3FMVA

Crystal structure of the serine phosphatase of rna polymerase ii ctd (ssu72 superfamily) from drosophila melanogaster. monoclinic crystal form. northeast structural genomics consortium target fr253.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
190
structure length
190
Chain Sequence
KLAVAVVCSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGMAFDKPNVYEFGTKYEDIYRDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTKEQFDIIVTVEERVYDLVVMHMESMESVDNRPVHVLNVDVVDNAEDALMGAFVITDMINMMAKSTDLDNDIDELIQEFEERRKRVILHSVLFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Serine phosphatase of RNA polymerase II CTD
publication title Crystal structure of the serine phosphatase of RNA polymerase II CTD (SSU72 superfamily) from Drosophila melanogaster. Monoclinic crystal form. Northeast Structural Genomics Consortium target FR253.
rcsb
source organism Drosophila melanogaster
total genus 43
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fmvA01
2VK2A 1VLZA 4RK1A 2TMYA 2LP4Y 4LZLA 1JFTA 5KWSA 1JWLA 4W5RA 4EYOA 4EVQA 5TQ0A 5ED4A 4RZSA 3QELA 4ZJPA 4RV5A 3QEKA 3H75A 3HCWA 4MS3B 4MRMB 3C97A 4G0MA 1QO0D 1QP0A 2HPHA 3HO1A 3T38A 3O2JA 2WB4A 4MR8A 3D02A 5DGCA 4YR7A 1OXKB 4KPYA 1D4ZA 1ZY2A 4LDZA 3KLNA 4UHKA 3K4HA 3CNBA 3F7NA 4EGSA 3H1EA 3C3MA 4RU1A 3OMWA 1SXHA 2MYUA 3KS9A 4JB2A 1L5YA 2QZJA 4RDCA 1ZESA 4WWHA 3VNAA 1ZGGA 4KQ9A 2JBAB 4P98A 4DN6A 4XXHA 2PUDA 2MYNA 4Z4IA 3EQZA 4MYRA 4WT7A 5DCLA 3N8IA 4Q6WA 1DCKA 5TQ2A 3NNSA 5FBHA 5FWYA 2IPLA 4UHJA 3SM9A 4YV7A 4JA2A 2FN8A 3JS5A 5HQJA 4PYRA 3GL9A 2AYZA 4MR9B 4KREA 1VRVA 3LUFA 1JYFA 3Q15C 1QKKA 4O1HA 4JASB 4MR7A 4Z4HA 3Q7TA 2RJOA 3FFWA 3R0JA 4G0YA 4MQEA 1FFSA 4E7OA 2PL9A 3TO5A 1OXBB 5TE9A 2PUFA 4YGXB 3IDOA 5C5CA 3MA0A 2IYNA 2VUIB 1SXGA 3LUCA 2M1ZA 1Z18A 3Q9SA 5JS1A 2QVCA 3CG0A 4RWEA 4FE7A 3SG0A 1EWKA 1I3CA 1RXIA 3E61A 1MIHA 3D8UA 4Z0NA 5IUNC 2GKGA 2B4AA 2HQRA 2NZVG 5JNUA 5BRJA 3LUKA 2I6FA 5BRAA 4QICA 1D5WA 1DBWA 1JHZA 1F4VA 1Z12A 2E4YA 2FMFA 3HDGA 1ZDMA 4N0QA 5TQJA 3L6UA 4G0PA 2JCGA 1P2FA 4DADA 4N41A 4JB0A 1E6MA 5B3JC 3CLKA 4OATA 3RQIA 4XFKA 4OLAA 2JVKA 1SXIA 5CNMA 5KQLA 3QLUC 3SQNA 2YHBA 5C5EA 1RNLA 3C3WA 4ML3A 2PUBA 4IILA 1JL3A 1U2PA 3M6MD 4LE2A 4RXTA 3KSMA 4IMIB 2N9UA 4OTZA 4G0XA 1ZVVA 2CD7A 1NXVA 3T6KA 1CEYA 3OLYA 1ZH4A 2PUAA 4RK4A 3RVPA 2LPMA 4LDAA 4HNRA 2RDMA 5EWMA 3H1GA 2BGGA 1DZ3A 4XASA 2RGYA 4RY9A 3SY8A 2A9PA 1TMYA 3OM1A 4NV3A 4OLBA 2FXIA 1YMVA 3NNNA 2PLNA 4MQFA 3IP9A 2MYPA 3T8YA 1BDHA 4ETMA 1USIA 5EWLB 4NCBA 5DKFA 4HNQA 2E4WA 4W5OA 4Z4CA 3LUDA 2HSGA 5JNWA 3HEBA 3TB6A 3ILHA 4LRQA 4B09A 3O1JC 3QX9A 3I5AA 2V0NA 3RVQA 4G0QA 1ISSA 4RXMA 2P9HA 4YLEA 1NXTA 1APBA 3OM0A 1E6LA 2R25B 4TMYA 3JPYA 3RVJA 2RJNA 2ZWMA 4PICA 1A04A 1JH9A 3B2NA 1JDPA 3EGCA 4TLLB 2FEPA 3RVNA 3QLVC 3JPWA 3KYIB 5IULC 2NZUG 4LX8A 3CU5A 1E2BA 1MB0A 1J56A 3G1WA 1U04A 5EWJA 1KGSA 4KRFA 1AB6A 4RK7A 1EWTA 3H6GA 1DG9A 1NXSA 2IPNA 3MM4A 4Z9AA 3RVOA 3DLHA 3N0WA 4YS6A 1QNLA 1PNTA 4WXEA 1XHEA 4Z99A 3HXMA 1DJMA 3C6QA 3I45A 1M2FA 4CBVA 5KQPA 2FEKA 3RH0A 1Z16A 4MPTA 5JNTA 2HQOA 3OQOA 1NTRA 4KV7A 4F12A 5BQ3A 4RK6A 3LOPA 3M9WA 3QEMA 2FLKA 2GBPA 4H3HB 2E4VA 4EVSA 4RK0A 5FWXB 1MB3A 1P6UA 2PJUA 3RVRA 3O2QB 4YCSA 1SD5A 5TPZD 3KKEA 4G0ZA 4KZKA 4MAAA 3KYJB 5KQGA 4P1ZA 3HDVA 4D74A 1KRWA 2OENG 2PUCA 1JX6A 2LUOA 4RS3A 4Y9TA 1QPZA 4EYGA 3LFTA 2PUGA 1Z15A 4MS1A 1AB5A 3MMNA 1USGA 2ZAYA 5DTEA 3Q7SA 2GWRA 3O74A 4IMJB 3OQMA 3GV0A 4EVRA 4Z4GA 2W42A 3L49A 5JNSA 4W5TA 4PE5B 2IPAB 2AYXA 4JAVC 4WZZA 5KQMA 3F6PA 1YTUA 3GYBA 2KYRA 1Z13A 2R48A 4W5NA 3HUTA 5E3JA 2F8TA 1BAPA 2NT4A 2PE5A 1U8TA 2H3HA 2HJ9A 1RZRD 4PEVA 4RK5A 3SNKA 9ABPA 2FEWB 3UK0A 3EJWA 3M9XA 3FMVA 3MYYA 3O1IC 4O1IA 4RY0A 5D2CA 4QPJC 4EUKA 1P8AA 2A9QA 3Q41A 1EHCA 4WUTA 3FGZA 2FQYA 2FVYA 3CS3A 1GUDA 5IEBA 3DBIA 5TQ0B 3QX8A 2L18A 2FMHA 3QELB 3BBLA 3OLWA 1Z17A 5CNKA 3ROFA 4IF4A 1D2AA 5TPWA 5I4CA 4Z4EA 3URMA 3BREA 4MR8B 3JTEA 4XARA 4L4UA 3BRQA 2B1JA 1JFVA 3QEMB 3QLTA 3F73A 4XLTA 1JF8A 4F3TA 1H9CA 2QXYA 3RVLA 3CG4A 1ISRA 1DRJA 5KC8A 2JVIA 3NNDA 3T95A 3IP6A 2A9OA 3OLVA 1YS7A 4QYMA 5CHYA 1A0OA 1NXOA 4G97A 7ABPA 1TJYA 1TLFA 2IOYA 2PAFA 3KTOA 3UKJA 3NHMA 4MS1B 4Q7EA 3VNBA 2XDYA 3CFYA 2R4QA 3CZCA 1M5TA 1EAYA 3TMYA 3OMXA 4RXUA 1YK1A 2E4UA 3H5VA 3LUGA 5TQ2B 4S04A 1BVHA 2L2QA 5FWYB 3A0UA 1URPA 5B3JA 3G85A 4KK3A 2YHAA 3LUHA 2LIVA 1YIOA 3KHTA 3QLUA 2QU7A 3KLOA 4MR7B 3FFTA 1QO0A 4MRMA 4MS3A 3IP7A 3H6HA 3RVMA 8ABPA 3F6CA 3NBMA 4MQEB 4QYWA 1C0EA 1GCGA 2OQRA 4LE0A 1FFWA 1KRXA 1U2QA 3LKVA 3OO0A 4FE4A 2M98A 5JS2A 1QP7A 1L5ZA 3IPAA 2WY2D 1ZITA 1TM2A 1Z2EA 1KMIY 2CWDA 2WJAA 5IEJA 2O20A 5PNTA 2NT3A 3HVRA 1B00A 1QQAA 2IPMA 3CZ5A 1IIBA 5F64A 4RSMA 1Y1LA 3ROTA 1A2OA 2QVGA 2JBAA 4RY8A 1C4WA 1GUBA 4ZPJA 5JNVA 2Q5CA 3FFXA 3MIZA 3A10A 3A3KA 3H5LA 3ILYA 2PMCA 5IX8A 4F06A 4N47A 5CNIA 3HJFA 4MS4A 1PEAA 4RKQA 1R8JA 4MR9A 4O5AA 5T3YA 3GBVA 3LUAA 4PZ0A 1BA2A 3DZDA 4RKRA 4MLCA 1ZHHA 4OBBA 2FN9A 2ID7A 3P9YA 3DLBA 1Z26A 1W9HA 2JVJA 4HYEA 4ZMSA 1LBIA 3JVDA 4OG2A 1LJUA 1NY5A 1CHNA 2CHFA 2FMKA 3O75A 5EWMB 4ETIA 1D1PA 2MYTA 3QLVA 3N0XA 4XAQA 2A9RA 1EFAA 4NCAA 1FFGA 2GI4A 3H5WA 4Z4FA 1RPJA 