1NW7A

Structure of the beta class n6-adenine dna methyltransferase rsri bound to s-adenosyl-l-homocysteine
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
279
structure length
271
Chain Sequence
GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLQRSYEIVEGAANFGAALQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION METHYLASE RSRI
publication title Structures of liganded and unliganded RsrI N6-adenine DNA methyltransferase: a distinct orientation for active cofactor binding
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
total genus 87
structure length 271
sequence length 279
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nw7A00
5LQAA 4E33A 4YV0A 2AOTA 4HSGA 3FTDA 3P97A 3MTEA 3EEYA 3PX3A 3HVKA 4PONA 1XDSA 3ANXA 3GRVA 4YUVA 2Y1XA 3OPNA 3IEIA 4RVDA 3ID6C 4E2WA 1M0EA 2QRVB 1KPHA 4HRAA 2OPBA 3M6WA 3KQPA 2CMGA 3FPHA 2PJDA 3GNLA 1RI2A 2PT9A 2JHPA 1JQDA 3LCUA 2ERCA 4M37A 3MGGA 5E9WA 4BLUA 1G8AA 4MHTA 2NXEA 3SGLA 2OKCA 3FYCA 3Q87B 2NXJA 3H2BA 5EOVA 2VDVE 4QPNA 4P58A 3KR0A 4RX1A 1JG2A 2ZBPA 2JJQA 9MHTA 4ER6A 1YFJA 2BR4A 4P7GA 1JQ3A 3TMAA 2Z6UA 3HCCA 4P7FA 3I5UA 2PX4A 2XVMA 5EQJB 2IH4A 3P9KA 2G8NA 2AS0A 2WA1A 4RYLA 3ORHA 5FUBA 3TM5A 3VC1A 1ZGAA 5DLYA 3MCTA 4HC4A 4X60A 5HILA 3REOA 5LQKA 3PLAE 3P9NA 5DTRA 5EZQA 4DM3A 4XCXA 3MCZA 1VPTA 2PWYA 4Z2YA 1OR8A 5CM2Z 3UJDA 3K6RA 4MTLA 3V8VA 3V97A 5K0BA 2Y1WA 3GIWA 4P7KA 3BGIA 4GUAA 3IHTA 2VDUE 3UJ8A 3G8BA 1QAOA 4KVZA 1JTFA 5E2BA 3LGAA 2FK7A 5GP1A 3UA3A 1Q0SA 3JWJA 1KHHA 3O7WA 3FTEA 1R8XA 1NV8A 4RTPA 3KPVA 4DMGA 5K8VA 5E9JA 1RJGA 3CKKA 3M4XA 4E70A 1EIZA 1P39A 1SVUA 5K0FA 1R00A 3DXXA 5DXJA 4YMHA 4RVGA 5DX1A 4L7VA 3THRA 2ZWVA 3IV6A 1UFKA 3NJRA 4KIGA 1H1DA 3OFKA 5DTMA 5B1SA 4F84A 3EEOA 2CL5A 2AN5A 3CJTA 2EX4A 2PXAA 2XYVA 4MQ4A 5EMJA 5DT2A 3OU2A 3A26A 1NW5A 5FADA 3G8AA 3PFHA 2PBFA 4M36A 4X63A 2H1RA 1AQIA 5FA8A 1R8YA 5CVJA 5EZSA 4ER5A 2OB2A 3ERCA 4RTSA 3LSTA 2AOTB 3LX6A 4RVFA 3NDIA 5HIJA 4RTJA 3BWCA 2XBMA 2E5WA 2JHCA 3A27A 3IYLW 2OO3A 5HOQA 4GC9A 3LBFA 4C07A 4C03A 2A14A 4EK9A 5LQCA 4RSRA 5LQNA 1KP9A 3KQQA 5LR6A 5GIPE 3E05A 3DH0A 2I9KA 5GINE 4RTOA 2PGXA 2NXCA 4EVIA 4X61A 3T0IA 4PYQA 1YZ3A 2CKDA 3HCDA 2ZIGA 3O31A 4ER3A 3EVGA 4PCAA 4DF3A 4UOEA 5EHIA 4B17A 4OA5A 3SVZA 3HA7A 5KYGA 2ESRA 3KU1A 3OZRA 2YXEA 4RVHA 3I53A 3RIEA 4ER7A 2PWPA 3CBGA 2GLUA 2HWKA 3LKZA 4FT4A 4X1OA 4KRGA 2ZULA 5EC8A 1RI4A 3FUWA 5ICEA 3FPFA 4CTKA 3AXSA 3MQ2A 5KS2A 3NDJA 5K0CA 2YTZA 2XYRA 3A25A 2R3SA 2N47A 1R74A 3A7DA 3FRIA 3KHKA 3DLCA 5CCXA 4OA8A 2HR1A 1KR5A 3CVOA 3GWZA 3EVBA 4FGZA 3FTCA 3EMDA 1HMYA 1KXZA 1U2ZA 2BM9A 3FUXA 4AUKA 1JG4A 2JH9A 4R05A 3GCZA 5FHQA 1ZKDA 1KYZA 2BR5A 3LECA 3SM3A 3NWEA 4YUXA 1EG2A 1O9HA 2P8JA 3BWYA 3ELYA 3HCBA 1WXXA 3AXTA 4HH4A 10MHA 2WK1A 1EJ0A 5DM0A 2ZCJA 1XDZA 2OZVA 1VE3A 3GRYA 1MHTA 2Z6QA 2HV9A 5EKUA 2IPXA 4E32A 3R6TA 3EVEA 5E1BA 5DXAA 3KR2A 1TW2A 2PLWA 1YUBA 3NW9A 4E2ZA 3QOWA 4LWPA 1WZNA 1G38A 4RV9A 5BXYA 5DX8A 5BW4A 2QM3A 5K01A 1AQJA 1YFLA 1BOOA 1ORHA 2GA9A 2DULA 1HNNA 3KQVA 2P40A 1F3LA 3C6KA 3M33A 2B2CA 1O54A 4CWAA 2G1PA 4GOND 5HIIA 1VP3A 3MB5A 5CVEA 4OBXA 3G5LA 1T43A 3VSEA 4YUZA 3A7EA 3CJQA 4ATNA 4Y30A 4BP1A 5IH3A 5LQUA 5DX0A 4YUWA 3JWHA 5FCDA 4C04A 4CXMA 1G8SA 4XUEA 4MIKA 3B3JA 1N7JA 1ZHFA 1UWVA 2BZGA 2YXLA 1JG1A 2VDWA 3LPMA 1IM8A 4G56A 4HGYA 3M6XA 4QDJA 1L3BA 2PX8A 3C6MA 4GOLD 4RTNA 2JH8A 2YX1A 5E1DA 2HMYB 5K0NA 3KQTA 5K09A 1WG8A 4PCLA 1INLA 3R0QA 2GPYA 2C7RA 1QYRA 2ZW9A 3BXOA 4FSXA 3FPEA 1SKMA 3GJYA 1M6YA 2K4MA 1JSXA 1ZG3A 3KQSA 4F85A 3KQOA 1XTPA 4RWZA 1FBNA 7MHTA 2KW5A 4QPPA 1NV9A 4M38A 4FZVA 1RJDA 3P9CA 3CJRA 3KQYA 2ZZNA 1KIAA 3LBYA 2VZ9A 5K03A 1YZHA 3SR4A 3DP7A 4PINA 4IWNA 1L1EA 2IH5A 2P7HA 4K6MA 1RI3A 4E31A 3QV2A 4HTFB 3EVCA 1ZQ9A 3P8ZA 2I7CA 4FSDA 4OBWA 2EJUA 5FULA 4CKEA 2C7OA 3MTIA 2F8LA 3ME5A 3KPWA 3R24A 3S68A 4DCMA 5K0JA 4PIPA 1VLMA 5K05A 3TRKA 1JSZA 3G2MA 3M70A 4X41A 5IKMA 3FTFA 2XYQA 4E2XA 4R8SA 4RTMA 5T67A 4YV1A 3LL7A 2BR3A 2H00A 3FYDA 3G7UA 5M5BA 1F38A 3NTVA 5C1IA 5CCBA 4HG2A 2ZFUA 2PKWA 3CCFA 3KPYA 4GEKA 2GAFA 3UJ6A 4PWYA 2P3LA 3OE5A 2ADMA 3AY0A 3FRHA 2ORED 2IP2A 3HEMA 4BP3A 3BZBA 1I9GA 1RI5A 3HNRA 4LWOA 3VYWA 3EGVA 2AOVA 3LDUA 3KR1A 4AZTA 3P2EA 5ICFA 3DMFA 2O07A 1NW8A 1XXLA 3O4FA 5DM2A 4FT2A 3UJCA 2GB4A 5EKXA 2ZWAA 4V0QA 3BT7A 4QQKA 4U7TB 5DSTA 5EG5A 5EIWA 4E30A 2AZTA 4ZTBA 2FK8A 1DL5A 1Z3CA 3TOSA 4GOOD 4A6EA 3EMBA 4C06A 2UYCA 2OY0A 3B3FA 4QVGA 3DMHA 4PYMA 1SQGA 2PXCA 3RODA 2O57A 3GRRA 1YF3A 4OX9Y 3PS9A 4Y2HA 3JWIA 1VBFA 4BLWA 2UYHA 1X1DA 1L3CA 1WXWA 5FQOA 2JHAA 3AJDA 5FQNA 4AX8A 5GWXA 3G2PA 2PY6A 4EKGA 2P35A 3FUVA 2NXNA 2I62A 1X1BA 5EEHA 3HVJA 4C4AA 3DXZA 4DQ0A 3PTAA 3GDHA 4RTLA 2ZSUA 3Q7EA 4AZWA 2PT6A 4OQEA 4E2YA 2IBTA 1R6AA 1WY7A 1SUIA 4KIFA 4AZSA 1FJXA 8MHTA 1G55A 3KQMA 4C08A 2EFJA 4EQZA 1FPQA 3BGDA 2BM8A 1EAMA 4YUYA 4PNEA 2YUIA 3SX0A 3HP7A 1TPYA 5GIOE 5CUQA 2HNKA 5HFJA 3UJ7A 5E8RA 4HTFA 2IIPA 1SG9A 1Y8CA 4KW7A 2IDKA 5DM1A 4PYIA 4POOA 1AV6A 2PXXA 3HM2A 1TW3A 4GOMD 1WS6A 3JWGA 3RW9A 3BWMA 5BP7A 3ELUA 5FWAA 5DTQA 5FWDA 3KPUA 5FA5A 4C05A 3MERA 4LG1A 2UYOA 2JG3A 3I64A 4H0NA 2WA2A 