1NW7A

Structure of the beta class n6-adenine dna methyltransferase rsri bound to s-adenosyl-l-homocysteine
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
279
structure length
271
Chain Sequence
b'GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLQRSYEIVEGAANFGAALQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION METHYLASE RSRI
publication title Structures of liganded and unliganded RsrI N6-adenine DNA methyltransferase: a distinct orientation for active cofactor binding
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
total genus 87
structure length 271
sequence length 279
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nw7A00
2ADMA 2P1DA 5T64A 5GP1A 3T7SA 4G56A 3DMGA 2FCAA 5FADA 2XBMA 1RI5A 1BKYA 3CCFA 3G2MA 4PYOA 4YUVA 3T7RA 4YV0A 3G89A 1EIZA 5C0OE 3ID6C 1QAOA 5FHRA 4AZWA 2WA2A 3G5LA 5ERGB 4QPNA 4R05A 2Z6QA 3KQTA 3B7PA 3E8SA 4WXHA 4AZSA 1Q0TA 1R8XA 3C3YA 3BT7A 2VP3A 3A26A 4QVGA 1EJ0A 5DT2A 3B3JA 3UA4A 3NJRA 3GRVA 4GOOD 4Y2HA 4YMHA 1MJFA 1TW3A 3ANXA 4CWAA 4RTMA 2CWWA 2H00A 3JWIA 5GIOE 5DTMA 5HFJA 2QYOA 2PWYA 2R6ZA 4FGZA 2NXJA 5GINE 2GAFA 2N47A 5HIMA 1D2GA 5CVDA 3EVGA 3G8BA 4BY9E 1ORIA 3KU1A 4QVKA 4PYJA 5K01A 5KVAA 3HVIA 3Q87B 2P3QA 1JQ3A 3FTEA 3L8DA 1F3LA 2NP6A 5DRTA 2CKDA 2YXDA 5E9JA 3HP7A 1Z3CA 3ELYA 3D2LA 3EEOA 3EVEA 1WZNA 3MHTA 1JTEA 4KRGA 3C6KA 1KHHA 2BR4A 5HIIA 2VDVE 2ZTHA 3DULA 3ME5A 2PWPA 3FTFA 5HZMA 5IKMA 1PRYA 3OU2A 3NTVA 3KPUA 2ZIFA 3PVCA 5EIWA 2PT6A 2H1RA 3UJ6A 4KW7A 5KS2A 2YX1A 1WXWA 2VDUE 2ZZNA 2F8LA 1KP9A 4F85A 4GOND 3FUUA 5IH3A 4C07A 4H0NA 2IP2A 2O07A 3BGVA 3LGAA 4MHTA 2NYUA 2UZ4A 3M6VA 3JWJA 5DM4A 4PYIA 2FPOA 4ER6A 4KWCA 1X1AA 3SMQA 3HCAA 4BLUA 4F84A 2FRXA 3LDGA 3C6MA 5BP7A 4HGZA 5DRYA 1WS6A 5K05A 3DLIA 2P40A 1X1CA 3G2QA 2G72A 2QRVB 3BKXA 3HVJA 4GOLD 2O05A 2I62A 2KW5A 3OFKA 4R6XA 3FPJA 4E2ZA 5FTWA 3BXOA 1U2ZA 2GB4A 3P8ZA 3SR4A 3ER8A 4RTNA 1HNNA 1X1BA 3FUVA 3LL7A 3R9XB 4B17A 1RJFA 3HEMA 4E31A 1BHJA 1VBFA 3M70A 3VC2A 3KQOA 4GOMD 4GC9A 4GC5A 2K4MA 2PX2A 1YZ3A 5F2KA 4BLWA 3GCZA 4RX1A 1RI4A 1XJ5A 2AOUA 4BLVA 3PFGA 5FHQA 3R24A 5GWXA 4EMSA 4OQEA 3OZSA 3BGDA 5CVEA 2PX8A 1OR8A 2JHAA 2AOTB 3FYDA 1V39A 4E70A 2ORED 3PX3A 2P8JA 5CD1A 3FRHA 3ELWA 3TKAA 5E1MA 2YTZA 3P9CA 3A27A 2AVDA 2V74B 3E7PA 5G02A 2O57A 3V97A 4CKBA 4E2XA 4MQ4A 1AQIA 5EKUA 2OZVA 2XYVA 3EVDA 3GRZA 1ZGAA 1R6AA 2CMGA 2IIPA 3TM5A 4DQ0A 5KQRA 5LQRA 5DSTA 3ELDA 4ZTBA 2IH5A 3TQSA 3ERCA 4K6MA 3TKYA 3WSTA 4DCGA 5DX1A 5EIFA 2C7OA 2EG5A 1YFJA 2GPYA 4OQDA 5FA8A 2PXXA 3ELUA 4P7FA 3K0BA 3OZRA 4ER0A 4V0RA 4FZVA 4XUDA 1WG8A 1NW7A 3FRIA 3K6RA 4BP3A 4PYQA 2PJDA 1L3BA 2Y1XA 2NNWB 3P9KA 2ZW9A 4P7GA 4HTFA 3P2IA 4HG2A 3THRA 2AN4A 3G8AA 1ZGJA 2PY6A 2QY6A 3GRUA 4FS8A 4GBED 4RVFA 1JSXA 5EOVA 3UA3A 1AF7A 1P91A 3F4KA 5DM1A 5EHGA 4YUXA 5EEGA 1EAMA 3RW9A 3KQSA 1VIDA 2VS1A 3EGVA 4Y30A 5K8VA 5DM2A 4ER5A 5ICCA 5KQSA 1KR5A 1YZHA 1KPGA 5HIJA 3UBTA 5CVUA 1T43A 3HCEA 1UIRA 2ZBQA 4YV2A 1HMYA 3B5IA 4GQBA 3DH0A 2OXTA 1XVAA 2PX5A 4QQNA 1RJEA 4JXJA 3OZTA 1M6YA 3QOXA 5GM2A 3A7DA 4OBWA 2I9KA 4RSRA 5H02A 4AZTA 2ZWAA 2JJQA 5E2BA 3EPPA 1ORHA 3O4FA 5CCBA 1JG4A 3HCDA 2EJUA 5FQNA 1JQEA 2ZIEA 3TM4A 4EQZA 5B1SA 5DPMA 2YQZA 2PGXA 1O54A 4RVGA 4PCLA 3U81A 1PJZA 3TPZA 2EFJA 3CJRA 2YVLA 4U7PB 3NWEA 3HA7A 3MCZA 4PYMA 3SGLA 4YV1A 4M37A 2IGTA 4OBXA 5BW5A 4P7JA 5ICGA 4E2YA 2VZ9A 5GIPE 2CMHA 5DXJA 3VSEA 3PX2A 4DCMA 2AOXA 3R3HA 4FT4A 3T0IA 1NV8A 5F2NA 1NW8A 1D2CA 2B78A 3LBFA 4ER3A 5K0GA 4PIMA 2WA1A 1O9GA 2ZULA 3UJ8A 2BR5A 2ERCA 3CVOA 4QDKA 1QANA 5EZQA 2NP7A 2OB2A 3GDHA 2P3OA 3KQVA 2P41A 5HOQA 2XYRA 3DOUA 2IBTA 3AXSA 1I4WA 3IHTA 4CTKA 1H1DA 4KIFA 3VYWA 3NVKI 1P1BA 3HVKA 1X19A 1RI1A 3DTNA 2AR0A 2HWKA 2PSSA 2NXCA 5FULA 2Z6UA 3T7TA 3UFBA 3DR5A 5GM1A 2PXCA 2FYTA 4RTLA 1NKVA 1JSZA 4XCXA 5CVJA 5C1IA 1AQJA 2ZCJA 4DA4A 3LDFA 3NDIA 1KPIA 4MTLA 4M38A 3S68A 5HEKA 3REOA 5FQOA 3HCBA 2G70A 4CKEA 5JR3A 5DX0A 1JR4A 1FP1D 1ZQ9A 5E9WA 3KQQA 3RODA 2V7EA 4R6WA 1R00A 5CVVA 2EX4A 5EPEA 2FK7A 3A25A 3BWYA 3JWGA 5LQNA 5DSXA 3NMUF 2YXLA 4RTOA 4GEKA 4IV0A 1QAQA 2QRVA 4YUYA 3DMHA 4C08A 1JQDA 1SUIA 3OE4A 1RI3A 3IV6A 4OA8A 3MAGA 5LQJA 1JTFA 3EVCA 4HC4A 1YFLA 1DL5A 3HCFA 2YUIA 2BH2A 1ZHFA 3OU7A 4KDRA 1DCTA 5LR6A 4PWYA 5LQAA 7MHTA 3QV2A 3C0KA 4X61A 5K0NA 2QM3A 4RTJA 3OU6A 5LQKA 1INLA 3OPNA 4MWZA 3OE5A 5E8JA 4M36A 1BOOA 2AN5A 1R8YA 3MB5A 3VC1A 2AOTA 2HR1A 3GIWA 1Y8CA 3UJAA 3IEIA 4FR0A 5FCDA 5E1OA 3KQWA 3X0DA 1FPQA 5BW4A 3FUTA 1YF3A 4R8SA 5E1BA 3KR2A 1KPHA 4U7TB 4CXMA 1NBHA 3KHKA 4V0QA 3P71T 4HSGA 1XCLA 1O9HA 1SG9A 1NW5A 3CBGA 4EVIA 4OX9Y 1RJGA 4F86A 3NWBA 3G2OA 2ZVJA 4RVDA 5EQJB 1NW6A 4ATNA 3I9FA 5HIKA 5KYGA 5CIYA 4E33A 2ZZMA 4YUZA 4LECA 2IPXA 3P2EA 1VQ1A 5E2AA 10MHA 2NXNA 4PONA 1X1DA 1AV6A 4PCAA 5E1DA 3HM2A 4GF5A 4RYLA 3KQYA 1SQFA 3CJTA 2XVMA 1KYZA 1NT2A 2O06A 2ZIGA 3KPWA 1WY7A 5EHIA 4X41A 3TRKA 5K09A 2GLUA 1L3IA 3AJDA 3MTEA 5U4XA 1QYRA 3TLJA 3LX6A 3LDUA 1R18A 3M6XA 4P58A 4A6DA 5BXYA 5C9ZA 2BZGA 3MCTA 3P2KA 2GH1A 3FUXA 5DTQA 3FZGA 4ISCA 4NECA 3LKZA 2UYOA 2G8NA 4QDJA 4R8RA 3SX0A 2UYHA 3KPYA 3PLAE 5M5BA 2PX4A 2AOVA 2PKWA 3DP7A 2HMYB 3G5TA 