3IP7A

Structure of atu2422-gaba receptor in complex with valine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
348
structure length
348
Chain Sequence
MDVVIAVGAPLTGPNAAFGAQIQKGAEQAAKDINAAGGINGEQIKIVLGDDVSDPKQGISVANKFVADGVKFVVGHFNSGVSIPASEVYAENGILEITPAATNPVFTERGLWNTFRTCGRDDQQGGIAGKYLADHFKDAKVAIIHDKTPYGQGLADETKKAANAAGVTEVMYEGVNVGDKDFSALISKMKEAGVSIIYWGGLHTEAGLIIRQAADQGLKAKLVSGDGIVSNELASIAGDAVEGTLNTFGPDPTLRPENKELVEKFKAAGFNPEAYTLYSYAAMQAIAGAAKAAGSVEPEKVAEALKKGSFPTALGEISFDEKGDPKLPGYVMYEWKKGPDGKFTYIQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, substrate binding protein (Amino acid)
publication title A conserved mechanism of GABA binding and antagonism is revealed by structure-function analysis of the periplasmic binding protein Atu2422 in Agrobacterium tumefaciens.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transport protein
total genus 137
structure length 348
sequence length 348
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ip7A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ip7A01
4HNSA 1JBEA 2F8SA 3ROFA 4KPYA 3F7NA 1GUDA 1A2OA 3CHYA 4KQCA 2F8TA 3QEMA 3HXMA 2RDMA 7ABPA 3LUJA 5CNIA 3CU5A 2E4XA 3CG0A 5JNTA 3QX9A 2JK1A 3H5VA 5CNJA 3A0UA 2JVIA 4JOQA 3H5OA 2JVJA 5CNMA 1Z26A 4MR9B 2O20A 1QNLA 2IPNA 3FFTA 3Q41A 1YK1A 3H5WA 3N75A 5CHYA 3M9XA 2I6FA 4KK4A 4YS6A 4YWHA 5IULC 3RVRA 5IX8A 1VPWA 2PL1A 1LJUA 4KMRA 1RZRA 2HSGA 1ZHHA 2KYRA 3LUGA 4NQRA 1ZGGA 4LZLA 2PUEA 1KRWA 1NY5A 1Z15A 4XLTA 1XHFA 2FKAA 4ZYLA 4KV7A 3JVDA 2PUCA 4IMIB 5DLEA 4ZPJA 4RK4A 3W9SA 4KFCA 1JHZA 1OXKB 3L49A 3O1JC 4G0YA 2WJWA 4RU1A 3T8YA 3E3MA 5FBKA 4KQ9A 1W25A 4QPJC 1DRKA 2A9QA 2L19A 1M2EA 4RS3A 5KI6A 2MYNA 3H75A 1QP7A 4Z4GA 3EULA 2LP4Y 3CKMA 3DLBA 1DC7A 3HVRA 4MQFA 5KQLA 1QQAA 3RVPA 5FWXA 4TLLB 4UHJA 3C3KA 4TLMB 4IMJB 5E3JA 1E2BA 2FXIA 3O2JA 3I09A 4PZ0A 5DTEA 1U0SY 4RY0A 4N41A 4WXEA 2E4YA 2CWDA 1TMYA 3HV2A 2V0NA 1SRRA 4H3HB 3QELB 3N6VA 3D8UA 3GWGA 3KKEA 4MS1B 3O1IC 3TD9A 1FFSA 2FMIA 3G85A 2LUOA 3HDVA 4XARA 4XASA 2BGGA 3OLZA 1MIHA 3I42A 5ABPA 4ETNA 2JBAA 1E6LA 1QP0A 4Z0NA 4N47A 4OTZA 1SXGA 2A9OA 3OM1A 3RVKA 3MQ4A 1MB0A 2PJUA 4Z4FA 1Y1LA 4RSMA 4YCSA 2HQOA 3I45A 1NXOA 3LMKA 3LUKA 5JS2A 3EJWA 1QKKA 3NNSA 2PUGA 3F73A 3LUDA 5HQJA 4O1IA 1DC8A 1U8TA 3QLUA 4YRZA 5IUKC 2VK2A 4IRXA 1JFTA 5IEJA 3R0JA 1QMPA 1NXWA 3GV0A 3BILA 1FQWA 4MR9A 4NV3A 1JFVA 2NUBA 1JL3A 1BDJA 2FTKE 4RXUA 1YS6A 3H5LA 3JY6A 3KG2A 5EWMB 2E4VA 3H1FA 5TPZD 1DG9A 2FLKA 3IPCA 2FMFA 3HUTA 1M5UA 1APBA 4GNRA 3HK2A 4G0XA 2FLWA 2HQRA 5TQ0B 2GX6A 3TO5A 3QLTA 4D6XA 3N53A 4W5QA 4OLBA 2FN9A 4Z4IA 4O5AA 3JPYA 3T95A 3URMA 3TX6A 5JS1A 2ID7A 3IP7A 1R8JA 1E6MA 3KHTA 3LTEA 3OMXA 3ILYA 2E4UA 1RNLA 1AB5A 5GOTA 1DZ3A 2VYCA 5IC5A 3GA5A 4HNRA 3EAFA 3O75A 3EQ2A 1P8AA 1DBQA 5FBHA 1CYEA 3MM4A 4LE0A 3RVJA 3FMVA 4LE2A 3N0RA 4MYRA 4MS4B 1FFWA 1XHEA 4EYKA 1MAVA 2P9HA 3C3WA 1EWKA 4RK1A 5T3YA 1A0OA 3O21A 3RVQA 2VUHB 4TMYA 3CS3A 3QELA 1NATA 4MS1A 1S8NA 3T38A 5BRJA 4RZSA 2Q5CA 3OLXA 3OQOA 3NNDA 4P98A 1ZVVA 2ZWMA 2QR3A 4RK0A 5TPZA 2P4UA 2FSPA 4N03A 4XAQA 1L5ZA 4YR7A 5BQ3A 3MYYA 3F6PA 3QK7A 3M6MD 4QYMA 4W5RA 2R48A 2NZVG 1DCKA 2YHBA 1RXEA 3P9YA 3SQNA 1E6KA 3QLUC 4F11A 4G0PA 3RQIA 3N0XA 3HZHA 3SM9A 3VNBA 3MF4A 3UUGA 4PE5B 5JNUA 2PUDA 3C97A 4RK6A 4EUKA 3Q9SA 2QVGA 4XFKA 5KQMA 2TMYA 1EWVA 2CHFA 3HUUA 2JB9A 5TPWB 2GKGA 1QO0D 2QZJA 1Z16A 2NT4A 2RJOA 1I3CA 1URPA 2X7XA 4KRFA 4P1ZA 1BA2A 4RXMA 4JASB 2WWVD 5EWMA 3JTEA 2ZAYA 1D5WA 2FEKA 2MSWA 3GRCA 4B09A 2R47A 1PEAA 3CG4A 2FQXA 4ZJPA 4YO7A 5TE9A 2QXYA 2NT3A 2B4AA 5TQ0A 2IPMA 2FN8A 3O74A 4OLAA 2IPLA 3OLYA 1Z2DA 3BREA 4MPTA 1U04A 3D02A 2WMYA 3M9WA 4IILA 1UDRA 5DCLA 3GT7A 1W9HA 1NXPA 1M2FA 4DQDA 4LRQA 2H0AA 4QYWA 3CFYA 5EWLB 3QLVA 2AYXA 3OQNA 1DCMA 2H3HA 3DZDA 3O2QB 1NTRA 1D2AA 1Z12A 2HQBA 3SAJA 2WY2D 3MMNA 1M5TA 4MS4A 1AB6A 4HNQA 3OQMA 5EWJB 1JX6A 1ZDMA 4EYQA 2WRZA 1QO0A 1LBIA 4EY3A 3TB6A 2GI4A 3H5IA 5TQ2A 3IP6A 1SXHA 2MYUA 1JLKA 1USGA 3A0RB 3VNAA 1RXIA 2B1JA 2IKSA 1JWLA 5HM6A 3NBMA 2E4WA 1LJLA 2PLNA 2OQRA 3EQZA 4WT7A 4Z4EA 3OMWA 4WXMA 4KNYA 3SY8A 2RJNA 5DGCA 5KQPA 1PHRA 3Q7RA 4E7OA 3B2NA 1VLZA 1EFAA 3CNBA 1DJMA 1EHCA 4F8JA 1QPZA 4L4UA 2YHAA 1ZGZA 3JVIA 1D4ZA 3Q7TA 1B00A 5D2CA 4CBVA 2W42A 2L2QA 2L17A 3I5AA 2QV0A 3QEMB 3KYJB 3LUAA 2LBPA 2QU7A 2CHEA 4NCAA 4WZZA 1P6UA 5TPWA 2PAFA 1CEYA 1DRJA 2GWRA 1GCGA 3FFXA 1JFSA 4E7PA 1ISSA 1DBPA 4N0PA 1BDIA 1HEYA 4Q7EA 2FEPA 4LDZA 4JAVC 4D74A 1A04A 2LIVA 2MYPA 3HO1A 3CZCA 1GUBA 3HCWA 1WETA 3IP9A 3LUFA 5HSGA 1D1PA 1NXVA 4Q6BA 4O1HA 1SD5A 4NICA 2FEWB 4W5TA 4G97A 2IYNA 4PICA 3SG0A 4KZKA 3OLVA 1ZH2A 1KMIY 3QLVC 4F3TA 1NXSA 3OLWA 5IEBA 3RH0A 5JNWA 1Z2EA 2FMKA 3KTOA 4PEVA 3LOPA 2VUIB 1F4VA 3IPAA 1Z25A 1YS7A 1KGSA 3GYBA 3ILHA 5EWJA 1JF8A 5KC8A 3MA0A 1QP4A 2GBPA 2MSLA 2XDYA 3KLNA 3NHZA 1ABFA 1EAYA 5JNVA 4OBBA 4S05A 1P2FA 5HKOA 1USKA 4EGSA 2CD7A 1BAPA 1DBWA 3T6KA 3DLHA 2MSKA 4NCBA 1SXIA 2PL9A 2A9RA 3O2SB 1IIBA 2LPMA 4F06A 3K4HA 4LDAA 4ZMRA 3LUCA 4EYGA 4F12A 4ETIA 3H6GA 2J48A 4MAAA 1CHNA 2RGYA 3FFWA 3Q7SA 2R4QA 4MR8B 4Z4CA 1FFGA 1PEYA 4MGEA 1ZN2A 4JA2A 3RVOA 4FE4A 1U2PA 4RV5A 5DKFA 1XWWA 3K9CA 1ABEA 1J56A 2AYZA 