5ERGB 4KDRA 2PX5A 5JUWA 3R9XB 4A6DA 5BW5A 2G71A 2NNWB 2AN4A 5K0EA 2P1DA 3U81A 3TPZA 2ZBQA 2CMHA 3PB3A 2FPOA 1JR4A 3ELDA 3R3HA 4GF5A 2GH1A 3DXYA 3OCJA 5HIMA 3VC2A 3HTXA 3OZSA 3THSA 3M6VA 3KPJA 5JR3A 5GM1A 3B3GA 1O9GA 2EG5A 2FCAA 4KWCA 1NE2A 4EKIA 5KQSA 3EVAA 3G89A 3EVDA 1PJZA 5E9QA 2ZLBA 2NP7A 1I4WA 2PX2A 4PYNA 4DKJA 2YVLA 4XUDA 2H11A 4PIMA 5CVUA 3TKAA 2AVNA 4F86A 1RJEA 2ZBRA 5K0GA 1G6Q1 2B3TA 5EVJA 3LCCA 3ER8A 3LKDA 4YV2A 5HZMA 3TQSA 2IH2A 3NVMB 5ICCA 2PV0A 5DSXA 3SSNA 3PVCA 3FUTA 3NVKI 4O29A 5D1HA 1QANA 5F2NA 5DM4A 3MHTA 4NECA 5EEGA 1EQAA 3ELWA 1BC5A 1NKVA 2ZVJA 2OYRA 3I9FA 3TM4A 4PGGA 5ICGA 3C3YA 2ZZKA 5E2AA 1R18A 3C3PA 3DULA 2YR0A 3OU6A 1MJFA 3E23A 1G60A 4JXJA 2AN3A 2GS9A 3CC8A 5C9ZA 4IV0A 3DOUA 4LECA 2YQZA 4GQBA 3TR6A 3HCEA 4P7JA 4R6WA 1PRYA 3T7TA 3FZGA 3UWPA 4ER0A 3LCVB 5CVDA 1RI1A 2AOXA 2IFTA 4M7RA 3E8SA 2ONZA 1JTEA 3LDFA 5H02A 3PFGA 4FR0A 5DRYA 4HGZA 1FP2A 5EHGA 3SMQA 4XUCA 3M6UA 3WSTA 3NWBA 2AOWA 1FP1D 1KPIA 4R8RA 5C0OE 5HEKA 3D2LA 5E8JA 2UZ4A 4RTKA 3UJ9A 3EGEA 1QZZA 3GGDA 4PGHA 5E1MA 2Q41A 2QE6A 2UYQA 2ZTHA 1NW6A 3SSMA 2NP6A 1VQ1A 2PVCA 4U7PB 5EMMA 1DCTA 1D2HA 5G02A 3FPGA 5P8WA 3X0DA 4RTRA 3T7SA 3DMGA 3GRUA 3DR5A 3HVHA 2BH2A 1Q0TA 3P2KA 2EJTA 4PYJA 3OZTA 2FHPA 1P1BA 2IDJA 4QQNA 3QOXA 2IBSA 5EMKA 5CVVA 2YXDA 3DTNA 3HA5A 4IKPA 4QTUB 1L3IA 3GU3A 2R6ZA 5EPEA 5HIKA 2P41A 2O0LA 3K0BA 2FYTA 1P91A 5F2OA 2O05A 1VIDA 3G5TA 1ZGJA 2IGTA 4CKBA 2AOUB 3FUUA 3UBTA 1SQFA 2OBFA 4MWZA 3GRZA 5CIYA 4IV8A 4EMSA 3HVIA 1KPGA 4R6XA 2B9EA 5MHTA 1X19A 1AF7A 3HCAA 3KR9A 1UIRA 3BUSA 4CTJA 4DCGA 2P7IA 1D2CA 2V74B 3BGVA 3KQWA 3B7PA 2B78A 3LHDA 3OU7A 5LQRA 3CGGA 2B25A 5D1NA 4WXHA 2P3QA 4AZVA 4DZRA 1XCLA 2DPMA 3A4TA 5F2KA 3F4KA 2QRVA 4QVKA 1QAQA 2XVAA 3TKYA 3UJBA 2LD4A 3TLJA 5DPMA 3EVFA 1V39A 3HCFA 5EIFA 4FP9A 3ER9A 2AVDA 3EPPA 1XJ5A 1NT2A 5CD1A 3SXJA 3UJAA 3BKXA 4FS8A 3UFBA 3EGIA 4GC5A 3B5IA 5U4XA 2OB1A 5GM2A 2AR0A 3BKWA 3PT9A 4PYLA 5T6BA 1YB2A 3OFJA 3EVZA 4BLVA 4CKCA 5EMLA 3P71T 1NBHA 5E1OA 3UZUA 4DA4A 1D2GA 1VL5A 1B42A 4QDKA 2C7QA 1EJ6A 1XCJA 2C7PA 4KDCA 3GXOA 5FTWA 5LSAA 3SSOA 5EGSA 4WVLA 5K0LA 3KKZA 3TFWA 3DLIA 1VP9A 1NW3A 1BHJA 2CWWA 1IXKA 4ISCA 1P1CA 2VS1A 2NYUA 1I1NA 3BWBA 3G88A 1M6EX 3HA3A 1RJFA 3OE4A 2QYOA 3E7PA 1IY9A 1JQEA 2V7EA 3FPJA 5KVAA 3AWIA 4PYKA 5FHRA 2OXTA 1XVAA 1KYWA 3I58A 1SUSA 2VP3A 2P3OA 3GO4A 1X1CA 3LDGA 3L8DA 5DRTA 2I6GA 4BY9E 2ZIEA 2ONYA 5T64A 1L9KA 3NMUF 2G70A 1JG3A 4PYOA 3P2IA 3PX2A 5GOZA 3MAGA 1NW7A 2PSSA 2Z6AA 2HTEA 3B89A 3UA4A 2O06A 4GBED 3T7RA 2FRXA 3G2OA 2ZZMA 2ZIFA 5LQJA 2QY6A 1BKYA 3P9IA 5DWQA 2AOUA 2G72A 1N7IA 3G2QA 1QAMA 1X1AA 1ORIA 3DUWA 4OQDA 1DUSA 1NBIA 3C0KA 4QTTB 4V0RA 5KQRA 4YMGA 4RTQA 1N2XA 1XDUA
chains in the Genus database with same CATH superfamily
2ZRNA 3NETA 4HSGA 3PK0A 4CUJA 4CMAA 2HADA 1EWVA 3K6SB 4M1YA 2AMVA 5CK4A 2FH5B 1DTWA 2XZDA 1I3CA 3FSGD 3ID6C 2XW6A 1CLUA 3MSXA 4RVDA 1CQJA 3ZJYA 1UBFA 3M6WA 1SXQA 2QTWB 4CVNA 2CK3A 4I2VA 1HNWB 2RC6A 2GXSA 1HBJA 1ZICA 1N1GA 2FW7A 4GPTA 2WMDA 1CIVA 3HKEB 1BO6A 1RKUA 2VC2B 4JLAA 5L7TA 1EWQA 1BE8A 5EOVA 2WJHA 4C89A 2NU7B 1Z25A 4FMPA 1GPDG 2P30A 2B1RA 4J2HA 3PUXA 3GHYA 4NH4A 3FJ1A 2ZJ1A 3S1LA 5B36A 9LDBA 3ELBA 1RC1A 2PG3A 1XDDA 5EI5A 5H3LA 1A4RA 3RBVA 4ND2A 2XVMA 3R3ZA 2VTEA 3F97A 3LC1O 2PL1A 2QLJA 4NX2A 3SC4A 5FUYA 2C0QA 3DDOA 4Z9XA 2VCEA 3OLWA 1E3WB 2C8JA 1OVMA 1X9GA 3HUUA 3R3SA 4B31A 3M3DA 4KFUA 4DCVA 2P0AA 4N0PA 4RXUA 1LRJA 3QFTA 5C7IO 1FU4A 2BPOA 2Z4RA 2Z83A 3DMTA 2FE4A 4B7AA 1D7AA 2FJ0A 1G2OA 3F4LA 3SQOA 4CCAA 4JP2A 1SBCA 3VR4D 4M0EA 1R9MA 2W2NA 3DEHA 4FS3A 3RIHA 4OKSA 3TTYA 1R8XA 2ZS9A 3LLVA 1HKUA 3NASA 1IZ7A 1Z74A 3OZUA 1NLMA 2W6CX 2VK8A 2B61A 3PNPA 4FE3A 4XTCS 5EE5B 3W2IA 1HNZB 4TMKA 1Q7GA 3UYKA 3CVWA 1GZ6A 4WDRA 2ZJYA 3DFIA 3ETCA 4Z0TA 3SM9A 3U3OA 4PZZA 1A69A 2LDBA 3FA2A 2ZWVA 3C3WA 4N3CA 3UJNA 1H1DA 1E1QA 1Y8RA 3TZQA 2GM4A 2E49A 3GY0A 1WXIA 1XIVA 1TAUA 1Z6PA 4PR0A 4R84A 4ER5A 1YFJA 2YY6A 1MD9A 3A9RA 3DCNA 3K0SA 3EC1A 3L8CA 2BJWA 5FUQA 3ISTA 4XW2A 2JLBA 4A92A 4UDNA 4AYWA 2XBMA 1T9GS 2QJRA 3PPXA 2OO3A 3QTTA 1UM9A 2HRQA 4QYWA 3HVUA 4JY7A 2ZRAA 4MYCA 4O59O 2F00A 5EIXA 4P1ZA 3B2QA 3QVKA 5KB3A 3IP8A 1YJBA 2AG1A 3AGPA 3U4CA 3VDXA 4DIFA 3FYUB 2I9KA 5C7YA 1W76A 2C9CA 5JXIA 4PYQA 3E9QA 2X0FA 3LA6A 1S1MA 2B4TO 4OB7A 4H1UA 3OTIA 1KAQA 2I1WA 3EVGA 4EPVA 4ER3A 4RZSA 3JU3A 4GECA 3OE7D 3N28A 2HPVA 1CJUC 3BE4A 4MRRA 1DI0A 1I1HA 2BKXA 3HKCB 3IRUA 3AIMA 1GZ5A 1YSCA 2Z30A 5BNFA 3ROGA 3TSAA 5E6SA 5IAEA 5J2UB 1OI7A 3WYEA 4F5EA 1RHQA 1NE7A 1TF2A 2W6ZA 3B1WA 4K6HA 4NEQA 2ZJ7A 2XCRB 3LKZA 3IAEA 3KB8A 4C6RA 3OTHA 2ZXEA 3R6GA 5AVWA 2EX1A 3JQ7B 1MPTA 3DNMA 5EC8A 3UC5A 5ICEA 2GYYA 1KGDA 2H4JA 2E5FA 3JSAA 3QIVA 2CL6X 1QB8A 4MGHA 1P29A 4E6PA 3I5MA 5L51A 3GARA 2O2HA 4O1HA 4ETWA 4BXOB 4AKGA 3IQDB 2PO5A 1QF9A 2C29D 2R48A 1NX6A 1PGOA 4WH0A 2Y67A 5AJXA 3FTCA 1MH1A 3MFQA 4AJKA 2VPZA 5JCZA 3EF1A 3UCFA 2P5TB 2HBRA 1KYZA 1H2WA 5JS2A 2X5XA 3HCBA 4EUEA 4WNCA 2DOKA 3RKRA 3NHKA 3H13A 2W00A 1NKSA 1T25A 3NCTA 4X90A 4J7XA 3SOPA 1ST2A 1XDZA 4DC9A 4NICA 3MINA 1MHTA 2ZJBA 4RKQA 3QSGA 3R6TA 1HH4A 1PJTA 1EK0A 4GZLA 1II9A 