3IP7A

Structure of atu2422-gaba receptor in complex with valine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
348
structure length
348
Chain Sequence
b'MDVVIAVGAPLTGPNAAFGAQIQKGAEQAAKDINAAGGINGEQIKIVLGDDVSDPKQGISVANKFVADGVKFVVGHFNSGVSIPASEVYAENGILEITPAATNPVFTERGLWNTFRTCGRDDQQGGIAGKYLADHFKDAKVAIIHDKTPYGQGLADETKKAANAAGVTEVMYEGVNVGDKDFSALISKMKEAGVSIIYWGGLHTEAGLIIRQAADQGLKAKLVSGDGIVSNELASIAGDAVEGTLNTFGPDPTLRPENKELVEKFKAAGFNPEAYTLYSYAAMQAIAGAAKAAGSVEPEKVAEALKKGSFPTALGEISFDEKGDPKLPGYVMYEWKKGPDGKFTYIQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, substrate binding protein (Amino acid)
molecule tags Transport protein
source organism Agrobacterium tumefaciens
publication title A conserved mechanism of GABA binding and antagonism is revealed by structure-function analysis of the periplasmic binding protein Atu2422 in Agrobacterium tumefaciens.
pubmed doi rcsb
total genus 137
structure length 348
sequence length 348
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ip7A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ip7A01
3HCWA 1DCMA 2QU7A 2R4QA 5ABPA 3G1WA 1ISRA 1Z13A 1YVUA 3FFWA 1P8AA 1J56A 4FE4A 1ZDMA 1U8TA 1EAYA 5GOTA 2L17A 2L2QA 4JP1A 4KK3A 3F7NA 3N6VA 4RK4A 4JA2A 3RVSA 2CHFA 1D1PA 4GNRA 4MQEB 4ZJPA 2JRLA 3TD9A 2KYRA 5CNJA 2FMHA 5EWJB 1U2PA 4YCSA 4MQFB 1KMIY 2TMYA 2HSGA 2FLWA 3Q7SA 1JYEA 1GCAA 1SXIA 3C3KA 3H1GA 3OMWA 2PUGA 2IYNA 3F6CA 4IRXA 2PUDA 1JFVA 5BRJA 3HZHA 4EYQA 2AYZA 2FQYA 3JVDA 2MYPA 1QMPA 1JWLA 4B09A 4RK5A 4MS1B 4KNYA 2HPHA 3N0XA 2FSPA 3DGFC 3D02A 4MS3B 4RU1A 4XXHA 2FTKE 3QLUC 4MGEA 5FBKA 2VYCA 1CHNA 4F06A 4Z9BA 3HM9A 3VNBA 3CNBA 2FEKA 3H75A 5DCLA 2R47A 4MR9A 3MIZA 8ABPA 1BVHA 2N9UA 4OBBA 4Y9TA 3LKBA 2JVIA 2CWDA 1URPA 3H5LA 1M5TA 2QVCA 3CG4A 3H1FA 3RVRA 3SNKA 3IDOA 2NT4A 1QNLA 1LJUA 5EWLB 1U04A 4KV7A 3F73A 3MQ4A 4GPAA 1ZH2A 1JFTA 3O21A 4Z99A 2FQWA 4OLBA 3NHZA 3LUHA 4E7OA 3EULA 4OATA 4QYWA 4RXUA 3HK2A 2QR3A 1DBQA 3CZCA 2FMKA 3ROTA 5IULC 1QO0D 3HVRA 3BBLA 3CRNA 5TQ0B 5IEBA 5KQGA 2L19A 3FGZA 3DLHA 3A10A 2PL9A 4RKRA 2HJ9A 4DQDA 5TPZA 4WWHA 3W9SA 4IILA 3QX8A 5TQ0A 1RXIA 5FWXB 2PUEA 1Z2EA 2IDMA 1PNTA 3RVJA 5TPWB 1SXHA 3KTOA 3NNSA 1USKA 1ABFA 1EWTA 5CNKA 1JF8A 1NXPA 3KLNA 1DBPA 3BILA 3N0WA 4IMIB 3HJFA 1LJLA 4FE7A 1YTUA 2JK1A 3I42A 1ZY2A 1M2FA 5FWYB 1YMVA 4EGSA 4W5RA 4KREA 5HKOA 4P1ZA 3OM1A 4WZZA 1C0EA 1QO0A 3LUDA 1K68A 3EQ2A 1MVOA 2PLNA 1DC7A 2GI4A 3O2QB 3Q7TA 3RVPA 4F8JA 3TMYA 5KC8A 2MSWA 4MPTA 3RVMA 3N75A 3A0RB 2ID7A 3SAJA 1E6MA 3RVLA 4NV3A 5IEJA 4WT7A 3O1JC 3QLVA 1MB0A 2B1JA 2FEPA 5F64A 1NY5A 1PHRA 2JBAB 4H60A 4MS3A 4N0QA 4L4UA 3NNDA 4PYRA 4LE0A 5BRAA 2PE5A 1DRKA 3KYIB 2VK2A 3MF4A 2FXIA 4QPJC 4D6YA 2WJWA 4N41A 5EWMA 4G97A 3LUGA 1R8JA 1DZ3A 2A9QA 3GV0A 3Q7RA 1JHZA 3JVIA 3QEKA 4KMRA 4M88A 4MR8B 4MRMB 3TO5A 5IX8A 4MR9B 1EFAA 3JY6A 4RDCA 1JBEA 2IKSA 2V0NA 5KC9A 4EYKA 1FSPA 2PUFA 2X7XA 1DG9A 3BREA 4Q7EA 3HUTA 4MR8A 4YP9A 3EODA 3I45A 1Z16A 3N0RA 4EYGA 4N76A 3CHYA 4KRFA 3URMA 5TQ2A 4RY8A 3FDFA 4MQEA 4ETIA 1E2BA 4RK6A 5KQPA 1NXTA 4PICA 1BDIA 1A0OA 1D2AA 4TMYA 3C97A 4FB4A 4Z4GA 4RK1A 4JOQA 4DADA 2W42A 1GCGA 5KWSA 2E4WA 3R0JA 3T38A 4PE5B 5DLEA 3IPAA 5CHYA 1VPWA 3KYJB 3OLZA 4YRZA 1ABEA 2PMCA 1NXSA 5JNWA 4YGXB 1NXWA 4JB0A 5TQ2B 5E3JA 3IP6A 1CYEA 2PAFA 1Z15A 3KHTA 2F8TA 3O75A 2YHAA 1GUBA 1YS7A 5DGCA 1UDRA 4ZMRA 1XWWA 1Z17A 2MYNA 1KRXA 4LE2A 4EUKA 3LMKA 5HSGA 4Z4EA 1VKRA 3JPYA 2FQXA 2J48A 3IP9A 1U0SY 3OQNA 1TMYA 3TB6A 1Y1LA 4Z4HA 4MRMA 4Z0NA 4MQFA 1YK0A 2LUOA 2GWRA 3I09A 3GBVA 3Q15C 2OQRA 4RXMA 1DC8A 3CU5A 2FMIA 1E6LA 1B00A 2HQRA 3BRSA 2H3HA 3M6MD 5JNVA 3DBIA 3C3MA 5TPZD 4MAAA 3GL9A 3OO1A 4DN6A 4MS4B 3K4HA 4G0MA 5TE9A 3EJWA 4RK7A 3CLKA 5BQ3A 4JASB 5IUKC 3TX6A 2IOYA 4RY9A 2WY2D 2QXYA 3LUFA 3O2SB 4OTZA 4TLMB 5KI6A 5IUJC 5JNUA 4WUTA 3LUJA 1LBIA 3LUAA 1FFGA 1SRRA 3GA5A 1ZGZA 2FLKA 4EVRA 1K66A 4IMJB 3DZDA 3I5AA 3DGEC 4MS4A 1DP4A 4ETMA 3OQOA 3QLUA 4W5QA 1PNRA 3EDCA 4D74A 1ZVVA 5DKFA 4KK4A 3KSMA 5T7BA 3LOPA 1EHCA 2VUHB 4O1IA 5TPWA 2PUBA 1IIBA 5CNMA 4RKQA 1YS6A 3H5TA 2MYUA 3M9WA 4EYOA 3C3WA 5CNIA 4F12A 4KVFA 2RJNA 1FFWA 4Q6WA 3EGCA 3IPCA 3CKMA 2R48A 5IBQA 4EY3A 2FKAA 3C6QA 5TQJA 3JS5A 1QP4A 4Z4CA 3VNAA 5C5CA 2Q5CA 4S04A 1XHEA 3RVQA 2FN8A 5FBHA 4MLCA 4KFCA 4G0OA 2WJAA 2PKXA 5JNTA 4PZ0A 4G0QA 2WMYA 3JTEA 2E4UA 4YR7A 3EQZA 3G85A 4N03A 1NXXA 3OM0A 1A2OA 3OO0A 3HUUA 5IC5A 3UUGA 1S8NA 3QELA 3SG0A 4HNSA 2NZVG 1TJYA 3HEBA 1BDHA 1P6UA 1RZRD 1PEAA 5GQSA 1ZITA 5B3JC 1F4VA 1Z25A 2GKGA 2R25B 3OMXA 4G0YA 1A04A 1JFSA 4Z4IA 4RK0A 3KG2A 3MM4A 1L5YA 2JCGA 3MA0A 2A9OA 5HQJA 1MAVA 1SD5A 2QV0A 4YS6A 1LBHA 1MB3A 1AB6A 2E4XA 2LIVA 3N53A 1APBA 3H5WA 3E61A 5JNSA 1VRVA 3HS3A 2A9PA 4N0PA 2PUAA 3CS3A 3F6PA 4WXMA 5ED4A 4YLEA 1NATA 3GWGA 2FEWB 4Z9AA 1QP0A 1QKKA 2P4UA 3LFTA 4OG2A 3RVNA 3FMVA 3EAFA 1EWVA 5FWYA 1GUDA 2LPMA 3RVKA 2MYTA 3T6KA 5HM6A 4RV5A 1F51E 4RSMA 2M1ZA 2PUCA 2RJOA 3N8IA 3SM9A 1ISSA 5KQLA 2HQOA 1TLFA 1Z26A 1W9HA 3RQIA 3OLVA 3QEMB 3KKEA 4IF4A 2LP4Y 3UKJA 1EWKA 2FN9A 1YIOA 4LX8A 1JDPA 1NTRA 1TVMA 3IP7A 2FVYA 3NHMA 3L49A 3GYBA 4ZPJA 1FFSA 3D8UA 4RXTA 5PNTA 1JX6A 4MLDA 2JBAA 4NCAA 4EVQA 1C4WA 1P2FA 2IPAB 