2IPAB 4EVSA 4KVFA 4JB0A 5B3JA 1MVOA 2FQYA 3H5TA 1YVUA 5IUJC 3CLKA 2PE5A 4LE1A 3N8IA 3KYIB 6ABPA 4N0QA 3C6QA 3DBIA 3HSYA 3CTPA 3GL9A 4YLEA 3GBPA 9ABPA 1JYEA 2FVYA 1C4WA 1YIOA 3HDGA 5JNRA 4MS3B 3E61A 1K68A 1FSPA 1DP4A 5JNSA 5KWSA 2ID9A 2IOYA 4L85A 5I4CA 2WB4A 4G0QA 2L18A 1USIA 3KJXA 4JB2A 1TVMA 1OXBB 4TN5A 5IUNC 3HM9A 2OENG 3IDOA 3OO0A 2HJ9A 4GPAA 4Z4HA 3H1EA 4XXHA 1JDPA 3KCNA 4ETMA 4EVRA 4YGXB 2QW1A 4ML3A 4Q6WA 4RKQA 4RKRA 5T7BA 4S04A 2IDMA 2M1ZA 5CNKA 4MR7B 1RPJA 8ABPA 1JDNA 1YTUA 3O1HB 3F6CA 4EVQA 2JRLA 4KK3A 4RWEA 5FWYB 4FE7A 1Z13A 4DN6A 3S99A 3UKJA 1ZH4A 1ZAYA 4YV7A 4RK5A 3NNNA 1PNTA 3KSMA 3N0WA 3KLOA 1BDHA 1LK0A 4MQEB 3BBLA 3DGEC 4MRMB 3OO1A 4UHKA 3SNKA 1ZY2A 4Z99A 3CZ5A 3RVLA 2PUAA 4RK7A 1GCAA 4IGAA 3JS5A 5B3JC 4MR8A 4N76A 4RY8A 2PKXA 5GQSA 1QQBA 3OM0A 3TMYA 1Z18A 1NXXA 1JH9A 1F51E 4QICA 4RY9A 1ISRA 4Y9TA 2N9UA 5C5EA 3Q15C 1PNRA 1TJYA 1L5YA 4M88A 1EWTA 1MB3A 4RDCA 4H60A 1YMVA 4HYEA 4OATA 3HS3A 3JPWA 5KQGA 1BVHA 1TM2A 5C5CA 3ROTA 3DGFC 4Z9BA 4RXTA 4MS3A 2WJAA 3A10A 1KRXA 3HJFA 3NHMA 4FB4A 3MIZA 4W5NA 1D1QA 1U2QA 2FMHA 5IBQA 1C0EA 1P6QA 1PUXA 3LFTA 4G86A 1YK0A 3G1WA 3FGZA 1GLGA 3CRNA 3HEBA 5BRAA 3C3MA 3H6HA 3KS9A 5PNTA 4H3KB 1DCFA 4ZMSA 4WWHA 4D6YA 3IP5A 4PYRA 4Z9AA 1JYFA 4G0ZA 3QX8A 2E4ZA 2PUBA 5EWLA 2FQWA 3QEKA 2A9PA 4YP9A 5ED4A 1ZITA 4LX8A 4W5OA 1Z17A 4MQFB 3RVMA 4MR7A 4KREA 4JP1A 1TLFA 2DRIA 4OG2A 3H1GA 4EYOA 5FWXB 1ZESA 4G0OA 5KC9A 1H9CA 3LKBA 3FDFA 2R25B 2JVKA 3LUHA 2FW0A 2QSJA 5FWYA 1NXTA 3EGCA 1RZRD 1YMUA 3A3KA 1VRVA 3RVNA 6CHYA 4WUTA 3BRQA 1T34A 5TQJA 3GBVA 5BR1A 2PUFA 3LKVA 2M98A 2QVCA 2NZUG 3L6UA 4MLCA 4DADA 2JCGA 4MQEA 1K66A 2MYTA 2PMCA 5F64A 2JBAB 4G0MA 4MRMA 3RVSA 4MLDA 3BRSA 3EDCA 5TQ2B 4IF4A 2HPHA 3UK0A 1LBHA 3EODA 1VKRA
chains in the Genus database with same CATH superfamily
3CCBA 1UBJS 2HPVA 1RQ2A 2QHXA 3PUJA 5LQSA 2QD2A 4XUGB 4WJLA 2PX3A 4A8HA 2AOTB 4KPYA 1ZYUA 1D6MA 4IOKA 1OC2A 5EKXA 4KQCA 2Q41A 5FP0A 3RK1A 4AJ4A 4GMDA 3AX6A 1XTRA 3AKZA 1Q2XA 2OP1A 1VZ2A 2AMYA 4A0QA 1QHEA 4DAOA 2PRIA 2IBSA 5JNTA 4O1MA 2YHUA 3NIFB 4G5FA 4UD2A 2EV9A 4UCQA 1R18A 4H7KA 2WOOA 3D6HA 4HS4A 4PLCA 2FWPA 5EAIA 4IJ5A 3OZFA 4LI0A 3KUUA 4FVTA 4UXJA 3I6QA 3VH2A 5B64A 3QLJA 2JRCA 4ZVNA 3FB1A 3LBIA 1R6BX 3C3CA 5KWSA 1UK8A 2VXYA 3MJSA 1PP4A 2YIJA 5AT1A 5B7PA 1X7XB 4KMRA 1WA5A 3HCFA 3N7AA 3IEXA 1UXHA 4X71A 3QJ5A 4K9MA 5F9HA 1HFKA 1LC0A 1Y6QA 4IDBA 3U7HB 1NY5A 3RASA 4Q3OA 2PKRA 1NMYA 2DCMA 4IAOA 4TV9A 4ZU3A 1LS6A 1M1XB 2A0XA 3CE9A 3JVDA 1YU6A 4GR5A 4P7BA 4ZQGA 4KFCA 1ODSA 1RYBA 1NT4A 521PA 1H05A 5BOSA 1IDN1 2QKYA 3UMSA 1XJ0A 2WNSA 5FBKA 4UU0A 2B98A 4D3SA 1ZD5A 2MYNA 1U80A 2OR3A 3H75A 1L1EA 1DFIA 1Y3FE 2XUGA 4MQBA 3GLFB 1DC7A 4GSYA 3ETDA 2FFJA 4JBXA 1DEKA 3SBDA 4MQFA 1KYQA 4LQCA 3FUXA 5CW1A 3ON5A 4U2EA 5SZIA 4CM8A 2G7MC 3CRQA 1Z4OA 4J0KA 2JFYA 3RUAA 4HWRA 1MEOA 5KCZA 2Q1TA 1UP4A 4YPOA 1CQWA 1WMSA 1US8B 1H0SA 2B6HA 1WB5A 2PH5A 2WU8A 3C5VA 5C4MA 1H3FA 2N47A 2Q21A 1VI2A 2B82A 3F46A 3WNDA 3N6VA 2F59A 1I5OA 3PC3A 4E22A 2GEFA 4E30A 3PXGA 3SJ7A 4UEJA 3WLAA 4X41A 3WGUA 4EPWA 4EKYA 2AKYA 2BTOA 2JCSA 2RGNC 3EZLA 5AXAA 3HCEA 3OZGA 3D6NB 4FMCB 4EJSA 4MV0A 2JBAA 2RE8A 1VBMA 2NTJA 1U3WA 3DA8A 1C41A 1SHKA 4ZREA 3FRHA 4E09A 3GNTA 4C0AC 2KWIA 2XTNA 4OBWA 3E9EA 1V8FA 1RXWA 2WPNA 4IIDA 4U8GA 2Q3HA 2BH9A 1H2ZA 3C8DA 3I45A 5FQOA 3LA8A 1B14A 2GZDA 3JD1A 4W1RA 5AVKA 3SOPA 2GXQA 5KU1A 2Q0SA 1M2WA 3VVMA 5AW2A 5DN6A 5BYBA 2X0IA 1M72A 2WC1A 2G6TA 3KQHA 5JR3A 4L76A 5EIBD 3NALA 4EPTA 1CK4A 4ALKA 3KQSA 3R0JA 2A84A 2ZI4A 4B71A 3DEFA 1GGHA 1SVNA 3NUZA 3E9NA 4JLJA 1BKYA 4HSGA 3O91A 1UMDA 2RHRA 4K9QA 1YB2A 4U0KA 3ZE6A 3KJZA 2W2LD 4GS5A 4P6VF 3EUWA 3R3UA 4H16A 4V38A 3L0OA 1T6BY 4RPCA 2V7BA 2CXSA 1F2TA 1YI1A 2ZKLA 3P5SA 3K73O 1XTIA 1FS6A 4JVLA 3E2PA 4OQ4A 4H6WA 4XIIA 4DDUA 5K5EA 2DKOA 3O0DA 4O2AB 4BNYA 4KUEA 5KNCD 3IJ5A 4CM7A 4F9EA 5A5GA 2QY6A 2VDKB 3MD9A 3QF4A 1F8FA 1Z6PA 3KHTA 3PRJA 4CRWB 1SVWA 5BV2P 1ITZA 2DUWA 1FW8A 3K8QA 3N2EA 4L28A 1N8TA 2ZTHA 3B5JA 4LDNA 3ZWNA 4DR4B 1FX1A 1RRCA 4NONA 3GA5A 3NATA 1Z0SA 3BHJA 2H1IA 3FGPA 4WKBA 1N6KA 2D2EA 4HDCA 5EXPA 4AZTA 4EYSA 2Z6UA 3BMCA 2YVLA 4HL6A 1CJUC 5AK3A 5H80A 5HQTA 4DQ0A 2PZEA 1V8BA 1Z8NA 3BRWD 1WNFA 3DM5A 2R8PA 1SVOA 4NOKA 5DEIA 1UPAA 1QQ5A 2YWCA 1FXSA 2H8GA 1OYYA 3DQQA 3PGLA 2V4MA 4FCWA 3VUFA 1KARA 1GUYA 1RRFA 3CW2A 1ZNQO 2OBMA 1J2RA 2POQX 4NJEB 1FDOA 3CS3A 4RZ2A 4CQJA 5BPHA 1C3JA 1T36B 1G2PA 3B8EA 5GGXA 3OLXA 1T4CA 9LDTA 4JHXA 1MRZA 2LCFA 2O3JA 4KO3S 3SZRA 1JVNA 2R8BA 1CIPA 1VB3A 1UXJA 2CLMB 4XJXA 5TPZA 1NQUA 1YR7A 1OBCA 3KTAB 2O3UA 1L5ZA 3KUXA 3ZIDA 1GU7A 1E2FA 1S9HA 3UT5A 4EHDA 4QTYA 1SU6A 1FDRA 3DH0A 3QK7A 1H4SA 3V6MA 2WTEA 4DB4A 2ZR9A 4AG6A 1PL7A 2CMDA 4B9AA 5KX5F 5AXBA 2JEYA 3QFHA 3JQAB 1WE2A 5CX1B 1P2DA 2FR1A 1Q0ZA 2GF9A 4X45A 3M82A 1UAGA 1KEPA 4QDJA 2NUPB 1QV6A 4RVHA 3T1VA 1N2SA 3VBEA 1CFJA 4R01A 2J5XA 1H8HD 1RJGA 2OMEA 3RF7A 1RWVA 1A4UA 3B6IA 1GZ4A 2Z43A 4YRSA 3PFIA 1A97A 1AGNA 2RKOA 4QEKA 4WTOA 3NMUF 3GC6A 4PBRA 4G24A 1LFDB 4TM8A 3OZXA 1N8NA 1SVUA 4PYOA 2FZCA 4XRRA 3RUIA 1T8WA 4JB8A 5DNEA 1PK9A 5F2OA 3TIXB 4DC1A 4RXMA 4JASB 4YMUA 2QTVB 1NQVA 1NR7A 3FF4A 1BWSA 1Z5ZA 4C3UA 3QVWA 