1NW7A

Structure of the beta class n6-adenine dna methyltransferase rsri bound to s-adenosyl-l-homocysteine
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
279
structure length
271
Chain Sequence
b'GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLQRSYEIVEGAANFGAALQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION METHYLASE RSRI
publication title Structures of liganded and unliganded RsrI N6-adenine DNA methyltransferase: a distinct orientation for active cofactor binding
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
total genus 87
structure length 271
sequence length 279
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nw7A00
1AQIA 2PWPA 1SQGA 3C6MA 3RODA 3ANXA 3R6TA 4JXJA 2GAFA 4M36A 3NTVA 3MTEA 1XDSA 4C06A 1VPTA 3MB5A 4PYNA 4YMHA 1KIAA 4HH4A 1RJGA 3LKZA 4OBXA 3EGIA 3P8ZA 1MJFA 3E05A 2HNKA 3BWCA 3KQOA 1QAMA 3LCUA 4BP3A 3LGAA 3B3JA 5ERGB 1PJZA 1O9GA 2ORED 3A4TA 4GOOD 4QDKA 4C07A 3LDGA 4Y30A 5KVAA 4MTLA 5IH3A 1G6Q1 3MCTA 1KPGA 2HWKA 1R00A 5K0JA 3GU3A 1V39A 2PJDA 4HSGA 3G2OA 3GO4A 2AOTB 2NNWB 1KHHA 4RWZA 4E30A 2Z6UA 4YMGA 2QRVB 5ICFA 2B2CA 3OFJA 3V97A 3R24A 3UJ7A 4EVIA 2BM9A 3EGVA 3EVAA 3PX2A 5CVJA 1RJDA 4RTOA 5T67A 3MQ2A 4GUAA 2PGXA 5K01A 3LHDA 3PB3A 4QDJA 4DM3A 3UBTA 1DCTA 3I9FA 4AZWA 1Y8CA 1UFKA 4RSRA 3DP7A 5CM2Z 1YUBA 3PTAA 4FT4A 3TM4A 5DX8A 2G70A 2FYTA 1RI1A 1D2GA 2AS0A 3TOSA 3KQTA 4CTJA 3T7RA 4PIMA 1Q0SA 1NW6A 2XVMA 3TMAA 1AV6A 4R6XA 5DM1A 3HA5A 2VDUE 3I58A 2H00A 4OA5A 5HILA 3KQYA 2FRXA 4LG1A 3H2BA 4MWZA 3BWMA 5EZSA 4ER5A 5FWAA 2ZIEA 2ZULA 4KRGA 2YTZA 4ZTBA 1RI5A 1XJ5A 3TPZA 3LBFA 2ZIGA 1EJ6A 2ZTHA 8MHTA 2IDKA 3ERCA 3LX6A 3IYLW 4WVLA 1EIZA 2ERCA 4FGZA 4LWPA 3TKYA 3VC1A 2EX4A 1VP9A 3UJCA 2AR0A 2IH4A 3P2KA 3MGGA 3NDJA 3A7EA 3ID6C 3KU1A 5BW4A 3ELDA 2PV0A 3D2LA 3EGEA 5D1NA 3UZUA 4HC4A 4X1OA 5EIFA 2OYRA 3THRA 3FUTA 2WK1A 3BZBA 1NW7A 2BR5A 3M6XA 5DTQA 2AN4A 2R6ZA 3DH0A 4KDRA 3MERA 4Y2HA 4CKBA 4E2YA 2XYQA 4MQ4A 4KVZA 1KPIA 1KYZA 3BGIA 4QQNA 5KQRA 1X1BA 2PBFA 3DLIA 2BM8A 2HV9A 1EJ0A 2OB1A 4OBWA 2ZLBA 3G7UA 2E5WA 1FPQA 4OQEA 1RJFA 1YF3A 2FPOA 2AOUA 1AQJA 1P39A 5EHGA 2H1RA 1FP2A 4X60A 4M7RA 3X0DA 3FPHA 1SQFA 1RI3A 4P7JA 2IP2A 5FHRA 4DCGA 2YQZA 1JR4A 3SSNA 1R74A 3M6VA 3REOA 2IIPA 2BZGA 3KPYA 2PXCA 5EMLA 2BH2A 3UA3A 4POOA 3UJAA 4KIFA 1T43A 1NE2A 3NWEA 1FBNA 4FP9A 4XUEA 3LCVB 2XYVA 4PGHA 1JG1A 5DLYA 5DX0A 3GRYA 5EGSA 4IKPA 1RI4A 4ATNA 1NT2A 3A25A 4AZVA 1NV8A 3JWIA 1ORIA 2B3TA 2CL5A 5DXAA 5HZMA 1JSZA 2AOWA 3BUSA 3KKZA 4AZSA 1JTFA 1RI2A 5EC8A 3B5IA 3OU2A 4CTKA 4CKEA 1F38A 1G8AA 1FJXA 2N47A 3HVIA 5LR6A 2NP6A 1WG8A 3G2MA 2Z6QA 3E8SA 3ELUA 1JSXA 1BKYA 3FYDA 1I1NA 5DTMA 1JG3A 1NKVA 3CJRA 4A6DA 3HP7A 1BOOA 4U7TB 1JTEA 3TR6A 5GINE 4RTSA 2IGTA 2VS1A 2K4MA 2P7HA 2HMYB 4U7PB 4YUVA 1FP1D 2P41A 2ONZA 3CJTA 5LQRA 1WS6A 3KQQA 5E1MA 5DT2A 5CVUA 4E2ZA 3EVCA 2O06A 2IFTA 5LQCA 5EZQA 5DXJA 2GH1A 3GGDA 5U4XA 2C7OA 5LQUA 4FSXA 5CIYA 2QYOA 1P1BA 3E7PA 3KQVA 3PFHA 3R0QA 2C7RA 1KXZA 3FTEA 2EFJA 4UOEA 1WZNA 3KPJA 1AF7A 4PYKA 5E1DA 2QE6A 2C7PA 3GDHA 4LWOA 1DUSA 5K0EA 3S68A 2JHAA 1NBIA 1EAMA 2VDWA 3CCFA 3JWJA 3P9KA 4NECA 5EEHA 4DA4A 5K09A 5G02A 4PYOA 3GXOA 5FQOA 5FWDA 3ER9A 5K0BA 1X19A 3VYWA 2PX2A 5K03A 4DMGA 5FUBA 4PYQA 3KR1A 5DM4A 1O9HA 3DMHA 5K0CA 2GPYA 5EG5A 5F2OA 3HCBA 3OCJA 5K0NA 2PXAA 2BR3A 1IM8A 3ME5A 4OX9Y 2AN5A 2FHPA 5DM0A 3E23A 1R18A 2OPBA 4DQ0A 2GLUA 3EMBA 5CVVA 5B1SA 3RIEA 4RTLA 4RTJA 2WA1A 4YV2A 1QYRA 3LCCA 3LDFA 3BGVA 4QTUB 4EK9A 3A27A 4RYLA 4A6EA 2IPXA 3A7DA 5C9ZA 4YUWA 5K05A 3EPPA 1NV9A 3FUUA 2HTEA 2GS9A 4PGGA 1N7JA 3SR4A 5FHQA 4RTQA 1OR8A 2C7QA 4PCAA 4YUYA 5EMKA 3KPWA 2P7IA 1Z3CA 4X61A 3FPGA 2NXEA 3A26A 4RVHA 1YZ3A 1KP9A 3NJRA 4E70A 5FA8A 3G8BA 3GCZA 1UWVA 3UJDA 4QVGA 2ZZNA 3OE4A 4CWAA 3PT9A 2JH9A 10MHA 4BLVA 3KR0A 2P3LA 2P1DA 1P91A 1Q0TA 3THSA 2EJUA 3SXJA 5DX1A 3CC8A 2PLWA 2ADMA 4RTMA 2YXDA 2PWYA 2O57A 1XCLA 3QV2A 2P8JA 3DMGA 3EVGA 4F86A 3M6WA 4R8SA 1I9GA 1R8XA 1ZQ9A 5LQAA 3NW9A 5LQKA 1MHTA 7MHTA 3ELYA 2EG5A 1NBHA 3GRUA 1M6YA 1EG2A 4RTNA 3B89A 1F3LA 4F84A 4EMSA 2ZW9A 4DF3A 5DSXA 3BGDA 1H1DA 4F85A 5K8VA 5GIPE 1KR5A 2G8NA 4FSDA 1HMYA 4E31A 4PYMA 2JH8A 2V74B 4GEKA 3T7TA 4DCMA 5F2NA 3HVHA 3ORHA 3I64A 5EEGA 2F8LA 2FK7A 4HG2A 3OZRA 3HCEA 4RVGA 1YFJA 3SVZA 4GQBA 2DPMA 4K6MA 3UJ9A 2ZFUA 3P71T 1YFLA 5FCDA 2PVCA 2YVLA 5M5BA 4KW7A 5MHTA 2AOVA 1NW8A 1QZZA 4PWYA 3NVMB 1L3BA 3Q87B 3G88A 1VLMA 4HRAA 1XTPA 3KPVA 2I6GA 2OXTA 3BWBA 5C1IA 1SUIA 1ZHFA 4V0QA 2I62A 2P40A 1SKMA 5KQSA 4E33A 5DSTA 2OY0A 4PCLA 3GRVA 3IHTA 4P7GA 3UJBA 2AOUB 3HEMA 3SX0A 3C3PA 5E1OA 3TM5A 2XBMA 2LD4A 3QOXA 3C6KA 3HVKA 1G55A 4IWNA 2UYHA 4AX8A 4RTRA 2Y1WA 3GNLA 5EPEA 3DMFA 3P97A 3DXYA 1XDUA 3F4KA 3G89A 2ZCJA 2FCAA 4KDCA 1I4WA 1IXKA 4HGYA 1ZGJA 4WXHA 1R8YA 2QM3A 2IDJA 3CGGA 4G56A 4RTKA 1YZHA 5EVJA 1NW3A 1KYWA 2G72A 2ZSUA 3HCAA 3PX3A 4M37A 2DULA 1HNNA 3HNRA 5EOVA 5EMMA 4BP1A 1U2ZA 3B7PA 4R6WA 3C3YA 1G8SA 5EIWA 4CXMA 2HR1A 3HA7A 2VP3A 2ZZKA 3KPUA 4ER6A 1EQAA 1ZGAA 3HA3A 4QPNA 1XXLA 3CJQA 3JWHA 5E2AA 3EVEA 1PRYA 2O0LA 3FPEA 4GOND 4HTFA 4MIKA 5GOZA 4ER7A 5K0FA 2H11A 5DPMA 4QPPA 2P35A 