3FMVA

Crystal structure of the serine phosphatase of rna polymerase ii ctd (ssu72 superfamily) from drosophila melanogaster. monoclinic crystal form. northeast structural genomics consortium target fr253.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
190
structure length
190
Chain Sequence
KLAVAVVCSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGMAFDKPNVYEFGTKYEDIYRDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTKEQFDIIVTVEERVYDLVVMHMESMESVDNRPVHVLNVDVVDNAEDALMGAFVITDMINMMAKSTDLDNDIDELIQEFEERRKRVILHSVLFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine phosphatase of RNA polymerase II CTD
publication title Crystal structure of the serine phosphatase of RNA polymerase II CTD (SSU72 superfamily) from Drosophila melanogaster. Monoclinic crystal form. Northeast Structural Genomics Consortium target FR253.
rcsb
source organism Drosophila melanogaster
molecule tags Structural genomics, unknown function
total genus 43
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fmvA01
1USKA 3QEMA 4WZZA 4YP9A 5JNUA 1JLKA 3UK0A 5BR1A 2QR3A 4Z4GA 1E6LA 4QYMA 2J48A 4G0OA 1QP0A 2NT3A 4H60A 2JK1A 3ROFA 4FE7A 3H75A 1EFAA 2R47A 2WB4A 4MR7B 2FMFA 2JVKA 5DKFA 3SG0A 4EY3A 1ZITA 3G1WA 4HNQA 5DGCA 1PHRA 1QNLA 2E4UA 3KLNA 5JNSA 1I3CA 2FKAA 4Z4CA 1SRRA 2WJWA 2A9PA 5DCLA 2PAFA 3N75A 4OLAA 1ABFA 2YHBA 4PYRA 2FQXA 1E6MA 1DCFA 2MYPA 3A0UA 3CS3A 2JRLA 4MRMA 4IILA 5IBQA 4KMRA 1QO0D 4E7OA 3OLZA 4F11A 3QEMB 2AYZA 3LUCA 3SM9A 5TQJA 3HSYA 3JY6A 2CWDA 1FQWA 2IYNA 4PE5B 4XFKA 3UUGA 3KLOA 4H3HB 4DQDA 3O1HB 3I09A 4L4UA 5FBKA 2P4UA 2VK2A 4YR7A 3LUGA 2FEKA 3EJWA 1GLGA 2PMCA 3EQ2A 4KZKA 4N47A 6ABPA 2PKXA 4Z0NA 2FXIA 4ETIA 4IRXA 3N0WA 4LRQA 3GBPA 3JS5A 3RQIA 3W9SA 2GKGA 1R8JA 2GWRA 2VYCA 4MRMB 3C3MA 3I45A 4YGXB 5FWXA 2IPMA 3RVMA 3UKJA 1BAPA 3IDOA 3Q9SA 1D1PA 1ZGGA 1E6KA 2L19A 2KYRA 1SD5A 3QLVC 4G0YA 3TD9A 1QMPA 5KQMA 4LE0A 4MR9A 4JASB 1APBA 3OQNA 1ZAYA 4WWHA 5KWSA 2M1ZA 3D8UA 4N41A 5KC8A 5CNIA 2IPAB 3KCNA 2JVJA 3VNBA 2PE5A 3G85A 2MSLA 3URMA 4MLDA 1DG9A 3H5LA 4Q6BA 4CBVA 2RDMA 4Z9BA 4W5QA 4ETMA 1NXXA 2MSWA 4XXHA 4RXMA 3KTOA 2PUGA 3SNKA 1GCGA 2FMHA 2FVYA 1FFWA 5TE9A 3GRCA 2FMKA 2A9RA 4LX8A 5FWXB 4MPTA 4KQ9A 3H6GA 3LUAA 3RVJA 2VUHB 2FQYA 2FLKA 2RJOA 3CG4A 5JNRA 3NHMA 3Q7RA 3O1JC 3HEBA 4KREA 4MR9B 1NY5A 1JHZA 3T95A 3H5VA 5KC9A 4RY8A 3R0JA 4O5AA 3D02A 1A2OA 1RXIA 5IULC 4PICA 3QLTA 3F6CA 2FMIA 3GL9A 4JOQA 3KJXA 1RZRA 3M6MD 1AB5A 4JP1A 4G86A 3TMYA 1BA2A 4QICA 3HM9A 1LJLA 3IP5A 1DZ3A 1NXOA 3GV0A 3KYIB 1XWWA 3N0XA 3JPYA 4FE4A 4GNRA 4Y9TA 2M98A 4NCAA 3LOPA 1LJUA 4RKRA 2IPLA 2GBPA 1DP4A 4RS3A 3RVSA 1JBEA 3K9CA 3N8IA 1A04A 5JNTA 3O74A 4FB4A 4MQEA 1YVUA 1RPJA 3LKBA 1GCAA 1P6UA 5IEJA 3FFXA 4RXUA 3MM4A 3CLKA 2E4YA 4MAAA 2OQRA 3A3KA 2L17A 2R4QA 1F4VA 1QPZA 4OATA 2CHEA 2H3HA 3ILYA 4DN6A 3KG2A 1USGA 3F7NA 2ZAYA 5BRAA 1WETA 1Z15A 2MSKA 4W5NA 3NNSA 2HQBA 3QX8A 3IP7A 1L5YA 3HDVA 1NTRA 3GYBA 4W5OA 2F8SA 3RVLA 1JFVA 1Z26A 2IOYA 4MQEB 2O20A 2PL9A 3HDGA 4P98A 1YS6A 4D6YA 2FN8A 1FFSA 2RJNA 5CNJA 4ML3A 3EODA 3SQNA 3TO5A 5GOTA 3MF4A 1T34A 2QW1A 2ID7A 1PNTA 2MYUA 4TMYA 5JS2A 4M88A 3CNBA 3L6UA 3EQZA 4RK5A 1DBQA 5B3JA 5IEBA 5IX8A 3KHTA 1BDJA 1EWVA 1TMYA 4TLLB 4EYOA 8ABPA 4KFCA 4H3KB 1Z2EA 1Z17A 3OLVA 3CU5A 2CHFA 1KGSA 