1NW7A

Structure of the beta class n6-adenine dna methyltransferase rsri bound to s-adenosyl-l-homocysteine
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
279
structure length
271
Chain Sequence
GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLQRSYEIVEGAANFGAALQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MODIFICATION METHYLASE RSRI
publication title Structures of liganded and unliganded RsrI N6-adenine DNA methyltransferase: a distinct orientation for active cofactor binding
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 87
structure length 271
sequence length 279
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nw7A00
2R3SA 5GIOE 3FPJA 3B3GA 4QTTB 2ZIGA 3MCZA 5EGSA 5GM1A 3M70A 3UFBA 3JWHA 4C08A 2O07A 2PBFA 2PT6A 2XYQA 2G8NA 2AN5A 2BM9A 1NBIA 3SX0A 2AN3A 4BLUA 4OX9Y 3B7PA 2ZCJA 2GH1A 4FSDA 5FQNA 3ER8A 4QPPA 3EGVA 3E8SA 4GEKA 4CKBA 4AZSA 4OBWA 1YFLA 3OFJA 3HVKA 3AXSA 4B17A 3OFKA 4EKGA 1ZKDA 4FT4A 2ZSUA 2FCAA 4PYIA 2EFJA 3MQ2A 4DCMA 1KPIA 2DPMA 3DULA 3I53A 3I58A 2XVAA 3TKAA 3KPYA 4CXMA 1VP9A 3CGGA 2JG3A 3SM3A 1XDZA 5KS2A 3OZTA 2C7PA 2Z6UA 5DTMA 1G6Q1 1VE3A 3CJRA 1ZG3A 4UOEA 4Y2HA 4X1OA 1Q0SA 2B78A 3CVOA 3V8VA 4FP9A 4E2WA 5K0FA 5GOZA 4E32A 3LKZA 3FUVA 2ZBRA 3AXTA 1VLMA 2OXTA 2OB1A 2YX1A 2YXDA 2P35A 4EMSA 4EVIA 1IM8A 5HFJA 5LQCA 4KW7A 2UYCA 2VDUE 3P9NA 2JHPA 1BKYA 1WG8A 1RI5A 1WZNA 3HM2A 2P41A 2ADMA 4PYJA 2V7EA 3I64A 1KIAA 3P9CA 5E1DA 2ZLBA 4V0QA 1FPQA 3PFGA 1KXZA 2H1RA 1ZGAA 2FHPA 2UYOA 4ER6A 4E70A 2QM3A 3FYCA 1JG3A 3ID6C 5ICEA 2PSSA 2WA2A 3M6UA 1V39A 4RV9A 5FADA 3RODA 3DXXA 3K6RA 2FK7A 2PJDA 5DM0A 5K0GA 1JTFA 5K0JA 2ZULA 3MTIA 1L1EA 2VS1A 3PS9A 4M36A 3KPWA 3ELWA 2AOUA 4PGHA 1O54A 1QZZA 4E30A 3E05A 3HCDA 2EJUA 3SSOA 3UA3A 2P3OA 2QRVA 4PYQA 4FZVA 5LQJA 2UYHA 2PLWA 2WA1A 5DWQA 2LD4A 4F84A 1ZGJA 4C4AA 2FK8A 2QYOA 1XXLA 4A6EA 4DKJA 2AS0A 3BXOA 2PGXA 3ANXA 3PB3A 5C0OE 1JTEA 3HCFA 5EG5A 1YZHA 5FA5A 2ORED 3C3YA 1P91A 1QAQA 3UJ9A 2FRXA 2XVMA 4X63A 3FRIA 4PYMA 2YUIA 1JG4A 3A4TA 5E2BA 4FGZA 3FPGA 5LSAA 2OB2A 5ICGA 5FWAA 3EEYA 4AX8A 3NVMB 4OQDA 1JR4A 5E8JA 4R6WA 3BGDA 3TPZA 4E2YA 1MJFA 4LWOA 3SMQA 5F2KA 4RTOA 1Y8CA 3NW9A 4RTJA 4PYNA 3VSEA 2G72A 3AWIA 2O57A 1DCTA 1KYZA 4C03A 3DTNA 3T7SA 1SUSA 3KQMA 2GAFA 3VC1A 3HEMA 5KVAA 1UIRA 1NW7A 3GRUA 1VIDA 4MIKA 4HC4A 1N7IA 3PX3A 5K01A 1OR8A 2I62A 1KYWA 5ICFA 3E23A 1WXXA 5EKXA 2ZZNA 3KQQA 2VP3A 2Y1XA 3FTCA 3GGDA 3OPNA 3LX6A 5GM2A 5HILA 3T0IA 3TLJA 3HP7A 4ER5A 2IH4A 3UBTA 2IDKA 2JJQA 2AVNA 4DM3A 4E31A 5HEKA 4GOOD 2KW5A 3BGVA 5EHIA 3A7DA 4HTFB 3P2EA 3R9XB 2YTZA 3I5UA 5U4XA 3EMBA 3S68A 5T6BA 3A27A 3HCCA 4M38A 5EKUA 5HIMA 9MHTA 4RVDA 5E2AA 3H2BA 1QAMA 2NXEA 4CKCA 5CM2Z 3IEIA 3DMGA 3B5IA 4ER7A 1DL5A 2EG5A 3DXZA 4EKIA 1G55A 3LPMA 1RJGA 1SKMA 3LDGA 5HOQA 5CIYA 3KU1A 5DXAA 1HMYA 2E5WA 5E1MA 3SXJA 3GRVA 1EIZA 5KYGA 2HV9A 1D2HA 3KPUA 4RVHA 2UZ4A 3KQTA 1YB2A 4GOLD 3F4KA 3M6XA 4GQBA 2P3LA 2NP7A 4HRAA 2GB4A 2HMYB 4ZTBA 3IYLW 3AY0A 3CCFA 1FP1D 3BWYA 3PLAE 1EJ6A 1Q0TA 2O0LA 3TOSA 4Y30A 2V74B 3EVEA 4RSRA 5DPMA 1ZQ9A 2UYQA 2XYRA 4MHTA 5EIFA 4FR0A 4YMGA 1NW8A 5DX0A 1SUIA 1WY7A 4L7VA 4XUCA 3TM4A 3VYWA 4C04A 4DF3A 2VDWA 2OPBA 3REOA 3G8AA 3NTVA 1X1CA 1RJFA 3G88A 3M6WA 2P1DA 3GIWA 4HGYA 3MERA 4QPNA 2IBTA 5K0CA 2YXLA 4CTJA 3NVKI 2CMHA 3UJDA 4BP1A 3GXOA 5CCBA 1NW3A 3M33A 3MCTA 3V97A 1MHTA 2Z6QA 1EJ0A 5DM1A 3LGAA 1JG1A 4NECA 4KWCA 1NKVA 2AN4A 2IIPA 3B3FA 1XCJA 2CKDA 4KRGA 4PWYA 2BR3A 2IDJA 3GDHA 2PV0A 1NW6A 1YUBA 3O4FA 2I7CA 3A26A 3UJ7A 7MHTA 2DULA 1KHHA 2JH9A 4QQNA 2G1PA 1M0EA 5CVVA 2I6GA 2HNKA 3NMUF 5FHQA 4YUWA 2ZBQA 1HNNA 3P9IA 1I1NA 2ZBPA 3D2LA 4PIMA 4JXJA 5DRTA 5EOVA 1N7JA 4U7PB 5EZSA 3FZGA 1PRYA 4OA8A 1JSZA 3P9KA 4POOA 2PX5A 4XCXA 2Q41A 3DOUA 4BP3A 4YUXA 3ME5A 5GWXA 2IH2A 2XYVA 3LDUA 1ZHFA 1TPYA 2NXNA 4H0NA 2WK1A 4FS8A 5DSXA 5K03A 3SGLA 1N2XA 5CUQA 3FPEA 1ORIA 4RTPA 5EMMA 4RTLA 2AOUB 4LECA 4YUYA 3FYDA 3ELDA 4R6XA 3LBYA 2GPYA 3LECA 2AZTA 2QRVB 5FWDA 4K6MA 2AOVA 5DTQA 1BOOA 4YV0A 2EX4A 3ELYA 4PONA 1YZ3A 3HNRA 3EMDA 5BXYA 2ZWAA 2ZIFA 4KDCA 3SR4A 1DUSA 3BGIA 3KQYA 5FA8A 3SSNA 4IKPA 4RX1A 5DM2A 4AUKA 3BWBA 2ZTHA 4BY9E 1AQJA 1R6AA 1P1CA 4X61A 1XJ5A 2AVDA 3KPJA 4FT2A 5EMJA 5FULA 5P8WA 3UZUA 5K8VA 1JQ3A 4RTSA 1RJDA 2PXCA 4V0RA 3LDFA 2I9KA 2ZZKA 4F85A 1SVUA 1YFJA 2BM8A 3KR0A 5K0BA 1PJZA 3HA5A 3KQWA 3TM5A 2NYUA 4A6DA 2HR1A 5DXJA 5DSTA 1RI1A 3CKKA 5FHRA 2ONZA 5GIPE 5EVJA 3GRRA 3Q7EA 2NP6A 1SQFA 1UWVA 5DX1A 2QY6A 3EVGA 5ICCA 1EG2A 3R3HA 4PYOA 2PXAA 2AR0A 4WXHA 3CJQA 3PTAA 4KVZA 2JHCA 2ZFUA 4FSXA 3LCVB 1G60A 1I9GA 2R6ZA 3C3PA 2PWYA 2ZWVA 3FPFA 4IV8A 2P8JA 4QTUB 5FQOA 1M6EX 4AZWA 5DLYA 2BR4A 1RJEA 2P7IA 4P7KA 3RIEA 3TR6A 1IY9A 5M5BA 5EEHA 5DTRA 1AV6A 1X1BA 2H11A 3HCAA 2NXJA 1SG9A 3KHKA 5E9WA 5E1BA 1P39A 4DA4A 5T67A 1H1DA 5G02A 3UWPA 2PWPA 1U2ZA 3FRHA 2FYTA 3NWEA 3OU6A 5BW5A 2HTEA 2IBSA 2ERCA 2AOXA 1XDUA 3DR5A 5FTWA 2IGTA 4HG2A 5K0NA 5LQKA 2PXXA 2PX2A 2AOTB 1BHJA 1I4WA 3GJYA 2YXEA 3EVZA 3TRKA 3BT7A 1ORHA 2G70A 3E7PA 3MB5A 5FCDA 4OQEA 3G5LA 3UJCA 3THRA 4U7TB 1FJXA 3G2OA 4GBED 4YV2A 4M37A 8MHTA 2C7QA 3EVCA 3VC2A 3EGEA 