5F2KA 1X1CA 5E8JA 4PYLA 1L1EA 5CD1A 4YV1A 5T64A 1R6AA 3BWYA 3OZSA 4GOLD 4DKJA 5FTWA 2OZVA 3FRHA 4AUKA 4ER0A 3SGLA 5DWQA 4FZVA 5HFJA 2JG3A 1WXWA 2A14A 2JJQA 4OA8A 5EKXA 5HIJA 4YUXA 5HIKA 1L3CA 5K0GA 5EKUA 3KR9A 4V0RA 1BC5A 3KQSA 5JR3A 1KPHA 1G38A 1ORHA 5DM2A 1XVAA 5ICCA 2V7EA 1O54A 1TPYA 5HIIA 4E32A 5DRTA 2FK8A 3KQPA 3BXOA 3EVZA 2OO3A 3FUWA 3I53A 3LBYA 4PYIA 3LL7A 3LDUA 4FR0A 1P1CA 5EQJB 5CCXA 4DZRA 2ZZMA 1VBFA 2OKCA 4GC5A 3OU7A 4RV9A 3AY0A 3BKXA 5GIOE 1JG2A 3P2EA 4GC9A 4R8RA 1JQEA 3UJ6A 2NXNA 3OE5A 4ER3A 2YXEA 2AOTA 2B9EA 5E2BA 4RTPA 3UA4A 5LQJA 2QRVA 3G5LA 1VE3A 2ZIFA 3O31A 2I7CA 3BT7A 5EHIA 3IV6A 5BXYA 5LSAA 2Y1XA 1X1AA 3RW9A 5IKMA 2IH2A 3P9CA 2QY6A 4E2WA 2G1PA 2VDVE 3ER8A 2IBSA 2AN3A 2P3OA 2AVNA 2O07A 3FUXA 3P2IA 5LQNA 3R9XB 5FADA 3TFWA 2GA9A 4KWCA 4O29A 3QOWA 2OBFA 3TQSA 5C0OE 3TKAA 3VC2A 1XDZA 1B42A 1M0EA 2IBTA 3M70A 4PYJA 3DUWA 3AJDA 3CVOA 4GF5A 1N7IA 3DLCA 2XVAA 3PVCA 2JHCA 4ISCA 4X41A 5H02A 5P8WA 5FQNA 2ZBQA 2PX8A 1XCJA 4GOMD 1M6EX 9MHTA 3MAGA 1SG9A 3LPMA 5E9WA 1SUSA 5HIMA 2NYUA 5D1HA 3OU6A 5E9JA 5T6BA 3FZGA 3EEOA 1D2CA 4FT2A 4M38A 3HCDA 4C03A 1SVUA 3EVBA 2P3QA 4IV0A 5CVDA 2NP7A 1DL5A 5FULA 3TRKA 2UYCA 4B17A 3GRRA 3NDIA 1ZG3A 5BW5A 4RVFA 2AZTA 4C04A 3HM2A 4IV8A 3G5TA 3C0KA 3UFBA 2Z6AA 2R3SA 1VIDA 3LSTA 2O05A 5FA5A 3OFKA 4BLUA 4YV0A 2I9KA 3DOUA 3GJYA 4P58A 1QANA 5K0LA 4PINA 3AXTA 4QVKA 3VSEA 2YX1A 4KIGA 3V8VA 3NWBA 2UZ4A 3G8AA 5CVEA 2KW5A 4XCXA 1QAOA 2AVDA 4HGZA 5E8RA 3KQMA 2ESRA 1WXXA 2B78A 3M6UA 3P9IA 5KS2A 1X1DA 1ZKDA 1UIRA 1VL5A 2NXJA 4X63A 2Q41A 4E2XA 3IEIA 3HTXA 2NXCA 3SM3A 3P9NA 1RJEA 3UWPA 3AWIA 3EEYA 4Z2YA 3O7WA 4P7KA 1BHJA 3M33A 3WSTA 4EKIA 4PNEA 3FUVA 5BP7A 3MHTA 5KYGA 3FPJA 2YXLA 3SSMA 3LECA 3HCFA 3T0IA 2B25A 3BKWA 3U81A 1WY7A 1TW3A 1IY9A 1D2HA 4GBED 2EJTA 2PXXA 3EVDA 5CCBA 3DXZA 1L3IA 3B3GA 2AOXA 4R05A 4C05A 4C4AA 2ONYA 3K6RA 3FTFA 3TLJA 1G60A 3O4FA 2G71A 2OB2A 3CBGA 5GM1A 1TW2A 3KR2A 2VZ9A 5E1BA 2YR0A 3JWGA 4XUCA 1N2XA 1VQ1A 2GB4A 4QTTB 3HVJA 4LECA 4QQKA 5ICEA 3NMUF 5DTRA 3LKDA 2PX5A 4PONA 1JQDA 4CKCA 5GWXA 2UYQA 2PT6A 4MHTA 4FS8A 3PFGA 4RX1A 4BLWA 2IH5A 1INLA 3HCCA 3Q7EA 5CUQA 2ZBPA 2ZWAA 3AXSA 3G2QA 3M4XA 3DR5A 3FTDA 2CMGA 3CKKA 3DULA 3KQWA 4EQZA 3ELWA 1JQ3A 2JHPA 4PIPA 5HEKA 3L8DA 5HOQA 2ZVJA 3OZTA 2CKDA 5DRYA 1NW5A 3FPFA 4YUZA 4P7FA 2ZBRA 2ZWVA 3GIWA 3MTIA 4H0NA 3SSOA 3NVKI 5GM2A 1VP3A 3OPNA 2CWWA 4EKGA 3R3HA 3FTCA 2WA2A 2BR4A 2PT9A 2PX4A 4C08A 3MCZA 3DXXA 4HTFB 4XUDA 1L9KA 2CMHA 3T7SA 2PKWA 2PSSA 5JUWA 3EVFA 4BY9E 4AZTA 3B3FA 4RVDA 3PLAE 3K0BA 5GP1A 3EMDA 4OQDA 3UJ8A 5ICGA 3SMQA 3G2PA 3GRZA 3FRIA 2XYRA 1YB2A 5E9QA 5EMJA 4L7VA 3KHKA 1JG4A 3I5UA 3GWZA 3DTNA 3PS9A 2PY6A 3FYCA 2UYOA 1QAQA 2YUIA
chains in the Genus database with same CATH superfamily
3H9BA 3NTOA 1RYDA 2RH4A 2F1RA 4AY6A 4L8FA 4JXJA 1N7GA 2QM0A 2BTEA 1O77A 3QQ5A 1U3VA 1XEXB 4GP9A 1JAHA 1M2HA 3H1GA 3M6AA 4HFNA 1XNGA 1TXGA 1ZUIA 3MWLA 1U2DC 2YC4C 1VJTA 2ZYAA 2X6RA 1WETA 4BLRA 3AP2A 4NDAA 4TTSA 3L5KA 2AD5A 4HEA1 4I55A 1R7RA 1PJZA 4KX5A 4QDKA 3ZCQA 4H27A 2XE4A 4G1CA 5J1TB 4W5WA 5HUQA 4NF2A 3FPBA 4MR9A 3II6X 1E99A 1FUKA 3BJEA 4TUYA 4X6YA 1B15A 5IXSA 4UNSA 2NO9A 2C2OA 5TMDA 3Q9SA 2PUDA 3LUGA 3IMFA 5F35A 5IVDA 4O4IB 1JXOA 1M2GA 5GQSA 4I2NA 1NVUQ 2AL7A 1WXQA 4XDYA 4NJOA 3R7FA 2PFKA 3RUCA 4TGLA 4ZJZA 1E7WA 3LS2A 5FEMA 1C9KA 4BV3A 3EVAA 2WAOA 4A4DA 3S44A 3ROZA 4B0PA 1RJDA 4FK8A 3VBEA 2PJUA 4GUAA 4P0PB 2VT2A 4X91A 4DCJA 2CDRA 4JXXA 1MB4A 1DU4A 3HCWA 2RGDA 3BCUA 3IKLA 1EEXB 1X86B 4K40A 4RSRA 3A1CA 3T9FA 3L0YA 3SU8A 2I22A 1BN6A 1U2EA 2QTLA 4P33A 3UCFA 221PA 1JSLA 2DUUA 3NNSA 3ZCXA 3NOOA 2WSBA 4IX9A 1WHTA 2PKRA 3QLVC 4PWZA 4XFKA 5G1NA 3UMGA 1A2KC 4I36A 4CU5A 1F17A 5AVVA 3GLFB 3CMCO 2JC3A 1WVGA 3FHOA 2CJWA 3I5AA 2UVPB 3QUAA 3ZOKA 2CCGA 4FC6A 4YRTA 5FBLB 3EDOA 2OENG 4UQPA 2HLDD 1HQDA 3RUEA 1UC8A 1KBZA 3KJEA 3X2FA 4JB2A 1ZVMA 1TE2A 2EX4A 1H0RA 4Q3NA 3DHWC 1LZKA 1FRVA 2R96A 1XTQA 3A28A 1Y1RA 1U4NA 1ZD3A 3ELDA 5DBEX 3SR0A 5BVGA 1ICIA 1JHYA 3V2GA 3THYB 3O1JC 3VR4H 1MN6A 1CULC 1M66A 1IPFA 1UP6A 1Y5LA 1SKQA 2AN4A 2TMYA 4YRZA 4Y2HA 4IVQA 3MVEA 4OPMA 5ULLA 3LC0A 1W5FA 4P5DA 5ALGA 4H1HA 5CNIA 4QQNA 1PF7E 4CU2A 4FQ5A 2GBCA 3RB8A 4ZYTA 3E1KA 4TN1A 5JXWA 2H1RA 3V5NA 1KI6A 2IU3A 3OKAA 2RJNA 1IBLB 1D0SA 2ZJAA 1FNBA 4LCEA 4JIGA 2XTNA 3AV0B 3DMTC 5EWMB 4A0GA 5KDOA 2IT1A 3H8WA 3R3YA 2NAPA 4I3HA 1S02A 1Z62A 2XI4A 3ECSA 2C61A 1O87A 2NTVA 4XX1A 1E4YA 5JDIA 1BD3A 3SZRA 5CBKA 2RKWA 5HUHA 3OJCA 2GRUA 1GCGA 1VG0B 3FLAA 4JCCA 1LRLA 1BE0A 3V4FA 3N9IA 5E9AA 5EGSA 5DX0A 3TLEA 3ZH2A 3GRYA 2F90A 4NCHA 2ECOA 1N9GB 1MC1A 1KJ8A 1N75A 4QHSA 5CTAA 4KWEA 4ZCSA 4AYXA 2DZDA 2EFHB 3A25A 4D9CA 2Y0EA 1C4KA 2VSQA 3LY7A 4MA0A 4MRRA 1WOMA 2Q9CA 3MUOA 1JSZA 1ZHOA 4NAUA 3OIWA 3PCTA 4FYYA 4J43A 4DG9A 5HZHA 1W1IA 2YYSA 1HYGA 3P2OA 4IEEA 1F38A 1G8AA 2QTCA 2N47A 4YRNA 2MINA 3UMYA 3EZXA 5DULA 4JJIA 4XQGA 1JSXA 3AU8A 1BKYA 1PJ8A 3TX6A 4M6WB 4BQOA 3ND6A 4DMKA 4YRDA 3CJRA 4RTSA 3IULA 4QOGA 3EA4A 1V0JA 3IAFA 4MKGA 1TDJA 4TT8A 4CLHA 2QW1A 2PCJA 3UAVA 1Y1KE 3L1JA 2R7LA 1JAZA 1SKUA 1FP7A 1ZD5A 4G0QA 1EGVB 3U1TA 3WMXA 1K6JA 1SBIA 