3MERA 2BM9A 1N7IA 2BM8A 2FK8A 3V8VA 3CC8A 2R3SA 3P9NA 2ZWVA 5ICEA 3IYLW 5DLYA 1D2HA 1B42A 4QTUB 1JG3A 1NE2A 4RTSA 3MQ2A 3H2BA 5ICFA 4YUWA 1L3CA 1NV9A 2OBFA 4FT2A 2UYQA 1SVUA 2PBFA 5EG5A 3TR6A 1G60A 2PVCA 1VP3A 2PXAA 3DLCA 3DMFA 3LHDA 2C7RA 2IFTA 3ER9A 1WXXA 2YR0A 3GNLA 3NW9A 1XTPA 4C04A 4L7VA 4DKJA 1G8AA 4C06A 3KPJA 1SQGA 1IY9A 4C05A 3UJBA 2A14A 2ZBPA 1FP2A 1IXKA 1P39A 5K0CA 3LSTA 3KR1A 3M6WA 3EMDA 4RTQA 2ONYA 3QOWA 3CGGA 4KDCA 3A7EA 2WK1A 1VLMA 1NBIA 3LCVB 3I58A 3Q7EA 4PYLA 2OKCA 1M6EX 5CM2Z 4XUEA 2OB1A 1BC5A 1EQAA 3BWBA 4KIGA 4O29A 2E5WA 5D1HA 3UJ7A 2Y1WA 4FSDA 4X1OA 2JH8A 3E23A 3BKWA 3UZUA 1KXZA 4RTRA 4PGHA 3AY0A 3BZBA 1XXLA 5P8WA 1EJ6A 2DULA 3DXXA 5EMMA 5FWAA 1NW3A 3THSA 1JG1A 3BGIA 3C3PA 1M0EA 1YB2A 3EGEA 1P1CA 2P7IA 4PINA 3I53A 2JHPA 2P7HA 3CJQA 3SSNA 4A6EA 1N2XA 5EMJA 4DMGA 3EVBA 4LWOA 4RWZA 5EVJA 4GUAA 2ZFUA 5F2OA 2AS0A 3GU3A 4RTPA 1XDUA 4PYKA 3G88A 2H11A 2IDJA 3G7UA 2OPBA 2PT9A 3OCJA 3UJ9A 3BUSA 1KIAA 1N7JA 3HA3A 4IV8A 3B89A 4C4AA 4DZRA 4LWPA 3M33A 1FJXA 2HV9A 2OY0A 3FTDA 1L1EA 2AZTA 3B3GA 4ER7A 3EMBA 5K03A 1G8SA 5EMKA 3SM3A 2OO3A 4MIKA 5EC8A 5DTRA 5CUQA 3SXJA 2PLWA 3CKKA 2VDWA 3FTCA 4QQKA 3HNRA 5EEHA 1RJDA 4CTJA 2G71A 3R0QA 3G2PA 4AX8A 4UOEA 3PFHA 1MHTA 3TOSA 5HILA 2I6GA 3FPEA 4KVZA 4BP1A 4AZVA 4EKGA 5EZSA 1XDSA 4E2WA 2Z6AA 3HA5A 3KKZA 4IWNA 2XYQA 3EVZA 3PB3A 4M7RA 4EKIA 5MHTA 1Q0SA 1G38A 5E8RA 5K0LA 2OYRA 5D1NA 3LPMA 3HVHA 3TFWA 3HTXA 3SSOA 5FWDA 1QAMA 3GRRA 1VE3A 3LBYA 3GRYA 3HCCA 3P9IA 4PGGA 5E9QA 3GGDA 2IH4A 5GOZA 4OA5A 5DXAA 1I1NA 4PYNA 3GWZA 2GS9A 3O31A 2ZLBA 4QPPA 4FSXA 3P97A 4P7KA 1UFKA 4X60A 2B2CA 2C7PA 1RI2A 2B3TA 1FBNA 3SSMA 1VL5A 3KR9A 3OFJA 3RIEA 4EK9A 2IH2A 3LCUA 1QZZA 4RV9A 2AOWA 5DX8A 3LCCA 1TW2A 2O0LA 1XCJA 1ZG3A 3A4TA 3UJDA 2ZSUA 5DWQA 2I7CA 4RVHA 1SUSA 3O7WA 5CCXA 4E30A 2C7QA 3I5UA 4WVLA 5K0BA 5FA5A 3NDJA 1TPYA 2BR3A 3PTAA 4CKCA 3JWHA 4C03A 1I9GA 2NXEA 2JH9A 2IDKA 5JUWA 3FPGA 1L9KA 5K0FA 5DM0A 3AXTA 1EG2A 1VP9A 2JHCA 3AWIA 3KQMA 5EMLA 5EGSA 2AOUB 3EVFA 2QE6A 1G55A 3GXOA 3KPVA 2Q41A 2ONZA 2ESRA 2DPMA 3KQPA 5LQCA 5FUBA 3R6TA 4YMGA 1G6Q1 2P3LA 4DM3A 8MHTA 2LD4A 2EJTA 2CL5A 3MTIA 3NVMB 5EKXA 4LG1A 3UWPA 1UWVA 2UYCA 3E05A 2ZBRA 3PT9A 2AVNA 4DF3A 2GA9A 3FUWA 3PS9A 4QTTB 4X63A 5K0EA 5LQUA 2IBSA 3BWMA 3M6UA 3FPHA 2B25A 4HH4A 4POOA 3EGIA 3I64A 2PV0A 3FPFA 2YXEA 3M4XA 3UJCA 3ORHA 3EVAA 3FYCA 4IKPA 3EEYA 3TMAA 2JG3A 2FHPA 3DXYA 3LECA 4FP9A 1YUBA 3SVZA 2HNKA 1ZKDA 3GJYA 3BWCA 4PNEA 5T6BA 4HRAA 1SKMA 2XVAA 1DUSA 5LSAA 1XDZA 2B9EA 4Z2YA 4PIPA 1R74A 3LKDA 9MHTA 1VPTA 4AUKA 4XUCA 1KYWA 3DXZA 3KR0A 4HTFB 3MGGA 2P35A 3GO4A 4RTKA 2AN3A 2HTEA 2G1PA 3B3FA 1IM8A 3DUWA 1F38A 4E32A 5T67A 1JG2A 2ZZKA 4HGYA 5K0JA
chains in the Genus database with same CATH superfamily
1RS0A 1TUBB 3CH5A 2I67A 3CT6A 3RO7A 2HQ1A 2PMKA 3KWMA 2OENG 4RESA 2CVOA 3DDOA 2E4UA 4ZA2A 2CMDA 3MVEA 2C9BA 2ECOA 4GNRA 4EM6A 2XBMA 4R2LA 4M87A 5CDSA 2VT2A 3LC0A 3OQIA 1EX7A 5EIHA 4CBVA 5B4VA 1RWVA 3T7RA 3OLWA 2EU8A 1EIZA 3EFOA 3THWB 4EW3A 1GKKA 3IBGA 4G5XA 5ERGB 3LLMA 4ZT5A 2WM3A 3OHPA 5ILOA 1C3OB 1XZCA 4XLLA 3RFVA 1SUDA 1AUVA 1L5KA 3VYRB 4ARIA 3OX3A 5DT2A 4E12A 1I7SB 2SKCA 1IHXA 4LQDA 5ALDA 3FXAA 2CFRA 3ITKA 4ETMA 3U60B 4CYMA 2A1UA 3SDBA 2PWYA 2W2NA 1ZOIA 1TNDA 4ZI7F 1AF4A 3S2ZA 2WU4A 2HBZA 5GINE 3GEEA 4EG8A 2FF5A 4DPKA 4JLBA 2ZOSA 1F8YA 2C8KA 3ICQB 3PCXA 2F1IA 4UQPA 5TMEA 3Q87B 2RAUA 3EBPA 3TZKA 5FOQA 2NP6A 2YXDA 1N78A 2ZUCA 1ZW6A 1CIVA 1KK1A 1UINA 3LPDA 3GFOA 1X8LA 3AGQA 4I1VA 5TGDA 5J58A 2ZDQA 2VH5R 2A1IA 3C98A 3LGSA 2GNAA 1E1QD 2XWJI 4OSEA 3TTVA 2IVFA 1Q20A 3QXHA 1B0AA 5REQB 1GR1A 4YBZA 5B3JC 1RQRA 2G82A 1P7YA 1T4CB 1U0GA 4WXMA 5JDCA 4ZKEA 4HMQA 4DMMA 1Z4PX 2VYVA 2ZXEA 4L6AA 2AF3C 2Z4TA 1B8UA 2X22A 3OQ6A 5ABPA 4GRIA 5LYJA 4WECA 3M3DA 1PT8A 4AJJA 1QSGA 2LWIA 2Q9CA 3Q40A 3J81k 1JBKA 1XAIA 3GDOA 4JOCA 3BGVA 3EZGA 4CTOA 4PG8A 3LM8A 3RC2A 4ALKA 1X8KA 3JWJA 3EXEA 5KKNB 1WXEA 1UXOA 3VHRA 2PRYA 3DP9A 2I4TA 1QRTA 1YDFA 1NVDA 2WPNA 2X41A 4JT2A 1DPGA 1CY0A 2P62A 1EM8B 4MS3B 2IKQA 3G2QA 1GAXA 2QRVB 4MLZA 4PHTA 3M6IA 1UBCA 5E0KB 2C5SA 3D3NA 1CUHA 2G04A 3DT6A 4KQXA 4NJEA 5LZ2A 4KPEC 3OT1A 1USUA 4RSHA 5HE8A 5IXYA 3RARA 1FY2A 2H59A 1BHJA 5BNZA 3LT0A 3M70A 4KH0A 1ZSVA 1KQOA 2FUKA 4ESVA 4GM4A 3F78A 2C9OA 3AEKB 3GFTA 1KBZA 1NJGA 1P4GA 4LCBA 4RBNA 3CR3C 5FT9A 1GG8A 4DXHA 1UK7A 2FJ0A 4OK3A 3UG7A 1XUOA 4D79A 1F14A 4ZHQA 1XJ5A 3WLSA 2GZRA 3W3AD 2XUOA 5BR1A 1RCUA 1Z4MA 1J2RA 1AB6A 4NU6A 4JYAB 2V98A 2QTBA 1YZKA 4QJIA 4D97A 2R6HA 3QBVA 3UUFA 1MB3A 3FR7A 5BNWA 4NYMQ 2RC6A 1Q50A 1JWAB 2A86A 4X1YB 3P9CA 4Y0VA 1GZUA 2AK3A 3D8NA 2O57A 1VIVA 3G82C 4IJ5A 1WV1A 2H6EA 2EBUA 2QYHA 3KWJA 1WMSA 4Q4HB 4PLPA 2XYVA 1CUJA 2I8LA 5IC5A 4URUR 2H63A 1U9JA 3MRSA 4WZBB 5DSTA 3WLJA 1A8IA 3OVMA 4Q4LA 1UDBA 3OG9A 4BVKA 5EIFA 1AKRA 2ZKIA 3NUZA 3ZU4A 2ADOA 1IXZA 2GPYA 4JN6B 4OQDA 5LB2A 1I2BA 1NWHA 2WJZB 3EFHA 3VYUB 1E1DA 4L72A 4BN0A 3OQMA 3PGXA 4KR6A 1MPXA 1NW7A 3DQPA 2QV0A 3DS8A 3WHPA 1HZZC 3GJ5A 5DIZA 5ANRB 4BFSA 4JITA 2P6MA 1H65A 4F7DA 1KEVA 2H1OA 1EUDB 4M9ZA 3KQKA 4ZVMA 2H0AA 1WUKS 4ZVLA 1ZGJA 4C08A 1YFLA 3Q3EA 4LA4A 