1P8AA 3F73A 1ZH4A 2JCGA 1TLFA 1DC7A 2FN9A 3CFYA 1VPWA 1JL3A 4MS4A 1QO0A 4OBBA 4F06A 4Z99A 1FSPA 4JB2A 4NCBA 2JVIA 2BGGA 4N0PA 5CHYA 2MYTA 2VUIB 4ZYLA 5KQPA 1ZVVA 1A0OA 4PZ0A 3QLUA 3A10A 5TQ2A 3QX9A 2TMYA 3HV2A 1KRXA 3RVKA 1JDNA 1ZH2A 3HO1A 3H5WA 5IUNC 2JB9A 3GWGA 4DADA 4XLTA 1QKKA 4KPYA 1YMUA 4JA2A 3JPWA 1OXKB 3CZ5A 3M9XA 3P9YA 1MB0A 1SXIA 5HQJA 3OM1A 4Z4HA 4KK3A 4F3TA 4MS4B 3HXMA 4RK0A 3QEKA 5KI6A 3LUKA 1LK0A 3MA0A 5EWMA 2IPNA 3M9WA 4XAQA 2FSPA 1VRVA 1E2BA 7ABPA 2QV0A 2YHAA 3Q41A 4G0ZA 4XASA 2FQWA 2IKSA 3DGFC 4RY9A 5TPWA 1EAYA 3LFTA 3CZCA 1XHFA 1M2FA 4HNRA 1D4ZA 2DRIA 1DRJA 2N9UA 3FFWA 3IPCA 4Q6WA 4YCSA 4YRZA 3RVOA 4RK6A 4YO7A 3DZDA 3GBVA 1BVHA 1ABEA 3TB6A 3FMVA 3LUDA 4RXTA 2QVCA 2E4WA 2NZVG 3MMNA 5DTEA 3C3KA 3C97A 1C0EA 3IPAA 2PUEA 3RVPA 4G0MA 2QXYA 2PUFA 5TPZD 5FWYA 3SY8A 2FLWA 3F6PA 4NQRA 1SXHA 4Z4IA 4PEVA 5EWMB 1D1QA 4W5TA 1CHNA 4LDZA 2FW0A 2AYXA 4Z4EA 3LUHA 3CKMA 4WXEA 1PEAA 3KYJB 4RK1A 4KV7A 1JFSA 2QZJA 5TPWB 4MQFA 4EYKA 1YTUA 2L2QA 2HQRA 1DJMA 1AB6A 2WWVD 4MS1A 1EWKA 1K68A 4XARA 1USIA 3OLYA 4EVRA 3DLBA 3O1IC 2F8TA 3EAFA 2WMYA 3EGCA 5IUJC 4YWHA 4EVQA 2QVGA 4LDAA 1JYFA 1YK1A 4UHKA 2E4VA 4G0PA 5HM6A 4MGEA 4OG2A 5HKOA 5ABPA 4KK4A 2IDMA 3CG0A 5FWYB 1PNRA 1U8TA 3QELA 4LE2A 3SAJA 5F64A 3LMKA 1EWTA 4S04A 9ABPA 3MQ4A 3RH0A 2CD7A 2H0AA 1S8NA 3H5OA 3MIZA 2LBPA 3FFTA 3IP9A 4KQCA 5TQ0A 4O1IA 4ZMSA 2PJUA 4YLEA 1PUXA 1NXWA 1ZESA 1U2QA 4MQFB 5KQGA 1YIOA 1JWLA 4KRFA 5IC5A 4MS1B 2HPHA 4E7PA 4OTZA 1ZHHA 3HZHA 3B2NA 3FDFA 4MS3A 5FBHA 4TN5A 4HYEA 1H9CA 1NXSA 3T38A 4RY0A 5C5EA 1B00A 1CYEA 2E4ZA 1DBWA 5DLEA 4GPAA 3RVQA 5JNVA 4G0XA 3A0RB 4MR8A 1YK0A 2JBAA 3ILHA 5IUKC 3QLVA 4N76A 3OLWA 1MB3A 3CTPA 5T3YA 1DCMA 3CRNA 2WY2D 4YV7A 4NV3A 4S05A 1QP7A 1OXBB 4RDCA 1TVMA 3BILA 3OQOA 5TQ0B 4N03A 3H1FA 4QPJC 1KMIY 2A9QA 3EDCA 4EYGA 2A9OA 4QYWA 4RK4A 2E4XA 1BDHA 4MS3B 4OLBA 2PUBA 1JX6A 3O2SB 1NXTA 2QSJA 2B1JA 4NICA 3HS3A 1FFGA 3H6HA 4MR8B 4EYQA 3S99A 2JBAB 2LIVA 1ZN2A 3LTEA 3Q15C 1ZDMA 4RZSA 3RVRA 4ZMRA 2FEWB 3JVIA 2LPMA 1W9HA 2R25B 3HJFA 1Z18A 4KVFA 1VLZA 1W25A 1ZY2A 1L5ZA 3T6KA 2PL1A 3OQMA 3HK2A 5D2CA 4G0QA 4HNSA 4Q7EA 1URPA 3N53A 2B4AA 3QK7A 4LZLA 1PEYA 2PUAA 3HUUA 1DCKA 1YMVA 1Y1LA 1DC8A 3KS9A 1Z2DA 4LE1A 5BRJA 2HJ9A 1P6QA 3OO1A 5EWJA 3LUJA 1IIBA 3O75A 4WT7A 2XDYA 1Z25A 3Q7SA 4MLCA 3BBLA 4IGAA 3H1GA 1QQBA 1LBIA 3NBMA 4EVSA 1ISRA 3C3WA 3T8YA 3O2QB 3DLHA 5TQ2B 5GQSA 4TLMB 1D5WA 4F8JA 3E3MA 3O2JA 4P1ZA 1RNLA 3EULA 3HCWA 3JTEA 4UHJA 3C6QA 2NUBA 1QP4A 1MVOA 1LBHA 1JH9A 3BRSA 5E3JA 2V0NA 1M2EA 2ID9A 3GT7A 1VKRA 3BRQA 3NNNA 4EGSA 1TM2A 4L85A 5EWJB 3Q7TA 4JB0A 1JDPA 5B3JC 5C5CA 1Z16A 3OM0A 1GUBA 3O21A 4RSMA 1K66A 3BREA 1D2AA 1M5TA 1U0SY 3H5TA 1BDIA 3JVDA 3LKVA 4MYRA 2GI4A 4W5RA 1P2FA 4WUTA 1ZGZA 3HUTA 2PUCA 3LUFA 3KKEA 2LP4Y 2Q5CA 1DBPA 1RZRD 1F51E 5TPZA 2P9HA 3H5IA 2OENG 2LUOA 4RV5A 3OMWA 1ISSA 4N0QA 5JNWA 2WJAA 2GX6A 2R48A 4D74A 3DBIA 3QLUC 3NNDA 1TJYA 5T7BA 1QQAA 1KRWA 3VNAA 4D6XA 5JS1A 1C4WA 2W42A 2NT4A 1Z13A 2FTKE 4WXMA 5I4CA 5CNKA 3DGEC 1GUDA 1EHCA 1NATA 1U2PA 1CEYA 5CNMA 4RU1A 3H1EA 2HSGA 4IMJB 1MIHA 3K4HA 5EWLA 2QU7A 4ZPJA 2RGYA 2X7XA 1NXPA 2I6FA 1SXGA 3OO0A 4F12A 1NXVA 1U04A 4RKQA 2PUDA 4KNYA 3MYYA 4B09A 3ROTA 2WRZA 3RVNA 3OLXA 4G97A 1YS7A 1XHEA 2FEPA 1J56A 3NHZA 5KQLA 1DRKA 4Z9AA 3TX6A 5HSGA 3KSMA 4Z4FA 3N6VA 3N0RA 3CHYA 3I42A 2PLNA 3GA5A 5PNTA 1JFTA 4RWEA 4IMIB 4ETNA 2MYNA 2ZWMA 2NZUG 4MR7A 4RK7A 3I5AA 4JAVC 4O1HA 1JF8A 1HEYA 3FGZA 4IF4A 5ED4A 3HVRA 1JYEA 1Z12A 3QELB 1RXEA 4ZJPA 3OMXA 5EWLB 3E61A 3L49A 1MAVA 4YS6A 2HQOA 4EUKA 6CHYA 1M5UA 2L18A 1UDRA 3IP6A 5BQ3A