2MSWA 1V11B 2J87A 2BEWB 3DMFA 3L0IB 4B09A 5IK2D 2FQXA 4IYJA 3JZMA 3BKXA 1U8AA 4RESA 5L7WA 3LBAA 4II3A 1QIKA 3FOBA 5ALRA 4D8YA 4N8DA 3KETA 1B42A 3QWIA 3DZHA 1G8FA 5BT8A 2ZRHA 4WOKA 3UJ7A 3IALA 5U4XA 4XR9A 2YJTD 4CV3A 5E7MA 2VPTA 5EJ7A 5LQDA 1NVVR 2YXPX 1PT5A 1UADA 3F6SA 3TDNA 3GT7A 2IS6A 4OMDA 2WM8A 1W35A 2GZ2A 1QGED 1GQRA 2OXEA 3DEHA 5EIBC 5IHXA 4PPGA 1DKOA 1P2GA 1QIDA 1RPTA 5A4KA 2H1CA 3OBIA 5CLQA 4XLZA 2AOVA 2ST1A 3DE2X 5DIZA 5KNLA 1A8QA 2AW3A 1VCMA 2KX7A 4H7JA 4HG2A 4A8PA 3F6RA 1KKMA 2HR1A 3ITEA 4XPIA 4ZI2A 3TW4A 3DFUA 4AT1A 5TARA 3U4CA 1CX9B 2ASEA 2ETXA 3OTWA 4BO3A 4QKQA 4ZAXA 4U4AA 2WUWE 1VJCA 1O94A 1NVAA 2G82A 4YUXA 5LP6A 1RP1A 5ALWA 3IUBA 1XKXA 3KEOA 2OL4A 3P8ZA 4JLWA 5E9AA 4DA7A 3L8MA 4IS2A 2AWOA 3FM9A 2ORIA 3ORFA 4EWLA 2PLNA 4WT7A 1KSGA 3SE0A 4KNYA 3X1DA 4YLYA 4N0EA 4HDNA 4S1OA 7GPBA 1NF8A 3QX7A 1Z62A 2EG5A 1B2LA 1A72A 3DNFA 3X1WA 5KQPA 3IAEA 1NW7A 4NHOA 1JP7A 1NE7A 2EFEB 3Q7RA 1RC8A 4RACA 4JJZA 3A1VA 2Y2UA 3HA3A 3UMMA 4GT1A 5DCYA 3QVGB 4IJUA 3UG7A 2ZDGA 4IEEA 4QDTA 3I5AA 5EIOA 2NV0A 4M1TA 1PT8A 4UNNA 3LUAA 4MWEA 1C9EA 3DWFA 3PUXA 2X8JB 4LK3A 3RIYA 1ULAA 1GNVA 1I6WA 1XK6A 2VG8A 2XKAA 4E7PA 2O3QA 1F0PA 1TM1E 1MB4A 4MUNA 1YAHA 1CKEA 3A6JA 4FZ3A 1VA4A 1B15A 1BWPA 4UDNA 3EYAA 1OH7A 4AJOA 1UBRS 2XLCA 3Q3CA 3DOJA 3IUQA 4FWBA 4D74A 3NHLA 5ECGC 1GUBA 3LE8A 4J0HA 2PWAA 1K5GA 3ME5A 3OOYA 1NXVA 1WXQA 4YJGA 2HMSA 4MGIR 1S7CA 4U39A 3EXIA 4AK9A 4ARUA 3SEQA 2OZPA 1QANA 2WB2A 4OSPA 3UWKA 1WHTB 1TCBA 2H16A 1NXSA 5LYJB 2ZJ7A 3NTUA 5BQ5A 5CLLA 4BYMA 4FJ0A 3FFBA 1A50B 1DQSA 1SBNE 5JANA 2FDCA 2CVPA 3PKIA 2DX7A 1UR5A 2OZEA 3IKLA 3RD5A 1UKCA 4ZWNA 3COSA 3EZGA 4GM1A 1WBBA 3CF4G 1X7DA 4HMQA 5DCUA 5LXTA 1TQ2A 4JH0A 1F17A 3C0KA 3JVUA 3KB2A 1GN8A 3VI3B 4KO4S 1SUCA 4BLUA 5GAJA 5KC8A 5JROA 1ORVA 2OOSA 4MLPA 4JWKA 2KI5A 5C7YA 4V0QA 2I87A 2PVSA 4KKVA 3EEFA 2ZDHA 3NHKA 3PHBE 4Q93A 3QX3A 3QUSA 3GUVA 3O2SB 1IJFA 4ZO6A 4EY4A 4CQNA 1TA4A 4HPWA 5L6LB 1T2UA 2DHRA 3O82A 3U0BA 3GDWA 4GBGA 1Z28A 2HMAA 3QJYA 4LOKA 3TNLA 1V47A 2ADFA 4NSNA 4Y98A 1GAWA 4BMXA 2XYPA 1VBNA 4RY2A 1JB1A 4MMZB 3ZD6A 2R0QC 1ZN2A 4HF7A 4C4AA 5J4KA 4JA2A 4OY3A 4GPZA 1XJWA 1U2PA 3NHBA 2AZDA 3V7WA 4AICA 3OBBA 4C1BA 2Y9MB 1C4KA 3OF5A 4MW7A 1UJ6A 3FPCA 1QRAA 4J76A 4AAYA 5JAOA 5JSFA 2GVNA 4LE1A 1YQDA 3N8IA 4B4OA 2DPMA 1Z4PX 3Q3GE 5E6RA 5CVEA 1VSVA 2JLSA 3NM5A 1X39A 3OPQA 4D79A 5IHPA 4MWSA 3OQIB 5EFOA 5BNFA 2VZEA 4MS3B 4ESHA 3AVYA 4E11A 1FSPA 1U1DA 2YWRA 1DP4A 5LOVF 3TDMA 4FEYA 4QAJA 3D6FA 5HKLA 3IT0A 5EP2A 1P60A 1QZUA 2QUIA 2X6RA 5DHUA 1OXBB 4TN5A 5T3UA 2NZ2A 3QKIA 4WBNF 4OUDB 2HJ9A 1QGYA 4UNRA 1EU1A 1XHLA 1K6XA 3EQ6A 2QX9A 4ND5A 5D87A 1XQWA 3KQOA 4DC9A 2QZ9A 2W6IA 2QE7A 5ALFA 2ZYWX 3FNFA 3OIWA 5E7QA 2KPOA 3UHOA 1R0SA 3MC1A 4JGIA 1WW8A 4MRVA 5HX7A 1ZWLA 4KXUA 4DDTA 4ALNA 1YE5A 1SC1A 2P0YA 2XB4A 3E9QA 1S89A 2OGSA 1OA0A 821PA 1BH6A 5D84A 1RKQA 4XFDA 2HT6A 1XTJA 4WASA 1SBCA 3KE9A 4Q48A 1GG2A 2FEMA 4J3NA 4JBGA 1Q0SA 1CZUA 3FUUA 3PHHA 2JATA 3AOGA 1Z36A 2B0CA 2QM0A 4A82A 1RHUA 2QRVB 5T5QA 2PZLA 2CL7X 1SOUA 1SB9A 3MBOA 2FHSA 3MN1A 4KRXA 4NZNA 4G9EA 5CG1A 1DB3A 2ZZKA 3N9IA 1YT5A 3DGEC 2NVOA 3DZ8A 4JDUA 1PIWA 4G5GA 3ZZMA 1J22A 4MCIA 2J0SA 2HO4A 2FZLA 3DPSA 4FGLA 3V7UA 5ITWA 3T1TA 4S12A 4MNTA 4Z99A 3FZGA 3MWLA 5FUBA 1A9OA 4FONA 4HH4A 1X87A 3HJBA 3HDYA 3A2LA 3BKWA 4P83A 4JK3A 4W1SA 4AI6A 2VT6A 3ODGA 4OO3A 1H9BA 2B83A 4RHUA 3ZBUA 4DVGA 1FFBA 3BK1A 4GMHA 4YRPA 5E9QA 4FFBA 1R3DA 1ZS9A 4X66B 3LP5A 3L1JA 1LXCA 1RRGA 2IXFA 2NU9B 3SSOA 3EEOA 4JBWA 2XT6A 3OJOA 1XNJA 4PSCA 4TMZA 4HNAB 1FS4A 1G8MA 2J9FB 4FOOA 4PR3A 3VU9B 1NNEA 1NPYA 5K3CA 3HJUA 5I9TA 3IQDB 5JQGF 3KOWA 3IE0A 5EJMA 3WMGA 3ZIAA 2WJVA 3JQCA 1TM4E 3HA2A 3LC2O 1M6VA 2GHRA 5D1NA 3TQFA 2O2IA 5HM8A 2PX0A 2CUTA 1ODTC 2O8EB 4FC7A 5EHZA 1X94A 3IAXA 2W2NA 2A35A 3QOXA 1U7DA 1FUYB 2GLXA 2ODTX 2R7AA 3OEED 3PCXA 4JDPA 4MVJP 2FZ4A 3HP7A 2R751 3TLZA 1YHNA 4HDAA 3N8HA 4RE6A 3IUNA 2VBIA 4S24A 4UFOA 4D46A 1LV8A 3INRA 2I33A 3IIMA 3CVYA 4B87A 4GP6A 4DR2B 3RSCA 4NYMR 5JD6A 4WK4B 3FYHA 1QH1B 1TTTA 1Y1KE 1IOLA 1PR6A 4MULA 1EQAA 4W7SA 3S40A 4YX9A 1RYDA 4LUCA 5DW0A 4AS3A 4CKXA 1Z17A 2HV8A 2ZIAA 4G4IA 3ZQ4A 2Q5JA 4YACA 3IIJA 4RPKA 4ENWA 4KREA 1S2OA 4QDXA 4EF6A 4GPD1 1QQ6A 5LNK6 2ZT7A 4I5DA 1X7GA 3UQYS 2D0DA 3G0IA 2Q5IA 5DTJA 1VIAA 3R7BA 2QL5A 3UWMA 4B4WA 4D2IA 3U56A 4I4TB 2YRWA 4CLHA 3PX3A 1IN8A 1RM0A 1TO1E 3AL2A 5I7SA 1O7JA 2C3YA 4KAAA 4WUTA 4GL2A 1T3ZA 1C7JA 2F3UA 3K53A 1X1BA 3HBFA 5A2QA 4JLDA 2HEGA 2WJGA 1TYCA 4MLCA 2JCGA 3BMQB 3R6GA 2HDOA 5G02A 2P5YA 1KMMA 1ZCBA 3QQ5A 4E2XA 4D5EA 2ZUUA 2XKJE 1M2JA 2ZE6A 1GCUA 3B60A 1WEHA 3GFBA 5FHRA 5JH7F 3C4QA 1KJNA 1RCTE 2Y05A 4PO8A 3FNGA 2V7TA 1SBZA 3WYNA 4DUGD 5LMUB 3IKJA 2H63A 2BFBB 3I0ZA 3UJCA 3KCQA 1JU4A 4KPFC 1E1QD 4OXKA 1SKUA 2BSQA 3PQ7A 3SNHA 4FCTA 2AA3A 5SICE 4CIYA 2UZ0A 1RRVA 2WJ6A 4KWEA 1LLCA 1XTSA 5H81A 1M8FA 1QRUA 4EQZA 5ALLA 5HFNA 3UN1A 5HQ3B 5IDQA 4X9XA 1G6KA 1Z39A 4JOQA 2JVJA 2J30A 3C74A 1IBRA 2JFBA 2UVQA 2NVUB 4ARZA 1VHJA 2WQZA 3IKMB 3FFTA 3QFCA 4GAEA 4KAFA 3R5XA 4B7ZA 5C1OA 4KK4A 4RPIA 3CMMA 1Z6TA 4FNGA 2I2XB 4FHZA 3WB2A 4OQDA 4NWIA 3S7TA 2A0KA 3C7TA 3W6PA 3PNQA 4D8XA 3HCPA 5L4LA 