3OBIA 1OILA 2GH1A 1NF8A 1ZS9A 3CRMA 4M7WA 4Q9KA 2WSLA 1DAOA 1T3TA 5E0KB 5C2JB 3ZVMA 1BWRA 1G8GA 2AYXA 1NQUA 3FTEA 2CHGA 1OUMA 2YN0A 1HBJA 5JD6A 1ZK1A 2E85A 2GBLC 5DGHA 1SVMA 4XQEA 4B31A 1GA4A 3HCRA 4BFXA 4E1AA 1QOZA 4QOJA 1I7PA 1N2ZA 3KEOA 1EAMA 3H75A 3GL9A 1JW9B 1G8FA 3JV7A 1YSCA 1ADFA 3TTXA 1ZESA 4R2MA 4BEBA 1CUIA 2AW5A 4NJEB 5BN4A 1JECA 5K0BA 3B1ZA 4A15A 4PX5A 3JYQA 4QL3A 1SZPA 2CYAA 4RZXA 1W36C 4EHNA 4OX9B 2W83A 4PLYA 4N3AA 3V8PA 4V1CI 3B85A 1QHIA 2LVBA 3IILA 4HLQB 1PT9A 4JHXA 1C4WA 3DE0X 5BSHA 3PXCX 4FR2A 3AVTA 1L4MA 4I55B 1T5OA 1NVMB 3D0OA 3EBLA 5DM0A 4IQ0A 3NYWA 3TIFA 1QP7A 4XWOA 1U1IA 4YT4A 4DCTA 1PWZA 1Q2XA 5JADA 1UP4A 4RD1A 1DG1G 3GLHB 3LDFA 3EXFA 1X9HA 3MTDA 4LJ9A 4EW1A 3Q7PA 2DBQA 3TCNA 3CVJA 1Y3AA 4MGKR 1FJHA 4K0KB 4QHTA 1V1RA 3OM9A 4L5JA 4QC2A 4P2BA 4M86A 1RS0A 2GS9A 3ZJYA 5K0GA 5JCJA 1Y7HA 2WYOA 1P1IA 3PUZA 3TAUA 2QRUA 1IDOA 4G89A 1NHWA 1BQ3A 3C16C 1H2HA 1WP9A 2WU4A 4Q03A 2JIPA 3VR6H 2QX7A 1C8BA 2GCPA 1TT7A 2HDHA 4G8JA 1QBKC 1UWVA 1XJWA 4M22A 2R6GA 2OZLA 1RLMA 2WIJA 2B83A 3DG9A 2Z4RA 5KJCA 1GQRA 4U2EA 1Y1QA 2QN8A 4ILKA 1XI2A 4XB2A 1MDBA 3IMKA 1P91A 3R0XA 4PG7A 4KXLA 4Q00A 4RTMA 1WCYA 3U60B 2R11A 3EVGA 2D59A 3M6WA 3ESRA 3CEJA 3L07A 4ZOQI 1T0PA 2WIDA 3D4NA 1ZNQO 3CNEA 3VH4A 1NBHA 1I3KA 2CJWB 5JC8A 4B74A 4RTNA 1OX4A 1XF1A 2A5FA 2RONA 3IS3A 3SJUA 3K8QA 5B4VA 4GE0A 3RVPA 4TT3D 1YAJA 2PU5A 3RHZA 4O2AB 3GAMA 3RVKA 3VVCA 3GLGA 1TAHA 3Q3HA 2YFYA 1Z6GA 3NCTA 2AFIE 2C94A 2C3UA 1SXJD 3HYLA 3IJPA 1ATIA 3KUXA 1LFAA 1FMTA 1ZMXA 3ODGA 4NBWA 2J6CA 5EEGA 5CEFA 1DKNA 5GV8A 4I1PA 5A4DA 5F1OA 1W73A 3UJ9A 4E1BA 1MRZA 4M0CA 5EJFA 1VHDA 4E5UA 1TGVA 3Q87B 5AHOA 3O1LA 3O94A 1R37A 2YMPA 5LKAA 1XTPA 2EJVA 4PN7A 4ZU1X 4KDEA 4F4JA 3THWA 4XEUA 4GX2A 2YRXA 4HX2A 4YRQA 3GEDA 2W4QA 1QHEA 2ID9A 2J45A 2DTDA 4NMLA 1EM8A 2B82A 3AKCA 5CYPA 2RCNA 2R84A 2PGNA 4E7OA 4C88A 3TE6A 1Z5GA 2YV4A 3O75A 3P0FA 4FNAA 4TTJA 4K9SA 1XYGA 4Q9JA 3HVKA 3MWGA 4ZO6A 4B87A 2UYHA 5IG2A 1QR6A 1Z83A 2C8VA 1I3LA 4HRVA 2A0KA 5EPEA 2J7PD 5J4KA 3STTA 5FO0A 4M60A 2O59A 5EHZA 2JFNA 2R8RA 1VHWA 3C1AA 1ULAA 3HP4A 1BJTA 3SK0A 4MNTA 3EMVA 1JJBA 4RANA 3OBBA 1ADGA 1YZHA 2VJOA 5J58A 4KYTA 2WUDA 3T94A 1A4XA 4M37A 1JSCA 2WP0A 1Q50A 4DUPA 1V3VA 2H5IA 2BSAA 3NGXA 4F4CA 3K9HA 3GBSA 4CN9A 5U1PA 1KRXA 1G8SA 1T2NA 1VCMA 4QLAA 5CFRA 4XARA 1HZZC 3KPUA 2WKPA 2IZ6A 2AZXA 5E6RA 1ANKA 2RGCA 1J21A 4N6NA 4PBRA 3ZZTA 1G18A 2A9PA 4BJ5A 3NM6B 4DGSA 1Z2EA 4EF4A 5SICE 1UOPA 4DYHA 3OWOA 1QHNA 5DN9A 5FBWB 5KYYA 1ORDA 3FETA 2YNMD 1Z29A 2MINB 5HMLA 2IDMA 3D59A 3VJKA 1JMKC 3LP6A 4IIDA 3W7AA 1CY7A 3WQHA 3W5AA 4ZREA 3DEYX 2D1RA 3ZGOA 3CSSA 5KWEA 1JR6A 2NZXA 1V5FA 4JI1B 2PH7A 2DG2A 3V42A 5IBCA 3QEBZ 3OETA 3BICA 2FDRA 3KAJA 2EDAA 3IBSA 3O38A 5KO2A 1IQ0A 3PA8A 3JYHA 1UXIA 3FNGA 1B76A 3AF4A 2YJZA 4DANA 3HXQA 4RADA 4D43A 4KNVA 2QQFA 1U7UA 4IRUB 3W6UA 4EY6A 2BZ0A 3COVA 1BOFA 3L7BA 4U2GA 4IMPA 2X9VA 5CCXA 2C84A 3HB0A 2OKCA 2WM9B 2WTBA 3F1KA 3KVNA 3B2EA 1GA1A 2E1PA 2RGRA 5BN4B 1HT1E 3EEIA 2HT6A 1ZJ4A 4NPAA 4PZEA 2OA0A 3UJ6A 2CE2X 1AKYA 1U0EA 3UA4A 1C8LA 1I6WA 1KYQA 2VT7A 2W2TA 1HDRA 3H0KA 1ZM3A 5FP0A 3V7FA 4YMLA 1TVKA 2X4LA 4PZCA 1WDKA 2V7VA 3UQYS 2JGDA 4DEVA 4ZOLF 1Q1ZA 2JJ2A 1FU8A 3EZ2A 1TZMA 3TBHA 4CM6A 1L8LA 2H65A 3QI7A 2FGKA 2JPDA 4S1TA 2O07A 4TV9A 1IVNA 5CH5A 5KYXB 4BNWA 2I67A 1C7RA 1X14A 1G16A 3I32A 3QP9A 1JJIA 3BF8A 1MG0A 2BGWA 1KDYA 1KVTA 1C1XA 3S5UA 3EXFB 3TKAA 3BBLA 4AJJA 3BMXA 1QJ4A 2IBTA 3VDMA 1G20B 4OM8A 1SXIA 2V4MA 2FN8A 3CVOA 1V1RB 3ZCSA 3QBJA 4X5OA 3V1KA 4ALJA 2GCOA 5TE9A 1UJBA 1ZY2A 3RANA 3QSGA 4M8IA 5KNDA 5KNBH 4NOMA 4P36A 2R8OA 3RVRA 5DNDA 5THXA 2Q4BA 4OLBA 2YVKA 1IUKA 2HZBA 3PG5A 4ZPXA 2XZDA 3C3MA 4QYMA 1NMYA 3TK1A 5HIMA 2FJ0A 2VJNA 4DMLA 1U8YA 1L5SA 4BQSA 1TPZA 5GZ6A 4U2CA 3OZ7A 2D00A 5F5NA 1EZZA 1IOZA 4DJJA 4IV0A 5KJ1A 4DQUA 4GZ6A 3TLAA 1DE0A 4FYJA 3QXGA 4DNXA 4JC8A 1PDWA 2UXCB 1SK8A 4YRJA 2OLEA 4MV9A 1NJ2A 4QRDA 1YR9A 4QNNA 2AKEA 1LX6A 1CY1A 1EX9A 2JIZA 4OSPA 2GNAA 2XRFA 5JNUA 1NURA 1EEHA 1DIRA 2LIVA 4RMGA 4D9MA 2PMBA 3GLGB 3G85A 2O2YA 3DUFA 5D6NA 3GD5A 4QDOA 4DMCA 1Q0HA 3NWBA 3FNHA 3GT4A 1BMDA 1RNLA 4XUGB 2ZYWX 2GOYA 3M6UA 3QITA 4BNTA 1KH1A 1PW7A 4TM8A 4C6RA 1BRMA 3HXLA 1ZNZA 3W34A 3FDZA 2FX3A 3ZJUA 3BB1A 3LT4A 2F59A 2YRWA 4HAIA 1EFVA 3RASA 2C99A 3UMCA 3WJ7A 2QP9X 3I6IA 1R3UA 4JT2A 4AP6A 3HXTA 3FUVA 4NBUA 3RU3A 1PS0A 1QO0D 4A2CA 1O0CA 1GZ4A 4AMBA 3MHTA 1IDN1 2CNWA 1OT5A 1A5BB 1P4AA 3ZBPA 2JIRA 3KJFA 5KHAA 5LD2B 1MOPA 2EKPA 3AI2A 4O4JA 2PYDA 2VJAA 3VO2A 3V8MA 5AOVA 2PUBA 3CRNA 3PRHA 3BRWA 3MLBA 2V9PA 4NTZA 1M7GA 2FEPA 4Z0PA 1XRMA 2PGOA 4GZ3A 4G5GA 5KKCA 1D03A 1Y81A 2IP1A 2QRNA 5LUAA 3ADBA 3R2JA 1E0SA 4HGPA 4HYYA 3KVOA 1JLKA 1DX9A 3Q4GA 3L79A 4FFLA 4EHBA 1K68A 1F4LA 1CFZA 4LKRA 1F60A 4GKBA 1YQEA 2DHCA 4QFCA 3FHTA 1INLA 1GARA 3FNBA 4U0JA 5B58C 1LLQA 5DHTA 3KEGA 5JYEA 3EPHA 2G07A 2V97A 1JKMA 2BFNA 5E6UB 4MV1A 4GWGA 4B85A 5BNIA 3L8DA 1KERA 1XELA 3HJCA 4ZFNA 3UKDA 4B5LA 1NBWB 3RNOA 2HK7A 2M6SA 2WJGA 4NFSA 2WTUA 1V8BA 2PU7A 3EN0A 1YOVA 3PLNA 2PO5A 5KYYB 1LS1A 1RTKA 2V5AA 3GLUA 1ZD8A 4LK3A 4POAA 4JFAA 3WA6A 4HEQA 1SGWA 