chains in the Genus database with same CATH superfamily
1AUXA 3CUKA 3Q8KA 1KFKB 1KBQA 3E8SA 3NTLA 4JGBA 4U2DA 4NTZA 1IRXA 1D2GA 2BBWA 4Y0VA 3R1IA 5TSDA 4H60A 2J4CA 4Y30A 5EY5B 3EDMA 3H75A 1TLLA 4HRVA 1T5SA 2KI5A 2WAXA 4X7RA 4OIMA 3H0CA 2F3QA 4JX8A 4I5IA 3ZVLA 3JQCA 4FMCF 2CL5A 2Q2VA 1P5HA 3FHJA 1CJMA 3NCHA 1YACA 3W3ZB 5KTRA 3CLSD 3VYUB 1POWA 4N5IX 1FNDA 1GPYA 4LWZA 1VC2A 3EMDA 5T4HA 5EIXA 4CE6A 2V55B 4DCNA 2EGGA 3AIIA 4Q1VA 5JI2E 3L7NA 4IM7A 4CLRB 1RHUA 3I30X 3KFXA 1XTBA 4II3A 3BWVA 4P4SB 4XFKA 2HJVA 2WD9A 2ERXA 2RB5A 3IVRA 5JFOA 1SCUA 1RQ7A 2GHQA 3H18A 2UVPB 3FNQA 1NQUA 2G40A 4XIGS 4CKWB 2X22A 4FEGA 2GKOA 4YR7A 1Z4OA 4HAYA 1A9RA 4Q37A 4BGIA 8GPBA 4JI0B 1A76A 3O95A 3LQRA 4BGEA 5IAKA 1P1FA 2PMCA 3IT1A 2DPYA 4JC5A 1P81A 1Y3CE 4WBNA 1A5SB 4Q21A 3V32A 2WYVA 1P60A 5FUVA 2J0UB 5JC8A 3EF3A 1T3SA 3L82B 3RQIA 2ZVDA 2ZWOA 2VYCA 5A4MS 3ESBA 1MJGA 1Q2UA 1CP3A 1NIJA 3P0RA 2VQEB 3FTCA 2I6UA 2WYOA 4WFKA 3HWSA 4Q4HA 3TD9A 4RPIA 2P75A 1OZHA 2Q3LA 1G7SA 4KJZA 4WLUA 1L5KA 2C5FA 2JI7A 4HP8A 1RJ9A 1E4EB 1SCJA 1QRAA 1L1EA 2VP9A 3A2LA 3C1OA 4X24A 1KIAA 3E0QA 1JVSA 1T5OA 4IICA 4OBEA 3FLAA 4WVLA 1N34B 3P0HA 3GU3A 5DCUA 3MMZA 1VL5A 3NXSA 3QJGA 1WQ3A 2EG9A 3OECA 4FU0A 3G2KA 4ZTZB 2MSWA 2Z83A 4JBXA 4NESA 1RIFA 3SVZA 1BX1A 3WK6A 2OBMA 6PFKA 2VT7A 1GTZA 1R0KA 3KVVA 4BKUA 2ZTVA 3QWIA 2ET6A 2IZ7A 2P2YA 3CVWA 5KJFA 3G5LA 5JAOA 3CG4A 3ZXSA 4ENRA 5LZ5A 5D00A 3E03A 3F5MA 1QGYA 3NBAA 3VV2A 3ZK8A 3NTQA 2REOA 2FRDA 4JUCA 4KHPB 3NHPA 2D5BA 4K6GA 4AJOA 4U8HA 3EF1A 4K87A 4OXNA 2GBLC 2XAUA 4AC9A 4DSUA 1JA9A 3FUCA 2F3RA 5DV9A 3E9RA 1N2BA 1X80A 3E7PA 1U7WA 3FGPA 3T3HA 2ZFUA 3EQ7A 1FDTA 3HN6A 4TMFA 1ZM7A 3V00A 2VLIA 1WZNA 4EB3A 1UAAA 1A9YA 5ECGC 1H66A 2P6MA 3WFJA 3ZY3A 3B3JA 4RM3A 1RRFA 4GYYA 1L7OA 3HM9A 1WZIA 3HJAA 3NVMB 3NT5A 2HDOA 5CVCA 1NAHA 1GM5A 4W7SA 3N0XA 5M04A 4S1NA 5G4KA 5CFPA 5FO0A 1YDEA 3QG5A 4B3SB 4L08A 2IPLA 3AF6A 4RJIA 3HDHA 2C78A 4TMTA 2Q2NA 1TXGA 3GEEA 3STHA 3V4ZA 1UQUA 4EL0A 3PA6A 4ISCA 3AF4A 2VYNA 2CNOA 1DUSA 2AN4A 1L4YA 1FYXA 3FMGA 4FB4A 1FYDA 4OGLA 1ZBDA 1G5FA 2FRXA 5F76A 1MMFB 2YOFA 4LECA 4XM2A 5DGXA 5ETJA 3FFXA 3FVQA 1NW5A 5HJ5A 2VJQA 1JA1A 1WQ4A 1TZCA 4OQXA 2FZCA 1THZA 2B5OA 3PFKA 2Q9AA 4Y2RA 2OPHA 4AY3A 3EW7A 4C4PA 2BY4A 2J9ZB 4CKCA 2BFEB 5CVJA 3GLTA 3WHPA 1PGJA 4ND7A 4PO3X 4S2EA 3N1UA 3IUEA 3H4VA 3T06B 3KG2A 1WV0A 2EV9A 5I51A 3AVXA 3UC5A 2GM9A 1FPMA 4MDHA 8AT1A 3THWA 4BJ5A 5TJ9A 3BK2A 3KX2A 3OEWA 3ORSA 1NVEA 2Q3MA 2YMLA 3ETJA 2X0EA 2Q5OA 1WTAA 5CEJA 1YR6A 1OB2A 2RH5A 3FNFA 4QULA 3M6VA 1N5LA 4MQEB 4GI5A 4J3JA 2A0WA 4EPVA 3KT8A 5DN9A 1ZLXA 2RHWA 3ED5A 2XB6A 2O8DB 1YS6A 2LD4A 1NLMA 1WU8A 4NKRA 1VLQA 4MTLA 3RQSA 4D9BA 5E4TA 2FN8A 3LCMA 1RYBA 4MV9A 3ZCPA 1XALA 2G9QA 3EODA 3NEPX 2H3EA 5AJHA 5AFSA 2B30A 1OLSA 4G1BA 2JJ2A 4GW3A 1SFRA 3UHPA 3WZMA 5J40A 1QRRA 4LY3A 4PX9A 5GOZA 4S1PA 3DEYX 5AK5A 2QX4A 1LSUA 2QROA 4LX0A 4QYIB 4C21A 2IYTA 4EL5A 2ZXUA 2P9TA 1R9NA 1WMDA 2DR3A 2PXAA 1DG3A 3LW7A 1T8YA 1USWA 1L5NA 3KSZO 1YJQA 2QU8A 