1YZTA 3IILA 5DOVA 2VEOA 3F5MA 1DBIA 3RJ5A 3LY7A 3R3JA 2Q5EA 2YKGA 1W5SA 2IXGA 1QCZA 3ZW9A 4D43A 3KELA 2IXDA 1XB2A 4P4LA 3FHCB 3MWDB 1AU9A 2W71A 5AVOA 3AQ4A 2PX8A 4RU1A 4BE9A 1M34E 1SZJG 2GEUA 3E3MA 3WICA 1W25A 1WCWA 2IW3A 2Q8NA 1KERA 3WK6A 3G9ZA 4QDKA 3TQQA 1UDCA 2WEKA 2TRSB 5JCPA 4PLFA 4XD7D 2FAXA 1IEQA 2W7TA 2QN6A 3RIGA 4WOJA 4XDYA 4Y0NA 2N46A 3BB3A 4HH0A 4QGHA 3ANXA 3W06A 4B5LA 1VLHA 1QORA 4LF4B 1BQ3A 3I09A 1NX9A 5EJFA 3GARA 3SWWA 2ATVA 4KPEC 3E70C 3TOXA 2XMCA 1RAHA 3NRJA 2Q3JA 1NDUA 3PHJA 1WF3A 4X7PA 2WE7A 1SUBA 3MUFA 4ZZ2A 1Y1QA 4LWOA 3ETEA 3ZD7A 2FUG1 1E9FA 1UBHS 5L45A 3RRJA 3WZLA 3K6JA 5JZBA 3ROXA 4JQSA 3I42A 3WQHA 1BE8A 1H5NA 2R6JA 2ZATA 3E81A 3QG1A 1F2UA 1EEXB 1U8ZA 1Y82A 4TQ9A 2E82A 3L41A 4ZVLA 4Z1MA 4N47A 3UMRA 4DJDC 2P0AA 1BX3A 5FWAA 2IHZA 2ATXA 1E0DA 3U7GA 2WUDA 3KEGA 1T91A 2YW9A 4JJAA 3RK0A 1JZTA 2AOTA 4BGEA 1EFKA 1YCGA 4M37A 1CB7A 4UHFA 1B8PA 2XYRA 4X93A 3TZQA 3EJWA 5KOIA 1MX9A 5K0TA 4YRIA 4Q1FA 3JQQA 1LWOA 5SZHB 4CCAA 4FQ5A 2YWXA 4C05A 5MF6A 3COYA 3RIMA 2YWFA 4DV7B 3O8CA 5HF5A 4D98A 1QMPA 2WF8A 3BWDD 1JMKC 2NUBA 3ASUA 2A9FA 2PRKA 3JQ9A 4LBYA 4LXIA 4N9QA 2W8BB 5C32A 1ZUD1 3DCYA 3V8RA 4OVKA 3RLFA 1L8LA 4ITUA 2XB6A 1X7XA 2RGUA 2YIMA 1K1EA 3JR3A 3M6WA 5ER9A 1VA5A 1E79D 2V5UA 4B75A 4ZI7B 5BV1A 1G38A 1MFZA 4ZEWA 2DTEA 1MG0A 3HK2A 4PNZA 4XYGA 4JLPA 4O5AA 2Q2OA 3QJGA 4YHHB 4YJ2F 1CD5A 4LPKA 2FEAA 4DR5B 1A95A 1QU2A 3QTLA 3LTEA 3X0DA 4EJ2A 5INTA 1K75A 1HQCA 1JXMA 3R20A 1NC1A 1U5AA 3I2KA 4RPLA 4BO0A 1CE8B 3GLFA 3UH1A 1MW8X 2PH7A 1P8AA 3ZZ1A 5HNKA 1MGOA 2H0RA 3ZU4A 3LK6A 5F1PA 1L4LA 1UK9A 2O2CA 2XMRA 3NETA 1UQUA 3M2PA 3T3MB 5CPFA 1N5IA 4B3BA 2X14A 2YX1A 1TKBA 1NV8A 1CY1A 3WQBA 3ONVA 5GINE 4P4GA 1US8A 3FZEA 4AQYB 3S5UA 5DLYA 1EWKA 2XGOA 2WU0A 2HNKA 3IT1A 2AFIB 3OD5A 3I5UA 2HGSA 2ZWIA 3PNLA 3ZW7A 2GEVA 3ZK7A 3WAKA 4OHRA 3PYMA 5K3OA 1QV7A 1X9IA 4P98A 5BN5B 2W6ZA 4WCDA 2X4DA 2WFMA 4FP9A 3MCTA 2QLBA 3I1IA 2ZTMA 2EW2A 2VXOA 4TTPA 5THQA 4B17A 2RHTA 4JIMA 5ITVA 4W5RA 1T8YA 3ROPA 3T9EA 3IMKA 1RXEA 2ZYVX 3EVEA 4B6FA 4M1WA 3L8YA 2JAXA 2NACA 5EJAA 2ZE7A 4B6OA 1RWKA 5HTKA 2EF1A 3FVVA 3K0KA 3QITA 2VHXA 2X8LA 2JFGA 2P4HX 2WKRA 2ZRQA 5FO1A 5A3VA 4LWPA 4RYLA 4BX8A 4HNHA 1AKVA 1WY5A 3LFHA 4IJQA 3RRMA 3ZCSA 3W5AA 1YQTA 5AO9A 3GFRA 3LCMA 5TPWB 3VPBA 2D5LA 3NZEA 2V7XA 3ORYA 5EFZA 3V4PB 1G8HA 4BY9E 1URPA 1Z0UA 4ZHSA 3TQIA 4HQFA 3DL7A 5TGZA 2YZKA 2GHQA 4PFQA 1CF9A 3IUJA 2DFVA 4R8LA 4DF3A 1JFFB 5BN1A 3D3NA 2V7EA 1AT1A 5TX7A 2F1HA 4PSAA 1SZCA 3D6MA 1NKVA 4A23A 5B53A 1MD9A 2HZ7A 2NT3A 4WNIA 4EFLA 1P9OA 3OPYI 3IAAA 2B3DA 4DJ5X 4AF6A 1TC2A 5B55A 4X8OA 1EUYA 4O2AA 1XZNA 2E0IA 2R6HA 3A25A 1OIXA 3WNQA 1ZL2A 5DB4A 1Z2DA 4P3XA 1W49A 4PCVA 5ELMA 5H82A 5H8WA 1U04A 3M6VA 4WHMA 3WVNA 3ZW8A 3S8YA 1U4SA 2Y27A 4UZSA 2BRUC 1NXPA 4PZEA 1FJXA 1UIRA 4MVJE 2P1ZA 3QEBZ 1Q7TA 4KWCA 5EWLB 4W4TA 3WFIA 4JP8A 1PVOA 4BCDA 4QAQA 1FU8A 3GOQA 1OAAA 1AD2A 4CKCA 5MGBA 2GYUA 2HSDA 1FP2A 4OMCA 4DMFA 3CH5A 4A91A 4NJEA 5EINA 1G7SA 5A4IS 1T36A 5ALMA 1JA9A 1JHAA 3UVEA 2HREA 4G1UC 4XIFA 2NYAA 4QHSA 1Z88A 9ATCA 2CFCA 1TCAA 3CW9A 4KQEA 1ZRHA 5A6VA 1YAJA 3GGJA 4RS4A 1EH5A 3KTAA 4D4GA 3BCHA 4TS3A 2J59A 1RWBA 3BB4A 3KVVA 4J1SA 4PHFA 1KAHA 3H9CA 3D0OA 4DIDA 2VDOB 3A26A 4MYHA 1PTJA 3UKOA 2RARA 3AH8A 1W2WB 3F2IA 4PNHA 1CP2A 3S70A 5FBQB 3WP0A 1A5AB 1H2YA 4X90A 1HLGA 5CX1A 4HNTA 2DEUA 3NM6B 4RF5A 5SV2A 1IWBB 5WRFA 5AW3A 3DC7A 2Y1KA 4H1WA 1VLZA 2H51A 1ILWA 2NUPA 3HM2A 5FLYA 4F8JA 1RMTA 1X42A 2IX3A 3GLIE 2BGMA 1ZGZA 3EZXA 1D4ZA 3WBBA 1B00A 4AUKA 1QOQB 3GEBA 4CF3A 5AVXA 1BX1A 2OLEA 3PA8A 4BLVA 2MJLA 3BE4A 4BV9A 4NG5A 4RANA 1ZUNB 2BKEA 4CPDA 4BFLA 4XW2A 4KYVA 4BMPB 2FPUA 3BWBA 4DLUA 2CN1A 4LDZA 1V9CA 4HZIA 1VKJA 1V11A 1RFLA 2BEWA 4JJ4A 1JDVA 4OI1A 4DDWA 3WYCA 2WWHA 3NPMA 1WVIA 2JGRA 4GZ6A 4B6SA 2CHGA 3I1FA 1D1PA 3W05A 4KP7A 1B8VA 4JIGA 4JWTA 4U7DA 5EYPB 3VYUB 4GI2A 4BVJA 3HB4X 2QPTA 1QYRA 3HRHA 2H7CA 4UXHA 5JEDA 3GEEA 3T1OA 3AKEA 4F3TA 1S96A 3OLWA 4C0JA 4ZRNA 4F21A 4RM2A 2VWHA 4RMHA 3REFA 5C3MA 7AT1A 2XCOA 4UHEA 4X3PA 5EGNA 5KVCA 4Q1BA 1SQSA 3BE8A 4G8DA 2V6JA 4RM3A 1E2UA 3QNWA 4F71A 1Z25A 2O2DA 3OAAA 4I8XA 3FMPB 2WZBA 4CM1A 5J5AA 3FDIA 1EG2A 2ZSIA 3GZ4A 1KVTA 3AGPA 3QEJA 2QV7A 1CQJB 4EUNA 4MGYR 4O8ZA 2B7LA 4O08A 4DMUB 3F3YA 4DY4A 1E7RA 1M8JA 3KJEA 2QLFA 2VYVA 4FHDA 4TGLA 4NCBA 5JMPA 1XAHA 2PZBA 3FY4A 3QHAA 5CDFA 2YDXA 1PS0A 1KI6B 3OPXA 5LC1A 4DLBA 5HKKD 4JV5B 4Q7MB 3C7AA 3RU2A 4RJIA 4H7HA 4KGZA 1L4GA 2IEAA 4DYVA 4ETIA 4F7DA 1WOMA 3D6JA 4MO9A 1FW6A 4JUFA 1DFHA 2A2ZA 3VGJA 5JHHB 4X64B 1A5BB 1EGVB 5LQNA 4U7FA 4P0PB 1KJQA 4PAMA 4EG8A 5EE1A 3AR8A 4ZT7A 4OXIA 1J2UA 1G3IA 3MJDA 3EXHB 4CVNA 1VPDA 3HP4A 5ALKA 2ZAIA 3LY8A 4KVFA 5CTAA 3QVGA 1MVOA 3IDZA 3RHFA 2JA2A 1NVXQ 1COWD 4KL8S 4ZU1X 3IMEA 6ABPA 2R97A 2I2DA 2X8JA 1M54A 1E3LA 3AEQB 3C6QA 3OCWA 4BB9A 1ILEA 1ZPDA 2QRGA 3VNQA 3DHVA 2ZYUX 3RT9A 1VMAA 1FXUA 1GU0A 1UJ5A 3GLHB 2YVQA 3ISJA 3PNYA 3TRDA 5CG2A 2HJRA 4NZMA 4LS3A 5KWJA 4TWAA 1N2JA 1R66A 1N3IA 5B2ZA 1JG7A 2VDVE 2ZM5A 3ML1A 4H17A 3VFDA 3WBJA 3ZU5A 2DPLA 2FX5A 1TQHA 3BZBA 4RPGA 4OA8A 1OV6A 2Q7OE 1SU4A 4EY5A 1JDPA 2CLDX 1QNFA 1V6CA 2IU6A 1YCDA 4I55F 4ZAVA 1WNTA 