3PVCA 1QAOA 2OYRA 4C07A 3BWCA 3SSMA 2AOTA 3G2MA 4QDJA 5ERGB 3EEOA 2IP2A 3KKZA 3P8ZA 4GUAA 2VDVE 4OBXA 5HIIA 4CTKA 4GC9A 3C6MA 2JHAA 5HIKA 4Z2YA 3B3JA 5E8RA 3THSA 2NXCA 1XTPA 3UJ8A 2A14A 2AOWA 4GOND 1D2GA 2GA9A 3MTEA 3KQOA 5EEGA 1Z3CA 3LL7A 3O31A 4M7RA 4E2XA 2JH8A 2ZIEA 1R00A 1R18A 3DH0A 5BW4A 1JG2A 2Y1WA 3KQVA 1SQGA 4PCAA 4X41A 3TFWA 3TKYA 1JQDA 3QV2A 3KR1A 2FPOA 2O06A 4ISCA 4P7GA 3EPPA 4C06A 4ER0A 4E33A 4DZRA 4RWZA 1NV9A 3CJTA 3R6TA 5DM4A 5DX8A 3FTFA 4YMHA 3OCJA 2C7OA 3ERCA 1R74A 3FTEA 3NDJA 3OZSA 5LR6A 5LQRA 4KIFA 2C7RA 1NW5A 4F86A 4P7FA 3T7RA 4IWNA 5JUWA 4PYKA 4DMGA 5IKMA 5CVEA 1F38A 2ONYA 2QE6A 1X1DA 1XCLA 3GO4A 3GRZA 3P2IA 4R05A 5K0LA 5T64A 4MQ4A 1RI4A 4R8RA 3DXYA 3DP7A 3FUTA 3R24A 2GS9A 3MGGA 3NWBA 1QYRA 1FBNA 3OE4A 3DLCA 3FUXA 3GNLA 4GC5A 3X0DA 4EK9A 1NT2A 3HVHA 2BH2A 2IPXA 2IFTA 4HH4A 5D1HA 3RW9A 4O29A 3TMAA 3LKDA 1B42A 3EVFA 1KR5A 1QANA 3GRYA 3LHDA 5JR3A 1VPTA 3EVAA 3P97A 2Z6AA 4R8SA 5BP7A 1G38A 3UJBA 2N47A 3IHTA 4BLWA 4RTKA 2VZ9A 5K09A 3G2QA 2PKWA 5H02A 2CL5A 1AQIA 2EJTA 3JWIA 2GLUA 3SVZA 4ER3A 5LQUA 1WS6A 3CBGA 3IV6A 2PX4A 4CKEA 3HA7A 1L9KA 4RTRA 4YUZA 1JQEA 2PY6A 1R8YA 4ATNA 4RTMA 3MHTA 3HVIA 5DRYA 1XDSA 4E2ZA 3AJDA 3P71T 1RI3A 3Q87B 2HWKA 1KPGA 2BR5A 3GWZA 1KPHA 3HTXA 1T43A 4XUDA 5MHTA 3EVDA 2F8LA 1NBHA 3HA3A 3GCZA 1VL5A 1NE2A 4AZTA 4C05A 5K05A 2G71A 1WXWA 2YQZA 5CCXA 2P7HA 3FUWA 3I9FA 5K0EA 3CC8A 2OO3A 1YF3A 3KR2A 5DT2A 4AZVA 1TW2A 3TQSA 4P7JA 4PCLA 3UA4A 5CVUA 3LCUA 3LSTA 5EZQA 5E9JA 5EQJB 4RYLA 5F2NA 1NV8A 3PFHA 3HCBA 1X1AA 2ZVJA 3A25A 2IH5A 5LQNA 3PX2A 3KQPA 3JWJA 1F3LA 3P2KA 3GU3A 3L8DA 2OZVA 2NNWB 3BUSA 5EHGA 3QOWA 5LQAA 5CVJA 3BZBA 2OY0A 3UJ6A 2O05A 3G5TA 1L3IA 1L3CA 1VQ1A 2YR0A 3O7WA 1G8SA 2XBMA 3OU7A 1VP3A 3UJAA 3DUWA 2ESRA 3NDIA 1FP2A 4GF5A 4QDKA 2PX8A 1KP9A 2B25A 3T7TA 3U81A 4XUEA 4IV0A 4CWAA 2PVCA 2H00A 3A7EA 3C6KA 1P1BA 3PT9A 1L3BA 3KQSA 2BZGA 4LG1A 4KDRA 4P58A 1D2CA 5C9ZA 2B9EA 5C1IA 3KR9A 5GINE 5IH3A 5HZMA 2B2CA 4PYLA 3OZRA 5E9QA 4PGGA 1VBFA 3HVJA 3R0QA 2K4MA 5GP1A 5EMLA 4BLVA 2OBFA 1JSXA 3KPVA 3M6VA 4HSGA 3FUUA 3EVBA 5CD1A 4QQKA 3WSTA 4DQ0A 3K0BA 3QOXA 5KQSA 2CWWA 2OKCA 4RVGA 1BC5A 1UFKA 4OA5A 5FUBA 5F2OA 1O9GA 10MHA 3FTDA 4WVLA 4PINA 5CVDA 4PNEA 4YUVA 1INLA 3C0KA 3G8BA 1EAMA 3FPHA 1G8AA 2CMGA 4QVGA 5EMKA 5E1OA 3DLIA 5EPEA 2P40A 3LBFA 3BKXA 4X60A 3G89A 4MTLA 5B1SA 3ELUA 3DMFA 3OE5A 1R8XA 3G7UA 2B3TA 5HIJA 2YVLA 3JWGA 3ER9A 2ZZMA 2P3QA 4GOMD 1EQAA 4RTQA 3EGIA 3LCCA 3OU2A 1IXKA 4PIPA 3G2PA 4HGZA 4YV1A 3BWMA 3MAGA 5EC8A 3ORHA 3BKWA 4MWZA 4G56A 3NJRA 1M6YA 3M4XA 4RVFA 4EQZA 4HTFA 4QVKA 1AF7A 1XVAA 4KIGA 4LWPA 4RTNA 1O9HA 5EIWA 3HCEA 1TW3A 3B89A 4DCGA 1RI2A 3DMHA 5KQRA 2ZW9A 2PT9A 1X19A 5D1NA
chains in the Genus database with same CATH superfamily
2V97A 1FDIA 5F9HA 4G9EA 4MEAA 1ULZA 3M70A 1R4MA 1RWKA 3JRXA 3PL1A 2C3UA 3AM5A 2OBNA 2UUBB 1HXHA 1JWLA 1J9GA 2IY7A 3D4IA 2DH5A 1LUAA 1WVIA 2Q5CA 1Z17A 2WKWA 1GA6A 3CISA 4JLOA 1MO5A 2PMEA 3UGKA 4EQ6A 2F3QA 2BP7B 3K9WA 3MUFA 1GNVA 4BNVA 1MO2A 3EFOA 2XDQB 3K6JA 4G1VA 1GPAA 2PJRA 3L6OO 3R8XA 3ZY5A 3FNIA 4OXNA 4LXYA 3DMTA 1HDGO 1IUKA 2GR9A 4LE2A 3HBAA 1H2FA 1PG5A 1B2RA 5DLQC 1UZUA 4AJ9A 4H1TA 2ZE5A 4KNYA 3BDIA 1WF3A 3F46A 5JS7A 1F7UA 1WQ1R 1W7AA 4Y1GA 2VNSA 2P35A 4RIFA 3H5OA 1EWVA 3LLVA 4BMOB 1Q22A 5H68A 3QVUA 2OMKA 4B47A 5G3YA 3AUKA 2DCUA 4DHEA 3O95A 4H4CA 4H2DA 4Y9UA 4U00A 1DNPA 3ZGVA 3D0RA 1X9GA 3IOCA 3NC0C 4RORA 4YVFA 4RJIA 3RTBA 3VR2D 3AUYA 3QVXA 3ESCA 2J6BA 1D4AA 2HD4A 2JLWA 2RH5A 2AQHA 3U3ZA 5ECDA 2HDWA 3S3TA 4ASUD 1KJZA 4YJHB 2W6ZA 4ZMSA 2VK4A 4QUBA 4NAHA 2IU3A 3S70A 3ZBUA 4CMEC 3T4UA 2PS3A 1K5DA 3M2TA 1PSDA 2OUIA 2VBIA 4CCYB 4D0RA 1SVKA 1IBCA 2OESA 4JHXA 3GLHB 1TVEA 2IJGX 3O38A 5FWXB 2QE7A 4RA9B 1JILA 1VCOA 1PNVA 3L7JA 3WA6A 3NHJA 1OASA 3AETB 2OXFA 1N2BA 3IB6A 2JGDA 1U2RA 2RI1A 4YJHA 2AXQA 3WK5A 5JO0A 2RE8A 4DKJA 3ANXA 4BECA 2CBZA 3RU2A 3TD2A 3HN6A 3JQ6A 3JVDA 3GGGA 1T2FA 2Q5HA 3K16A 2QT0A 4QTZA 4AFNA 5B6IA 2PJUA 3S2IA 3GLHA 1P74A 3VYSB 1NN1A 2DKOA 1Z4JA 2FTKE 2FZ5A 2Z09A 2ZR9A 3ZQJA 4BKUA 5LSAA 4G5HA 1KNQA 4CJXA 1NULA 2W6CX 4HVTA 1HNZB 4G8DA 1WCV1 3MRVA 4PXAA 3HKCA 3PC8A 4XVRA 4BO9A 3G8YA 4UTXA 1Z34A 2V4MA 4MVJG 1FFAA 4PY2A 2OYCA 2O57A 1VFNA 2Y4OA 3TW4A 3NV7A 1WB5A 4Q12A 4Q7EA 4JLAA 1BDIA 3VH3A 3R3UA 4YJDA 4XLLA 2EARA 3RU9A 3U6KA 3B7GA 2WJPA 1LU9A 3DBIA 1SIBE 1WXXA 2JFOA 2CVZA 4ZO4A 2WAMA 3GD7A 3KZXA 2YFQA 3TQCA 5A4FS 3WLMA 3GUCA 3ZDEA 4D92A 4OXQA 3ROZA 1XQVA 3ZY2A 4RKRA 3IUNA 4X8HA 1XXHB 2P9EA 5KC9A 5DOVA 4UQLA 3G2NA 9MHTA 3EMBA 2FDXA 1XR3A 3QFFA 4RVDA 5E38A 1QGAA 1EFKA 4TWJA 1LZKA 2GTIA 2XWQA 3O9MA 1Y82A 4CKCA 4HCJA 4JQYA 3JWPA 2YVAA 3W8EA 4MNTA 4P0QB 1EHCA 3L0PA 2AR9A 2PAFA 5CDYA 1R0LA 2WJYA 4KBGA 1UPUA 1R0SA 4W9MC 3KQTA 2BKUA 5JH7B 1CS4C 4KKVA 4MV1A 1KJJA 4DDWA 2O3SA 1Z5UA 1PT9A 3JY6A 2IYPA 1SZDA 3DWFA 4MZXA 1ZJ5A 3ADOA 2E48A 4MPTA 2CJYA 3F3MA 2OD2A 1T9GS 3W5HA 4DBLC 1SH7A 4Y30A 1JS1X 2C99A 1VMAA 1CUHA 3CCBA 1ZGHA 3TM4A 1JIIA 4NF2A 1Z0SA 2PKQO 3MNFA 1BFUA 1BWSA 3RVLA 1W5BA 3PCTA 4G86A 4BN0A 1ZN9A 1KZHA 3EZLA 3MERA 4NFSA 3CM0A 2YXLA 4BYMA 1QPZA 2CMHA 4J76A 3SOPA 3PNBA 