1TVMA 4KVFA 4JP1A 4EYQA 1JFSA 2FSPA 1DP4A 4ETNA 4MQFB 3BILA 1XHFA 1FSPA 3HZHA 2PKXA 2FQXA 3OQNA 1NATA 4KK4A 1PNRA 3N53A 5HKOA 3LMKA 3EAFA 3Q7RA 1Z25A 6ABPA 2WMYA 1EWVA 2L19A 1JBEA 4TN5A 1DBPA 1GCAA 1MAVA 1K68A 3LUJA 3CTPA 1SRRA 3MQ4A 2CHEA 3OLXA 5GQSA 1S8NA 1DC7A 3TX6A 1ZGZA 4N03A 1YVUA 1T34A 2QV0A 3C3KA 3CHYA 3O1HB 4IRXA 4WXMA 3JY6A 1W25A 3H1FA 1RXEA 3EODA 2MSKA 1PEYA 3EDCA 4S05A 3A0RB 3KJXA 2H0AA 4DQDA 1M2EA 1NXXA 1QP4A 3H5TA 5EWJB 1LBHA 2VYCA 5FBKA 4GNRA 4MS4B 1U0SY 1VPWA 4ZMRA 1PHRA 2PL1A 1JYEA 3NHZA 4KMRA 4MGEA 5T7BA 4G86A 4GPAA 2FMIA 4EY3A 4F8JA 3E3MA 2X7XA 1F51E 5EWLA 1WETA 3TD9A 3GBPA 4NICA 1HEYA 4JOQA 1NXWA 3GA5A 3GT7A 3MF4A 5JNRA 2MSLA 1JDNA 1GLGA 3DGEC 3O21A 4H3KB 4W5QA 1ZAYA 4Q6BA 1ZN2A 4YWHA 4YRZA 6CHYA 4G0OA 3IP5A 3CKMA 3KG2A 4MLDA 2ID9A 4KFCA 1PUXA 5IUKC 4ZYLA 4L85A 1CYEA 3LTEA 1FQWA 5IBQA 2FQWA 2IDMA 3GWGA 2DRIA 5GOTA 2VUHB 4M88A 2FTKE 3N6VA 2JB9A 3SAJA 3RVSA 3IPCA 3LKBA 3UUGA 1YK0A 4H60A 2JRLA 1D1QA 1DC8A 4IGAA 5CNJA 1YMUA 2QW1A 5KC9A 1BDIA 3I42A 1LK0A 3O2SB 1JLKA 1DBQA 1Z2DA 2WRZA 3OO1A 4FB4A 5DLEA 1DCMA 1QMPA 2L17A 1ABFA 2WJWA 1USKA 3I09A 3HK2A 1ABEA 4N0PA 2FW0A 1MVOA 3EQ2A 4YO7A 4KNYA 1E6KA 4TLMB 3W9SA 2F8SA 3H5OA 1BDJA 4YP9A 4D6YA 3HM9A 5FWXA 2E4XA 3GRCA 3K9CA 1NXPA 3OLZA 4F11A 3N75A 1UDRA 1DCFA 5IC5A 5TPZA 3N0RA 3RVKA 3HUUA 1VKRA 3EULA 2PUEA 3BRSA 2MSWA 3CRNA 3FDFA 1M5UA 2NUBA 2WWVD 1DRKA 1P6QA 2QR3A 4D6XA 5TPWB 3KCNA 2R47A 5IUJC 2QSJA 1YS6A 4KQCA 3S99A 3H5IA 3HSYA 1ZH2A 5BR1A 2GX6A 3HV2A 1K66A 5ABPA 2JK1A 2FKAA 4Z9BA 1XWWA 4N76A 1LJLA 3JVIA 3QK7A 4EYKA 3DGFC 4E7PA 4NQRA 1RZRA 2HQBA 2P4UA 3HS3A 5KI6A 1QQBA 2FLWA 2LBPA 2IKSA 4HNSA 2E4ZA 2J48A 4LE1A 5HSGA 5HM6A
chains in the Genus database with same CATH superfamily
3AR7A 1MJGA 2NYUA 4ERNA 2G63A 4WQMA 1SB9A 1IM8A 3IKTA 5C4IA 5A6SA 2EGHA 4GC9A 2C2YA 1TYZA 4QUKA 1W85B 3G2HA 1KI8A 2ADFA 2JIRA 4QOHA 4CDNA 5ED4A 3L4KA 5FCDA 3IODA 5FADA 1XTRA 3GD5A 1I3KA 4O5OA 3U44A 3O2JA 3PX7A 1IAVA 1WCWA 4JXZA 4KBYA 4BB0A 2HCBA 1AV6A 1E8MA 3AEUB 1I36A 3WC4A 4LJAA 3IEIA 3O91A 4MAMA 4IDFA 3UT6A 2E9SA 1DAGA 3WRVA 3KDSE 3HCDA 4CM4B 5DCYA 1VP3A 4AJHA 1KZGB 3DHYA 1RAAA 1SUFA 1JZQA 2H63A 2Z4SA 3TVYA 2DLCX 2LWIA 4I1RA 3BXHA 1NT2A 3H1EA 2WA1A 1ZC4A 3QJ5A 2QX7A 2WHYA 2QLBA 1SK9A 4UM9D 4F71A 2IU0A 3OUTA 5CLFA 1ZG3A 1L1EA 1M34E 2VEOA 3HN2A 4HYQA 3HVHA 3OX3A 4H0FA 4CF5A 2ZTHA 2MYNA 2N3ZA 1F3OA 4ZOQI 2OBLA 4LF8B 2Q0QA 3I5UA 4TT8A 3LBYA 5EXSA 3RYFA 5JZBA 4L4SA 2XX3A 2JHPA 2Z5GA 2JDID 4ZHQB 4ZO9A 3AI1A 3ZDBA 1SUCA 2ID8A 3GRAA 1MA3A 5CX1B 3HA2A 2OLKA 3KJEA 5LOVA 1SIWA 2NYRA 2WG0A 1JQDA 3G88A 3R0JA 4D9NA 3RNOA 3FJOA 2FW7A 1O8CA 1OLOA 2OPHA 4JV5B 3I2IA 3UUEA 3IGFA 3K72B 4DPMA 1T9HA 1FFEA 3KVVA 5TS2A 5BVGA 3LE8A 3KLPX 2YHUA 2VUIB 5AJZA 3ZQ4A 5JRDS 2Z6VA 3P32A 1BFKA 4OX9Y 5KNCD 2WDZA 1UKEA 2JLQA 4G89A 4ZPXA 1XAJA 3WIUA 1CETA 2DTEA 3D8UA 4P31A 3EDMA 2B4AA 4DC0A 2A2ZA 1E9VA 3PPWA 3IDZA 1E4OA 1UDAA 4OPMA 4KIGA 2CFTA 3CF0A 2OZEA 3AVYA 3FWKA 4R6WA 5EKTA 5K0JA 1ECGA 2WP0A 5HDQA 5H59A 2JCGA 2HU7A 2HA5A 2CXNA 1WMDA 1GZ7A 3HJHA 3LLSA 5T67A 1XPRA 2D2FA 2UZ4A 3VTZA 3UEOA 1OXUA 1Q1GA 4EHBA 2C4MA 5JMPA 4A3SA 1RHMA 3OAAA 4LE2A 3N3AC 3AG5A 3G0DA 5GVRA 4QAJA 1NGSA 1W36B 3FPGA 2XSZD 1IL0A 3QWIA 4OTZA 1ZBDA 4G0XA 4PZLA 3USCS 1VC2A 1NXVA 4P93A 3JQDA 3R75A 3TDMA 4F5WA 2XCTB 2IXTA 2XMQA 4GM4A 2FZGA 3UGQA 3LQYA 4DWVA 5BR4A 1JVNA 1YGPA 3H1GA 4YBRA 1DZ3A 1OD6A 1U8EA 3BBPA 4C87A 1SQGA 4FKZA 1ZEMA 2YNMC 3WK8A 5KWVA 1DKPA 2JKVA 2ACWA 3EG5A 3H97A 4Y0AA 4DZRA 1MOZA 2PXAA 1P81A 4HEJA 5KNBD 2VHCA 1NVWQ 1P0PA 4U8HA 1QHFA 2PFSA 4IRMA 3FLBA 1Y9DA 3FVTA 4ZOCA 1S2MA 3F1LA 4UPVA 4YUXA 2JA1A 4O25A 3UCXA 2HSGA 1A9SA 2MSCB 3G5AA 3STTA 3TB6A 4H7DA 3UFXA 6AT1A 5JIBA 1R0YA 3QH4A 10MHA 2ZAOA 1ZHOA 4EKNB 4YCCA 3HDTA 1G8JA 4OJTA 4RD4A 4CMAA 5IHXA 1J90A 3HVKA 4PYQA 3ZXUB 3RIXA 4K9MA 3HUDA 3KUUA 3AVWA 3NEYA 3ZW8A 3EVFA 1DWQA 1KP2A 3VR5A 3HU1A 5JLJA 4LS3A 3T1QA 3ZI0A 4LBWA 4M0PA 2HADA 1GSIA 5CK5A 3IKMB 1UH5A 1EK6A 1JPNA 4RW0A 4GGMX 4NDNE 3C85A 4AXXA 1GUFA 4UULA 3JYOA 4Y2SA 3FPJA 3FVWA 3PLRA 4AICA 1YULA 1NQTA 4CIYA 3Q12A 3G2OA 3S44A 2G3YA 3TVTA 5C1BA 5LXTF 1QP8A 2GAJA 4D46A 4W6QA 4BEBA 1MEEA 1M2FA 1ZCJA 3TLGB 4J7AA 4BB9A 3EPJA 5EHNA 4B45A 4KN9S 1R9JA 1LBQA 1PU2A 1NULA 1H6CA 1TEXA 2PIDA 2PSEA 2YIDA 3G8DA 3LG2A 2W37A 3ANXA 4LFCB 3W2EA 3GD7A 1JA0A 1KSJA 3I9V1 1YQUA 3L92A 5CEFA 1NW3A 3QU9A 5U4QA 4LOLA 5IF9A 4YR9A 2P75A 4IO1A 3QVXA 4FQ7A 1TIPA 1PR4A 2GVZC 1O9GA 1KIFA 2GPNA 4HZIA 3GW8A 5H9WA 1R4NB 3T7EA 1OLXA 2OENG 3DAHA 2DPXA 3COPA 1IQUA 3DVSX 4ZEXA 4BJ3A 3P2KA 3D0QA 2QPTA 4XQ0A 1DOZA 4BGDA 1X1EA 2BGJA 1BQ3A 2BEJA 4PM4A 2Z9BA 4ZK6A 2OECA 3RU3A 3SQDA 3KZMA 4AS1A 3WGOA 5JWRA 5B1EA 2JIZD 1A8QA 3NP9A 1DJNA 2H06A 1QYDA 3U9TA 1ABBA 4BNVA 4P6VF 1IJEA 3W2TA 2IOQA 3JARA 3BWCA 4FKBA 4GPZA 1H42A 4ISCA 3D2AA 4JI8B 1DJPA 1UKZA 2J5QA 3ZQUA 3SP1A 5K5EA 1E1QD 1TFRA 4RGQA 1E1YA 1U80A 1E1MA 5T41A 4R3WA 5KYKA 2H3HA 1REQB 2HU8A 3KJHA 3I0MA 3N74A 2O50A 3HRIA 4KSBA 4WECA 5B7NA 3KXKA 1BW9B 5A4IS 1CJTC 4HGRA 1I9CA 1RM5A 3MSXA 3SZLA 1AZWA 5JASA 3EQ7A 4MUMA 4JKYA 5HILA 3A4MA 2OCDA 3QSYA 3WFJA 4E5UA 2OXIA 1UWVA 4AJEA 1LWNA 4C6HA 5TT1A 