1K63A 3FZQA 3LY5A 4ACAA 1FRFS 2WUFA 4DJFC 2RH5A 3PQ8A 1CJKC 1VMEA 1T35A 1XYGA 4RKRA 2HNBA 3OH8A 1HDIA 1WHTA 2E55A 2OWEA 4P33A 3HFGA 5LYJA 5JDIC 2F9MA 5KMGB 2C8LA 2HBRA 2VJBA 4IUBS 4TYMA 3H83A 3WNBA 3DZFA 2MDTA 3NYIA 2UZIR 3W8FA 2XRMA 1UFQA 4JR1A 2JRLA 4GG1A 1EVKA 3OZSA 3PSAA 1TK3A 4PLHA 2DY1A 3MAGA 2IV2X 3SHQA 2JBWA 1JPUA 2LD4A 4L6CA 4A8JC 4IWYA 1IJEA 3W04A 4KBGA 3FBTA 1PNTA 3EVCA 4A26A 4X63A 1G1AA 4WLVA 1GFIA 3KLOA 1GZ5A 3PA6A 4EJ0A 2NSHA 3NGMA 5LWQA 1M6HA 4H7FA 2WP8J 1VYTA 3KZNA 3PUYA 4NCJA 5K0BA 3DDSA 4IRMA 1WKBA 4ZDJA 1RXUA 1YKSA 2IBTA 4DTCA 2D1FA 2QIOA 3AUXA 1KPIA 3KVNA 4EUFA 5A1TA 2HDHA 1NIPA 2AFVA 1YGYA 4GOJA 5EHXA 2A7XA 3V4SA 1MX5A 5EIWA 2UXBB 1FYDA 4C6TB 1E6CA 4K1XA 3LQFA 4BVHA 3JQFA 4I36A 4OI2A 2MCFA 1A88A 3D5EA 3LLCA 4OXRA 3OWOA 5KQGA 1RWPA 3HU5A 4YQZA 4YRTA 4BMVA 3WL4A 1SXPA 3OQIA 4EZEA 1TL7C 3RPEA 5E9JA 1W44A 4MS3A 2ZTSA 3A10A 1KRXA 3NV9A 4BX0A 3T99A 3ZDFA 4HPXB 3KL4A 2WWFA 5I51A 2WJ4A 2CDBA 2WSBA 3KS9A 1A9RA 1OLOA 3TGWA 3HXOA 4IIYA 2AJBA 2ZTVA 2ZRLA 4PYRA 1Y48E 5FUWA 2MHCA 5JMTA 3MWEB 2HM7A 3EIOA 4HDMB 3AZPA 3HJHA 2OCBA 2A5DA 3ND8A 1QIGA 3SC4A 4KR3A 1OXSC 2N1BA 2YINC 2VTEA 4IG4A 2PKEA 4K81B 5H83A 1G3QA 2P5SA 3NDBB 3RJMA 4PPFA 2QTCA 4AROA 1JPVA 4UNQA 1TO2E 1JQEA 1EUZA 3LKBA 1C3LA 2R6CA 4Y3UA 4EI2A 1JEDA 2Q1WA 2HA0A 4GGOA 3PLRA 2QRVA 2LCQA 3SZGA 1NVUQ 2FR8C 3V1TC 5C8ZA 4NV0A 1L3IA 1SOAA 3LU1A 4OXNA 5L3QB 1KPHA 1KSFX 1WCYA 2NO0A 5EEGA 1L4FA 4CF7A 4FDUA 4K05A 3HHEA 2B92A 2OCGA 5TV2A 1KK1A 4Y2SA 3EVAA 4EJSC 3GLKA 3WKDA 2MYTA 1I1HA 2IOFK 2OO5C 2QU8A 3JATB 3HNRA 3TTUA 5D6OA 2R7NA 2IYPA 3M4NA 3T54A 4QQRA 3EODA 3PNBA 1X1QA 3O3CA 2F8SA 4TLDA 1E5XA 1Q0PA 5BW8A 4C4ZA 2HLNA 3FR7A 1T3HA 4G8CA 1PR1A 3W4KA 2W8ZA 3WHPA 1PFGA 2VT7A 4LDJA 3X44A 1PZHA 1Y6RA 3HXMA 3JAKB 4O4HB 4L3WA 1D2MA 5E4TA 4ENTA 5B6IA 4LTNA 2NU9A 1Q3KA 1KOGA 2B2NA 3B89A 3KQVA 4HRXA 4X20A 3WS7A 1U8XX 3FWPA 4NV1A 4YT4A 4PC6A 4EW1A 4HNAA 2JVIA 4CUZA 1T5OA 5LZ2A 2J9FA 5AJZA 4R9SA 3OZ7A 3VU9A 1LZKA 3OZAA 3SZLA 1GPAA 3L0SA 3UV6A 1TAQA 1RYZA 1PFYA 2O07A 3PL1A 4F56A 1VPWA 4LXTA 1J6UA 1SC3A 2CNNA 1KGDA 2ZROA 2P9QA 2ZT8A 2J32A 3BGOS 3DAOA 3I76A 3ITNA 1NHGA 2PA3A 2O8EA 2O23A 4UJ5A 1OREA 2G5TA 1MLDA 3NTLA 1KRWA 4LHEA 2VRWA 2BZSA 1Z15A 2J5QA 4ZFNA 4I1YA 3C24A 2Q5QA 2XVMA 4M98A 3L8ZA 1QAQA 4YMLA 3ET4A 3IFSA 2RCYA 2LCIA 1HGXA 3V80A 1IXYA 4FZRA 1BS1A 3R7LA 1QH1A 4EJ6A 3EWIA 3ADBA 2VJYA 2GDJA 3HWRA 5AI8A 1G3MA 2FFQA 3OJXA 1NNSA 2Y6VA 4OJYA 4J94A 4R51A 3CC8A 4HN9A 4N5NA 4WJKB 2VP6A 3MNFA 1UAAA 3M6UA 4OGFA 3M3PA 2GR9A 2PLRA 4HOYA 4BIIA 4BO9A 2HFJA 3UIEA 1I9CA 3AB8A 1YZFA 4W8OA 1VYVA 2CJPA 2FDRA 3M5CA 1UPUA 2FLVA 4AZ0B 4QBHA 3DOEA 3IE1A 1CUDA 3OE7D 2RC6A 4XARA 5E2BA 3IXQA 2QTLA 5K0JA 3EFBA 3BMQA 2WJZB 1JLSA 4LJSA 4J0JA 4MQ6A 1SY7A 1M8PA 1TE2A 2ZUDA 3LT2A 4O2BB 1LQUA 3R6TA 3TQOA 5KPDA 3MSCA 4J29A 4WXYB 3L93A 5KYWB 2F90A 2IYAA 2WIDA 4ZGGA 5BSGA 1SCNE 4KXVA 4DV5B 1GTG1 2BFBA 3DFMA 3KX2A 1Y1LA 2QIPA 1RWXA 3EIHA 2XF8A 3GJ5A 1Y0BA 4IHJB 1EKXA 4IXNA 3KFLA 3LMKA 1UH5A 1VCHA 2OC4A 2GN8A 2Q6VA 4BRZA 4CQMB 1T29A 3TCNA 3K8OE 1MEJA 3RADC 4FILA 3TFOA 4K86A 2J8ZA 2XEXA 1NLMA 3IJRA 3QLUA 4UEWA 4A3SA 5HQ3A 4U9IS 4QLBA 1C3OB 5ITZB 4ATNA 1G18A 2NVUA 4FZ5A 5BSEA 1AV7A 1VG0B 2CBZA 3AY3A 3AR2A 3I9MA 2O05A 2SCUA 3NAQA 5EXTA 5LCXA 5TMDA 2E4VA 1LI5A 2EQBA 1N1MA 4CGYA 4ESOA 4DQUA 3TRHA 3INNA 1PX0A 3LQYA 1EUCB 4KE8A 2W0MA 3GGGA 4Q7QA 4Q5IA 3SC2B 4PN3A 2Y1LA 3BCRA 2QG6A 3MCWA 4Y2VA 1RZUA 3LWNA 4LNUB 3MJFA 3TZLA 3VR3A 3WV4A 2FZEA 3FVTA 4A4DA 5I7VA 1PL8A 1PKEA 4LZAA 2J0QA 1JS1X 1O95D 3MWDA 2PQ2A 4YI3A 2H2AA 4UBLA 5H7XA 5LJLA 1NFQA 1N2XA 3ENKA 4H18A 1HT0A 3AU9A 4FDLA 3H8JA 3BTVA 5I7EA 1JIVA 3SZ3A 7ADHA 1IXSB 4BN4A 1T0HB 2CEAA 2R6AA 3DD1A 1XU7A 4YRKA 2B99A 1KTVA 1V45E 4I9NA 4V0KA 3ZV4A 1DPFA 2HNAA 4GM0A 4GW3A 4CTOA 5FTLA 1ENZA 4QOSA 3DOFA 4C7KA 3JWJA 4DLSA 5BMOA 4CI9A 4PAGA 4F92B 2CSXA 1J70A 1KDTA 1HE2A 2HHAA 3GUCA 3N0RA 2FZKA 4PC2A 4EYKA 5JZSA 2ZRDA 3RS4A 3ZOZA 3DKKA 2GEKA 4RK1A 5T3YA 1JEJA 2HOQA 3FYUC 4TMYA 5IAKA 3TRKA 3AXSA 4X6XA 4EQ6B 3I6MA 3T38A 2F4VB 5BQOA 4XYMA 5DI3B 3KOMA 3A6KA 4LJ5A 3FZYA 3TZKA 2FSPA 3PT5A 3DDOA 3E48A 5BNZA 2PX2A 4AY4A 1YULA 3ESXA 3N2NA 4KX3A 3RRYA 5CB0A 1RPZA 3H5NA 2P7HA 5JXGA 1VSQA 3H11B 4MAFA 1RJWA 4LQDA 3ZYCA 5I5GA 1NJSA 4CYMA 1F6WA 5CFLA 2Q0XA 2GPYA 2WKPA 2JAHA 4RHTA 3C6YA 4IG9A 1PR5A 3MF4A 2W2MA 2YWGA 4MUBA 5HDBB 4MJ3A 1Z06A 5CA1F 4B4VA 3GGDA 1QYVA 2ZYTX 4HK4A 4HQLA 3W6OA 3WQQA 2PDAA 4ZD6A 4G1EB 1EWVA 3WLSA 4YT8A 3GCDA 1QO0D 1CZLA 2VJQA 3NIWA 5DYNA 1JVSA 4HDKB 4R05A 2ZREA 3SS8A 2IHUA 4DEVA 3RAEC 2W8BA 3DAGA 1YXMA 2ZAYA 1Q44A 3Q2OA 5FL3A 2XGGA 1T0IA 2LDBA 3E9ZA 3JZAA 4KXLA 1IH8A 4R5MA 2R47A 4CWAA 4HUTA 4ZI7A 2J9YB 1UC8A 3OFJA 3RJTA 3ILSA 4L5IA 2QM7A 4OHPA 5AXDA 3E7FA 4N5DA 3VH1A 4GEKA 5F7ZA 3I61A 1PG0A 3KJFA 5KO2A 4OLAA 2D2FA 1XOIA 3NG1A 3N74A 1J8QA 4BEVA 3H9JA 4KV9A 13PKA 1FRVA 2C3OA 2YVKA 1IVYA 3CNHA 2PJZA 1V0JA 4MUAA 4DIFA 5IXJA 2CFIA 4MPTA 6GPBA 3OT5A 4LOIA 5FOTA 3DVQX 1KIAA 1CE8A 4EOGA 5A03A 5C37A 1W9HA 4FIDA 1QVWA 1E2DA 5L40A 2ZIXB 2OBLA 1U2ZA 2XCRB 1DGQA 2BGIA 2OYCA 3MWKA 2PJRA 4M8NE 4J4TA 2HMUA 2VK4A 2WUEA 4HAYA 3ZX5A 1Z7GA 2XDAA 3OQNA 