1GAJA 1M2JA 3M33A 3J7AC 1KOFA 3MF4A 1GAWA 2JAQA 3EAQA 4OYLA 4Q4JB 1ZBQA 4BPRA 1QTQA 1UPCA 3TF5A 1DTSA 1NKVA 1ZWKA 4NR0A 3S99A 3PNQA 2IDJA 1ZIXA 2AEEA 1RZVA 4FFPA 2E5LB 4J0FA 4HPXB 3LT5A 2I6GA 1N75A 4PO9A 2WTXA 2IOQA 1BJRE 1J8YF 3JYQA 1CDOA 2EKDA 4IRUB 4RS3A 5TSDA 1DEOA 1DGQA 1OBFO 5LP6B 2AN9A 3H0CA 3FZGA 4TQUS 2IYRA 1R2QA 3NT4A 4WY2A 5K4AA 5HXAA 1F7VA 3EG9B 4JJAA 1SXJA 3H5VA 4A7PA 1XYVA 4E4TA 5LXTB 3RT7A 2R5NA 3JX9A 5BN3B 4CT5A 5CMLA 1L7XA 4PAQA 2AOUB 6NULA 2ZUTA 1J49A 1CRQA 1UC5B 2VK8A 3FYDA 3ILXA 4YR7A 3SS9X 1YOBA 5EWLA 3LECA 2D54A 3QPCA 4OJNA 1FVXA 2JLUA 4UTVA 4E3WA 4UREA 2AE1A 2AOVA 3OX2A 5GV7A 3TNLA 2BH2A 1MAWA 2C58A 4ZJUA 3HO6A 4B6JA 4JI4B 5LXTA 2WU8A 4XTCS 3E15A 1QE5A 4FOLA 5BN3A 3B1YA 3ZGLA 2HZBA 2BMWA 1ULAA 2LIPA 3SSNA 4DY6A 2JIPA 1ZA1A 2QM0A 1EA7A 4OF4A 1EVQA 3VDXA 4X61A 1FQKA 5K8VA 4L50A 1YRLA 5SZHB 5CA1F 4MUKA 4O3FA 4HDQB 1DFHA 2PXCA 4WOCA 3HWSA 5TS2A 5IUKC 2OV6A 1P17A 1T1SA 2EJVA 2JZOA 3A6EA 2WW8A 3F6YA 4WXYB 1N2IA 1U3UA 2QTBA 4GZ5A 2ZJ2A 5AJYA 1NUAA 2PMFA 4OGGA 5EPUA 3SZOA 1K7FB 2UZIR 2P9JA 3RS9A 3ZBQA 3GUYA 4WK4B 3CKKA 2IHYA 5C5IA 3P9QA 3VNVA 4JH0A 3PYLA 1VYHA 1A5AB 1BH6A 3DBLB 3OJFA 5ICCA 1YHZA 3LUCA 1EG2A 3NUGA 3OWHA 2AMYA 2C5LA 1HYHA 4KPGA 4C89A 3CJQA 3PTAA 1T2AA 2ZIWB 2XWJI 3IUYA 3CLRC 2GM4A 4DARA 2P30A 5CG2A 5ADVA 1IDN1 1KE2A 4F2DA 3T12A 2QU8A 2ZWVA 3VA7A 2I4NA 4QTUB 3HO1A 1J8QA 1MX1A 2OOSA 3UCFA 1KY2A 5CFOA 4YMWA 4X1IA 1UINA 1ZI8A 3U7EB 2ZAOA 2DQKA 5HZHA 3AHJA 4O4HF 2ZB4A 3NBZC 3ZWNA 3HLTA 3BD9A 5DMHA 3A2NA 4HRYA 4M60A 5CX4A 3ZQ4A 1AKEA 2I2BA 5JNLA 2AOXA 1JHVA 1GPWB 4UOZA 2YQ5A 4AJOA 3N39C 1JU4A 2HC9A 4QJ5A 2G1JA 4JOCA 3DVSX 2AOTB 2D5BA 3HK2A 1I4WA 2AK3A 6Q21A 2VHZA 2ZSIA 1Z4MA 3LRXA 4IQ0A 4Y9DA 1E20A 5DYYA 5TVKA 4CMIA 4ITUA 5HDQA 3I9LA 4KTVE 5BSGA 4ZYZA 4B85A 5KVSA 1UK8A 1QYVA 3MS4A 3NEPX 4OHXA 3M1LA 3Q40A 3HACA 4M37A 1WL8A 1OLSA 2V8OA 3GROA 1RW4A 4NENB 4ZGWA 5CYFA 5TF0A 3T9CA 1PJ8A 5JTUA 2C4KA 4TYPA 3GCGA 3PE3A 2IV3A 3RADC 2AOTA 4JT8A 5ERGB 1M75A 3C45A 3K05A 2FHSA 1TUGA 2QN6A 3ZDYB 5I6DA 4PPFA 1DBPA 3BHJA 3M3HA 5B1EA 1JDJA 3HYSA 3LWNA 5JSYA 5FNVF 1YCFA 1N2CE 2AK2A 1KQGA 2H2GA 4P84A 1FDVA 4LRXA 4Z7NB 1Z62A 4PRZA 5HJ7A 2IYEA 2NZ8A 4NENA 1QVAA 4LC0A 3MWDA 4OL0A 1KK0A 4D3YA 4XWAA 3W2EA 1OTHA 2GA9A 2DKNA 3EOZA 2BV3A 3OT4A 2ECOA 3O8OA 3F0TA 3LHSA 4F2PA 4KZKA 1RQGA 5DYGA 4XD7A 2W2LD 3SG0A 4PRKA 3TIIA 3BHNA 4M9SA 4N7JA 1IN4A 1M67A 4XX0A 1SU6A 3GLGE 1NBWB 1ZH6A 4D44A 3CUVA 4FBMA 2IEGA 4I9UA 5AH0A 1T0BA 3NLLA 4BX2A 1Y1KE 5FTMA 3JQAB 4K8RB 4LYYA 5IAKA 3FPCA 3GY0A 3KKLA 3GBSA 5DJ5A 5C46F 4J91A 3L1VA 1T2VA 1WNFA 1IZZA 1DJOA 1DKLA 5JO9A 2R1VB 5JSHA 3HJAA 3D6TB 1EQ2A 1RXWA 3E3OA 3BXGA 1P5FA 4HQ6A 4WZBB 1F2UA 3ABOB 4CN9A 2XODA 5AW6A 3RAGA 4MQ4A 3H4MA 1FVHA 1Z8NA 2DBQA 4S1WA 3F5FA 1ID8A 5G3ZA 5I4IA 1V8BA 4ZZIA 4ALIA 4AUEA 4BWVA 2DHRA 4U7JA 2XNDA 1P0FA 4X84A 3V2GA 8LDHA 1YXMA 3CRW1 2R8PA 3P9SA 1PQUA 1QH8B 4O29A 3L8HA 5C4GB 3VHXB 2H06A 3CEPB 4BEWA 3K6SB 5A4DA 2IS6A 2XOKA 4J7XA 1BXZA 4PTLA 2Q1UA 1S8FA 5IEBA 1T29A 1TJ3A 2QTZA 2QD4A 4J4TA 1Y6ZA 2ZAGA 1GTSA 1HE1C 4U7WA 3DOOA 2VT6A 2WTBA 3FD8A 2YY5A 3MSXA 1M1YE 2OCLA 4HAVA 4O59O 3S55A 1EK6A 5KNBH 4Z4IA 2O8CB 4LRYA 1CCWA 1WS6A 1ZMOA 2GD2A 2UUPA 3AHCA 3H97A 4CDGA 2FEOA 3I04A 1QH8A 1J1UA 3K6SA 1GCUA 1RJ9B 2RCYA 3QLVC 4E11A 3AJDA 5LN1A 5DGDA 1QPBA 3SPXA 1T43A 3IUMA 4TV8B 4Y6OA 4XJXA 1QRRA 1SC9A 1Z07A 3K0AA 3NHKA 3T1NA 4YJ2A 5CTJA 2OORA 3RB8A 3CZ5A 3V3KA 1L7QA 2CYBA 2RHJA 3EWIA 4KNVA 2M6KA 3UTDA 4YAKA 5HRCA 3M2PA 1P9WA 5K8TA 1H8ED 4ENUA 1L4NA 5WRFA 2QGNA 5TXGA 4C5BA 1U1GA 1DIHA 2V6IA 3DHEA 4D3SA 4RBNA 1RWBA 3GGOA 5EUBA 1OLUB 3N8NA 4TV8A 4C78A 1IEQA 3PFHA 2AG6A 2OFOA 3L0BA 1PT6A 2Q5OA 1BXRB 1RT9A 4FCVA 5GZ6A 3PX2A 4JL8A 2O2GA 4RGBA 3MWGA 4YPFA 3LCMA 3GCXA 2NNWB 3BUSA 3GVCA 2P0EA 4MYDA 5LYYA 3TPFA 5GTDA 5JYDA 2J85A 1STOA 2RGGA 1TD1A 2A9PA 3AR2A 4ZI7A 2C0CA 2WIAA 2V7QA 4BMSA 3AF6A 4GZLA 1VP3A 1MVNA 1KP9A 1IC6A 2BFOA 4Q39A 4QWWA 1LNQA 2B92A 3PC4A 4Z0TA 2GM9A 4KDRA 3DMTC 3ZHSA 3ABZA 4WSOA 1IXYA 2FFAA 1LDNA 2FZLA 4KRYA 1RZ3A 2R5WA 3A6FA 3KOOA 4KBFA 5FLYA 3W34A 2XCSB 1PFUA 3CF6R 1LQ2A 1SZPA 3WYCA 2H8GA 3OJWA 2ZS7A 1CP3A 1U3FA 5CD1A 1P2DA 1Z7BA 3HB5X 2C94A 3F6BX 1HZJA 4ND5A 2L0XA 5KQSA 5THKA 3ZYZA 1VPDA 4YDSA 1RBYA 4LBVA 2R48A 4C5CA 1UFKA 4L5CA 4D9IA 5KYTA 1A95A 1ZJJA 1FXWA 1GQQA 1SEVA 4F3YA 5FPHA 2AGVA 2EHJA 3JD1A 4IV5A 4CLRA 10MHA 4HNQA 3AR4A 3O3CA 1IVYA 1C3JA 1UKZA 3AY6A 4LI3X 3GT0A 4DCCA 2X77A 4G5XA 4X5OA 4ZREA 1TM4E 4AJ4A 3ZE9A 4Z4FA 3F96A 3W5JA 5A5EA 3FOEC 1R0YA 1VCNA 5LBIA 2PZJA 4X60A 4EHJA 1XZJA 2ZE8A 1PJAA 3G89A 2YJ6A 4YYEA 3C5HA 3NXSA 3WGKA 5REQB 1T9GR 1YZVA 3CZAA 1BGWA 2JGNA 1RTTA 4ZAWA 3UHPA 4GOMD 4O0LA 1OXSC 4MPJA 4W6ZA 3LLUA 2W48A 1C9NA 4D25A 4N0EA 4CDNA 4KGXA 3NRCA 1M6VB 1NU8A 2OKGA 3GJSA 2QVYX 4JXKA 4L4YA 3THOA 3ZS8A 2XZOA 2VCEA 2J31A 2WT4A 4G0PA 2YJTD 1C81A 2AC2A 5AR1A 2UXCB 3M4XA 3TJRA 4MQEB 4UNIA 3K0FA 1XVAA 5B58C 3SKXA 3WB1A 5F23A 3LUFA 4Q82A 3DZBA 1XL0A 5EIWA 4PLWA 4AZ3B 2O5EA 3BIOA 3MTQA 3GVHA 3ZHVA 4ZN6A 2GK3A 1U0GA 2Q6LA 2I71A 3KSDO 1MDBA 1XTQA 4IFTA 1SD1A 1H9CA 5D1NA 2ZJ0A 5K3CA 3I4LA 