4WK4B 2EBUA 1ZL2A 2BFPA 3TRIA 1JG4A 1U9ZA 3PJDA 2GD0A 3CUSA 3FWPA 3H19A 3LZ6A 1YKGA 1P3DA 2Z56A 4MV8A 4QGGA 3DZGA 1MHPA 1N2OA 1SQGA 2PMWB 2FW1A 3R6TA 2XMBA 3MWYW 2WSYB 3DAYA 1SIUA 2IC5A 1KIAA 5AK5A 3CPEA 3W6NA 2Q5JA 3GCWA 1XTKA 3GJXC 1MDFA 4P3OA 4X1YB 1MJFA 1BVYF 1QKJA 1M2FA 1BXGB 5LC1A 3K9BA 5ALJA 1PT5A 1X7ZA 1XNHA 3H1PA 5F76A 5EJAA 1YZNA 2BC9A 2O3RA 2VBCA 4D9NA 3TZKA 1D2NA 1N2IA 2CZQA 4RKWA 1QRAA 2BCGY 1CIPA 3GU3A 3CE6A 2P90A 2IW3A 1WUYA 3V8RA 4FEGA 4M2LA 4WSOA 5DMHA 2PUTA 2WHEA 3OM8A 3ZYZA 1Z36A 4OB7A 1J09A 1U3CA 4XPIA 4Q3LA 1II0A 3N58A 3VYTB 4A5OA 1TLLA 4EVIA 1JEAA 1TVKB 4G09A 4ZK6A 3QFSA 4ZZ0A 2JGDB 3QUTA 1VIYA 4P4UA 1DCTA 1QVRA 5C1PA 1ITZA 3MMZA 4TV9B 1BE6A 3AHIA 3JZDA 1A8HA 4L1KA 4AI6A 1C81A 2IEIA 3LY8A 4HXYA 2VDMB 4Q1AA 3CKYA 2Q2QA 1YUBA 3DC2A 1U5BA 4ZCIA 1JF8A 2FYTA 1X9GA 5LZ4A 4JWKA 2ZI4A 3A4VA 4AG6A 1GAEO 2QNBA 3JQ6A 1CF4A 4ZWNA 1TEZA 2GCOB 3BN3A 4ER3A 5KB3A 4JBXA 4OA5A 3U4DA 3A06A 4FD2A 1PEDA 2X0EA 2IPAB 2VJCA 2RJ3A 3ISTA 1ODLA 3V3TA 3T9AA 4IIJF 1QP4A 2GPAA 1AHHA 1PQUA 1SK9A 3WLJA 3TEMA 1D0IA 4F7WA 1MGOA 3AB8A 1U0RA 3N07A 4IGIA 4YPVA 5LOVF 4LBWA 4ZVTA 4CM1A 4CM9A 4ED9A 1U80A 6PFKA 3W3AH 1SKYB 7YASA 2VHUA 3TQIA 1OH7A 1RC8A 1EK6A 1XZMA 3A3YA 3ZY6A 1Y6JA 4C6TB 3KU1A 2GX6A 2VCYA 2JCGA 5AVSA 1E32A 2PV0A 2W90A 3NS7A 1S7GA 2GYUA 2JI6A 3RS4A 1QTRA 3AR5A 4A1FA 5C32A 2ODQA 4XGIA 2WPDA 4Z8XA 1S1CA 4P83A 2BR5A 3IV7A 3K5HA 2VTVA 3MERA 4TWIA 1G59A 2J4FA 4OG2A 3RU2A 4MQ4A 4X8HA 2EFDB 1IVYA 1OGYA 3KE9A 3O82A 5EY5B 3BGIA 1PGPA 4GW3A 3A6ZA 3N0VA 3JARB 3QTBA 2ZLBA 1W9MA 1YZFA 3DUFB 1Y5MA 4YJ2F 3H2JA 2E18A 5JMPA 3WK7A 5ARDA 4NAHA 2GRAA 1YNSA 5ECDA 1BXRA 2VPZA 1LSUA 2H85A 3X0DA 4D74A 1P7PA 2ASEA 3IIIA 2OEPA 4YACA 4DNPA 5J2UA 5E4YA 4GXTA 3SSNA 1EK5A 2E7ZA 1MZVA 3FDZB 2ZUWA 4WCDA 4FEEA 3KLPX 2QENA 1KY4A 4QGFA 4AYTA 2QVCA 4RD3A 3J81k 4L85A 4N39A 3QE4A 4PGAA 4I08A 4ABYA 3W9SA 4CNQA 3LCVB 3DFUA 1K2WA 1TYBE 4BL5A 3PL1A 3T7KA 3A58B 4O4JB 2HFKA 2XECA 4IIXA 2GSWA 1T3GA 2BELA 2R2GA 4WL0A 2RC6A 3BQMB 3U5ZB 3H97A 4DWWA 3GJZA 4R3UC 3AYZB 1RMQA 3F6EX 2QWXA 1DHRA 1S5PA 1SULA 3OQVA 1CQZA 2D62A 1T2DA 3T5DA 5KVSA 2HNAA 1LB1B 3F67A 3KEQA 3RLFA 1OTYA 4XGNA 2G67A 5FPKA 5B4UA 3A4NA 2RIRA 4KJZA 5KTKA 4JJ7A 3B51X 4QFMA 4HDMA 4JJKA 1H8HD 5D85A 4AJLA 5C8ZA 3TSYA 2ZJ4A 4A6DA 1K7FB 4AKTA 3PFBA 1CPYA 2K4MA 3I04A 1RVDA 4ILEA 5KWJA 2R8XA 2EJCA 3RUDA 4BQQA 2BMEA 1DQSA 2BMJA 3ZU2A 3VJMA 3RJ5A 1YOVB 5LMUB 1K63A 5SYAA 4KR9A 4JQSA 3WXBA 2I6QA 5CIYA 3R0QA 1XTSA 4MULA 1H2YA 2IYLD 1ONPA 2LBPA 3EXHB 4UNRA 4I14A 4EA9A 1CF2O 1J42A 4URWR 2HSZA 2Q2WA 4FU0A 3VVBA 3GDHA 4F9EA 4KR7A 1YH3A 4Q3DA 3AEXA 4LWOA 5BWCA 5BWBA 2HYIC 1SUEA 1YDFA 3S68A 3B6EA 3I6MA 4CL8A 4DA4A 4IQGA 1ECFA 1BCRB 4KIUA 2ZRBA 4R0VA 4EW2A 5L45A 3D6FA 3E6AA 4INOA 2PYZA 1PO7A 5DYTA 4YMIA 1NMZA 5CB6A 5JI2E 3EH1A 1DADA 1E9EA 2BEWB 1MABB 3BE8A 4NZ9A 3FSEA 4GKKB 3KR1A 1L0BA 3WDKA 1E3IA 1JFSA 1A88A 2E55A 3G0IA 4LJRA 1KC3A 4LYDA 4KEAA 5ALOA 5KWIA 1OLUA 1P2UA 2FSFA 5FNVF 1L7OA 4CNBA 1NP6A 4MUAA 3I37X 1F1JA 2FW8A 4DLVA 3FCOA 4MJLA 2FR8C 3DFKA 2XT6A 5HKAA 3LA6A 1J06A 4YAGA 5JQGA 2GLUA 2WWXA 4W7HA 1ZEMA 2NUAA 4UBMA 1J8QA 5H4HA 1RXIA 4QTUB 4R1NA 1V11A 5B37A 1QZTA 2OYCA 3AJ8A 2GILA 2JK1A 3EZGA 3EH2A 3R09A 3FUUA 3S2EA 2I54A 4JLNA 5G1OA 4DWJA 1WMEA 2XDQB 5LA6B 1MC8A 1JWLA 3G2HA 2OFOA 5BR4A 3UK2A 1PDVA 3PCXA 3VR3D 4M1WA 4ALNA 4EFNA 3RYHB 4W9NC 4LXUA 4J0IA 1EB9A 1GUFA 1PVDA 2HFJA 2WWRA 3QENA 5ALEA 5HYVA 2YYYA 5JJBA 2ZZNA 3BXPA 4RXTA 2DWOA 3DOJA 3U4HA 4DIDA 1EGMB 3MUNA 3PGLA 3K0EA 4GRDA 4AY2A 1UOEA 5JPIA 5B7PA 1TL7C 2HK9A 3A0UA 1PLKA 4MIYA 2AB0A 2IV2X 3DMGA 4PG4A 3IODA 1RKUA 1TMYA 5DB4A 1TAUA 4ZN6A 1KI2A 2ZYHA 4FILA 1J7JA 3GRUA 4HEA6 1HE1C 5FOUA 3FCUB 1WY5A 5CAEB 5B36A 3EGOA 1H2RS 1YQTA 2GBFA 1YONA 3BDVA 5LB4A 3TRJA 1FXWA 4OK6A 3UIEA 4HRYA 5CFMA 1N6OA 3VC3A 1II9A 3FTNA 4FSDA 4L4UA 2J6BA 1HMYA 5BVHA 1NVKA 5KTYA 5B3AA 4HVLA 3L7IA 1VKJA 2BHNA 1ZOOA 3LGSA 2C20A 3UHOA 4Z86A 1G5FA 1YZKA 4KOAA 4OU4A 4DV4B 2W6IA 4KRXA 3IEXA 1S01A 4FB4A 1PBNA 1UK8A 2IEBA 2FW7A 3PSHA 1Z33A 3UWMA 4CG1A 2P9BA 3G9QA 3HHEA 1NATA 1Z8HA 2SHKA 2WNIA 1RBMA 2AOVA 3D4BA 4N6OA 4QHYA 3R7WB 3W4IA 1FLVA 2FSVC 4TXMA 3PNQA 3MT7A 4IG9A 4KKXB 3ETCA 4M8LA 1CFJA 1ZMOA 1THGA 2FEAA 3PC4A 2HLNA 4GIBA 4EHJA 1CR6A 2OBNA 2W6NA 5D51S 4CIXA 2OP1A 1SHTX 1HF3A 2Q6LA 3C1UA 2YVAA 3LSYA 3QNUA 4OHCA 2X58A 1BXRB 3BE6A 3LVFO 2X7JA 3QOXA 4B6QA 5K2OA 2C9CA 1TAQA 1B8UA 2WICA 2YHIA 2YW9A 5B1HA 3KHUA 4E5MA 5H9WA 3BL6A 2ZKLA 3HUDA 3TINA 1Z0ZA 1RP7A 3DO6A 3RVNA 3PNBA 3K9QO 2JJ1D 4KDCA 4GM4A 1XA3A 1IZ7A 4QULA 2IEGA 3UMMA 2CHEA 2G9ZA 3T35A 5C1DA 1VSTA 2OD7A 3DNPA 3GFOA 4JH0A 1K4YA 1P8JA 1NF9A 3B7PA 1GTL1 3LUFA 2JGAA 4I9FA 1QU2A 1BAPA 2MMGA 3PENA 5DNUA 2HY7A 3IIKA 1ZNWA 4C20A 1IIRA 1FU7A 2H07A 3ZU3A 1XMSA 2JI9A 3AB7A 5CEEA 3E27A 5GJCA 5HF5A 5K0FA 1OH6A 1XVVA 2IRWA 3NCHA 1L8XA 2P4UA 4QSHA 5JD3A 3OMLA 4YRMA 2OBBA 4KH1A 4HDMB 4DXHA 1NJ5A 2QG6A 1I5EA 4R84A 4WECA 3SLRA 4IH4A 4JQCA 2Q28A 3K0FB 1Y3CE 3ROPA 1O03A 2WM8A 3OUZA 3TUZC 4D7AA 3DVRX 4OD0A 2G3YA 4O1MA 5K3AA 3FOCA 2IOHA 2RHDA 1WXWA 4M1EA 4TKZA 1LEHA 1L3CA 3MZ0A 3QF4B 3V46A 