3AW9A 5AOVA 3U3DA 2QN2A 3IUEA 2BH9A 1LC0A 2NSJA 2D2VA 3BICA 1X1DA 1JIUA 2PH5A 3Q7IA 4KXLA 4CV1A 2C7PA 2VQFB 2L18A 2G40A 5F9MA 3QELB 3BBLA 1X7XA 4IIFA 5ERGB 1WIWA 2WKPA 5FI1B 3WQHA 1ZEJA 1CY6A 1R2QA 1Y33E 2Q3FA 2XGJA 2W6CX 2F55A 4UZFA 3DOJA 3EZNA 4YO8A 1QF7A 5F1KA 3OSUA 4BFUA 4M99A 3EDOA 4QGGA 5AVQA 3EDRA 3AWDA 4DEXA 4G67A 3CX3A 1U7HA 3C5WP 1G291 1CR2A 3KUKA 4K40A 4Y2TA 1YZYA 3VR6D 1NVVQ 2W6QA 5LBIA 1Z9BA 4I8XA 4CPDA 1ZI8A 1CD5A 2V7TA 4RF5A 1WDLA 3QYPA 5BMVF 1PWHA 1X39A 2PT7A 2O2HA 2XQVA 3P2MA 4G24A 1TRHA 4GRIA 4MKGA 1P0FA 4MRSA 3A7EA 4QQNA 4RM2A 3JAWA 2O23A 3ZZ1A 1AF7A 4R0MA 4M1TA 4RNCA 4A27A 3C3DA 5EIWA 5H83A 4DCJA 4YRNA 3TQIA 3GPIA 3TMYA 1N0VC 2J0EA 4ENRA 5TQ2B 2QR5A 4NCXA 4JBIA 2C1ZA 3I6ZA 3B20A 4LKOA 1DELA 2II6A 5BN5B 4U1RA 3HJNA 4MP8A 4BFYA 3D1VA 2LIVA 3PHLA 1WG8A 4DHEA 2YZMA 3QFRA 3KO8A 3HJAA 4MQEB 4UFNA 2XMBA 3PIRA 3AFIA 5EXXA 1GCGA 4TXHA 4ARUA 4WDRA 5B4UA 2OYCA 1K4MA 1FW8A 1G7RA 1GL7A 2BFFB 4N8SA 5HYVA 2QX8A 4RTQA 2JJ8A 1L5ZA 3P9CA 1ZITA 4TSFD 3R8XA 4MPDA 1FB5A 1JPUA 4AWXA 3HO8A 4JBNA 4UUOA 4M7WA 4PFSA 4AUMA 4LBVA 1N2EA 5CLQA 1THGA 1GZ4A 4GZMA 3QP9A 5B4TA 3L4BA 2JARA 4MV9A 3TUJC 1XIVA 3ICOA 2A3RA 4GSLA 3SICE 3EISA 4RD6A 4C4RA 4UM7A 5CP8A 1GNRA 2D0PB 4DWOA 1UF9A 2AFRA 3K0KA 3RHZA 1IZ0A 3ITEA 3P2IA 4DZTA 5EKDA 3HJFA 2P2NA 3WQQA 3T9FA 4P22A 2WNHA 2ZB4A 3C16C 3EFEA 3WRYA 1RCUA 4RZHA 3GA0A 2JH3A 3PWZA 2EP8A 2PUJA 3X1KA 5A2GA 2VWHA 1C1YA 3HPQA 3ZY2A 2K7ZA 1FP7A 5IDWA 4YJGB 4B17A 1FY2A 3I34X 1LD3A 1LPAB 1UOEA 2PR7A 1IK4A 2YASA 4NABA 2Y2UA 5JW6A 1VL2A 3PFIA 3UANA 5HJEA 1C4KA 4X90A 5CLIA 1I7SB 1QDLB 4YJ3A 4R84A 5EWMB 4YTEA 1N9GB 3N0XA 3R20A 2YVLA 4I1VA 1ISGA 4ABYA 4RIGA 2GRUA 3MS4A 1YBVA 2GN9A 2O0LA 3CTMA 3G2PA 2JW5A 3LYHA 4NU5A 3NASA 1GRRA 2WUGA 1G41A 3H87A 2A9KA 1C4OA 2XQKA 3HYLA 4J8PA 4JSRA 5BSWA 1ZWKA 1YL5A 2NU8A 3R0VA 2O8BA 2O2SA 1PV4A 1TQ8A 3GCGA 3ESAA 1N2CA 1KMCA 1ETHA 3FYSA 3V32A 3Q7RA 4CFZA 2L19A 4X45A 1THMA 1RFLA 5FLXA 3PTLA 2FB9A 1C7IA 3G0BA 1K68A 4NOMA 3C45A 3MQ4A 4LRTB 3SQOA 1IOVA 3FDJA 3ISVA 2A0WA 2HIHA 1E9RA 4N03A 2IYOA 2Y0EA 3O1HB 3R3XA 5T3UA 3VU9A 1KJNA 3HTXA 2WF8A 3DKKA 3MWKA 4ATNA 4Z3OA 3EODA 5HF5A 3V2UA 3OZXA 1WZNA 3B9QA 3K0BA 2CYAA 4U7GA 1NXXA 1UT5A 4ER0A 2BFCA 3L77A 3O3OB 3PDHA 4RV4A 5FULA 3VJKA 4A0SA 4DIKA 2O8DA 1T5BA 2DUMA 3E9MA 1XQ6A 2HWWA 2DWUA 1E5VA 2MSEB 3V34A 4WJKB 5KYYB 2PL1A 5JARA 4MYSA 4LOKA 4KIWA 4KAJA 4KWCA 2K4MA 4EY7A 4YNBA 3L6CA 2AN3A 1F2VA 3AL2A 1PYOA 2DHCA 2Q3CA 1G42A 3LGXA 4NHOA 3G7SA 4FDTA 1G2OA 4JYAB 3JQFA 5DDIP 3AESB 2WDPA 5A4DA 2HJWA 3O21A 2P4HX 3HJGA 4CT5A 3FDIA 3OP1A 3LDUA 5IBPA 2VP3A 3KXLA 3D4LA 1OIWA 2TRSB 3HI6A 4I4NA 2GLTA 5JFOA 2BKAA 1GPH1 1KFEB 3PPXA 4TN1A 5J2UF 1CYEA 3LTEA 4IGIA 1IWBB 1VZ3A 5FOWA 1T8YA 4DT1B 1SNYA 2GXQA 3A11A 3CF2A 4BVKA 1ZM4A 4GM1A 3RT7A 1E6CA 2I2CA 2CB0A 1Z07A 2O06A 2G8NA 2JB9A 2PLFA 5DTRA 1ENOA 3SAJA 4RTLA 2OV1A 4QUIA 4D4LA 4EA8A 3F6EX 2MR6A 2VCYA 2C88A 3NXSA 2VQDA 8ADHA 2C5EA 5EE9A 2VPTA 2O2YA 3H4MA 1EX1A 1PN3A 1V35A 4TMVA 4C4OA 5KQSA 4KGDA 4G84A 2GBLA 2JLCA 4HMPA 3TVDA 3V6MA 3VZCA 5G3ZA 4CTMA 4WBNF 2CLSA 4UEQA 1HFJA 1L4UA 4GR5A 3TKLA 2C0QA 2SCUA 4P32A 4XDGA 4TTRA 2B98A 2RB4A 1HG0A 4CCSA 4N0PA 5L8VA 4HEQA 1YZQA 3GNQA 2VSXA 3R7AA 3DL0A 5I9MA 2BTEA 4G0WA 4JBYA 4EEKA 2C82A 3O7WA 2FYTA 4HAVA 3RHFA 2XBLA 4C04A 4BYMA 2OCYC 1R8XA 2ZIFA 5A3VA 3R76A 4TL9A 3AVPA 4ENVA 1NUUA 4NNOA 5SYNA 3VJLA 1MGOA 4DJTA 3WWCA 2WE7A 1JWAB 1KE2A 2YKGA 4DYDA 5C8YB 4QFBA 2H8GA 3VUEA 4QYSA 2OQVA 2WK1A 1AMOA 3K6SB 4YAEA 2V3CC 1D2RA 1OLUB 4QEDA 5LA6A 3KNZA 4Z54A 1ZU5A 1LSJA 5DBIA 4Y2PA 3A9WA 3FKJA 3CZRA 4C0BA 1E79D 2Q4RA 2M1XA 3VAAA 4ZQGA 5JAOA 3CVUA 1ZXXA 3RC8A 1V8BA 1XVLA 3LGSA 2VTDA 3ZCQA 3ELWA 2IIBA 4ER6A 3C74A 3PHHA 5B3AA 5AI8A 2ECKA 3AQ4A 1VDMA 2P4UA 4M55A 2OORA 1ECJA 2CLEB 4FM9A 3KUCA 1XQVA 1WMAA 3S4YA 3EHDA 3VYUB 2H7YA 1A9XA 2QZSA 4GMGA 3A06A 3WIBA 1FJGB 3S8EA 4B3JA 3B53X 4AFNA 5FNVF 2HNKA 1YONA 5D7NA 1JFTA 4MO9A 4RVHA 2GERA 2G5GX 3E27A 1XRQA 2IELA 3ZGNA 4DJ5X 4EUHA 2AJBA 2BEWA 4DJDC 4HMQA 4EYOA 2QV7A 3W5CA 5AVJA 3WAKA 4LOIA 3P20A 3U3ZA 1JR6A 2ALJA 2H0QA 2XJ9A 3K0AB 3OCUA 2BN4A 4OCZA 1I3OA 4MS3B 4J7CA 2W6ZA 2JGFA 2A0FA 1N77A 1QS0B 1L8OA 2AFVA 3I2JA 4IV8A 4EF4A 3BWEA 5A0TA 2G9RA 3WA7A 2ZQ5A 4JN6B 4B8YA 1AQJA 3VDQA 4JEIA 2IIPA 4M46A 4PC1A 3K9QO 1Z39A 3L7BA 3KLBA 3NHJA 1MD9A 2K2QB 2WU3A 2D62A 1RIFA 3DEFA 3E7WA 4B33A 2QQEA 5KHLB 3ABZA 1XCGB 2VATA 1BIFA 2WIDA 4UTVA 1ZESA 5ERYA 1I0ZA 5T4EA 1CEXA 2P5UA 1WVIA 2XNDD 2PYDA 4HI0E 2I65A 1WOYA 5LDDC 2OAEA 2Y0PA 1U3UA 1U3DA 4UQLA 4XWYA 1JFFA 1LRJA 1XL1A 4FHCA 1UDWA 2IUUA 2P9JA 3WDSA 4B3TB 3V7UA 4M83A 4Y1RA 4ZO8A 2DR2A 1WBDA 4JASB 4MR7A 5ILOA 1A8IA 1KQGA 2BF4A 3UWPA 3F3SA 2C7GA 3H1TA 4FW9A 2BGKA 3C8UA 3PA6A 4P7JA 4RTKA 1ULBA 4RPCA 3ZI7A 4EL5A 3EDYA 3K0EA 3Q5EA 4KO1S 5EOVA 4ZKEA 2WT8A 2WOJA 2IU4A 4TKVB 1JGTA 2OV4A 4DSTA 4WASA 4BO7A 4QOJA 5JDIC 3RYIA 2DB3A 1VYHA 3ABOB 2DE0X 2WWHA 1EWKA 3FZEA 4PQYA 5AKHA 5ALTA 4HF7A 1OAOA 5SV2A 3EHEA 3DT8A 4JR1A 3WKBA 1DO8A 3VHXA 4MQ4A 4QICA 2VR1A 2GZ3A 4QJIA 1XUOA 4F3RA 2TSYB 2R7NA 4GH5A 1Q3HA 3C3AA 1ICEA 1NR7A 1P7ZA 4IQGA 4LXXA 1SHZA 4BECA 4C22A 5JJKA 2AMJA 3F5FA 4LW8A 