3JATB 4LHWA 4NBVA 4Q05A 1QGUB 5KMGA 3GPLA 1TLFA 3LS2A 4J16A 2KMLA 4GDFA 3WRXC 3RBZA 3OTWA 2ZE7A 4MS4A 5ALMA 5H3CA 4BMDA 1IEWA 3ID6C 5DEOA 4CFYA 4EF6A 4PS0A 1IY2A 4UE3S 2B20A 4Q7KA 1RI3A 1WSDA 4XPIB 4IDDA 1W88B 2JFPA 4M0KA 4MARA 4N0MA 3SC2A 2L0XA 2E2WA 4OQEA 2VUIB 3I0ZA 5AXAA 2GR9A 2FYTA 1SZCA 3ZBUA 3ZGOA 2HU7A 3ZR4B 4MW0A 3IBYA 1EKXA 2OCYC 4KX5A 1LDEA 2PSDA 1IQRA 1EBUA 5JPIA 1CJUC 2ZBGA 4U7JA 2N1MA 4XVHA 3CQ9A 3V7NA 3H5WA 2H1RA 2R66A 3PQCA 2QM3A 3QWBA 5SICE 3WMFA 1L5VA 4DADA 1MW8X 4HGRA 5FTMA 4IDCA 4I6GA 2VAVA 2KJQA 3Q85A 1YQGA 3I1FA 1US8B 3M9XA 3AX6A 3A26A 1SB9A 3AVPA 1T5IA 1P39A 2BCJQ 3PXDA 4D8UA 3RU7A 1HWYA 1M2GA 1J23A 2BGTA 3M3DA 1D09A 3VC2A 4V0SA 4J0DA 2HU2A 5H68A 3VH4A 4N39A 1YZ3A 2P9JA 3TTXA 4S12A 2XB2A 4XAQA 1HDCA 1ZEJA 1ZRNA 3A3OA 1G5QA 4G5HA 1U8ZA 5P21A 1OXSC 1LTQA 1SKBA 4M9CA 5EHIA 2LCQA 4WJKB 4R2JA 3U4CA 3E5NA 1WW3A 5EP2A 2H9IA 3FYHA 4JBYA 5F9FA 5JECA 2GJ4A 5BN3B 3W5IA 1UOOA 3MWKA 1Z0ZA 3AHDA 3N8NA 1MX9A 2FFJA 3V1MA 4AQYB 3EZ7A 4ZMBA 1JAHA 2BGNA 1Y63A 2CYBA 3IUJA 3MD0A 4YMUA 3A4LA 1Y98A 3ZGZA 2REQA 1A8QA 4OXRA 3PNMA 4ITRC 2HM7A 3GCGA 2IY9A 2FLVA 3C2QA 1RWKA 5BN4B 2FLWA 2AEFA 2P3OA 2WEKA 4MXDA 3RV4A 2CLKB 2HA2A 1SXHA 2GZHA 2WA1A 3WAKA 3BBPA 2QSZA 4L5BA 5EVJA 1QSGA 2CLCX 1RRGA 2FW0A 4UBNA 2SKDA 3G89A 2PPVA 4G0UA 4LMPA 4Z0PA 3KYJB 1ISFA 5NLLA 2M6KA 2RBEA 5KHLB 3F49S 1W47A 1TECE 3DWGA 3ZY4A 4LZPA 4MQFA 1YTUA 2LDXA 4W5WA 2WWHA 2ZBEA 1AB6A 3KD3A 4LMBA 1YVRA 3M2PA 4PHHA 4I14A 3N8HA 4KSYA 1T5HX 3K8OE 4CL8A 5HE8A 1DRVA 1NR1A 2WMYA 4Y6OA 4WFJA 5KTPA 1NN0A 1ZGAA 5ECYA 1JBQA 2ZE6A 4FDAA 3FOFC 4G0PA 3PTAA 1EBFA 2XJ9A 4OUKX 3M89A 1QBGA 5DN6D 4KK4A 3NLLA 3ZS8A 3V4SA 1WDWB 3CCBA 3QELA 1ISGA 2DQSA 3CR8A 3AILA 5K3FA 4X1KB 4ISBA 1BMTA 1R0WA 1M1XB 1RLOA 1K6MA 4NE7A 4E09A 2JASA 2OWEA 3EMVA 5FLYA 3L4BC 3BFPA 4EA7A 4MKIA 1BROA 2BI4A 4YECA 3WGTA 1PAUA 2O2IA 3GLKA 5LWQA 2C20A 3MEQA 3DVRX 3NAQA 3OY7A 4CM8B 4EAAA 3NEAA 5DGIA 1JWLA 3OTGA 3SR0A 3ICQB 1JZTA 1M6NA 4IIBA 4FIZA 2P2LA 3E5RA 3M7IA 5KYXA 2IX3A 2RHMA 4YJ3B 1CYEA 3GLUA 1QOQB 4WLOA 4IPTA 5FXMA 3C3DA 4DLAA 1BEUB 4MR8A 1N0HA 2EWWA 3EA4A 1QLWA 1OVGA 3L0BA 2A1UB 3SHQA 4OAOA 3Q7QA 4IWNA 3A11A 4LZWA 4MPJA 3SDBA 1OT3A 1PJSA 1SEPA 4GWKA 4LNUB 3ZN2A 2I4MA 1OFVA 2NZXA 3E3OA 3GUCA 2IHVA 3BICA 3K3PA 5EHZA 2OBXA 3OWXA 3TSAA 4D81A 2FG5A 2WD7B 3CC8A 1V26A 3HY4A 4PSAA 4QYWA 4RA6B 3NTUA 5A5GA 2CDNA 4NK5A 4RKYA 4MMZB 3THRA 3ZXYA 3DO8A 5K6AA 5CVEA 3L02A 4P4SA 3GMDA 1WAMA 5IW8A 4F6CA 2E4AA 3KJFA 2FDRA 4DLUA 1R15A 1JQEA 5G1PA 4ZV4A 3LFHA 5MFPA 1T4BA 3N76A 1A7AA 4DWWA 3BYZA 3VJRA 2EX1A 2GYYA 4ARBA 2CXTA 4DCSA 5JLJA 2FE1A 3BD8A 3LQKA 1Z4QA 4EYQA 2Q3HA 3OWHA 4JCCA 4LOHA 3CVOA 3SHOA 1C80A 2HZ7A 1G59A 2EFCB 3WDKA 2OZKA 2D1YA 5D87A 1BIFA 4M1TA 1K5PA 2H2AA 3VR5D 3OU2A 1MNQA 4R4JA 1G7CA 4EI8A 5BT9A 1ZY2A 1L5ZA 2QUBA 3TBKA 3P9SA 1VPVA 2R62A 2XUAA 3Q1KA 4FILA 4LV6A 4D02A 5C46F 3DKPA 3U4IA 3LVRE 2QVZX 1K7FB 1QKIA 1W1IA 4B3HA 4HLCA 1C7RA 3DPUA 1WHSB 2BUBA 3MRTA 1Q83A 1DAOA 2CXOA 4CMIA 4YAKA 4X3OA 3GIWA 2C8LA 2FK7A 1MVNA 2Y1XA 3C87A 3LO5A 4N18A 1P6QA 4WZ6A 1KWKA 3PCXA 1NG1A 4B2LA 4ECAA 2UVQA 5EJ5A 1BCSA 1K9VF 2IPXA 1N1MA 4OHOA 1FUYB 2IVFA 3MVEA 1EA7A 5KPDA 3DQZA 2CEAA 1H1TA 2YQZA 3F8SA 3GT0A 3JQ9A 3U9LA 1XMVA 2XB9A 4PPYA 1A7KA 1HDOA 1OIVA 1E1QA 2Y0DA 5FA8A 