2EC5A 5EE1A 2BMAA 1PHPA 2ANCA 3JSAA 3X3HA 4AUMA 4OXYA 4C0QC 1XVAA 1EK0A 3U1VA 5ICCA 1O54A 4EPVA 1Q6ZA 4AS2A 2X8JA 4I3GA 2AV6A 1ULHA 4L0CA 4AMYA 3V33A 2QX6A 4F0JA 4M8SA 4KR3A 1J22A 3Q7QA 4J1QA 3WQQA 3G02A 2C00A 1UJ4A 2WY2D 3MFYA 3JQRA 3O2NA 1EXDA 2PQ2A 4XLZA 3W1VA 3CEAA 4RV9A 2B1IA 1JKIA 4FDAA 3S7ZA 1GFIA 1JG2A 1P33A 3P2EA 3D7RA 3RBVA 1U98A 4DUGA 1EUDA 3AR8A 1L5FA 4DQDA 5C8XA 3N39C 4I4TB 3B9BA 3GEIA 3UOWA 4D1YA 1SBYA 5KVQA 4EGQA 3BMQB 1HM5A 3B70A 1T2AA 2C29D 3E3AA 1N5KA 1OLUB 3AH8A 4EHLA 4FWTA 1XQXA 4ZRNA 4U63A 5KTNA 2W6CX 2WJYA 2P3OA 3CRQA 4IHJF 5ADUS 1D4AA 3R0ZA 5INTA 5JQGB 3T9BA 1ISSA 5HKKA 2NUAB 3QOWA 1YJCA 2D2XA 6CHYA 5I7VA 1JEQA 1WVMA 4ZIRA 2I29A 1V11B 1VG9B 1YBAA 3DUWA 4TMXA 4JXZA 4P31A 3RVQA 2TMGA 3EODA 3G68A 3EEBA 4CM4B 3W6OA 2DB3A 3WWEA 1XCJA 1ZBQA 2CJYA 1UK9A 2CXUA 4ME6A 4PTZA 4HQOA 3T9CA 4C1NA 3DHEA 3ESXA 3EYWA 2J3DA 1DC7A 2JIDA 1MQ8B 3MELA 3VR1A 3OU6A 3U6BA 3FPSA 3JU3A 3WJAA 2GEJA 4CM8A 5LQDA 3WGUA 3CQ9A 4PV7A 3CT6A 3RK1A 1R6DA 3I5MA 5J4YA 1DEXA 4R9UC 3EVBA 2FJUA 1L5OA 5BQ3A 3TW0A 2FP4A 3HRKA 1MH1A 1EP3B 2E6UX 2IE8A 3AHJA 4ZVVA 4JSTA 4R9NA 2IOQA 1E79A 1QPGA 1E2EA 4TWJA 2ZK7A 1P9RA 4QARA 2IJGX 3B13B 3T9DA 2R3SA 4B5KA 1ZCJA 5AI9A 5AJYA 4H7JA 2FOLA 4HFJA 3CFYA 2O05A 2HZ7A 3PUXA 4M1SA 2QM8A 3LWBA 4MROA 4W5RA 1XXHE 3CZ4A 4C2BA 1OROA 3GJYA 3L49A 3HE3A 1QHGA 5H81A 1Z06A 2NU9B 1XCMA 3NHWA 3G9TA 1CKEA 2NUPA 2OM6A 4EX7A 3GJTA 5CFQA 2VWGA 2ESRA 1L5ZA 5KS2A 1X8JA 5BWNA 1YACA 4OK5A 1OA0A 2FA9A 1Z7EA 1H0KA 2QUZA 4WADA 4NYIR 3KQLA 3MJHA 2WT9A 4MRPA 1NRWA 2B6HA 3KWMA 2WG1A 3O7WA 3DZJA 2ZUUA 3IP9A 1OA1A 1U6JA 3GFBA 4MUNA 5A7GA 3W2EA 1BMQA 2YRFA 1Z75A 4IKOA 3RTBA 4B3MB 2G7MC 1K3FA 3BD6A 1IY9A 4UDXX 3DMDA 5TS3A 3N86A 3Q1KA 2DSNA 4U00A 1L3IA 3F2IA 4R05A 4S3MA 4WKPA 5AW7A 3D3WB 3EZFA 4B3HA 2ZCVA 4Q7QA 3D81A 2OG2A 4ANFA 3VSCA 4KI7A 5EZ5A 3ZXSA 2YHIB 5GM1A 2PKXA 5A2QA 3L6DA 1N2XA 1O6BA 1QK5A 4LECA 2IITA 1Y5IA 3E4CA 1NMXA 2EZ8A 4GOJA 2X4IA 2PH5A 1ZD4A 1KMCA 1EUCA 1D9ZA 1H2BA 1R4MB 3HO6A 1Q1EA 4LDZA 3R7AA 2ZXUA 2QE7D 3CZ5A 4LYGA 4Y0NA 1BWPA 2F3QA 3GFRA 3M4XA 4ZT4A 2G1KA 2NAFA 3KFLA 2O8VA 3KQWA 3KB6A 5JZVA 4FHDA 5CH3A 1OU0A 3A9WA 3HO8A 2VAVA 2YCBA 4YAJA 4EL0A 3QLTA 4QJBA 1ORVA 2QQGA 4H08A 4E21A 1SELA 1IEQA 4E22A 1CUDA 2WA2A 2BFDA 2D1SA 2NVBA 1EVQA 3F5FA 3JRXA 1P72A 3K92A 5MN5A 3N3AC 4CMEC 1O4WA 2A0XA 4FYKA 3SMQA 4YLYA 1OI4A 4HEHA 1H4SA 1EZ1A 2FVXA 3N59A 3H83A 4KQGA 1N0UA 4EPRA 2VRCD 5JBQA 4WY8A 1UUFA 4XWWA 1GAXA 3GRVA 3GARA 4UE3S 2RARA 3FDFA 4IFEA 1W34A 4M9RA 4RLFA 2ZIWB 3TLCA 3BOSA 3G0HA 3DO5A 2VDWB 3F8SA 1TA9A 2F67A 3PYMA 1Y9DA 4ZT7A 3H5WA 1PS8A 2JFFA 1XO1A 4CCWA 3MWEA 5HS6A 3ZLJA 1PSZA 2X8JB 5IDYA 2XVYA 3FPAA 4GICA 4RA9B 5JVDA 2H9AA 4D4MA 4MQUA 2OHXA 3UMSA 3BFPA 5K3CA 3LGAA 1XZDA 3K1ZA 1DDOA 1PTJA 4KXXA 4U6SA 5I9BA 3U48A 2HLDA 2C59A 4JQZA 2HWKA 3GLRA 4OUKX 4RS3A 3SVTA 4J1NA 1WHSA 3BAZA 3V1MA 4PNPA 1T8WA 2ZAGA 1G9TA 1MJ5A 3VDNB 2AFIA 4L8LA 4PRKA 5ICFA 3BK1A 1GGVA 2JJMA 3RBAA 1RE1A 1QO7A 4R3WA 2YWJA 1LLFA 1C8KA 4Q6BA 3WLFA 1Y4ZA 2PGXA 2HPHA 3QHPA 1USUA 2C2HA 1EXNA 1JU3A 1CQPA 2IYOA 2X8BA 3LKVA 1Q0RA 2CNBA 2QJFA 2KE5A 2PRIA 4WXEA 1IJFA 1Z6AA 1O5TA 1U8XX 1U2RA 2HGZA 1NVDA 1EA5A 1IYZA 1LSSA 2JBAA 3A1NA 3F0TA 1G3RA 3H87A 4N3GA 4BUCA 4ZIRB 5GTDA 1RAAA 2ERYA 3FR7A 4HGRA 1DRKA 4UBLA 2PEYA 1USIA 5DM1A 2PKCA 4YROA 4EDFA 1W7AA 8MHTA 4L5CA 3KQYA 3CISA 3M5WA 3G1UA 4L4ZA 2C5AA 1C3XA 5FWAA 3PHLA 2ZIEA 1PZFA 4YAOA 3DVSX 2YTZA 2H48A 4BX2A 3FCEA 4A92A 1C41A 1GUYA 1N92A 1V8PA 2CHQA 4J2TA 4K1XA 1Y9JA 2YASA 4FB5A 1I2BA 1AUVA 5CA1F 4JV5B 4Q9AA 1T3LA 2HW8A 2Z1MA 3KSAC 4Z4GA 1ZOLA 5KI6A 4AUEA 1EFTA 2JLSA 2CL0X 1RMYA 4O8CA 4EZEA 2TRSB 4WZAB 2F3PA 4O33A 1RQ2A 1NW7A 2QMEA 1UBMS 4KXNA 5J5VA 3WX0A 1IQPA 4NV0A 4CMCA 1YQGA 2PUEA 1QGED 4E2YA 5CVTA 4KVZA 1QV7A 3QVMA 4IDPA 2Q1WA 3REFA 4ENRA 5EIHA 2R6CA 3N28A 2WRZA 4RD0A 4C0HA 4C78A 3KL4A 2JFYA 3G7UA 2JKVA 3U09A 4LGMA 2P11A 4B2IA 5DZSA 3RS2A 2H1SA 1SBQA 1VSVA 1RYYA 3RQSA 1VE1A 5EIEA 1SQFA 5JYBA 1P31A 3M8KA 1I2ZA 2QJWA 3GJ3A 3SPXA 1NG9A 1FP4A 3TTSA 3HU2A 1L5NA 4BZZA 3EOAI 3PFIA 1EFAA 4U3JA 4LDPA 3ZZNA 1ZK0A 3R5KA 4UXHA 3CLTC 4FGJA 4LOHA 1JIQA 2JANA 4FD3A 3VH1A 1GWNA 1NE2A 1UK6A 2CDAA 4L78A 1MMFB 3GZNA 1EH5A 4W6QA 2D7JA 1QHYA 2XYVA 1JG1A 3N8IA 3PNMA 4WK0B 4J0KA 3ZHSA 2Q5OA 5KSZA 4GXQA 2GN4A 3BSSA 5B3JC 2V1UA 2GXAA 4LF5B 3LP8A 2H18A 4IMRA 2VBFA 1FFXA 1N2SA 1FSZA 2AOWA 3DC7A 4BB6A 4B80A 8AT1A 1JDUA 1QRTA 2PIAA 2O2SA 3B5IA 3RFVA 3CE9A 1K6EA 4LPKA 4X0EA 3RFUA 5JH7F 4BO2A 2YQ5A 3I3OA 1WG8A 5LD2C 3IUYA 4NULA 1PK8A 5IDWA 1NDUA 2XNKA 5EIBD 1EXVA 2Z6QA 1OLOA 1VA5A 4RE6A 3KYDA 1HTTA 1G8PA 2FU5C 1N1GA 1XA0A 2DCMA 1TF5A 2Y3IA 2JLUA 2ADOA 1LSJA 2Q62A 4V0SA 5E4JA 1C9MA 1C9DB 2J5KA 5KTTA 1JQLB 2WJ4A 2WVAA 4YI3A 3IT3A 4C89A 2AJBA 3IKJA 4L3VA 3ZCPA 3QKRA 4FSXA 1GU7A 3E81A 4RE5A 4UAJA 3EIFA 1K9SA 4B9AA 2C7RA 4WY5A 1XMJA 3ZIDA 1H2XA 1Z68A 3FMIA 4FDVA 1E3LA 5CMLA 2R1ZA 4CKYA 2RHRA 2G4VA 4M1KA 4RZ2A 3WLIA 1YJ8A 4D8WA 1QHHA 4LYAA 1VYVA 2P9FA 3FAKA 2GK7A 4Y98A 1A2QA 1C1DB 1E5XA 2HU5A 2J9ZB 2JI4A 1E6MA 3HZRA 1CK4A 1GG9A 3IOYA 4UM5A 1P17A 5KNLA 3L6UA 2I1LA 3ER9A 