1K88A 3RTDA 2PBFA 1U2DC 1E79A 2XUDA 1GGVA 4AZ0A 1SXIA 3GJRA 1VIYA 5GZ1A 3UJCA 5KQLA 2QG6A 2XB4A 3K3PA 3MERA 4WSOA 2C9DA 2J5BA 1GPJA 3CSUA 3PJFA 3V8VA 3FRHA 3NATA 5EJ9A 2GZMA 4MW7A 2Y0BA 4DLRA 5B4VA 3RODA 4D25A 3QPUA 2W2QA 1YS2X 2ZR7A 4KYIB 3PVSA 4URFA 1CY1A 2TYSB 4LDAA 4LJKA 3WE7A 2F4VB 2A5YB 4UD6A 3AY7A 3HNOA 4P53A 4PAGA 2RGYA 3GT4A 2X7JA 1ECPA 3T1VA 2Z8XA 3SIRA 4WH0A 1QFJA 1CUAA 1Z5PA 2J5RA 4DLNA 4DMFA 4MUEA 4I8DA 5TDHA 5JSKA 4PYJA 3AUTA 3F49S 1NVEA 5I9BA 1Z3IX 1EFHA 3JQ8B 4B4VA 2E37A 5DM70 1QX3A 3FJYA 3I9MA 1HBJA 3I9V6 4RJ2A 1ENPA 3T99A 3IQWA 1RE0A 3I5YA 1FXWF 1P4GA 4FYIA 1P3Y1 2IYZA 1JU3A 4MQUA 2DWCA 3KP1A 1A5BB 1KMQA 1XPJA 2EYUA 2X9LA 2VPPA 4MWGA 3KZNA 2QJRA 3O38A 4LXHA 2M6LA 1R0SA 2QLFA 4PIMA 1AGXA 3B51X 4M0FA 1G1MA 2VG8A 1ISSA 5HS6A 3R7NA 5IVKA 2XUOA 5LR6A 4FFVA 1E6LA 3PI7A 2R25B 3AOEA 1NTOA 1XAIA 3EC1A 4TMYA 5LXTA 3ADOA 3C70A 2B1RA 3LIPA 3DOHA 4PICA 1NF3A 2H5IA 5J47A 2VPIA 2FAXA 3QLVC 2VO1A 1JI0A 2JJYA 1DKOA 2W2VA 5AW1A 5IULC 1OGIA 5AM3A 1IBRA 3COYA 4KRFA 4FBLA 3UMFA 1EH5A 1PJ2A 3UTCA 2Z2XA 3AVQA 3JSXA 4ESOA 3X1YA 3C6YA 2P9CA 3AINA 4M1YA 2BKUA 4O4IB 5L3ZA 4B2LA 3C5EA 4J9VA 4L51A 5HRUA 1ZJ5A 4REOA 4KXQA 5ARCA 2VDPB 5FJIA 5AXAA 5KJ1A 4HWTA 1ZLYA 4J7UA 2PT5A 2Q2VA 3TL3A 2BM9A 4F12A 3O8CA 5C5DA 3UUWA 1TVKA 1O87A 2FLKA 4DG9A 1MV5A 4QAQA 4X3CA 5F9HA 5DHPA 3K9BA 1M0TA 3PCRB 4AJ4A 2CJWA 4DA4A 1Q91A 4B35A 3CLUD 3JQCA 1AQUA 4BIIA 4E46A 2O48X 1TGVA 2WV9A 4IVRA 5DBHX 1DHRA 4I50F 4ENTA 3E3OA 3TW8A 4LSZA 1GPLA 1UXKA 4NONA 4J91A 4OBEA 1GAEO 4YI3A 2Q1TA 4P81A 4W1QA 3T5DA 4U7TB 3OT5A 1AGPA 1IZZA 1G98A 3QG5A 3DE1X 4ZCPA 4WOBA 4D3FA 5JXJA 1ZK3A 3OZDA 4GVLA 2ZXUA 3WV5A 1NY6A 5B58C 3SJBA 3N8HA 1E2MA 1YZGA 3OE4A 3BGWA 3GV0A 1WXHA 4BOYA 2WD9A 1TZKA 1KK3A 2PXCA 4WACA 5IXSA 2WOOA 2G5PA 4A8JC 3PC3A 2ZYGA 3SSOA 3H17A 1AKWA 3F6PA 2PZEA 3C48A 1LFDB 1GQFA 4YCBA 5DYWA 1FDOA 1CF9A 3H8WA 2Q3HA 1Z13A 3N07A 5LYYA 1HNZB 4U3JA 4BPBA 4IIGA 3ZTYA 4TYWA 3B1KA 2F1KA 2MCFA 4NULA 5E6UB 5CAEA 1HI9A 5AW2A 5HTOA 3BXZA 4FXOA 4WMLA 3TCXB 4LGCA 2BGUA 2W2MA 3HYTA 2YUIA 4I9GA 4MH0R 3UK0A 1NBMD 3VPHA 1YB2A 2P4QA 4POAA 1MIOB 4C14A 1OE0A 3LCMA 5C35A 5FI5A 3UQZA 4YRDA 2WD7B 5KKCA 2QN1A 1E2HA 1B74A 1KTVA 3W5IA 4AAYA 5AHWA 4B4UA 4DYHA 1WBBA 5DYNA 1Y8QA 4BNIA 4KNWA 3NTRA 5JY6A 1KMHB 4A92A 2PS1A 3DBIA 1XNJA 2NQ8A 4LYDA 3G8YA 5EC8A 5FEUA 2XVZA 1YKFA 2J0QA 4XWAA 4DUPA 5I4CA 3INNA 5BMVA 2BHNA 3GH1A 3MW8A 2FZEA 3PICA 2VCHA 1KC1A 4FEYA 3URMA 3E4DA 4C29A 2FRXA 1XKLA 1OBOA 3WISA 2CSXA 2VAMA 2BKEA 4F3TA 1JS1X 3C7AA 5JV5A 3BB4A 3VO8A 3ANLA 5DM1A 1LV8A 4HQNA 3GJQA 4RGVA 2JVIA 1L4GA 3SPXA 2C2OA 4Z3DA 5AI4A 3KQTA 5KREA 4ZQBA 3IEXA 4LC9A 5JSUA 2GA8A 5FBZA 2I80A 5K7SA 3PDUA 5BQFA 2B0JA 5DBEX 4KAXA 3OZBA 4R54A 2A7QA 2P41A 5DHFA 2IHBA 2JL1A 3OC0A 3EGXB 3VM6A 1K8RA 4G41A 3FM9A 3PQCA 3OEHA 5BSVA 1M5TA 1TB4A 1YASA 3THYA 2PQ2A 1GCOA 4FOSA 5IAKA 3NRJA 4BZQA 4ENSA 2M9MA 4ND8B 1AQNA 5EPUA 1A5SB 2PKQP 1E3LA 2BMFA 1PGQA 1KHTA 4NC9A 4HLDA 3RROA 5KDLA 3ZCTA 1PJZA 2EU8A 4PLZA 4WOPA 4D82A 4IIUA 4QT0A 2BI7A 3K5PA 4RZUA 1C7QA 4BZXA 2UYHA 1E7WA 4X9XA 4KQXA 3YASA 4XLLA 2PA0A 1ECCA 3DDUA 3Q9NA 2AZXA 3BQNB 2ZXFA 2WHRA 1J8DA 1KK1A 3PCTA 1M1YE 2MWMA 1M3SA 3B8HA 4P92A 5JS2A 4DQUA 5AQ1A 5KJCA 2OCLA 1HTWA 3I01M 1L5NA 3TPCA 2AFHB 3AERB 3V7FA 1XXHA 4ZN6A 3ELUA 1UBNA 3CX4A 1SKUA 5CM9C 2BP7A 5PNTA 4CQJA 5DTIA 1ZCAA 4G8JA 3DCIA 3S1SA 1RHKA 2PSDA 2OGTA 3EAGA 1BD4A 1MT3A 3WGNA 4HLQB 1SVKA 4MPJA 1DFGA 1OU0A 1ZH0A 2OCAA 4LISA 3SLGA 4KBGA 3GLQA 3FFXA 3QMWA 1EK1A 3EXIB 4C7JA 4OQNA 5JEEA 4M86A 4AQDA 5EJ5A 1PT8A 5SY9A 4X1YA 1CDOA 2OC4A 1EYZA 1Z4JA 4ND6A 4AW9A 2ZJ4A 3PZBA 1UK6A 1NU6A 4F3CA 1DOHA 3GROA 1QRRA 1RYZA 1RTKA 1Z8FA 3GFTA 4DAEA 3JD4A 4PLTA 1QB7A 1JSCA 3WYDA 3QF4B 1A5AB 4QSMA 4DMKA 3QA9A 5F23A 3OE1A 3U7GA 4PC3A 3GLUA 3DFKA 4GMFA 3JQEA 1F48A 4YPOA 5KU1A 1P5FA 1MN6A 3DDHA 5DMXA 5ENVA 2QIPA 4BFWA 5CDYA 4QQRA 1LJUA 4D0LB 5F7OA 4Z2AA 3G7NA 3PIIA 3IBSA 5LZ8A 3I5XA 3U5ZB 2JHCA 5K6AA 5DTQA 1I6KA 3HEMA 3GJYA 5BT9A 2QPAA 2W2LD 4WA8A 3QV1A 3GJ7A 1YL7A 4MKFA 4D4KA 4Z1MD 2EL7A 2IZ0A 1A96A 1A9RA 1XKQA 1LLQA 3OM8A 1SA0A 3IT2A 1HPLA 2JCBA 2J5XA 1L5VA 4KFUA 4C6TA 2E7ZA 4BX8A 4A73A 1NUHA 1SC9A 3ADPA 3AVXA 1XK6A 2JKZA 4Q9DA 4XD2A 4OMUA 5E0KB 3VSAA 2VDLB 5TX7A 1EGQA 2OP0A 3LMKA 3PEYA 1RE1A 1XCPA 4NNPA 2V5VA 4TTQA 2X86A 2GPAA 4PZCA 1GXSA 1QG6A 2B1QA 4BASA 3ZD7A 1LLFA 2GCEA 2HBQA 4C7OB 1N75A 3WLEA 3JQ7B 1CUSA 2J7PA 4JLMA 4L5AA 1T34A 2XEDA 3CHYA 4FFBB 3N87A 4Q1BA 3HR7A 5HIAA 4HB0A 1RXEA 2JI8A 2O3SA 3LVBA 2QRQA 3Q10A 3ZCXA 3KVNA 1CJUC 1YDMA 4B3BA 4H08A 2BFMA 2D74A 1P2VA 1W34A 1XJ0A 3QFTA 2HSJA 3TNYA 2Q7OE 3K9LA 1X1BA 3EOZA 1KAGA 1AVTA 2I6XA 1G5TA 3ND6A 4IUBS 1HYEA 3UCFA 5CLHA 3CLSC 3AR8A 3AWIA 1W2WB 1GN9A 1F0PA 1IHUA 1UMBA 2R7AA 1A71A 3R44A 5J2UA 3RF6A 1ZD4A 1FZQA 4ZIRA 2FZLA 4ZD6A 3U37A 5ICCA 3E3MA 2QTBA 3JD2A 2GZDA 1K5GA 3PJGA 1TKAA 4B44A 3PU6A 4QARA 3BRWA 1V8FA 3FN4A 3CIOA 1RD4A 4BNGA 3QUBA 3R41A 2ZTSA 2MT9A 2WBLC 3COWA 5E4JA 3IFSA 3HB1A 4OBWA 4OI1A 3TPFA 3LP6A 3PKJA 4WXRA 4QVGA 4KFCA 2OD2A 5AO9A 3QFSA 2ABWA 2HJRA 4P2BA 2NXJA 5G0SA 5JC1A 1SB8A 2IDMA 4INOA 1VE5A 4HTAA 1YL6A 4BX2A 1N8TA 1ADYA 