4C0LA 3SP1A 2DZDA 1B8OA 3GAAA 4ZT4A 3TTSA 1XZIA 1J8DA 1P80A 2EIXA 2Y0BA 2WD8A 2ZJAA 4S2UA 4WNCA 3ZUPA 1ISHA 5DM2A 3B8HA 2O5RA 5EZYA 1TLFA 3O82A 4N54A 1GNSA 4EUKA 4MCIA 2GUWA 5CJJA 5EQTA 3V4LA 5K99A 5IKOA 3U61B 4Q3OA 2JBHA 1E3TA 3B5IA 3LHIA 1C7EA 1QGED 4L28A 3JR3A 2DHCA 4KV7A 1E1RD 2K7ZA 4Q66C 4XB2A 4US2R 3U1VA 3GMIA 4UNNA 3MQ4A 1PK9A 2UZ3A 1T3SA 3EIUA 1E3EA 3AO0B 4YMVA 1RYMA 1SU4A 2VHJA 4IKEA 3LP8A 3CQ9A 2VHCA 3FVTA 1M1YA 4YRQA 1IQPA 4KN5A 4L74A 2RG1A 4PPFA 5CB4F 1DXOA 3ITNA 5DPMA 4ID9A 3H84A 3KHUA 3LUKA 5ISMA 4WT7A 1K2WA 1Q0QA 1QLWA 3L6BA 1VJRA 3OJOA 1J1UA 2LCIA 3HEBA 1ODJA 2WTEA 5EJ9A 2OWEA 1J70A 3MIIA 1XHFA 1XL0A 4KJXA 4PYMA 4A2QA 4YV1A 3L7OA 2DRIA 4OBXA 4G4SP 2HLPA 3C4VA 1Z2AA 1CUAA 3PNKA 4A27A 3VKHA 3U17A 2C07A 4YPVA 5IX8A 4BLTA 1Q1EA 2OV6A 4GR9A 4PTZA 4E5MA 4ODIA 4EHKA 2EXXA 1JLLB 2XGJA 4Q1CA 4X7RA 4W5NA 3CPSA 1EXMA 1FUIA 1M1XB 1VGRA 2FW7A 3IIKA 3PQFA 3UMGA 5HS6A 1QMGA 1TGYA 1VPEA 4FKMA 4IDEA 4G85A 3V7YA 3DUFA 3ORYA 2DBRA 3KZKA 1Y3DE 1RC8A 5DKFA 3T3MB 2PZBA 5CURA 2VHEA 3DONA 5SYAA 2Q7OE 1E9SA 2REXB 3WTCA 1MPTA 5G0UA 3L8CA 2RHBA 1G18A 1Y5RA 4YDQA 3WMEA 3RYFB 2WABA 4TTJA 4J2OA 2BKVA 3L7LA 2O4UX 4HHEA 4L6CA 3REOA 5K45A 3T5BA 5LM3A 3HJTA 3NAQA 4O63O 5DBGA 1DOZA 3DHYA 4IQFA 4QYIB 2H65A 5JNSA 2J46A 5E6SA 4UFNA 1MQ8B 5AJTA 3ICEA 2FSSA 4UHEA 2QG4A 1ZD4A 3NX4A 5K6AC 1JMVA 3JZFA 4TT8A 4EQ6B 4RTOA 2F3PA 3A28A 3K9QO 4D80A 5DHTA 4IG4A 3AH8A 3F9RA 1R66A 3FUCA 4QJBA 1A5BB 4MVJP 1EFVA 3FTQA 4ZO4A 1EWQA 2PYDA 4Q1BA 1NVVQ 2MTBA 1EVIA 1WHSB 4UUMA 4AO7A 2EC5A 1MABB 1BS2A 4GYKA 2H8KA 3G1TA 4PWYA 3PE6A 2GSWA 3VSCA 5EKDA 1L5YA 3WGLA 4DLTA 1ZX1A 4G25A 1LZLA 1PF7E 1PJAA 1VCNA 5HQ3B 2FV8A 1IMJA 5H3LA 1MUUA 2PM8A 4H4EA 3UGQA 4IIUA 2AN5A 4Y98A 1J0CA 1IDOA 4LIPD 3E5RA 1K5DA 5IKEA 1E64A 2VPIA 4YAOA 2EFYA 1EX1A 2YZNA 4LV6A 3L8EA 4F93B 3CVWA 1Z6PA 4KQMA 2WNSA 4YT5A 2D13A 4QBFA 4KRXA 1N8TA 3QJ5A 4V3CA 2EJVA 4TT3A 5HQTA 4UU7A 1IBMB 4CVNA 1X7HA 3OIVA 4KWTA 1X9GA 2DVMA 4DIBA 1USVA 4PRKA 3TE6A 3PNMA 1OFGA 3BZUA 2V7TA 2DX7A 3JARB 4J76A 5L95A 4W5TA 3HM2A 3ETJA 4H0FA 4G5SA 4JA0A 2V55B 5JNTA 5DV9A 2A6PA 1Y3CE 4CKCB 1KYZA 3K9GA 2P9EA 2ZIGA 4ZO7A 4F5ZA 4TTQA 2V7BA 1CZHA 2OUKA 3DDSA 4PCUA 3D3WA 3SHVA 4AFNA 2BFFB 3G9UA 2NPFA 4Q01A 4PRYA 4NMWA 2GKOA 1F9AA 1UP6A 3UHOA 2H2IA 2VRWA 1WZCA 3WWYA 2FUEA 3FZGA 2I76A 1PW7A 2LCFA 1NBMA 1YI0A 3RK1A 5BYAA 3KPYA 4YRLA 5CFOA 2PX4A 3G5TA 1SOMA 2HMYB 3O8QA 3P20A 5EP2A 3VPXA 1E60A 5B64A 3ZI4A 2P5TB 2C42A 3ESQA 2R3SA 3GLUA 4GT1A 1JHQA 2PL3A 5ICEA 2QLBA 2A33A 1ZOPA 4RS4A 4Z8YA 2R7KA 3STYA 4PLFA 3PYMA 4EABA 4JB2A 3K0EA 2XZLA 5B6JA 4KXLA 1DT5A 4FHFA 5C53B 1ZUHA 2CUTA 3JRWA 2WZBA 3ETGA 4YUWA 3WJ7A 4H59A 3QYFA 1TA9A 1UZMA 2YW9A 3OLVA 2H3EA 4BU0A 4ZMBA 5KNDA 3LD9A 3TSYA 1R7RA 1KU6A 2Z04A 1XK7A 3EDQA 3VNAA 2ROQA 1GITA 3RJZA 3ICPA 1WXXA 1QHHA 2IXGA 3LL4A 4TSFD 3UY4A 3FI0A 3V1LA 4C06A 2Q3JA 3CGWA 4HX2A 1JJIA 4N9WA 4XR4A 4Z4QA 1F17A 2CHGA 3SKVA 1IXKA 1GTJ1 1G3RA 2HDHA 3AOEC 4G4SO 4I55A 1N0WA 2ONYA 4ZKDA 5JU6A 1YB4A 4MGKR 1N5RA 3SJBA 2WK1A 4FMDB 5A5EA 2OVFA 2REQB 1ZXXA 5IC4A 3NG1A 3Q7EA 4M6WA 4PYLA 4NYIR 2DERA 4DM4A 1OVGA 4L78A 4LHSA 1DVRA 2HIAA 5DHAA 3KTOA 1GPAA 1S4MA 3OIWA 3NBKA 4M1TA 4O29A 1Z0IA 1Y5IA 2R9VA 3E23A 3KOZA 3OP1A 4BLSA 1FTWA 3U7GA 2H2AA 2I4RA 3P0RA 5KTTA 3VYSB 1BDIA 3KQNA 2JI7A 2X1VA 4UNSA 1K63A 1TU4A 1RADA 5L6MB 4ZC8A 1AKEA 3EGEA 3WR5A 4L57A 4O2AF 4UOQA 3WGQA 2W37A 5I5GA 2CLDX 3S6JA 4YFYA 5ALJA 1XDUA 2HCRA 2IWHA 2J4DA 1DPFA 3W5SA 2O50A 3OP4A 2P5SA 2VEDA 621PA 4GX1A 2I6TA 1GU0A 1RKUA 4OIFA 4LF6B 3FYSA 5EWJB 3RVPA 4RL6A 1EB9A 5MDHA 2MSWA 4Z6KA 3C85A 3CYFA 2CB0A 2FWJA 1NOKA 1DIBA 5K03A 3KSRA 5F3DA 3RUEA 1G8SA 2ID8A 3TIIA 1OI3A 4LPKA 3N8KA 1VLZA 2W6CX 3ESXA 3DFUA 1TOAA 3E9MA 3P9RA 3T9CA 1SXJB 1UBGA 3PHJA 3PRHA 1XDGA 3IAM6 3LFHA 1GV1A 5G0TA 3TMKA 1PWEA 1XMXA 4L7QA 1XZBA 3BM5A 4Q4JB 4F9TA 5GJCA 5FBQB 1G5QA 3KEQA 4UPEA 2G7MC 3HA5A 3NTUA 1CUFA 1UZUA 1Q0SA 2XIQA 2XLBA 4Z86A 1QFZA 1WMFA 4UJ3A 5FYQA 1S2IA 1NXWA 1PGJA 3WLKX 5CLFA 4MYHA 1ESNA 2HC9A 1VE3A 3LBYA 4Q4DA 3N0WA 4RANA 3VZDA 4XYLA 4N3AA 2BEVB 4UDXX 3GWZA 1I7NA 1NF2A 3O31A 5AM3A 5ICMA 3H9BA 4ZQEA 4HZUA 4FSXA 3PDJA 4EUNA 4OSOA 1U1GA 2C7PA 1FYWA 3K05A 4D3ZA 1HE3A 1AS0A 3GROA 2AOWA 1P31A 2XA1A 3IAEA 2F8MA 2O0LA 3LCCA 3VR5D 1X2EA 4GL2A 1E63A 4B6SA 5FUVA 2GTHA 1G3IA 5BUCA 3G8DA 3HJFA 3K09A 4RU1A 3G49A 4ETIA 1SC9A 1YB5A 5DGHA 2CK3A 2C8JA 3L8ZA 4ENVA 1X14A 1WV0A 3T3PB 4G5YA 1U0OC 2WF7A 2PRIA 5ALNA 4BWVA 1KBOA 1ZGZA 5AK0A 1SXQA 5A4AA 2NM0A 4P3PA 1CQJA 2QSJA 3MTGA 1DBPA 2H4WA 2HDNB 2IF0A 2WRZA 2OXIA 3RHFA 4CF4A 5SZKB 4MB6A 3AM3A 4TMZA 4GXQA 3T15A 2R7LA 4XDGA 2ZYUX 2NQTA 2FTKE 2P3LA 3G23A 3OF3A 4WKCA 2MIIA 1LRJA 3WZLA 1Z83A 1A8QA 4ZQFA 3WICA 3BB1A 3BS4A 3CZ5A 5AOCA 5GONB 3UC5A 4UBMA 5D00A 4CIBA 2Q1TA 3ZJTA 2OV2A 4OH7A 4WZBE 2B4KA 4Q16A 5TARA 2FW8A 4IKPA 5DTIA 1TF5A 2RG7A 4RETA 3NEAA 4FJ0A 1TZCA 3OZWA 3TNDA 4BYMA 2DPHA 3CLHA 4XQ0A 3COJA 2WINI 3OEHA 4M54A 5CJPA 5JNUA 1RXYA 4DR5B 1MVOA 3HBNA 1QQ7A 1VCIA 4MR9B 5JRZA 5BUSA 3PEVA 2JCVA 4NCIA 1SZDA 1PR3A 4GI7A 3HR4A 4M76B 4Q3BA 4QTXA 2C5LA 3VQTA 4F5DA 5FPQA 1WBBA 