1TEXA 1Z2PX 1KYYA 4NP6A 1U0GA 1MX1A 4LWPA 2LDXA 3CLSC 1AGRA 1YFLA 1E61A 2AJTA 2VHCA 3H9JA 3R1IA 1JDBC 1K7SN 3AJ9A 1N9GA 4BX8A 1HNNA 1GG2A 1US8A 3NCHA 4G5HA 3L7BA 4LGCA 3RYIB 3WISA 1KEKA 2HHHB 5H16A 5LDGA 5FFNA 4ZVKA 1QIDA 4CWAA 4KKVA 1BQ4A 2UUBB 1XHLA 5F7XA 3L1IA 1QQ5A 2PJRA 1IY1A 3AINA 4R1UA 4UUNA 1HL3A 2CLHB 2QXYA 1YL6A 3HV0A 3BJMA 1OH8A 1W87A 2GJ4A 4P3PA 4UUPA 3UH1A 4KAAA 3DE3X 3OLZA 2D1TA 1PWYE 1MXHA 2GUGA 4QYSA 1B4DA 1Z0KA 4OJKA 4UBOA 5DT9A 3AFGA 4WEQA 1N3BA 4CLEA 4JASB 4INPA 5IT5A 1XV5A 3B52X 2XVYA 2ACEA 3BRWD 2NSYA 3AF6A 3PD1A 1Z2CA 3C3CA 3LQ1A 4ALJA 1E7MA 1YAJA 5HPYB 1DLJA 1ONNA 1TJ3A 2EP7A 4QXOA 3RIXA 4CHTA 1J99A 4XVUA 3ZY4A 3CJRA 4J0EA 5KNLA 4XR4A 1D07A 1NR5A 1Z4LA 2AQKA 2IKSA 1W1WA 4KPGA 3DBRB 1L5HA 3V2GA 5EMHA 3VR5A 3U7GA 2AMYA 4JLJA 3H6HA 5HCIA 1SOVA 1YVUA 3BE8A 3X1DA 4D9FA 2E4UA 4JYAB 2R6R1 2F8LA 3THYB 4PIPA 4ZTUB 2GPTA 1W52X 5BN5B 3BAZA 1DDIA 1LS1A 1VFNA 3G2MA 1JXMA 1RACA 2CNWD 3CURA 4FD3A 2QP4A 4JEHA 4X41A 1T0HB 5F9MA 1F12A 2EHDA 3O4HA 1OZHA 3JQ6A 4ZJPA 4YAEA 1J23A 5DGTA 1V0JA 3TD2A 2ZPAA 1D9ZA 3EFHA 4K88A 3UT5A 3ZCRA 4EGJA 3OEEA 4K2HA 1KS9A 4WACA 4AYTA 1V5FA 4RZIA 2V1XA 3QKRB 3QXGA 5HQTA 3NG1A 3I2YX 1OASA 1T26A 1EZ1A 3DKPA 1E1LA 3ZWVA 1ZSNA 5FFMA 1QE3A 2AOVA 4IPTA 4ZU1X 5C7OO 3UMYA 1SELA 4W82A 2V3CC 2F3UA 3WLAA 3AHDA 4IUDS 3I9NA 2AX3A 1E3TA 4AUEA 4EG4A 4FHFA 4U9UA 3WSWA 1Y4AE 4Z9AA 4UNNA 3OWHA 5FR1A 2J3EA 3CEMA 3SEFA 1DL5A 1EE9A 4F72A 2D5LA 1BX3A 1GT91 1K9SA 4YROA 4ZVOA 3EMBA 3O74A 2OY0A 2QTZA 1ENPA 4HP8A 5JWHA 2G82A 3RT7A 4AWBA 2JDID 4CLOB 4KUHA 1HWYA 1X1DA 1XK7A 4O4IF 5AI6A 1JEDA 4LAFA 3TIXB 4Q4AA 1Y4DE 3AY6A 2F8TA 5JJLA 4L9RA 1RPTA 1T1SA 3DYBA 4R1QA 3MGAA 5LKRA 5FRDA 1Y7LA 5LPNA 3S8EA 1MFZA 3QE2A 4X64B 5KYUB 3X43A 5L4NA 1GOTA 1GQOA 2H2AA 3O2SB 3I9JA 2HMUA 3W4IA 1W4LA 1Y3DE 4E2YA 2JA1A 2QMZA 4N9QA 5EPUA 5F78A 1RYFA 3FX2A 4A3SA 1CNMA 3SEZA 4C08A 1JLSA 4LNUB 3FPKA 1Y89A 3EIWA 1EAMA 4PC6A 1OWPA 2WIAA 2V7GA 3UWMA 1ZO8A 4DSAA 4FD2A 1RM0A 3NT2A 4QGFA 1QGDA 3RU2A 4UU0A 2OV1A 4POOA 3EGXA 1YQGA 5CW1A 3REQB 1PK8A 4EJ0A 2A30A 1FLDA 1XU9A 1ZP6A 4KNVA 4ZPJA 1POWA 2YQ4A 1L4LA 2R8XA 3WQBA 4PC1A 3FNRA 3PQEA 2KX7A 2PZ8A 2GBLA 2PQ2A 3IBCA 4U7FA 4EJ6A 4ZDIA 3RVPA 4M1EA 3DDHA 5JZ9A 3O38A 1DWQA 1NPYA 4GWLA 3PENA 4IW3B 1PGQA 2JHGA 3WRXC 5AK6A 4XOIA 3KHTA 4NG4A 4INJA 3H42B 5FPPA 4YH1A 2QAGB 3VC2A 5DULA 1VIVA 3BFVA 1SC3A 1CJTC 3OT5A 3G89A 2V7QA 3EVDA 3ZV6A 3A1SA 2JGMA 3CX3A 3IFSA 2G5CA 1QWOA 1BVUA 4DKJA 3CNHA 1XJCA 4BVLA 2H9IA 3IEUA 4MUMA 1F7UA 3HCNA 3PGA1 5CLIA 3R4VA 5TRTA 3FVRA 2P9YA 4XSGA 2UUPA 4G23A 5HZMA 3OQ6A 1QZUA 3R0VA 3WLQA 4FJ0A 4KPUB 3V7WA 4HWOA 1C3EA 1NM5C 5AOBA 3RWMB 4I9FA 1Z4MA 1JJBA 1GCGA 2D2VA 2GBFA 4NECA 4Q1VA 2OO7A 2LWIA 2YHSA 3LXUX 2R0QC 4O4IA 4RS4A 5AMXA 1WZ2A 3AFOA 2OQVA 1E2UA 2B4YA 5AWFC 1J8VA 5HF9A 4UUAA 1QVVA 2Z4SA 2D3WA 1BA2A 2YR0A 3IKVA 2VI5A 3SS7X 4DMLA 2YQZA 1QH0A 1Z22A 1LQ2A 1ZHOA 4HDNA 3NIDB 4UZFA 2NYAA 5AJVB 3G7SA 2IXFA 1IZ0A 2WF5A 3HKDA 4MUNA 4OP1A 1IEVA 5KTRA 2QX8A 5AKEA 2JVIA 4K0KB 4M7RA 4INAA 1UOPA 3GB9A 1KRHA 2IYUA 3LHKA 2FPLA 3IJEB 3GQBB 2GAAA 3D2BA 4EENA 3QLTA 4IEFB 4ARZB 2AI3A 4LXIA 2NNLD 2QLLA 5A03A 1OA1A 1XTVA 3ZJTA 3AR9A 2A0WA 2C82A 3U56A 4Z4IA 1IM5A 1MJNA 3H5TA 1KZ6A 4G1CA 2ZSHA 2H92A 3LUPA 3T5TA 1CP3A 1HOTA 3GGDA 3KLPX 2YIJA 3N0WA 4ARIA 1LX6A 1VIMA 4R1MA 4ZOQI 4OXKA 3MWGA 4X20A 2GZRA 4B3SB 5TDHA 1GPWB 1E0SA 1LA2A 4HTAA 3V1MA 2P67A 5FL3A 1PQPA 2WMNB 3ZGVA 2PEZA 3D31A 2WINI 3EY9A 1GKLA 2PRIA 1DCKA 4EY4A 2XMZA 4J4BA 2IU4A 1O1YA 2WKRA 4ZMSA 4HR7A 3D5TA 2C54A 4D46A 4U00A 5JW6A 3N8IA 2WP0A 3BMCB 5LOVB 4MDEA 1CUSA 1EDBA 1G1MA 4N0QA 4YONB 3DTNA 5IBPA 1NOIA 2W6ID 3D8UA 2OHFA 5EESA 3LP5A 4V2UA 5E3JA 1M2VA 3BIOA 1N6HA 3PL1A 1LNSA 4EUKA 3NKLA 2IEAA 3VUFA 3OY2A 2AHOA 4JLKA 1FNNA 1RZ3A 2QM8A 1IZZA 1IHDA 3G1TA 4M49A 1UBCA 4XRGA 3HKBB 3QEAZ 1SNYA 1P3Y1 2JJMA 4GPZA 3ETLA 3WBKA 4MQ5A 4QRHA 3S3TA 1QE0A 3EIEA 3KR9A 1FSGA 3BUSA 5LXTF 4RK7A 3BGVA 4ETNA 1KH3A 1N5LA 2X9LA 2JIOA 5CP8A 1ZRMA 4X5OA 5LYYA 3WQRA 1N5MA 4ZAFA 1I13A 1PL7A 1ZD4A 3NIWA 1T5DX 1SVWA 2GASA 2IP1A 2Q3MA 1CYEA 1T5SA 2ALJA 4UEWA 3NDRA 4FHZA 2QHXA 1JAIA 2QMUA 1KQ3A 3RC2A 1KYVA 1NT2A 3GVPA 4TN1A 4U2DA 2FVXA 4BWGA 1SXPA 1W75A 2YHIB 4XIYA 4QG3A 5AT1A 2L69A 4P34A 2HA0A 2I6UA 4U2EA 1L1FA 5GM2A 1NN1A 4LTDA 1S96A 4MYHA 4B4DA 3EVZA 3VVMA 4MQ6A 4M1WA 1SZCA 5FWNA 5ALOA 4B8ZA 3BORA 3HK2A 4LQDA 4BZPA 2Z95A 4Z7QB 1TJ4A 4R51A 2ZVDA 2VPQA 3S81A 5EGSA 5I9LA 3QEJA 1P3JA 4S1TA 1VP9A 1ZX1A 3WG9A 1Z82A 3F6YA 2ROQA 4X63A 5FV7A 4REOA 4MR9A 5JMOA 1YR7A 2XB8A 1L7RA 2CNNA 3FHLA 1DV2A 2IGBA 4JDUA 2FWNA 2XV1A 3RSOA 4D8WA 1PUIA 4B2IA 1W5EA 4L8GA 2Y8EA 3CTPA 1W36D 4BKUA 1KC3A 4QASA 2CLLB 2I6GA 2GNOA 1ZN7A 5DGCA 2UZ3A 5T64A 1RYBA 4LBZA 1UFVA 1VOTA 1KBZA 4BFSA 1VG8A 3AY7A 1JG3A 1D4FA 3HFJA 4A91A 4DWJA 4OFBA 4BJ1A 5A4KA 3KO8A 1M33A 1ADFA 3BCHA 3USZA 3Q2IA 3WHLA 1U9IA 3TO5A 1DRWA 1E6EA 1Z17A 2OV6A 3Q8KA 1JPVA 2HWWA 1U80A 3FPAA 3DBVO 5ALNA 3L6RA 1C2TA 3FAKA 3LUBA 5DNUA 1Z5WA 1R4ZA 2R6DA 1YQXA 3C0KA 4UXJA 3D7KA 1NJ1A 1G3QA 1SOUA 3NBAA 3MTBA 3ZHVA 3JQ8A 5DNCA 4B6PA 3T1OA 1RKBA 4ARAA 2QTVB 4TTTS 1N36B 