4OLAA 1ZGGA 1Z18A 5JNRA 4P98A 5D2CA 4YO7A 4YWHA 2CD7A 3OLYA 2M98A 5JS1A 1USIA 3FFXA 5EWJA 4D6XA 5EWMB 5KQMA 2I6FA 4KQ9A 1M2EA 2H0AA 2WB4A 1YK1A 1AB5A 3UK0A 3GRCA 4RWEA 4LRQA 2RGYA 2E4YA 4G0XA 2HQBA 3CZ5A 4F3TA 3O1IC 4HNRA 4NICA 4JB2A 2MSLA 4MR7A 1DCFA 4XFKA 1ZHHA 2NT3A 1DCKA 1RPJA 4ZYLA 2ID9A 4H3KB 3M9XA 4ETNA 2JVJA 3QLTA 4RZSA 3H5OA 3CG0A 3ILHA 3H1EA 4L85A 1OXKB 4UHKA 4XLTA 4UHJA 7ABPA 9ABPA 1QPZA 3BRQA 3HV2A 3QX9A 6ABPA 2L18A 3SQNA 4G86A 3H5IA 3SY8A 1JL3A 1BA2A 4E7PA 3O1HB 3CFYA 4YV7A 2NUBA 5IUNC 3QLVC 1GLGA 4TLLB 1Z12A 3OLWA 4WXEA 1P6QA 1CEYA 3S99A 3HXMA 1DRJA 1D1QA 2B4AA 2PJUA 4NQRA 2QZJA 3B2NA 4NCBA 4LDAA 3FFTA 3LTEA 1KRWA 3GT7A 3QK7A 3T8YA 1Z2DA 2PL1A 1M5UA 1NXVA 1H9CA 1LK0A 3KS9A 3E3MA 1D5WA 1USGA 3A0UA 1E6KA 3LUKA 2IPNA 3Q41A 4KZKA 5JS2A 1QQAA 2ZWMA 5DTEA 5BR1A 1DJMA 2ZAYA 4S05A 1SXGA 4QYMA 3L6UA 3KLOA 1HEYA 4QICA 4W5NA 2QSJA 1JLKA 1ZH4A 1W25A 2E4VA 4HYEA 5EWLA 4KPYA 1FQWA 1JH9A 1KGSA 4KQCA 2BGGA 3LUCA 3P9YA 1ZESA 3T95A 1PEYA 2JVKA 3O2JA 1ZAYA 3OLXA 4RY0A 1OXBB 1TM2A 1YMUA 1ZN2A 3KCNA 4MYRA 3RH0A 5I4CA 2E4ZA 2FW0A 4CBVA 5T3YA 3NBMA 3HO1A 3Q9SA 2O20A 1U2QA 1BDJA 3QELB 4LE1A 1VLZA 2DRIA 3H6HA 3MMNA 3RVOA 1RXEA 4MS1A 1JYFA 3GBPA 4G0ZA 4O1HA 2F8SA 3K9CA 3ILYA 4XARA 4PEVA 2GX6A 3H5VA 3IP5A 3NNNA 3QEMA 3O74A 4H3HB 3H6GA 4MR7B 4N47A 1DBWA 2IPLA 4LDZA 2LBPA 1BAPA 3ROFA 4XAQA 3HDGA 4HNQA 1QQBA 1JDNA 4Q6BA 1RNLA 1RZRA 2FMFA 3A3KA 2VUIB 4TN5A 3CTPA 2QVGA 1PUXA 2XDYA 2OENG 4W5OA 3HDVA 2WRZA 4O5AA 1XHFA 1L5ZA 2AYXA 2GBPA 4ZMSA 4XASA 4G0PA 4IGAA 3LKVA 2IPMA 4RS3A 4JAVC 3HSYA 5C5EA 1QP7A 2MSKA 2YHBA 4Z4FA 2WWVD 4EVSA 2RDMA 3KJXA 2P9HA 2A9RA 4ML3A 2QW1A 5B3JA 3DLBA 4LZLA 5FWXA 1I3CA 4F11A 6CHYA 1T34A 2NZUG 2CHEA 1MIHA 3MYYA 3OQMA 1D4ZA 2JB9A 3JPWA 1WETA 4W5TA 1NXOA
chains in the Genus database with same CATH superfamily
1P1IA 2R79A 3K0CC 5BSTA 4CL8A 5J3JA 4I9UA 5CT4A 4EA8A 4GL2A 4QVKA 2ERCA 5TGDA 4BASA 4UUMA 4O63O 2P2NA 2GNOA 3FFWA 4NU6A 4WJLA 3K6SB 4KH1A 4A03A 2NPIA 1TOAA 4R84A 2R8EA 5DDIP 4OQYA 4UBLA 5M34A 3PC3A 2ROQA 4MW4A 2P7HA 3N6VA 1L0BA 4RK4A 4KWTA 4B4UA 1PCXA 2OBNA 3TSWA 2WWWA 1X1QA 1DEOA 5CFRA 5I9BA 3STYA 3HA2A 2D1YA 2Y1EA 4YRQA 1E5DA 3TLAA 4OQ4A 5EWJB 4YCSA 2YZKA 2HSGA 3DT9A 1BXRB 5BQOA 3ZS9A 5DI9A 4P4LA 1ODKA 4XQ9A 2Q1TA 3BMOA 4XLZA 3TDKA 4YV1A 2NO0A 1Q92A 1JE0A 1Z5WA 2QGNA 3JW8A 4ZJUA 3VYTB 5IJ9A 5TIIA 3GN2A 4UEQA 1ZD2P 2VPIA 2QA5A 2NZ8A 3K70D 1M10A 3LSYA 3P2JA 4X1YA 3WDLA 2XGGA 3DEHA 4AP6A 1OIVA 3GAMA 3IAFA 4FGSA 1NQTA 1GCIA 1E2HA 1CB0A 1QMGA 3B5JA 4Z2YA 1MW8X 1S96A 1YR3A 4D6PA 3ZJVA 1IBSA 3CF0A 1AS0A 4TQAA 3ZV3A 1EP3B 2YV3A 4X93A 3JWPA 4K6CA 5JMPA 1MP0A 4UTXA 3WYAA 3GLUA 3SVLA 3QEOA 3CNBA 2VZLA 4K03A 5A4KA 2IA5A 3MIZA 4YRMA 2Z56A 3V1KA 2QNRA 1OSNA 5F2EA 4X8HA 2FW9A 1GFIA 1Q20A 2OQIA 3B9RA 4E2WA 5HJ2A 2JFGA 2BFNA 3AERB 4IH9A 4MDHA 1A88A 1W6UA 4LZWA 1AK2A 1GJRA 1SBCA 4A82A 3OPYA 1GPLA 2C5BA 2JH8A 3RRZA 4AY5A 1XJQA 3DDCA 5HCIA 4ARCA 2P9BA 1JKFA 1YIAA 4V1CA 2PS9A 2PT9A 3JQDA 4GQBA 3EXEB 3D2LA 4R98A 2QN1A 4H9GA 1KF0A 4MCIA 4R1LA 1NSTA 4DOMA 1PS0A 2ZJAA 2HT1A 7MDHA 3C5HA 5I7SA 1UOPA 4Q3AA 5AI0A 3AHDA 1DAHA 1FMJA 1AVTA 1Z4MA 2DCMA 2J0UA 2MSCB 2BP7B 4C4XA 4EHHA 1MO2A 2ACWA 2F1OA 2PKEA 3E1GA 1PT8A 2JFPA 2ZYUX 4JNKA 1W4RA 4CKXA 4BFWA 1CUGA 2J59A 3PXDA 2NAPA 2ZBDA 1DPGA 3NOQA 1TK3A 3G1UA 4PX9A 5G1PA 3KTOA 3INYA 3RYFA 1NBOA 1NW6A 1U1FA 3PC2A 2FN4A 4CF3A 3FVTA 4OJMX 1JDUA 1M34E 1M6WA 4R81A 4UASA 4ESHA 2VEDA 5ECWA 3UGKA 4K28A 4FINA 3GLIA 1NSYA 3P2IA 3WV4A 2DMRA 3HJFA 2I5PO 2IIQA 1ICEA 2F67A 1DAFA 4JS0A 4ND3A 1BKDR 2P0EA 3QVGA 3S27A 3DXZA 4ZZ3A 2BFMA 1RQXA 2X8AA 3MJVA 1NP6A 4X71A 1AXRA 3VOTA 3ZBPA 2EBUA 3D6VA 3UB3A 2ZRQA 1ZX1A 3ZHZA 3AFOA 3UOWA 2HQ1A 2WWTA 3KTDA 2NNLD 2BHRA 2PLNA 3WK7A 3KAKA 3RVPA 5AJTA 5HMMA 1FYFA 3GRVA 3LKZA 5IAOA 1ZM4A 3D3WB 3LC1O 3EQ6A 1YDMA 4I6EA 1XXLA 1E1RA 4YRGA 2P2DA 5LWQA 1S2GA 1W5BA 1W34A 4FN4A 4ALJA 1GNVA 3HADA 3W2FA 1E3DA 1QS0A 2ZATA 3GHYA 3BIWA 4PGFA 1DFHA 3B20A 3JQFA 3UO8B 2WJWA 3PUJA 3OHSX 3Q0IA 1DZ3A 1VKHA 3Q7RA 5EZYB 4EDFA 4MR8B 3GZTB 3MWJA 3F49S 4K9MA 3KWJA 4LFAB 3Q88A 3DCIA 1P4AA 3FDXA 2IKSA 4S35A 3S44A 3FPLA 1EEHA 2OHFA 2Q0QA 1JA0A 2HCBA 2Z2ZA 2QN2A 4WD3A 1FSPA 1P9OA 3GOQA 4BMXA 4DSZA 1THGA 2B5VA 2FR1A 4MR8A 4EGQA 1GGEA 3B9PA 3R7LA 3TR6A 3X1KA 4DY4A 4N76A 4P0PB 1M0TA 3B38A 3BAFA 1ORVA 4UVDA 2ZXFA 3WE7A 2M32A 1W48A 1JQKA 5E9JA 4OP2A 2FSFA 2C0QA 3DOEA 3K2BA 3JRWA 4LISA 2YRWA 2NV6A 3K15A 3R3HA 2BF7A 1A82A 2B4TO 3RK4A 1H4SA 1JHDA 1XV5A 1O8BA 4H17A 2PT5A 3TZ6A 2JGIA 3HCNA 1WU7A 3AOEA 3CVOA 4KPFC 4HGYA 4ZMBA 4F2PA 5CB4F 3IIJA 3VNVA 4Z3KA 3F71A 3GLGE 5TF4A 2I7TA 3B6ZA 3QV1A 3ITNA 2LCQA 4BLOA 4E1AA 1ORWA 1GTSA 2XYQA 1RLTA 3OLZA 4KMSA 5C80A 3H7AA 2XOKA 3LYAA 4WUVA 2QJFA 3EPHA 1T35A 3QFCA 1V5GA 3BMCB 3OPXA 1QGYA 2ZSDA 4G5GA 3LSTA 5JYBA 2XYHA 5DGCA 5DSXA 2V4ZA 2PA3A 2Q2OA 3FNFA 4W1RA 2HPZA 3K2EA 5E1OA 2Z4SA 1RU3A 2AJBA 3I9JA 4L8FA 1XNRB 2DB3A 4KRYA 3NIGB 1VKRA 2GESA 2KBFA 3A2MA 1KO8A 1NIPA 3RU2A 2XGJA 5A9SA 4FQ5A 2AA3A 4MGHA 1JXQA 3FWKA 3IP9A 1KJZA 3KDAA 3EFEA 4L72A 4FGLA 1Y4SA 4YUAA 3E70C 1Y1LA 1GAWA 3BHIA 4Z4HA 2LUOA 5HMLA 2YNMC 2ZSJA 1MH1A 3SIRA 3MWDA 1B4DA 2OBLA 3ZYZA 