5DBFA 3OFSA 3JVDA 1SEPA 1W96A 3T99A 1NR1A 1JU9A 3UVEA 3NHKA 3MWEB 1ZI8A 2Q3EA 1FMCA 4ZPJA 1O1YA 3RYTC 3S6JA 2I2FA 1GNVA 1T8PA 3PL5A 4ZOEA 1EVYA 2PXAA 3HXPA 2C4VA 4G26A 1OB5A 1YVEI 4TRNA 4ZCQA 2CMFA 4ZKEA 3AMVA 3BXFA 1FVHA 2DSTA 4TT3A 2RI6A 1BO6A 2R8YA 2WD9A 4P4SA 4Q1VA 5D7BA 5IHXA 2R5FA 2SICE 4YJGB 2AHRA 1WHSB 2NZVG 4BQPA 4PHHA 4OJTA 4EUEA 2EFGA 1LVUA 4WXRA 5DI3A 4H1TA 3SYNA 1VDZA 1O94C 4Q3AA 1BJRE 1Z74A 2FPRA 2YZNA 1VMKA 4MYTA 3IJ5A 5KSPA 1FW8A 3E9MA 2YOFA 1CJUC 2O3SA 4U4AA 2NG1A 4GX1A 5F1KA 1H1LA 4J0HA 3A9TA 3P9QA 3VNVA 1GU1A 3MILA 5LFAA 2IA5A 1XD9A 5CJPA 1NOIA 1GCUA 4MVJH 5A5EA 2HHHB 2GPTA 4YP5A 3PZRA 1W5AA 5K3BA 1R12A 2ZYTX 3C98A 3GJ7A 2X8LA 1B73A 3VKHA 1KVQA 1NXQA 2IK8A 2O1SA 2X9LA 4JI5B 3I12A 3NWJA 2YXDA 1XMXA 2O57A 1QTIA 2VHVA 3QV2A 5C46F 1DTSA 4YCLA 2R1VB 5COQA 3NW9A 4DDHA 3SQLA 5LQKA 3RFXA 4L95C 4EB0A 4JL5A 2J7PA 4L74A 3AZOA 3B89A 3GGSA 2VXCA 1EGQA 2ADFA 4WBNA 3U39A 3AVPA 4U0KA 5HKBA 2BFFB 1RC0A 5EUCA 4DLLA 2G17A 4IXNA 3L7YA 4L15A 4DUZB 1B3RA 1UJCA 3BZWA 3L06A 1ID1A 2FZKA 3A70A 3AK4A 5I7UA 2F8LA 4U5XA 1I3CA 3HCEA 4NH4A 3DTTA 4RV5A 4RVGA 1PQWA 2O2HA 4CKWA 5BR1A 2ZFUA 2VJDA 3QY9A 4N5NA 4ND5A 1PNQA 2PXHA 3I01M 4KW7A 4NQZA 3SDSA 3LX5A 3SJCA 4ZHSA 3PT5A 2AZ4A 4JVLA 4I1RA 2ZQYA 2GXUA 4BNNA 2V7UA 3IBYA 4REQA 5ED0A 1KFBB 4P93A 5IPFA 2A57A 1UODA 1RQPA 2VP9A 2JGNA 5I3CA 3E58A 2VO1A 1BEUB 4F6RA 2P8SA 2G88A 3QKSB 5D3MA 3WRXA 5AVUA 1MX5A 2UZ0A 3L0PA 4A8HA 5L3QB 4LZOA 1FP4B 3TXXA 1CS0A 5AJZA 2WILA 4IGFA 1HPLA 3C3DA 1S3FA 2K7ZA 1E3JA 3G89A 3MGAA 4FNMA 2C2ZA 2Q6KA 2DHRA 4DCVA 1D5WA 3IP1A 1F0NA 1WD5A 1SU6A 1XG5A 4FWBA 4ZOBA 1AGNA 5EVJA 2G72A 4RORA 1MX3A 4D3XA 4DV5B 3A4YA 1PG0A 4XRRA 3GH3A 3NBKA 2WD8A 4LSGA 2DQKA 4PPFA 4J3FA 3D3EA 5EGNA 5SZJA 5U4QA 1Q84A 3L9WA 1DJLA 2YVUA 4Y1EA 5EL0A 4S1PA 3CF6R 3ZS8A 2PUGA 1PUXA 1QCYA 4JUFA 3CLKA 2DQ4A 2A58A 4A03A 1FFXB 4NS4A 1ZH6A 2RAUA 3EPLA 1ZVJA 1LLUA 4MIKA 2FV8A 2YV2A 1M33A 4JBYA 4WINA 4Z49A 4QPPA 4HLUA 2L19A 3LBHA 3GPBA 1ZI6A 2OCIA 2I1WA 2BJHA 2PEZA 3KKMA 4HAOA 1L1EA 1CETA 4ARUA 5B6JA 1WD7A 5G4KB 1DBIA 3IUMA 1MIOB 3ZC3A 4RZHA 4WN3A 5DCUA 5D86A 2UUCB 1NN5A 1Q0PA 3RJZA 2AR7A 5J59A 2GVZC 4Y67A 1E2UA 2Q46A 5EPOA 1RPZA 4HNQA 5BQOA 1VIVA 3PLRA 4ENSA 1Y42X 1S0UA 1LBTA 4NXMB 2JIMA 3QKRB 3A9RA 3U7GA 2I87A 1MB9A 1XRNA 1QYWA 2Y66A 3KQPA 3HSYA 3ETGA 3LBYA 2YZMA 4JSYA 4P38A 4V0OA 2H7VA 2OXFA 3EQ9A 1A71A 2XXBA 4GLFA 4GECA 3WLRA 5KTRA 1EK2A 4ZRMA 4JEHA 5EQJB 4XM0A 5CR9A 5GONA 4HTAA 3VX4A 4PG5A 2VDJA 3TQTA 1QG2A 3OU7A 4UPDA 1VPVA 3QYAA 4FFDA 5C8YA 4R8RA 3Q8XB 5H3HA 3V8EA 3QKUA 2DGDA 2VIIA 2YXEA 1P0FA 2B6NA 4GGOA 4PM4A 5ALIA 5E2BA 1CNEA 3RNLA 2EARA 5JZSA 4NNOA 3GJ6A 2CLLB 3EXHC 1AGPA 3IR6A 1KI8A 2WU1A 4I99A 1M0SA 2GN1A 1IN5A 3SS9X 1X1AA 2VQ6A 4YGXB 2VH1A 4TTRA 2IH2A 2JHFA 2WZCA 4JB3A 3UT5A 2VDVE 1TVMA 3PC8A 1EWRA 5CU7A 5H83A 2K7FA 3K05A 3FUXA 1QQ7A 3T0FA 1A9XA 3IUBA 4P4SB 3TFWA 2Z58A 4A5SA 3GNQA 1TQDA 1Q7TA 1MRSA 2Q5EA 3OT1A 1BWSA 1UM9A 4US0R 2PD6A 4S04A 3DE5X 1M0EA 1RU3A 4E3WA 4PYJA 3B78A 3AJDA 1SXJB 5DI3B 2ZVPX 4FGWA 4YYZA 5B64A 5CK5A 4ISCA 5A06A 4WA7A 5IRCD 1C7FA 3CNOA 4JD5A 1D2RA 3USCS 2XR1A 1XLTA 3IOBA 4LJ6A 4N3NA 3WSWA 1EGHA 2C2WA 1SCQA 1H1LB 2W6MA 3O9MA 1BVUA 1EBUA 2D4AA 2QIOA 4NQRA 3OQHA 4V0KA 2CFCA 3GFGA 3L02A 3MSCA 3NIFB 1M5UA 3PHHA 1G63A 4QU5A 3S8EA 2J67A 1JPUA 1F5NA 1YZYA 3FZGA 1J33A 1XOIA 5BQ5A 1J0XO 5ICSA 4KKVA 4AUNA 1W8DA 3OO1A 1F8FA 1HQCA 2C5HA 2CVZA 3AR4A 4HDOB 2FWIA 2GEBA 3AFGA 3FHLA 3ADDA 4L02A 2VJLA 3O6VA 4J9UE 2C4KA 2VHJA 5BMVA 4INZA 4K46A 1N5OX 3EXAA 3KL2A 3ISVA 5TX7A 3V6MA 2V7QD 4OGWA 4G5YA 3ZQJA 5CT8A 2IYRA 3CZPA 4WBNB 1O6ZA 2Q8NA 3TLGB 2D5CA 1WDTA 4JB8A 2PZ8A 3AP1A 4P5PA 5T4EA 2CF5A 4AP9A 2DUJA 1LGYA 4XQCA 4AVYA 4KYUA 1F8XA 4CLOA 5HM6A 2AH5A 1E1DA 1RAHA 5AJHA 4G63A 3VSAA 2AVDA 2V1XA 3JS5A 1TM3E 3OE1A 3P9IA 3W5BA 2XWJI 2IF2A 5J5AA 4AMZA 1MW8X 1OBOA 2XHZA 1CJTC 1P0CA 2ET6A 2Q50A 3SDZA 1V5GA 3PGXA 2FN4A 2AI2A 3OA0A 4FJ1A 1SU7A 4GR4A 3JYNA 3ONWA 3CN7A 1Y63A 3QPWA 4IQ8A 2WUGA 4IYJA 3RC7A 1WV1A 1SG0A 3WSTA 2J9FB 5ARCA 1CUYA 2QP4A 3NYQA 2RJOA 5H1YA 2NYAA 2WIKA 4MR8A 2COKA 2ECFA 4JP3A 2H59A 1U0JA 2IUFA 1J5XA 4OXRA 1P44A 3EUEA 3U2QA 2AFRA 1U1FA 5L8VA 4N01A 2GB4A 2C98A 4YIKA 1T91A 1R0BA 3TD6A 5ADWA 5GWXA 1Z4NA 5JZOA 1TD1A 2X1HA 1DZ3A 1Z6YA 5HFNA 5LMZA 3QUQA 3DAPA 5CUQA 3K6SA 1KJYA 5KMGB 4YRPA 2CVPA 3AINA 5CYFA 1BGWA 4XASA 2BEUB 1KI4A 5HEKA 2ZJZA 1Q44A 2O3UA 2RGBA 4N0DA 1NW5A 3X1DA 4DRXA 2FR1A 5JXHA 5K1ZA 3GIWA 4OQFA 5GADl 4MQFB 1CWUA 3OPNA 3BCHA 3RFFA 1HRKA 3ZNPA 3ORRA 5TEVA 1KMIY 3ZS9A 3EFEA 2I91A 3JR3A 3F6RA 5HCIA 3HMKA 2NZ2A 4OAOA 4QUIA 3T3PB 5JUWA 3FE2A 1WW2A 2D3TA 1DFIA 4HUQA 1K8ZB 4UC0A 4ZDWA 4ZMRA 5AJTA 2E6KA 1GL6A 3UOAB 4W1RA 3UC5A 4J16C 5L7YA 1W59A 2ZVQX 3DTNA 1WXFA 2QPLA 2XTAA 3M4ZA 3PS9A 4KLCA 4EFMA 3LVRE 4PGMA 3W79A 4P53A 2XQVA 3OC6A 3QNMA 5JV5A 1CZKA 4TYMA 1P77A 1Q3KA 3TN7A 3DXFA 4WKNA 4G25A 2XUJA 4X8OA 4MJ3A 5HJ2A 1GUZA 4DNOA 1QM5A 2B30A 1J90A 2GPBA 4HH4A 5JARA 4A82A 1WZCA 4P4NA 4X3OA 1GTVA 1F06A 3GH1A 4PRYA 1U3DA 3PQ4A 1Y82A 4HYTA 4YCAA 3VPHA 4JS0A 5JMWA 5KYWA 1RWXA 1HE8B 1GGKA 4XW2A 1XKTA 3IB3A 3RT9A 