1M6VA 1XKTA 2VRBA 4FINA 4PV7A 2ZBUA 4D26A 4PO8A 3EZXA 1SU8A 3TTSA 4ZK2A 5HWSA 4MUXA 4EKYA 2PBFA 3IT3A 4NL4H 1HA3A 2OGUA 3C7TA 4MQEA 1G3UA 3B7PA 3PC8C 3RTEA 5JS8A 5FQNA 3MA0A 1GUYA 4N5HX 4NFLA 2FPSA 2JF0A 2X0FA 4TYWA 4F7DA 3DD5A 3OIWA 2NV2B 4B17A 2X0RA 4NCBA 4M22A 3U9SA 5SY4A 4NG5A 1X7YB 4UEJA 3D0QA 2LKDA 4I6JA 1HURA 4I0WB 2HXYA 3E4DA 4EOGA 2GFHA 1YMUA 2WUEA 4PSAA 4E6PA 5JZ9A 2UUAB 1NKTA 1E60A 2UXDB 2AJTA 7GPBA 3CT4A 4YMLA 1SXPA 1CUJA 2PRJA 3OZTA 4H1HA 4I9NA 1FYDA 3IHWA 3ADKA 4J8PA 3OP1A 7ADHA 4NPCA 3V8VA 3HU3A 3PEUA 1YZKA 2CE7A 5AYVA 1A2QA 2Q1YA 1RXUA 2JDIA 4WESA 2UYCA 1IM8A 5HFJA 1QIMA 3LCRA 4BAZA 1RQPA 1R5BA 3NOXA 2DWUA 3P9YA 2VYND 3N59A 4FKMA 1YMVA 5E1DA 5LMZA 4JK3A 4DSAA 1L7AA 2O0JA 3DOHA 2VA9A 3DCIA 4V0QA 3AFOA 3PQ3A 4C88A 2H1RA 3LC0A 3QOFA 3VTFA 5DEIA 1QG2A 1WX1A 3NX4A 4P22A 4CVNA 4JBIA 3II6X 3BWXA 3PQFA 1SULA 2M9MA 4BQSA 4Q7QA 1UWLA 3M1YA 3ETGA 3LUDA 1T5BA 4UDNA 1YJBA 2OZLA 4AY4A 4HBZA 2YZ7A 3WIBA 4IH9A 1W52X 2PJDA 1GSHA 1WR8A 2NVWA 3B38A 3FTNA 1YCGA 3JALB 4C4SA 1Q20A 2BISA 2IUFA 2XITA 3MTIA 3H65A 4JGIA 4HK4A 2QOEA 3T9DA 2II6A 1U7WA 4P53A 4XUGB 4JGGA 4WK6A 2X0EA 3BRCA 4FZVA 4MKHA 2P2CA 2P9BA 4QO7A 4AP5A 3TVTA 5JNUA 5F7ZA 1AKQA 1H2AS 3JD0A 3KFVA 1P1RA 1JZTA 3QF4B 4J9VA 3TAXA 1K8ZB 2PSJA 2V3VA 2ZJ4A 1T8RA 3K70B 1H8HA 4PZEA 4N7BA 4OO3A 1VECA 1LS6A 5HS6A 1OT5A 4BNKA 3DL4A 3O82A 4LYDA 3UJ9A 3FOCA 3RIMA 3FMGA 3QXJA 4DR7B 2O7SA 4KGDA 1WZ2A 3QJ5A 4AAYA 4ESHA 2PRIA 1CETA 2R2AA 4AMGA 5E2BA 3EMKA 3RYIB 2XA9A 1FLAA 3FPGA 4OFBA 2H08A 1RQXA 1HYBA 2QTVA 4P9NA 3VJMA 3BIXA 4BIIA 1UJ2A 2CDCA 2IW3A 3DXFA 4R6WA 4WERA 3TQFA 4E1BA 4PS0A 1SVSA 3SMQA 2VP0A 3EGDB 3AFHA 2JEZA 1QWSA 1U3VA 3G0HA 2GYYA 4Q05A 1SXJC 3UMCA 1UIRA 2JI4A 1AU9A 5FWNA 1WKBA 1K9VF 3GC6A 3KVVA 3GCWA 3ND7A 3E23A 4OHMA 4JQSA 1QUFA 3TSYA 4CMCA 3VO1A 4Z1MD 5A4AA 1QG0A 4UXJA 2QMOA 2RGDA 4J1NA 3EE6A 5JD5A 1FQOA 1Z0ZA 2IHBA 4KN5A 4DUZB 1U8YA 1WDMA 4G09A 3RS7A 3A27A 1PHRA 5HR5A 3O8BA 2I3GA 1KDOA 5ENVA 4RK0A 4CHTA 3HFRA 3T4XA 4R3WA 3FFAA 2HFKA 3RFVA 3ZIAA 5A71A 3Q1LA 1U28C 4GI7A 2R00A 2X8BA 4KEAA 1JLSA 4AYTA 3BA1A 3KVRA 5BNFA 3ZDRA 2O14A 2BVNA 1DDOA 3NBQA 3R3SA 4JLWA 4K3VA 4B4UA 3LV8A 4C4TA 3RJMA 1YBMA 2I1QA 4EF5A 1DJLA 2YWFA 3L49A 5K0SA 3F4KA 3MGKA 4IG9A 2AI2A 2OECA 1LX6A 4MB2A 1FMCA 1JX6A 3PE6A 1XZEA 1O4WA 2KBEA 1KZ9A 3OY7A 1TRKA 4MR9A 3FGPA 3QKRA 4YRFA 3UMGA 1W0JD 4L9SA 3ORSA 2XYRA 3T1TA 4DIBA 4MHTA 5INTA 1GPDG 1PJLA 1J39A 1MB4A 3NUZA 1H05A 3UW3A 4DF3A 2Y3IA 2FQQA 2M98A 2FUG1 2GFIA 2NOAA 1EEHA 4WLOA 4X3CA 2Y0CA 1X1CA 1P4JA 2YOFA 4JZKA 3KC2A 5EXDA 2ZEJA 1F5SA 1XTUA 4MOWA 1IJFA 4IFEA 2PQ0A 4RAOA 1S6YA 4XRGA 2Z9DA 5EXPA 1DLIA 2VTBB 1ZGBA 4P3OA 1X86B 5LLDA 1C8KA 5ETJA 1XROA 1BYUA 1Y98A 3H11B 3JQFA 1ZD9A 3CZ9A 9GPBA 4HEQA 4KUEA 1T9AA 1KQ3A 2WU0A 4NC9A 5BQ5A 3A26A 2D0PB 5K6RA 1Y1QA 2DQSA 1SK9A 1XTKA 5LBTA 3WP1B 5IULC 3HSSA 4F6LA 1HNNA 4CG2A 1CNFA 4GNRA 4NMLA 1U8XX 4Z86A 5BSMA 1XK7A 4UU7A 2AT1A 1BQ3A 3LQYA 4UBMA 5T4EA 1ZUNB 1KJ9A 1M2NA 3MEQA 1NI5A 4LSMA 5JS1A 3N8KA 1SXIA 4TTJA 3H11A 2OHGA 3PJDA 4MWGA 4QM7A 1CQJB 3UN1A 1N0IA 3C4VA 1N3LA 2BY4A 5CNJA 1JJ7A 3UHFA 4YUYA 5IJZA 1NUSA 3ELDA 2P91A 4UULA 3FWHA 4YASA 5DCYA 5HCNA 3WQSB 5C5CA 1QSGA 2BF7A 5H70A 2MSCB 5B1YA 3HB9A 2YNMA 3BYZA 4Z7QB 1NMEA 2VJLA 3HNRA 1HZZC 3W9SA 4RHUA 4D99A 1ORVA 3O74A 3OEWA 1CQJA 1S3GA 5KOHA 5BR7A 1Z18A 4NZPA 2P9GA 1QMPA 3W9BA 4BASA 3AF2A 1SKAA 2X19A 1V16B 1SCJA 3N7UA 3FB1A 5KZMB 1BOFA 3QKIA 1SM4A 2QSYA 1ZPDA 2RHCA 3H4VA 3NS7A 3L4JA 2X8JA 2KSQA 3GUHA 3WC4A 4ZPXA 3FCAA 4RYDA 4V0RA 4XGKA 3TXAA 4FFOA 3ZHYA 4C7BA 5U9CA 1QJ4A 2A0YA 2MSNA 4B40A 1TLFA 1NY5A 2HIGA 1E9CA 1TF2A 1KFCB 2V6MA 1XRRA 3GEMA 3PGJA 4NCKA 4RPLA 1THZA 1AG9A 5BOSB 4A6DA 1G7SA 3OCYA 2W22A 1L5VA 2WJHA 1GZSA 3V1MA 5GIPE 5T3YA 3T1VA 1UWVA 4QEZA 3INTA 2Q2OA 3MINA 4DAEA 2R11A 1C5KA 4KVZA 2XYHA 3G82C 3AB8A 1VJ5A 4EHLA 5FDFA 4QOJA 5J63A 3QWIA 5BOSA 1QGUB 1JEEA 3RG8A 3EUEA 1FXSA 1XJQA 4RZ3A 1M6EX 2BFCA 3N2IA 1F9AA 3TR6A 5BXQC 3NAMA 1G9XA 5JMPA 2L19A 2WAAA 1SIWA 3IR7A 4DJDC 3T9AA 3PF8A 3R44A 1IZ7A 4CKZA 1P39A 5TVGA 5T67A 4O08A 4DA4A 1L5ZA 1U8FO 2PWPA 2O23A 1F8GA 4LXHA 3U26A 3VO2A 3GYGA 3SKVA 3CZQA 1Z4OA 2D8MA 3WMXA 3C74A 1QXSA 2AC7A 3KOUA 4OLAA 2EP8A 5CT5A 2I6SA 1G20B 1TTHA 1BHJA 2FUEA 4BNFA 2D5LA 1BEEA 1N1EA 3UHAA 4BC1A 3TRKA 3OAAD 2MYTA 5L3SA 4NRDA 5IM5A 1TM3E 4OATA 4Z4GA 4BX8A 3EIXA 4IDEA 1E2IA 2PUFA 2MIIA 5CLQA 1BEZA 5JCJD 1SC3A 1TF5A 3INGA 4JSTA 2C7QA 5M7EA 2OORC 3L6RA 2P4QA 1UKBA 1N6NA 1G20A 1HLFA 3C97A 1AQYA 3F4BA 3I8SA 4QDJA 5AJTA 1E1RD 1LJLA 2C83A 1VIAA 1L5RA 1KNXA 1OC2A 3N0VA 2NVBA 5T6MA 2W6PA 1W2GA 2PQMA 1XTRA 3B52X 3ZXSA 2PWZA 5JD3A 1ZM7A 2QTCA 3TLXA 4NK4A 4ARZB 1R10A 1DHRA 5GV8A 4B6RA 1QQ6A 3FHLA 3FKSD 5BUCA 2ATXA 4RH3A 1MIOB 2CGEA 4EW3A 4TLBA 4CEIB 3EZFA 1EK5A 4PAMA 4YDRA 1MOPA 1T2NA 2JH8A 3Q5DA 2GN4A 4LHZA 4U0JA 1EESA 1DWUA 2FX3A 2FQ1A 1R00A 3OOYA 4Q1DA 2GWRA 3U17A 4FDMA 3VR4D 2AEJA 1SQGA 2PKCA 1V47A 2QP4A 5H59A 3UTCA 1ECPA 2FFRA 3PQ5A 1W5EA 3QV2A 2ZUUA 4IO0A 4RKYA 4KPFC 4A0GA 4ARZA 5LWQA 1F17A 3EPPA 5KVVA 1FYWA 1TRHA 2JAWA 1KI9A 3MWKA 3QKSA 2Q1WA 1MXHA 3R4CA 5H80A 