4YQZA 1H2ZA 2OXFA 3I6QA 1JSCA 4F5EA 3KD2A 4MWOA 4BUCA 1U5AA 1UK9A 2AZ4A 2PM8A 1TDJA 3N2KA 4R1OA 3U4GA 2YIJA 1FDRA 3AUUA 3OKPA 3GLQA 1J1IA 3VYWA 4O2BB 1OLSB 2I67A 1E6EA 1ZM3A 3NR2A 4FYXA 4H0FA 4B3HA 2DPGA 4YIHA 4KO1S 2DY1A 5GGXA 5EXEA 2WHEA 1SZJG 1XWFA 4FFBA 5IP5A 3U0BA 1GDTA 3COZA 3NANA 1SCNE 3PFBA 1FPMA 3U49A 1AQLA 2W2LD 3A37A 4CM8B 1VPEA 2LW7A 1PFYA 5G02A 1L3CA 3HRHA 4BAGA 3QXSA 3EB9A 3OTQA 4PLWA 3T1NA 3U3XA 1I80A 2J0VA 3KPVA 4PXYA 5DEIA 1Z3IX 1AGXA 1LVUA 1TMOA 1K5HA 4LYJA 4M87A 1Z7BA 2IWHA 4QVIA 5BURA 1YHZA 3H87A 5TPWA 2PUBA 2HRQA 4MYHA 1XD2B 2SKCA 2ODBA 1ORDA 2PUJA 1ML3A 4KFTA 3A6FA 3GDHA 2VYND 2WM9B 3ENNA 4A8JC 1M7GA 1U8FO 4OGKA 5F5XA 3V97A 3HM2A 4AECA 4HNTA 2PV7A 1TPZA 3AFMA 1F17A 3B6IA 3NV9A 3HJBA 4QXMA 3LBFA 2VO1A 4UATA 2WWHA 2QYTA 2RK6A 3K5IA 3VNAA 4BVAA 3UAZA 1RYZA 5C8YF 1K3UB 4Q03A 4ZVSA 1ANKA 1WIWA 1FC0A 4ASUA 1GNPA 3KJGA 4QREA 4ZANA 5C52B 1WW3A 2GM4A 2PLWA 1NVVQ 1KMHA 1EM8A 3PUKA 5EZSA 3TOCA 4YV0A 5ISMA 1X86B 2OCDA 1RQ7A 1TU4A 1PTJA 3TRDA 3WLSA 4XVUA 1K97A 2D5AA 5E38A 2FXVA 3W4KA 4FIZA 4X1IB 2Z2KA 3U3RA 1WS6A 4ZTZB 3KB1A 3PG5A 1S6YA 3OJEA 4JXXA 2Z5VA 3M4NA 2CHVA 2VPYA 1KSGA 1AIPA 2HLNA 3QITA 4ZI2A 4BLVA 4JJ6A 2BKLA 3L9WA 4KGDA 4NHOA 1DC3A 4R1MA 1MQ9A 3OE7A 3DHVA 4NSNA 1N0IA 2F9FA 1BU8A 3UATA 3VZPA 4YJFA 1F4VA 2R25B 5CLJA 1U2GC 1GD1O 2P69A 1OX4A 1TUEA 4H18A 2QY6A 1BEZA 3C8MA 1XNJA 3K09C 2GAOA 1ODFA 1OFUA 1XLTA 2HOQA 5AD1A 3L18A 4YS6A 3B2QA 4EFNA 4F97A 5JSZA 1IQPA 2P4HX 2Z2IA 3F7MA 3LHDA 3BT7A 2P9EA 2EWMA 1UPFA 2JGDB 2O3SA 3QLJA 5EE0A 3EZGA 5CLFA 1JKIA 1YDHA 5K8JB 3H6KA 1QIMA 1NKSA 4OO3A 1BGXT 3V3KA 2J7PD 1VMKA 1I4OA 5IDXA 1L5WA 2R97A 3HU3A 1J8DA 1T13A 3JU3A 3LG2A 3RVNA 4HPJB 1BE1A 1U2SA 2W43A 4B2LA 3ET5A 1N3LA 2DUJA 5E6RA 5WRFA 4DRZA 5IHXA 1UZLA 1RABA 2RJOA 2Q3MA 1GQOA 5CLHA 4FZ5A 1KPHA 2RMKA 3QY0A 3RV4A 3OQ6A 4EB0A 3PC8A 5AKGA 1ZAKA 2GF2A 3AHJA 3ORFA 4OLFA 1T0JB 4LQCA 4E33A 1QFJA 2X7HA 2YTZA 1KEPA 3C1TA 3JD2A 3HVJA 5BNFA 2B3TA 3VAZA 2QRVB 1AF4A 1EXDA 2CDRA 2QTFA 3GJYA 3H9EO 3JZMA 4J2HA 4DTIA 1KOJA 3I76A 2ON6A 4LC0A 5GM2A 3PYMA 4DJEC 1EB8A 4DSOA 2PT7A 5G53C 5AVYA 2ZJFA 3D6UA 2HLDD 3K9QO 3QVLA 3CZAA 3OI7A 2ZBFA 4IR7A 3LGXA 3OVMA 3L1IA 2FOIA 4XTCS 4R7GA 1A5BB 1XTUA 3HACA 1ZXXA 1SVMA 3O8QB 1E79D 3RYHB 4EBFA 1LV7A 1RHRA 2AUMA 3ASVA 3TZBA 2RI1A 3V8PA 1X13A 2BMWA 5K9ZA 1NFFA 2EWVA 1IL0A 1ZLYA 4ZARA 1CS0A 2DM6A 4D1YA 3D6FA 3PRHA 5KQMA 4YAKA 3ICVA 4OQLA 1OAOC 4BBAA 1OFGA 4IRMA 2IQIA 3IHKA 2ZANA 4E5DA 1J0CA 1JR3A 1X7DA 3L02A 4QDOA 3K5WA 5F4ZA 2JLXA 3DKPA 4GX5A 4AY3A 4DZZA 4F04A 2HMYB 3F1KA 5G4KB 2ZI9A 4KWIA 4RL6A 3DE0X 1II0A 3FTCA 4N9QA 4QDKA 5KMGB 1K06A 4WXHA 2A0XA 2V7XA 3JQAD 4MQLA 4AIIA 1BSVA 2J7KA 3AUYA 3EASA 1B16A 3O4GA 1DARA 5IUNC 5CA1B 2QRQA 2W6CX 3HB7A 2OV4A 2VA8A 3I4CA 3B53X 2QROA 1GU1A 4JOCA 3IR5A 1U3UA 2ZSFA 4QASA 1BH2A 1XZJA 2L82A 4U6SA 3IMEA 3TR0A 1UQRA 1KETA 1F48A 3GRKA 4JLNA 5AI9A 3AW8A 3DYIA 2GCIA 1NG1A 2VHWA 3UH1A 4A8JB 1ESMA 1U11A 4JENA 1Z38A 3LCRA 1DTEA 2VJQA 4BVJA 3QHAA 1SQGA 3CX6A 3KKNA 3H83A 3FOBA 3V4VB 1LW7A 3BGIA 2ZWPA 4P7FA 2GCGA 2HHHB 2CJFA 1U0EA 1VE5A 2Q3FA 3EG9B 2UDPA 3OX4A 4LGYA 3DS8A 4G2NA 4UNRA 5KUTA 1H9CA 2FX3A 3JQCA 2L69A 1KE1A 2AW3A 4GX1A 3U7JA 4BU1A 3LUKA 4BWYA 2EKLA 4P3NA 1MO4A 4IDOA 3J7AC 4QNMA 2FYTA 1OXUA 3GZJA 3HCPA 2A7QA 3I2GA 1UBOS 5JAOA 2WHQA 4BRUA 3SCZA 3WBKA 3K9FC 4B6PA 1H8ED 2B8JA 1HKHA 4DA9A 3H4IA 3W0LB 3AF6A 1W25A 3KIPA 1FQWA 1IOZA 2X42A 4KZPA 5DXJA 1N6HA 4KVZA 1S5PA 2TS1A 3Q0EA 2PGNA 2VDOB 3R3XA 4YROA 2W6IA 4C4ZA 2IXBA 4DLZA 2VBIA 3L7DA 1Z5NA 4JUDX 4OGLA 4E46A 4IWYA 2Z8ZA 3G0GA 3EFBA 2XODA 3L9XA 4QJ3A 2H9AA 5LFAA 1ZUHA 2IXAA 3QPDA 5I45A 2PXXA 1T9ZA 4M9XA 4E5YA 4XM0A 5H5JA 3PX3A 2R00A 1PWYE 1ZD1A 4QOHA 2GA9A 4RA9A 4YV2A 2E5FA 4DWWA 1QYDA 5ULLA 1H1DA 1NWHA 1G3RA 2RBGA 2QZPA 2VQ6A 3BB1A 3BHJA 5IVKA 1GGHA 5KYKA 4QPDA 3H7IA 3PPYA 2YNMD 2J87A 3MYRA 5H4GA 2H1VA 1RYMA 4G5YA 5K3FB 1E4OA 1I2MA 2C2WA 2F43B 4H6XA 4XYGA 3A1TA 3UPTA 3AK4A 3PF8A 5ALXA 3K96A 2AD5A 3CRRA 4DLYA 2CCKA 4I5FA 1I1OA 2ZB7A 3SN6A 1ZOLA 2EZ8A 3T5MA 2J3IA 2JZNA 4B7XA 3FOEC 2I2WA 3AY0A 2JBWA 2P6RA 2QTVB 5B58T 2R85A 2VJOA 3Q1LA 3QGMA 1JTEA 1LFAA 3ESDA 3GUUA 3EVDA 2W2KB 2XB4A 4J1TC 3SSNA 1DEHA 1V25A 2DLDA 2PGIA 2FSVA 2X0JA 4GRIA 5LP1A 3C3EA 3GO4A 4M1KA 1KBOA 2ORVA 4B85A 1PEKE 1FP4A 1QF6A 1BFDA 1GUYA 3ANLA 4Y18A 5AXDA 2GPNA 2JLUA 3JAMA 4AJKA 4FNGA 2B8WA 3MJSA 2R87A 1O3YA 4Q4HA 2VT6A 1XEWX 1I3CA 1UBKS 2O0KA 1T34A 2E1RA 3VKFA 3LTNC 3C5VA 2WFMA 5DNEA 2HX1A 5L40A 3SSMA 1JG4A 2D7JA 3S2IA 1JT9A 4EG6A 1Z3CA 5CJJA 3E4DA 2EF0A 3TXYA 1J8YF 3MRVA 4K9RA 3E3LA 1JQAA 4D92A 3G1WA 5GY7A 4CCAA 2HBQA 5DNCA 3VSEA 3ON5A 2X41A 2PH1A 1PR5A 1KFKB 4UUOA 1SEPA 1KE2A 1NHGA 1NBWB 2GFIA 1YC2A 2H0RA 2XD9A 3GRUA 3QW4B 3RSSA 2IS6A 1Q7CA 1T26A 6NULA 2ZIZA 5AVJA 3T54A 3M1LA 3VYVA 2A30A 4DUYB 2QQEA 4PN3A 3T7SA 4JA2A 5EEHA 4GI1A 1N5LA 4I0WB 4MW0A 3TL6A 3LHSA 4LJ5A 1OVMA 1M34B 3DM5A 3KXKA 3Q85A 4P80A 4AMVA 1Y1PA 1UWCA 1E1LA 1PSZA 3LJKA 3T99A 5LXTB 2H07A 1MOPA 4GP9A 3UMSA 4YRJA 1VJ5A 5D85A 2PANA 3TCKA 3A6PC 4DR4B 4D46A 1MQ8B 3MWFA 1SXIA 2OBXA 4B3XA 1NUAA 1X7WA 3V1MA 1OFHA 1QHXA 4NG5A 1C7IA 2PRKA 3S0JA 2I3GA 3L4JA 3VR0A 