA 1DV2A 3UAGA 5EINA 3VR6D 4E09A 5BVHB 3RTBA 4NFSA 5FL3A 3WRXA 9LDBA 2VQFB 4FZ5A 2Z0MA 3TCNA 5LMCA 2CZGA 1SBTA 1OX5A 3I58A 4QXPA 3RABA 4EUEA 1A4XA 7ADHA 1YULA 1J9EA 3WGJA 2J6BA 3PUHA 4KWTA 4WN9B 4NNOA 5BRNA 3MWYW 3RVPA 2QD4A 1KQFA 3IJRA 1RMQA 4MR9A 1GXSB 4ZK6A 4UBOA 3AY6A 4YR9A 1NL3A 2VQDA 2O8FA 4ECEA 3KOZA 1G6OA 4YYEA 2QWXA 4KQXA 4L0CA 1NW9B 1R0RE 3IOBA 2VT2A 4LF4B 1G2OA 2YYYA 2O54A 2NP6A 4LPSA 3D81A 4KPEC 1YA6A 1FQWA 4MV4A 2VKQA 3V9PA 3W3ZB 1P2UA 3UT6A 3OD1A 1JIIA 1RW4A 1UJCA 1ZJ4A 4COKA 5A5FA 5ICCA 5JS8A 2Z57A 4PPNA 4GXTA 4MVCA 4MLZA 5LUAA 1GQOA 2IITA 3EASA 3FOWA 4FYJA 3DAOA 4CE6A 3MWJA 2O8EA 2BF7A 3NI2A 1R6BX 4F7WA 3MB8A 2IVFA 1N1MA 3L6EA 2IEBA 3QH4A 1B2RA 2FN8A 1UBLS 3DKRA 3AW8A 4GMHA 2OXTA 1KAOA 4TMVA 2DHDA 3T0IA 4DBLC 4MP8A 5LKRA 2BONA 3UAVA 3FKQA 1H1LA 1PR3A 2X3FA 2GWRA 3D3QA 3QV2A 2AYZA 2B8EA 2JDID 2ILTA 1Z45A 3AJDA 3EEFA 4UEOA 3ASVA 3V32A 3GLHA 4PAWA 3UIEA 4EY7A 2DQYA 2XNKA 1V41E 3TW0A 4M60A 3D3EA 2HN9A 3LYHA 4N5DA 5ALLA 7GPBA 1SUSA 2ZP1A 3RJ5A 3OZVA 3K31A 3RW9A 4HDMB 2MMGA 4G0QA 1RYBA 2G5TA 3SBOA 3R3WA 5JBQA 1U4OA 2F9FA 1JDTA 2AJTA 2NT4A 3L4SO 3NHAA 2YMMA 3GC6A 5ICFA 4HEQA 4CTKA 1VMIA 1A8IA 2ONCA 2PXCA 2QN3A 4OAPA 3NBQA 3DOOA 2PGNA 4N76A 2AFRA 1X7GA 2BUCA 3DUWA 1GEGA 5HW0A 4TGLA 2BBWA 1KTVA 2JIZA 4NOJA 2I5PO 4D80A 1B8OA 1O95C 1BX1A 3W7AA 4Q19A 2AVNA 1F1JA 3C5VA 2KW5A 2O8VA 4A0GA 1U5CA 1SY7A 2AE2A 4PG4A 4JT9A 1CY2A 4WSOA 3ETLA 3WYEA 4R1SA 1KDVA 4ERXA 3OLZA 1EHCA 4AZSA 4BEWA 1UMCB 3IEXA 4MPRA 2QRPA 3AR2A 3EULA 4FUTA 4MCHA 1L5KA 3GEHA 1XN1A 4CKCA 3A10A 3IGFA 4L9AA 3FRIA 4M98A 4PHTA 1CUYA 4IVPA 3SDZA 2OO7A 3ENKA 4M88A 3V3TA 2XYGA 1H9BA 1K1EA 4M99A 4BVAA 1J70A 1JA9A 2QP4A 4P4UA 1CUXA 3E9DA 1E5LA 1RYDA 1TYZA 4JBLA 1YBHA 2VP3A 3CIOA 2CDBA 4IPTA 1IN1A 3U49A 4C1BA 621PA 2E4UA 2RCYA 3BK2A 1X3SA 3I45A 3IL2A 1BCRA 4OOFA 3ZS8A 1DBRA 1T0PA 3CJQA 2GN8A 2IUSA 1VHDA 1EK5A 2AMLA 1V1MB 4CM4A 3KZ1E 