2C9CA 4N5DA 2FTKE 1F38A 1JAXA 1N3YA 1R27A 1QDEA 4JWTA 4NOJA 4RD1A 3HB5X 5J59A 2GAFA 2J1LA 5G1OA 2QRGA 4AO8A 1XTUA 4D9IA 1YVPA 4UCXA 2H5EA 3TLCA 3RJMA 1EINA 2GCOB 2UZAA 2J6HA 3NDRA 1G59A 4ZT7A 2ZCUA 3O2SB 3HWWA 1QIEA 1FXSA 2F43B 2C2WA 3I2KA 3QVGA 1XMQB 3EXHA 2PGDA 2QMUA 4NJEA 3HK2A 3UPDA 6GPBA 1G5QA 4LWOA 2RHLA 2AG5A 3PUJA 4EG4A 1NFFA 3NFYA 3EYAA 1A77A 1SQSA 3QEAZ 1H4QA 5LJIA 3NTQA 2HLPA 1LJ8A 1N6RA 5EG5A 2WB2A 1IATA 2OKGA 2D2XA 2B36A 2XYQA 5EXTA 2ZE6A 4NMHA 2DR3A 4HUTA 5B64A 1F6WA 2YC2C 3CW8X 1U3CA 4MVJG 4MVJE 4DRZA 5ALJA 5IVIA 4EHAA 1TO2E 1CUZA 3FDFA 5CGZA 3P9SA 4NRDA 1U5BA 3ETCA 2B1GA 3F1KA 2G9QA 4D6XA 5REQB 5B1YA 3JCZA 1KZ9A 1EVEA 4JLNA 2QNRA 4RETA 3FOWA 2X0DA 5EJ4A 3JQPA 1VCHA 5BSGA 2C2KA 2C61A 4XPIB 1W5BA 2YZKA 1K75A 2H48A 2PZAA 1K5PA 3MAAC 2FN4A 3HV2A 1MDFA 4UFOA 2I2XB 5FNVA 2FG6C 5I9TA 1JG1A 1KR5A 3RG8A 5AJWA 1E2JA 3JAKB 2CFIA 4GICA 3HDJA 1LJLA 1VIDA 2FPOA 2ZBRA 4GBMA 4TUYF 1KJ8A 2GF9A 3N2LA 5TARA 1EVYA 3RKUA 3WL7A 4E7PA 5LNK6 4ZTZB 1A5ZA 1ZINA 2ZXEA 2B78A 3W6PA 2FK7A 1PVDA 2R1ZA 3JQAD 4HWSA 3SGLA 3CO5A 2OFXA 3LY8A 1L4MA 5FT9A 4WVLA 1RWNA 2VK2A 4MEBA 3WY9A 1H8EA 1ZL0A 4C01A 3QE0A 2FGKA 1FQKA 1DRUA 4OLJA 4JB3A 5ALNA 5BSHA 5I9SA 2FA9A 1YR6A 2OXFA 3O8OA 1JA9A 3T41A 1G4HA 3VPGA 3ZC3A 5KWSA 1N92A 3Q3VA 3KYDA 1X2EA 4CFSA 4ZTUB 3TLAA 3LLCA 3QNWA 4LRUA 1I30A 2CFSA 2AQIA 1RJWA 1JHVA 4HNAB 5JXIA 3G9ZA 1QO0D 1CIPA 4HNHA 4QOFA 4ITRC 3T38A 2Q9UA 3FKSA 1FJ2A 3D2CA 1W5FA 2P9TA 1C9YA 1NNEA 4CM8A 1BO6A 1V41E 4WN9A 1J9EA 3HZZA 2YL2A 4D80A 1SZDA 1I4WA 2C54A 2QQGA 1VHWA 1SUWA 4HB2A 4L9SA 5E9JA 4TMKA 1COZA 2BE7A 1RZ3A 3IVXA 4Q7JB 3ZWQA 4D45A 4PPNA 1FLNA 2FXVA 4ZVRA 2HO5A 2AFIB 2FQ1A 4J4HA 2P4SA 3RLIA 1JDVA 1K8YB 3BORA 3FVRA 3EY9A 3H8VA 3OFNA 5DGXA 2C2ZA 4LY6A 1SUEA 5LL6P 4YXFA 1WXWA 3QIVA 2DFLA 4WWHA 3ILXA 3T5AA 4IJ6A 5CVDA 3HY3A 4DRXB 3GPLA 2FP4A 3IEPA 4QU0A 1T36A 1H93A 3K09C 4CLRB 4EBBA 3JYLA 3HC7A 4YJDA 3RAJA 2ZVJA 3BFJA 3U80A 4YV7A 3GGOA 2E6KA 3Q8XB 3W4KA 3PFGA 3OZSA 1BVRA 2DBVO 3PNLA 5JH7F 2WSSA 1LUAA 2FUG1 2Q49A 1KR2A 3OBBA 3ZWVA 3P52A 2GAIA 3DAFA 2XCIA 3PGJA 2RJOA 1D03A 2DGDA 1QKIA 3FFWA 1KEUA 1X19A 2X1LA 4HZGA 4AKSA 3PQFA 3V4SA 1BXKA 2ZRBA 5FP0A 4LNUB 1RPNA 3O3CA 3TO5A 1COWA 2Q4DA 3THXA 3C3CA 3T15A 3WLNA 1M7GA 4OX9B 4X7RA 4ECAA 3WWZA 1PWEA 1EUZA 1Q0QA 3PTAA 1IBLB 3FETA 4JXJA 1LCIA 3N5CA 4CF4A 2HNBA 1Y8ZA 2LRHA 3N59A 3RDPA 5A6SB 5JYEA 2Y1LA 1OAAA 3KXPA 3QBDA 4WFJA 3MMXA 1UDCA 1YDHA 4KRXA 2VAPA 4DPKA 3A4IA 1ZL2A 2BFPA 3VHQA 1YZUA 1C3OB 1E9BA 3A70A 3T7TA 4CMIA 4BQOA 3NONA 1ONBA 2E4YA 3VSEA 2E0IA 3MTDA 4AT1A 4EHLA 2FF7A 4MYDA 3HCCA 2WHQA 3KPJA 2FWRA 1Q95A 2ZBVA 3B1ZA 3A4LA 3JWJA 4LYAA 1QHHB 2F3QA 3K0SA 4RTOA 2I4LA 3PNMA 1NX9A 2GN6A 1BN7A 1VMKA 3T61A 3TJMA 3H0KA 1KH2A 1SOUA 1XC7A 2FLVA 3DZGA 4FZRA 4G5XA 1NW5A 1PDWA 2IYRA 2X5OA 2O14A 3DE0X 4PYLA 4C5CA 2O2IA 2NZ8A 2F1OA 5KYVA 2A0KA 4TYQA 4RA9B 5EZSA 2N9UA 3FX2A 4UQPA 3VO9A 3K0CC 1TYBE 3JQAA 1CEYA 5CEEA 1AHPA 2BLNA 1QYWA 1VDZA 3K73O 2DX7A 1P74A 1M2VA 1P18A 1F8GA 1T2DA 1E3EA 3D7NA 5EY5B 3NTXA 5JCOC 4RDHA 5COAA 4Y3UA 3OQ1A 5G0WA 4K3UA 1CB0A 4RY9A 1U4NA 3GCXA 1AX9A 1VJ5A 4NV3A 2R7LA 3HP1A 1RAGA 2FXIA 2Y66A 4R01A 3KETA 1TC2A 2RC5A 1ESMA 1G8GA 4R9NA 4OUDA 4WINA 4A8JB 1M6WA 4F6CA 5B55A 4K9QA 2QMYA 3TTXA 2QN6A 3CE6A 2ONJA 1IUOA 1OREA 3QNUA 5CBKA 5LOVB 1EXDA 3L6RA 5LZ7A 4M1MA 4ZCTA 5EE1A 4NJMA 1PYDA 3E22A 1QRAA 4Z4CA 3LFHA 4ZEMA 3IE0A 3L4EA 1AKMA 2EEPA 1HKUA 5BVGB 1CUJA 1DL5A 5DN6D 3DUWA 4GUDA 1II0A 1ZJ6A 3ILSA 1PIWA 1DAIA 2V0NA 4K9KA 5AW5A 1GO2A 4RXMA 2Z9CA 1ACLA 5A7FA 1R6XA 3Q6MA 4RIFA 2KLBA 3JPYA 2ZWMA 4UAUA 4O59O 2IV2X 2DFNA 3WHIA 1T9BA 5DSXA 6NULA 1K06A 1EFTA 2OM6A 2DTDA 1GYQA 3KPUA 3W06A 4FFMA 2NZUG 3UK7A 1G63A 1QZ3A 3G02A 1VGQA 3HGMA 5U1PA 2Y1OA 4L0CA 1Y4ZA 4MUAA 1FVFA 1MJFA 3FBWA 5FH9A 5I7EA 1D1SA 2O6HA 1EGMB 4FFLA 2NMVA 1EP1B 4WCFA 3DLHA 3OMLA 4IV5A 1EFUA 1LK5A 1QNLA 2OHFA 2YCLA 4CVNA 1QK4A 3ZW9A 3NTUA 1ZA2A 4I50A 1W0CA 4G26A 1MHTA 5F9FA 1H5NA 3HACA 2VOEA 3FI0A 2BR4A 4Y9DA 5ELXA 2D5LA 3FY4A 2QDXA 5ETJA 1ZRNA 4NBRA 5JRZA 1UKAA 3DQQA 2XB6A 4QYXA 1EBBA 2JFWA 1MABA 4GI2A 1UWCA 2DLNA 1U0FA 1YR2A 1MO3A 1CUXA 4OL9A 1UXIA 1XTZA 4LVCA 3BHJA 3NI2A 5DLPA 4E1BA 3ZK9A 1P2SA 3OLQA 1P9LA 3PGXA 4TLAA 1UXHA 2GK6A 1A50B 2WWFA 2VWPA 3LA8A 3V1LA 3L07A 2P2YA 4TV8F 5JSZA 2H8KA 5ALRA 1R3UA 3CRRA 3DB2A 4PLVA 1JZTA 2Q3EA 2R751 3DO6A 5ED0A 3SC2B 3VA7A 2GHTA 4KSCA 2OXTA 4OXIA 3GRUA 3FGNA 4A5OA 4QFMA 1E99A 1DQZA 5AM1A 5LWQA 1QG4A 2W42A 4F6RB 1Z6PA 2GR9A 3CH5A 1B7GO 3UWDA 4PLYA 3U3OA 1E32A 1PE0A 2E89A 3A2NA 4JYBA 5JCPA 3SBDA 4C5BA 3VKGA 5DXAA 1FJXA 5IAGA 5K2MA 1KSHA 2IOFA 4LJ9A 4RK5A 4PGMA 1WHSA 1U8FO 3TS1A 4XDZA 3EVGA 2BDEA 3GDWA 4LVOA 2G7MC 3WSVA 4CKWB 3ONNA 2IH4A 5ALWA 5KHAA 1R50A 4B75A 4DZZA 4XYEA 4YYZA 4JKIA 2QG4A 4TKUA 4O1IA 4EB8A 4GFDA 4QWWA 3STYA 3VZPA 3KEFA 4QGSA 2P7HA 1P8AA 3AL3A 3M4YA 4URUR 4PXAA 3GP3A 3HXKA 3STUA 1HYBA 2I54A 2NNLD 2JJ2D 2FVYA 1GUDA 4AMBA 2O7RA 2H07A 1JXQA 4JLVA 2YJGA 1UK9A 1CZLA 2FEAA 3OX2A 3VHLB 2PK3A 4MWDA 5CT8A 2XVYA 1ZJZA 3OLWA 4IHJA 3SZRA 1V4NA 5TPWA 1B6TA 2YXDA 3T9EA 3Q5DA 1HA3A 2XDAA 1P73A 3TOXA 1H1DA 2J67A 2PX2A 3BEOA 4KQIA 4XARA 3JTEA 