4RLQA 5IDWA 2ZVDA 4GG1A 3PIDA 4HADA 3HZHA 2O06A 1ZD5A 2AYZA 2A1TS 3I6IA 1RPZA 2G88A 2PLAA 5B4TA 4EAQA 4OU4A 2EP5A 3SKVA 1BQEA 1D09A 1QYVA 3ZY2A 1QGDA 3UNXA 4I9NA 1E59A 3EZNA 3VJLA 1MX1A 4J6EA 3USCS 3HM9A 1ZO8A 3OZEA 4B43A 4YQYA 1HG0A 4G1MB 2X5JO 4UU0A 1H94A 5A3JA 2O1XA 2WHYA 3TBHA 4C7KA 1HFWA 5BR7A 3NDRA 4FCWA 2PJDA 2Z1MA 4TUYA 1KH3A 3AEYA 2JVIA 4Q1VA 4BZXA 5FA8A 2CMKA 4YCAA 5BQFA 3C1AA 5T6MA 1QORA 5EIXA 3I72A 3QIVA 4IZOA 5HF8A 2OEPA 3P20A 1ZNZA 1ZH2A 3D0RA 3SC6A 3VMMA 4PG8A 5CCEA 2ZYIA 2QRMA 1AA9A 1U8YA 2IZ1A 2JH9A 2X13A 3KAQA 2XJ9A 3NHUA 4HPWA 1TCUA 3FUUA 3JYPA 4MV0A 5DISB 3VNRA 3JTMA 1YE3A 2VDWB 1L3BA 3LPLA 1WXHA 4ZU6X 4Q82A 3OUUA 5FBLB 3CH4B 2QUJA 4C4TA 1HXHA 1HYGA 2XUOA 1SVIA 2D1TA 2HFKA 2ZYDA 3UAYA 3VISA 2BLLA 4ZRDA 4HLUA 2RIPA 4C7MA 2FPMA 2HAEA 4HH3C 4QHYA 1E2IA 1KSFX 1RWBA 4DYHA 2GLTA 3RVJA 5TPWB 3GJ7A 3U7RA 2VF5X 2RGDA 3AR6A 3EWAA 2BH2A 1RRVA 1XTSA 1UJ5A 4HY3A 2Q5FA 2CV0A 4EPWA 1AZLA 1N2XA 3PGA1 2H1WA 4XKJA 5LQNA 1V8BA 3OLCX 3HCDA 3RSQA 3N0WA 3PNQA 2AR7A 2VNHA 4A7PA 5BW5A 4NZZA 3JQQA 2O2EA 1WHSB 4JT8A 1ZIXA 2A4MA 2HH9A 3ABSB 4HC4A 4NBNA 1XYGA 3CF2A 4JI0B 1HPLA 1SR8A 4KREA 2BI7A 3K0KA 3S70A 1W36B 5DTRA 1KP3A 1OBFO 4LJ8A 1YA8A 4PO9A 5BUZA 1MEJA 2KX7A 4IIJF 3ZUGA 1XZCA 1QU2A 1N75A 3C3PA 1H9BA 5JBQA 1G3UA 1TC1A 3BFKA 3N75A 4RIIA 5EMHA 3RVMA 3UV3A 4WGFA 2AI2A 2DCUA 3OE7D 3SAJA 4B17A 1H2BA 4E09A 2Z0MA 4P3KA 4DIKA 5IZ4A 1YZUA 4JBXA 1I13A 3P5BA 1NF2A 3ZWNA 1OH8A 3ANTA 4MS3A 4YY3B 1EVEA 1CULC 2DECA 1C3JA 1PZXA 2HEGA 1DRKA 2R4TA 2VK2A 1QGOA 3BB4A 2I76A 2OO5C 4HQOA 4MKZA 4QPJC 5EWMA 5C0OE 2W70A 1GLVA 4QHSA 5GP1A 4ACBA 1ID8A 4IDNA 3HYCA 1U6JA 1YRHA 5FHQA 3SIPA 2IUYA 2J9RA 3HCAA 2ZK7A 2V59A 3JY6A 4EKNB 4G25A 4TOIA 4XYBA 3VV3A 3DPIA 1JZTA 2C8KA 4NFLA 1N3BA 1V7CA 2ZGVA 4IVNA 2C04A 2QMHA 3KQTA 4TTTS 3WJ1A 4RTSA 5IKEA 5FNVB 4FB5A 4RFSA 4X3CA 3PU6A 4EYGA 5FPKA 3VNUA 3IOMA 2P6OA 5AVRA 1AHPA 3NATA 5J5CA 4DDMA 1XP8A 4D8YA 3AM1A 3PNMA 3O3MB 4RD0A 1JEQB 1YDWA 4YCDA 1G7RA 2XMGA 4CG0A 2PUWA 5F7OA 1VIVA 2JAPA 2ZIXA 1KZGB 1W75A 1RFGE 3MJHA 4WNAB 3WYGA 4BTEA 4ZALA 4CN8A 4EI2A 4JOQA 4KX5A 4QUJA 3QBVA 1P4JA 4Z4GA 4MO2A 1T2AA 1NBHA 3GNQA 3U7IA 2H5IA 5KNCD 2PDAA 2BY4A 5LQAA 2IP4A 4DUGD 4U4AA 2QTNA 2IHTA 3SS7X 3WLRA 3H2IA 4JYCA 1PGJA 5HUHA 4NECA 1G8KA 1UPCA 4DLNA 5FT9A 4I1IA 3SQOA 4DT1B 1V4NA 3ELYA 3TLJA 1Z17A 1VLVA 2HA6A 2O2HA 4LDPA 4RIEA 1YR8A 1ZMOA 3IUEA 3MFYA 4MVJM 2C7QA 4D9CA 2ECQA 2GD6A 2JANA 1KSHA 2WDZA 1WQ1R 4RADA 3ACDA 1Q1ZA 3D6AA 2PRYA 1ZEJA 5K01A 2SCUA 4I2VA 4M22A 1GQQA 1HWYA 2WVJA 4BO4A 4C87A 1E9EA 2VPQA 3IMCA 4PFKA 5LDDC 2LCFA 3OZBA 2AJ8A 1MQAA 5DHUA 1TECE 3GUVA 1B74A 1DC8A 2BDEA 4IIXA 4NG4A 1V47A 2FWMX 3W8NA 3RUDA 2NM0A 4BC0A 3HSKA 5FIUA 1RYEA 4BV3A 1TO6A 1KDYA 2J45A 5GZ1A 1N2CB 2O3TA 1VG0B 1WDLA 3E9MA 3DZIA 4O4IB 4ZQIA 3BD9A 1FYVA 3OO1A 3FYTA 3PUXA 4LYHA 2PNFA 4XPIB 4KAJA 4Q34A 5TRTA 3T06B 4EITA 5IKMA 1TQ8A 3AT1A 1G3MA 4G0MA 2VRWA 1T9CA 2D2IA 3VYRB 2HDHA 1TO1E 3G6KA 2FK8A 2WSIA 2P90A 2ZIWB 2YFHA 2QN7A 2IOYA 5T8KA 5B3AA 3LUFA 2CUNA 4EPTA 2DQYA 2KM1A 4BV2A 3OETA 4OAQA 1SRRA 1VIMA 2Y4OA 3G9TA 1Z4KA 3QVSA 1AN0A 3DTYA 4MS4A 4F21A 2VNAA 3L0IB 3E82A 3IO3A 3M0EA 5IF9A 1ND6A 2F62A 4JGGA 2P9YA 3FSGA 1FNSA 1KK2A 1XAGA 2XQGA 3CN7A 4Y6RA 2NU8A 1XTTA 4F5DA 5DBFA 3KSMA 2OCAA 3KLBA 4EHJA 4BVHA 5JXWA 2AKEA 2VUHB 2VXOA 4AS1A 4AYXA 1OB2A 2FZ5A 3WK9A 3DLAA 1M0SA 2P9FA 3BDVA 1PFKA 1GPMA 3QOYA 3BMCA 1K9SA 1EBFA 4G89A 5BORA 4YMTA 2ZRAA 3INNA 1FFWA 1MXHA 3ESZA 1I3KA 1LWNA 3K0FB 3CKMA 2J33A 2R48A 4Y98A 3RHSA 3VAAA 5JAUA 1QP4A 2CF6A 3QW2A 1NR5A 4PAMA 4KN9S 2BT4A 4BP1A 4D9IA 3RVQA 1L4FA 2CLFB 3OEYA 2AE1A 1P1RA 4MWDA 4QELA 1H8EA 1TCCA 3DZBA 2HU8A 4UDNA 4YT2A 1IU9A 4JP3A 4WA8A 4QSHA 1VZ2A 5JD6A 3W6OA 1PJ3A 1BJKA 1UFRA 4HDNB 4B35A 4BFUA 1NXXA 3KCQA 3IEKA 4TTPA 4M86A 4R1NA 5K3SA 3O03A 2I1WA 4DMUB 1VPLA 1WB5A 2XCUA 4TMKA 1P7PA 4BDTA 4YRLA 5JD5A 3ZOKA 3L8YA 5LLTA 4U6NA 2W93A 1FU4A 2Z4TA 3ENQA 4DM4A 5LQRA 4AQDA 1Q0TA 3WK8A 4JLOA 5I7RA 3VPSA 1P6UA 2V7TA 2ZAOA 1P80A 2PHZA 3G6WA 4G6ZA 2Y1GA 4Q1AA 1R0RE 4C7JA 3ONNA 3AF5A 3QWFA 4J2OA 4J0IA 1JHRA 2NYRA 1IXSB 3WYNA 4G0YA 3HA5A 3EEQA 5CCXA 1Z74A 1VPVA 5GZ6A 1L5YA 2EKDA 2JCGA 2FPUA 4YJHB 3ZWCA 1XMOB 5GJBA 3TR5A 3LWDA 2CLOB 2VJMA 4COOA 3MINA 1OZHA 2O50A 2BBOA 2PR2A 4H35A 4HEJA 4OHWA 3VPBA 2J3DA 3ZOZA 2ZIVB 1VBFA 4U9HS 1P2SA 1IB0A 4WZ6A 2XUZA 1WLSA 3AC0A 3O2NA 4O2LA 1OX5A 4UHHA 2Q46A 2HF2A 3GUCA 5EC8A 5G0TA 5HUJA 1T15A 3UMMA 3UK7A 4IP0A 3NX4A 1SXPA 4XB2A 1QIDA 4RSMA 1F0KA 3PGKA 4BMYA 1IK4A 5DLPA 3U9LA 3FWNA 3DC7A 5K7SA 2BZ0A 2G0NA 2OE2A 3INGA 3O8NA 3RKSA 1VHDA 3NHSA 3CLVA 1KZ1A 1U3WA 3ORSA 1PFUA 4JDPA 3UKJA 4E5SA 3SR3A 5KSOA 4RSRA 4OHYA 4KDFA 1HK7A 3LOUA 4FNMA 1K5GA 4UHFA 3I4LA 4WASA 3STXA 1AHHA 1BWQA 1XALA 1L3IA 3IMKA 2AXQA 1NTRA 3LRXA 1TKAA 5EY5B 2Q28A 3P9SA 1PS8A 1USVA 1XZKA 3ANYB 4HUQA 3A2NA 4M1TA 4U3JB 2Z8YM 3FSRA 4RXTA 2Q8PA 2NTJA 4L51A 4EG7A 1QE5A 1ACLA 2I1VB 1CERA 4PG4A 4UEWA 4BLRA 1UXJA 1GN9A 2PKQP 2VDLB 2YZ2A 3FMGA 3TLEA 4ALIA 2GD2A 3SHVA 4DQKA 4EI7A 4YRNA 4E6PA 4GLOA 1VE6A 3GDOA 4RMHA 2ENWA 3WIOA 1XPUA 2WVAA 4YPVA 2O23A 1XU9A 4JITA 4M6WB 3RJZA 5EVCA 1R88A 3RREA 1DJOA 3S28A 1C0KA 2FN3A 