3V4OA 2UYYA 1G8PA 4CF3A 1MIOA 1VPLA 4F2WA 4I3GA 2UZAA 4JFRA 4CI0B 5TMBA 3HFRA 5JJIA 1IN7A 3QKRB 1EWQA 4ESHA 1SIUA 2GHIA 4XLZA 4EFMA 4F2GA 1JAXA 2J0UB 1USGA 4KNWA 1I1HA 4N65A 3VU9A 5HGXA 1FXUA 2V45A 5LZ2A 1WA5A 3EXAA 5IAJA 3NC1C 1JDSA 3T5MA 2IELA 4HH0A 1I0LA 5B1SA 4MR8A 4WLFA 3NDBB 4JJKA 4UHHA 5JD4A 1TAHA 1Q7TA 2CMDA 1B16A 2IX9A 1HDOA 1VJCA 5EHIA 1E4OA 4N6OA 3RRMA 1YCGA 3ZVRA 1GAJA 4DYVA 3PD1A 4MWBA 2FAXA 3DEFA 3FRJA 2PX5A 3T06B 1FX0B 4EF4A 2PGAA 4ZGGA 1OWLA 1QYXA 1JKFA 1K88A 1ZISA 3GQBA 4FR2A 4WESA 1KJNA 1J7KA 4HOYA 4S1OA 4RZ3A 2OAP1 5BSRA 4X6YA 1H6DA 3V7FA 2BW0A 1JVNA 2QV7A 4WN3A 1T3ZA 4ZTUB 2G67A 2DHCA 2IYPA 2Y1OA 1PR1A 2JBAB 1CUEA 4INZA 1DEXA 4LS3A 5MDHA 1Q57A 3TPZA 3C3WA 2ZSJA 1RJ9A 2BGRA 4I4CA 3T54A 5E1MA 1SHUX 4XVHA 3OZBA 3HKCB 4KXVA 3UCFA 5JCPA 1N8TA 3JYLA 4N0PA 2VAWA 3D3NA 3F6RA 3D4OA 4ZT5A 3KXIA 4Q9AA 5HDBB 3ZR4B 5EHQA 4FOLA 3AVTA 1ZL0A 4YRGA 4BWFB 1LDBA 4G85A 3I5AA 2YV2A 1QOZA 1YDWA 1G63A 2DHRA 3A9VA 1MGPA 3N0VA 1CY4A 2AYXA 4QBIA 4ZGBA 2IXDA 2PQMA 5JSYA 2ZZNA 4WK4B 1EVKA 2FP3A 4HGQA 3Q8LA 2FP4B 2G17A 5CYPA 4LE0A 1MN6A 1N6OA 3FCCA 1W6UA 3GEMA 2QPAA 3V2GA 4JI2B 1Z5UA 4GOLD 3VXKA 4S1TA 2Z9DA 5DYYA 4Z3OA 3M8KA 3W8FA 3ET5A 1GV0A 3O31A 4ZTBA 3KFXA 5EEHA 1S8OA 2CF5A 3MGKA 4QUIA 5HE8A 4UFOA 3IKLA 1P7CA 1O4VA 3ZJUA 3H5AA 3UJAA 5BRAA 2CNBA 1NN0A 3CUKA 4IIUA 3LUFA 3NIFB 2QRZA 4GM4A 4HXEB 4NAUA 1NJSA 4X7RA 4C05A 4TTSA 1YI0A 3HS3A 3QFHA 4MSUA 2FPUA 3G7UA 5EIHA 1CVRA 2ACWA 3GLGB 2W37A 1E1CB 5K3AA 1RVDA 2MDTA 3IB3A 3KKKA 2GK7A 1QPBA 3R5JA 3T1YB 3F5QA 3E9RA 4WY8A 1VKRA 3K71B 3HJBA 2C5GA 5CK5A 1KZHA 3TAUA 1OC4A 2J3MA 3W8NA 3I05A 4G0MA 1P33A 4XM2A 2ZQZA 3FNIA 3N8HA 5F2KA 4L16A 1BN7A 2BFFB 1R0ZA 5TMDA 3LECA 4G36A 2F3PA 4CQJA 3U7QB 3K72B 3DXXA 1VSBA 3RYCA 2ZIEA 1IRIA 3SQLA 3G23A 1MZPA 3T9BA 1B00A 2AKAB 2EX4A 4OH1A 1PF7E 4Z7QB 3BFKA 2YWJA 5KC9A 2CYCA 1K2VN 3U4GA 2YVKA 5DYGA 3FWYA 2FWNA 1ZAYA 2ZTVA 