4WZAB 1W581 2GSWA 1KSFX 2M2IA 2NUAA 2WAOA 5PGMA 1IAQA 1PNQA 5DN6A 1NI4A 2IEGA 3E1KA 5EQFA 1P29A 3SE0A 3BC1A 3FAZA 2UZ0A 4JLOA 5LKRA 1YAJA 1U98A 3FCYA 3WGLA 1M6VA 1I2CA 2PO7A 1A72A 1YS7A 5CHYA 4MROA 4D56A 2J07A 2QNBA 2VPWA 2XNSA 3H11B 5LQKA 2QLLA 3SQXA 2IQIA 4KACA 1GZDA 1HK7A 1OLXB 4PCAA 3HXQA 2NSHA 1KFBB 4KE7A 1QRTA 4B6GA 4HDNA 4PBSA 3OCJA 1QU2A 2FWIA 4XSGA 3CFYA 4WLUA 3SFTA 2VDUE 3ZIAA 1T3ZA 3BDAA 1T9AA 2G09A 4TPKA 4Y7CA 3H5VA 2UUBB 2QBYA 4ZOBA 1ESCA 1G6KA 4EKDA 2GEFA 2EZ4A 5JD5A 4F38A 4QA9A 2HCRA 2QM3A 2AA3A 2IY9A 2P5YA 5KU7A 3QBEA 1Z0KA 3BRCA 3ITNA 3TLMA 4UE3S 3RVMA 3K1AA 4CLOB 3WX0A 2C7RA 2RC6A 5EIAA 1Y7HA 2VH2A 2C98A 4L4YA 4XEHA 2VT7A 4H59A 5CVUA 4CQMD 1X9IA 4YAOA 1Z7YA 5HIIA 1ISHA 4CTJA 1UR5A 3LWBA 1B23P 4WERA 5CMLA 4XQGA 4ZRNA 2AFHE 3LDAA 5AD1A 1CS0B 2O52A 4BAUA 4DV7B 1W2GA 3DBVO 1SULA 3FKQA 4IWNA 5ICMA 1Q1NA 5SZKB 5DCWA 1OVMA 2PX3A 1HNWB 3FDZB 2Z57A 4RSMA 2IPXA 2QKYA 4IO0A 5EXPA 3WK4A 3T7DA 4X44A 1NBHA 1X7XB 1S7GA 3PENA 3OY7A 3AIIA 4DTCA 1U0OC 1VKHA 1V9CA 2WAMA 3H5LA 3OICA 1HE8B 4F06A 5CD1A 1F0NA 1TCVA 3FSGA 3M6WA 3QTTA 2NU9B 4O5AA 4PF1A 3ZUGA 3FVQA 3OEEA 1BA2A 3DZDA 4KGXA 4QUBA 4RHEA 5IS2A 2HGSA 3DHWC 3GPBA 4MLCA 5FTKA 4AMGA 1ZHHA 3B13B 2YWBA 4KXVA 2AW3A 2FN9A 3G1TA 1YBAA 1Z26A 3FXAA 3KKOA 1W0JD 3E5RA 4TTPA 3BVPA 4R2JA 3UB2A 5M3BA 3QENA 1HT3A 3NWPA 2WYVA 1R7RA 2I29A 2O8NA 4KWIA 1J7JA 3KWMA 2ZROA 4YCAA 2D2EA 4Z4FA 1EE2A 2EFJA 2PR2A 1LF5A 4LPSA 3BK1A 1GGNA 3A1SA 2V7VA 4HN2A 4MQFB 1MP0A 2QS9A 3DUFA 4LI0A 3T7RA 2J6CA 4AJOA 1RABA 4QTYA 5ALEA 3LCVB 4Z0TA 1FSSA 4I2NA 2COEA 4QXQA 3WLPA 4MRNA 3SHTA 1PNRA 1CKEA 3GN1A 3N53A 3O03A 4XUGB 4MTCA 4MW5A 4BKOA 3NVDA 4DCPA 4WK0B 1DBPA 5ITSA 1Q20A 1RWKA 3L3BA 2QTMA 2NVBA 4RQUA 3N2IA 4UCWA 5BVHA 5KSZA 3GAZA 4WHMA 3ITKA 4EHFA 3MJEA 3JVVA 3ZHQA 3NHBA 5LLTA 4IRXA 4PZ9A 4K28A 5CFOA 1L7QA 1WB6A 3QFHA 4CG0A 3IJPA 2Z09A 4P08A 3EEYA 1QSGA 4KVGA 2C0CA 1RWWA 2ZBFA 3D3WA 2Q1UA 3TR6A 3KHUA 1QHGA 1UZAA 5BSUA 5I6DA 2C5LA 5CFQA 1DKQA 4LY3A 3N2KA 4Q1FA 4RSGA 4B74A 2CLMB 3EUEA 5F7JA 4D3SA 1J1ZA 2DM6A 4Y6SA 4DCOA 4KWHA 1NZJA 4DIBA 4FKMA 1ATIA 2XQJA 1Q1ZA 1NAIA 4NI5A 2V8OA 4L6AA 4MVJP 4ZYYA 4C6RA 5IHPA 4LF7B 2WWTA 4EY3A 3W5BA 1ACJA 4GWGA 1LBEA 4C2BA 1JW9B 1MEOA 3ZDYB 3MHTA 4I81A 4JOQA 1YQWA 3TQQA 3RI3A 4JVLA 3WMGA 4CI9A 1FP4A 1B0UA 2NP6A 4UHBA 2GPWA 4BNLA 4BNWA 4EG0A 4M0CA 3E5HA 4YRZA 1YUMA 3TSZA 1X8XA 3MLEA 4DREA 3I62A 1EXWA 1JSLA 3EXG2 1XZCA 1X0XA 4EB3A 4XJSA 3GWGA 2DRIA 2R7KA 1OXVA 2X1MA 5ALYA 3ZLTA 1SEPA 5D5PA 1HTBA 2BV3A 1ZIYA 4MUJA 3SI7A 1YSCA 1NHWA 2XUIA 3RVSA 2ZRDA 4PVCA 2ZUDA 3HGQA 3O4FA 1N2CB 2PLWA 1D1QA 3OCVA 3CRQA 4RL4A 2NU6A 3JALA 4JC8A 2RGRA 3UK6A 4YCMA 1V7ZA 1YR7A 4HRXA 2WKQA 2XVMA 5KTMA 4DQXA 3KQLA 3DBHA 3BXEA 1M2NA 2ZBQA 1F8YA 4BYGA 1ULAA 1QVVA 1RQPA 1GR0A 2FMXA 4H15A 3B9PA 4BQIA 4MWZA 1T35A 1M2WA 1O6GA 4FIDA 4M98A 3V5NA 4EHJA 4C78A 1TCBA 4TLMB 4E51A 3L93A 1LLDA 1QH9A 3NBXX 3DFFA 2CKMA 3O4JA 1WUHS 4ZAWA 4GQBA 4F8EA 1PZFA 4Q1DA 4A2QA 3PQDA 1DCFA 4WZBB 1WSAA 2Q8PA 2ODEA 3ZEIA 1QGUA 3IAS6 3JWHA 1LSSA 4PS1A 1DC3A 2WSYB 4L9WA 2IDKA 4R6XA 1N4DA 3V3KA 3ZCVA 2AC7A 3DW1X 3IP8A 4FI3C 2VP4A 4TUYA 1GPBA 2I7VA 4BNKA 5DNDA 4YVFA 1K0FA 4H7HA 4BX0A 2PSFA 2QT1A 1XJQA 2QX6A 2WHPB 4PG4A 3HQ4O 3I6IA 3R7LA 3IUQA 4R2MA 3JQBC 5A9SA 4YPVA 1MPXA 2HHAA 4FD2A 3UGTA 1AMUA 4MWOA 3MWFA 4CMEC 1PSWA 2X0NA 2TS1A 4C2AA 5BR1A 2AZ4A 1SAYA 3R40A 1FTYA 1L5FA 1U8XX 2XTJA 4Z9BA 1V5WA 1OOEA 2VQ6A 4UJ3A 3UYLA 2OHHA 4NKRA 4XGKA 5B6IA 3ZVNA 3AJDA 1HE3A 4JGGA 3LBAA 2C3OA 3UC9A 4II7A 4R51A 5ADUS 5IVDA 3UGJA 3LKDA 1XU9A 1W9MA 2QTZA 4JD5A 4EKEA 1HX7A 2FQQA 2ODWA 3ZCUA 1JNYA 1P33A 2J48A 2R00A 3NV9A 1OWMA 3W5UA 5KJEA 3TWOA 3UK2A 2JA2A 4DNQA 3C4QA 1NZFA 3LYLA 3STVA 1JWLA 3GVIA 1EUDB 3PDCA 1CUCA 5KVVA 3DQPA 1Y7PA 1RT9A 1Z5VA 2O2CA 3HCWA 3P2EA 3MJFA 1KSGA 5BV8A 3FNEA 2WKRA 1J0AA 3FFBA 4FEGA 3QOFA 4LZNA 3OPYA 4ZCSA 1YQGA 3D0OA 3AP3A 3N8DA 3QG1A 1GQSA 3DDCA 1NVUQ 1OXKB 4JFAA 4YDSA 1W52X 5FBLB 4L9AA 4F6LA 4QJ3A 3UN1A 1FX1A 1FBNA 1KZ7B 1U63A 1H5QA 3E5NA 1ZY2A 4LDZA 4XVUA 2IHUA 3VOSA 4M9CA 3GZNA 1EX6A 5DOVA 4EJ6A 1E5QA 2Q6KA 1GP2A 5TXGA 3URKA 2HCFA 3LGAA 2AFIE 3FAKA 4CODB 1NLUA 3TKYA 2Q5IA 3AFHA 5JH7A 1IY8A 2XDWA 5G4LA 2VP6A 3BWBA 3GBSA 1OLSA 1A98A 4R9VA 5D6OA 4EHDA 1NNSA 1L4NA 1Z56C 4QBTA 5JYBA 1BWQA 4WXPA 2FFHA 2ONCA 1BH6A 3B38A 3UG6A 3W8NA 3AF5A 3WGHA 2JZCA 4ZVVA 3AUSA 4E1VA 2QAGA 3GT3A 3WJ2A 3DV9A 3ANTA 3P2YA 2ACKA 4O8CA 3E9NA 3HRHA 1GFWA 1R8QA 1WW8A 3JS5A 4OQZA 4U9HS 3MS7A 3QOYA 1PI3A 1NP7A 1GPDG 1EFCA 1IBCA 2ODQA 3LUFA 2I34A 4KFTA 1N8SA 1Z8NA 3L5KA 4O1HA 1CIVA 1X7YA 1T5TA 1CJSA 2DG2A 3IBCA 5EGSA 1B43A 4Z4HA 5JXWA 2G1AA 1CUVA 2YY5A 2I66A 2UVPA 3HKCA 3MGKA 1IOZA 4EAQA 4RMGA 1M6NA 2AOTA 1YI0A 1UIMA 2DPLA 2PKWA 2XD9A 3PNPA 4FC7A 5HW0A 4DV2B 2PUFA 3ER8A 2YW2A 2P69A 1A9XB 2C5BA 4RSHA 2Z95A 2CB9A 4KW7A 3U2QA 4ZGBA 4PLHA 1PDVA 5IW8A 1T0HB 5KYUA 3CG0A 3WOVA 3AF3A 1BU5A 1P4HA 3CRMA 4L4XA 2AOUB 2BEWB 4EI7A 1Z0DA 3DP9A 4MDYA 3EQ9A 2ZS8A 4PAWA 1MOPA 1GUYA 2C9MA 4JNKA 2RHWA 3SVLA 1NRWA 2I4NA 2NO5A 4HQ0A 1Z12A 4PBTA 4WTOA 4BJ5A 4RIHA 1D8TA 5CG1A 1LNSA 2QTWB 4QBFA 1P2FA 3ROPA 1GPWB 2W93A 2JIQA 1O95A 1WP9A 4HGQA 