2C3PA 3OPVA 3D1JA 4H3KB 4L8WB 5L3QA 4Q1EA 3V4RA 2GN1A 1JIXA 4ZXFA 5LXTA 3TUZC 4K9QA 1N8SA 1E5TA 1KPHA 3P20A 5JAHA 1Z6XA 5G1NA 3UGQA 5ECYA 521PA 1AZLA 1TK3A 4RXTA 3CG0A 1QO0D 2PT9A 1XMIA 1OTYA 2Z8ZA 2GHQA 1MMFB 4JWTA 4RXMA 1Q50A 2YFQA 3MJEA 3ROPA 1XZMA 2XD4A 4D4LA 3K2QA 2GQ0A 1Z83A 4D9HA 2W71A 3C3AA 3DBHA 3TE6A 3AFHA 2Z5FA 3IE2A 4YRRA 5FI1B 1X0XA 2GEKA 3RU9A 3ESAA 5U1PA 3PEVA 3IR7A 4N3BA 1XMOB 3GMTA 4GYKA 5FTKA 1W9HA 4K40A 3X2FA 3AEXA 3FB4A 3IIIA 4P7FA 4DR4B 1XZEA 1TIKA 2A0XA 3F6RA 3QVVA 2JGRA 3AVQA 2F7SA 1I2ZA 4QUHA 4ILKA 4HCJA 1AH2A 2ZRCA 5TEVA 3SC3A 3ASUA 5AW2A 2FSFA 3EH1A 4BECA 1NNLA 1EFUA 4KL8S 2AGVA 2C1ZA 1QIIA 3RSGA 3RVNA 2OK7A 2Y1WA 1YBMA 2I3ZA 2JGLA 4W7HA 2YJ3A 3W8RA 4Q00A 1USKA 4KVZA 1GU1A 1JDBB 3AP2A 3FYTA 5EKSA 1VRCA 1ZQ1A 2CFSA 1POXA 1QC5B 3DGFC 5EMNA 5GP1A 5KOIA 1DKMA 3GN2A 1ADCA 4WOJA 3O4RA 1MRNA 3D4OA 1M6HA 2CDAA 1E3LA 2NYVA 3LWNA 3M4XA 3EE6A 4B3JA 5JBIA 2G9UA 2VG8A 3OCZA 5GVSA 2JEYA 1VHLA 3VO1A 5CB8A 5K4HA 4YCAA 3RRFA 3ZHQA 1SC9A 4XEUA 4F46A 3I1IA 3CKMA 3SYNA 3TX6A 4KIGA 1VCHA 3BXZA 2HNAA 4Q3CA 1ID8A 4TN5A 2I33A 4DTCA 1HDCA 1DOZA 1RWKA 3NTXA 2G1AA 3WGZA 4LQLA 4IIBA 3NWOA 1LSOA 4O25A 4KAFA 2BISA 1TT5B 3GLIB 1IRXA 1QRTA 1E3EA 3DMDA 1Y1KE 1P17A 2QG9A 4B44A 3WWPA 4E08A 2CYCA 2E5WA 1X7GA 5AM1A 2OK8A 5CT8A 4GC9A 5FYDA 3V1LA 2Q9UA 1H4QA 1FP7A 1CRLA 1U9JA 2ZCUA 3WGYA 1L5WA 1TVEA 4UMEA 1H2XA 2BFFB 2GFQA 1Y0BA 4V0SA 1A04A 1GQQA 2WLSA 2HMAA 2WU0A 3BD7A 3FSGA 1E5QA 1Z29A 3BB4A 3H3XA 4L4YA 3MB8A 5BSWA 5EIBD 1GDTA 3UEOA 5IMBA 1P5RA 4XIIA 2QU8A 4DJEC 4HNGA 3H9BA 1OMOA 2YKGA 3PQ6A 3QUTA 1XKTA 4ZCRA 2Q3FA 3KUKA 4CM6A 1GA4A 1OBFO 4CM8B 1K2VN 2E7ZA 4P86A 2D0PB 4FT4A 2FEAA 4PG5A 2OCBA 3LBAA 1PDOA 3PQ3A 4TKUB 1E2BA 4QEDA 1RFGE 2QZPA 1W85A 3ACBA 3ICCA 1DEXA 3H65A 4NQZA 2ZYHA 1P7CA 4NYMQ 4RLSA 4BYMA 2VZ8A 3K2IA 5DMXA 4QAJA 2IEIA 4FU0A 1A82A 1HOXA 1UK8A 4GMFA 4D9NA 1B7GO 1UDRA 1KRWA 4OA8A 1EJBA 1YOVA 3D6MA 3SI7A 2D5BA 2SBTA 5LZ9A 3VTZA 1U2ZA 4R8LA 1JG4A 5A9SB 3GCZA 2IZOA 3R0XA 3OIGA 1I4OA 3DNFA 3ELYA 1YV9A 2ZT6A 1MB0A 3VR4A 3D43A 3X1YA 4MQUA 5F33A 4PFQA 5B12A 1EJ0A 1GA1A 1WSBA 4MQEB 5EPOA 4AM8A 4EI7A 2QTGA 2AXQA 4PGAA 1SHUX 4PNHA 5BN4B 5C8XA 1A50B 2PLWA 3KETA 2SNIE 2P2NA 4FFVA 3SXUA 4BGUA 1CNFA 2VYCA 4DBLC 1TLLA 2Q3CA 4YCLA 1YRYE 3HV2A 4DT1B 1Y9ZA 2PAAA 3AESA 4E09A 3KQVA 4AAYA 4OF4A 1TADA 3C6KA 2CEKA 3F7TA 3AHJA 1X92A 4GOND 5EJFA 5CVEA 5B58T 4IQ0A 5CEEA 4PXYA 5HUQA 3WA7A 2NV0A 1B26A 5DX0A 3GGOA 5NULA 2VRBA 1QHYA 3VHXB 4PX5A 4YUWA 2WTMA 4ZI2A 3OM9A 4MS3B 1YDGA 5LM3A 2H57A 2Q2OA 3FVWA 4XGIA 3SLKA 1E59A 1L8XA 2VDWA 2Y3IA 1X39A 2JFGA 4NE9A 4OXIA 5DB4A 3AUJB 4N1AA 4GOLD 5L3RA 1FFXA 5KU1A 1GPAA 1TEVA 2ZI9A 1PQUA 1U1IA 1XZLA 4PCLA 4XH9B 2GOYA 4I8IA 1B76A 2QLBA 3AHEA 6PFKA 2WWHA 3OE7A 3N2LA 2NZVG 1R5OA 2XGOA 1H2FA 2VOJA 2GLTA 1BNCA 3FPEA 4FWIB 4GZ3A 4IDOA 4NFSA 4TYYA 2FN4A 2HOQA 2MU1A 3WAKA 2AD1A 2GF9A 2Q8QA 3JYNA 2CUNA 4UBJA 5AJHA 3I52A 1D6MA 1GXSB 4DILA 3ADPA 4EJSA 2HDWA 3BMQA 1NVMB 2OUKA 1VHQA 4MYRA 1H4SA 3VI3B 4TTJA 4TMWA 3FZQA 1KYXA 4RIGA 3L1VA 4HAWA 5C18A 4U3JA 2WSSA 1EWYA 2B99A 4FSDA 3C85A 4I4TB 4WNIA 3FOFC 2O2SA 2O8NA 2UDPA 3HYSA 1RMYA 3R24A 1Z6ZA 5K6AC 4NDAA 1LH0A 3X1ZA 1KXJA 2G5GX 2PLAA 4QQFA 2ZSKA 4H0CA 1PQWA 2IYFA 3A1CA 1E3QA 3S44A 1KA9H 5JS1A 1U2RA 2AFIE 2CLIB 4KFSA 5KSPA 4KXYA 4ZOLF 3S2FA 1EDOA 2H00A 3JQQA 2DP4E 4E88A 5C1IA 4MX8A 3VKVA 3HJUA 1USGA 2Y1CA 5LMUB 4G5FA 2Q07A 5HGXA 4OVKA 1LBQA 3H17A 1A97A 4NJOA 4EG8A 5GJVC 4PAQA 3EGDA 3W5DA 4R2WA 3O9VA 3MW8A 3M3PA 1WVGA 4Q39A 3I72A 3TTSA 2NUAB 1M2GA 2J4FA 3EGVA 1GSAA 2GSWA 1Z06A 2ZWOA 3G0DA 4BQIA 1FNMA 4K8RB 3SBXA 1MP0A 3GV0A 2BMWA 3WJ7A 1YS2X 2QD4A 1N6LA 3EYAA 1CUEA 3L04A 3VA7A 1KNQA 1UPUA 4QSMA 5HM6A 3LTNC 2G67A 1KVSA 3RV4A 1HLFA 3QUQA 4HAIA 4L3WA 2FK8A 3FROA 4G89A 3AR5A 3QE0A 1KOJA 1OLUB 3KHSA 5DNWA 2XUJA 2DHDA 2GD0A 1Q7TA 3IQHX 3PBKA 2J7PD 1X86B 4OUDA 4OX9Y 3OLYA 4JJGA 3WYNA 1H2RS 1M73E 2YH2A 3LQ2A 4KQ6A 2O8CB 1YJ5A 1VBFA 1ZJZA 4U02A 3PR3A 2CHEA 5JADA 2WD9A 4QUDA 4X6UA 5DGIA 4JQCA 1RJ9A 1C14A 2CXQA 5J4LA 4Z1OA 5EZ5A 3UAYA 1FUEA 2C99A 3KG2A 3PQ5A 1ZM7A 5HXAA 2OT3B 1XROA 2QMEA 1KDVA 4DLWA 4HDMB 3JQCA 2RGYA 3BRWA 2JCBA 4I1UA 4NPCA 4AZSA 2BFCA 2FZ5A 5AM4A 3D7NA 2BM8A 1WHTB 1IDN1 3EIUA 4YT8A 4Y18A 2EJCA 3CNQS 2HNKA 1HY3A 4P9NA 4P4GA 4ZQFA 3I9OA 5I7UA 1Y8CA 3MS2A 4IDNA 4O4HF 1UJ4A 1WB6A 1E2HA 3TZKA 5AFSA 1OAKA 5JSZA 5JXJA 1TJNA 2JLZA 3W2TA 3WDMA 3TZHA 1C5KA 1RHJA 3BWMA 5G3YA 1WUKS 2YIMA 3GYBA 2P9CA 2WT4A 1VL1A 3BH7A 1CF9A 4B6FA 3I76A 2NO5A 3TX2A 2QTFA 3IRVA 3R9XB 5BRNA 4ZOLA 2REQA 3SY8A 4I19A 5GY7A 2G71A 3PQCA 2NNWB 4HK4A 5LFAA 1XMPA 2HBQA 4G5RA 1J5EB 2NMVA 2QI9C 3TW8B 3KZNA 1HL7A 1ULAA 2CE2X 2JCXA 3AEKB 4GGPA 3TPZA 3UENA 3WNCA 1WDKA 3ELDA 1OWOA 4Q19A 3MSCA 4TWRA 4WZAA 1PT9A 3TSCA 4KQCA 5CB0A 3IPAA 3F1LA 2ILTA 2OLJA 2AZXA 2R84A 2RGAA 5CDFA 4PS1A 1VJ0A 3SJZA 5JVDF 1EGQA 1YDEA 2FX5A 4IXWA 4UTVA 5JLJA 5JH7A 1ODFA 4J6EA 5CM9C 1V41E 3S29A 3ZCSA 3EBPA 2Z08A 3GT0A 1H3FA 1P0MA 2NTVA 3HJHA 3K8YA 4JA0A 4WRRA 3KCNA 4GKAA 1GN9A 4GI7A 3JQAB 4IH1A 2EBFX 2JS7A 2BEVB 5E38A 1T5BA 4NV1A 1DS6A 1C7EA 3SHTA 3QU9A 3VMMA 