3IXLA 3VZPA 3O2QB 2HQBA 1T6YA 2XUFA 1T8PA 2OAEA 1JKIA 1KJIA 2H7YA 3NM4A 5KDLA 3FYTA 2UXDB 1H0KA 4HNQA 5DMXA 3T3EA 3B7GA 4PX3A 4XB1A 5AD1A 5JSQA 3TNDA 1MHPA 1A7AA 2AFIA 3AHGA 1JHMA 3MTBA 3OT4A 2Z08A 4JI7B 5IT0A 3TB6A 1ZNWA 4XIJA 3L1UA 3OJWA 4CMKA 1V6AA 4Q3DA 2QPOA 2CFRA 4OJTA 5BN5A 5KWIA 2R1TB 3MINB 1USWA 4HFJA 4F46A 1O95C 4NZPA 4IV8A 2HJGA 4X24A 5HM6A 1BOFA 3HGTA 5KWVA 3IUMA 4XE5A 3L8EA 3OCXA 3ZDAA 3GELA 1OXTA 5HS6A 5DBOA 3GUYA 3NHYA 4Z4EA 4ONEA 2HCTA 3ESBA 1Y5RA 4FM9A 4AMVA 1S3IA 5YASA 3MJCA 4PZLA 2WDZA 2FR0A 2GPTA 3PFGA 3TVYA 4URXR 4LRSB 3EUFA 2O5VA 1B26A 4ERNA 3ELDA 3AV3A 4C0WA 1OX5A 1Y3BE 4D9KA 4AECA 4PYIA 4KO8A 2DUJA 1E1NA 4DRYA 1O4VA 4DMMA 1UWVA 4W9RA 1IU9A 2GRAA 4UM7A 3E6AA 3HQ4O 4WZZA 5TPWA 2E5WA 2P2YA 5EQTA 4DRZA 4AY2A 5DMHA 3K8YA 2R7KA 3BTSA 3NEYA 2ZAGA 1XDWA 1SUEA 1TB4A 1QGAA 2W0SA 5I7WA 4BWYA 2ZJ0A 3G13A 3ZGOA 1JFFA 1E2JA 2D7CA 1N5DA 1RBYA 1WUTA 2XX3A 3C15C 2BWJA 4NMLA 1ADFA 1U31A 1IIRA 1VOTA 3OJFA 4P8RA 5CLIA 1PI3A 4Y7CA 1FCJA 2IFTA 2WWTA 1W7AA 3PQEA 1R00A 3CSDA 3TRFA 4RTLA 1H5QA 1XA0A 3ONNA 3UJBA 1F4LA 2EWMA 2J0EA 1WCIB 2F7SA 2JGJA 3C3BA 3P0FA 4NS1A 3WK8A 1Q19A 2GILA 3ZEAA 1TUIA 2IYNA 4FWIB 4JEHA 4KZKA 1EB8A 3L4BA 2H1WA 1Z29A 1KMIY 3UXMA 3PEEA 4I4IA 2V9CA 4WZBB 4WLUA 1ZISA 4Z4QA 3BQ9A 3F5QA 4FGSA 1ENOA 1U2EA 2EJWA 1TC1A 3ICPA 3KRTA 2OGUA 4OJKA 2X0KA 4JVSB 5DT2A 2C20A 4FLFA 5CH5A 4JT9A 3U3MA 2XODA 1S5PA 4PEVA 2ID8A 4RH1A 4ZHQB 1TKCA 4CL0A 2F1IA 1F4VA 4J0CA 2YWHA 1IUOA 3M70A 4RSRA 2UXCB 2X15A 1ISHA 3I9V1 3L7LA 1Q17A 5FKJA 2BLNA 4MVJG 3SQMA 1Y3DE 1UFOA 1UK6A 1A77A 3LLVA 3UPDA 3KLPX 1UQTA 1EAYA 5HIKA 3MUNA 1HZZC 3GRUA 2XYHA 2A1UB 3BXOA 2OLKA 5JZOA 4EEZA 2ANBA 5IM4F 1NBIA 2JGIA 3BC1A 4UU1A 3SEZA 5JOQA 2O8CB 1DU4A 2H4ZA 2PL9A 2WIJA 2B69A 2M1XA 2IVFA 3ABIA 1YC5A 3C1AA 2HBYA 3UMVA 1LDEA 3DOHA 5HZKA 4UAJA 2ECOA 2J07A 3T7DA 1KAEA 4PC3A 3E0XA 3JARB 1BMFA 2FJ0A 3NFYA 4AMYA 1DE0A 4RIIA 3W0LB 1SKYE 4M1ZA 3EF3A 2YNMD 1QKJA 3PGA1 3U4QA 2VRCA 5IW8A 1PWZA 1J00A 3MUOA 4J7CA 2YRXA 4CLEA 4EVSA 3I34X 4UTVA 3NEAA 2ZW9A 1Z8HA 1CZKA 1NVMB 3ASZA 3DE3X 3QBEA 3QF7A 4FLEA 2P7IA 1AQ6A 1RYNA 3MJEA 4RIEA 4Q9HA 2V6IA 3U9LA 1ZUNA 1VJDA 2KSQA 3O5AA 3V7FA 4R2JA 3GA0A 2VDUE 2OSBA 1NC3A 4QYXA 1RYYA 3HDGA 1YCHA 3C6BA 1F38A 1NBMA 5F33A 4YRGA 1CUJA 5C4GB 4Q9JA 4MW1A 4ZKDA 1EVZA 4KMSA 3FTPA 3GJZA 3QEOA 4FBMA 2O8DB 1NN5A 4RPHA 3ZNOA 1VE5A 4EI8A 4ZGBA 3ZHOA 3UHAA 2NYRA 3SXPA 1T6XA 3EGIA 3SJBA 1HDZA 1OGYA 3GUZA 1T2NA 1D0VA 1P4JA 2G6BA 1HR0B 5A9TA 2PR7A 5EYPA 3AIKA 3HU2A 4FFMA 1DEOA 4J03A 1TTQB 3CR3C 2REOA 5GM1A 5I9MA 2XZOA 3DW3X 2DZDA 4Q19A 2H4XA 5GJCA 4DABA 2F3TA 2ZULA 1GSAA 2BC9A 1YR6A 2CZCA 3KDSE 1V8DA 2ZM6B 4C0QC 4D8TA 5FUYA 1YRAA 3CE6A 3FTNA 4YMTA 2P35A 4JJ8A 2AKEA 1E89A 1XZIA 2QB5A 1IY8A 3K1AB 4FFPA 3RRFA 3UMFA 3KEMA 1Q57A 4Y6RA 3TLXA 2XB2A 1HQDA 2XUIA 5CCDA 4PRYA 3DOCA 2QW0X 4NE2A 1G20B 4LHSA 5BSVA 4R71A 4MVJD 1E9AA 5CFRA 4ZTZB 3MXTA 5A5DA 5JVDF 3STXA 4E4RA 1CQJA 1L7PA 1VJ0A 2VWPA 5AKIA 1XXHE 4P4SB 3SQLA 1MV5A 2BEUB 4NECA 3U26A 2Z2YA 4MIKA 1Q0QA 2ADMA 5HPYB 4MQEB 3FSRA 4P4UA 4Q9DA 4CR8A 4MRMB 2Y68A 5H02A 1KI6A 4AP9A 4Z7OB 1LSSA 2FP4B 2RKBA 2VNJA 3NXSA 1YU9A 2LKCA 3SDSA 3E4CA 1PFUA 4YH1A 4ALMA 2FRXA 4IGAA 5I9IA 4F2DA 1RWMA 4B2PA 2PBZA 1SZDA 2EHJA 4QIHA 5LMZA 1T5TA 3OM0A 3IJEB 3Q1LA 5J59A 4JLVA 4EAAA 3EXHA 2G3YA 3H2YA 4IKOA 2H2FA 4WGGA 2ZXFA 5IRCD 2J3JA 3TSYA 3AK4A 1UOOA 3MSXA 5A6SB 5A02A 4MMXB 4BZWA 3AF6A 2GPBA 1Y3HA 3UJ6A 2ZYDA 4ID3A 4L22A 5B3LA 2BD0A 3ZGVA 2WINI 4WEOA 2XCQA 4R2MA 3AEQA 4UMEA 1G21B 5TY0A 3HBMA 2H52A 2V45A 2WJ3A 3VO1A 2QSYA 1KDPA 3GLHA 2QJWA 1N3YA 1YJXA 2P5UA 3GY0A 4I5FA 4R9VA 1G4UR 5AW5A 1CG6A 4JVOA 4TWBA 3TE6A 5DI9A 1L7VC 2JAUA 1O5OA 3K8ZA 2G1UA 4MV7A 3ZU6A 1MBZA 3QPDA 5IVKA 5G1PA 4ZKEA 5AI4A 3GJRA 3V33A 4KLAA 3J7TA 2XNSA 3C3MA 2X0EA 4MR9B 1QDEA 3AW9A 3TW8B 3HB5X 4RUKA 3NRCA 3CWQA 4WACA 4Z9AA 3HGQA 3OEHA 1YR9A 2YNMC 4MW4A 5HHTA 1UPCA 2O7SA 4RIFA 3VR0A 5I9LA 5IXYA 1T5DX 4PPNA 4UUMA 4JYZA 3L0YA 3RV3A 4UTOA 2F55A 1K5HA 1XZMA 5KMGA 1GGVA 2JLVA 2ZR7A 3CO0S 1N9ZA 4R1OA 1JQLB 4FDMA 4JNCA 1LJ8A 1UOEA 1J0CA 1HDCA 1MIOA 2QSJA 4MI6A 1DIOB 3IS3A 1C14A 3CURA 3P96A 1JHRA 5F1KA 5H4HA 3DB2A 4F4IA 2CW5A 2WR8A 3P9SA 4G2NA 4BLSA 1H3NA 4U9UA 4O3FA 3RYFB 4HDSB 3RVNA 3A6GA 3TUIC 3DDNA 4BNTA 2VHYA 1JJFA 4B73A 1JHYA 2OA0A 5JC8A 1YUMA 3E9MA 2H5EA 4DQVA 1DTEA 2M98A 1K2VN 3FYCA 5BSTA 4DADA 1SXJB 1ZGHA 3IBCA 1RW4A 2VDWB 1Q11A 3WLOA 1G59A 1P1FA 3EFEA 1IRIA 1LA2A 4POOA 1CPYA 4QVGA 3TK1A 4UMVA 3X1KA 1RI3A 2V55B 3D2BA 1W19A 1MQ8B 3DZIA 1GRQA 1VFPA 2C3PA 3GVCA 2PWZA 1N7JA 3KU4A 3L7BA 3V46A 4E1BA 2C0CA 1V9LA 2VNSA 2WFLB 3ADPA 1Y4SA 3PUWA 3S7ZA 2GHIA 3I9NA 3KFXA 2GEBA 4DY6A 3F97A 3LT5A 2ZCVA 5KKCA 3UAGA 2ZRFA 3MLAA 2P9ZA 3LCUA 4INAA 2GJKA 3A0UA 1ST2A 2I6UA 3HVKA 4OIMA 4U7HA 4CFZA 5ILGA 4PCAA 4J9UE 2PM8A 3QP9A 1OE0A 1YI8A 2F3SA 3M9XA 4GOOD 5G0SA 4C08A 5BVGB 3P0IA 3RVRA 3IAM6 2W83A 2W6JA 5F4ZA 2O8NA 4W8HA 4BP3A 1S2DA 1AUQA 2HSGA 2Q62A 3C41J 1GT6A 3HWWA 4YFYA 1XZDA 1YJBA 3QE4A 3QVOA 5HXAA 3A1TA 2JGLA 1AKRA 1TEHA 2R00C 4KV7A 3WO0A 2QX8A 2OAP1 4NKRA 4DM3A 4EA9A 5T8KA 1U9JA 5EHIA 2ANCA 3TTTA 3QMVA 1WULS 3BMNB 3H3FA 1FZQA 4OQYA 4HRYA 