3NEJA 2XCLA 1VXRA 1RZRD 3OPYB 4F2WA 4Q21A 4QEDA 1KR2A 3OFNA 5KCZA 4C0BA 1M74A 1K3FA 4NJOA 3WO1A 4DUGA 3V7WA 5HDBB 1PEAA 4P7FA 4RESA 5DO9A 4F3CA 2VP5A 1KMMA 4P3XA 2V0GA 2DECA 3M4ZA 5AVSA 1TLTA 3OKAA 1GPBA 5T64A 2E21A 2A5LA 4AKSA 2IKSA 1GRQA 4YP5A 1A5BB 1J90A 5B1DA 4JVSB 2DRIA 5T5QA 2XRYA 3WLSA 4ABYA 3R24A 5CFQA 3JQQA 4CIXA 3SJ7A 4WXPA 3DLCA 3UV3A 3A6JA 4MH0R 3BRWA 4AN1A 2QV0A 2OGZA 1XELA 1N4DA 2P2LA 4NZYA 4LOKA 3GK3A 2OV2A 1Y7IA 1IXRC 3KOXA 2CMFA 4XE5A 3WDSA 1HR0B 4CM8A 1QBKC 1F14A 5M2QA 3BMOA 1X7WB 5CJ2A 4W8HA 4AJ2A 2IU4A 3FVQA 2PKWA 2FWIA 4QATA 1BJTA 6YASA 1OB2A 2CMKA 2NSYA 4L7QA 1EFVA 5C1OA 1C7FA 5CURA 1QKJA 2OCYC 4B74A 4YUZA 4HZGA 4YRPA 4M6WB 3TD6A 3BD8A 1VHJA 2APJA 1XDSA 3H5NA 2QG6A 3Q87B 1VM6A 3GP8A 3N5CA 3QV1A 1C2TA 1HYQA 2B1GA 5FOTA 4HWPA 4C6SA 5IC4A 1ZLXA 1X7WA 4ZAGA 2UDPA 5I9TA 2V9PA 4J1SA 4ZRDA 4YI5A 2VZEA 4IQ4A 2PO7A 3QKWA 4KHZA 2ZIVB 5AK5A 2P7HA 4EHDA 4GWGA 1FTSA 2VPZA 3DM5A 3TTWA 5JFGA 1KMCA 1EG7A 1DT3A 4OHUA 1RKXA 1TW2A 4JR1A 2EQAA 2B69A 1YR1A 2GZSA 3FYUB 1FIUA 3PUWA 3KYJB 3CNOA 1Z82A 2BH9A 3GL9A 3LS2A 3OLYA 3R77A 1P0PA 4QEKA 3KT8A 3D6MA 2PO5A 5EXSA 4GAEA 5CVCA 1V37A 2GPAA 4BB5A 2OBXA 5EWMA 4DNPA 1ENPA 2HU8A 2JHFA 2SKCA 3B53X 4INPA 1WD7A 5SY6A 5FFFA 1CV2A 3U4DA 2CZGA 3ZKAA 3BT7A 3WQBA 1U8TA 1VTKA 3V1YA 2FQYA 4WH0A 1JQJC 2J8ZA 1C9YA 3FYUA 3OU7A 3L01A 2O0MA 5J59A 3OM9A 1NXSA 1RHRA 4XDGA 3RC1A 1U8AA 4XUEA 2C00A 2AR7A 2MYPA 3C4QA 3CH5A 3OUZA 4KFUA 3LP8A 3URMA 2X40A 4L15A 5CCBA 4LF6B 2YW2A 2DWOA 2B9EA 4OLJA 3FNEA 4YRGA 2AV6A 2EIHA 3NBMA 4R9NA 5K0TA 3ZVMA 2XVZA 2ZATA 3MAJA 4E14A 3IUJA 1YRHA 3D3JA 4FFBB 4H1VA 4I2VA 2Y6UA 5BNIA 5T4HA 2OBFA 1Y1PA 3M6VA 5JMTA 1Y4AE 4QM6A 5JD4A 4QULA 3TRDA 2XXBA 3ROTA 1TTPB 2XRFA 1AT1A 3DOCA 2NTJA 4LSGA 2CWWA 1W0KA 4JCOA 4UBKA 1FMTA 1PP4A 5IDQA 4BFSA 1BX3A 1FNBA 1KVSA 1A71A 2XUJA 1VG0B 4H4EA 5EPOA 5BWOA 4IGEA 4H9GA 1BTOA 4FFBA 1TJ4A 4KV9A 4MVJA 3C98A 2EP5A 3FPHA 2DYKA 1C50A 4KR9A 3CZMA 5E1OA 1CVRA 2X0NA 3AL0C 2VH2A 1MRSA 1U90A 1DOHA 1UMKA 1FBTA 2JJ1A 5DNUA 1EJBA 3NKLA 3GZTB 4TKVB 5KQLA 1IN6A 4OFXA 3OHMA 4KMRA 2MSKA 3ASYA 4BS9A 4BQNA 3PLNA 2IZ5A 2NU8A 1EGAA 3VDQA 3OU2A 3WLTA 4XVUA 1DQSA 4D57A 3A9VA 2QPAA 3IO5A 1E3SA 4OEHA 1TUEA 2A4MA 2P2SA 3TX2A 3N70A 4L3VA 5B2EA 5AVTA 1MVOA 4PLPA 4XIIA 2DSTA 1M6YA 2GF0A 2VN8A 2XRMA 1WMDA 2IYSA 2FPMA 3K1JA 3OZBA 1N2HA 2EFHB 3DEJA 4C4PA 4UTPA 3VU9A 1DPFA 2PGJA 1DZIA 1ZITA 1DRWA 1EWYA 4Z51A 1XZIA 2H8KA 4JI0B 1WCIA 2XHEA 2UZ1A 1AB6A 2ZW9A 2ZYAA 3LYLA 1EFDN 2YN0A 1J0DA 2IITA 1OFTA 3DE0X 4TN5A 1F60A 3PXCX 2FLVA 1ZIPA 2FZKA 4Y2YA 4CEJB 2I0FA 3IAS1 4ZCPA 2NUPA 5EXXA 2F9MA 3RGWS 3HEAA 4E03A 3WS7A 3EGVA 1GG2A 1F51E 2Q27A 4WCDA 3CF0A 3GA7A 3PQ8A 5ALKA 2JHGA 2HHHB 1B4DA 1I2CA 1Y9DA 1NR1A 2ECQA 4P32A 5DNDA 4XB1A 2O2IA 3K9GA 3W5VA 4ZOLF 1KPIA 5AO9A 3H9UA 4CEJA 5HM8A 2PKYX 3MMXA 3N2EA 2R1UA 3I58A 3N5KA 4EB6B 3TKAA 1ZP6A 2FR8A 2XXAB 1ZD5A 1WTAA 2Z30A 4TL6A 3PIDA 1QV9A 1PJSA 2D4HA 4CKWA 4JS0A 4CLEA 3NHYA 4ND1A 4WFJA 3I01M 3HUUA 3C3JA 4B4VA 5EJ6A 3PHJA 4OGKA 3RVDA 4V39A 4E2WA 4E32A 3RC8A 5JNWA 4YJGB 1BQ4A 1UADA 1VL2A 1ZH2A 2OWDA 2RH9B 4LZPA 5LQCA 5J2TF 4FTWA 4I4TB 4EB6A 4NCIA 2F17A 1RI5A 1YV9A 3KFXA 2R4QA 2ZQYA 5JEEA 2A92A 3ENZA 4P80A 5L40A 5JSKA 1VHLA 1SVWA 2R00C 4YN3A 1D1PA 4M1YA 4UXHA 4EPYA 5CBPB 1UMDA 1U4NA 5ELLA 1IPFA 1WCWA 2A9JA 1USVA 1ZYUA 1AV7A 4Y2UA 4BFLA 4Z54A 2ZETA 1U6IA 3H5AA 4ENSA 4YJGA 1VHDA 3ZHCA 4AF7A 4EFKA 2AMVA 1RABA 3WZ2A 2HV8A 5KX5B 2QLLA 3JTMA 4I4TA 1CP2A 1CF2O 5JXJA 4QRDA 2BMFA 1T6ZA 2J9XB 2OCXA 3K6RA 1WOYA 4G9BA 4TTSA 3HDGA 4XIGS 1GFWA 3ZWMA 4EJ2A 4QPDA 5CBPA 1X14A 3NIDB 1S9HA 3H2JA 2QK4A 2QRZA 2Y8EA 3ELWA 4E15A 4W1SA 3OSZA 5FR2A 2PMWB 4LFAB 3HCDA 1IJKA 1W4CA 3MN1A 3I2HA 1XRNA 5ALRA 3FZEA 4Y0AA 1SQ0A 3AKCA 3Q11A 5DNWA 1NX9A 2H4YA 1F5NA 3FZYA 1Y8RA 3T5GA 3KD3A 5HX7A 4FOOA 1O5IA 3ETCA 3H87A 3BTSA 1AA6A 5ECGC 4MUYA 1FRZA 2BEKA 2ZB3A 4AWBA 2B34A 3IX7A 2D7DA 4KQMA 2XUIA 3PWKA 5L7YA 2NU6B 3LNCA 1J07A 2H1HA 4X54A 3O90A 1AKTA 2OB2A 2XMGA 3O1HB 4IX9A 1W8DA 5KBYA 2VJCA 1GZVA 1Y34E 2CXHA 3Q3IA 3BGDA 2SKEA 1T1GA 3QRWA 3TPZA 2ACWA 3WGZA 1C9DB 3KZNA 3SF0A 2YS6A 1XLWA 3KTOA 3LUPA 5E4JA 5G0WA 3C4JA 4Z99A 4DIKA 3AWIA 3QLJA 3LUHA 1OGYA 1YC5A 2YJ3A 1S3FA 3EZNA 1HYEA 2BGLA 2Z1MA 3GVXA 4H7KA 1PTJA 1H2EA 2NU6A 2Q5FA 3M3DA 1MX9A 3BSFA 1C4WA 1W4LA 4DAOA 3AG6A 2VAXA 2I2WA 4R8MA 2ZRHA 5AKKA 1OAKA 4O02B 4D02A 3A9WA 2P75A 3QPAA 3ZU4A 4BWGA 3OEYA 1XMQB 3KXIA 1ZMRA 2R60A 3KEGA 1S2NA 2YNMC 4NULA 1NQAO 1CQIA 1FU8A 3SIRA 1O03A 3WWOA 5EJEA 4O0MA 1B3RA 4JENA 1KTVA 1TC2A 4MWBA 4QUKA 3ZDFA 4G1CA 3AKEA 4M0PA 2Z43A 4R4JA 5EKUA 5HIMA 3KTAB 4CM9A 2W98A 1K0FA 1QUEA 2I7XA 1K63A 4EPWA 5TNXA 1OZAA 1Q5PA 4J3FA 3VO9A 4RZSA 1WUYA 1YIAA 2GN0A 2O2XA 2WTNA 1G55A 1XNJA 3BIWA 3DO5A 4P4LA 4MW4A 1O0SA 5LZ2A 3WAGA 2C0PA 1SKMA 2BGIA 1GKUB 4EATA 5TC4A 1P72A 2ACVA 1C1XA 1NMSA 3K9LA 4M1SA 3DCNA 4FUQA 2XLBA 1GADO 4MUNA 3UJHA 2BM1A 4ID9A 2EDCA 3IEXA 3ZWXA 2V54A 2WQ7A 2NO6A 3KE9A 3KTAA 3W3AA 3GLHE 1NE7A 4GX2A 1UDAA 4JC0A 4WJLA 4FMDB 4R8LA 4GGPA 1X3SA 2HMYB 5D2CA 3HY4A 2QORA 5I7RA 1GWNA 1Q3KA 1T8WA 4LGVA 3ESZA 1LDYA 3FDZB 3HNOA 1UXKA 