2AR7A 4QTTB 4U0JA 4OK3A 4LI0A 1GITA 1M6NA 2O7VA 1C0PA 1NRJB 2GNAA 4NBWA 4C6TB 2V5UA 3FVWA 4CF5A 2O50A 2VP5A 2QTBA 4QJBA 3KEMA 1L8AA 1UP4A 3LT4A 4TROA 5J63A 3GN2A 3OQMA 5C3MA 1FLAA 3HN6A 4CIDA 4EPVA 4XE5A 1XQVA 4MI6A 2HSDA 3MYYA 4EUFA 3WYNA 5GTDA 5IBPA 4K9MA 1UXKA 3FUCA 2JIRA 1Q1EA 4LMBA 1SHLA 3O26A 3KRTA 3O95A 4ZQFA 3RLIA 3RSSA 1M54A 4E12A 1QPGA 1CFJA 1WDMA 2E87A 2VH2A 2WG2A 1GUYA 2RHLA 2P35A 4JODA 4PPGA 1XVIA 1S6YA 2PGOA 1K7SN 5U1PA 4R16A 4HL6A 4KXMA 1DWOA 5L9AA 4N0MA 1HFEL 3ZI7A 3PGJA 3GLIE 2JCXA 3EIHA 5KPDA 4MVXA 1FCJA 4HV4A 5IJ0A 5FR2A 4KDFA 4OHPA 2BM8A 3ZGLA 1JX6A 3LPCA 3T5GA 4D6XA 2BEVB 2GEKA 2XODA 1XL1A 3EYAA 4F84A 3DFUA 4TV8B 1E7WA 3A8TA 4NXNB 4GKJB 3OZEA 2FZLA 1M73E 5A0VA 1EM8B 4P4SB 2I4OA 3QXSA 5I5EA 2HSJA 5LQCA 3N7AA 3PYLA 3MOSA 4E5YA 1QH8B 1T2VA 4IDAA 2KYRA 2VSXA 3IYLW 4K9QA 1THMA 3X3HA 4CIBA 3DFKA 4I66A 3UPDA 1E1QA 3SIWA 1QV9A 2QKYA 5BMVA 3K0KA 1R0CA 1Z38A 1MFPA 3VR5D 1LJ8A 4GMGA 3EWNA 4WCDA 4IQ0A 4ZOLB 5CNIA 2OENG 3V8BA 4BMSA 3FLAA 3AEUA 5CU7A 1QG0A 3I9NA 1PRYA 1P4GA 3CXUA 3JQ7A 5FWNA 5JV5A 4IIGA 1CP2A 2NACA 3UAYA 2BKVA 2GLTA 5IJWA 3KJZA 1K86A 2C4MA 4ZO9A 1JE1A 4RYDA 2NYVA 5C7LO 1N33B 1LDYA 3NETA 1ENZA 2C95A 1U0OC 1RRPA 2H2HA 3BMOB 3C3EA 3C39A 5CFLA 1U1EA 2PH3A 3GRCA 3IULA 3KB2A 3QVKA 4DPMA 4BQNA 4PZZA 1Q3HA 2IP2A 1YBMA 5A5DA 1PT5A 3IIIA 3I5YA 3PDIA 1WDTA 1FNMA 1FU4A 1T35A 3LF1A 4KUGA 4MUAA 5FNZA 3K0SA 2FQYA 4JUFA 4WVFA 1AHPA 2J45A 2P9JA 3SX2A 1MU0A 1D2NA 1UKZA 1QMGA 2ZAMA 1OTHA 4LHVA 4O25A 2ZRPA 4H3HB 2EQAA 4G09A 4KMSA 5F2NA 3SR4A 2A3RA 2R86A 4EJSC 1D2EA 5J5AA 3A9UA 3DE1X 3RUPA 2ZM5A 3SVTA 2ZM6B 2I80A 4W82A 4Z9YA 4ZC1A 4A1FA 5E95A 1VPVA 3DLHA 2BFCB 3VZRA 2QPTA 4OSOA 1XMOB 2QE6A 2VPZA 2ZUBA 3CEPB 1H4TA 2OUKA 4L7QA 4FP9A 3AGQA 2PGXA 2LPMA 2I1LA 2C54A 2O6HA 2PXHA 4XFKA 1OIVA 2R97A 1XBTA 4B71A 4MAFA 3RH0A 3HJHA 2HUPA 1N9ZA 1T3GA 4UCWA 2PL9A 4MUBA 1W5SA 3H42B 2Q3BA 2YOFA 3HG7A 