2JDIA 4V03A 3HE3A 3PDIB 1WPXA 1ISGA 4Y2JA 5EWLB 3ZQKA 1SIUA 5K8UA 4KSBA 1KOGA 4MO2A 4IIVA 2FXIA 3AERA 2ACKA 1R18A 2I78A 1IOZA 3MMXA 4KX5A 3LVBA 4F56A 4LVUA 2IEZA 3FMVA 5A3SA 3CH5A 1A88A 4S0ZA 1F5NA 3EDMA 4UEOA 1MV8A 3WB9A 4TKVA 3JTMA 4DIDA 4RPGA 4JQZA 1L7BA 1BHSA 1OX5A 3JX9A 4HJRA 4K9MA 1PRYA 1HO3A 1FEZA 2JIMA 1AQ6A 4N49A 4M8SA 2IRWA 1M1YA 1Q2XA 3L6OO 2CNDA 5ECWA 4AQYB 3CE6A 4UHBA 2MSDB 3IEMA 2NQTA 3V1TC 3C7TA 1OTXA 1O77A 4XWOA 4BPRA 3JQGB 4O4HA 1ODJA 4ESEA 4QGSA 4QYXA 1UKZA 2GYVA 3GBPA 3V2UA 3TLYA 1O94D 3OD5A 4OHVA 3K94A 2D1YA 3GOQA 4A15A 1WOYA 1I0IA 2HO5A 1ZH8A 5CXQA 4L5AA 2NTJA 4OOFA 5JZOA 3CUWA 4JKIA 1XA0A 5JAPA 4BNZA 3SSMA 1GFIA 1XXHA 2LZ0A 3ORFA 1M54A 1I94B 4YRPA 1T4BA 1YK1A 2AKYA 1U2GA 3ANYB 1Z0DA 2EFHB 2W7TA 4G1VA 4UZEA 1GV1A 1HSZA 1R3UA 3OAAD 4MQMA 5JAMA 3EQ8A 2RHTA 3MT8A 4NMXB 1WVMA 4F4HA 1RRMA 2HRBA 3RVSA 4I36A 4QTUB 4RA9B 3DAPA 4XWTA 5LB2A 1QUEA 2HCBA 5JVDA 1ZA1A 3IURA 2QPOA 3T41A 1RXSA 4GXTA 1RMTA 2E6UX 4LBYA 1IG3A 4P4UA 4UHEA 5JJ5A 2G7MC 1NONA 3O0TA 4HX5A 5AVKA 1SQFA 2RMKA 2V65A 1UINA 4RZQA 4ZO9A 4RKEA 2OGWA 4WT7A 5TJ9A 4NKRA 3HCAA 1W4RA 3OU7A 3HUEA 3MXTA 3RFUA 3QWFA 2JVJA 4C0XA 5ELMA 2JIQA 3U3DA 4XYEA 3BAFA 1KR2A 1X7WB 1M34A 4DC0A 3W2GA 3Q3IA 2FR1A 4HDAA 3TLJA 1IN4A 1D6SA 2RHJA 2ZQZA 3TLMA 5KCZA 4US0R 3V80A 4A2WA 4M83A 4CFZA 2VTBA 2CJWA 3D3WA 4AURA 4EATA 4R0VA 1NW4A 5KWVA 2IY7A 3I05A 3HB7A 4F1KA 1P4HA 2GVNA 4GC5A 3S2UA 3Q72A 7AT1A 1QKKA 2C98A 1CPYA 1JHXA 2EKBA 2EV9A 4LK2A 1V9LA 3W79A 3GFGA 1LLDA 2Z56A 3A6KA 1KNXA 3K73O 4LHZA 4TMYA 3UZUA 4HFNA 4CL2A 2O8BA 2WWIA 1E6WA 2QTNA 2VYFA 3D8TA 3GC6A 3I6IA 3LIIA 5HF6A 3WWCA 2J0UB 2IPMA 2YRFA 5B4UA 2HHAA 2D00A 4RKYA 1L5LA 4WVLA 5D3QA 1Y3HA 2HD4A 3PJFA 3MWEB 1K5HA 2X19A 2VS1A 4RKRA 3T6KA 3QGMA 3CUEF 2OMKA 3MJDA 4GNKA 2VK1A 4RKWA 5HQJA 1YACA 3DYVA 4BFVA 1CJVC 1H3NA 3K0KA 1IBKB 1HLPA 4ESOA 2FRDA 5JWOA 4QELA 2IIQA 1BTOA 4W7SA 1OAOC 2P3OA 2EQBA 2ZRKA 4CIBA 5FO0A 3UOWA 2L0XA 1YL5A 5KOJA 1XLTC 1KSFX 4OI4A 2PGIA 1VRWA 1DZIA 3JQ9C 2E18A 3CTMA 3CXUA 5AI0A 3TIVA 3WLTA 4ENRA 2J45A 2BBTA 3G8DA 2FSVA 4RD6A 5KCMA 4DL9A 5I5EA 2NZWA 3WQHA 1ZR4A 2O8FA 2B1JA 4P4NA 1T6YA 1HZJA 4TV9B 2F1IA 1OKKD 4TTSA 1GUAA 4D02A 4GBED 1MC5A 1O6FA 1YULA 2C9MA 4M98A 4Q05A 4ETIA 1VL0A 1R9NA 3H5VA 2Y77A 1IL0A 1JPUA 1PJ8A 5CD9A 1QWSA 1I3OA 4WLEA 2OFFA 4Q4HA 4LX0A 3RVBA 4POAA 2JLRA 1N2XA 2WJ3A 1O0SA 2CZGA 3MCAA 3E9MA 5NLLA 4OXYA 3HVKA 2OBMA 1NXXA 2JCYA 4WZBA 4OP3A 3OPNA 3LCJA 1ESZA 3G17A 3JALB 4LJ9A 1PWZA 1F20A 4KQEA 1CU1A 4QBTA 4CMEA 4YCSA 3GG2A 1W19A 1XAIA 1KZ9A 3GNLA 4QU9A 3H1FA 3ZQUA 1HYQA 4E5DA 5K8IA 1SCNE 1Z47A 4RMNA 4UNQA 4H7IA 4QHSA 1T9DA 2GI4A 5LD2B 2C83A 2OKCA 4C6TA 1PX2A 1YBAA 1SCKA 3RSFA 1WB4A 3OKCA 4Z5XA 1K7FB 1GY8A 2D1FA 2H17A 5EIAA 4P58A 3M1YA 1Y9EA 4XR9A 1DT3A 2HGSA 4II3A 3HP1A 2YICA 3U80A 4G0XA 2FW9A 3W6OA 5M3BA 1ISHA 4F6RA 3EPKA 2HC9A 1Q1GA 2JI8A 2I8LA 2BHRA 4LNAA 4EY7A 3HCCA 4BUCA 1HQCA 2PDAA 1NY6A 3P9KA 5F76A 1XMVA 5ENZA 2Q5LA 4RYLA 3COYA 4UXHA 4O3FA 1JAYA 1DUIA 2WFLA 5TV2A 2IYOA 2AEEA 2HCJB 3PNOA 4G5SA 4MPTA 4R9RA 1CVRA 2C4HA 1V3VA 1V6SA 2R60A 5EKTA 5JJCA 1QO7A 3HO6A 1PYOA 4IF4A 3TR0A 5SZIA 3WLPA 1KY2A 4CM7A 1UADA 2B94A 3H8SA 2K7ZA 4AKEA 2VDUE 4MJ3A 4EPRA 4FE4A 2Q4RA 1EEHA 3LGAA 3SYMA 2IJGX 5ES3A 3TSOA 2Z2YA 3G3EA 2I2WA 2G6BA 1OX6A 3V32A 4AP5A 4F5WA 4B3MB 1M1XB 4EX6A 1J70A 3TPFA 2HA2A 2WW8A 1SVUA 1KK3A 2M2IA 3H6GA 3W5CA 1J8FA 5FOQA 1K97A 4JL6A 1JHDA 2J3JA 4DR1B 3FGPA 4PLWA 3KKQA 3CB4A 2PKYX 3PXCX 5EMJA 1E1DA 3TPCA 3TZEA 3A26A 5L40A 3K8ZA 4LSGA 3R5SA 4ZU3A 3WYGA 2ZWIA 4PQFA 4NBUA 1WXQA 5FA8A 2ABWA 1KE1A 4F7DA 1Z5VA 3VC7A 2XMQA 1REQA 3DNPA 3LSTA 3Q1KA 2JGEA 2OBNA 3HABA 4RVFA 3O4IA 1N5DA 5K51A 4TQGA 5BURA 1W0CA 3LGSA 5A4IS 5IH7A 3ZN2A 1SMKA 1DIBA 4BNFA 1W5FA 4FFSA 3K6SA 3TXXA 3UWDA 4BPBA 1W96A 4LHWA 1EGAA 5EUQB 1NU8A 1L2TA 1M10A 2RSLA 5JXGA 2A94A 3PKIA 2CUTA 5GINE 4RTOA 1IHUA 1PLKA 3HKEA 1T5LA 3T0IA 1YZ3A 2QAIA 4XD7D 3A6GA 5AVZA 2XB2A 2ZIGA 2IDZA 1QO0A 4TWZA 3GEBA 5J2UF 2NU7A 2QZ9A 2OESA 1T9BA 4N9WA 5CB4B 5AKLA 1T2NA 4DAOA 4D4MA 2GLUA 3C39A 2JLUA 4US1R 4KRGA 3TZCA 5CCEA 4AG3A 1FX0B 3EUAA 1B8UA 3ZLUA 3FUWA 4DEVA 2ZG6A 1AC5A 1U1FA 2A9KA 2ERXA 2PEYA 3SNHA 3S1SA 5C51B 3WQQA 3CEHA 3MQ2A 1L8OA 3GELA 1E3WA 3DL4A 3A25A 4GGMX 1FA9A 4OATA 4CR6A 1RZRA 4JAVC 1XR3A 3WOHA 4DQLA 3IAXA 4K81B 3NHRA 3VH2A 1WZUA 3I01M 1OFGA 3EMDA 2IWHA 1FU8A 3FUXA 5BPHA 5FHQA 4B4OA 2XQIA 4YWJA 1XAHA 1Z8NA 1QDUA 2FWPA 2NSJA 4P2GA 4TMXA 3F0TA 2A5FA 1B15A 2ZB8A 4YQEA 4E1VA 4TVOA 1A95A 4JV5B 3IP1A 2GPWA 1U28A 2Y1GA 1QV9A 2Y1EA 3G9XA 4PHCA 2I1VB 4D0RA 2EJWA 1V95A 4R7TA 4RANA 2H5IA 3OWOA 5KNCA 5DXAA 2DPGA 2FMUA 2BHLA 5HCUA 3VO8A 4NOKA 5HMMA 3F7OA 1YUBA 3L9WA 1G38A 3LT4A 4IM7A 3PHHA 1HE2A 4M76B 5K01A 3HLKA 3M83A 4GPIB 2YVKA 3L84A 3UWSA 5K0TA 2Z9CA 5GADl 3GH1A 5EJIA 3HB9A 2DF8A 2POQX 2OA0A 4CKWB 1E1YA 1LY1A 2OL4A 2VJAA 3QVTA 4JP8A 4OBXA 3ZIDA 2PR7A 3F7NA 4A82A 1X3SA 1YJCA 1EHIA 1UEXC 1I1QB 4QBGB 5HZGA 1COWD 3IP9A 2HMVA 5KYWA 2IXBA 3JWHA 4RDCA 3V00A 3FYUA 3GLSA 4UM9B 4Q9AA 4ZWNA 1E0KA 2P9BA 1C1XB 1XC7A 4KOEC 3AILA 1CFJA 3U19A 3M6XA 3RBAA 1EI9A 4LJLA 3W05A 