4JB0A 5KTTA 3G2NA 3EIFA 4OLAA 1DTSA 4XD7A 1S01A 2POCA 1QOQB 2QUZA 3A3NA 2CYCA 4M9RA 2YS7A 2ZIXA 4W6ZA 5FR1A 3B52X 5K9ZA 1M8JA 2ZUUA 3LVFO 3BERA 1Q0SA 4UARA 4Z7QB 3JATB 3IQDB 5DRYA 1R6UA 1XVTA 1SFRA 1ZM9A 3NAMA 1ZVVA 2UU9B 1Z5WA 2CL7X 2FRDA 4Q18A 4F7DA 1ZPDA 4OLFA 1CVLA 4PLGA 4NZ9A 4QQFA 2PJRA 3RVPA 3H99A 1W0KA 2PTGA 3RJZA 4LC0A 2CLDX 1O2DA 3H2GA 3BSSA 4D6PA 1HLGA 2WA2A 5BSTA 2VJDA 5FYDA 1K7SN 4OLBA 1VI5A 3PSHA 4EIWA 1K9SA 1WD5A 2UZIR 4IKPA 3N1UA 1FLDA 2YZ7A 3MQ2A 4HTFA 1UZMA 3PK0A 3RS7A 2YC4C 3VOBA 3NUZA 3A05A 3B9BA 2BGRA 2QZ9A 4QEZA 3IHWA 4QDTA 4RD0A 4JBWA 3TW6A 2I4OA 3PFKA 4XJVA 5JCXA 1TZMA 5EIOA 4JKOA 1KARA 1TQ2A 5CDGA 2BR5A 1HE5A 3OZWA 2IEDA 4AYTA 1CUHA 4DCVA 1I7QB 3A6PC 4LRQA 2Q1YA 2C4KA 4N6GA 1UBRS 4N5IX 1U81A 3IEVA 2PPVA 2H11A 2I2AA 1ULSA 1F3LA 3S1AB 3Q3CA 2X42A 3GR6A 5LM3A 4ENWA 1XDDA 3CVJA 4BNNA 1O0BA 4PG8A 1IBMB 1MX9A 1ACMA 3IUYA 2NTEA 1BWPA 1M9NA 1YS1X 5THKA 4ID3A 2UYGA 3V6LA 1MTZA 2PMDA 3P4UA 3TPZA 4IQ4A 3JPWA 1A4RA 4BWFB 4I1UA 1G66A 1S2NA 2CD9A 3DVRX 2ATXA 3G1WA 1DADA 2ZUBA 1ZOSA 2RGDA 3G5TA 4P84A 3ZE2B 2BVNA 3GG9A 4D43A 4ZP1A 4DYVA 1XD2A 3HCRA 3MWEA 2IPNA 3R3ZA 3CH6A 3RVOA 2IYFA 1J5PA 1ZSYA 1BSVA 1VIVA 3NEJA 1UANA 3NW9A 3HN7A 1USVA 4KLRA 3UMCA 5LQDA 4Z99A 5HK8A 1F1JA 2GCPA 3FVVA 2NUTA 3T3GA 3G2KA 4YRMA 2R79A 2IUSA 4CBVA 5K6TA 4OQXA 4TV8A 4OFZA 4K6MA 3RUAA 1JALA 4DCMA 5IFKA 4IV0A 3KQHA 1TEZA 2WMNB 2WF7A 4M54A 5JAMA 2JJ1A 5JJBA 3UHAA 3WWDA 4OSOA 4O3MA 1X14A 1NJ1A 5FO0A 1UBLS 1EFPA 3LQ2A 3PQ5A 5EHIA 1EXNA 4MB0A 4BMXA 2O5RA 2R2AA 1OH7A 4S0XA 3TQOA 2RONA 3GRZA 3X1JA 4J0IA 2CVPA 4AO6A 4JC5A 4A03A 5AHKA 3LBFA 3HDVA 3WLAA 1KRWA 1YC2A 2D5IA 3BWXA 3FMFA 4K6GA 1XP8A 1YRLA 2FUCA 3A3YA 4YGYA 4W9NA 3UGKA 4HSEA 5HRCA 5INTA 2CBZA 3D2BA 4JU8A 3ZV3A 1LH0A 2QTRA 1OHHA 3BIFA 1DC6A 1MUUA 4F9FA 1ZNXA 2JLRA 1XKXA 2XUJA 1C7EA 1HDCA 3O84A 7REQA 5ECWA 1FP1D 4FD3A 3KTAB 3OIFA 5KQMA 3LKZA 4X0EA 4QD3A 1IU9A 3WV4A 5LZ9A 4FONA 1CJMA 1FC0A 1JU4A 2XAAA 3NIFB 3FUXA 4CF6A 5J58A 1RZRD 1Y7LA 2HJ9A 3A1NA 1BGXT 3RTEA 4PEVA 3R7WB 3ZE6A 4PHFA 2B69A 1PJSA 2VWGA 3BYZA 4GOND 2GN1A 5BQXA 1FOEB 3CLHA 3W3AA 2EX4A 3M9XA 3Q40A 2AXPA 1ZRSA 3O1IC 3OZGA 1T0PA 2XKJE 1MC5A 4I8IA 1T9KA 4Y6RA 4XLZA 5IKEA 4HAYA 3WK5A 2ZQYA 2ZRLA 3FGZA 3NWEA 4IQFA 1UBFA 1BNCA 2JGJA 2OMKA 4NDZA 4V0MA 1CDZA 2WZQA 3OBIA 1XCMA 3QE2A 2FMHA 2KPOA 3UKOA 4GYYA 3RTCA 3RARA 2W71A 4Y2HA 1J4AA 4Q9AA 4Z4EA 3HVUA 3V1NA 4GGOA 1PS9A 3BREA 1SO8A 1P6XA 2ASEA 2VQ3A 3F73A 3AY3A 1BEEA 4EPXA 4EMSA 4RTPA 3AKZA 3TZ6A 3DW3X 3DPIA 1LV7A 4GR9A 2CJWB 4RH3A 5I7VA 3VXKA 5AK6A 2ZI3A 3I9FA 4EFKA 2XMGA 4ZANA 2CXOA 5JSQA 4N7JA 2X76A 3EIOA 2X0RA 3U7RA 1P4SA 2PFGA 1QLJA 3JVUA 1HY3A 3DDOA 4KZPA 1ATZA 1RM4A 3NVMB 4GX2A 1CQIB 1Y3DE 2ADMA 2C9BA 3MB5A 3HU5A 2QRLA 1CQZA 4IUYA 1B16A 1I3LA 1GQOA 5I4BA 2I9KA 4IAOA 1YK1A 1E2EA 2E4UA 1U2RA 2WU8A 5AK0A 4D5EA 4L02A 1T2VA 3H65A 3JQ9C 3GG2A 1WNTA 1WS6A 2NXCA 2IZZA 2YJNA 1URPA 5B3JA 3V48A 1FTWA 2Q5QA 4ABTA 2G0AA 1VE1A 1WXIA 2AJTA 1Z2AA 3F90A 3R5HA 3MT7A 1NLYA 4HFRA 4CLRA 1MGPA 2Z0MA 2D59A 2IXEA 1UPBA 3H2BA 8ABPA 1EZ4A 5CAEB 3X2FA 4QYWA 3LV8A 2WAYA 3VNQA 2YMQA 2Z58A 4HDRA 5L3RA 1NM5A 4EX6A 3AOGA 1M67A 3FLEA 3HKEA 4HYYA 1Y4SA 3U7JA 3KOXA 1M1NA 2YZGA 3F7OA 2GSDA 1C50A 4IRUB 4UUBA 1NQOA 4ZQEA 5TT0A 2B8EA 1J00A 2CBXA 3TTVA 4Z3KA 2DCUA 4AF7A 5JJCA 4FS3A 2XW6A 3BTUA 1JVBA 1SC4A 1TTHA 2H29A 2EX1A 1Z4MA 2Q4EA 4Q3EA 3HNRA 1GUBA 4HGOA 2ZJFA 2AXQA 4BRWA 3BL8A 1VRWA 4G81A 4DUYB 4MYCA 4XIGS 2PMCA 4HAXA 4MMYB 2PN1A 1M33A 3MMSA 4DA0A 3LZ6A 1G60A 2BWJA 4W7IA 3V4RA 2XYGA 2IYVA 1I2AA 4RKRA 1LI5A 5KTNA 5CIYA 3B89A 5C7LO 5AUPB 5KTSA 2FHPA 1IC6A 1CNFA 3WYCA 3IDFA 1QH1A 1GAWA 1YB7A 2X9NA 1W8IA 1FYDA 2OO7A 3KYCA 1M75A 3PS9A 4FWIB 2A4MA 3U4HA 3EVDA 2GVDC 4KQ2A 5ALXA 2NZWA 4AZWA 2MYTA 4ZHQF 1EP2B 4H1VA 4XAQA 2Q8QA 4Q7KA 3U1VA 4M53A 1G21B 2BCEA 9LDTA 4CEIB 4KVFA 4KHPB 5ALUA 3RO7A 3TSCA 3AH8A 4QTXA 2JLXA 1T2NA 5A5FA 3DSRA 1YOBA 4M87A 2CXPA 2IT1A 3D43A 1FBTA 3BH0A 3IOCA 1EVIA 1DO2A 3LJKA 4LPKA 2ZSAA 4GVXA 2FY8A 3OQNA 4PR3A 1RQGA 4FCWA 5A1JA 3UBTA 1J8VA 1NW8A 4FFNA 3LF2A 3ZKAA 5JHGB 3P0HA 4BQNA 4MCAA 4EKGA 2YUTA 3W90A 4MB6A 2O4UX 3C8MA 3HLTA 1I14A 1B8OA 4BVJA 4Q1VA 4XR9A 3RG2A 3LUJA 4L0MA 3U4AA 1XZKA 1TM7E 3C7TA 1KYYA 1WWKA 4MRAA 5GQSA 3VKUA 1ADFA 1VI6A 1FS6A 1K2WA 2A1UB 3EW7A 2HIGA 3EZLA 3ZU3A 5DLQC 2GEVA 1XHLA 3JY6A 1HORA 1PWZA 3A1UA 3LBIA 3RC7A 3TTYA 1JRLA 1JQ3A 4NBLA 1FEZA 3UJ7A 4MI3A 1T10A 2G80A 2H0AA 1OR8A 3A0RB 1CY2A 3ZKWA 3PUVA 1GFIA 2D54A 3F9CA 3SHOA 4BATA 1J0DA 4DLLA 5BUQA 3Q8KA 5A5DA 2QUIA 3DBLB 3REOA 2I6UA 2YFHA 3FHTA 4HDOB 2F6RA 2DFPA 3QKIA 3OKCA 1QH8A 4MGEA 5ITVA 1OPXA 5BN1A 3MJRA 2VN8A 3OVMA 3COJA 4XTCS 4M2LA 2YMMA 3TLJA 4F8JA 1TDJA 1JDTA 5DM0A 4YCNA 1WETA 1NN3A 3FTCA 2C7VA 3GBPA 4NICA 5AVYA 2REXB 1KORA 1VOTA 2WVGA 4V24A 1CDEA 5EUMA 4B9AA 1VMIA 1XDUA 1PTJC 5F2KA 4BHTA 2F1HA 5G1NA 1YA8A 4BO9A 5H81A 2WWIA 5AVSA 1ZAYA 3Q8MA 3SDZA 5LDHA 1VA5A 1T2AA 3TEFA 4DXHA 4DQLA 4HLNA 6YASA 1D09A 1GRVA 4URVR 2P79A 1VE3A 3QE9Y 3OZTA 2ZP1A 2ZWPA 3VJMA 2ATEA 4LBYA 3U3XA 3AUUA 2O6LA 4RQBA 2GNPA 1IZ8A 4FMBB 3BMCA 4P3XA 1GNSA 1SA0B 2C00A 4BGIA 1ZD5A 4IFIA 2CWWA 2GZHA 5ICSA 4M88A 