3CGGA 2BGTA 4DLAA 3CVWA 4QYIA 4JB2A 5C1BA 1SUFA 2CBXA 3B2EA 1QC5A 3MNFA 3OD5A 4ER7A 3LKDA 1GDDA 2NT3A 2XNCA 2YVAA 3IV6A 1D07A 1RPJA 2H2WA 4OK3A 5BYAA 2ID9A 1UADA 5JHHB 1U1GA 1T5LA 2ZDHA 5LCXA 4ALNA 2YZNA 2JLQA 1X8KA 4FYPA 4Y67A 4ZC8A 1P74A 4OKSA 3ENZA 1EFDN 4ZAFA 1RKQA 3JQ7A 2V7PA 4H4CA 3D6TB 1XBTA 5EL0A 4YV7A 2CNOA 3FMFA 3F7TA 3LP8A 3WQRA 5AQEA 4Q9JA 5CFLA 5JATA 4GEKA 1HYQA 4MUEA 3H42B 3EARA 3GLRA 2QTMA 3RNOA 5FA5A 3TLMA 2WJYA 3VSAA 3B1FA 1CJKC 2B4AA 2F3SA 1MAUA 4EKYA 4NCBA 2G9NA 4I55B 1JEDA 3RC7A 2WF8A 1WPGA 1BHO1 5NLLA 2ZYVX 5CYPA 2CXQA 2P9ZA 1CLUA 3C85A 5JMOA 1TM4E 5ER9A 4LJRA 4PHCA 1WNFA 2HXGA 3CV3A 4IDHA 2HIMA 3GNSA 4RH3A 5AHOA 2A57A 3GD5A 3ER8A 2R7NA 1G21B 4IV8A 3VU9A 2D54A 2MSNA 1DJMA 1QHNA 1XNHA 1M2KA 1II8B 2QVBA 3OZFA 5ALPA 5AM4A 5ICMA 4UAJA 4LRYA 1TIPA 2PZGA 3R5TA 3RSCA 1BCRB 1IWPB 2OILA 5A7FA 4A8PA 3PDCA 2P4QA 3KOOA 2DTXA 1JILA 1I4EB 3AV0B 3WJ7A 3I04A 2ANCA 2PJRA 2M6KA 1RLIA 1X92A 4HEA1 1ZMTA 3LUCA 1NQVA 3P9YA 3G2PA 2YJ4A 4JQCA 1CEQA 1FJXA 2WWFA 4BCBA 2H4ZA 1UIMA 4GOMD 4YIKA 3QKUA 1C30B 3ZK8A 4GZLA 2EEPA 3DE3X 3HY6A 3AEQA 1NOIA 2V7EA 3GLTA 3OJFA 4GVXA 4ZIRA 1YQEA 2QT0A 1U7ZA 3FVWA 3F4LA 3QFRA 5CDGA 1KDVA 5GIPE 4C76A 2VTDA 4U7PB 3C3XA 1T8RA 2DRIA 3GJSA 5IVIA 1FNBA 3BQNB 1M5RA 5FUXA 1L7DA 4BKUA 3NWEA 2JL1A 1QF9A 1GNTA 4NYJQ 1N6PA 3EJ6A 3MS2A 3O47A 1BCSA 4FZJA 3K31A 4U39A 3MMPA 1WO8A 3QBTA 3QPAA 3SBDA 3TRHA 3W5CA 3SQWA 1GSIA 4AT1A 2OFXA 4K9SA 4MA4A 3RKRA 4H3HB 3V1UA 4QTYA 4OA8A 3JATA 1FU8A 4NBTA 3WIVA 1E3TA 4ZYZA 2WOJA 3LFUA 3KSZO 3U40A 2WU0A 3UMGA 3ZVLA 1TT5B 2YS7A 3R5FA 5K6AC 3PHJA 3ZXXA 4C4YA 2Q1SA 4EMUA 2QX7A 5GMOA 2VZ9A 4INPA 4GPTA 1SBQA 4XOUA 3M5DA 5L3ZA 2OFFA 4CF4A 5ADHA 1CUUA 2F90A 3OA0A 3UJ6A 4OMUA 1V26A 1TLTA 3OPVA 3PX2A 4OXXA 1TL7C 2YHBA 4G63A 4MV6A 3NBUA 4HNAB 1NPDA 4Y1EA 5IRCD 3C6KA 1P5FA 4OHKA 1OLUA 3NJ8A 3WWCA 2ICAA 3ZNQA 2A1IA 1JLSA 4QDTA 4TLEA 4BFYA 3OQMA 3RSGA 3ODGA 1REQA 1J70A 2UZ0A 1DKQA 1GPH1 2XE4A 1E9VA 2H54A 4C0KA 2PRJA 3RE1A 2IYRA 3R3YA 4Q18A 3ZCSA 4GXNA 5SZHB 1BWPA 1S4QA 3GY0A 1XF9A 1J56A 1QU3A 4O2BA 4PVCA 4G0VA 4LV6A 5KIAA 5MF6A 3LFHA 2ZTUA 4A5SA 1Q22A 2JA2A 3LCCA 2O6LA 4XJXA 1N1EA 4N1AA 1TRKA 5CFOA 5AKJA 3M5WA 2VJPA 1XEWY 2VQDA 3I8OA 4LRUA 3A6HA 1DTWA 1F7VA 4NOKA 3T3OA 3DEJA 1COWD 2CSUA 3OQJA 4DUPA 1RWOA 3FOWA 2PO5A 3QLEA 3LK6A 2OAGA 1G20A 3GQVA 4G9EA 5DOZA 4YAFA 3ROEA 2K2WA 3RSLA 5AOVA 4AZ3A 4BN0A 4F84A 5HKKA 5KJEA 1J6UA 1J20A 2FPGA 3WNCA 1EE1A 2PTGA 1B0ZA 3MTIA 4K1XA 2J6HA 3TKAA 1GRRA 3E9CA 4D26A 1Z5VA 1JLLA 1I8TA 1ADGA 2AJTA 4LHZA 4JJZA 4YR9A 1MNAA 5ARBA 4PYJA 1NPYA 1UIRA 1ZUNA 9GPBA 4KNYA 1VLHA 1LPAB 3D4PA 3BB3A 5EI5A 3VI4B 3FYDA 3HGMA 2VTKA 2GJSA 2B4KA 3LLMA 1IPEA 1HT1E 1UDXA 1VHWA 3QTBA 3VNBA 4BVBA 3DF7A 4MITA 1TAQA 1IXRC 1GTG1 1BVHA 5GJVC 4BAZA 2R5WA 1O0SA 3EW7A 2OECA 3BC1A 1HNNA 2P1ZA 3O6VA 4URZR 5COQA 1UKVY 5HQ3B 4H1HA 2G1PA 3O84A 4AWBA 2DWCA 1UXGA 1P4SA 4KSCA 1ZI8A 1ZK2A 5JZBA 5DCUA 4FHGA 1TQ6A 1L5VA 3E2IA 4J0DA 3UJPA 1SB9A 4ER6A 4ZP1A 5EYPB 3SC2B 1CQWA 1H2AS 3UAVA 3O21A 5FOQA 4PZZA 3NYIA 4UNNA 3SDZA 2OAEA 2P77A 5F23A 4OATA 4GBED 3EY4A 1X1DA 2JJYA 3DMTC 2E0IA 1O77A 1ADFA 1ZFNA 1DMRA 4O6VA 4KXWA 1EWRA 1LF0A 2FE1A 1MVLA 3DLIA 1JJBA 2EYQA 4IS2A 1DV1A 1FQOA 2Z1DA 2OB1A 3W2GA 1RRGA 4W7IA 1SXJC 3G9ZA 2ZCUA 4RA6B 4E4TA 3A10A 4ZQCB 1ESCA 5FD8A 4NH0A 3DAGA 4AKGA 5CAEA 2IUFA 5EN4A 1ID1A 1LQ2A 3JYQA 1Z36A 4NU5A 3RANA 3C6BA 1O5OA 3VKVA 3RG2A 2F3PA 3R5XA 1NJ2A 1A27A 4B32A 1DT3A 3PCXA 4IICA 3IV7A 4F5WA 4J16A 3WSWA 1J2JA 1U9IA 3JWEA 3VBEA 1DAKA 2VIIA 5JU6A 1G59A 1OXTA 2C2GA 2PPLA 5C46F 2CDAA 4HFMA 3JALA 4ID3A 1D4OA 4BU0A 5ALQA 5H9WA 1L7MA 2VKTA 2PLFA 4NABA 3Q3GE 1IEQA 1A7UA 3GNTA 3K7EA 4F4CA 4JP8A 1D4FA 1N4DA 1Y5LA 3L7AA 3FAZA 3MRSA 3MJFA 3K35A 5B37A 3SICE 4CCYA 3X2EA 1G291 4FBMA 4R0MA 1UXKA 2GD1O 2GI4A 2ZRHA 5CA1F 2Z8YA 4K46A 3TMYA 4DR3B 1AT1A 1TU3A 1Q17A 1V95A 3OCXA 4WAUA 1GZ6A 4YXWA 1P7CA 4BEJA 5BV2P 3ZVKA 1C8VB 3PHGA 5K3FA 5FV4A 1H4QA 3I9KA 3QVXA 4NV3A 1MHTA 2OC4A 3HBMA 3PENA 3NWBA 4W8GA 1P18A 3M6AA 4C7XA 5ADWA 1XD9A 2ECKA 3HYLA 5BRAA 1N5IA 5DWQA 4JJFA 2BFCB 2QBYB 1QHGA 1E9RA 2Q6VA 4CF6A 1JHZA 1W52X 2QP3A 2QUIA 3CJRA 1PT9A 3EH1A 5I5GA 3TIVA 3SEQA 3TNLA 3ZGOA 4OJKA 1UPXA 1JI3A 1NFQA 2QD5A 1OC2A 2HLHA 2XDQB 3OWXA 2GEBA 1WULS 2K6GA 4XFJA 4X95A 5IKOA 3UMBA 1Z0DA 1EBBA 2DR0A 5BQXA 3I45A 4KRFA 1MRNA 4C1BA 3CHYA 1JFRA 2IYFA 1UEXC 5DLYA 1HRKA 5TQ2A 4FKZA 1W5EA 4DXHA 3EEYA 4EB3A 5M7EA 3WQSB 4TZ0A 1A8IA 1TVKA 2QY9A 4BXOA 1A7KA 1XYVA 4NZYA 1MG5A 3C4QA 3MAJA 4IL5A 4MTCA 4X6UA 1LFDB 2F00A 2XZPA 5CB4B 1XOIA 4Y6QA 5J4HA 5AUOB 3D9QX 1Q95A 5CURA 1N7IA 1Q7EA 4KUHA 5DT9A 3FNHA 5EQFA 1YS4A 2PU5A 3P9NA 3P2EA 4QZVA 4R8MA 3K6JA 3CF4G 2PX5A 1N0VC 3R9IA 1E1QD 3R75A 4UAGA 4YQEA 1YS7A 4OU5A 1ZN9A 4WKNA 5EJEA 1R3DA 1MJ5A 5F3RA 1QB8A 4MVJA 3UUFA 4A0QA 1LC3A 2ZKLA 4DCOA 5MDHA 3IBFA 2ZG6A 1NE2A 1UKAA 3HLKA 4N8DA 4UVIA 1OWLA 4MI6A 3HL4A 3CPEA 2ZZKA 3T3NA 4BLSA 3NIFB 4TS3A 2CW5A 2XQIA 4TKLA 4I5DA 4L07A 1UK8A 1G0NA 4WVFA 5CG2A 1Y8ZA 5FR2A 4AKEA 1LDNA 3VGJA 3KDSE 2D59A 1IBRA 1QBGA 4G4GA 3BXGA 2VUTA 3U1TA 3VOAA 1L5NA 5KWJA 1B00A 1N0WA 5GONF 3K0SA 4IOKA 2A92A 2GN0A 2H3HA 3LDAA 1VI2A 1DE0A 