1YVPA 4Q21A 1N78A 4ZOLB 3S28A 1GPWB 3LDGA 5LMNB 3F7TA 1IHYA 3WLHA 5HG0A 1AHNA 3RC8A 1IHXA 2CDNA 1T6NA 3LNTA 2XDWA 4KVFA 3RCBA 5HQ3A 2DOKA 5C8YB 2PJDA 1YB4A 2QROA 4FM9A 2QRGA 4WEQA 2DHQA 1Y37A 3N3BC 4N03A 4DBLE 1J24A 3DOEA 3FGPA 3OFJA 3LHKA 1OLXB 5CB0A 1Y1PA 3UHPA 2F6RA 5KX5F 3RARA 1S9HA 2EF0A 1CR0A 4CHTA 3FDIA 3PHIA 2HJHA 3ZHVA 4BKPA 3UT5B 2ZB7A 4LHVA 1IBRA 3R7SA 3IPRA 3VZSA 2C57A 1EVZA 5EHNA 1A9XB 5K3FB 1NJFA 5JTTA 1JH9A 2H06A 2AX3A 2FW0A 4ETIA 1VL8A 1Q91A 3OT1B 3PFWO 1XUOA 3K1YA 2P78A 1Z0FA 5DX8A 3U62A 2AS0A 3OHPA 1S2IA 2A1UB 1Z4OA 1UZMA 2OZKA 4AWXA 4D4HA 4E0BA 3SQWA 1NF3A 4KQ6A 2H4YA 3BWVA 2ZB3A 3QVVA 2OD2A 3FMVA 3H2BA 2IUTA 5EZSA 3ZW9A 1EFHA 1J0BA 1P1FA 1GCOA 3HEBA 4OJQA 4B79A 4BATA 1B8VA 7MDHA 5JY1A 2JIQA 4MUFA 1J1IA 4PVCA 4Q9HA 1MPXA 2ZR0A 3CNHA 3D1LA 5IM4F 3TKYA 3F3SA 3MJDA 3E1GA 2H5LA 1HLFA 4EGCB 2MSCB 5BUQA 3F4BA 2PLAA 3AM3A 1X13A 1Z08A 4DPMA 1KSGA 3ZY5A 5CXUA 4MV3A 1YOBA 4ERXA 5FX2A 3UBMA 2CNKA 2Q9BA 3CG4A 5J4LA 2XWBF 4HGQA 1BMTA 2RH9B 4NYJR 2VRNA 4U7HA 3HJFA 5CPFA 4I1OA 3WISA 4ZJYA 5BMVB 2OCLA 3M6XA 3O9VA 4GYYA 4MS4A 3CPSA 5AW9A 1NKSA 4M1TA 1S4MA 1A0OA 2J5XA 1FDRA 5ALRA 4CIVA 2WE8A 4HNTA 1KYZA 4BMCA 1SFRA 3HJHA 4UE2A 5KQRA 4IIUA 3PWZA 1X42A 4Y2VA 1TTQB 2C9MA 1CY2A 3MWJA 4Z4IA 3HXOA 1ZR2A 1H8HA 2E5WA 5K45A 4CLOB 3KOWA 3PQ3A 3IL2A 1AQLA 3SXPA 3ZIAD 1ECGA 2F9LA 4D9IA 1C3OB 1GL7A 1P39A 3BXEA 3EGXA 4RQTA 3WHIA 1MPTA 4B3SB 3TRDA 1RI3A 1XALA 2IP2A 3KTDA 5MGBA 4JUCA 5M34A 2CGEA 4WBXC 2C8KA 2GAIA 3E9CA 5DBGA 1E6WA 4TTAA 4G9GA 4MMYB 2AA3A 4JGIA 1K92A 1KNQA 2RG7A 3NETA 1P2VA 4IV5A 4IMJB 4MS1B 4ZYLA 1T15A 3MRVA 4Q1DA 1TC2A 1FX0A 1K2VN 4HB2A 1QONA 4WT7A 2Y4OA 4FKBA 4P80A 3RC9A 1T5HX 1BS1A 3SQDA 5KJFA 3H5TA 5KREA 4KO1S 1KJZA 1NV8A 1UBUS 3CIOA 3HY4A 5LUBA 2FNAA 2V8OA 4N1AA 2I3ZA 1C3VA 1WKCA 2P9YA 3WKAA 1MO3A 3CRW1 4TMFA 4DJ5X 2IXDA 1RAFA 5AW8A 2I99A 3BFXA 4QXPA 1WW3A 2GETA 4Q4DA 5LCXA 2XQGA 3DF7A 2ZRLA 2VP5A 1CLEA 4BCDA 2IOFA 4JOBA 4B34A 1JG3A 2QXTA 2DJIA 2WLTA 2X6QA 3BA1A 1P61B 1W46A 3JSXA 4GX5A 4U7TB 3W5SA 5I7HA 1STOA 1H22A 4DRXB 2ZUTA 3AERA 1FC0A 3ZW7A 1UMCB 3ZWYA 1NXSA 2PZAA 3CZAA 4V3BA 2HU2A 3KQQA 3PUWA 4Y9DA 3WYGA 4A36A 4F3YA 3CNLA 2ENUA 3O92A 1U1DA 3H4VA 4M0LA 4PS0A 4KCGA 1O97C 4YK7A 5BWOA 1T5BA 3AY6A 3ZV3A 1UBGA 3DZFA 3QPBA 4G85A 4YP9A 4HUQB 3WYEA 1DJPA 4UREA 4OQYA 2E48A 3WADA 4NMXB 1TO1E 1O96A 2SBTA 4PQFA 4B3JA 4JMLA 4XTCS 3QG1A 5HF9A 3A14A 3VR3A 1XIVA 4GPTA 4EUHA 5JS2A 4TKUA 2Q3HA 2XUHA 3ZE2B 2JFPA 1LCIA 1Z5ZA 1NRXA 5EJGA 3UWDA 5B7GA 4NECA 5H7XA 5G02A 3ZDEA 5DP2A 2WG2A 1RQLA 4F5ZA 2DWQA 4Y0AA 4JP8A 3QH4A 4DIUA 3VYWA 2H31A 9LDBA 3CH4B 3WMWA 4F97A 4B3CA 4Q16A 1P81A 2VEOA 1RJ9B 4R1PA 2XCTB 4TLAA 1D5CA 1DTWA 2W2PA 3ABIA 3I2KA 3PI6A 5DIZA 1IM8A 1IOWA 1X94A 2L18A 2WJVA 1E9AA 4W82A 2BEJA 1CCWA 3NTUA 2Z95A 4NI5A 1DCFA 1D04A 2REBA 2X0NA 3SI7A 4DPLA 1GXSB 1NYTA 3EMBA 1J2TA 1HFEL 4D0LB 2WE7A 3ENQA 1QYRA 1W36D 4EA6A 4PRLA 1RR6A 3BQ9A 2IHZA 3IQGX 5ALMA 2ZAMA 4ZI2A 2GASA 1YJQA 1GG5A 3G1WA 1TK3A 3NAZA 4KN9S 4JKYA 2YHBA 4MEAA 2R62A 4R9SA 4V0LA 4X85A 5AFSA 3FVTA 3VV3A 3MRXA 3OPXA 1OVMA 2VK1A 3W77A 5T3UA 1GPBA 1YA4A 3D5EA 3PDHA 4FE3A 4IIJB 2BCEA 3VHXA 1NQOA 3LAWA 4WZBE 2XADA 4ODIA 3DE4X 3WDMA 4EPYA 1WW8A 5LOVB 4O2LA 2ZETA 4BXOA 3FI9A 4Y6GB 2EJUA 2C92A 3GRAA 4OHKA 1S2OA 2Y1OA 3FFAA 3NLLA 2V7PA 4RGBA 3KKNA 4W1SA 5JZ9A 1V5IA 4PS1A 1G6HA 1ZCBA 1MVOA 2AFHE 4WKGA 3MWDA 2M2IA 4XIFA 2XNJA 4AULA 5FUYA 2HRQA 3MJCA 1E8NA 3N70A 5JFGA 1VJGA 3HHPA 1KK3A 4QFBA 4RVOA 2JJ1A 2FMUA 3L18A 3OIYA 1KWKA 3FFWA 2G8NA 2G28A 2O6LA 2NACA 1YBFA 3NZEA 1RZVA 2IDZA 1P5HA 2VAMA 1NQVA 1VMDA 2H17A 3AUXA 2CMDA 1B1AA 2J3KA 4NC9A 4NENA 4KLNA 3ODPA 4LJ8A 3CRZA 4R31A 2HMVA 4GGPA 4RVCA 5A0FA 1NF2A 4YJ2B 2P27A 1A77A 2CD7A 2F9FA 3FOAA 1CTQA 3GDGA 4BBZA 5BUZA 1KQGA 1IY1A 3DCNA 2NU6B 1MA3A 3T4EA 2C3PA 4NNJA 2FPGA 4C5AA 1BQEA 2A33A 3OZBA 3EC7A 4QYIA 3OUUA 3TIVA 2H1LA 4IS2A 3X1XA 3O74A 4PCLA 1X0VA 3IHTA 2B99A 4G3XA 1T36B 1RCUA 4EARA 5JXJA 2EEPA 4RIFA 2ZUSA 5AH0A 5E1OA 1X87A 2Z98A 3A6FA 4IH1A 1TT5B 2XXAB 2JFHA 2G5PA 2ZIAA 3FOWA 2ZI5A 3VYSB 1W4BA 3KCNA 1GPUA 4JQYA 5EUBA 5ES4B 2ZUFA 3F4KA 2MMCA 3KCQA 5C5CA 3RYCA 1N36B 3OZEA 4LHZA 2FCAA 2FMHA 2O8EA 2IPOA 1YJBA 3K30A 4R51A 4WXHA 2R25B 4YAEA 5K6TA 1C7EA 1KC1A 2VDLB 2YOHA 3L8CA 1U2GC 4LXTA 3UKOA 3V4ZA 4AG3A 4EELA 3FOFC 1OAKA 2ZYVX 1FX0B 1F8UA 4P6VF 4YAUA 3NC4A 1U2ZA 2PQMA 4AZ3A 4B9EA 4CXMA 1G5QA 3JQCA 1FZTA 2FEXA 2ZM5A 2VP3A 3R7LA 2EZ4A 1DPFA 4DAOA 2HV8A 4LZLA 3H9JA 4A8JA 1SKAA 2G82A 4EYOA 3PA6A 4IIVA 5F7OA 3ANLA 1GPJA 3FCXA 4R4JA 2NYRA 1UZLA 4HTFA 4JJGA 2WI8A 1M2KA 3I9OA 3O8QA 5LP6F 2YKGA 4KMRA 3K72B 3WGYA 4AO8A 5CD1A 3JQ9A 4IGEA 2ACVA 1YB7A 2P9EA 3E9DA 2HA5A 3KWLA 5JHHB 3GAAA 3F5MA 5B6PA 5EE3A 1P0MA 1NXWA 1Y4DE 5CNJA 2JLQA 3FBGA 2Q4EA 1KZGB 3AERB 3KSMA 3OFVA 5C5DA 3MYRA 1GU0A 5T8KA 5BUCA 4B76A 3D02A 2RK6A 4KXWA 5EP1A 3JWPA 4UXJA 4R2LA 1AUXA 3SQNA 1KEKA 1Z7YA 1ZU5A 1OV6A 1KPHA 3KZOA 4HDAA 1E0KA 3ZJ4A 4LGVA 4E32A 5HIIA 1IZ9A 1AT1A 2X40A 3C5HA 3A8TA 5LXTF 3TE7A 5A3JA 1BFKA 1FQWA 1O96B 3GEBA 3HCNA 3QFFA 3UB3A 3GUUA 1IC6A 2JDID 4FDTA 1TCUA 2AC2A 2WYWA 4NBVA 