3WGQA 2JH8A 2XUQA 2OVFA 2I71A 3HKCA 3QU2A 3K0FB 5G2OA 4B40A 5J2UA 2QRZA 5BSGA 1CZLA 1SQ6A 2JZOA 1PG5A 2NU9B 3I6QA 1SCUB 4OHRA 1Q1ZA 4UPDA 3O4GA 3SFTA 2JFNA 3IIJA 3KKLA 2XSZD 3JQ7A 4TLLB 4QPPA 3EC7A 1ITZA 1Y1RA 3WK7A 1EVLA 1GL9B 4HPJB 1R4AA 1AGNA 2CL7X 3NANA 5IDXA 2G28A 2WNSA 3C97A 2B2XA 4GPAA 1N5RA 1FQOA 1SN7A 3A11A 4N7RA 4BXOA 1A1VA 2IH5A 4ILEA 1D03A 2W2VA 4ESHA 1FQKA 4P8RA 2EU8A 1YGYA 3S68A 2D8MA 2J5BA 1U0NA 1MJHA 2BZ0A 5D6OA 2R6GA 1VBNA 2ZYUX 4R1LA 4XDYA 2J09A 3RT9A 2ZTLA 2CLDX 4GMDA 1QIKA 3LL7A 4B84A 5JOQA 3DEKA 7YASA 2X40A 4KWIA 1JFSA 4A0RA 2LVBA 1EMDA 2PD3A 3FPCA 1KFJB 5JEEA 2Z1DA 4CEJB 3SIWA 1NR1A 2QXTA 2EBHX 1S01A 1TCVA 2P3LA 5B2FA 1S3FA 3R6DA 4BP9A 3TIFA 1QGOA 3EFBA 2G40A 4FCVA 2XNDD 2QLTA 1YS7A 5CDTA 3LKVA 1XEFA 1IUKA 4Y2TA 1NC3A 1OIWA 1L7XA 3JYQA 3GR6A 1HT2E 3UNXA 3VYSB 2BMEA 2FPSA 2ZWAA 1CYDA 1OU0A 4V0QA 2WILA 4H0FA 3T9CA 2PXHA 4V38A 4PGMA 1G5QA 2P0EA 2NU8A 2CXNA 4AKSA 2CDBA 4QVGA 2NZ8A 3BBLA 5EUMA 2UYCA 4D9JA 1SQGA 3U31A 2I6SA 2P6PA 2VL7A 3DV0B 3LOQA 3PS9A 1FBTA 1OXBB 1VE5A 4JYPA 4Y2QA 3JR3A 3TXYA 1AUVA 1PR4A 1YZKA 2PWZA 2ECFA 3KOOA 4WOCA 4DUGD 4NCIA 2B1QA 4YRCA 3DTVD 4JUAA 3OOWA 5HF8A 1V3TA 3WYAA 4LFCB 2H06A 4UU1A 1MDBA 2CHVA 4NMWA 2W98A 5ESRA 3EZGA 1BX1A 1PYDA 2Q5HA 1SEPA 5EYPB 4F4FA 3WGOA 3GI1A 5JCOC 4KIFA 1OLXA 1YT5A 4D6XA 4KR3A 3HR8A 3NPMA 2WPDD 1K0UA 3OBIA 4KQMA 2Q3DA 3MTQA 3VPHA 3O73A 1DC4A 4CRWB 3R3YA 1YZYA 1R4MA 5GONB 8ABPA 4WY8A 4UNRA 3ZC3A 1NDUA 1IHOA 1J39A 3THYA 2IW1A 2WDZA 1QFSA 1BMDA 2CSXA 1XRLA 4C3OB 4R8MA 1VDMA 1YTUA 4JR1A 1S4MA 3MJCA 3SU8A 2RARA 2D0OB 2O8DB 2ZPUA 1NUAA 1FS4A 1O95C 3KTOA 1U0TA 4M3NA 4PQEA 3ESCA 4Q82A 2SKEA 4HB4A 2PGAA 3QKRA 3E3AA 1G3IA 5AH0A 1KP3A 3SZLA 2GN0A 4YYEA 4E5KA 5JNLA 1ZI8A 1RQNA 3E53A 1XALA 3IDZA 3NU1A 4MUAA 2D7JA 4TYMA 5FV4A 4V3CA 5IRCD 1VYHA 3RAPR 4RM3A 1P45A 1P77A 2FUG6 2H1WA 3GMIA 4CQLB 5A2GA 2RBKA 3QFHA 3PU6A 4PLYA 3GOHA 4R3WA 5I5GA 2NP7A 1C3VA 2C42A 1GYRA 3AHHA 1F51E 1I3NA 2ZJFA 3CF4A 3IB3A 1K0FA 3UJHA 4C29A 1QHNA 2CL0X 4IHQA 3RS9A 1L8QA 3R20A 4AI6A 3K4QA 1CY6A 1Q21A 3AHFA 4WNAA 2B3TA 3SLRA 1I7QB 3IUEA 4YBRA 4MCJA 1WO8A 2D2IA 3HYNA 3AH8A 2PZEA 3F8SA 3JQAD 1YO6A 2XB9A 3I9V6 4AKTA 4BMCA 3OQJA 1ZGBA 2IYAA 1RYEA 3L7MA 5DK4A 3MOIA 4HD8A 5I9MA 1A71A 4O29A 1Y4SA 4CLOA 3IESA 4FIZA 5JSFA 3ENVA 3IB6A 2XMSA 3UPDA 4F3CA 2IOFA 1PNRA 2OZEA 2J7PA 1SPXA 3QVJA 4QOGA 2VLIA 3IILA 3VR5H 4ETMA 3P19A 1BVRA 4LYJA 4Z3DA 3BSSA 4D1YA 5HCNA 2OYRA 3RUPA 4XGQA 1NBOA 5KYUA 3VMFA 1DC8A 5E2AA 1FTSA 3ROQA 3RU7A 1PWHA 8LDHA 2DQKA 4JOSA 4LRYA 3DEYX 3RH0A 1PR0A 2F4VB 3JD0A 5DM4A 5I7AA 1T3GA 1KK1A 2FOXA 3U13A 6CHYA 1XRSB 1JUDA 4LNUA 4AN0A 5ADVA 4DV3B 1R0ZA 1S2IA 1KMIY 1JHAA 2GK6A 1R6VA 4G36A 4X3CA 1X8KA 4IIXA 1NRIA 3VSCA 4A0FA 2AWOA 3JQFC 4FEYA 3PX7A 1O97C 2LP4Y 1YZTA 2BFDB 3REQA 3LY8A 3OQOA 2W22A 1QE5A 2W0MA 4MUGA 1JAZA 1GT6A 1Z08A 1RXEA 5G4KB 5ER9A 3ZX5A 1E6CA 1FP1D 2PA0A 4FJ2A 4CDNA 3OIVA 4JB3A 3RF7A 2I22A 5HOEA 1TL7C 1WULS 2VK2A 4XDGA 2JJ8A 2HZ7A 3LXXA 1K08A 4HGQA 5H0IA 4RTKA 3AVXA 1KWKA 3VSBA 3TCNA 5KJFA 3KUDA 5FBRB 3J81k 3CCCA 5GZ1A 2QAGA 4A73A 4J9VA 4KLCA 4B3TB 3K09C 1XT6A 3R0ZA 1L7VC 3FPGA 3TIGA 3WLEA 1G4UR 1TYCA 1ZW1A 2R47A 2XYHA 4Z7OB 5LOVF 4A8JC 3ZWWA 3O4JA 1MPXA 3IP3A 2PUCA 2Q6VA 1JQAA 3BTUA 4EB0A 4M22A 2NW6A 3DJYA 3ZCPA 3LVRE 1CY4A 4GW3A 1S7GA 3C7CB 1RWMA 1HTBA 3NONA 1JHVA 1GL6A 2VHYA 4HRVA 1O8BA 1TYZA 4XLLA 5FXMA 1RVV1 5THKA 3QQ5A 3UK0A 1K6EA 4KHZA 4DNFA 2FPGA 2O0LA 3OE1A 3QU4A 5F2OA 5DIZA 2Z2IA 4TTPA 4NS4A 3FH0A 1JR3E 2AOUB 4KPUA 5DNAA 3DWFA 2PFSA 3FBTA 3DZDA 2WLTA 5KPJA 3CVYA 1ZAYA 3I04A 1UC5B 3PQ4A 2CLMB 2A9QA 3O03A 1WOMA 4TVBA 3HVIA 3H83A 3EUFA 1RAGA 3ZD9A 1PTKA 4N0MA 3V5NA 5FEMA 5C8DA 1JHZA 1K6IA 4IXNA 4PFJA 3WOVA 3PICA 2IUSA 1LZKA 4AZVA 4O2RA 2O19A 1DAEA 4DZRA 2MSEB 2Q4OA 3L82B 1T0IA 1QAQA 1NHGA 3GGCA 4W1RA 1VZ3A 2ZR9A 4N39A 1YI1A 2V9ZA 1VLJA 3Q2OA 3UHFA 4IUYA 4EVSA 1DWUA 2BFWA 1XJ5A 1F5SA 1PT8A 1NPDA 1Z88A 3NHLA 2X9VA 5AKZA 1T2VA 1I51A 4FS8A 2VKTA 1AHPA 1VJCA 2FUG1 1CFZA 2AEJA 1X7YA 1ZHHA 3BIJA 3CH7A 4G5OA 5GJCA 2C20A 2O4UX 2QU7A 5JG7A 3VZPA 2HJHA 1ZEJA 1X8LA 4B8YA 2A8YA 3P71T 4Q1FA 1VHWA 3FZYA 4AK9A 1F0KA 4OK5A 4ARZA 3KVRA 4HQRA 1LVHA 2IEDA 2WTEA 4HLNA 1QJ4A 4Q01A 1HTWA 1A9TA 3AF3A 3H7IA 4C30A 2FWMX 2Q3LA 1J0BA 2D54A 1O94A 5BMVF 1DAKA 4EHFA 1JVSA 1U8CB 5ULLA 3TL3A 1B0ZA 4MHSA 1DAFA 2JIRA 4FEAA 4KRXA 3VSAA 3H2HA 3R5FA 3I58A 4LYEA 4F5YA 1GQYA 1SUSA 1A8UA 3CIOA 4OQNA 5EE9A 3RS2A 3NTLA 1X1CA 3AVVA 5LOVA 3STYA 3BMCA 3ILYA 4ITUA 1NIPA 3MLBA 1E4EB 3VFDA 2CF5A 1K66A 3AVPA 3OAAA 1CZRA 1DVRA 3DCIA 2QLNA 4B79A 1W7AA 1ESEA 1QPZA 2C9ZA 5F5NA 1FRNA 4TTIA 1S3SA 4IJ6A 1ZEMA 3B3QA 4ZZIA 4TYWA 1R0YA 2VTVA 6REQA 2DMRA 3GJ4A 4V0ME 2FN7A 3IAAA 4LXGA 5ABPA 1CUIA 1JPNA 2IYEA 4Y6QA 2C5FA 4R1TA 4FUTA 5HGJA 2YYYA 3OM0A 3QA3E 4AZ0B 4MUFA 4BNLA 1NSTA 3FTDA 4Q3LA 3IPYA 3MTEA 3UMFA 5DCLA 1Z33A 4Y2GA 5JWRA 1Y82A 5KI6A 5KYYB 1JU3A 1FJ2A 2PPVA 5LWQA 1EUYA 2COEA 2ZBGA 4WKPA 2C1EA 2Z43A 3LYLA 1Q1NA 3H7AA 2BFEB 5CFRA 1JR6A 2JHPA 3HN7A 3PVSA 4D98A 3IERA 3DZGA 3GVCA 3RRBA 4Q6WA 3SGLA 1I2BA 4AY2A 2CVPA 4HN2A 1UDBA 4IIDA 1Q95A 1OWNA 2YHIA 