3G7SA 3GL9A 4ZD6A 4CCWA 4CV0A 4XTRA 2X5NA 4UOZA 1Y6RA 2VYVD 1O6CA 2J5QA 3QEJA 4MROA 4K40A 4MWBA 2PKCA 3T7CA 4N01A 2HLPA 4ADSG 5AW4A 3PVSA 5FX2A 5IH3A 4MPJA 4BGDA 2HIHA 3GPLA 1FDSA 4XQCA 3K1AB 5KI6A 4E32A 5IUJC 4ES6A 3U4QA 3EY9A 2N47A 4BWGA 3EGOA 3AKDA 1CJCA 4LTMA 4EVRA 4XQ0A 2VAXA 1G8JA 3J81A 4YLGA 5C5DA 3KLMX 3ZHSA 4KK4A 1FF9A 3LGSA 1C3VA 1PT6A 2ASEA 5IDVA 1DIRA 1M8KA 1PFWA 3W5SA 4DHEA 1NNUA 2ZBEA 4IDQA 4IQ0A 3W8FA 4BO2A 5THQA 2NXEA 4CKZA 4RKQA 5C18A 4II7A 2Z6QA 1ZUWA 4LXHA 2PSFA 3SEZA 1X80B 1M6YA 3STUA 1DQSA 1X6VA 4Q4AB 4X8MA 1IM5A 3CZ9A 2YR0A 3IKVA 2AEMA 3FUCA 5FLXA 2BHLA 3H9GA 2GMWA 2VH5R 4GIBA 5LXTF 1C1HA 5C5CA 3I01A 4C89A 2BVNA 3EGDB 4DPKA 1KFJB 4JL5A 5DGDA 1O96A 1AG9A 1Z4LA 1U8EA 1TI7A 5JS8A 1TJPB 2J0QA 3GUYA 1YRWA 3N74A 3A26A 3E7PA 5EKTA 4JOBA 5CLIA 4ZODA 5TC4A 2JD2A 1WG8A 3JSXA 3VH1A 4FTWA 2O2ZA 4B6OA 5FPPA 4M1ZA 4MJ7A 4XD7D 5KSPA 2QIOA 2I91A 4EYSA 3PPIA 5FNZA 3SDSA 3Q5DA 2WINI 5A4DA 4OYRA 1MEOA 3CUKA 4HGRA 3AF2A 3S1SA 4BX3A 3UXMA 2G1UA 4F91B 4O0MA 2IHYA 3ZU3A 3MWKA 1H6CA 5JFOA 4R68A 1OC4A 3B6KA 1BDHA 1O7JA 5AOCA 3LY5A 2X2OA 1N1DA 4RD3A 5THKA 1QUFA 2YINC 2Z83A 2B6NA 1IVYA 1IHUA 1ENPA 1YQTA 2CNNA 3AJRA 3HKDA 4IDBA 3UA4A 4JEHA 1JFSA 4EJ2A 2JGEA 2PYZA 4F5YA 2A86A 2ATXA 4C20A 3O8OB 1JMVA 2ZJ6A 5CA0B 4JI4B 1XRMA 3QNMA 2GBFA 3WADA 4DDUA 1J8FA 1NNSA 1SD5A 4UTRA 2WUGA 4TYYA 5EXXA 1QAMA 5COAA 4E1VA 4G85A 2NU9A 4BGIA 5AKZA 2W00A 4EQ6B 4MMXB 1SO8A 3QF4B 1Q7RA 5FKJA 1DIOB 3UG6A 1OGYA 2XCIA 2ORWA 4PQFA 4Q4CA 1O94A 3TJMA 1GO2A 1VMIA 5LM3A 5IJ0B 2OM2A 1WVGA 3IPRA 4AMUA 2ZSAA 3F2IA 3LP6A 1GUDA 3OU7A 5HJ5A 1RWXA 4TKUA 1MOSA 2COEA 1B3BA 2NQ2C 2W11A 3N76A 4GF5A 4LDJA 3LGAA 4KIGA 3QBEA 1YJQA 4CG1A 1EPUA 2ONCA 3MQ2A 3RQIA 2YWXA 3WB1A 2IJGX 5C1OA 3V33A 1T2EA 1TMGE 2Z08A 5KJ6A 1P9NA 1NAIA 2OCKA 4N8EA 1YIOA 4Q9IA 3ZBTA 4DIDA 1OILA 3RS8A 5GTDA 1ZM2A 1QYXA 2QV7A 4ZEOA 3AB3A 2J3QA 3KKZA 4AZ0B 4RBNA 2IYTA 1P0FA 5L4LA 5PNTA 1NQUA 1JIIA 2IT1A 4IHJA 1M6VB 2WIJA 3HBFA 5REQB 4CNBA 3HABA 4YBZA 1E63A 3OWOA 5BYKA 4PRYA 1E6CA 5DOVA 5EG5A 3RTEA 2DPLA 2CSXA 3FDZB 4YASA 3E1SA 3UFXB 2CUKA 3E7DA 3ONFA 2F55A 4XSHA 4YRBA 5L51A 2IXGA 2H5LA 4O2AB 3D8RA 1MGPA 2HXSA 1YA4A 3A3OA 1I6KA 4KGZA 5BNZA 4A26A 4CM8A 2XA2A 8OHMA 2Z5GA 4KQ9A 3NHBA 4PLPA 3C7KA 3LDHA 3ONDA 3ZWYA 3MT7A 1PZNA 1EVQA 4A8TA 2XCRB 4J2TA 1YFZA 4BKRA 3LT5A 5LP6A 2YJNA 2RHMA 3EF0A 2J5XA 5D1HA 3WNBA 5T8KC 1TTQB 3GLHE 4KXNA 2VAPA 3EZ6A 5HIJA 1OZGA 1ADBA 4OJTA 5ILGA 3H1EA 1XQXA 1OXKB 1OLXB 3AF3A 3C6XA 3BMXA 3DDNA 1NKTA 4ARZA 1MUUA 1L8LA 4FYHA 1SOAA 2F4NA 2FSSA 3PKIA 4KGVA 2FWNA 4IHQA 1A8UA 1Z83A 3RRXA 4F1WA 1WP4A 5BOSA 1Z0JA 2I2AA 2Q6TA 3SSAA 4YMSA 3FTEA 5TT0A 4L6AA 3U39A 2WF7A 3GCZA 1RYYA 1X14A 1MCZA 4M7OA 5BR4A 5K03A 1A8SA 1ZLXA 3PTAA 4L9AA 1E3WA 5IXYA 3M2PA 3NOXA 1ECCA 3ROQA 4ZC1A 4Y2JA 5LBIA 1J0XO 4R6WA 4EI8A 2JFXA 3WHKA 1T43A 4NPCA 3EGVA 4DCSA 3IP3A 1KI6B 1E2BA 4OAOA 4LDAA 4DWOA 5HNKA 1WAMA 5ALSA 2ORYA 1ZCAA 1OI4A 1E94E 3FROA 2FCAA 4IZHA 4Y2YA 2YMQA 1JP7A 1PJQA 1LK0A 1T29A 3EDOA 4IEFB 3DTVD 2OR3A 1U3FA 1R0BA 5B4VA 3Q2KA 2IPNA 1CYDA 1OWMA 3MCUA 1AM4D 2WPDD 3ITEA 3P5SA 4JKYA 4QBKA 5AO9A 4N47A 4EDHA 2ZAYA 4PINA 1U7DA 1BDMA 4OMFG 1T6YA 2QL9A 4ZKDA 1LEHA 2C4UA 3BYZA 3P9RA 4N3CA 1HEYA 1NLUA 3MJ4A 4RVOA 4V38A 4WOBA 2FSUA 2D6FA 4W5NA 2C8JA 1SKQA 4K6MA 1IMJA 3OCUA 4J0QA 4TT3A 5K8CA 2QXTA 3TL3A 3NYWA 1RWPA 5FBWB 2Z5LA 4HS9A 4GXTA 3Q40A 1EJ6A 3D7RA 2W90A 1Z0AA 3OKCA 1NTOA 2RGNC 4WDRA 4JI6B 5F9MA 5A7GA 4BN4A 1PK9A 3GUZA 3T4XA 1U0GA 2YWJA 2EF1A 5FADA 1Z6YA 4Y2GA 2RHWA 3GIDA 3I34X 4YYZA 3G59A 3PIRA 3AJDA 4HYYA 4KLZA 5DCYA 5J2TF 3V4FA 3DW1X 3M2TA 4E5UA 4PQRA 3WGUA 1QM5A 3IA7A 3RM3A 5H16A 1IDN1 1VLZA 1P19A 4X84A 4IIYA 5EJFA 3UHPA 4YPFA 2X19A 1SN7A 4MHTA 1B1CA 1ZD4A 1ZPDA 4FE3A 3QX7A 2NVUA 2A5YB 3I61A 4DLWA 3KR2A 1CY8A 4YLYA 2BEVB 4JHLA 1G98A 4V0OA 3ZGVA 5DJ5A 3V1TC 3H5VA 2HY7A 4ZV7A 2ZAGA 4HTAA 4CMCA 2TECE 3P0IA 3ZI7A 4N7MA 1EIWA 3KZXA 5DO9A 1LI4A 2H65A 3IIEA 4FSXA 2J31A 3FRHA 1HE1C 4HDKA 4L50A 1P29A 5EP2A 5EXSA 3ROFA 2IE0A 4AURA 4FI3F 1JDNA 5E7MA 1QQBA 3VVMA 3ZEIA 2X0IA 1JHXA 2VUIB 3IDSA 4M1EA 4RENA 4TN5A 3THXB 2PN1A 1P5ZB 2FUEA 5A6VA 4P31A 3W4IA 1F0PA 3ZV6A 2V4UA 1R4MA 4Z51A 2W6ZA 4A0RA 5I4BA 1M8JA 1Y3AA 3IAEA 4G0PA 4GMDA 1RBMA 5LR6A 4BCDA 1YQQA 3RGWS 4Y2RA 1RQPA 3VZCA 3GT3A 2MSKA 2EV9A 3SC3A 4J7CA 2PGLA 2QL5A 2INGX 2Q50A 3ZX5A 1HX7A 3Q11A 1IC6A 5CVCA 2FW1A 2IELA 5AIBA 1NW7A 1RXSA 3UAXA 3ZI4A 3DO5A 4EHIA 3IVRA 3LRPA 2P35A 2JB9A 2YWHA 4WZAB 1L4MA 1F8UA 7GPBA 1GV0A 1ZW1A 1Y6JA 3OQBA 1T2VA 5KAMA 3WB0A 3IAM1 5HF6A 4WKCA 1ISRA 4OI2A 3AI3A 1J9GA 3EPJA 1Z8FA 3AI1A 2ADFA 5A5GA 3NTLA 3NHFA 1ZDMA 4JJ7A 1S01A 1WUHS 1PLKA 4IJ5A 1MMFB 3IT1A 4DM3A 4NENA 1UODA 2IPOA 3L7LA 2VXCA 2F48A 2J9FA 1N6RA 4UEOA 1SU8A 2HSJA 2XQKA 4I4TA 3TAUA 3BA1A 3DVAA 1AUQA 1DAPA 4R1SA 1XP5A 2I4TA 2JGAA 4YECA 5HVNA 1YVPA 2O8EA 1GDHA 2N42A 3RC1A 4EUEA 1U28A 2WZDA 2PZAA 4NX2A 4N7BA 3D6NB 1JYEA 3KKPA 4MMYB 3A1DA 3ZXIA 3GVHA 2BKVA 1LS1A 2WU8A 4IFTA 3X1YA 1FJGB 2CLSA 1T8SA 3W6NA 3IUMA 1F20A 4J0KA 1EGAA 3GBSA 1ZHOA 3KJFA 1AKEA 2EKZA 2QN6A 3RBXA 1RI3A 3DGFC 4HTFA 3ZHYA 2PGAA 1KVUA 3A4YA 2FCRA 1LZKA 3BTSA 4LXXA 1PI3A 2REXB 