4S35A 2TYSB 4HFNA 2VK8A 2ZK7A 3DLHA 1H0RA 3PNOA 5IT4A 5AIAA 5LIPA 3L79A 5DI9A 2YXBA 3BSYA 4ZEWA 5I4IA 2K5UA 2QRMA 1XVIA 1NV8A 3D0RA 2CF6A 1R6UA 2C00A 3AFGA 5HMLA 1TZ2A 1GPKA 2OSVA 5JCXA 2ZUCA 4M55A 3T1YB 4WADA 3RRJA 4E1AA 4UPDA 4LGVA 1QUFA 1E5LA 1YA8A 2GPBA 4HLNA 1N1GA 1N2EA 1V3QE 2PH1A 3ZWPA 3TX2A 4FHZA 2DYKA 3I9OA 4ON9A 1U0SY 2FPXA 1MA3A 2C3UA 4R0NA 4RSMA 3T5MA 5FPYA 2X23A 1OWLA 5HKKD 3RJ5A 3T4EA 1XSEA 3QBDA 4W9MC 4V0RA 1WR8A 3R5SA 1BWRA 2RH4A 3HUTA 3CJTA 4MYTA 3VR0A 4JXZA 2D2EA 1GAQA 2XQVA 4M3NA 3TLZA 2VJMB 1GAWA 3ITDA 4NPHA 5CFZA 2P9HA 3GAMA 1NN3A 1YL5A 4FR2A 2A5DA 2NU9B 3I4FA 3VR6H 5CDGA 2VQFB 1E9BA 1I2AA 1GDTA 1XZHA 3IXMA 2HCFA 2WJAA 3C3EA 4MX8A 4EI2A 3BRCA 5T7BA 3A6PC 4MW9A 1GNVA 2W42A 3BFKA 2HADA 2FTKE 1B6SA 2IYOA 2RJ3A 5CNKA 4A23A 3QF7A 3TG8A 1H2HA 3T12A 1HYHA 4HEQA 2AVNA 3PDIB 1J90A 4QPPA 2VYND 3C45A 4ZGGA 4KBFA 3SGLA 4LFAB 4ZYXA 4JVLA 5KSPA 2GJ9A 2Q9UA 1QH1B 3N2KA 4BO1A 5KOHA 2BFCB 2VP6A 2YJ6A 4LDQA 5CT8A 3NHYA 2E49A 2W4QA 2XZPA 1HKUA 3AUTA 3L0CA 2R6FA 1YS2X 3IDAA 2V3CC 3NHZA 5KQLA 1N6HA 3G13A 2FR0A 1E2PA 1SBCA 4D9JA 4UBLA 2RAUA 2R5NA 1FC0A 1OFIA 1XN4A 3VGJA 1FNMA 1MJNA 2NZUG 4B5KA 4L0QA 3VM6A 1K3FA 3NYRA 4WXRA 4G1FA 4OK3A 4CQMA 5ARCA 3SFTA 1RE1A 1QONA 2JI6A 1VL6A 4ZJPA 1GADO 1TO6A 4QDXA 3L49A 4B8YA 1E7SA 2QLFA 3KM0A 2E5LB 4KWTA 3HU5A 3OBIA 3VJLA 4CCYA 1GPLA 3CVYA 4I4IA 4QECA 1R2QA 1ZHFA 4CL0A 3C0KA 4EB6B 2XXJA 2IEIA 1U9IA 4EFMA 4DDTA 2RGCA 4FHDA 4YV0A 4AZVA 4XCVA 4ZVVA 2W43A 3HKEA 4HEJA 4JLNA 2JJ2D 4DLKA 1OE0A 1M8FA 3LCJA 4JBLA 1QGUA 1BN7A 4GRDA 4JMPA 3T1OA 3KKMA 2ODEA 2G08A 3H3XA 4MIEA 4ACBA 2ZUBA 1EFAA 3GRUA 1IAVA 2IF2A 3GPDG 3UKDA 1QV6A 5IBRA 3I6BA 2WU0A 3UMCA 1QNLA 1NF8A 2B99A 3EG9A 3LVBA 1E92A 3WJ2A 1U8XX 4G1VA 3WO1A 5JQWA 3ORHA 2EZ4A 1DU4A 4DT1B 1RJDA 2PVCA 1XQ1A 3CVUA 2EW2A 4OSEA 4QXOA 3AESB 4FJ2A 1M1YB 2PT9A 3ENZA 5EKDA 3RI3A 2JRLA 3W2FA 5KWVA 2DZDA 4LS3A 5F98A 2WJJA 1V8BA 2GVZC 2XB8A 3IV9A 4HEA6 4KMRA 4WBSA 3W8DA 2OUKA 1OX4B 1CP2A 2RAPA 1D6SA 1C1XA 1QXSA 1UMCB 2I2WA 2YRFA 3RASA 2ZI6A 3DEJA 4I4TF 5F5XA 1Y4DE 3KLOA 4IXDA 5LMZA 1CY0A 1TMKA 1SOVA 2C9DA 4RD4A 3EXHB 3MTAA 4RVOA 3WRYC 3BFJA 4XD7A 3WLNA 4X90A 3MJCA 2GZDA 3UJHA 2AF3C 2YZ2A 1F8GA 2W98A 4OMFG 2QS9A 1MP0A 2RKOA 1LS6A 1JQBA 3H8SA 4G8CA 1S9DA 4DMRA 2YYYA 1Q0UA 4OH7A 2NO4A 4Z2YA 5IVDA 4CKEB 4IRXA 1O0CA 3JS5A 4M1QA 2Y27A 3ZEIA 4A6DA 2VO1A 1VJGA 2W6MA 4L8WB 4NZYA 1OQAA 2Z2IA 4B32A 2AEMA 1VCNA 2JGEA 1QGZA 5JNLA 2BUCA 4BQPA 1E7RA 3ANTA 5HJ2A 2DPXA 3DTNA 1O9HA 4Q48A 5HS4A 5KWSA 2JFFA 1TYCA 1WZ2A 1J1UA 2EU8A 2OCXA 5IANA 4QAQA 2PE5A 4NG4A 2OAP1 4MYDA 4Q7JB 1U6IA 4NP6A 3DM5A 5I7OA 4L95C 2IGBA 4LSMA 2EQ5A 3EFBA 3H5LA 1C8KA 2FMTA 4AYTA 4IDAA 4AG3A 3WIBA 3WWOA 2B78A 3CB4A 1HETA 1N5MA 4CR6A 4TLAA 4Z0TA 3DLPX 1PYOA 4F4IA 3QWHA 1XZNA 3KUKA 1YRLA 4MCHA 4YRIA 1LU9A 4R68A 5JSQA 1IVSA 4G4SP 5DX0A 3UMBA 3BHMA 1CZHA 1G2PA 4LOKA 2KLBA 4Y1EA 3UPDA 3I39X 5DXAA 5BUCA 3TFOA 2O8VA 3DYIA 2YFHA 1G20B 1QX4A 3D6FA 2FLKA 4TZTA 1BN6A 3OZVA 5DNUA 3OFSA 5KNDH 3BWEA 4DLRA 3RAEC 4HR7A 4AKGA 5DHRA 5K4GA 4Q4CA 3HR7A 4R5HA 3DPIA 3UZUA 3CX7A 4BZPA 4LRSB 3SSMA 4OJNA 5LP6C 1X1AA 4FFWA 5C81A 4X45A 4YRNA 1V25A 3I92A 1HLFA 3FMFA 4PICA 2NNLD 3ETDA 4U6QA 3TXYA 4ILKA 1ISHA 1GY8A 3AJ8A 4EMBA 4HFMA 4EJSB 3NXKA 3TQHA 4M98A 4JP1A 2ODAA 5FDFA 4HTAA 