5HE9A 4S05A 2A9JA 3KTFA 4MRMA 3CX7A 3QU9A 2LDBA 3DUWA 3VR2A 3U48A 3UKOA 2E4VA 2PX3A 2ST1A 2ZZKA 5D01A 3WG9A 4DRXA 3B6MA 3MD0A 4F56A 1YJ8A 1RYHA 1YE5A 4UXJA 2UUBB 5TF0A 3ZZMA 3L43A 1U80A 1WWKA 3U80A 4XWOA 4AU1A 3HRKA 4QWMA 1ETHA 1Q1GA 2OT3B 3ETCA 3IEPA 3X3HA 4O8CA 3G2MA 2XTAA 4PYOA 2JC3A 1HTTA 3PG5A 1V5WA 3NBFA 4N7JA 4OSPA 1VG9B 3A9RA 2CXHA 3IKTA 1E7WA 3B7PA 4I4CA 3A1UA 3WV4A 3V42A 4WDRA 4MHSA 4RW0A 1BVUA 1OREA 1N6RA 3GRVA 4QRDA 3HG7A 1HETA 1GQSA 2JFZA 3K4PA 2A9QA 3SHQA 1G5FA 3MWLA 4KBFA 4B4WA 3DYVA 3JWIA 3FSEA 5AKHA 5GIOE 2Y77A 1YASA 5LA6F 3ZDEA 2H1CA 2N47A 1J99A 5CHYA 1Z26A 4LCEA 2QMEA 1GGHA 2VYCA 3AR9A 4FGJA 4PBRA 1DWPA 3EVGA 1QTNA 2I6FA 4J9UE 1QIDA 3OMWA 4DUGA 1RWNA 2XY4A 3I62A 4A36A 2GASA 3IP7A 5JXWA 3LTEA 3F6CA 1WW2A 1V5IA 3J7TA 2ZUTA 3KKQA 3LO8A 4OK6A 2HJSA 1OYVA 1SQ0A 5AM2A 5B3AA 4AP9A 1XL1A 3WIUA 1SXJD 4DV2B 2O8DA 1CPYA 4JDPA 4X54A 3PRJA 1NN1A 4TLMB 4X92A 2R84A 4JLJA 2P2GA 4L51A 1C1YA 2GF0A 2Y67A 4QYSA 4MTCA 1D0VA 4C0WA 2GEBA 2G08A 1DSSG 2WUEA 4MQFA 3DEAA 2C9CA 3RTGA 4J91A 1K7SN 1E6MA 1EWVA 1V4VA 2PZFA 1Z8HA 3LUBA 4FW8A 3VYVA 1M66A 4CTMA 1E3LA 4QU5A 1SIOA 3DAYA 5THKA 3EQ8A 2CFCA 5B57C 1VL2A 4JBIA 1SRRA 3G8CA 4WOCA 1FUEA 1J1ZA 2QAIA 3FUUA 2OAP1 2O07A 1KJ9A 3RVLA 3SLRA 1E6KA 4NPAA 2P1ZA 1EGMB 3KOUA 3LIIA 1XFAA 2AB0A 4ZAYA 3KDSE 5I9LA 4ER6A 4RMGA 1GZHB 3IQWA 3LQ4A 5CXUA 3IQEA 3UN1A 2Q46A 4DS3A 5DI3B 3WL5A 1CKEA 2PA3A 2OD2A 2C29D 4URXR 2HPAA 2YWFA 1TVEA 3S2SA 1WS6A 2PS0A 1JPUA 121PA 1W7AA 3M9WA 3BXOA 1T34A 5IF3A 5LP1A 4BJ3A 3ZKAA 1WB9A 2UXCB 4TL8A 2N9UA 4GR4A 1EXDA 2R44A 4TN5A 4U2BA 3KQOA 3WK6A 3X2EA 3K6SA 3L3BA 2G36A 3BXPA 4AJPA 3UOGA 5LOVF 2PRZA 2BCEA 3BRWD 4GZ6A 3EZXA 1O6ZA 5CLJA 5H9WA 5HX7A 1WZEA 3DZKA 3PGLA 3ADDA 1U65A 3PWSA 2RCNA 5CEFA 4BVHA 1ZIDA 2AOUA 3G2NA 2VKTA 3CH4B 3NH9A 4GYJA 4WY2A 4HRXA 5P21A 4P82A 2O8FA 1GRCA 3ABQB 1FRVA 4GP9A 4PNZA 2IU0A 1V45E 2OAQ1 3JQBC 2ZATA 4BC1A 1TM4E 5I4BA 2ORED 2PMEA 4B76A 1ODTC 4PZYA 3SQXA 2BFMA 1EWRA 4ND8A 2Y1FA 3A27A 3U7QB 1NSYA 2SKDA 1ZK3A 4R7ZA 1NI4B 3FYUB 3LNTA 1I3LA 4JJAA 2CXNA 4TWRA 2INGX 3GRZA 3M4YA 2Q2NA 1YIDA 5ALIA 1FFXA 2FH5B 4ZOLB 4BO8A 3ZD8A 1FMLA 1KEZA 4EB6B 1OU4A 1M8GA 2JIRA 1YFJA 4G4GA 3RVBA 3NIBA 2FRDC 4FMBB 3PC3A 4LK2A 2DHDA 3LKBA 4Y1RB 3UWDA 2Y9MB 3MMPA 2L2QA 2YHIA 2CL0X 1X7WA 4KKVA 2CSXA 5DWVA 2PK3A 3KAPA 4P86A 2AQKA 2FZ5A 3H5AA 3ZXYA 4AY3A 1J39A 1MX3A 3WBBA 4R0MA 2DBYA 2Q5CA 1QG2A 2H2HA 3THRA 3UB4A 5FO0A 4E11A 4C0SA 5ALUA 1F5SA 3C3EA 4ESEA 3Q7QA 1UAGA 5FTKA 5KQGA 3WNZA 1T24A 2OBBA 2V5AA 4LNAA 3R09A 5EEGA 2O8VA 4F45A 2O8EA 1YVRA 1KMNA 1JU9A 1U1FA 3QLVA 5JPDA 1UEJA 1DC3A 2C3UA 1G98A 2EHJA 4CLRA 2XNDA 2QD3A 1N9GA 3L8YA 3P0HA 3JZMA 4HK4A 1YA8A 3WYAA 5KQSA 4JBWA 3UBTA 5IVPA 3ZHSA 5CVUA 3HCEA 3PC8A 4C4TA 4G8BA 1P17A 2WTBA 3I2JA 3RC9A 2YXNA 4G1EB 5ESDA 5GADl 1LDYA 2FKNA 1KO7A 3HUFA 4REOA 3R8CA 4G0VA 2EQAA 3VNRA 3BZWA 4NBKA 4QZVA 1E98A 3EMVA 3AB3A 2NSDA 1K4YA 1X80B 1ORHA 4BTEA 3NBQA 2CCKA 4QHYA 1VRVA 3MS7A 2WICA 4YYZA 5J4YA 3EDMA 2BFEB 2CUKA 2CDAA 2A8YA 2XCRB 3D7SA 2BFDB 3DMYA 1EWKA 3LQKA 1SCDA 2VSNA 4UE3S 4NE2A 5FL7D 3V6LA 4C7KA 4AKTA 2FW9A 1RKXA 1DX4A 3D8BA 3QUCA 3UG6A 3CW2A 4DCOA 3ZXSA 1KI2A 1WVGA 5DBEX 1MJHA 3DMTC 4D8UA 4E2YA 4MEAA 3QUAA 3OMLA 3WK5A 2ILTA 4GZMA 2QJTA 5BPFA 5K6RA 4FCCA 3D6NB 3E5MA 1C5KA 4OJKA 1YK1A 1XHEA 4DDWA 4Q4AA 2WA1A 2ASEA 2I54A 3DZGA 3TLYA 1NX6A 5AM0A 3TSOA 3BMCA 2WJWA 2QEQA 1SO8A 2X8AA 4RCVA 2FVXA 3IPYA 1TA4A 3CTMA 4EW1A 1DG3A 1FMTA 4AZ0A 2AN9A 4ZCQA 5FI1B 5J3JA 3H11A 5D2CA 3LSYA 4JUFA 4B3HA 3GJTA 1DAKA 2Z1MA 2R8BA 4Q3KA 2EHDA 1B43A 4B4OA 4TYWA 2HCTA 1U1CA 2PV7A 1Q0RA 2NYRA 1P75A 3FCOA 2J3HA 1X6VA 3LAWA 2J87A 4ENUA 5CAEA 4ZTUB 1RWOA 1APBA 4ZOAA 1EX9A 4XH9B 2AMLA 2NXWA 3FG9A 3FROA 3O83A 4IIXA 4P98A 5SYMA 5E6RA 4NK4A 1X8XA 4UZSA 5FFMA 3AR2A 4E6PA 1JR4A 2VNAA 1BEZA 1TGVA 1XVIA 4HVLA 5FV7A 2BFAA 3JWGA 1IZYA 3DOHA 4FMPA 4YMTA 4WRRA 2OG1A 3N2ZB 1Z7EA 2JJ2A 4U0KA 2QS9A 5LQJA 3RS2A 4FWBA 2VDOB 3EDRA 4P2BA 4W1RA 1NOIA 1YBVA 4MGIR 2C5EA 4WHMA 3P2JA 1IRXA 1Q2UA 3RWOA 3ZK8A 2AFIB 5JXJA 3ZH9B 2EZ4A 2D1SA 1W5BA 1SXJE 3CONA 3AJAA 2FMUA 3EY4A 4H6VA 3R23A 5K0NA 4A8TA 5LQKA 1N4DA 1INLA 2M6KA 2G09A 3CPHA 3MOSA 4YALA 3AYZB 3VC1A 2CV0A 1K7EB 2AOTA 2C78A 5CK5A 3WSWA 4Q3LA 5B5SA 1CRLA 3GUCA 4IR7A 1NAIA 3PV0A 1VC2A 2WJ3A 3EIQA 2Q3HA 4Q0MA 4V0NA 3FUTA 1R9MA 4ZI7A 2P69A 1K8XB 4INOA 2NPOA 1CJMA 4HSGA 1XCLA 4AO6A 1IN7A 5FP0A 4F86A 5KCZA 2GCPA 1BO6A 3AEUB 3G2OA 3QK7A 3I9FA 3LCMA 3UIEA 5EIOA 5EJAA 1SC3A 1YUMA 3VHXB 4OHBA 2O2CA 2BY4A 2NXNA 1E2EA 3NHKA 3QKSA 7AT1A 2C4MA 5JAPA 3LUGA 4RYLA 1BEUB 3S2FA 3KL4A 1PG2A 3CHYA 3G6KA 4LYHA 3IB6A 3QELA 2CUNA 2JZNA 5LCXA 3SYLA 2BGNA 3HDYA 4B5KA 2PUTA 3S40A 4LOHA 3SE7A 3D1LA 1LZKA 3PT5A 1SUPA 1TYAE 1MA0A 2VXYA 3GT0A 4H27A 3VKFA 4X91A 4HNAA 3EXFB 2YHSA 2G8NA 3AFOA 1VA5A 4HXYA 2Z5VA 3JCZA 1X1TA 2NU6A 4YUAA 1PNOA 3VC3A 3ZYZA 2RGEA 4LDAA 4E09A 4JI7B 3WP0A 3CA8A 3CR8A 5A1TA 1QVRA 1NRWA 1T0HB 2P9TA 2RE8A 5A62A 3P9NA 3PQ6A 1E2LA 1E9DA 3TPFA 3AVOA 2B30A 2HRZA 4KX3A 4JI5B 1K1EA 3QA9A 4KO2S 1C4OA 4L76A 2YNMC 3KLPX 2R60A 3PFBA 4PSAA 1A4XA 3UV7A 5BRAA 4RMIA 3W6OA 1W581 