4FMBB 2VL7A 3NVAA 4IGAA 4TKUA 3QU2A 1EFPB 4HYTA 4RSRA 3QE2A 2UYQA 5AI5A 4EMUA 2O8DB 1E4YA 5HK8A 1Z4QA 3VYWA 3OPYI 1GRCA 4DE5A 1DO0A 3OIYA 3QA3E 2N1MA 1Q7CA 1G7CA 5IVIA 1KE1A 4EABA 3D3WA 4QGFA 5JAZA 2X9LA 1ADYA 4AZ0B 2IOFK 2UZ0A 3KJNA 4FOTA 4QPNA 4IMIB 4UBIA 4BP1A 2ZYTX 4CF3A 4DQUA 1F0KA 4YRQA 1UBLS 1YWGO 5LKAA 2YWGA 2WWYA 3EXEB 3HJHA 3S6JA 2O8DA 4HATA 3HR7A 1ZVQA 3R5HA 4WL0A 5JROA 1B41A 1KI7A 3U3JA 1QU3A 1T1IA 3L4KA 4N6GA 4FD2A 1YUBA 4M0MA 3N8DA 4NDAA 3FTPA 1LC0A 1SR8A 3HUDA 3VSBA 2WAYA 3AL3A 2HNKA 4P82A 4AZ0A 1YVDA 3LW7A 1WHSB 1ML3A 1JB1A 5FHQA 2ZBQA 4F4UA 3KETA 4HNSA 3RGGA 3GJTA 5F51A 1XRPA 2O0KA 3RKRA 3TOCA 4CCWA 2IIVA 1CLUA 4ARUA 2EF0A 3U1BA 2G0AA 2O5CA 3DOUA 2PYIA 2YV2A 4YP7A 4HUTA 4H0FA 4D9FA 3ZCUA 1XXHE 5H8WA 4XYMA 3L8GA 3LP5A 3SGLA 1RQ2A 2A33A 2X0IA 2IUEA 2M6RA 1PLKA 1WHSA 1AKVA 1QX3A 1OGIA 3AF5A 4WZAB 4B2PA 5AFSA 2W2NA 1G4HA 1YAHA 4K2AA 1KEPA 1SWWA 3TXYA 1JW9B 4O6VA 3TTUA 2WC1A 4M0LA 2VWQA 2WVHA 2PGAA 1KWKA 3GJQA 4A1FA 2VLBA 2EJCA 1KMNA 2GA8A 3D4PA 4PSKA 1DRKA 3R6GA 4XFJA 2B1JA 4TTRA 3SJZA 1T5LA 1R6VA 1WD5A 3WGHA 1ICEA 4JJGA 1ZN7A 4G24A 4G37A 4QU9A 3ESQA 1YK1A 4N12A 4GPAA 3PA8A 1IBRA 1JJFA 4OLFA 1NNI1 1Z45A 4FT2A 5A1JA 2G77B 4FYXA 3FUCA 2JCYA 3QVOA 4GPTA 4W9RA 2UUCB 3AV3A 1VSTA 4FHZA 3ZHBA 3C6BA 2Y0DA 4S04A 4B2YA 2H2IA 1ZSNA 1LK0A 2AQKA 2GCIA 4AECA 1E2DA 3R0JA 1J33A 3BD7A 3E81A 1SVMA 1Z6ZA 1Z7YA 1P18A 2EX0A 1HWYA 3SJUA 2ZBEA 4J7AA 5F3DA 2QZPA 3IILA 4K81B 2GXQA 2XBUA 1P0CA 4G8JA 3M5CA 2BEVA 4LSZA 5KYKA 3IAUA 4YB8A 1ZNWA 2FPXA 1LWOA 3E9CA 2ZXUA 4IKEA 1JXAA 2WKPA 3IBTA 3IIIA 5K4GA 2WVJA 1UIMA 5DGTA 5EJ9A 3B9QA 3KLNA 2H52A 2J3EA 4BMVA 1TJNA 3L40A 3L7LA 2YJ4A 1ECGA 3SQDA 3JQ8B 3PI7A 3A70A 1T4BA 1JR2A 1IN5A 1D0VA 1VPEA 2OHFA 4P98A 4DV5B 5DF1A 1JEQB 4H7PA 5KNCD 1ODIA 4G1EB 1E6UA 3ZV7A 3CVWA 4ANFA 1NQUA 4AS1A 3OZAA 2J41A 3GLVA 2JCBA 3N0RA 1VMIA 2CFSA 3PXBA 4G0XA 1TMGE 1TLLA 4HZUB 3ZBTA 3E22A 3IQXA 1MT3A 1E66A 1QO0A 1UCFA 1TZ2A 1MH9A 2IXDA 3LQQA 4FFLA 1NVWQ 2PZGA 2VP6A 2WB4A 2H7CA 3E2PA 4FYWA 4RMNA 4Q37A 3W6OA 3SX4A 1JEQA 2PUVA 3RRXA 3A6ZA 4NS4A 5IJWA 2C61A 4CQNA 4Q9LA 1JQ5A 4HZUA 4FB5A 4L8LA 4RDCA 1DBRA 1BXKA 4D9BA 1NJ1A 1R7RA 4CM1A 3G5AA 4CMBA 8MHTA 2WM9B 1YL6A 1WKVA 2FSVA 4KXQA 5LA6F 2Z95A 4YJ3B 4AJIA 3AEXA 1BNCA 3KB6A 4N6NA 1QFZA 4OBXA 3Q85A 1A4XA 3OQNA 2I54A 2ZYUX 2HLNA 4GI5A 1T5TA 3CUTA 3E0XA 4QUIA 3D6JA 1L7EA 4LXGA 1XZPA 1TX4B 2QJOA 2NXCA 3OPVA 4WJZA 2XR1A 3FW1A 1RSZA 4JUDX 4O2AB 1HG0A 4RZXA 1X7HA 4TRJA 2H0QA 4K9NA 3TZBA 1UMCB 4YJ3A 2V98A 4LISA 3OA0A 4KQ6A 4PX9A 4XSVA 1KZ7B 1RCTE 1W85B 3I6BA 5EKDA 1BJKA 4EJSB 3IAFA 4XSGA 2CUZA 4FHFA 3EHEA 3JS5A 3ZJ5A 3P2MA 3KR1A 2QNBA 1JQKA 1MJNA 3CVVA 2VDNB 5BWMA 3D9QX 1RFLA 3BB1A 2I4OA 3FF4A 3ESYA 2LV8A 3DEHA 1ZXLA 1W85A 4F86A 3AUAA 3PPYA 4AS2A 2VSNA 2Y1DA 4NTZA 5CVEA 5AM3A 2WPDD 4GT1A 1JHAA 4IRMA 3A10A 4QRIA 4B33A 2BGKA 5EHXA 3MJTA 5JQGF 4GOXA 2CW5A 5IAGA 3M4NA 5EHQA 3BHMA 1T3TA 4LXIA 3C8DA 4N76A 4O4JB 4K9KA 1WV0A 4GC5A 3PDWA 3TJMA 2IXEA 3MWFA 2Q07A 121PA 1B1AA 5LNK6 5TE9A 2ATEA 2UYYA 1E1CA 2J48A 2HQOA 1P7WA 3DDOA 1QANA 3GRYA 4OHFA 1Y7HA 1QOPB 3EVAA 4RHEA 2Z6AA 4R8SA 2J45A 1QDEA 1WU8A 1SVLA 4JYCA 4A2PA 1ZM2A 2DKFA 4LZZA 3SJAA 1BXGB 1F4LA 3ZGZA 4KDEA 4URWR 3AR9A 2F8SA 4GW3A 2HU7A 5CB4F 1D6SA 4UVEA 3Q4GA 1KYIA 3I72A 5AW5A 5DW0A 4X65B 4CM8B 1M2VB 2WWRA 2O4CA 4B09A 1YQGA 1YRQA 3AHIA 3BAZA 3FH0A 4GS5A 4QXAA 1W4BA 5K7SA 4U2CA 4BO8A 3AUSA 3M81A 1P2UA 2ZUDA 3IPLA 4CF5A 3OQHA 5HIAA 2EW8A 1S8OA 1U2PA 3C3AA 2A0WA 2AEFA 4PVCA 4QUDA 3MRSA 2EW2A 4G97A 3OZWA 2DPHA 2PLNA 2VJMA 2P5SA 1T0IA 1XG5A 2ZIAA 3D43A 1M2VA 4FHDA 1Z33A 1KORA 4F45A 5IF3A 1AO0A 3OTOB 4IXMA 5I01A 2W42A 1XZLA 3EJWA 4ZICA 5KWSA 3B1FA 1X1AA 3R76A 3UPUA 5KAPA 3MWYW 4N41A 1SBTA 2VJQA 3IKVA 5CLLA 4GLFA 4B6EA 1B0ZA 3GU3A 5HA5A 1Q1EA 4IXDA 3EUFA 4PS1A 1P77A 2FPWA 2VXBA 3Q98A 4QDZA 3N6RA 2NADA 1MZVA 2GBPA 2Q6VA 4LHWA 1N8NA 1FFBA 4MYTA 4DC9A 2D0DA 4IJ5A 3NR2A 3WHKA 1O6GA 2G9ZA 4WZBE 2IPNA 5DH9A 2J9FB 4NI5A 4BNJA 1OA1A 3LU1A 2FR8C 3ISTA 4JY7A 4MZDA 5K3FB 2RMKA 2CVFA 4QHTA 3JARB 3OM1A 5CU7A 2FEAA 4HXYA 4Z3DA 3TGWA 2A3RA 1E99A 1HEUA 1CDDA 1K4YA 3IP5A 1CUVA 1YULA 2ZSJA 1RRCA 4RL6A 3VR5H 2QVCA 3B8EA 1P7PA 3K0BA 3ANNA 5JWHA 2J9FA 1G3MA 3JQCA 4EYGA 4HAUA 5K3FA 1QBGA 1WCYA 1E2UA 3GLIB 3D1JA 1RLMA 2AZMA 5ENZA 3WVNA 4F4IA 3VKUA 2P4UA 2FOXA 5J2UB 3UMVA 4PNEA 1O58A 4ZI5A 4RF5A 4V1CB 1OT3A 3A05A 3OJLA 3MPOA 1J06A 1XZAA 2JZCA 2O0HA 3AFMA 2HJGA 1N0VC 3AIKA 3MIZA 3UMRA 3I4FA 3D4NA 2XKBA 3GLRA 4L3WA 2GCGA 4QNMA 4DJTA 3KUCA 1E7SA 1Z7EA 3OX3A 3P9RA 4U2DA 2WBLC 1L4HA 3E3NA 5B1IA 4BLPA 4RMIA 5HKKA 3PPVA 1QHHB 2DHDA 3CWCA 1LA2A 5HBGA 2ORVA 5DBFA 4N3GA 3KHTA 3ZHQA 3JWGA 2WHRA 1IE3A 4EG4A 5J2UA 2ZZMA 2UYGA 1ZJZA 3EGIA 3ENQA 3KBOA 1S3SA 5GPBA 5CA1B 2Q1XA 1JT2A 2FWAA 2ZI5A 3F78A 2CFIA 1WDTA 2JB9A 3KWJA 4GP9A 4N7RA 4AVYA 2QTFA 4UPEA 3UKOA 2XNKA 4RABA 3AF3A 1Z5PA 2H1FA 1VDZA 3KB8A 4JBXA 4C6TA 3EQ2A 1M8JA 3P0EA 1PS8A 2R6R1 1V6CA 2XD9A 4HTFA 2WE8A 1WB9A 4X71A 4HLQB 1M5TA 2ZUWA 2XJ9A 4MAFA 3L8CA 3H1FA 5F21A 3IOBA 2Q2WA 3IGFA 1JPNA 4RVOA 4F56A 3QUCA 4KQ1A 3QFHA 4QTTB 4F91B 1NC1A 3PD7A 