3BMOB 1H85A 4J3FA 3TD6A 3N7UA 4OP3A 3WKBA 3WRYC 5DHFA 2HHCA 4ESEA 1W4LA 4F2HA 1QZTA 4BQRA 4EHLA 4HAXA 1FVXA 3B3QA 4FWIB 1IB6A 1T6XA 3QQPA 2SBTA 2H08A 2GWHA 3PEEA 1UANA 3ZIAD 1UMDB 5K6TA 5JO0A 3SHWA 3QOFA 1CHDA 1GYQA 2IEIA 1R0KA 1KAOA 3PI7A 2ZRDA 4I1OA 3J81k 2EJTA 5C34B 3W3AH 3FPEA 5FWNA 4J3NA 3OKAA 3R44A 5BW8A 1VLJA 3FPKA 5EIWA 1ZOPA 4INJA 3KE9A 4QRIA 1L1QA 5A4MS 1SUBA 2AN3A 3S55A 1KO7A 1O4WA 3V48A 5H59A 3T3DA 3AEUB 5KHAA 4LKRA 5DFAA 2WD9A 2AQ8A 5KVCA 3CVVA 4NDAA 3UT0A 1PQ4A 5I3CA 1KO5A 3NM4A 2F1KA 1VCHA 1GGFA 5HDQA 1FLDA 1Y9ZA 5BWCA 1DAOA 1XI2A 4C21A 3G8AA 4F9EA 4JQOA 1E77A 4XJTA 1IIRA 1ABFA 1FP1D 3HC7A 1PKEA 1V1MA 4GRDA 4BNFA 4O4LF 4DAOA 2BBWA 2ZE8A 3BILA 1DOZA 3X1XA 2HMSA 3H8VA 4RZ3A 1LJLA 1Q3TA 4GM0A 1XX6A 4ZYTA 1P3Y1 1US8B 1VRCA 4D4MA 1YMVA 5C32A 4IKEA 4WFQA 3Q2IA 2FDRA 4I4NA 4DJDC 1QO0A 4MVJE 1OXVA 1KI8A 3EQ2A 1IZ0A 1ISHA 4IVRA 4TL7A 4UVGA 2YHIB 1XN1A 1YUBA 3Q7TA 2KHZA 4MUHA 3RRMA 4ZO4A 5KC8A 1N1GA 2EARA 3B7GA 1T9GR 4WINA 1WXGA 4YJ3F 1S8FA 4Q4JA 1XMSA 1ONOA 3ICOA 4MGYR 4BTVA 1R4NA 1SCBA 4WT7A 2MMGA 3PT9A 2EG9A 2Y6VA 1E7RA 2HV8A 3OZIA 3OZXA 2PE5A 2GXAA 3TSCA 3G5TA 3ZU5A 4LE0A 1X9IA 4LUCA 4W5HA 4BX2A 1AQIA 1RCTE 2H7VA 3INRA 2R68A 3WWZA 4B6RA 1XCPA 1JLHA 1R8JA 1U0OC 3LX6A 5IJ9B 3QEKA 4MRMB 4C08A 4DLLA 3TDMA 4P4NA 1FDIA 3DKRA 3FDZA 2BONA 3DOCA 1FUUA 1TEHA 3SKXA 2R00C 5D8DA 1BQ3A 3BULA 1AKWA 3I05A 4MLPA 3L0YA 5HFJA 5FBRB 1RHJA 4G01B 5EP1A 4X6XA 1LDEA 3Q8LA 4N48A 5F98A 5CK5A 4AMYA 1EG7A 1C9MA 2YWBA 1O94C 2D1FA 3CA8A 3FF4A 3LC7O 4FDVA 3ZKWA 5K4HA 3ZPXA 2DHDA 1XRLA 2WAYA 1NVKA 1GARA 5BWMA 3PLAE 3UICA 2O8CB 1CNMA 1INLA 4W99A 2EX4A 5A9RA 1NRIA 5B1SA 3WXBA 4C07A 1VCNA 3W9YA 4ZZIA 3K70B 3PFFA 2R7MA 3VO8A 2GERA 2XTNA 3U4HA 2HF8A 2B2XA 2I55A 4V0MA 3UJ7A 5KWEA 4KBYA 1FNCA 4XWKA 1Y37A 1ZH0A 3JXEA 3BA6A 2I1QA 4PV7A 8AT1A 2O57A 1N4AA 4DMHA 5CIYA 1BG6A 2PAFA 2XXJA 2YHAA 4NMMA 3TAXA 1R9GA 4DLTA 4N6OA 4US2R 2ACKA 2WWXA 3LO5A 1BOOA 2ZBVA 1K8RA 4HNGA 1KOLA 3HCBA 4MKGA 3AVOA 4B31A 1RJGA 4HAYA 2NACA 2VDNB 1YK0A 3OQHA 1X1TA 2R6CA 1DLJA 5EFOA 1VJ0A 1S2MA 4YP5A 1X7XA 1FXWF 2ZFUA 3EK2A 1SBIA 5D3MB 4ZRMA 2GCNA 3JSAA 4TVSA 3ESBA 1EFHA 1EQ2A 4PSDA 2Z3ZA 4XUGB 1EXVA 1OFIA 4AJ4A 1JECA 3ZDZB 4LXYA 2C78A 4NAVA 2XXAA 4MAAA 5LYJB 1JQ5A 5ECGC 4XB6B 1XEAA 4OXIA 3E9EA 2IIVA 4XSVA 1CCWA 2JH3A 3BE4A 2A5GA 3EQ7A 4WVLA 3PZBA 4EY7A 3THRA 4CGZA 3WP1B 1Q84A 2CXTA 2WUEA 3I73A 5IUKC 1IEVA 2GTIA 2HHJA 1L7BA 1VE1A 3NJRA 1YJXA 5E1BA 4BQNA 4RJTA 1VE7A 1U2GA 4FILA 3WL8A 3LM8A 1UKCA 1Z8NA 4Q9KA 5F52A 4X7RA 2G82A 3ETEA 3O8LA 2XVMA 4ERNA 3I5AA 3K92A 2J3HA 2FFBA 4ACAA 1A4IA 3O26A 1S2IA 1ZVVA 4JXZA 1QTRA 2J9GA 1O96B 2B1RA 3EOAI 2VK4A 1HSOA 1XUOA 3MINB 5BXYA 1EUYA 5HRUA 2R86A 4PXAA 3ZDYB 3LOPA 2H8GA 3E2MA 4HAIA 3ER6A 2HCFA 2JZCA 3GLGA 3N7TA 2D74A 2PXHA 2YDYA 3M9WA 1TJNA 3IUSA 4LYFA 4PBRA 5LU9A 5CIWA 3PEWA 5TXGA 1OIWA 3QV2A 4UULA 3UK2A 1BXZA 1FDUA 2H4JA 3ISTA 4QU0A 2PX4A 5JCPA 3GR6A 3B8HA 1SHKA 5IM4A 4EFKA 4WESA 1PZHA 3WGOA 1PFGA 3DM9B 1G64A 1RIIA 1S9HA 3C14C 4EX7A 3V6MA 5K3CA 5BSRA 4HGQA 3DV0A 3FGNA 1E89A 5HIAA 4IUBS 4KE6A 4N03A 3NP7A 1A2OA 1AQUA 4M0FA 2O3RA 3IQHX 3FPHA 1I0LA 1BGVA 1P3DA 2HRCA 3HRKA 3UMFA 4EH1A 1XPJA 1Y1RA 2WFZA 2XUPA 3FD8A 4NH4A 4QDXA 3QELA 3ZHXA 4CLOA 1KWKA 1WBBA 1TAUA 1GYRA 4CTMA 2VSYA 3SOPA 4OIMA 2C96A 3O8BA 1Z0IA 3R6LA 4O4JF 1K7EB 1KJWA 1OF1A 2EXXA 4IJWA 4ZCSA 3R0IA 1GAJA 3OQVA 4MW1A 1I6LA 3C3AA 1RZRD 3IAS6 4H77A 2XNHA 5GWXA 1HEUA 4X97A 1QCYA 2FK7A 3SX4A 1D4AA 3T9FA 3TQSA 4EG4A 4DV3B 1BXGA 2AFHB 5DRTA 3H9BA 4DLRA 1HFKA 1PYDA 1YRQA 5FNVA 3V7YA 3BDIA 1AK9A 3SD7A 4M98A 1QFZA 4QNNA 1A4XA 2O9JA 2Y1FA 3D4BA 1JR3E 2G80A 2VPPA 3MA0A 4HWOA 5HQJA 5BNTA 3VJKA 1JWBB 3C3YA 4QBHA 2V55B 4UVEA 4Y9RA 5HX7A 4AAYA 1ZR4A 2ZIEA 2VRBA 5A5EA 3DWGA 2PH3A 4D4JA 3PL1A 4KUEA 3HBNA 3N05A 1KC3A 1CR6A 1NRWA 1YASA 2WF9A 1PZFA 3X0DA 2WHPB 2QS9A 4HEHA 4YUZA 1SU7A 3EVGA 1GKLA 3FB4A 2W6JA 1QVAA 1KI1A 1NZFA 3GGPA 4XSGA 4R1UA 2Q5OA 4TRRA 4MIYA 3ZX4A 5CD9A 3DVRX 4INZA 4JBHA 4UTZA 5GAJA 1J2YA 4P3XA 4NEGA 2O8FA 1KS9A 3DYBA 4HDKB 4Q1FA 5DRYA 1GA6A 2P40A 4RF4A 2OPHA 2XCLA 1EP1B 2C4WA 2PMFA 3WGIA 1GSOA 2C4MA 2JFQA 3GRFA 3ET4A 3ECCA 2X14A 1TVKB 1M1YE 1RAHA 3BX1A 4WY8A 3E9RA 3K1JA 1FS6A 1CUCA 3JRXA 4P3OA 1UMBA 4PCLA 4L3OA 4UFNA 4EPVA 4FDMA 1F7UA 4BP8A 3VSBA 3RQSA 2RHHA 3A7EA 4GDMA 4BO5A 3GLGB 5LA6F 1J1ZA 3WRXA 1ATZA 2ZVPX 3LDFA 3WWPA 3GFRA 4E2FA 3A28A 3PXXA 5JTTA 5KREA 3ZJUA 2JAXA 2H4YA 5AKIA 5EXPA 1OH7A 3AXSA 1YSCA 3A3YA 3QKRB 1RLJA 4YT4A 2I3ZA 1NYRA 1BZYA 1S2NA 3M6XA 1WRBA 1GTVA 3ADBA 3M81A 2IYXA 5DNDA 1RRPA 4ENRA 3FOZA 1JEEA 2HJSA 3DL0A 3HCFA 4J1NA 1YK1A 3UK0A 4CVNA 2QAGA 4LRQA 1USUA 3K1AA 1BVRA 2JEOA 3O1IC 4NICA 4M0CA 5LZ7A 2MSLA 3LYLA 4G8JA 1CKEA 3AUKA 4G0WA 1JTVA 1O4VA 4DSUA 5MN5A 4IXNA 3JQPA 1R37A 4D56A 2JVJA 2WSLA 3QLTA 3ZHQA 4UUAA 1SBHA 5DNYB 2UVQA 5GVSA 1V7PC 1Y5MA 3HGTA 5D3KA 4A2QA 2XYGA 3DYVA 2I22A 3AONB 4HLDA 5LP6F 4L8WB 3PJRA 5C37A 4D25A 3W5IA 5A3RA 5K20A 3PUZA 2XLBA 1T2UA 4L08A 4P83A 1ISJA 4KU4A 4ZOLA 3HYTA 5IHPA 5L45A 1LPBB 5FO0A 1B7GO 3V1LA 3WV5A 3DEKA 3CUVA 2FPGB 3LVQE 2Y2UA 4NLLA 4P2GA 1YJ5A 1XVLA 2D2VA 3DFKA 3E0XA 3CLRD 4FD3A 1A3CA 1KYZA 3N2EA 4XLLA 