3CLUD 3LRXA 3KXLA 2OD7A 4NLLA 5T4FA 2X6QA 1S3FA 1XB2A 4LJLA 3ZDRA 3TW0A 3B9BA 4M0DA 2C5BA 1PIWA 3A9CA 3HR8A 2DFPA 4CEIA 3OX1A 4ZOCA 3LSYA 1CUIA 1TU4A 2C96A 1DTWA 1JDSA 3LP6A 4F1JA 3UWOA 2E6UX 3VX3A 2V4UA 3IA7A 2DLCX 1W8DA 2OC4A 4PR0A 4YX9A 4I50B 3WQRA 1UBLS 5BN1A 4FXPA 1QIKA 3RSZA 3P9PA 3OKCA 1U2TA 2D3WA 1JXAA 3CLHA 3DL2A 3S55A 3LKBA 4XQEA 2JLYA 4PXYA 4EKNB 3AIMA 5C34B 3U3JA 2I0FA 5J1TB 1PI3A 3N6RA 4IZHA 3CLKA 3HUFA 4MKZA 3E9YA 2OQRA 4ZK6A 4MWOA 5IJZA 4DV2B 1SQ0A 1NBEA 1KZGB 3BSSA 2YHUA 1V8DA 2XEDA 5DSTA 5HKLA 2WHPA 4JLKA 4TWRA 1X77A 1YC2A 5BRAA 3ZK7A 4FZ5A 1I6MA 4EFDA 2WJIA 2HQBA 1PUIA 4CG2A 1FNNA 3E22A 4L15A 2PMEA 3RVLA 5FBWB 3VA7A 1Z26A 4EMTA 5ADVA 1YFKA 1YS1X 4FSHA 4C4ZA 3DDCA 4CQNA 3FYSA 1UBFA 3GAFA 1A8HA 2I9PA 2VR1A 3V46A 1KP3A 2YJ5A 3HMQA 3QY9A 1F5SA 3GRPA 4E70A 4NMLA 1ZS9A 3QH4A 1UINA 5HEKA 4BVJA 4RUKA 4MCIA 4DQUA 3KT6A 2B82A 3IBTA 1CUYA 3LL4A 4V0OA 2FPIB 2VPYA 1YO6A 1EE2A 3IT2A 4K26A 4Q4DA 4XWKA 3F8WA 3KU1A 3MCAA 4ZOLA 3DLAA 5DHPA 1O0SA 3IEIA 4HAZA 1I7LA 1FMTA 3VZPA 1BO6A 2Q0XA 4R71A 3E6AA 2Q5FA 4P58A 5A04A 1L5MA 3V8MA 5IJ0B 2I4RA 3CU5A 5IWCA 1W2WB 4FUTA 3DBHB 5DBIA 5L7YA 2V59A 2XBMA 2VHVA 1KMHB 1IEXA 4TS3A 1CS0B 5L3QB 5BV2P 1RJGA 2EFJA 2QD1A 4NG5A 4XDYA 4BL5A 1IBRA 1J0CA 2QTCA 4MQ4A 4NV0A 1QIEA 2V45A 3MTQA 3RLFA 3EZNA 1TJ4A 2DBVO 2PT6A 3AIKA 3K09C 2X3FA 3TN7A 3TTTA 2PMFA 4P0TA 5CHYA 1PZFA 2REXB 3FYUA 4AN1A 2FFBA 1NKTA 4ZP1A 1AKYA 1GKIA 2MSDB 4YJDA 5G3ZA 2JFUA 5KVQA 4ER6A 5LQCA 3O4JA 2FEXA 3E1KA 1TU0A 1XJ5A 2XH8A 4NYMR 2RB4A 4FE3A 3H19A 4RD0A 3A37A 5LBTA 1EFVB 1UK6A 5HUJA 1QTIA 3U4GA 4UTNA 2OZEA 1CWUA 1IUNA 3JQBC 1E1QD 4ESEA 2C8KA 5HQJA 1EM8B 1K92A 3DUFB 5DCWA 5E7MA 2D0PB 4RADA 2RD2A 2B6HA 2XD4A 1MO5A 5CLFA 2XY4A 2XUPA 4ZAWA 1QDUA 3KCQA 5E9WA 3W4JA 1J06A 1RQXA 3K9BA 4A0HA 4DNXA 5DU2A 5CT4A 3PC8C 4I9NA 3RIEA 1QV9A 1GSHA 3MIIA 4HGZA 1QP8A 2HEGA 5LXTB 1TYZA 6Q21A 5COBA 2V97A 7ABPA 2QZSA 5A9SA 4U0KA 4KITB 2R6CA 4D0SA 1B42A 2Z5VA 3AM3A 3ZKAA 1A8UA 1CK4A 2VQSA 4HO1X 1MGOA 1C0PA 2DRIA 2YJZA 4K2AA 4D8XA 1IAQA 1TB4A 2JC3A 4Q6WA 1FW8A 3GBSA 2GAAA 2CGEA 3AF3A 3FPBA 4MPRA 3QEAZ 2VDLB 4RXTA 1IZZA 1QE3A 1XZFA 2PFGA 4KTTE 1N75A 1Z5ZA 2LCIA 3L92A 3MMNA 5FPQA 5H82A 4DSAA 4K6KA 3A1WA 4IKEA 4LOJA 1C5KA 2J32A 1G2QA 3FNIA 3SY8A 4Z7OB 3NUZA 1ZMXA 3FHTA 3QMMA 1CZRA 3ZQ6A 1LWNA 1Z34A 3TE6A 1X70A 3U3MA 4EW6A 4KV7A 1Q0PA 3F9CA 1G8MA 1PGQA 3A27A 4PLPA 2OKCA 2WP8J 3GLHB 5E7JA 3UH1A 1H6DA 4OV6B 4C7XA 1QUEA 2HV8A 4GI2A 2MDTA 2AOTB 3K96A 5LQAA 3HTXA 3K0EA 5AOVA 1NQVA 1OJ7A 1MC8A 3P9KA 4JNKA 5K0SA 1G7RA 2P2CA 1TEZA 1QDLB 5FV4A 4Y2XA 2OXEA 2GWHA 1JIUA 5F73A 2IEGA 4EVQA 4LDPA 4D82A 5F2NA 2VDPB 1UJCA 1FJXA 3QTTA 1O5TA 3IAEA 5M29A 4LFBB 1EJ2A 2W9XA 2QMQA 3BVPA 4L9WA 1ORIA 5TNXA 4F92B 3L07A 3LCVB 4LE2A 1WU7A 3E3LA 3U3XA 1JMVA 4YJFB 2OGWA 1T13A 3JQFC 1ETUA 2BMFA 3VZQA 4BJ1A 2H0AA 3HKBA 4OKNA 3IHTA 1G3UA 2P91A 1E60A 3IP9A 5CEEA 4O1IA 1XZQA 4LQLA 1PUXA 3VNSA 3ZU4A 1AMNA 2Q50A 4LF5B 1Z4PX 3QFFA 4IS2A 1C8LA 4UBIA 5DWDA 5JD3A 3RSQA 4FIDA 4M9ZA 3GB9A 5FO1A 1C3EA 1G38A 1NVVQ 1ZJJA 4ND2A 4MV6A 4US0R 3PHGA 4GMFA 3TZ6A 4E4RA 1Y37A 3W2IA 5JZMA 5ICSA 4G4SO 1V1RB 4LISA 2O5CA 1X1SA 2XMSA 4E4TA 3QYFA 3UBTA 2I3GA 1EVEA 1RLTA 1S7GA 4I55F 4OUDA 3ZH2A 5B64A 4RULA 3EEOA 4L51A 3OZ7A 2I03A 2BBTA 4YQEA 3Q1LA 1M1YA 1WBJB 