4JI4B 4B4WA 3G13A 3SZGA 4Z3KA 2QF7A 3IQIX 2UVQA 4AJ9A 1VBMA 3KEQA 1PEKE 4Z4HA 1CRWG 1MB2A 1RBYA 2Z1MA 3K31A 1DKUA 3H1GA 3P0RA 4HGPA 1FDIA 2WUFA 1N8NA 1IWBB 4RJJA 5BVGB 3EA0A 3QVOA 2BWJA 3ZTYA 5LN1A 1XDGA 3O8DA 1H23A 1QFZA 1UOQA 4IJMA 3E0QA 3PC8C 1KEUA 5AYVA 3O92A 1UBUS 4ZCPA 1KERA 3LBHA 2ZBFA 3SQLA 3MCZA 3P4YA 1GGVA 1ICIA 4Z8XA 5ENVA 1JG6A 4LZPA 4MTLA 3UMRA 3V8VA 1U5BB 4CF6A 5BMVA 5GVRA 1GPNA 2ONKA 5JXHA 1N0UA 1LLQA 2AJLI 3LUDA 3VPFA 2DETA 1YC2A 3G8BA 3I73A 1BN6A 4D2IA 5E2BA 1S6YA 4FR2A 1E5LA 2WABA 1RKQA 2AH5A 4CV1A 4DN6A 2CDCA 1X3LA 1LTQA 3KPVA 3PQ2A 1BYUA 2ERYA 3EIHA 4P4TA 4Q9LA 2E21A 1YVDA 1V4NA 2VQSA 3FD8A 1P2FA 2V7BA 5DX1A 3WYCA 3E3LA 1BD3A 1NXOA 3H9GA 2I0FA 4CYMA 3C1OA 3LK7A 4FKMA 3ZGNA 3QE4A 1OKKA 3HJTA 4KN6A 5KTYA 4M36A 1OBVA 4QPCA 1ABFA 3F7MA 1O4WA 5BWOA 5DVZA 1SXJC 3IUBA 2FPWA 4KPYA 3QU7A 3BTVA 3FFBA 4MHOA 4UARA 5DU2A 2C97A 2Y0EA 4X24A 2Y1OA 1X1QA 1NMQA 1SOMA 3AFMA 2A0YA 2R4TA 4CU5A 4YCCA 1GARA 5EIEA 4NK4A 3DOHA 4WA8A 3C5EA 1HEUA 3K9FC 3C8ZA 3FDZB 4HDSB 2P4EA 1RRFA 2ZDHA 3N2KB 2PGXA 2FDXA 3D7LA 5D3ZA 5H68A 2F90A 3U6KA 1GPYA 3LY9A 5C31A 2CKDA 4C2BA 5IASA 4DLTA 3A6EA 3BK7A 3EASA 3C5CA 3BGSA 4MV6A 2WIKA 2H2IA 4PLZA 4REQB 3EPRA 3VXKA 4BKOA 1WKVA 4U9HS 3A58B 2P2YA 2W2OA 2Q3HA 1GRVA 1FE8A 2OHXA 3OQIA 4A8HA 4W7IA 1FRZA 2B7LA 3DT6A 3D6NB 3HCOA 2D1RA 2I4TA 4FFPA 1VSVA 5JDCC 3DBOB 3Q0TA 4FCTA 2JB9A 3ITEA 3AIIA 3O2QB 3K9GA 1RWOA 2GCIA 5ADWA 4RJ2A 5A6SB 1LFAA 3TLXA 5GJBA 4GZ5A 1G7RA 2YTZA 3DSRA 5B1EA 3K2EA 3IAM6 3DLCA 1WABA 3UFXA 3VI4B 1QIEA 1T34A 1THTA 2XE6A 4KMMA 1FVOA 2WG1A 1HMYA 2Y6UA 4AL4A 5C8ZA 3ESDA 2G6TA 721PA 5C8YF 2YJTD 4KB5A 1NQUA 4EI2A 3KQHA 2JLSA 3D0OA 3ABSB 4S05A 2F59A 2HEGA 4IFIA 3N8GA 1E2FA 2OZVA 1THGA 2Q4BA 4MWBA 4R98A 5E4YA 3ZE7A 3AL2A 2OZKA 1C1YA 4GKVA 2OO5A 4GQAA 4L02A 2LTAA 3RS0A 1NN0A 1JE1A 1QS0B 2EJBA 3GRPA 4CDMA 4QC2A 3I2HA 3SQWA 1OZAA 3D3KA 1VHDA 1TT5A 1Q3TA 1YZNA 5T4HA 2WJJA 5IJ9B 1JALA 1T0PA 3EXIA 2HFKA 3ZZUA 3LWBA 5LZ4A 4JK3A 2PANA 5AXDA 2I3AA 2J3KA 1XZBA 1AQLA 5D5PA 1E9VA 1VPVA 5C34B 1NVEA 2FW0A 4AZ3A 3CUUA 4DZTA 1Q91A 2PMFA 3V7UA 3VSEA 4YUZA 4ZEMA 2P5YA 2VWPA 1CG6A 1EA7A 1GN8A 2IF2A 4C4XA 2PZMA 1TAHA 3PGXA 1RLTA 4XARA 5DBHX 3F1KA 2BFFA 1Z2AA 2WVJA 3LPCA 4UCQA 5DCUA 3CX4A 5DNYB 3QVLA 3SBEA 3QLUA 2I2AA 3N86A 4GOXA 5K09A 3L46A 3ROXA 3LPMA 4EA6A 3ONNA 4HVAA 4BFZA 1C30A 1L3BA 3R2JA 4LXHA 2AV6A 4HRYA 1KJYA 5FUMA 2I6TA 4MW0A 5K45A 2HMYB 1PD1A 3IT2A 1Y6GA 4XD7A 4D3ZA 4BMNA 4DIKA 5JSHA 4RGBA 3V7FA 5KQGA 1T9HA 1U1EA 2O23A 3L8EA 4KXMA 4KR0A 1GNQA 1P2UA 2A92A 1F4LA 3KDPA 4HHEA 1ODSA 5D84A 4TKUA 3QKUA 4C3UA 4LRQA 2KW5A 4Z3OA 5JZMA 4M7PA 1XVIA 1Z2NX 2BCGY 1GILA 3NKFA 4QTYA 3JPWA 2BMFA 2O1SA 2QQEA 2GKOA 2WJWA 2ZYWX 5AQ1A 3K9HA 4I4TF 4OK3A 4QT0A 3T5GA 4O08A 4PRLA 5LNK6 4MIOA 1WBDA 3FSJX 1E2GA 3KC2A 2QSZA 3LMKA 3NHWA 1U94A 3RASA 4NE7A 5H81A 3REFA 3ZWDA 1GZUA 2QUAA 3CNLA 3G8YA 2IHZA 4DMKA 5A9SA 4JELA 4OFWA 2W9XA 3M70A 3HVRA 3KM0A 3Q8WA 1W48A 3T3EA 3THXA 3FHTA 1AO3A 4YV1A 5IK2D 4QU5A 3SHFA 1DBIA 4EFDA 1KAMA 2BR3A 2X2PA 4GLLA 3L4BC 4EL5A 1DQRA 3W6UA 5C8YA 3LT5A 3FNQA 4FCWA 5JH7F 4WKGA 3SE7A 2ZFUA 2QX6A 4MQEA 2C04A 1ONBA 1P8AA 1VL6A 3OF3A 4BMSA 1X1SA 3EPJA 4KIUA 1FNSA 2D1QA 2VFAA 2XRYA 5BN4A 5LQMA 3NRJA 4G07A 5TEWA 3TQOA 2FKNA 4EARA 5F3WB 4GKKB 3F4BA 2IVZA 4YAGA 4LWOA 1MT3A 2IX3A 3H9UA 2HEIA 2YZ2A 1QH8A 1F8UA 1JX6A 4P7BA 1XYYA 3U5ZB 2JD2A 4WXPA 4PEVA 1XXLA 2J48A 1XGKA 3QWIA 4FT2A 3GJQA 1Q14A 5EKXA 3SF0A 1Y6RA 3SIRA 4IDQA 3BT7A 3T4EA 3QG5A 2X13A 5EHNA 4E7OA 2PD6A 3B6ZA 2PUFA 4Z4FA 1T9CA 4DRYA 3VHXA 1NSFA 2G0NA 4XYLA 4DABA 2PKQP 3IAM1 3WIDA 2OGSA 4MS3A 4DRXB 3UF0A 1COWA 2A1TR 2RAVA 3A1TA 3ZZMA 1IMJA 2XTNA 3ONEA 4FFLA 4UULA 2HIAA 4L28A 1VKRA 5FQOA 5AUPB 5AVRA 1SVLA 3IEVA 2ZYRA 2AFHE 2P35A 2JH3A 1QHIA 1HQDA 2B1GA 2QMQA 3ORRA 3NI2A 4C4AA 3K20A 2FMFA 1IRIA 3A3NA 2KQUA 2X42A 3L0CA 3AUUA 1DKNA 4OQEA 4ZZ0A 4D99A 4BO3A 3VHLB 4EYOA 2AMFA 3N75A 1G55A 2XSZA 1R8QA 4MDHA 1FPQA 2GGSA 3TFQA 1GTVA 4EY8A 3GAZA 8AT1A 3GEMA 5AXCA 3E82A 4K05A 1ORWA 1TTPB 1RABA 2RHGB 3GLQA 1GSHA 1UKBA 3ILVA 4I4TA 4L5IA 1BSVA 3SHQA 3R9WA 4JYCA 2WHQA 1FMFA 2ES4A 1LV8A 3LFUA 4KMRA 2D13A 4ZC1A 3IMCA 5FWAA 1KMHB 1W0KD 4Q9IA 3P0EA 5DGXA 5JD3A 4C20A 5JS6A 3ADKA 1Q83A 1NLUA 1RVDA 2VT6A 3M2TA 2OC4A 1ADJA 2YMMA 3I64A 3OA0A 4LFAB 1HSOA 3OX4A 3WQSB 2ECKA 4ITRC 2F4NA 2QDKA 1V96A 4MV3A 2ZRGA 3H1TA 4FYYA 3WWOA 5ALVA 2P91A 3FLBA 5AW8A 9GPBA 4N76A 1DPGA 1TZ2A 4PBRA 2NUAA 1CUUA 3V8MA 1YNOA 3AM3A 4QLAA 4DXHA 3GLRA 4ZHQF 4KWCA 2FCAA 2QLFA 4Y6RA 5KQSA 1ZOIA 3IP7A 3R9KA 2V58A 5L3VA 4B3GA 1E99A 2ZLBA 2VYVD 4U6NA 2XNDA 4PYNA 3B9BA 1L6RA 1O89A 2OZLB 5A9TA 3TKAA 3SG0A 2GD1O 1EQUA 3H4VA 5MGNA 4JUFA 2CCGA 4CEHB 3NBUA 2GESA 2UXBB 4ZVQA 2JFBA 5HDQA 5ICCA 4CUZA 4U7DA 3EY4A 2WU3A 1ZVMA 4NPAA 1PBTA 1LSSA 3C15C 4JU8A 4C78A 2TMYA 4XIFA 4Y6GB 3TINA 1JA9A 3FSRA 1JR3D 5EQFA 5FLEX 1IG0A 5AI9A 4F4JA 5EEGA 2BGGA 3A10A 1NDHA 2J9ZB 2J7KA 4IUBS 3KUXA 3I9FA 4Z8YA 4BNTA 4DUGA 1P4GA 3OC6A 5K3CA 1J20A 2QN3A 1QYIA 3FN4A 3DTVA 2G5TA 2P8SA 3BCUA 3LX5A 5DCYA 5KTNA 1TOAA 2UZ1B 3M34A 4D43A 3RK4A 1TLTA 4HDMA 2O2DA 5JNTA 2KMLA 