4AWBA 2HA5A 1LBTA 3CU5A 2IP4A 2WB4A 1W87A 1YS6A 1WQ4A 4K6HA 3ZD8A 3AKZA 2LWIA 3JQCA 1P81A 3WGQA 3QYPA 1I4EB 4K9NA 16PKA 2DFPA 1L4EA 2B99A 1CIVA 1UXJA 2HU5A 1A7JA 2I71A 2Q6IA 2X4GA 1NM5A 3HY3A 2DUWA 1E99A 2VNAA 2CXQA 1TE2A 3JWIA 2ID7A 5FD8A 1M7BA 3VX3A 1XCMA 1M3SA 4PAMA 3RSQA 3U7RA 1ULAA 1Y6GA 4I9FA 1RIIA 3RRBA 4W8HA 2QMHA 1APBA 1U7DA 4OKSA 1F7UA 3KHSA 2I6FA 1Q5PA 1L6RA 1SA0B 1TF2A 3ADPA 4RQBA 3WKBA 2QJRA 2A8YA 2Q1XA 3IIEA 4ZGWA 3PUZA 5I7FA 5DHQA 2PZEA 5BNFA 4LI3X 5EWJB 1QUEA 4RSMA 3JX9A 1IM5A 1T4CA 1N9KA 2G9ZA 3MRVA 2ETXA 1QE3A 4RQUA 3O21A 4U2GA 2VYFA 3WK4A 4ESEA 2N46A 1C3OB 1TC2A 5E1BA 4BMZA 4EGFA 5HYVA 1HRKA 5TE9A 4LOAA 1KYQA 2JI4A 4NZ9A 3WYFA 3DMPA 2B8NA 1SCKA 2ICAA 1VECA 1W1IA 3D6VA 3WB1A 5IHPA 1D2AA 1GTZA 2IIVA 1HQKA 1ZUWA 2JJMA 3C5EA 3QE4A 4B3HA 2PN1A 3PCTA 4LF5B 5F9HA 1R9JA 1J49A 3DF9A 5IAOA 1RWKA 4J49A 1D1PA 4KXQA 3H97A 1X39A 4HLNA 1E9DA 3BK7A 3ZE2B 5B55A 4LYDA 3RB8A 4RF2A 5BV8A 2OO5A 1OFGA 1KVQA 3E9ZA 2CBXA 5CGQB 2QYTA 2IYAA 4DHEA 4DT1A 5CXUA 3V4VB 3MAGA 4RZIA 5JSKA 4EKIA 1CKEA 3VPHA 1KS9A 3CRVA 3NAGA 3ZZTA 1ECFA 4B44A 4CIXA 2PZJA 2VT7A 5GVSA 4YJHB 4OGFA 3QPVA 4Y6QA 1OIWA 1SNYA 3ZCPA 3DB2A 1JQ5A 3L0OA 3C5WP 3G02A 4DUZB 4ZAFA 1QRRA 4JQSA 1IFXA 4B5KA 3C8UA 1JFTA 4ND8A 2BF4A 4W5NA 4NG4A 2QNBA 4GDMA 1BA3A 4R01A 4RK1A 5I7SA 3KLPX 3FNHA 4ABTA 3KBOA 1HNNA 4V1CI 1TFUA 5CYGA 1G8YA 4FC6A 1TJ3A 4WOCA 4GPD1 2H5EA 1YGYA 3AL0C 2ZUEA 2WD7B 4QTUB 1EESA 3M70A 4FDVA 2XXJA 2I8CA 2R4QA 2DCUA 3IT2A 3NIWA 1KE1A 2YN4A 4CM8A 3ZQ4A 3CMMA 2P2CA 1QNFA 3T7RA 1TKRA 2FPWA 3LT2A 2CHUA 4KE9A 3LY9A 5KJEA 9MHTA 2Q07A 1GTG1 3RFXA 4MQBA 3KTAB 1ES9A 1KFJB 1OV6A 2BFEA 1CX9B 4N18A 4TYQA 4JBNA 2JZNA 4FXOA 5I4KA 3KEOA 3BZUA 4W9RA 3TXAA 5F1KA 4HWTA 1OTXA 3ZS9A 4GYYA 4LJSA 2I6TA 2BSAA 3H7AA 4FSHA 3IDZA 4MKGA 4RVGA 2O2JA 3OZ7A 4RGVA 1SBZA 2VHUA 2ZUCA 3ICPA 4QO8A 5JH7F 2CB9A 3H11A 1TEXA 2FRDA 1D3AA 3CR8A 1LVHA 2GCEA 3F6BX 3P2KA 