4C7OB 4YP6A 4XM1A 4A16A 2V03A 3H8SA 4M55A 4I1YA 4PR3A 3U0BA 1JKMA 4GVPA 1A9XB 1AC5A 2R2GA 4FSDA 2YHIB 3E35A 4EBBA 2ONJA 1NJ6A 3G9QA 4ND6A 3QHPA 3A6LA 4WQMA 1EBBA 1Q1NA 1PTJC 1L5HA 1D2EA 2ZUSA 1V41E 3L06A 2OR3A 4OUDB 4WDRA 1T4GA 3W4IA 1DRUA 3EDRA 5KSYA 4BEJA 4RXUA 3AV0B 3HADA 3KKMA 4GXTA 4ZT4A 1A9XA 3ESDA 1F0NA 1MU0A 3WKEA 5BMVB 2JG3A 2J59A 1ZISA 1L7DA 1VLZA 1B7GO 1PWHA 4D6PA 1DWQA 4LY0A 4ARAA 3LG2A 5IXSA 2FX2A 5AWFC 3BIJA 4FBGA 3QVTA 1A82A 2GYWA 4LZWA 2WAXA 1K8YB 3TE6A 1DELA 4OUDA 4WBNF 4LVCA 4JVMA 1Z06A 3HRIA 1D2RA 5JDIA 2ZIUB 2IGBA 4MDFA 1PJ3A 3P9NA 4C7VA 4CIDA 1WZNA 2HQSA 1F8FA 1NUTA 1OE0A 1ZD1A 2L42A 3CRMA 4IDCA 4KNWA 1FNCA 3A8TA 5J5AA 3FPLA 3STXA 2C4NA 3P9CA 1E2HA 1SC6A 4O63O 3CVJA 5I51A 3B8HA 4FCCA 4OQPA 3JVVA 2QRGA 4UASA 1KI6A 1PX2A 5ADUS 5DYIA 1ZJ6A 2JANA 4E70A 4EPXA 5DBHX 1DC6A 3IJRA 3ED1A 5DHQA 3VOSA 1ZD4A 1UZMA 1W73A 1EXMA 1W36C 4J9UE 2HMTA 1UXJA 5ER9A 4E22A 2Q2QA 3TL2A 2WWFA 1EGMB 2EFGA 2P2YA 5FJJA 2FK7A 3JAMA 5KSWB 1V7CA 1PD0A 1E8MA 4LF5B 5DI3B 3ODPA 1QZZA 3E05A 1QFXA 3KJZA 4LJ7A 1MB2A 3DLAA 5COBA 4X9XA 1CEEA 4ZTZB 2CLMB 1F9EA 1O95D 1ACMA 2Y0BA 4UHKA 3HM9A 1XRJA 3KAJA 3KQLA 2NQ8A 2I65A 2HIAA 4HGQA 4UZEA 3C48A 3E2MA 4KIJA 4ZODA 5ITSA 2NN3C 4MVCA 4LCBA 4HOYA 4TL7A 3RF6A 1JE1A 4EI7A 4PQEA 1E1LA 4CV1A 2Q5JA 1M2EA 1NFRA 3PCXA 2G88A 2XXJA 4BRZA 1Y3AA 5TEVA 5BVGB 4MDHA 3N86A 5IUJC 3JASA 3A3YA 5F78A 4RTOA 4HDNB 4IPTA 4KCGA 1SUPA 1YKGA 3TAUA 3TX6A 5CT8A 1M2HA 5KJFA 2AG5A 4BNDA 1HE8B 3CF4G 1CJUC 3QEAZ 1KYZA 3T7SA 1M6WA 1ZU4A 3KYCB 4P54A 5GONB 3N2KB 1J00A 4B48A 5E3IA 2AWOA 3L18A 2LR0A 5M29A 2GBLA 1LV7A 1N7IA 1XEXA 5AHWA 4P6VF 3ZWWA 4BBPA 1MQ8B 4R0MA 4C0SA 4GECA 2HJRA 1KAOA 1ZCJA 4PLCA 5EKXA 3IDZA 5HILA 4E7OA 4I8IA 3RQSA 4CQMA 2AB0A 4HDNA 5AXAA 5UKDA 1R15A 4DMMA 3LQRA 2AVNA 3MTBA 4ZZ3A 4F71A 3K32A 1JA9A 1R5JA 2G3YA 2RAFA 5EHIA 4U02A 4A15A 5KNBA 1EM6A 3KYCA 2YHAA 3C39A 4OJTA 2RHTA 4REQA 2VAWA 3G1TA 5CR9A 3K31A 3ROQA 2XF2A 4ZVMA 1OZ0A 2QLJA 4AKTA 4EX7A 4GM4A 2QJTA 4IHJB 3TPCA 4B5LA 5HFAA 3QWAA 4UUNA 1P2FA 4DTCA 4MQ5A 1X7ZB 3QSGA 1EFHA 4EARA 3EXIB 5ER6A 1XJCA 5DYNA 3V8MA 3OZUA 3KPUA 1HK7A 1ZU5A 3PDUA 4EW6A 4W5QA 4CKBB 1RPTA 3TRIA 3DZKA 2G83A 5DW3A 4IUBS 2XQIA 4WN9B 4AK9A 3T5PA 1E3QA 2O8VA 4KQHA 2FDRA 2C2ZA 2OO7A 1ZAKA 2QN9A 2X7JA 3OO0A 4WA8A 3E5NA 1C3EA 4IHJA 4C22A 1I2AA 4EHNA 3X1DA 1KTIA 2JASA 3AVXA 3N74A 1UK6A 4KK4A 1WMSA 3IIMA 4FR0A 5DBEX 3WIVA 1GXSA 3EXIA 1Y89A 3NORA 4L7VA 3LXXA 1KETA 1TAGA 3DFZA 4LV8B 4YCLA 1ZH8A 2XUQA 4F3TA 1E2QA 4K46A 4EO4A 1ISPA 1PNRA 4JI1B 2GBCA 4WN9A 4WXMA 3QUSA 3FMIA 2PE5A 3NVKI 1KGSA 1OKKD 4RXMA 3ETEA 3V97A 1QP0A 3L8ZA 4G1UC 4R2JA 3AU9A 3GUVA 2IELA 4F46A 4KHPB 4JZYA 3WKAA 5FLXA 4JC4A 4J1TA 2LP4Y 4NOLA 4QQNA 4ZEOA 2C8JA 2C04A 3MWJA 4CI9A 2R6DA 1ISGA 4AULA 3JD4A 4M7OA 1EE9A 4ZOAA 3PNMA 2P11A 3FETA 1N7JA 1U3TA 2EGGA 4FQ5A 4U7PB 3DT8A 3AJRA 3G8CA 1JSZA 3B12A 3JW8A 2PX5A 3DFFA 1UBOS 4JJZA 4OA8A 4RLSA 3VYTB 3LYAA 1E9VA 3DVAB 5IT5A 3RI3A 5IARA 2FSVC 3K8OE 4UFPA 1BIFA 3Q0TA 4JSRA 2W7TA 1KH1A 2WSBA 4YXWA 3VR6D 2FW6A 1FW6A 2NMVA 1Z4NA 1W9HA 1YH3A 3ZV4A 3G13A 4MCJA 1NVAA 3QEJA 5JASA 3GFQA 3R7DA 3RRMA 3T06B 4QFDA 2WYOA 3GP5A 1W76A 4FOPA 4TTQA 1BS2A 4L57A 4K6MA 2H3HA 3B6ZA 3RHSA 3WK9A 4C9BA 2ZJ1A 5JRZA 1J09A 4UXIA 3UXMA 5AI8A 3DVAA 3FTQA 5HP4A 3ETJA 3PXXA 4MV3A 4B3XA 5BXYA 2ZWAA 2G8LA 2W8BB 5JAOA 1HPLA 1KMQA 1I7SB 4J03A 4QOFA 3SR4A 5KDLA 3MT0A 4RPCA 1PQ4A 3Q3EA 2IY9A 5FL3A 3IOYA 4F7WA 3KAQA 1PKXA 3ZQUA 3A14A 3DQPA 2HLHA 4PZYA 5JH7F 5EMJA 4EG8A 2PKRA 4IHKA 5AVOA 1ZGZA 4LDPA 4ZQBA 2C57A 1BU8A 1UKEA 4OMDA 4DR5B 2H3EA 2SICE 2EJWA 2ZI3A 2ZZKA 3AEUB 4FZ3A 1VRCA 1GLVA 4BCDA 2BM8A 2MINA 2RHWA 1ILEA 3MWEB 1P4HA 1PT7A 4NU0A 3KQWA 2PQ6A 2ZJZA 4I55A 5CW1A 2AHOA 1U2TA 2EGUA 3AIIA 1V1MB 4PLFA 1CUBA 5F4ZA 3ZWQA 4UUAA 2JI6A 5FV4A 5L6MB 4W1PA 6ADHA 1A4RA 1O6CA 1KP2A 3N0XA 3FB4A 5JCXA 5JTTA 1GU7A 1HOXA 4AY3A 3K8ZA 4A10A 3BXZA 4FSXA 3FROA 4RMGA 1NF8A 1EX1A 1H65A 1N0WA 3MWEA 3C3PA 1CUXA 5FOXA 4FONA 3G1WA 5FQOA 4Z49A 1EWQA 3EQ9A 1V1MA 5A7GA 2WWIA 1PEKE 1IY9A 4ZCLA 1FUEA 3B36A 1AV6A 3M6IA 1G0NA 3CPSA 4IDAA 1RCFA 2HRRA 1M8KA 1KHTA 1YS4A 2DY1A 1AGRA 5AHRA 1P9OA 2VWPA 2FPUA 5JY6A 5LP6F 4HL6A 4QQ8A 1OYVA 3IH5A 4DA9A 1JQAA 1YA6A 1UZNA 4BV2A 1I4OA 4RDIA 4LJ5A 2HCTA 1K6JA 3QI7A 5LXTF 3B1VA 4RD0A 5HTOA 1XVIA 3ND5A 5LD2B 3LCJA 1OWOA 1NDHA 3KV3O 1K98A 1ZRHA 5FCDA 3TBKA 3DO6A 4ZRMA 4MRNA 4ZEXA 4LVUA 4CTNA 3N2GB 3AERB 3PG5A 1YGYA 3OOHA 5IZCA 1T8UA 4XWKA 1A04A 2RIRA 3HPRA 4N03A 5DOZA 3TDKA 3DE2X 4A0RA 3G2MA 3QBDA 4LK2A 4BO5A 4J43A 1PR0A 2O1WA 4AKEA 2KM1A 2LVBA 4QDUA 2IP2A 1WCXA 1NBAA 2PEYA 4GUAA 4H3HB 4NY1A 2Q46A 2F3UA 3USZA 1E5VA 4PIVA 1T0HB 3V6MA 2Z8ZA 2JFVA 3Q3JB 3THSA 1X7DA 3BCHA 1LV8A 4A26A 5KTYA 2J3IA 1VSVA 2BGGA 3HWWA 3E03A 1FTNA 2Q0SA 1WB4A 3HRKA 1GJRA 1KFBB 2J7PD 4HJRA 4P4SB 1OIVA 5HTKA 1QR2A 3EXAA 3PQCA 1Z3CA 2DFKB 3H13A 2QENA 5CA0B 3T5BA 3X1KA 2HEGA 3X2EA 1YQEA 2PT7A 3AKDA 3I5AA 4N3AA 3LKVA 3R0XA 3LO8A 4G36A 4I36A 5AP9A 4MWDA 5CIQA 2Q7DA 5MF6A 3CPJB 3H6GA 2GZAA 2GCOB 1Z5ZA 4HPWA 4OBBA 4MW2A 4TS4A 1DX4A 1FFGA 3RUAA 4B0OA 4DZRA 4P4SA 1S89A 4FX5A 3TEFA 