2RK4A 4OJNA 1II8B 2XE4A 4ANFA 3DOIA 2QLTA 5DE3A 5ICFA 2NX2A 3AKEA 4FT2A 4GBMA 4IZHA 4Y2SA 1SURA 5MN4A 1ZONA 1NXSA 2DQSA 1GZ5A 3GLQA 3K70C 4A8PA 2YVAA 2QYSA 5JXIA 3B7WA 1VP3A 3ROEA 3HJCA 4DGSA 3T3EA 3TXYA 4A8JB 5F3WB 2QTHA 2IFTA 3KD2A 1XZKA 3ESRA 4Y7CA 3B6JA 1P6UA 4KIJA 3VR4H 3E15A 5AD1A 2ET6A 1DRKA 3ISTA 2C2MA 2WFLA 2GN0A 1T9CA 3HYSA 4FYXA 4D82A 2PZEA 1CY4A 2ZTVA 1JA1A 1GYQA 2Z43A 1Q17A 2PGAA 3MLEA 3JYOA 3IVCA 2OKCA 2OK8A 1M6EX 3QTTA 4TV8B 4AD8A 2IHYA 4KUGA 4ZREA 2OB1A 5CBKA 4ZP1A 6REQB 2HDOA 4FMCF 2JIMA 2HIGA 4JS0A 1WPXA 4RTRA 4ZZ3A 2F55A 2IX9A 3HNOA 1XXLA 1TF2A 2VL7A 3ZNOA 4L02A 3RU2A 3PXUA 1DKLA 3I53A 3G13A 4N5NA 5CT6A 3G0IA 2PGDA 5KTMA 3HP4A 2ATCA 1W2WB 2GBFA 1YR9A 1ZJ6A 3DTTA 4KI7A 1PGPA 1HQDA 1I3OA 1HYHA 3JWPA 4JJ6A 2Z2IA 2RAFA 3PVSA 4GP6A 1FS6A 2JI6A 4HAOA 4F9GA 1TCBA 4BAGA 5CBPB 4XJVA 4L9RA 2FEXA 1L7XA 2CJFA 1LSJA 1WCIA 5AJHA 5H9VA 5CH8A 5JV5A 3E81A 2Z08A 1PJQA 1EFPB 5AW7A 3B89A 1FJXA 1L5QA 3E58A 3E61A 3M33A 3A1DA 2W4IA 1U28C 3OKFA 4R8VA 5D51S 2G8LA 1L5GB 2WR8A 3OBBA 1SH7A 3RPEA 3UATA 1YU9A 4MGYR 1JJBA 4D98A 3TFOA 3EVTA 4CCAA 1TUGA 1JHRA 1G21B 4QQKA 1KK3A 4AX8A 1V1MA 2GBPA 3P5SA 4M1YA 2QZSA 3E0XA 2SKEA 3B1WA 4EX7A 4P6VF 4AJHA 1U2EA 2GXUA 1YDGA 3A6LA 2NUPA 3EVZA 4DADA 1SM4A 1ZZEA 2O0KA 1ZAKA 1C1HA 1UMDA 2WSYB 4N5IX 4U8HA 5CB4A 3ESYA 4ZEVA 3TLXA 4FZ5A 4MA4A 1X1SA 3BD8A 4BQRA 5GOZA 5AI9A 1NJ1A 4Q7KA 3IDFA 2E9SA 1GHTA 3MAJA 4OHUA 5DLDA 5T5QA 2I80A 3PRYA 1QFSA 4NOKA 5AM4A 4FVTA 3KR9A 4GO1A 2COUA 2P9ZA 2QAGB 2F2TA 1ODFA 2EAUA 3IERA 3MWJA 3EULA 4CEHA 3TUJC 3L92A 2PZGA 2IIVA 3K1AA 4WERA 4EYOA 1EDZA 2EV9A 3BF8A 3I5UA 4N3GA 4F9EA 5DXFA 3OC6A 4CM7A 2JJYA 3I23A 1CY7A 3D81A 2H2WA 2JH9A 3KV1A 3Q2OA 4QEKA 4MZDA 4V02A 4DCUA 2Q6KA 3UXMA 5JHGB 3LCJA 1HYEA 1NSTA 2JHCA 3H7IA 5IVDA 2Y1OA 2Q29A 4BMOB 1KO5A 2RH8A 4Q7EA 1PJ8A 2JIOA 3GXOA 4XIIA 3NHSA 2G9RA 2C7VA 3QKRB 4EB0A 2MR5A 3PA6A 4IIEA 4CIXA 3Q1KA 4LBVA 2IL1A 2I6SA 4EHHA 4F92B 3ZR4B 1HT2E 2G1JA 1YV9A 3BSFA 2IHTA 4CLOA 2HRRA 4KQJA 2B4RO 4J16A 2IBSA 4JUIA 3O4GA 5JJ5A 4RF4A 4OGKA 3R5HA 1DXYA 4CR6A 2PV0A 2QE7A 2V4ZA 2I03A 2Q2OA 2BEJA 2GT1A 3DFKA 3OJWA 4AWXA 3EEYA 4WBNA 3GP8A 4LSZA 2H4XA 1RWXA 2AD1A 3FD8A 1S2GA 2H1SA 1ZR2A 4RVSA 4IXWA 5AVYA 2YV1A 1S7CA 2Y0EA 3UFXA 5FPTA 3UYLA 2M1XA 1T5DX 1YMVA 2XVAA 1SKMA 3C87A 5JH7B 1OILA 3JU3A 4IRXA 1FC0A 1U2GA 2V7QD 4NQRA 1IHDA 5C4GB 4AUKA 1BN7A 5G3YA 4HRVA 4E0BA 2AFHB 2JFXA 3WZMA 1MG5A 2YFQA 4HTFB 4ACAA 4E1BA 3ECAA 5DYYA 3ZTWA 4NP6A 4NARA 3SIPA 3B1JA 4KQ9A 3PFFA 3A1CA 5FBLB 5B12A 1QH1B 4BKPA 3K1ZA 4RYDA 1RQGA 3ZNQA 2HF2A 4NNJA 4XA8A 1E58A 2H1FA 1NN5A 2ENUA 4BLPA 2BHRA 5CVCA 3T5GA 1G4AE 3P9ZA 4FPXA 5FH9A 1VPLA 3S27A 5K0SA 4UNRA 4UHHA 4DM7A 3LCRA 1RHKA 4JI6B 3STUA 2CLEB 4BEBA 5JCXA 5BURA 1Z9BA 4TL9A 1IXYA 3FSGA 1KKLA 1H5UA 4BO5A 5DSZA 4CV2A 4D44A 5H70A 1Y4UA 2C57A 3ENNA 1QE5A 3EODA 3C3YA 1I0ZA 2CBGA 1RRGA 4LF5B 5CHEA 3TX6A 4EVQA 3RBAA 1OE0A 4E88A 2IPMA 3H5LA 3LT1A 1NQVA 4DQXA 5FOTA 2EKLA 3F4LA 4EAAA 1TJ3A 3I9NA 1FB5A 1XZPA 3DB1A 5EHZA 3B6EA 3R5FA 3I37X 3FNIA 3T4PA 2NTNA 2BGMA 2Y27A 1M7GA 3ET4A 3GK3A 3OQHA 4PVDA 4RZIA 4ALIA 1H1LB 3T3DA 3K0FA 2RHGB 3BC1A 5EI5A 5FOXA 2LDXA 4AKEA 2P8SA 4O4LF 4JGIA 1GLGA 4EY4A 4KE6A 1CY2A 3CLUD 4Z54A 1UOOA 3D2LA 2DUMA 3EG9B 3ND5A 3W3AH 4YPOA 3TSCA 4A8HA 3AINA 3OF2A 3RGWS 3RTAA 2OC4A 2P90A 2CHVA 2GESA 1XTQA 2K2QB 1T9BA 2BR4A 2BUCA 3C6KA 3ICCA 2IPAB 2DFNA 3GGSA 4P4NA 4P5EA 1G63A 4BX9A 1GRVA 4K0KB 1T0IA 4Y3UA 2QZ9A 1TCAA 3QTBA 5B7PA 1FSZA 2PYIA 2XTNA 2OC9A 2DM6A 3OEEA 3AVWA 4CMIB 2H1RA 1FOEB 1JS1X 3CG0A 2RH9B 5F21A 3T1OA 4UBOA 4DR4B 2YX1A 5BRJA 1OTYA 3HU5A 4TS4A 4YP1A 9GPBA 4ARBA 4G89A 4GPAA 5BW6B 4K3VA 1ZMBA 5ECWA 1NU8A 3D6HA 4I6GA 4U7DA 4S24A 4HBGA 4B80A 1X1AA 1PZFA 1VCMA 1HDRA 3I42A 1Q0UA 3NP7A 4U7HA 5HCUA 1A1VA 3AFNA 4A03A 3LDGA 2JGDA 5AKXA 4OMDA 5BSVA 5DRYA 5HGJA 2P40A 4K40A 1R4MA 2G72A 3DE2X 3RKUA 4EPWA 5AQ1A 3GMSA 4QUDA 5K0EA 5KPJA 3SR4A 3P8ZA 1JEOA 1X7XB 2RI0A 2F43A 3AESA 1H6BA 2C20A 3HEMA 1VBFA 4E31A 1J56A 4K03A 2FDXA 4IF4A 4GOMD 3EGXA 3D6FA 1TTTA 4GC5A 2JLVA 3MMNA 1F5NA 3HBJA 3K0KA 3RT9A 1T3GA 2B1JA 4DCPA 4KLAA 4QELA 1Z17A 2IX3A 3QIAA 4R16A 3RYCA 1A2QA 2FOXA 4MYDA 4EGSA 1PT5A 2FFHA 2UKDA 3HB5X 3WGVA 4EFLA 2AV6A 4OLJA 4LF8B 2YTZA 3RUHA 1YDEA 1PWXA 2EGHA 4O2AA 4Q3NA 1VHWA 3QKIA 4R69A 4TSKA 2OZVA 3EVDA 4EMBA 1ODKA 4D9KA 2PGOA 4C87A 1ZK4A 4F3YA 4YRDA 3E3LA 2VDMB 5BR8B 1E3QA 1YJXA 3I8SA 1BGWA 1I6WA 3V46A 2IYQA 3EHDA 4KR2A 1KMIY 1VLVA 2C7OA 3H5RA 5DOZA 5TGZA 3JV7A 4MLCA 4QPZA 2V3VA 5TIIA 2PXXA 3VVMA 4P7FA 5J1SB 2YFKA 3EXHA 5FTLA 1ODIA 4TXNA 1YD7A 2NZWA 1WDKA 3R5KA 4E5YA 4O1MA 1GRRA 3IBCA 2QX9A 1DWUA 4PLYA 3CRRA 2ZW9A 1RQ7A 2CN1A 3IDAA 4FN4A 4MITA 3ILSA 1KAGA 2HHLA 2CD9A 3TH5A 3TZQA 3HXKA 1AO0A 3SMVA 1QJ4A 4WINA 2GVNA 3BXGA 4C7OB 2IEBA 1MC4A 1V1RB 5SICE 4BV3A 1E0KA 2BEUB 2W2VA 4JQCA 4U02A 2YL2A 3M6AA 3HO6A 2ZB8A 3LXXA 3RJTA 3N7UA 1TCUA 1W36B 4P4SA 3K9BA 4D3XA 3IAHA 1VLJA 4H6XA 4MPRA 2X5OA 3F8SA 3JATA 3WAKA 4YRGA 4XGQA 3QOFA 4H3VA 2OXTA 3DYBA 1QU3A 2PX5A 3FHLA 2FMHA 3ESZA 4XKJA 1E0SA 4I4LA 5JASA 1VBKA 4NBNA 4OBWA 3PFKA 3AWDA 1YS1X 1Z45A 3DKRA 