4IIHA 1K1EA 4JT2A 3F8SA 2MU1A 4JJ4A 1H42A 1IZ9A 2DSNA 1JVSA 5ADVA 2P9TA 3W04A 3O7MA 3OPQA 5FL7D 3R9WA 1YI1A 1Q21A 2GFQA 3T5TA 3E3MA 5HOQA 4ME6A 1RADA 1D5WA 4AFNA 1HUQA 2A58A 4EFDA 3UJCA 4BP3A 4OFXA 4GSLA 4I2NA 5K3BA 4C2BA 1BO6A 1Z0SA 2FEXA 3IPYA 3SBXA 2YQ5A 3FBTA 1W29A 1LSUA 2AWNA 4MJXA 3PDJA 1GQYA 4L74A 4NBRA 1KIFA 3T5CA 4A73A 4BQIA 1D2RA 4UPEA 4N5MA 3T7AA 4EGJA 2AW5A 2CCGA 5AW3A 1ODLA 3QSYA 4NZOA 3OFKA 1JEAA 2D7DA 4OOFA 2YCBA 3DBRB 3F9IA 3HU5A 2R6DA 2QX6A 1CSEE 1G21E 4M89A 4UMVA 3RRJA 3NIWA 3LO8A 3RAPR 4IDAA 4ZO9A 3PEYA 4F4DA 1WZ2A 4PZEA 1PR1A 2CT8A 4JGIA 1KAMA 2W6MA 3HO1A 1XD8A 2R1VB 2D2FA 5EQDA 5AFSA 4LE1A 5B12A 4FU0A 4CKYA 1IWBB 1Y6FA 3OU2A 2O19A 2OK7A 4IVQA 1I10A 1R8YA 3DEZA 2JARA 3MTGA 4Y0AA 1S4MA 3IOYA 3ESRA 1FFDA 2EGHA 2FZLA 3CO0S 2AK2A 3KPYA 3KFVA 5G1NA 4TLCA 5DN9A 4ZZ2A 2ZRFA 4ZAVA 4WDQA 1Z34A 4PHFA 1FXUA 3KXIA 3NNNA 2UAGA 3QA9A 5EHGA 5FUYA 3L0ZA 4YX9A 4NFHA 5AVQA 4QQKA 1UMCA 3FMOB 4JBLA 1I6MA 3U0VA 2FSIA 1E2LA 2PMKA 4HNQA 5AKKA 4DKJA 2QTBA 3D7MA 3PGLA 4PTLA 3WYCA 2AGVA 2FMFA 3ZZ0A 2C5EA 1PUXA 1VHJA 4Z9YA 2AC2A 1R6TA 1O89A 2FI1A 1GR0A 3B12A 2J85A 3WB2A 4GWKA 5T3UA 1NT4A 1N0UA 3IKJA 1M8PA 4IGAA 4DGQA 5ERYA 5IC4A 5JARA 4Z7NB 1SKYB 4TM8A 1U3GA 3DTTA 2JNWA 3OOEA 3IIMA 2RHBA 1L5HB 1QCZA 2ZRNA 1IHPA 2VDKB 4H7HA 2V7GA 3UT6A 2WWVD 4PC1A 4EECA 1S3SA 2QVZX 5TGTA 3PNVA 1JU4A 1SXJA 1OD6A 2GK4A 2NYUA 4RVSA 3EGEA 3U3ZA 3NBFA 3DBRA 3ZLJA 2IYSA 3SFVA 2E82A 4AKHA 1NDUA 4BQSA 2A5JA 1QIJA 2VZ0A 2BEJA 4YONB 2P7IA 1S1CA 3K9LA 4Z0TA 3RADC 2H4XA 3AG6A 4QC2A 5JS7A 3HLYA 3T4UA 2XGMA 1NDQA 3NDJA 3TLKA 2QQ5A 1SIUA 3ESYA 1OTHA 2C2MA 1YVUA 2C9YA 4RGVA 4RGBA 4Q1DA 4V0ME 1CJTC 1O95D 4M0EA 2X1HA 5A7HA 1QF7A 2X0KA 3AR5A 3NT2A 1YVDA 2F2TA 2RGBA 3BERA 1DRWA 4LYEA 4B82A 4IG4A 2HIGA 3OE5A 5H4HA 1QCDA 3MLEA 1XZDA 3JQBC 4OHOA 3KQVA 3EPKA 3THSA 5DHTA 1KNQA 2XT9A 3KV3O 2HSWA 4ZJPA 1QIFA 1YWGO 1SVOA 2DG2A 2H2HA 4A2CA 4EIWA 3MTJA 3SK0A 2Q0HA 2G07A 3KT6A 2DUUA 2HEIA 3DMFA 4LVCA 1W1WA 5K0BA 5E95A 2D1SA 4PYOA 3PWZA 4NCIA 1Q0QA 2V7QA 4OK5A 1G1MA 1YKGA 3V2IA 1SAYA 5C81A 1KQ3A 2RK3A 4AJJA 1QTQA 2QPTA 1R8QA 3IBTA 4KE8A 1HGXA 3ZBUA 3OPNA 2R60A 4UMEA 5I7VA 5JZMA 4BMCA 3ST7A 5IZCC 1T9GS 2EOAA 3HFJA 1ZIOA 3DHEA 5KYUB 2WUVA 3A1VA 4GEGA 5FBKA 1FNNA 5ALGA 4D42A 3DR3A 1DG3A 1JI0A 2EFEB 2FMXA 1VDZA 2OA0A 2W4QA 4GBJA 4AZ3B 2WFAA 1JAZA 3VU0A 2N9UA 2QIPA 1JQBA 3LX8A 3L2OB 4OIFA 2OOSA 2PVSA 1F2DA 1QDUA 5GJCA 4WKPA 2WBLC 3H5LA 3KWMA 5CJ2A 1UXHA 1XCJA 4TQGA 3A9TA 5I9IA 4GZ3A 3HVKA 1U04A 3F4KA 4K6GA 4BPRA 3MQ4A 1DOHA 1P91A 1COZA 1GPNA 1SOVA 2ZREA 1YZTA 4K9NA 5TDHA 3WIEA 4A6DA 2WF6A 3FPJA 1DJQA 3U17A 1B8OA 4WBSA 3U3DA 2I87A 2I29A 1DT5A 1CE8A 3HR8A 1F2UA 1U8CB 4B3IA 4QO8A 2NOAA 1VGVA 1O2DA 2CE7A 3EF3A 2O5RA 3FGZA 5U4XA 3QH4A 1GGMA 1CV2A 4MZXA 2X22A 3HKDB 4BZWA 1HL3A 1U3CA 1CVRA 4DQDA 5C1IA 2ZSUA 4FCTA 3CLUC 3F97A 4C6RA 3ZWWA 2NUTB 3P9KA 2I0FA 1PJSA 4LHWA 3CX4A 1CJVC 4NNJA 3OF5A 2CMGA 1B8VA 3Q8KA 3GCXA 4CM4A 5AHRA 1QWSA 1JF8A 3N5KA 721PA 4NXNB 1N32B 3K1ZA 1V71A 2CD9A 2O8FB 4IMIB 1I7SB 5CAEB 4QG7A 4Z3OA 4BLTA 2ZJ4A 2A94A 4RA6A 3TQCA 2YUTA 5CW1A 3JQ6A 3H4MA 3QU7A 5JC1A 2W4MA 1OBCA 3VHRA 4IDGA 4ZOQI 1A7JA 2BR5A 3UBMA 4ABTA 5GONA 4L0MA 3K4QA 1RPNA 4NF2A 2NO9A 3RUEA 3HVHA 4QFDA 4H3SA 3NG1A 3S68A 4UUNA 4WK4B 3W5HA 4RE5A 3GQBA 1VL5A 2CYCA 1XTRA 4EJSB 3EXAA 3C7AA 3GEMA 4B3RB 2CL7X 2AZMA 3F6BX 3HK2A 5SYMA 3IVMA 3PFKA 2A9VA 1A9YA 1IM2A 4CQMD 4QBIA 1JJ7A 3C6MA 3D2BA 3VMFA 3WLKX 1N2CE 1FQJA 4KB5A 3EWSA 3X44A 4G67A 3HDHA 4ESVA 4UCFA 5IX8A 2JBHA 3CUEF 1EFAA 4HUJA 4ZAGA 1OAKA 1RRKA 2Q8QA 2ZT5A 2VXYA 2B30A 4WZBE 1K4YA 2RH4A 1V3TA 3HXKA 2DBZA 4ZRNA 3SZ3A 1DC4A 2O2DA 1CR2A 2R6AA 2PKQO 4MQ4A 2ZAIA 4Q7EA 3TPFA 4JSRA 3HU1A 4G5OA 2C42A 1RC1A 4NDZA 2O2YA 3INTA 3V34A 1ES9A 4RMJA 3GEBA 1VMAA 1FU7A 1BEEA 1DC6A 4HN9A 5H02A 1W0KD 2G8LA 2DUMA 2ZT8A 4HK4A 1GVNB 3FWYA 1CRWG 2QK4A 3C97A 2X9VA 4I5EA 4NFYA 1QPGA 3T1OA 3T9EA 1IUKA 4FB4A 3L8ZA 3WFZA 3PJFA 1TUBA 4ZHQA 1R0ZA 4URWR 1XZPA 4HVCA 4A15A 1TYDE 1WHTA 3KD3A 1ZU4A 5EMMA 4WBNA 2C7RA 2Z2XA 3R0JA 3MJDA 2VDQB 5M29A 1IFXA 3KAPA 1UC9A 4X45A 3P32A 1TLLA 5C53B 2IEGA 2IVFA 2ZS9A 4QE3A 5EZ5A 1CNEA 4CCYB 1W0JA 1IE3A 5EOVA 3ZDXB 4WZAA 4XGQA 3RRFA 2C9DA 1DUSA 3AHFA 4JP2A 3G7NA 4DFDA 3KHTA 3K1YA 4OB8A 3P52A 4PIVA 4JQYA 2BL4A 2BOVA 4WKBA 2OC9A 3Q5GA 1HH4A 1COWA 1S3GA 1ZD3A 3NZEA 4LJ4A 3DUFB 2LNDA 3UW1A 4EBBA 2I2BA 2NVBA 4KXVA 2FJ0A 1KAHA 2J48A 3NLLA 5DTMA 4RABA 1A8QA 1U0SY 2G83A 4B33A 1SG6A 3FPSA 4W1PA 4H1TA 1GAEO 2HIAA 4FHCA 6AT1A 4MRMA 3ND9A 5JUWA 3AHIA 5ALNA 5CXQA 2IQ5A 1RKUA 2QTAA 4BV8A 4CKWA 4R54A 4WLNA 1FUKA 3WC4A 5G4LA 3HZOA 5JRJA 2JK0A 5FI0B 4GPBA 2HQRA 3KR9A 3BRSA 2HCRA 1Y7LA 4N18A 4PAQA 4Q4JB 5ALRA 1SJ9A 4NARA 5AJYA 4AS3A 2VRNA 3ZWDA 1CNFA 3EVFA 2JKZA 1R5JA 3CLSC 4PLCA 1UZUA 1I6WA 1YHYA 3D5TA 1UWLA 4FMBB 4EGFA 3TQQA 1NV8A 3T34A 1U2DC 3WKDA 3D3NA 3I6YA 2W8BB 3DTVA 4ZHQF 1E3MA 1O6ZA 1LBIA 4JLAA 1KS2A 3TTWA 5EJ2A 3W3ZB 1ZSNA 3GELA 4UJ5A 1X94A 5TR9A 1H0KA 1KH2A 3I23A 3LY7A 5HPYB 5I7OA 5IPFA 1GADO 4IYJA 4TXNA 4CIDA 4JR2A 2OESA 4DSAA 1E4VA 3LLUA 1SBNE 3DVLA 3W05A 2NO4A 2HA2A 4ZVTA 2JS7A 4AKTA 3KZMA 1R5OA 3KEOA 3PHHA 4WCVA 4BMVA 1YS6A