4QPJC 1AQJA 2ZJ3A 3LRXA 4UNSA 3MWEA 2BM8A 3VTZA 4BV3A 1O2DA 4HDMA 4CG2A 3CLSC 4GVXA 5CAEB 5SY9A 3V8NA 1RBMA 2GK4A 1I36A 3TEJA 1X7ZB 2PLAA 4L0DA 1ZJWA 1RI5A 2EQ5A 3P45A 5FA8A 3K9LA 2EKPA 3B9BA 3QVXA 4WE3A 4QJ3A 4ZOLF 2PBRA 3KZMA 1X19A 4IMJB 5CT5A 3KSAC 1U2DA 1ULTA 3H84A 3O2JA 4I1RA 4NP6A 3HY3A 3I64A 2PT7A 4N41A 2J6IA 3I12A 4EO7A 5K45A 3QE9Y 1QLJA 4R2HA 4RZXA 3E35A 4EY7A 5KYUB 5KYYB 3PD1A 2YZGA 3PF9A 5L3QA 2ZB7A 1UBLS 1RIIA 4D9IA 2XRZA 4O0MA 4P93A 2BGGA 3SC3A 5KOJB 1TX4B 3H5AA 3B36A 1XDUA 3VKHA 2HK6A 3RKSA 3HVUA 3WWPA 2ESRA 4EKGA 4MSUA 3JATA 2WHYA 4N3BA 3TWOA 4IIGA 2ZT6A 4YCBA 4JD5A 5G3YA 1CY4A 3FDXA 5D01A 4WPGA 2IXBA 3L77A 5CRIA 1JJ7A 3A1SA 3AGQA 3QBTA 1FMCA 2C03A 3JQBA 4UARA 3Q8KA 1EVEA 3QLEA 4ZT6A 1G2QA 2KHZA 2WBLC 4E31A 1VLJA 5ECDA 1JYSA 3NT2A 4WESB 4YROA 3JAKA 4O4HA 4LJRA 5IDVA 2J85A 4NAUA 5KYVA 3DEYX 5CFPA 5CUQA 1Y8ZA 3VO9A 1L1RA 2KBFA 5LZ5A 2BFCB 4RMJA 4C04A 3S8MA 1D9ZA 3UBTA 4F72A 1L7DA 4KDEA 1EM8B 1CLEA 2HK8A 1AO0A 3Q0EA 1ZONA 4JXXA 4NV3A 5D6NA 2IP4A 1JR3A 4I4TF 3U7EB 3T5PA 2R86A 2REXB 3B6KA 3QTTA 5K05A 1P0PA 1UUFA 5FOUA 1C30B 5L3ZA 5I3ZA 2PLFA 4MV6A 2DHCA 4QUDA 3KALA 4F2GA 3BZWA 1W73A 3E7DA 1UXIA 2DOKA 4TL6A 4PAOA 3K0CC 3QVTA 4FOTA 2AE1A 4M4SA 3WRWA 5JISA 2J3LA 1LDMA 2QDXA 4AJLA 4UASA 2P62A 2HO5A 1BZYA 1Q83A 1AB5A 2AJ8A 2C0PA 4C7VA 2E87A 1R0RE 5HF9A 1PVDA 1W93A 1BXZA 3GD7A 1OGIA 1Z83A 1NU8A 2GD0A 4GX0A 4P7FA 5J3JA 1ELOA 1DSSG 4YCCA 4MB6A 4CL3A 3TUZC 1O0SA 3DO5A 3D43A 1HZJA 2BYTA 1UZLA 4DWJA 1KZ1A 5F12A 1V71A 5LUAA 1L5RA 1BXGA 5KS2A 4EH1A 1ZIPA 2IYSA 2C54A 2Z04A 3BCSA 3SFVA 3SN6A 1BWQA 3K30A 4F2WA 5IU6A 3VNUA 2F1JA 2E37A 1T9GS 3O21A 4EG6A 1ODCA 3WYGA 2AZXA 1Z6QA 3KYCB 1P5ZB 1Y1RA 4PIVA 1SUPA 4AZ0A 4EF4A 3LC7O 4WLFA 4JEMA 2XQKA 5C53B 1Y63A 2RJ3A 4RK0A 2HA3A 2WSMA 3DTTA 2UUAB 3ZZUA 1E2IA 1HFJA 2FSIA 2FGJA 4O2BA 1DO0A 4M49A 2QG9A 3G5LA 3NUGA 4IO1A 5ICGA 1KP9A 5K99A 5KYWA 1PTJC 4B6PA 1J0XO 1HT3A 1DCKA 2GYYA 2FV8A 2NN3C 2O0JA 1ZK3A 1L3CA 2HZBA 2VRNA 3C4VA 3EDOA 3FUVA 1GPMA 5FTWA 3SQNA 1Q0TA 2I8CA 1CUGA 2IW1A 1JTEA 3A05A 3N0XA 4IHJA 3SM9A 3UUGA 3M5WA 4GPTA 1JDBC 1WDWB 2X9VA 4YDSA 1C9NA 1B43A 2O54A 4CLOA 4F38A 3K94A 4CQMA 5F4BA 4M0DA 1FFXA 2PQ0A 2EWWA 1C3OA 1U90A 2JB9A 1OPXA 3OKFA 3UT6A 4XUDA 4CIAA 5ITZA 1DC6A 2PHZA 3A1EA 3A9TA 4FN4A 4RJKA 3N5CA 4OI0A 2YV3A 3TKYA 1YB1A 3GVXA 1GUFA 2AUTA 2R3SA 3F1LA 3QU4A 3K1TA 1TM5E 2JCBA 5G4KB 1BG6A 5AJHA 4RDXA 4MA4A 2RGCA 1EUCA 4KAJA 3SC2A 4DXDA 2YQ4A 2QTGA 2B4AA 4LNUA 1SBIA 4REQB 1AK9A 3PXCX 2BBSA 3EC7A 4U2DA 1UDWA 3GP5A 4QDUA 5TC4A 4DLZA 4XWWA 4QUGA 1W5EA 4FMBB 2C1XA 2XWSA 4KKXB 4FK8A 4R3NA 3LO5A 3PICA 1VFNA 2H4FA 3DMTA 4TS1A 3DDHA 4YUZA 4D9GA 3FN4A 5FNVF 1B8OA 3T7IA 3IOYA 3L4KA 3GYGA 1N77A 5CB4F 2OHHA 2IOHA 4BKQA 3KVOA 3K70B 4D0SA 1CNFA 2JASA 1E2GA 3P4XA 4ER0A 3F47A 5LDGA 1KIFA 4MINA 3QKRB 3IVAA 1C1XB 4B84A 4G36A 4OYRA 3P32A 5IYZB 1U2TA 3UT0A 2OCYC 5F78A 4EQ6A 4JJGA 3QXCA 2G28A 3LUBA 3OZCA 1JG4A 2OORC 2WLSA 3FOWA 3KTFA 4NZ9A 3VC3A 1XZFA 3H5IA 4X54A 4CFSA 4UHHA 5DI3A 4DGQA 2C2YA 2JH3A 4EW6A 2MYUA 2CJFA 3WK5A 2CYAA 1T1IA 1QTRA 2BT4A 1CRQA 4PPYA 4NIMA 1JNYA 3A4LA 3IAUA 3SSNA 3HDHA 1IN7A 4ALLA 3FKSA 5E1DA 1HLDA 2C07A 4NNJA 2A14A 3H11A 2B7BA 2QUHA 1ID1A 1GSIA 1Z73A 4RL4A 4DUPA 5AKZA 4RADA 3SD7A 1PX2A 2Y77A 2Z8ZA 5BMVB 1NUAA 5FBRB 1C5KA 3LX5A 4WINA 1TAGA 1MPTA 1XZEA 1YRHA 2OAGA 4QXOA 4M87A 3U3XA 3BIWA 4GP9A 5C1DA 3IB3A 1DEHA 4PQFA 5G0WA 4M0PA 4N6OA 4Z1OA 1YCFA 2R5WA 3I6BA 2A4MA 2F9FA 2FN3A 2V6FA 1KVUA 1ECBA 2QTNA 2QR5A 5JZ9A 4XJSA 4Y67A 5HFAA 5DLQC 4CV0A 2W2OA 2J3QA 4HDKA 1XQXA 4WNYA 1X1EA 2MU1A 4BPRA 1MOSA 4YWJA 2P77A 2OBYA 3NQ41 3CPEA 4MVCA 2GLUA 2YUTA 4KMMA 5FI0B 1DBRA 1RYHA 2EL7A 1CNMA 1S6YA 2GD6A 2BTQB 3EA4A 4JQYA 1OBVA 1BWRA 2C8JA 2DFDA 1UKYA 3T3PB 1P0IA 3GPLA 2JZNA 1H94A 3ZS9A 3R75A 3HKEB 1MAWA 1AC5A 1JU9A 1WG8A 3ZD9A 2CMGA 2ZRJA 1JUDA 1F0YA 5EIEA 2PT5A 2IC5A 3BXPA 2VZ8A 3ONFA 1MO3A 4LKRA 4MIEA 1VPLA 1PW5A 2P9TA 2WP0A 4A5SA 2QUJA 2X4LA 1PFWA 2ZIXA 2J0VA 3AG5A 4D9MA 1E0KA 3I58A 4R83A 4IIJB 4W9NC 1U81A 5F98A 2ZEJA 4JKIA 2IL1A 4D9BA 1HNXB 3AW8A 3Q6NA 1N78A 1YZGA 2QRUA 5KNCH 2BUCA 3OZTA 4KIGA 3HVIA 3S2GA 4C5CA 1IOWA 3T9DA 1QP4A 1PJZA 4PZAA 2HXYA 4WZAE 3NHZA 1OKKD 4S05A 1GPUA 4GVLA 1FYXA 2WF5A 4LJAA 4Q1VA 3QVKA 1RHJA 4D02A 4DQLA 4H1VA 1QH8B 2R1TA 2X4GA 3MINA 2CB9A 3MFQA 3R74A 1CBUA 2WK1A 1T8TA 1YACA 1RXYA 1IUPA 1JHDA 3JRXA 3LLUA 1Z47A 1I3KA 2A3RA 4MAAA 3QFRA 3IPRA 1NJFA 3Q7SA 4KH1A 4ETWA 4Z4CA 2B4YA 3VVCA 1GNQA 5K7SA 4FE4A 5DTMA 1SELA 1W4CA 4PINA 2NO4A 1OH5A 1T1GA 1YZNA 2EJUA 3ESDA 5AJTA 2CLCX 1M6EX 3CLKA 4MGKR 3AUUA 1DAEA 2PMFA 3AF4A 5HDQA 3UWDA 4AY6A 4N0QA 1CJSA 3LIIA 4PZYA 2BFEB 3S68A 2H9YA 4OM7A 5B58T 3BA6A 4AJJA 1V5GA 3VC1A 2J9XB 5AOAA 4AM8A 4B34A 3W9UA 4YT2A 1AF7A 4CKWA 2DFPA 2IOYA 1UBCA 1V7CA 2BVNA 2DQYA 2NU6B 1PZEA 1AA9A 1CF2O 1DADA 5HBGA 1FVXA 3G5MA 5BSMA 2GQ0A 3IDOA 1QSGA 2K5UA 3OO0A 3P27A 4IVQA 4URUR 1SQGA 1E1YA 3CH4B 4YVFA 2XSZA 1MZVA 1WCIA 3CRW1 1W30A 3E03A 1NRJB 4TXNA 5DWDA 1BCRB 4R3UC 4YAUA 3GZTB 3GUHA 3RSOA 4MWBA 1KYXA 2BL4A 3EOBI 1KO5A 2ORVA 1FMFA 3A6HA 4FQ7A 4WZBA 1ADYA 3B1FA 1XD2B 4ZIRB 4DC0A 2R2GA 3A36A 1JPJA 4TS4A 4C6SA 2WUGA 2ROQA 