3T7AA 3EXIA 3X1MA 4EQ6B 1ACJA 4KO3S 2RAVA 3EEIA 1DO8A 4I50A 4K6OA 4KXXA 3SIRA 4D5EA 2RKWA 4ZYZA 3MWEB 1DKOA 2DWOA 4GWGA 1LU9A 1WEHA 2ZTLA 4YBZA 1U0FA 5F21A 5LN1A 1DIBA 1EK2A 3DO6A 3ELYA 3IUPA 4KODA 4INJA 3TD6A 1V6CA 4BO3A 4BWYA 5E9JA 4J94A 2CFRA 2D0DA 2EKZA 3T7TA 4JLJA 2JJYA 4QL3A 4EBFA 2Y4OA 3P1JA 4WTOA 5ELLA 3FR8A 4HSGA 1U4SA 1YJAA 4TXMA 2XUIA 2DB3A 1UXIA 1D7OA 3NONA 3NT5A 3PHLA 1SUBA 3I04M 1NQVA 2V96A 3R4VA 4YH1A 5JEEA 2ILVA 2V1XA 2QD5A 3E9CA 3LBIA 4ROSA 1CY8A 2OOSA 4GH5A 4RDCA 2NZYA 1Q21A 5LMZA 3I1FA 3IPXA 1K5PA 2EFJA 4FBGA 3GFGA 2OG1A 4RD4A 1DWQA 3SDBA 4F06A 1VFPA 5JNWA 3CLHA 4HZGA 1O57A 4HDRB 1U2GC 4O4IF 4UPDA 4C29A 3L0IB 4ZI7B 4OA8A 4XTCS 2B5VA 3GJYA 1IHDA 4MPPA 1G2QA 4HGOA 1AKEA 4M4SA 4OV6B 1XNHA 2RB4A 2EYUA 5LUBA 1Y80A 3D4IA 2EG9A 3SHOA 3QKWA 1WBDA 1GD1O 1MGOA 2JAUA 2RG7A 3I52A 4M76B 5ER6A 3CUSA 3AKEA 4RY9A 3W5DA 2VWGA 2J09A 3OM1A 4L0DA 3TIGA 3DFZA 2DBZA 4FHDA 3TIXB 2CXUA 3FRHA 1GLGA 4HEJA 4REQB 4V0RA 3LV8A 4Q7MB 2G0NA 3DE7X 3FW1A 6ABPA 4FE4A 2BZ0A 4EKGA 1UKAA 4UULA 5FTWA 4MYCA 1EGAA 2G8LA 5ARCA 2YXNA 3B6EA 1EA7A 3A11A 4KN9S 4IIDA 1QKKA 5IARA 4Y2HA 3HJRA 3H2BA 4GT1A 4JDUA 4RC9A 1IOWA 4WKBA 1P5JA 1RXSA 2XB4A 4XX0B 3L77A 4L3OA 1T29A 4UZSA 4II3A 4GLLA 4HQOA 1Q0ZA 3MS2A 4E22A 4EHHA 4RE6A 1D0IA 1U0EA 5KNDA 1SCIA 3H2ZA 2A5DA 3SC2A 1K4KA 4NBKA 3J81A 4X8HA 1FDUA 4ZHQB 1L8QA 3VYVA 3DBLA 2WP8J 1FP6A 2HJ9A 3E61A 3Q3IA 1IC6A 3DPSA 4D8WA 5BN1A 1O96A 4BYGA 1IATA 1JVSA 1KXZA 1V7PC 3INTA 10MHA 1XVUA 1JEEA 3JSAA 4LAFA 2TMKA 4HH1A 4JJ8A 1KR2A 4CW7A 4AL4A 4Q1DA 1PFWA 3STYA 5COBA 5CHYA 3HRKA 3AONB 3W79A 4PYJA 2J32A 2B37A 1FJHA 2Z83A 4AS3A 2V4MA 3KM0A 2VZLA 4XQCA 4D0NA 2R1VA 2ZRJA 4J0GA 3VNUA 2BWJA 1YJ5A 2ZIXB 4H4EA 4QUEA 2R7NA 3AM4A 2M32A 4FGUA 1X6VA 3KO8A 5EIOA 1D8AA 3TTSA 5E0OA 2EFEB 5BNWA 2ZI9A 4G0VA 1TW3A 3DYIA 4AMBA 5EQDA 3KSAC 3BXXA 3HO8A 2C5FA 5DHRA 4AKHA 1V4VA 5JFOA 1LSOA 2VNKA 3F5FA 3FOBA