3ZV5A 2GDZA 1YOVB 2OYSA 3CO0S 1V1RA 3GH1A 3X1XA 5DK6A 2VQSA 3T5DA 4E6EA 1J2YA 1IL0A 4BAGA 2YYSA 2O6LA 3FKQA 3IP8A 1BVYF 3NP9A 5DWVA 1TZCA 4PYKA 2J0SA 1T1RA 1UPTA 2D1TA 1YL5A 1PV2A 1X1DA 5KWVA 1R6DA 1UANA 2P0AA 4KBYA 3ICPA 1Y0BA 2BEWB 3MJEA 4LCJA 3A4MA 4HX5A 5FBZA 1YOVA 1CZRA 3A6DA 3ICWA 2ODQA 3I9JA 5HUHA 3W1VA 1G20E 3ESXA 4IJKA 3PX7A 1YU6A 4EA6A 1H0SA 3PF9A 1LTHR 3LJKA 4Y2RA 1ZCBA 3LC7O 2E7ZA 1GDDA 2QXTA 4EG6A 4M21A 1E2MA 4K7JA 5ALUA 4U5QA 1EDBA 1XEWX 2PK3A 1JQBA 2BHLA 2QIOA 2MR5A 3QNMA 4JLMA 1QF7A 5AESA 3NQ41 3QU7A 1O4VA 1Y8AA 2A5GA 1AZTA 2CF6A 2IOFA 4RUKA 3E1KA 1BRMA 3R8CA 4A5SA 3WRXA 3L84A 2QGZA 3LHIA 4R1MA 4HDKB 2R4TA 4MS4A 4RTMA 2ZJBA 4BZQA 4F3KA 1I14A 3PWTA 5HNKA 5EFOA 2MSWA 2PLRA 4KFCA 1ZW6A 3P71T 5DBIA 2ZRBA 1Z39A 2YIJA 3R5SA 4DDVA 2ZANA 4GUDA 1OZHA 4GEGA 1D03A 1C3OB 2QX9A 3GDFA 4ZC8A 5JD6A 3STYA 2QAGB 1DQRA 4PZ0A 3H6KA 3VR1A 3I1FA 4EFNA 3K20A 4QSMA 4W9NA 4P4GA 4HDKA 4JNCA 3A1VA 1VPVA 4G4SP 2BGUA 2OO3A 3TBHA 1WW8A 2G82A 3SBEA 1Q12A 3GR6A 3X1ZA 1G3QA 4W63A 4K1XA 3TQSA 2ZIXB 5DKFA 1X8LA 1WDLA 2HLPA 1LW6E 2YWBA 1D5CA 2R1TA 2XKJE 4M99A 2VNHA 4YAGA 2WB2A 3A25A 3LRTA 1XMPA 1GKLA 3H4TA 3SR0A 3DPIA 4ND4A 3S2EA 2BMEA 2F59A 1U0TA 4QZVA 4YI3A 2VYCA 2E4YA 3LT1A 5LQAA 1V43A 2PMCA 1HT0A 4AP9A 5A7FA 3BQNB 1L3IA 2VI5A 3CX3A 4GVLA 3Q88A 1G8SA 2QQGA 4IJWA 3AZPA 5A4IS 1UQUA 1XMJA 1GUZA 1F12A 1HM5A 3NDIA 4QGGA 3TUIC 5CYOA 2ABWA 2JBHA 3MMSA 4MVYA 3A7EA 2A0FA 1Y4DE 2JK0A 2YIVX 1REQA 4RA6B 4BHTA 1KFKB 3ZCTA 4JBLA 3S7ZA 1P80A 4D5GA 5G53C 5GVRA 3HVJA 4PGFA 5LQSA 4BVJA 5F9FA 5KI6A 2ATCA 4H7JA 3JYLA 3V46A 1Y9AA 3WGQA 3GMDA 2OC9A 1QV6A 3A37A 1JU3A 1KK1A 2H0RA 1AKRA 1BFDA 1NNUA 2ASEA 2FXVA 3JR3A 3PNSA 3QOXA 4LNUB 3ZJ4A 4DA7A 5JDIC 4WOJA 4PPGA 4MV7A 4RVGA 4BNYA 3KT6A 4QBTA 1NMXA 4HB2A 4GPBA 4UFOA 4YJ2F 3T5CA 3HXMA 4IH4A 2PKXA 5HK9A 5F2OA 3WTBA 2OZEA 4TXLA 3STWA 4ZJYA 4MYUA 1Q2XA 2Q4RA 1USGA 3ZLJA 1TM7E 1INLA 1FRVA 4LMBA 2OLEA 3IERA 1XNGA 4R1PA 4BBZA 4TZ6A 3HB7A 1LI4A 4R2KA 2FW9A 1PAUA 2JATA 3Q7SA 4LKRA 1U0LA 5IKEA 2JBAB 4LNUA 4H1UA 1DWPA 3PDIA 3UT0A 2HKIA 4TV8F 3IP1A 2W2KB 4MO9A 1IHYA 3BFXA 1KEEB 2Y1EA 3W2GA 2BMDA 4K9LA 4BKRA 4ZTUB 1CJBA 1E59A 4FK8A 5JNVA 5I7HA 1C29B 1E1QA 1FU7A 2H31A 3BEOA 2IUUA 4EUEA 2C9BA 4NEHB 3RUHA 3E9RA 4ZI7F 3NC4A 2WABA 5BSVA 4RHFA 2ETVA 2JBAA 2M6SA 3O91A 1QH1B 1XKLA 3CF2A 3WNCA 3NJRA 4DC1A 5JJIA 2CXQA 2W2KA 3REQB 1OFHA 4EY8A 4GRAA 1KEEA 1O9HA 2RHLA 5ESXA 3MRXA 3B89A 2H0AA 1HT3A 4RWEA 1F1BA 4LHXA 5HF8A 1FSPA 1E2PA 1AY0A 3OJOA 4M9CA 3LK7A 5HQ3A 1E8NA 1DFGA 4OL9A 1W0CA 2X9QA 1ZM9A 4UEKA 2DUJA 2O52A 5EGSA 3PVZA 5GM1A 5F77A 5T8KC 3WHIA 3G8DA 5B55A 1QH1A 2J9RA 3H42B 1C9MA 1PNQA 2AZXA 3OJXA 3REQA 4N0DA 1LI5A 2GPSA 4QOEA 1Q92A 4Q3BA 3CNEA 3EXFA 1MH1A 1EP1B 2E0IA 1S2LA 1XZGA 1XZFA 3L4EA 4TPKA 5KWEA 1FXWF 4EGSA 1U1FA 3ETLA 1NF2A 1O1YA 3JQDA 1UDRA 3NJ4A 3VDRA 1WXQA 2OM6A 3RQIA 4LZLA 1K08A 3IP6A 3UW1A 4LRWA 1GTL1 2QP3A 2GBLC 1T10A 2PR7A 2X9NA 3LPLA 4O4IB 4OXIA 1WBJB 4BGEA 4YX9A 1C80A 1QRTA 3R7SA 4Q3NA 1VP9A 2HT6A 1KS2A 1LSOA 1UC8A 3IULA 1J7KA 2K7ZA 4BV3A 1Y81A 1ZG3A 3CKMA 3WDLA 4AD8A 3S29A 2ZI9A 2B82A 1OYOA 1TDJA 3ZY4A 2JD0A 3DAHA 5EIAA 1VLMA 4O4IA 4L07A 1NPYA 3RVJA 1MQ9A 2DSNA 2JFYA 4JYPA 4X7RA 1JRLA 3BD6A 3LBAA 2R7KA 4X7MA 1ST3A 3AESB 4PBTA 5KPJA 4HGRA 2WUGA 4C1NA 4IHQA 4YY3B 1RMYA 2BSQA 2GRUA 2X3FA 3G0IA 4DRXB 2GVDC 4OQNA 4GM0A 4QUHA 3LK6A 1M0WA 3NGLA 3B2EA 3SOZA 5LYJB 2G9VA 2E1RA 4FSHA 2WI8A 5KOJB 5IMBA 3MTAA 4WADA 1MQSA 3ID6C 3EC7A 4GX1A 4H08A 5C2JB 3C8ZA 1Z28A 2O2ZA 1DRJA 2VP4A 1ZZGA 4ALKA 1W8IA 3HU1A 3R0ZA 4Q16A 3AESA 4DGQA 1BEUB 3M9WA 1NRWA 2GJ8A 3HXLA 2CNWD 4XLTA 4M36A 2AFRA 1TMOA 1HE5A 1NVVR 1XLVA 2BTOA 1P1HA 3QLEA 4D45A 4ZAFA 2CLIB 1GG9A 2VPQA 1MG5A 4KYIB 5GJVC 3SSOA 4DJ5X 3NHZA 2ZRGA 3NTXA 3PR2B 1XHEA 4S0ZA 5DWQA 3U39A 5C1PA 1TYBE 2PUTA 2HBZA 1KZ6A 1TOAA 2J9YB 1ZRSA 5FTKA 3DONA 7ABPA 1PZHA 2Q9CA 1NXXA 1SN7A 2B5WA 2ZK7A 3I4CA 4L08A 3VUEA 5KJ1A 1KEKA 1CHNA 1JTEA 4IBOA 3U4HA 4IUDS 3U48A 1XU7A 3IKMB 1QAQA 3SBXA 3AUUA 1O6ZA 2XVMA 1PJ4A 4AXXA 4BNUA 1ESMA 8ADHA 4PYMA 1Z0AA 2WUWE 5FNVA 1P19A 1UEXC 2ID8A 1E0DA 3BMQB 3FHOA 2ZUCA 4J1TC 2WSIA 4QPZA 4U2BA 1C7IA 5FWAA 3NVMB 4OYRA 4AX8A 5ICGA 1JGTA 1H0KA 1MJFA 5ES3A 5DM70 3NHMA 3E2IA 1H2YA 2CN1A 3AFNA 1I24A 5GADl 3TQHA 3GP3A 1KSGA 2RARA 2FPIB 5LQDA 3FX2A 4DLUA 3GRUA 5AJWA 5E6UA 2OK8A 3NTLA 4ZV7A 1AB5A 1M8PA 3EDQA 3N9IA 2W2QA 2PBZA 1EM8B 4M1QA 5C34B 3CINA 1ENZA 3GFSA 1LLDA 3EWAA 4RJ2A 1AN9A 1U7UA 2QTTA 4ZWNA 4M0UA 3PUIA 2FSSA 2BFWA 4O3MA 3TIVA 2FPIA 1LBQA 4KO8A 4ZT5A 2ETXA 2F43B 2VUHB 2DP4E 5ALZA 4RSGA 1J24A 1YK0A 4NP6A 1ABFA 2J5BA 5F76A 4EMTA 1T25A 1U02A 2GF9A 1IM5A 3GJ5A 3H2BA 3PK0A 1Z6XA 2BFFA 3QVKA 1CNEA 2IXAA 4JLSA 5CM2Z 5LB2A 2I4MA 3E9MA 2I2XB 2VBGA 4MRPA 1EM8A 3S2YA 1A5SB 3LHFA 3V4SA 2X1HA 2XSZA 5DXAA 4KO2S 4Q3LA 1BCSA 3GRVA 2L69A 1RCUA 3F8TA 2F43A 2HV9A 4EHIA 4ZKEA 5JALA 5LPNA 1FMJA 2GN2A 4ZC1A 3GJXC 1GLGA 4DB4A 1IEXA 1C7RA 3D31A 2HMUA 4H3SA 3IUSA 2WSYB 3C8UA 4HS4A 5IBRA 5CFZA 4NE9A 1DOZA 5DBOA 4B5KA 3U4QB 1LY1A 4XGNA 1IOWA 5LLTA 3TW0A 1L5YA 1ZNYA 2WIKA 3HB0A 5ITWA 1R3DA 3C3CA 3DB1A 2X2EA 1KI1A 2OBLA