3H05A 4RDCA 2V6BA 1J25A 4KI7A 2H17A 4WDQA 4N03A 4E5NA 3QV1A 4IH4A 1KMIY 4R54A 1QH0A 3ENNA 1E8NA 3EDCA 2BMDA 4N82A 5D3KA 3PLAE 3K8QA 5AUQA 2IWRA 3D4PA 3D6UA 1BXGB 2PGIA 4OLBA 1E8MA 4L3OA 3U17A 5FQNA 2XI4A 3BQNB 1FLNA 1IY9A 1DO2A 1NXTA 3EX7C 3RIHA 4HDQB 2NVWA 2JARA 1QORA 5THXA 3LQ1A 1IBCA 3HNPA 4ND4A 3D6MA 4MUNA 2MMCA 4I5EA 3MXTA 2CXSA 4HN9A 5AYVA 4AN0A 3A1VA 5DM60 3JVIA 5CFMA 1YQDA 2DUMA 1LSSA 3CIFA 1Z18A 2O7NA 5JZSA 5DK4A 4X5OA 1D5CA 5ECDA 4NCNA 1RRPA 2AMFA 3Q3IA 3WIOA 3HY3A 3OQMA 5IHPA 1PW7A 1Z28A 3PFIA 1QTQA 2HF9A 2HLPA 2Q1XA 3SOPA 3I52A 4LRXA 4JYZA 1TZKA 1Q16A 4OP3A 1Q7GA 2OMKA 4WD3A 4DJAA 2JGLA 1T4MA 2C99A 1XDZA 4WACA 4OYYA 3DKIA 1TUIA 1GCOA 1QZ3A 1MAAA 3EAQA 4J90A 1F8FA 1NRXA 1SVIA 2C2GA 2RBKA 1X13A 4QUIA 1YB2A 3COWA 3B9RA 3LLVA 1N5IA 1T1IA 2C8VA 4C6RA 3T99A 2Q4DA 4JP2A 4QTYA 2ASVA 2KHZA 1HQCA 4IFEA 2OXTA 4KVZA 2CE7A 3BJZA 2VP5A 1TT5B 1YJ8A 3Q7SA 4CFSA 3QTLA 4MZDA 2E48A 1Y48E 4NZNA 3NANA 1WRBA 3AKEA 2YWFA 1YQTA 4DCVA 1RPNA 5IMSA 3TQOA 4EUEA 1F12A 1WUJS 1V7CA 2PX6A 4G1UC 1X1DA 2H4YA 2ODWA 2VF8A 3AFIA 4TLMB 2A67A 3ROMA 7REQA 1C7IA 3AI1A 4UVEA 2G9VA 3CISA 1F9AA 3LPLA 1AK1A 1KPHA 4E2WA 4UHJA 4WY5A 1D4FA 2AD1A 3M6LA 1LBHA 4J0CA 2IL1A 1UWKA 5EUMA 3D0OA 3UAZA 3ET4A 1P3Y1 2NSYA 5AM5A 5K6TA 3EIUA 1Z5OA 2WVGA 1G4UR 2ZIAA 5IM5A 4P7FA 3HCCA 2Z4TA 2G76A 3DE4X 4FLMA 5F21A 3BMNB 1LX6A 4TLCA 4BX8A 2F00A 4PZUA 5K03A 4HVCA 3DEZA 1D2AA 1II8B 1POXA 1OGIA 3HVUA 1EUDA 1ZMOA 2QN3A 4PAWA 3KUDA 4ZVOA 1IBLB 3O6VA 1UPCA 1WVIA 2W0MA 4CU5A 1N5DA 1QZTA 2LP4Y 4HK4A 3TGPA 3SBDA 4QGSA 1JQ5A 3Q9NA 1CZNA 3TLAA 1WB4A 2LUOA 4BLUA 1FTNA 1KZ7B 2NZ2A 2JH9A 4H7PA 4WKCA 2QMUA 5CLGA 4C01A 4D74A 4DDWA 5LLTA 4LXQA 1NW3A 1HFJA 1TJYA 3R7BA 1CR4A 3ESXA 1V11B 3I12A 4I46A 3AQ4A 1C3JA 2VF5X 2IXGA 3CX8A 1TTPB 2RI0A 3L9XA 3NJ8A 3PTZA 4H27A 5DP1A 1U2PA 3K30A 1X39A 4N3CA 3PIRA 1F8YA 4H7KA 5AVUA 4GBMA 3GXBA 4IO0A 4KJXA 4TXMA 5JVDB 1Q50A 2RGYA 3F96A 2I6FA 4BP9A 4LY9A 1DIRA 3U1TA 1RVV1 3N8DA 4Q4JB 4YMVA 2C7RA 4MULA 1KSJA 1XK6A 2EARA 4GGMX 4PC3A 3ROTA 3T9AA 2B4YA 4Z1MD 2WG0A 3QX7A 2AUMA 3HE3A 4EPRA 3JD4A 2DGDA 5JMOA 4C6TB 4CMHA 2FWBA 2O3JA 2VWPA 3RRNA 2F90A 3T3MB 3SYMA 3AFMA 3D4NA 4JSTA 5H83A 1RFGE 3COVA 1N5OX 2QMOA 3C1TA 3DTYA 1JFTA 7GPBA 4MUIA 2IZ1A 5EUCA 4FGJA 4KO4S 4ALNA 3N2LA 3H7IA 3F9RA 3OHSX 4PRLA 1BTOA 1OZ0A 2ZAIA 2ZI3A 2ZBPA 4JHLA 3IX7A 1C50A 3IJEB 4H2DA 4ARZA 3IC5A 3B1VA 2XQIA 2EOAA 3N07A 4EUKA 2C3PA 3AXSA 5BV7A 4PSUA 2ERCA 1L7DA 4M1SA 2LNDA 2BF4A 1YCGA 5TF0A 4IP0A 2CNWA 4UVGA 1M1YE 4O8CA 4KQEA 3OD1A 4WZZA 4H1WA 1T6YA 4PCVA 2O6LA 1EIZA 3FH0A 5ELLA 3UK0A 1A4RA 3A58B 1TQ2A 1BA3A 1N7JA 4UMFA 2NT3A 3EOAI 5ESDA 1RLUA 1WPRA 4FE7A 1T36B 5E7IA 1TKAA 1AU9A 2HXYA 3MFYA 3SE7A 4FQ8A 1FSFA 4F0JA 1SQ6A 1VP3A 5KPJA 2NMVA 1UK7A 2XMPA 3IHLA 2F2TA 3G2QA 2YY5A 1XOIA 4FS8A 2A9PA 4QU9A 4MMXB 1EX9A 1F06A 2J87A 1IHPA 3EYWA 1CVIA 1S2OA 5EP1A 3TRHA 4OF4A 1AG9A 1NWHA 1ADJA 4L22A 3GC6A 1AGRA 2DU8A 3RJMA 4E7OA 3K5PA 3VC1A 1YHZA 2TMKA 2ZJ5A 3DNPA 3AB7A 3ZGNA 1FVXA 3GJ0A 3UEOA 2DHCA 4LI0A 4QOEA 5DISB 4BP1A 4MGHA 2Y0EA 2CF5A 1VKOA 2WQZA 3UQZA 1ADCA 1X1CA 4L9AA 1IVNA 3OSZA 4L28A 2QTRA 4JI7B 2G4CA 1ELOA 3S1LA 4J6FA 1EDZA 4XWWA 5ALJA 4GE0A 4Y1RA 3LUGA 5EUQB 5FUBA 4YGYA 3MUFA 3EQ2A 4PLGA 4LVUA 3WKBA 2W00A 4I1OA 1DDGA 5CH8A 3WI7A 2VF4X 2GWRA 