2LCQA 4TLBA 4YAIA 1UWLA 1JEJA 5FNVB 1M6VB 1VBFA 1RXYA 2IHUA 1QC5A 1OHHD 3UO8B 1IXZA 2BDUA 3BKXA 4A6PA 2IZ7A 1P1KA 2JCYA 1OFVA 3ZOZA 1RVV1 2HRRA 4NAVA 1DXOA 2CUNA 3FMFA 2Y27A 1SNYA 3ADPA 2DP4E 4XYEA 4BWYA 5LQJA 3PD0A 1YUNA 2I2XB 2ZPUA 3G0OA 2Y1XA 1IN4A 1DLIA 1LXCA 3RW9A 1FFCA 3TGLA 1N0IA 3LRTA 3AEUA 5TRTA 1DMRA 4JELA 3ZZUA 3A9SA 4ZEWA 5CFNA 4KFUA 5T4BA 1R0RE 2C7BA 3FH0A 1W9HA 2Z4SA 3OZUA 1I6MA 4FYPA 4GSYA 5DH9A 5AKGA 5FOVA 1CLUA 3VDQA 4U2KA 4KIWA 2OBFA 5KAMA 5BURA 4TYPA 1OZFA 4BMVA 1MX1A 1G5TA 1B42A 1IBCA 2E4ZA 3N0TA 3S8MA 3UGTA 3MJFA 4RHEA 2HPAA 3K6JA 2Z3WA 5JO9A 4ZXFA 5BXQC 4ZTUB 2NMVA 1L1RA 2XW6A 2FGJA 2XGJA 1UFOA 2NTNA 3SNKA 3TZEA 2YIVX 3RG2A 4O2BA 3ZY2A 3IVCA 1QRRA 3HK2A 3QELA 1NQAO 2EVWX 5E9WA 1EUZA 1B6GA 2VBIA 3G0CA 5KNCH 1D2CA 2XUKA 3CCCA 2NO4A 1MJHA 2Z4TA 4CIYA 4BXOB 4TOIA 3ZDYB 3D64A 3AOGA 1FMLA 5C81A 4UFNA 3R5TA 3AR7A 4EYQA 3DVLA 5A4KA 2H1WA 1O95D 2R85A 2X0IA 3MWDB 3OKFA 4FHFA 2AZTA 4Z5XA 2P68A 4KG7A 1YKSA 3DD5A 4O1IA 1C1HA 1UZUA 4C04A 1BCSB 3HKCA 4IZOA 5IWCA 4PLWA 5CH8A 5D5QA 4EI7A 1JJ7A 4Q3BA 1SC6A 2QE7A 1VJ0A 3E2MA 4EB3A 5K0LA 4C5BA 2LCIA 2YX1A 3LT1A 2NLOA 4TLLB 4I8DA 5FUWA 5I7OA 5HF6A 4LI0A 4Q9IA 2QUIA 3H2IA 3WGLA 1R27A 2AQHA 2B78A 4AS1A 1E62A 2NXJA 1SC4A 1F2UA 3ZQ6A 6GPBA 2P2NA 3DDUA 3OQ1A 2FPGB 2OCXA 4DL9A 2AI1A 1TUGA 2GGSA 1TM1E 4PSDA 4UJ3A 5TQ0A 5TT0A 2O5RA 2AT1A 2IVZA 4PTLA 3SN6A 3T0IA 3WNBA 3WLKX 5C3MA 2XCRB 4GBED 4IUCS 4L4RA 5IJWA 2HH9A 4I66A 4TXNA 4LK2A 2XUPA 3L7MA 4F3NA 3UMBA 1J1ZA 2VRCA 1IMOA 1YRWA 4FSHA 4IDAA 3D4PA 3CH5A 4QBTA 3QWHA 3COJA 1XZKA 4XUCA 5ICEA 3GYGA 3IP7A 1MT0A 3HB4X 3ZHQA 4YX9A 2F8SA 1BW9A 4UD6A 5DM70 2O8EB 1K06A 3NHFA 5J23A 5B12A 3CUUA 2OGSA 3WP1B 1YA6A 1HFJA 3HR7A 2EJBA 3Q7EA 5AQEA 3WNZA 4CR8A 2I4RA 4PX9A 4ZDIA 1ILEA 1QZUA 1GPMA 4JL8A 1K8RA 1EXWA 4BNFA 4MO9A 3HFRA 2V7WA 3NBZC 4PIPA 4ZV9A 4M1OA 3ZTTA 2BTQA 2QYTA 2V8BA 4XDHA 5A5DA 3JXEA 4IEIA 4DXDA 1X70A 5HA5A 4MR7A 1MVNA 4Q7EA 4TYQA 4OVKA 5CIWA 3WK8A 5AW5A 3E7WA 4L50A 3TOCA 4B84A 2FQQA 4L4SA 4HTFB 4QXQA 1L9KA 2O2ZA 1BDHA 2PKWA 1R8JA 1GLNA 3F1LA 1FP6A 1MA0A 2CYBA 2C1XA 3O8QB 3PNYA 4I6GA 4DR3B 3ZD6A 4NDNE 1XP8A 2B2XA 3SJZA 1GLGA 1XZHA 1D2MA 1YB2A 2QZ9A 1W29A 1C50A 2GDZA 4FFBA 3WK4A 4B75A 2I6XA 2ZIZA 1L7DA 3K5IA 1VMAA 4FPXA 4GOND 4XJXA 5ITVA 3EF3A 3JQGA 4GSLA 2E4XA 3WI7A 5JTUA 3RC1A 3NC0C 1KZ7B 3LT2A 1GFZA 2HSWA 2M1ZA 2PAFA 1JDPA 2V0NA 3R6GA 4XYBA 1W5BA 5FWXA 3DVAA 1B2RA 3AKYA 4HWTA 2RHMA 5DNCA 4K0RA 1MXHA 3H11A 1YMVA 2Y2UA 3WQSB 1TQ8A 4CTMA 2HQSA 5EJ6A 4K2AA 3H8VA 2CUKA 2GAOA 1ILWA 1CZUA 3LCUA 3UGJA 2YWGA 3QJGA 5FBVB 2H9YA 3BYZA 3A4TA 3BD8A 4G5QA 5I7SA 3LT5A 4FYHA 3VX3A 1ZGBA 4RENA 4QOFA 1QC5B 5AVRA 1RRGA 1GHTA 1XZLA 1NR7A 3G3EA 5IYZF 1UJ6A 4JYMA 3RG8A 3AV3A 4Q18A 3DF9A 4RWZA 3SC2A 1ABBA 2XKBA 5I7WA 1I3NA 5AIBA 1XVIA 1OX6A 3UJ7A 4DMMA 1UC4B 2HMTA 5EIAA 3DM9B 5ALQA 5IJZA 3V4RA 3SFZA 2IS2A 3DMNA 2Z5GA 1ZONA 4NL4H 3WKEA 3WYFA 2FZCA 2HU7A 2B4KA 3AEUB 3M5PA 1YZVA 3HN7A 5AKEA 4BU1A 5E2IA 1TFRA 1GDHA 2IXTA 1QP0A 3SHQA 3PJFA 1ZM7A 1F2TA 2C9ZA 1KQNA 1M1NB 4GKJB 3OQJA 1DQPA 1UQRA 2H2AA 3O3OB 1MAVA 4FT4A 5DYYA 1W0JD 4Z7JA 1Z4MA 3TMAA 2AJLI 4JI0B 2JFOA 4KPFC 1EWVA 4IIEA 3G1TA 2NU8A 3W0LB 3AL3A 3FLMA 2FXIA 1UOOA 1G2OA 1MAUA 3HN6A 4O2BB 4O0MA 2B37A 5FV4A 4BRSA 2ZTVA 1SH7A 2QI9C 4J7AA 4CMHA 1UAAA 4MQEA 5JRDS 1VE5A 1KS2A 1Q5PA 1JAXA 1QIDA 2QTBA 1FLDA 2ZTHA 3Q9UA 1FNSA 3NORA 1ODIA 1R9JA 1T0HB 5ESDA 5IJ0A 1PR5A 4M46A 1FMFA 1IUPA 1SXJC 4YPFA 5C53B 5HHTA 3OJEA 4DXAA 1E9VA 4LMPA 3O1IC 3W2GA 3EGEA 2MSDB 4F12A 1N5JA 2NVWA 3AIMA 4RV4A 2C2YA 3THRA 2R68A 1G5PA 3BZBA 4II7A 3WLTA 2PX3A 1A98A 1S8OA 1VMIA 1YGYA 3HKCB 2DVMA 4GRIA 5HGJA 2E9SA 3G5AA 2P91A 1AO0A 1FYVA 3D8BA 2BM8A 5FTJA 1KQ3A 1PR1A 1LZLA 5BR8B 2HDWA 1D9XA 4QU0A 4BVAA 3FOZA 2B98A 3NUQA 1EQUA 2AF3C 2IWHA 2ZUVA 1CDZA 3GV0A 3B1YA 3ZIUA 4O5AA 4TN5A 2OFFA 2JLYA 3WKCA 2GN9A 2P77A 4IRXA 3TLZA 1P45A 1P7WA 1ESCA 2FSSA 2CXHA 3SDBA 2QTFA 3OTWA 1DWUA 4PZPA 4MCJA 4C6SA 1ZCAA 4ETMA 4W5TA 4KUEA 4D41A 4M0KA 3LG2A 4P9NA 4RDCA 3O8RA 3E2PA 4REMA 3INRA 2FE4A 5AT1A 3WR5A 2GQ0A 4HLDA 4C0LA 4P3XA 4RY0A 3PNOA 4JR2A 1XMPA 2HMSA 4ZI7F 2IKSA 1E5TA 1ZR4A 2CD9A 4PPQA 1OXUA 3LTNC 1CB0A 3D5TA 2C5GA 5KYNA 1JKJA 3HJAA 4AF8A 5L9AA 5JNSA 2BF4A 1I94B 2B35A 5DJ5A 3SJ7A 3VR4A 3WB2A 3FF1A 2QGFA 2HXYA 4DM7A 3LBIA 3CWZA 1EX6A 2DLCX 1VKNA 3GT7A 2X13A 4A0RA 2VSYA 3NDBB 3BK2A 3USES 4CKXA 2YNMC 5IT5A 3BCSA 3WTBA 5BQFA 4RKFA 2PFSA 1UH5A 3PGVA 3ELUA 4A23A 1A7JA 2YJNA 4UJ5A 3OOHA 2MHCA 3VAZA 1WE2A 3PSAA 4RF2A 1JTEA 4RK1A 2BTQB 4OFZA 4IXMA 5EJ4A 2VS1A 3G2IA 4KGZA 1IBKB 2DFNA 5CURA 3TQFA 4MR7B 3K4PA 2IOFK 2WF7A 3BM5A 3VTZA 3MSXA 2CUZA 3SG0A 2GEUA 4D9JA 3G6KA 2AEJA 1ODTC 3RSHA 4UTVA 1PJ2A 4GXRA 1BD4A 4Q05A 5IMSA 1F2VA 5ICMA 3O8OA 1LVHA 3LM8A 3A6JA 1J0CA 4IDBA 3HJGA 5HSGA 2BUCA 4PF1A 3KBOA 1QRUA 5AHXA 1O6GA 1G3MA 1AS0A 1Q1AA 3HB5X 4Q4AA 1ZWKA 2WSSD 3QSYA 1CJVC 3JQGB 2JRCA 3ITEA 1HNXB 5I47A 4HOYA 4P5EA 1LW6E 3P52A 3SQXA 4KFTA 4QU9A 3DVAB 3ENVA 1I6LA 4LMBA 4BQRA 1DT3A 5IKXA 1O9HA 2ZXFA 4P4LA 3JVEA 1K8YB 3I6YA 4U8HA 3ED5A 4BE9A 4D45A 2CWDA 5BQPA 2A59A 4G5SA 4GLBA 5COBA 4YP0A 2CEKA