4AZTA 5AXBA 4ARZA 3V4PB 1YVDA 2QN1A 1V8ZA 5IK2A 1QO0D 3C2QA 5CCBA 3NYWA 3BILA 4V03A 3ZGNA 2Q9BA 5EXSA 3B1XA 3MT8A 3RSHA 5FNVB 1RWKA 1GA1A 4DT1A 2GPNA 2VP0A 2OCKA 3HMKA 3K6JA 3VR3D 3UK6A 1MV5A 2NYVA 1HDCA 3HKDB 2HD4A 1Z2DA 2A4KA 2A0KA 4DZZA 3P7MA 2OKGA 4DJDC 4JLUA 1QWSA 3MCZA 5I3ZA 3CSSA 1ZM4A 4LJ4A 4OM7A 3RYIA 3OD5A 2R4TA 1CX9B 4G5HA 5EUMA 3T0FA 4EB3A 4HSEA 4TM7A 4E3ZA 5BSWA 2YRXA 4ZDWA 1AHIA 2GTIA 4UCWA 2R79A 1B41A 1NZDA 1LJLA 2K5UA 4NF2A 1OH8A 4AP6A 1OAAA 3QEKA 5CRIA 2UU9B 2NAPA 4RV4A 2X9GA 4R1TA 3ZW9A 4HLNA 3JZAA 4OL9A 2IHNA 2IP4A 2ERXA 3GOHA 4IQ8A 4EPTA 4YEDA 3ROQA 3NVKI 1MFZA 5JS6A 1JQJC 5FULA 4K9KA 2VCEA 5K3DA 3ONEA 3U31A 4DMHA 4EZEA 3R6DA 2IYLD 5E3IA 2JD0A 1U6KA 4YXWA 4HMPA 4D0SA 1UBTS 2XNCA 1Y63A 4BQOA 1BNCA 3F9IA 2V4UA 2JLAA 1JVNA 3H5VA 3LPAA 5EPOA 5UKDA 4QSHA 1N36B 3ZCTA 3JVIA 1FQOA 3WYFA 1P2GA 3SEFA 1W59A 1TIKA 1YU6A 4XUGB 1FFEA 4FCVA 3VKWA 5KI6A 1ZVMA 1KJNA 3VZBA 3UHAA 1HG0A 1ND5A 4LHYA 4NLLA 4UPDA 3O73A 4HNRA 1KS9A 4ERXA 4QLBA 1QAQA 4MOWA 2XMBA 4HPXB 5LUAA 5IN5A 4M99A 1A9QA 2H2DA 2E5LB 3G1UA 2WIKA 3T7IA 1N1EA 2A7QA 4FR5A 1Z6GA 1IG3A 1PNRA 4PEVA 3HDHA 5A4KA 2H7VA 3CF4A 2MHCA 1DCTA 3HUDA 1V11B 1G21E 1S2OA 3LW8A 4AUEA 4BFZA 2EL9A 5COAA 3NAZA 5AOBA 3A1TA 1T1GA 2WJGA 4HYEA 1FXSA 3URKA 2W6NA 3L04A 3GI1A 2NV0A 3PC2A 4MQEB 3UMVA 1T2UA 4AXBA 1QG6A 2HR1A 3GB9A 2C58A 2J09A 4KPFC 1ITZA 1EBFA 1KZHA 4DKXA 2MCFA 2TMKA 4YRNA 1I8TA 1Z82A 1E0DA 5KQMA 1OUMA 3IT2A 5LVAA 1OSNA 2MR6A 4B83A 1NBHA 2XB9A 1J22A 2VJBA 4QGAA 1NJ2A 1NP3A 1ZPDA 1POXA 1CJBA 4A3SA 2HJGA 3E6AA 1TMOA 2OQVA 3W9YA 3U39A 3HCWA 2B4YA 5TLSA 1R0YA 3ZDYB 1Z5PA 3O38A 4REMA 4RK6A 4FFSA 1E2NA 1P7ZA 4GF5A 4GIBA 3P9YA 5AOVA 2EGUA 2VJDA 1GPBA 1W47A 2XXAB 4RA6B 4CEIB 2H7CA 2C2XA 4IICA 1WY7A 4XWWA 4Q24A 3TRKA 3F98A 4GGPA 2VDRB 4P31A 3QSGA 3G0BA 4IILA 1LFAA 5U4XA 4BNXA 1IZZA 2WKSA 2XLCA 1RW4A 4FZRA 4PGFA 4C29A 4GI2A 3DVQX 4ZEXA 3MCVA 1ZBQA 4OBEA 4A6DA 1T4MA 2RONA 5FDFA 3WJAA 3TMYA 3M2PA 2FUNB 4EI2A 1W36D 2J48A 4ISCA 4NECA 1T9GR 3H86A 2IYWA 1FU7A 1ADCA 1LLFA 4KR0A 1NI5A 1K66A 3C3KA 4DIKA 1MH1A 4BB0A 1AQLA 1N7IA 2V6IA 5K8IA 3R9WA 1GPUA 3CF6R 2HU7A 1JTVA 2D7JA 4BNJA 1I3MA 2NQ2C 1Q0PA 1L2TA 2EYQA 3D4NA 1ZJJA 4X1IB 3DF9A 3D6VA 4I8DA 1UKBA 2E1PA 2R1ZA 4OJTA 5SY6A 1V16A 3AL0C 1E9EA 4NDNE 2H16A 3CF0A 3PEWA 2HO4A 3IHWA 4OJQA 4KITB 3FW1A 1RJWA 3T9AA 1EJ2A 4RKFA 4X93A 1FF9A 3CVUA 1M6NA 3NHMA 2PWBA 2NVUA 2WYIA 4PO1A 5J47A 3NIGB 1A9OA 3FVQA 4DAOA 1U7WA 3A9UA 3HKBB 3ZHVA 5IJ0A 3PUKA 4E03A 5LOVA 5JZOA 3NHLA 2H85A 2J08A 4R2KA 3TQIA 1P33A 4L9SA 5FPPA 1W1UA 4ASUA 1X0XA 3R4CA 4LOJA 4UUOA 4BGUA 3GP5A 3S1AA 2PUBA 4ENRA 3A14A 4CMEC 1FL9A 3NORA 4QT4A 2PLNA 5FEMA 3TDMA 4HNUA 1OPRA 2GKGA 1NRJB 1WLSA 1T10A 2J9RA 4XCQA 3RU3A 3QE9Y 2B3DA 2RKOA 4JSTA 1U1EA 1KJIA 2HSWA 2WZDA 1VLLA 4LGCA 4N12A 5KO2A 5CDTA 2C1EA 3NT4A 1FNCA 2BMVA 4J7XA 1L5OA 1EXVA 2W2LD 3D1VA 1DHRA 2XV1A 1ZYUA 4DABA 4GS5A 3VMMA 3L01A 5DP1A 5K8LA 2QOEA 4ZMSA 3PXEA 1KXZA 1BFUA 3RBXA 1EDDA 1XRSB 4CW7A 1OT5A 4LYYA 2KQUA 3C3PA 1HKUA 1RPJA 2YJGA 4HF7A 3VSDA 3AKCA 3VZCA 3OFSA 3NBUA 2EERA 1CQIB 2BISA 1TIBA 1M2WA 4A6EA 1HQYE 4NU0A 3RG8A 4P92A 4ABYA 1T2NA 2D1YA 2PXHA 1Z2OX 3MM4A 1EBUA 3WIBA 4D25A 3WHKA 1U1DA 4PYKA 4RK5A 1DADA 1WUJS 1SCJA 2WB4A 4F72A 4CQMB 1SBNE 1ST2A 1VJ0A 3IIIA 1XZDA 2JJ1D 3BUSA 3M1IA 4HB3A 1B8NA 1NNLA 2H08A 1JHVA 3HA3A 3TI7A 3ZXIA 4AM8A 4F8YA 5IDWA 1X38A 2OY0A 3FTDA 1RAIA 4IUYA 4KWEA 5IYZF 4B7CA 2YIJA 3O1HB 3N05A 2RIPA 1OZAA 4IJQA 4ER7A 3VV2A 4AJLA 4YRAA 5HRAA 3Q2KA 4XXHA 4Q6BA 5CUQA 2OV3A 2XJ9A 4UZFA 3DEYX 4JP3A 5EEHA 2FDCA 3SC2A 1KK0A 3R0QA 3GRKA 1QCZA 1XMPA 1CE8A 2WM2A 3H8WA 3PFHA 4JROA 4TLEA 4X20B 4BP1A 5KOJA 5JSZB 3KTDA 3QEAZ 1GTL1 2GJKA 2HA2A 3OTWA 2XYQA 5JSFA 4EAQA 4P34A 4NI5A 4NHEA 4XSVA 3ZV5A 5JZ9A 4JXXA 2QUBA 3IUMA 3ODGA 4W7HA 1SIUA 2GXSA 2X9NA 4H7KA 3T41A 4V0KA 2Q1SA 1GNQA 2GEDA 4JDUA 4WX2B 2PBZA 5AI4A 1CFZA 3A6FA 4J1QA 4LDZA 1MORA 4MWEA 1G7TA 1A95A 4TMXA 3V8RA 2PKQP 2R4QA 3G0CA 4F46A 5KYVA 1QIMA 5I3CA 4LRWA 2V3CC 2I8AA 1XF9A 4L5CA 3E9CA 4RZ3A 3AM4A 4TRJA 3A4TA 1ZG3A 1WSAA 4RVHA 1SUSA 3C7AA 3ESDA 2W90A 5IT0A 1Z16A 2C3PA 4AWBA 3GLGB 3I45A 1M7HA 3OESA 3PTAA 2JK1A 3NETA 4M98A 1BCRB 1AT1A 4XYGA 5HQJA 4HDSA 3TLKA 2DLNA 3UJHA 4QFCA 3K8QA 4FE3A 2IDKA 2WU3A 3AIKA 3GOQA 1KMHB 3KYBA 2EX1A 2BDEA 2QI9F 1PNQA 3G0GA 4J0QA 4M49A 4E15A 1V26A 3I01M 3W3AA 4H7PA 3BWVA 1AK9A 4B8WA 1ZLYA 2FPGA 5AVXA 3FWNA 1Q95A 1M2OB 5ER6A 4YCLA 3A4LA 4JA2A 4ND3A 3D7LA 5JNWA 3F46A 2YOHA 1LFDB 2CL5A 2VJYA 1ZIOA 3AEQB 5JSYA 2BUAA 4F6RB 2UYCA 5BOVA 5M04A 4B87A 3AI7A 2Z0MA 2V6JA 3DVRX 4DLBA 2HDWA 2CNWA 3JQ7A 4F6CA 2Y3IA 1O0BA 5DU2A 4BNYA 2AE2A 3ORHA 4ZU1X 4BVJA 3FR8A 3DW3X 2QTCA 1Q1ZA 3IPLA 3HB9A 1UBRS 1EHYA 1BDMA 2Z2JA 2C2HA 4HUJA 4YRFA 1J0AA 3S44A 3B5EA 3EPLA 1RWPA 3LUAA 3LKDA 2XH8A 1VPTA 4ZDKA 4ROTA 4H1VA 2I8CA 4UTOA 4IH9A 3KT8A 4MEBA 4XFJA 3QPBA 1CG6A 1DCKA 3CLRC 4DMUB 3UT0A 1PZMA 2R00A 3M4JA 3U4GA 4I8IA 1JWBB 1QYXA 5KTYA 3TLGA 3FFAA 2B1RA 1IWOA 2O14A 1U4SA 1SBCA 4FSHA 2VKQA 3T5CA 1A2KC 1Y37A 2I4LA 2VNSA 4GP7A 4J0JA 1W6RA 4LWZA 2WLSA 4RPJA 4U5QA 4ZRMA 1XO1A 2FCAA 3JALB 2LP4Y 2J59A 