1BXRA 4CR6A 2W22A 1QFMA 1Z6YA 4KXNA 4WFKA 1N2CE 3FPHA 3MT8A 3O0DA 4RQAA 1YR1A 1UEJA 4BFTA 5NLLA 1BDIA 2HT1A 4D4GA 1DAFA 3V46A 2VYND 4RJKA 2HDNB 1EBUA 3ECSA 4EITA 1QONA 4RHUA 1N2BA 5ALMA 4EG8A 4WNAA 1KXJA 4ZO6A 1ABFA 2CNNA 4DCGA 1C4XA 1FMCA 1KJ9A 2PG3A 5DNCA 5ADHA 1NW4A 2AMVA 3DFIA 2R44A 2OO5C 4RVUA 4DARA 4BP1A 1AZSC 3EXEB 3KC2A 2QUHA 4YAWA 3H4TA 2V6MA 3M5WA 2CW5A 2CZQA 3BM5A 2X40A 2O3RA 3WIDA 4NE9A 3R9XA 1UDRA 5LD2C 1XZJA 1MAHA 1QF9A 4WZBE 4JHXA 1SCQA 2NPIA 5T8KC 4A2WA 4YIHA 4EM6A 5L9AA 1A9PA 1YJBA 3EULA 4NS4A 2J4CA 2G71A 4RTMA 5LLDA 3BFKA 4N7BA 3SS8A 1DRKA 3UYKA 3SSMA 1UM9B 1X13A 1U1CA 3EEBA 3L84A 4ZIRB 4ZZ3A 1SBCA 3H86A 1KDTA 3QVKA 4EG5A 4D57A 3KCNA 1RI2A 1PLKA 4F7WA 5JOQA 2F9MA 3HBJA 2G04A 1IUNA 1N0HA 4K9SA 1C7JA 4EFDA 4ZJZA 3U09A 1C8KA 2Z1NA 5F2EA 2AQKA 2WR8A 1QZUA 2QU8A 4MW6A 2XY4A 4YQFA 1L5SA 1RMQA 3OHSX 4X8OA 3UT0A 2JFXA 3DMTA 1ZIDA 4EYKA 4BQQA 4Z53A 3W2HA 1VGRA 3BD8A 3OTHA 4HO1X 3TZBA 2QVBA 2YWJA 4Y1GA 1HDRA 2WU1A 4HXEB 4GSYA 1E66A 3NKFA 3I73A 2OY0A 5IJWA 4FNGA 1P4AA 3QVOA 2XMRA 4BCBA 3PJRA 1PV2A 2NTYC 5LWHA 16PKA 4RZIA 3N2GB 4FFOA 1BROA 1JXMA 5E9WA 1PG2A 1O89A 2OFWA 3EJ6A 3LU1A 1VCIA 4LZLA 4W1SA 4WN3A 2C2GA 4F4IA 3R9IA 5KYNA 5HXAA 5L53A 2QK4A 1EFRD 1C0IA 1C5KA 4I5EA 3L01A 1W6UA 1H8HD 3RB8A 1FUKA 2Z43A 4ZZ1A 1EPUA 4DF3A 4RLHA 4RDXA 4TRJA 5CYOA 4XDHA 2W6ID 1E2IA 4PY2A 3LQ4A 4EHHA 2GS9A 5LCXA 3R6WA 4TQGA 5JD3A 3SKVA 4C1BA 5FFFA 1I7PA 4AIRA 2RIPA 3VNVA 4EGSA 4WLVA 1CJVC 2NXEA 3H3JA 3C3MA 1JIXA 4OLHA 2VPQA 3KJQA 4L5YA 2V4MA 3T7AA 2P67A 4AY6A 1WVMA 2VAVA 1C9JA 4QLAA 4UBOA 3BTVA 1C3JA 4RDCA 3KJNA 2BD0A 3ZHOA 1DIRA 5CGQB 3UFBA 4EK9A 5F2NA 5TJHA 3SJUA 5E4YA 4I9NA 5BP7A 5DCLA 2JI7A 1Z6GA 2HWYA 1K5HA 4DMGA 5FWYA 3JW8A 3SM9A 2WTUA 2OV2A 3TZQA 5ALGA 1FRQA 4BX3A 1AJEA 5FBWB 4AECA 3E1SA 1E59A 2ATCA 5JG7A 1Y6QA 3OTGA 3MOGA 3RC2A 3WBJA 2X8JB 3W1EA 2X77A 2VDKB 3ABSB 3DYIA 4E7OA 3W04A 3M2PA 1XFDA 4QPCA 3HCBA 1PK8A 1KAMA 3FF1A 4HGNA 3C8ZA 4JL5A 2WHEA 2O5CA 2IZ7A 3VC2A 3W8FA 3TFWA 5D3KA 4R2LA 3OKPA 3IKJA 1T3SA 2QE7D 4NL4H 5AXDA 5KSOA 1PEDA 1T2UA 1YZ3A 5F5LA 2VA8A 3VYWA 4S3MA 2I6FA 5B6PA 1WXQA 2IHJA 3L43A 2FJ0A 5CXUA 2H51A 1SBHA 1T3TA 3HBFA 5SYAA 4EGJA 1EX9A 1W76A 2CY0A 4G07A 1XOIA 2JCXA 2OE2A 5D6NA 2Q1WA 2XR1A 3KALA 4XVQA 2C5SA 5AW7A 3RS4A 3SZOA 2HDWA 3VISA 4FGWA 2A86A 2IHZA 1ORWA 1OBHA 1EP3B 2B2CA 2J9FB 4F9GA 3WIOA 3ZHCA 5JZOA 4GXTA 4JZYA 3GFPA 3ZLUA 2PSSA 3JR3A 4JI0B 2ZAMA 1AM4D 1KK2A 2C42A 2XI4A 3KSUA 2B21A 1B6SA 2AQHA 5EXEA 3GGPA 3IQGX 3GAAA 4IWXA 4NCNA 3ZTWA 2FPKA 4PN7A 4JWKA 3OLYA 4XW2A 5BQ5A 1K6MA 3VPBA 4LTMA 4RK4A 3QVUA 3EB9A 1FP2A 4EB0A 2RBEA 1VCNA 4GL4A 2CNDA 1SK8A 2ZGVA 2X13A 3CJQA 4JYMA 4ZT5A 3H16A 3EMBA 2WJIA 1CUWA 2I6QA 4IVQA 4CMKA 3A6JA 3OM1A 2D1SA 3OU6A 2VBIA 4BL5A 4PZZA 5JAPA 2I4MA 1FU8A 1D7AA 3AHCA 3EZ9A 3PR3A 5LU8A 1BQ4A 3GNTA 5DHRA 1QCCA 3OURA 3T8YA 4TTAA 1H6AA 1Z4OA 2ZDQA 3SR4A 2VTBA 1PNOA 2YCBA 3F2VA 4CG2A 5HF8A 4BXOA 5IVPA 2E4WA 1I4DD 1ZK0A 1YKSA 2DHEA 4R41A 3OFSA 3LVRE 1YE8A 2IHNA 2W0MA 4FHZA 1HETA 1SUBA 1UP7A 5L7WA 2D8AA 3BMQA 2FSIA 2TMGA 3DJYA 4GLJA 4JBHA 3ROZA 2QT9A 2YIJA 3HJRA 1WKVA 3OQIA 1PT5A 2CE2X 4RADA 3OQPA 1U65A 4HZUA 5E8RA 4MVYA 3X1XA 1OH8A 1TJPB 2AGVA 4A0QA 3I0ZA 3RV4A 1LW6E 4YUAA 4RGBA 2AN1A 2AOWA 2VJOA 3PXDA 5I3ZA 3B2NA 1WSBA 2AI2A 2WUVA 4B47A 1HFKA 4LJLA 5CB4B 2H4JA 4GXNA 1NBIA 3CU5A 1MTOA 1MB0A 3PHCA 3ONWA 4HPJB 1VB3A 2ZU0C 5FV7A 5MFPA 2P2ZA 4CCYB 1Z0IA 2VT6A 3GEGA 3MM4A 5CT6A 2ZRIA 3ZWWA 1JB1A 2GYVA 2XOKA 1XO1A 4WXEA 5T4FA 1G2IA 1J1UA 5CCDA 3C6QA 5KHOC 1HDZA 1XQ9A 2C2MA 1W73A 2OB1A 2O7QA 2QI9F 3K9NA 2C3MA 4JJAA 4BBAA 1SKAA 3OEWA 1SBQA 2GEBA 4KV7A 2FI1A 3RRBA 4CM9A 5I51A 2FSFA 1QCDA 2HHJA 5DWDA 3W5JA 4CIDA 3ZWAA 1YE3A 3N3BC 3W5SA 3FW1A 1EFLA 2K6GA 3BWVA 2NO0A 3U40A 3CV3A 4KDRA 1KJJA 4XM2A 4WLOA 1GNTA 3KYBA 2WZCA 1W4BA 4FOPA 4UMFA 1N0UA 3LPMA 5B30A 3FTEA 3DKPA 1GU0A 2J45A 3L7OA 3CH7A 3OQJA 1R0CA 2QMEA 4UVDA 3DTVA 5J5VA 3SZ3A 1RAFA 2OK8A 1DTWA 3IB3A 1AB5A 3TJRA 2BHLA 5A05A 4IMJB 1Q15A 1H2RS 1U7XA 2G25A 5J40A 1E7YA 2ZJ8A 4PG7A 4I9UA 2AG8A 1WUIS 3E22B 2QW8A 1EM8A 3PHIA 1W8DA 1RLMA 3GFGA 4HVLA 2UUCB 2O8CA 1XEFA 1WO8A 3VBCA 5GZ6A 2IPAB 3CB4A 3H84A 1P8JA 3TEMA 2X8LA 1KOLA 4MV5A 3T0IA 1FDTA 3G59A 3A4YA 5JEDA 1SHLA 1L5MA 2W5UA 5FHRA 4BP3A 4C2TA 1CY0A 2EC5A 3KQNA 1EUCA 2DWPA 4OXKA 4I2VA 1FNMA 1MH1A 3D8TA 3F74A 4K6OA 2PFKA 3U3MA 4IZIA 3QYJA 3WGMA 1ZOIA 2CDBA 4NSNA 3Q2OA 3ESRA 2EIXA 2ZJOA 3I64A 1CFZA 4J1SA 1DC5A 1G8HA 2KBFA 5H70A 5LDGA 2YWGA 3Q11A 3VDXA 5MF6A 5IAOA 3NBAA 1AKQA 3GHYA 2RGGA 1ZRMA 4QBKA 4X1IA 1SJ9A 2RHHA 1P2TA 3LO8A 2NAFA 3PQ8A 4MGIR 2WIGA 4NZYA 3VR4D 3VU1A 2YN2A 5C8XA 4LSMA 5TQ0B 5EIHA 1RC0A 4JYPA 2C7OA 1TJ3A 2QB5A 1T9DA 4EQZA 2JAPA 5CVJA 5EHGA 5EN4A 2Q5LA 4FDLA 3KQPA 4GI7A 2ZYIA 1RI4A 1J8YF 2WJPA 2NV2B 1F7UA 2VWQA 1YZHA 4XEUA 3SYLA 2JGAA 3IEKA 4MR8B 2B82A 2BTOA 2PNJA 1V37A 4HP8A 1F17A 2OAP1 2WIKA 1E77A 1PDOA 3LNCA 3OIVA 3PDIA 3JWEA 4X94A 4TS4A 5H7XA 1M6HA 1X7WA 1X87A 1ZVKA 3KZVA 4L8FA 4MVJF 5DTJA 1KKMA 5DH9A 4AB1A 1NI5A 2GEDA 5F1OA 3OLVA 4FGKA 4NPAA 4EW3A 1UUFA 3KSZO 4Q1EA 2IIVA 2XWPA 5EJ6A 3KKQA 1IRXA 5JSFA 1QZXA 2IHKA 5K51A 5C8YF 1F8FA 1J49A 2WWGA