5BOVA 3ZLTA 2PTGA 4UBOA 2P91A 1XA4A 3OOEA 4ZHQA 2PUTA 1MQSA 1R5OA 2F1KA 3ZWDA 1U7UA 1C80A 1QAMA 1P9NA 4KXNA 3DZCA 5FPQA 3MHPA 3QZUA 4MGZR 1VG9B 3QVVA 3TOZA 4LRXA 5THXA 4I1SA 2AR9A 2XTMA 2AS0A 1KI2A 2EZ8A 4K7JA 1VXRA 3DHWC 2ODPA 4CIBA 5KTNA 3WSTA 3WSWA 3BH7A 3CNOA 1Q77A 4ARIA 4PIMA 5KVQA 1GCAA 1MPXA 1VI5A 2C2KA 2DH6A 2FPOA 4QWMA 2PFSA 2PEYA 1A7UA 3JARA 3JYOA 4XSVA 5CIWA 3EMVA 3K9HA 4ZCLA 1KAMA 1TI7A 2B20A 2CNDA 2V03A 4DEYA 3HJGA 2M6KA 4U2FA 1QE0A 1XVAA 5DNVA 3U17A 2BFWA 1K8XB 3BK7A 3DMNA 3EY4A 1A9XB 3QHQA 4NBUA 4UUNA 2J09A 4LSZA 4N5HX 5DTEA 3P2JA 1ISRA 1YOVB 5JD3A 4HDOB 1EE2A 4Z3DA 3AVUA 1ORHA 1PTKA 2C78A 3QMWA 4P22A 3V4ZA 5ER6A 3QUCA 3H9GA 1QGZA 4LGVA 5KJCA 2A5LA 1I5EA 2XVYA 3DBVO 3GDFA 3L92A 3Q3HA 4HYEA 4JELA 2QBYB 4J4HA 4E5PA 5KEIA 1I1NA 2ECQA 2C96A 4I81A 5GVRA 1JSRA 2RHWA 3D6AA 3H99A 1WKCA 1GPH1 3BH6A 2VP4A 3LAWA 2HA2A 3GPCA 4FB4A 1F12A 2JLWA 2O8DA 5G1NA 1K27A 4F5DA 4TUYF 3G79A 4IDGA 5AK6A 4HHEA 3ZLUA 4F4JA 4RH3A 5LKAA 1P29A 2QN3A 4CN8A 1T6ZA 3Q8XB 5FA6A 3W4JA 2DQ4A 3KSUA 1V6SA 3WISA 1D2HA 1TO6A 4WWHA 1UT5A 3GQBB 2DTXA 1NPDA 3EAQA 1RJEA 2KS6A 1I0IA 4OHZA 2PUBA 4U6SA 5C7IO 3OJLA 3T1YB 3R77A 4K9SA 1N5KA 3UCFA 2IYZA 1NLUA 5JI3E 4GLFA 1PNQA 2HDNB 2PK3A 4IGIA 2G5CA 4YIKA 4C0LA 1ADCA 3EVDA 3U44B 4R9UC 3M1YA 3FDFA 3K1AA 5LZ8A 1QTQA 3EZ9A 2X0DA 1CJTC 4E2YA 4HGRA 5JJ5A 3O3NB 5TXGA 3KNZA 1PJCA 3FETA 4WRRA 1YONA 3S0JA 1G20A 1OQAA 2OY0A 4GC5A 4UJ3A 1ZOPA 3A1NA 4GZ5A 2JFXA 4ESEA 3H8WA 1YZYA 5BR1A 2VHUA 1H8EA 5B1SA 3UCXA 4QYIB 3NTVA 4P4SA 1VIVA 1EFHA 2BEUA 2AI3A 4IVPA 4FPXA 3H7IA 4MQEA 4F3CA 4X84A 3HL4A 4MJ7A 5F64A 4MRMA 3TAHA 2FXVA 3LT4A 2FP4A 4P3KA 3DLTA 5I3CA 1KQFA 1J8FA 4P38A 4E21A 4ASUA 1VECA 1JJVA 3Q98A 4K88A 1G19A 2CNLA 3PD0A 4UW9A 1NYLA 3GH3A 1PZMA 1M2HA 1QPBA 2HX1A 4ZTUB 3DTVD 2XADA 2X1VA 3CR7A 4P32A 8MHTA 2WA2A 5EE9A 1UJ2A 3OJCA 4WBXC 4Q7LA 1I7QB 1JEEA 2E21A 3H2HA 4I19A 3Q12A 3QX9A 4WXPA 4ZV4A 2I4OA 4IIFA 2GFIA 3OCUA 3ZGNA 4TTQA 1EDDA 2XV1A 1OFVA 4UQOA 3FJ1A 5GPBA 1U0LA 3N75A 3Q41A 3C1UA 1JH9A 1G21A 1D1SA 1JGTA 1EZ1A 3JQGB 3E1GA 3OCJA 1K7CA 4Q05A 3AWDA 3AY6A 3DC2A 3NOOA 1NOJA 2GDZA 2IYTA 3B2EA 3JALA 3O92A 1IZ9A 4JL6A 4YO8A 4F8YA 1JQ5A 4HS9A 5C1BA 4XVUA 2ZVDA 4UQLA 7MHTA 2EERA 1AJEA 1WXFA 1XHFA 3Q2KA 4I0WB 1Q6YA 1OI7A 5ES3A 2IZ0A 2X8WA 4PXSA 3W9SA 4RK4A 4DIEA 3K0HA 1RYEA 1P18A 4PX9A 1BX0A 2Z1NA 4WN3A 2P4QA 3TW8A 3WGHA 3I1YA 3Q3IA 4YP6A 2A9QA 3B20A 1GP2A 2XQJA 3T41A 3QY9A 2QRHA 2QF7A 3GH1A 3STYA 3EULA 1NUUA 5D51S 3HVRA 5C1PA 1NM5C 1ZK1A 1QQAA 3DL2A 5T6BA 3GLSA 3IQZA 3WGNA 2H00A 2FWAA 3R2JA 2QZSA 3AEZA 1KH1A 2A9KA 1V8PA 4RGVA 4TV8B 4WV3A 4ZO7A 5E6SB 2E49A 5C0OE 3R9XA 4BN0A 1M7HA 2WV7A 4MW0A 1GGKA 1RCFA 4B6RA 3N6XA 1IHDA 2QL9A 3F49S 3RYFA 1N9GB 4HDSA 4OKNA 4WEQA 1NZJA 3O1IC 2ZWVA 4IM7A 2YYSA 4J2TA 4MROA 2FMIA 3G85A 4M8LA 2AFRA 2NZ8A 3PJDA 1O6CA 1NVGA 2B9VA 2P69A 3S6JA 2I3DA 3AF5A 3V2HA 1SXJA 5J2UB 5IF3A 3VR2A 2C00A 1P3Y1 2HCJB 2IYWA 2VDWA 1U3GA 2GN1A 3D8HA 3VGPA 4O4LB 3NYQA 2IUTA 5HK9A 1PYDA 3PIDA 1NP6A 4FINA 3AHDA 4X1KB 4KI0A 5AI0A 3OE5A 1WVMA 2JLZA 2MSCB 1V7ZA 2O0LA 2YY6A 1IONA 1WW2A 2O5EA 3K0BA 3EISA 5JLAA 2WFLA 2X5NA 1S2LA 3PYLA 1HKHA 1AGXA 2GJ8A 2ACWA 5DLDA 3ZTTA 1KF0A 2OHVA 2UZAA 3KUDA 4P3OA 3VU3A 1U8TA 2D5BA 2IYLD 1JG3A 3FNBA 4COKA 4D7AA 2AL7A 1FQWA 1LBEA 1LK5A 1UBMS 2VQFB 5BVGA 2FTKE 1YV9A 4ARAA 1TNDA 3FPHA 2QPLA 5K8CA 3AM4A 4CCSA 2UZ1B 1U9IA 1ULHA 2V7PA 3L8FA 1R50A 5LBTA 5C8XA 3RC3A 4CV2A 2QLTA 4KNWA 1BO6A 4XWAA 5LA6F 4EZBA 3IAFA 1IN1A 2GUGA 1EBFA 3NCTA 5EC8A 3W5UA 4BFVA 4EKEA 3CZ4A 3NIGB 3TAXA 4BP8A 4ZJYA 1DVRA 5BNWA 2FN9A 3CWCA 5B2EA 3U80A 1R5NA 3BMNA 1Z45A 1LW7A 2DTDA 1A71A 4XWYA 4KFSA 4IHKA 2V0GA 2FCRA 5CAEA 4TZ6A 3GGOA 3L6DA 3WLMA 3J7AC 1X7ZA 2VJMB 2X9NA 3FPEA 3EAFA 3LLMA 1GZSA 1W46A 4IO0A 4LYDA 2H1SA 4TKLA 4GKJB 2HTFA 2FN7A 5DN9A 2ZTUA 2ZB2A 5DM70 1HWYA 3MTQA 1N33B 621PA 1UM9B 2NIPA 3DSRA 4DQXA 2VDRB 1KY5A 1IK6A 1RC0A 3OCVA 1LLUA 3CSSA 4LC0A 3PQ4A 1MAVA 4RLHA 1J5PA 1X0VA 3BXXA 2WMNB 4JOBA 2OT3B 5KYUA 3RE1A 5JYEA 5KYYA 1J0DA 4TZ0A 3ZTWA 1GRCA 4CJXA 4CT0A 5KSWB 2WNIA 1WV0A 2Y4OA 3KR0A 3H13A 3TEFA 5KOJA 4TT8A 3ORHA 4MKZA 1MJFA 4FHEA 3EXEB 1T3SA 3I3SR 3NOVA 4EB0A 2EBHX 3S55A 4CIXA 3O83A 3I04M 1J25A 3RS8A 4BRSA 3KQNA 4EG5A 5CDSA 1QVVA 3UPTA 1EVQA 3L0DA 4X6LA 5E0KB 1PEKE 3GRZA 3Q9UA 3HZHA 5A4FS 4C06A 1OY1A 1T13A 1P72A 1R6XA 2R8RA 2ZQYA 3PRYA 4YCJA 4EY8A 5TMPA 4DUYB 4UHDA 4DM7A 1VTKA 5CJJA 2F3QA 3U61B 2BFCA 3GRPA 3L4JA 3LWZA 5FUXA 3HUUA 2JFPA 5F2EA 3WXBA 2GKGA 3QTBA 3LOQA 1JJBA 1EM8A 1KO7A 1ZMXA 1X1DA 2HUPA 4GX5A 5LU9A 2D8MA 1T10A 3WJ2A 1P5RA 2WWXA 3PRKE 4L5AA 3ZE7A 4KRFA 1C9KA 5BUZA 1V4BA 2FMXA 2FMUA 3F67A 3WHKA 2ZUFA 2HIGA 3F5DA 1C30A 1PL0A 1OD6A 1VKOA 2BMJA 5JCOA 1DO2A 1I2CA 3WE7A 4Q01A 2V7VA 4U1RA 2XOXA 5DFAA 1M6WA 4HAUA 4X61A 1BJKA 2IPLA 3OC0A 3DL4A 3O9ZA 5CJPA 3K5HA 1JQDA 2DERA 5JXWA 2PL3A 2IDKA 2V5AA 3GU3A 3FCUB 3VJMA 4X60A 3WKBA 5B30A 3VOSA 4Y18A 2WLTA 1AQLA 1XCMA 2LV8A 2DFNA 1A5SB 2VQ6A 2H0AA 4K9NA 3GHHA 1NKSA 4G5XA 3ID6C 5D7BA 3URKA 5IWCA 2ZRMA 1OWPA 3KBOA 3DZDA 1D2AA 2M6SA 1HSOA 1NX6A 3K15A 3MRSA 421PA 2OVBA 5JBNA 2WOJA 2PH3A 2JFHA 1Y8CA 2CWWA 3D4LA 1ECLA 4QX6A 1E2QA 1YMQA