5JXHA 3HSKA 3THXB 2CF6A 2ZIAA 4Z49A 1B2LA 3FY4A 4EZBA 2F64A 2FN9A 2DG2A 2II6A 2WHXA 3CE6A 3UJNA 4HLDA 4N6NA 3OWXA 4JAVC 3ZGZA 3UK2A 3ZD9A 1Z68A 2CXTA 1BIFA 3Q3JB 3CNEA 4JP1A 4YP7A 4L5IA 3BJRA 2ZWMA 1MXFA 3ZE1B 1DQYA 1VZ3A 1OLUB 2BTQB 2HIMA 3IVAA 4HNQA 2QAJA 1QU2A 2ZSJA 3A3NA 1YRLA 3BGOS 2NACA 2CHQA 3OZFA 3M82A 2Q1WA 1U7HA 4IGIA 3PC7A 1RHRA 4CQMD 1R0RE 1Z63A 3FDIA 2O3TA 2MSKA 5BQXA 1DJNA 1IZ8A 4JU8A 2JW5A 1J7KA 2JIQA 3KRTA 5AVTA 1HYQA 2B69A 2P3QA 3QHPA 4DXDA 1S3SA 2GPWA 2DSTA 3A1SA 2A9OA 1K68A 2FPRA 3VU1A 5ELLA 1CB0A 3UXYA 2OHVA 1G8JA 3ZZTA 4PPYA 4CUZA 1PJ2A 4URYR 2AG6A 1YDMA 2GERA 4DTIA 5IT4A 4KRGA 4RLSA 1T4CA 1JBQA 3L0DA 1LK7A 3VUFA 4DJ5X 3UMYA 2C5AA 4O5AA 1W5TA 3BHIA 3G17A 3R0ZA 2HAEA 1KEUA 4IJUA 2VHUA 4QM6A 3DDUA 3L7JA 3A2NA 4MCAA 4ZODA 4GGMX 5FLKA 3V4RA 2DXIA 1JNYA 1VHLA 4IMIB 4M0CA 3V2HA 3WRXC 2F8LA 1GVNB 3JWEA 2UVQA 1H69A 4G9EA 4F4FA 2IP2A 4MHTA 1K0UA 3M34A 4YCMA 2CL7X 2HQOA 4XWGA 4CKEB 1ESMA 2CE7A 1KDOA 4OQYA 3NTRA 4YK7A 3SFVA 2V8BA 3K0AA 5GAJA 5HTOA 1Z75A 3TTWA 3QYJA 2Y05A 4FFOA 5GV7A 3IBTA 4TVBA 4WZZA 1F7VA 4O2BB 4PGAA 2PKQO 4RPCA 1N6PA 1COWA 2KW5A 3DV0B 2GBGA 4NBVA 4K9PA 3VJKA 4Z5XA 1O95D 3N3AC 2YY7A 2CDBA 4U6QA 1E96A 2OPHA 2G77B 1VRWA 4PTLA 4PX9A 4LXHA 2XMZA 4LBZA 3M1LA 4KE8A 4WCFC 4M0UA 2PJUA 2AW3A 1QC5A 2R86A 2WQZA 3NNDA 3P52A 4RX1A 5BSFA 2ZM5A 2NO1A 4DHEA 3E22B 1K4KA 2NW6A 2PBLA 3PFGA 3BE4A 3WFIA 4OMCA 4B4VA 5I8PA 4X1YA 1UOEA 1JHMA 1OR8A 2VUIB 4LV8B 3FF1A 4F2HA 3N3BC 1H4QA 4Z7JA 1KH1A 1KIMA 2FXVA 4ITUA 4HWOA 5E1MA 3U62A 1QP0A 1EP2B 1PV1A 4BUJA 2A0FA 2RBEA 1OZGA 4C7XA 1IQUA 4MCHA 1I32A 1EZZA 3PNLA 3PJGA 3G1WA 1XJWA 2JVJA 2KE5A 4Q9NA 2YMQA 3O90A 1M33A 1LW7A 3SPXA 1KO4A 3F5SA 1YOBA 3CUKA 5H81A 5A2QA 5IZCC 1M1UA 4H7EA 3V33A 3K0BA 1UF9A 1OHHD 1TQ4A 2FPIA 4Q03A 1IMOA 3O3OB 3CB2A 4X3CA 1FX1A 5EWLB 2HM7A 4QT0A 1RNLA 4OLHA 1IN1A 4KMSA 4M1OA 1CS0A 3K6KA 4B46A 3R77A 1HLFA 2RHTA 3GARA 4ZHSA 4FYVA 2JIPA 1B0PA 1KY3A 3GQBA 1KSFX 4Y6PA 4D6YA 4QREA 4HDMB 2PY6A 3EGOA 4I2VA 4BLQA 1U9IC 2CLMB 3Q72A 4FDMA 1ZY2A 4NULA 5ER9A 5KYTA 1NP6A 1N0HA 2WT9A 3KUCA 3MCUA 4XGIA 5JG7A 1VIDA 3UTCA 4BWYA 4WI1A 1N2CA 4Q05A 1U8TA 1RFGE 5ALSA 4JC4A 3E2PA 3WMRA 5AKJA 3RSOA 4A5OA 3KCNA 1G2OA 1GGFA 4P54A 1F2UA 4R54A 3LVRE 3VYTB 5D6NA 5A6SB 3OZTA 4KTTE 2R6FA 5E4FA 5C7YA 1FX0A 4Q7MB 4JJGA 4N01A 3WLHA 2QT9A 3CNHA 3LNCA 3I2GA 1JG4A 3HUUA 3OZGA 4GOJA 1V48A 1GIAA 1FNBA 5FFNA 4DBLC 2LZ0A 1IOWA 5FTMA 2N3ZA 4NKRA 4RLQA 1ZN9A 4TL7A 1T26A 4KQCA 4KNYA 4ZV9A 1C4XA 1WUHS 2H8GA 1C9DB 2FLKA 2HA4A 4GZ5A 3DOEA 1DC8A 1HPLA 3N39C 2PAFA 2A5GA 1P5FA 3NB0A 4Y9UA 3JASA 8GPBA 5CEJA 1F20A 2SCUA 3FYHA 4MRAA 4LF9B 2BC9A 4X97A 1VXRA 1SCQA 5H83A 4OQFA 3UH0A 4YQFA 5B1HA 5AVQA 2R65A 4IQGA 3ROTA 4D6PA 1KVRA 4RMNA 4BMXA 5EP1A 1A5SB 1JKXA 1G9SA 1Q14A 2YRWA 3DZJA 2BAGA 3TGPA 1GPLA 1KVTA 3KKNA 4P22A 3I28A 1J5PA 1H5NA 4QDKA 3EZ2A 1RHJA 1FXUA 1UC4B 1UT6A 1MF7A 3H4TA 4JSYA 3N07A 4PR0A 3TUIC 3OZ7A 4IGAA 3U3XA 4CTKA 3A6JA 2OD7A 3HVKA 4IWYA 2VNJA 2FY8A 1NN3A 2PSSA 4ZCLA 1IB6A 1OLXB 3QE4A 4X62B 3U3RA 1I7QB 2R6AA 3HKEB 5SZHB 2YV2A 3JRNA 1Q11A 4GKVA 2C98A 4TS9A 2PNJA 3BJEA 2PQ6A 3RABA 1DOAA 3ZQKA 3AJ8A 4DLXA 3SQWA 1XWFA 1PT9A 1CR2A 4MV9A 1RM0A 5L3QA 3K1YA 1MAVA 3EIOA 3PEFA 1X8JA 3UK7A 4J94A 3TCNA 5KMGA 1VL8A 4RFSB 2BVNA 2WAOA 1G8YA 4EQ6A 5J5AA 5ARCA 3A0RB 1JUDA 5TS2A 3EK2A 2FK7A 1NVMB 4C1NA 3LO5A 1VI2A 1MB4A 4GEKA 5TQ2B 4DOMA 1VPDA 5DFAA 1ESDA 5D8DA 4TKUA 1MRZA 3NYQA 1XEFA 1XCGB 3PPXA 1QOQB 4GE3A 4EBFA 1T13A 4GEGA 4G1VA 1U94A 3LX5A 3EVNA 5IHPA 3R9XA 2BH2A 3CCBA 3BGWA 2BGGA 2V58A 2VDWB 1JZTA 2F1RA 3EF0A 3IESA 3BCSA 3I83A 3NP9A 5FLYA 2L42A 3MGBA 1UJ2A 4D0NA 2CV1A 1YZUA 1H66A 1GD1O 2XUZA 4B8ZA 2A92A 2W43A 3V4ZA 4RJIA 3LX8A 4K2AA 3VDRA 2PJZA 1Q3KA 4OHPA 4CM5A 1MDFA 3PQ5A 4J7CA 4CFSA 3AP2A 1X9IA 1Y8CA 4UM8B 1EVKA 1BHQ1 2JEOA 1V47A 2GNOA 3HZZA 3QLUA 4I1YA 2OFXA 4U7TB 4ZV7A 1WD7A 3KTAB 1ZISA 1UMCA 4N1AA 1H85A 2FFRA 3ZQ4A 5AJWA 2GUGA 1NW5A 4JY7A 2XE7A 1LPNA 4KX5A 5I7AA 3QX3A 3VAZA 1SHTX 1MP0A 5CIYA 3OX2A 5C8YF 3U3MA 1QM5A 1QX4A 2ECQA 3JS5A 1XZMA 4O4LA 4G0PA 4PN3A 1Y80A 3ESBA 3A58B 1L7QA 2Y66A 3HYCA 4YAIA 4P3XA 5M3BA 4MP3A 1AUOA 3INTA 2WWHA 2GJAA 3W9UA 2F1JA 1SQFA 3BIOA 4EW2A 3GLGE 2VNIA 1T1RA 4R3UC 2BFFA 3H9GA 4PQEA 3KLMX 4QU0A 4DJEC 3KPWA 4NMMA 1TO2E 2RGGA 2WILA 3BK1A 3DWIA 3M6MD 3PJRA 1MQ9A 3MTEA 1PLKA 5FD8A 1CFJA 5H3CA 3WWPA 4CM1A 1KJ8A 2PH3A 3E2MA 3QHAA 1JHZA 4B0PA 4QQ8A 2BKEA 4O02B 2ZT5A 3W8NA 5BXYA 3PQ7A 2D0IA 1GRNA 2J9GA 1W0JD 2D59A 5DTQA 2GJ8A 1T5LA 2ANBA 3BQNB 4GLJA 4KK4A 4ARSA 4R68A 1W85A 3V9PA 2GPJA 4C3UA 2QDKA 5CH5A 1J90A 5EMNA 5EIXA 4II7A 4QJ5A 2ZR0A 3DLPX 1FPMA 1URPA 2JNWA 5LD2B 4FYYA 3DAFA 2GAJA 1R5OA 3CC8A 3GNSA 4S1PA 4M4SA 1TQDA 2ZWVA 4D9MA 3OBIA 2R1VB 2FSHA 1JX6A 2NPIA 2XNSA 1AV7A 3PKJA 3ZCSA 1RLJA 1N2ZA 2IYXA 2MMGA 1F9EA 4XM1A 1LQ2A 1M2KA 2M1ZA 4E08A 1W88A 1NE2A 4LJ7A 2H9YA 4M0LA 1Y7LA 2XQGA 4P1ZA 4GMXA 1VI5A 5EG5A 1Y1PA 4FINA 4B31A 1PKXA 4R9SA 3WDSA 2H4HA 2PXAA 3DKPA 5KJCA 2C00A 1OU0A 3DPSA 1QMPA 2XDYA 3B3AA 1RPAA 4NR0A 5F1KA 1E3JA 4ZIRA 1M5UA 3F3SA 1SCUA 1EP9A 3DGFC 1TE2A 1X92A 3DL2A 3BFVA 1VL1A 3UOAB 