5IANA 4B45A 3Q1LA 1QX4A 5BV1A 1R66A 4R6WA 1RWWA 1DE0A 3KEFA 3DOCA 3E84A 1WHTA 3Q7TA 3WJ2A 2J33A 4BAZA 4D5EA 2AKAB 2QSYA 4ZFNA 1OBCA 4I46A 4YRJA 3D4IA 2HT1A 4NRDA 5P21A 3U60B 2WPDA 1QKJA 4UUBA 2PJZA 1QRUA 2Z5VA 2CZQA 2XMDA 3D4BA 4Z0NA 4DGQA 5A5DA 3UANA 3RR2A 4YALA 2JARA 3T1VA 3M6MD 5IBRA 1V4BA 1B3BA 1BFDA 1XD8A 1TRKA 2ZRDA 2PGJA 1KH1A 3D02A 5HEKA 1TO1E 3EWAA 4UPEA 1IY2A 4IQ8A 2GD6A 1V11B 4XSVA 5CLGA 4YRBA 4OQQA 1ISSA 2AI2A 2HDHA 5EZ6B 3W9UA 1VBKA 3BRSA 1S8AA 2VH5R 5E1MA 2XF8A 1NATA 3CZRA 3FOWA 1ZL0A 1KC1A 3V9AA 3WY9A 1ZVVA 3H11A 1ZLYA 3G0CA 2MDTA 5K7SA 2CFIA 4U7PB 3TGPA 5COBA 3KU4A 4KZKA 3AR4A 5MN5A 2IUFA 3NBKA 2YHUA 5FYQA 3FWKA 1JMVA 3HVHA 3FNGA 2AQ8A 4Q4JA 1NGSA 2R1UA 5E4TA 1PN3A 3PUWA 1UIMA 4PG7A 3TRFA 4ZHQA 4LJ4A 2VP6A 4KO8A 3DVQX 3DZBA 1DKRA 4MB6A 3WNZA 4BBJA 1G2PA 1TZJA 4NULA 4DGSA 1HEYA 1A27A 3BSFA 2XNJA 3K0BA 2FYTA 4PTYA 5JMTA 2O05A 2VCHA 3C6YA 4HWKA 4L5YA 3WV5A 1FXUA 3K5HA 3K0AB 3NC4A 1IN7A 4YJDA 1CULC 5ES4B 4OU4A 1NAHA 1Y1TA 3FUUA 5AKGA 5DLDA 4DA0A 5I4BA 2WSMA 2OBFA 3JQAA 4YRTA 2ON6A 3O8LA 5FOWA 2BEVA 2FFBA 5BR1A 2JAHA 4ZU6X 1GQFA 3T3HA 2DLDA 4B3DA 4JBHA 1D2CA 1V9CA 4DLBA 3M5CA 4MW7A 2X0NA 3FTPA 4WXRA 4WXHA 5D1NA 1ZN9A 3ZVMA 2B5OA 2DPMA 3EFOB 1I3LA 3KTAA 5F2KA 1IBMB 3AHGA 4QVKA 3HYCA 1OQAA 1OTHA 2ZYDA 4MOWA 3KOUA 3ITKA 1R0SA 5ITWA 1DADA 4A6PA 1EHYA 1SQ5A 2P9HA 1UF9A 2YOFA 2CHQA 1QXSA 3JZMA 1L4YA 1T8TA 3LQRA 3MRTA 4PGFA 4TUYB 4BMOB 4EG5A 4HVLA 3OZAA 2KBEA 4Q4LA 1FNDA 3DS8A 2BHSA 4QT4A 3C16C 1E7WA 4PQGA 5K3OA 3JVUA 4LKRA 4N4AA 1UK9A 4O1MA 1A1SA 2C84A 1FNCA 1V5WA 1XA3A 4G9EA 1EDZA 1PL0A 2QVCA 1VTKA 4OHFA 3JQGA 2ZBDA 2EW2A 2O54A 4IY1A 1DOAA 1YIOA 2XXJA 2GDJA 3NHZA 1SVIA 3I28A 3OECA 4FTWA 4ZT2A 5KC8A 5HRCA 4PAMA 3BDAA 1VJ5A 1HI9A 2QRGA 3LLUA 1X13A 3ZV4A 1XRQA 1WQ3A 1JHYA 1W88B 2ZROA 5HZKA 1PYGA 4LF8B 5IT9A 3IQWA 3B1KA 4R54A 1M6EX 2DHRA 3BHNA 4ZA2A 3IVXA 5AW6A 5MN4A 1E1NA 4MUXA 3QUBA 2FX3A 3P2MA 4KBGA 1FZTA 3KALA 2HU2A 1YI8A 3K32A 1PG0A 1ATIA 1JWBB 1S9DA 5EZYB 3MMSA 4KV9A 4HGOA 3W6ZA 3KOYA 3FCUB 5I48A 4BNGA 2VP3A 2W4IA 2PKQO 4FLMA 1SXJB 4MW4A 4UAUA 4XPIB 1B8OA 1GVHA 1L4GA 4C7VA 3MUEA 3T94A 1E1CB 2BT4A 3GUHA 2BTQB 2V4UA 3X1MA 4NCNA 4B87A 4TV9F 1QP8A 3KKEA 4ZO6A 5LBIA 4A0QA 4BVFA 3GLGB 2JBWA 4KGZA 2W42A 3C24A 3OOSA 4RA9A 5CX1A 1NBME 3ZHOA 3DVAA 5FI5A 5ESXA 1P1KA 4RHEA 2R1TB 2XF2A 5CGZA 4WXYB 4A0HA 3R76A 5BWCA 4EQ6A 2G72A 3KJEA 3L0DA 4E5NA 1F2UB 3QBVA 1P80A 3JZFA 3TQTA 4YMGA 4HVTA 5JI2E 2BSAA 1WXDA 3WFJA 2FSHA 4EITA 4YV0A 1K6MA 2AOTA 3FR8A 2NU6B 1U7TA 3K72B 3BN3A 4K6KA 5DLPA 4DWVA 4MDFA 3LOPA 1KQGA 3VR3D 2IYSA 3I1JA 2X0DA 2GHRA 1KAGA 4KXLA 2RIPA 1X7WA 2G0TA 2H1IA 2X4DA 3IV7A 4B74A 1RXUA 2B21A 4ZDKA 3VKUA 3WBFA 1SH7A 3KLMX 3OKFA 1NLFA 4E5SA 2XY4A 1JQDA 1YRHA 2ERCA 2OTCA 4LRUA 3OSZA 2DFVA 1IH8A 2WJ4A 1LRKA 1R1DA 2DRIA 3BWXA 1PO7A 3DL7A 4JC8A 4IFTA 4HUQB 3U4DA 5BY2A 2VDVE 3DZJA 2BMDA 4QPNA 5FTJA 1LLCA 2P75A 2FN8A 3KR0A 1FYFA 3UO8B 2I54A 4OKNA 16PKA 3C14C 1OPXA 2JJQA 3O8NA 2FF7A 3R0JA 1ZSVA 5ALLA 3B6KA 1L6IA 1MABB 2PX4A 4WHMA 4OB8A 2XIJA 4QXMA 4AO7A 2AS0A 2J0UA 1U8TA 3C4JA 3ML1A 2A1UB 2O2ZA 4AJPA 5ENDA 1TK2A 4AD8A 3C5HA 3MWEA 1SXJE 2H18A 3U4QA 4B6OA 4TWAA 5LLDA 3GBSA 4RCVA 4ACBA 1W2HA 5ALPA 1GD1O 2WIFA 4HLCA 3GLGE 4WE3A 3AV3A 3CLUD 1ZU5A 4TRRA 2BYTA 4JZKA 5CHEA 4MIYA 4NPHA 1WPRA 2PGOA 3GJSA 5HYVA 1Q1EA 1P18A 3P5BA 3NTOA 4X3PA 3AI7A 4X84A 1TD1A 1E1RD 5A71A 3O8CA 4E70A 3U7QA 5AI5A 5K0FA 3H87A 3D8BA 2QUJA 4YMHA 5CTJA 3VAYA 2PKXA 4TV9A 2M6KA 4V39A 1UT6A 2WKPA 4OGFA 4RHYA 2Q0SA 4N0EA 4CF4A 4MW1A 2PXAA 4FOTA 5J43A 4XJSA 4R7ZA 1SUEA 3WBJA 1OFTA 2OMEA 2YFHA 5EHZA 1DARA 2AF4C 3HQ4O 1CEQA 2IPNA 1SC1A 2C31A 2Q5IA 1EFKA 4J7CA 1U3VA 3IYLW 2FPRA 3EMKA 4PZUA 1U3CA 5HK9A 2F3QA 5AUQA 3R8FA 3JALA 2A14A 3MHPA 4BVBA 5A0VA 1T2AA 2G8LA 1PK9A 4QQRA 2BFMA 4S2EA 4JXKA 4LV8B 1PJCA 4P5DA 5E3HA 1UJNA 2D3TA 7ABPA 1FXWF 1MORA 3JYHA 3K4PA 4MRMA 4NMMA 4I1OA 4YMTA 1EBUA 3HRIA 3I1YA 1AS0A 1JU9A 1CHDA 1SHKA 4WCFC 2ZI6A 1UWLA 2O4CA 3DOJA 3RARA 2DUWA 4NU5A 4EG6A 4MP6A 2P3SA 3EQ7A 1HMPA 5CB4F 2EX0A 1TGYA 4JLNA 2GF0A 2CXOA 4EPYA 3HFRA 1RQLA 1ZOLA 3LPLA 1BCRB 4ZK2A 3EG9A 2CJYA 1QDEA 3RABA 4AF8A 3TLBA 1RI4A 3BPSA 2WAOA 5C4MA 4KLAA 3ZU4A 2IXDA 2BJHA 4XWKA 1XTBA 1AD2A 2QW1A 1GPUA 3I6YA 5CNMA 5J4YA 1GVNB 4WN9B 1P0CA 3O93A 2O14A 4P35A 3N7UA 4EHNA 3E7XA 1DEKA 1PW5A 4BLTA 1ZW6A 3WFZA 1U2EA 4YLYA 3IQFA 1ECJA 1XZNA 4RHXA 4K9KA 1E79D 1CF2O 1Y48E 4JR2A 1EG2A 2DQSA 4TT3A 3KYDB 4MJXA 3VKFA 1R15A 3WK4A 3EZLA 4DEYA 5A04A 1PNOA 5KX5B 1TUIA 1TC1A 3NEYA 4E5YA 2WKSA 4IMRA 1YBFA 3WWYA 3D7RA 3OZDA 1PFYA 5TQ2B 2A78A 1JAXA 3GEPA 4B82A 4G67A 4KR9A 4J16A 5JAQA 5KNBH 4RV9A 2WSIA 2CVFA 2AEMA 3AF1A 4E7PA 1M76A 3EZNA 2X8JB 3N0RA 4KH0A 1AQUA 1LDNA 3MTDA 1M8KA 2ZTVA 1LK0A 4ZT4A 3FCXA 4UBKA 1QOPB 4NWIA 4GSKA 2OD9A 3CINA 5AK3A 3S2IA 1Y3BE 4OQMA 1WSDA 4K1LA 4BX3A 4ZYXA 2A33A 2Q1TA 3BM5A 3GGSA 4P3YA 4G0PA 1C9YA 5EIHA 3WICA 1HZZA 3H05A 1N9ZA 1Z13A 4BC0A 3GP8A 1BDHA 2PR2A 1PI3A 1I7NA 4P83A 5AK0A 2WWXA 1U7HA 4QGGA 4L8LA 4CKYA 3RNOA 1IOVA 1JG1A 1FXWA 3KOMA 4OQFA 4DCCA 2FXVA 1F6WA 1RYZA 3KJFA 4L0MA 4F3KA 1P8JA 2HB6A 1CRPA 2GPYA