3HR7A 4I5DA 3TPCA 4JJ4A 1SGWA 1ZJZA 1ULTA 2BBWA 3BXXA 3EMDA 1C29B 3GJ7A 3QOWA 4QNRA 2X8LA 3LXUX 1VKRA 2YH2A 2ZPUA 3K2EA 1LBSA 1THGA 2DPLA 2Q9UA 2ADFA 2F9FA 4ECEA 1ILWA 4UZEA 3OQIB 4B6PA 2ZE8A 4XUEA 3PQ4A 4BAZA 1SVLA 1BC5A 3H1BA 3O4JA 1N5DA 3EFOB 4LTNA 2D2IA 1X1QA 3CKYA 4RPGA 4WK6A 5KSPA 1JE0A 3FDFA 3MPUA 4OI1A 4BX8A 2XB2A 2G4VA 2AJLI 4CCYA 1X1RA 1ZNXA 3LXMA 3IBFA 4R2MA 2ZRKA 3T5AA 3EUAA 3KEGA 3REFA 1CBUA 3EYAA 1FSFA 2O1XA 2O2GA 2RGBA 4C14A 3LYUA 2ZUUA 3MJFA 3H9JA 1MAWA 1P1CA 2P7IA 3IA7A 3OD1A 4TMTA 3W8FA 1VECA 2WTMA 1RACA 3K9WA 1Y82A 2HMWA 5EWMA 1UEXC 1U8EA 1M2HA 4DYDA 1Z2EA 3DZDA 3OKCA 2W0MA 1QP8A 3FZNA 3HDQA 3BJMA 4JKOA 4WXEA 1X86B 1PDWA 4BVFA 4Y6OA 3BJZA 1IJEA 1AOXA 3MTJA 4Z51A 3PIDA 3RB8A 4G0QA 3REQA 2OO5C 4IM7A 5IM4F 4Y2RA 4D2IA 1OAOC 1OZ0A 4LWPA 3T5MA 4ZC1A 4GSLA 4D9GA 1CUZA 4LGYA 2FWPA 3UGTA 1C0LA 3BJIC 3CXRA 3G68A 4RMHA 5K0ZA 1SXJA 3MWDA 1M8FA 4MIYA 4O1IA 3IV7A 1SVMA 4JR1A 4JLWA 1IONA 1NQXA 1J21A 4MIKA 3HBMA 4JLKA 3FTCA 3H0KA 3HNRA 1F51E 1R15A 2JKYA 4ZI2A 4Z2AA 1TK2A 3CCCA 3BMQA 2EEPA 1M2VA 1Z0FA 3FYUC 1PO7A 1S8NA 2O9JA 3CG4A 3P2OA 2CFSA 1H6DA 3OJFA 1HDOA 3B82A 2OZLA 5LYJB 1B15A 2FSGA 3L40A 4F4HA 1DP4A 2DOKA 4GKKB 3I1YA 3ND7A 4QU8A 5E8RA 3UAYA 3LPMA 5LIRA 4KQIA 4MPJA 4KP7A 2IEGA 4L9AA 2XZTA 1P2VA 5AKZA 5KKAA 2HLNA 2IH4A 1FXWF 1ECFA 1PS8A 2OAEA 3EXEB 3KXKA 1GL7A 2IU6A 3V8PA 3L0YA 1HEYA 1MXHA 1H0HA 4HDRA 4PO9A 1DQRA 4BQFA 2GLTA 5A4DA 2IH2A 1O5IA 2O3SA 3HKCA 4M89A 4Q9JA 1K6MA 1O6FA 2PE5A 3LY7A 4DSTA 1T8RA 1XCJA 4NJEB 4RABA 3OT1B 5DWQA 1G0OA 1K89A 3HYNA 4OOEA 5BN4B 1GFIA 2VJPA 3VZQA 3HFRA 1U2DC 2ZG6A 4ZVVA 3VPHA 2X6RA 2G9VA 3NDJA 2N46A 4MV1A 2BRUC 1KH2A 3L9WA 3Q9UA 3T9FA 4C4PA 4LZNA 1NPTO 2DUWA 2P0EA 3C5EA 3OY7A 3UMSA 1Q12A 2Z2KA 4ZHQB 3QEMA 4BDSA 1DX9A 2F3QA 3VZSA 5CDFE 5FPKA 2B1IA 5FUQA 1A9YA 3BA6A 2JLQA 3L06A 1NZJA 1E6UA 3H4VA 1Q6YA 1NR1A 1L1QA 3IS3A 4IIJF 4CKBB 4EHFA 2HXSA 4O08A 4BFUA 1NF9A 2AVNA 2HGZA 1WNFA 5LQUA 2QXUA 3LGXA 2C99A 1Z34A 4NCJA 2B25A 3VU8A 1WZUA 3EGIA 1WBJB 5FO1A 1YTUA 1EDEA 4HN9A 4EX6A 1B6GA 1LH0A 5DNAA 5FR1A 1T5BA 2ZI6A 3FNRA 4Y1FA 2FW0A 2ID4A 2VF2A 2JJ8A 2R5NA 2X14A 5CFNA 2C04A 4MCJA 3W1EA 1XMJA 1M72A 2GEKA 1TQ6A 1DUSA 2C4UA 3C3AA 1JH8A 2XCUA 3OQVA 1JU3A 2IRWA 3DMPA 4G26A 2OCBA 2HA6A 3C6QA 4LQ4A 4RUKA 3NYRA 5AKGA 4EUSA 4R41A 3KR0A 2BTEA 3MGGA 1UBJS 1AG9A 4W7IA 2CHUA 2IU4A 4WK4B 1QOZA 2IBMA 5ITSA 4JI8B 5H82A 2VO1A 3GXBA 3O5AA 5K0JA 2FX2A 4Z4HA 3PD1A 1RXVA 3TOXA 1T2FA 1O87A 1ACJA 3HL4A 3IE2A 5EZYB 1KQ3A 3CZAA 5JSQA 3H99A 3D5QA 1RAGA 3H6KA 4BMSA 2ZIZA 3R5JA 1N92A 3WLFA 5F1PA 3EIWA 3E4CA 3H83A 4PTYA 2XDWA 5ELMA 2XCTB 3ID6C 1P3DA 2I1VB 3AUFA 3E18A 3G5LA 4PRLA 3U9TA 1JPVA 4TUYF 5HYVA 2BPOA 4PC3A 3RRBA 1R8XA 4IDFA 4LJAA 2C4WA 1H0RA 1M1YB 2HA3A 4PG5A 221PA 4GOOD 1JFLA 1N6OA 1TW3A 4OO3A 2YIMA 4JYPA 1IZ7A 2Z8ZA 4IV5A 2NUAA 1RFLA 4IDAA 1V8OA 2GBLC 3UWSA 3WGTA 4PZCA 2IYOA 1AQYA 2IODA 4TQUS 2O1WA 2TRSB 3MA0A 3QXSA 4KCGA 2HA5A 1QP7A 1TJ4A 1TXGA 2AJDA 1L7DA 6LDHA 1I51A 1SCIA 5FL7A 1EQUA 2OBNA 1E4YA 1PCXA 2OCAA 3KU1A 4XQ9A 5K01A 2QNBA 3IQZA 1JQ3A 5ALKA 1GCAA 3WDLA 5DRTA 4YIKA 4WY8A 2PSHA 1IBKB 2XCOA 3ZY3A 3QWFA 4M9RA 5ERYA 5EQFA 3DB2A 5EUBA 3S1LA 3ZCRA 1WPQA 4RDXA 1I80A 4W5RA 4NXNB 2IUEA 1XTUA 3IP5A 3P9PA 4BLVA 3CS3A 4KB5A 5F5LA 1BQ3A 4NHOA 5KDDA 1T2EA 2VYVD 3DUFB 1G291 3I92A 1RWBA 2QQFA 4IDHA 1L1FA 2C54A 4IF6A 5DHPA 4G63A 1A2OA 3O7MA 1PRYA 2FQ1A 3NTVA 3KPUA 2ZIFA 1YRHA 2DTEA 1T8UA 3HQ4O 3E9RA 3WQQA 4KREA 4HWRA 3CTPA 2GVZC 4DQVA 2V6MA 4CDGA 4ZU6X 2VG8A 4GXRA 3LBNA 3L0ZA 4JYBA 2DFLA 2NSHA 4KHPB 4B1FA 5LU9A 2LPMA 3I9LA 4OYRA 5A04A 2COEA 2HLHA 4RGYA 1JP7A 3OIFA 5E6SB 4K6OA 4KO3S 4JX9A 2ETXA 4R2HA 4XVRA 2OR3A 1I1OA 2CW5A 5K05A 4LMBA 5I01A 1NC3A 1REQA 2CLKB 2O05A 2VYQA 3AUKA 3BKXA 4GRAA 3ZH2A 1EFVB 1XZHA 2XWSA 1RABA 3DE0X 2ZRLA 2X4IA 3LL7A 3FUVA 3P19A 4I7EA 3D5TA 2ZJOA 2PLRA 5ETJA 2W6IA 5BT8A 4AI6A 4L4SA 1QORA 4QJ3A 2AUTA 3EWAA 3WTBA 1D4ZA 3EOBI 4RK7A 4GC9A 2MYNA 1GG5A 4CR7A 1QTRA 1PSDA 2P67A 1KQPA 5K6TA 1E9BA 3DNPA 3M5CA 1NX9A 4X7BA 1YZ3A 4ADSG 2W83A 5BWOA 1VBNA 4RH3A 2VPPA 4GVPA 4ZYUA 4OQEA 2OFFA 2UUOA 1L8AA 3HFJA 4AVYA 2VCYA 3B6KA 4KN9S 1MVNA 2YY5A 1QIHA 4MGHA 1KTVA 3CV3A 2CT8A 1CHNA 2I1LA 1OH7A 1TQ2A 3A9CA 3H2ZA 1ENOA 1QH0A 3MXOA 2V74B 2ZSKA 1SEVA 3GVPA 3CN7A 4ML3A 4UBNA 1NVGA 1DNPA 1TD9A 2Z58A 3N2GA 5FORA 3RYHA 4TMKA 3KJQA 4TMVA 1RTKA 2V7GA 4PHCA 2GZMA 3C3BA 2JFPA 4UCQA 2WJJA 1YQGA 1ORWA 5CT5A 3RLFA 3O8DA 5A05A 5JQWA 2WP0A 1E7YA 5KQPA 4UM7A 3E70C 2VJOA 3ZX4A 3TL2A 2NAFA 3A1EA 5B55A 1UPXA 5IYZA 1WG8A 5IT5A 3R7SA 3X1XA 3EW9A 4IXDA 4K7JA 4I3GA 4QATA 4ZPJA 1LWNA 9LDTA 4BXOA 3OOYA 3D3WB 1GFWA 3TEFA 1W2GA 3JQ9C 1TD1A 4DLNA 1DG1G 2Q6IA 5F76A 3G8AA 2QMQA 2CV2A 1G3MA 3AUJB 1UODA 1IXSB 4FM9A 3WMWA 2O2IA 3TDKA 2Q3EA 3NVAA 2V0GA 4MI1A 5BMOA 1QO9A 3NTQA 3PDCA 3EGVA 4Y30A 5K8VA 3C15C 3QH4A 2VH1A 3CN9A 1O97C 2C2ZA 3O8QB 3FPCA 3F47A 1OFVA 2XUQA 3EWSA 2BFPA 2F6RA 4UFPA 1RJ9B 1XMOB 4LRXA 4MVJI 4JENA 1F8UA 2Y92A 1PEYA 4ALLA 4JXJA 5IBPA 3TRHA 5BMVF 1MEOA 1ULAA 4QECA 3TQFA 4EJSC 2AQIA 3O26A 3TDNA 4WGFA 3HCDA 1SU6A 2CXQA 2BFEA 5DOVA 5L3RA 3W6NA 4AT1A 3O8RA