1R8JA 3C3MA 3WADA 4PYJA 3GEGA 1XRMA 1XRNA 2XOXA 1RWQA 1XZKA 2WNHA 3MAJA 3QLVC 3OPYI 2KYRA 3EG5A 4YV1A 2HJHA 4MR9A 2O2JA 3LT4A 1ZNQO 2WICA 3M6UA 2J4DA 2MIIA 1G20E 4FFPA 4IV8A 3ZG6A 4BOYA 3FPHA 4DBLC 1SZDA 1FFXB 2LRHA 2XQJA 3B3QA 1KJNA 4FZRA 4I99A 1BGVA 3INRA 1W5FA 3D31A 4EFKA 2V7BA 5CTAA 2GM4A 4QFBA 5AKIA 2AG5A 4WK6A 2CVHA 3BWMA 1NSYA 2Y9PB 4P4LA 1PG0A 4BAZA 1X2BA 4HSEA 4LX8A 3PVCA 3V8EA 2WJ3A 1PT5A 1BKSB 3U7FB 1X7ZB 3C15C 3D2BA 3T1TA 1O2DA 4IJUA 1L5WA 4I2NA 1U1FA 3T0FA 4TV9A 1FCJA 3E35A 4FMDF 4E5SA 2A84A 2YS7A 9GPBA 2PAAA 3ZZMA 1U5BB 2FX2A 3LLUA 4DAOA 4U02A 3IAAA 1PHPA 3MJ4A 3D4BA 1ZINA 1FTYA 3RV3A 1Q77A 4QFDA 3LBNA 3NYIA 3Q7IA 4QL3A 5FBQB 3TAHA 6REQB 1ZJ5A 4O4HF 4DLBA 4QARA 1TDJA 4IDFA 1HT1E 4C9BA 1D9ZA 1ZD2P 1M2HA 1E4VA 5B5SA 4EECA 3UJDA 2QZ4A 2JGNA 4GO1A 1C3XA 3N3AC 5FA6A 4F56A 2GVNA 5BXYA 1VBFA 2ZRAA 3F9IA 2O4UX 1DZ3A 2EJVA 3LHKA 4OLJA 3UMSA 4BMNA 1PCXA 1VKJA 3T9BA 2OL4A 3BL6A 4PLWA 1OREA 4ZEMA 1DC5A 1KNXA 3QV2A 4YTEA 1KHHA 1PL7A 1JBEA 2I71A 3GDHA 2VK1A 4OB7A 1I30A 1WXDA 2Q4BA 4ABYA 3OF2A 1JJBA 1SRQA 2IX9A 3W8EA 1JEYB 3T5CA 3OIUA 1KK2A 4WCFA 5M3BA 2GK4A 3MINB 3GQBB 4NMXB 2W0SA 1GG5A 1RR6A 2E4YA 3VOTA 3JASB 1F7VA 2IZOA 5K0NA 1KR5A 1FRNA 4ZAYA 2PLRA 3OJEA 5KVAA 1QPZA 4G0VA 4RFSB 1M10A 1T2NA 1WMAA 2H3HA 4Y7DA 2DC1A 3LBFA 1M2JA 1I94B 2VDVE 1G291 3D43A 3LQQA 2J0VA 1RHQA 1ZCAA 5JAQA 1YZYA 2FCRA 4BVLA 5B1IA 3NVKI 2AFHB 1PDVA 5CD9A 1KHTA 3B7WA 2HF7A 1RC1A 4F60A 2YY6A 3OZBA 5B58T 2R6HA 5I7UA 3BWCA 4FYVA 3EH1A 1GOTA 2HY7A 3CSSA 3EWAA 3PHBE 1VB5A 1R0YA 2GHIA 5DYIA 1ACMA 1XXLA 3ETCA 4N7RA 4RE6A 1GITA 3L0DA 4NBTA 2NV2B 3P26A 2EVWX 3SQNA 2JATA 3G0DA 1R6AA 2B94A 2OBYA 2VJOA 2ID7A 4KV9A 1D4AA 1PNTA 3C8MA 2FDXA 2IIBA 4QBFA 4TMYA 4AMYA 4MVJE 4DV7B 2DCMA 4AW9A 1OGYA 1B1CA 3VPCA 3G0GA 3BGIA 2VPWA 3DJFA 5KYNA 3GH1A 3HQ4O 3MHPA 1L6RA 2BEVA 2FFRA 5L3SA 5THKA 1U7OA 1ECLA 2QAIA 2WMDA 3OLVA 2VVTA 4YVFA 3VBCA 1DPFA 3OM8A 3TR5A 2FWNA 3DZFA 2RGXA 2D2VA 1PSDA 2P9BA 3WWYA 1P1KA 4EG1A 3ZDCA 2V9ZA 3C6ZA 4NQZA 1XRPA 3VR4H 3WJAA 2WNSA 4F06A 3KQYA 3QPCA 2BWJA 5GJBA 2F62A 1CR6A 4UU7A 3KJZA 2IV3A 1MGPA 2ONYA 2OFWA 1M54A 4M1MA 4UEKA 1N25A 3K8YA 2ZRFA 1L4FA 1YS9A 3U3RA 1FS5A 3QX9A 5TEWA 5FEUA 3PEYA 1D07A 2F1JA 2RGUA 2QBYB 4AUMA 1F2UA 5FYDA 1N0WA 1QYXA 2C1EA 5FTJA 3MJHA 2OC9A 3OQBA 2OM6A 2Z58A 5HWSA 3E9EA 2P3QA 3N9IA 4DIKA 1RXVA 3IRVA 1P4JA 3SS9X 1KZYC 4L9RA 3TKLA 1U3CA 1M73E 2GA8A 1FTWA 1PDOA 2C29D 3M70A 5E6SA 3DV0B 1OBHA 1EX6A 3QEKA 4ZGBA 4S1TA 3UWDA 5CP8A 3C5WP 4W9NA 3MS2A 1QIHA 1RADA 3T9FA 1KIFA 2AFRA 2NADA 3T15A 4KXYA 2HIMA 2EKDA 1DMRA 5JRZA 2CMGA 2RHCA 2Y67A 2ZR9A 4IBOA 2NTVA 1B8VA 1B0UA 4KAJA 3UAVA 2AJBA 3BDIA 3PT5A 4IIHA 3S29A 1E2GA 2NTNA 3PRKE 1JNYA 5AKEA 1UT8A 3A2NA 1SR8A 4BKPA 2Q2OA 2ODBA 4RYDA 1XTTA 4UHHA 4G2TA 1O94A 1QFZA 2QAGC 1LFAA 1EG2A 3ADKA 3DHYA 3LP8A 4HEHA 3I9KA 3GLHE 1YR1A 3ESAA 1ABEA 3I76A 1ISPA 4YO7A 4RDXA 4ZQEA 1FOEB 2ZSJA 1OR8A 1J49A 4XWTA 2ZULA 1KEPA 2AG1A 1S2IA 3BJEA 2QG4A 4JI2B 1K3TA 1WW8A 4O08A 1FP1D 2GT1A 3U0VA 2OV2A 4PEVA 4DY6A 1TEHA 1L8XA 5HBRA 2JFVA 4JGGA 3I04M 1X6VA 1U02A 2V6IA 4L75A 4ITUA 2X2PA 1Q6ZA 4OHUA 1OYYA 3G9XA 1WXHA 2WTAA 4UJ5A 1JDBC 1ZIOA 1HG0A 4QUJA 1AKVA 3KLBA 1Z4JA 2EBUA 2J4FA 5CYPA 2XE7A 3W3AA 2I6SA 5DGHA 3T4PA 2QTVB 4COKA 5ALGA 3WOHA 4PFJA 1V39A 5FULA 4D57A 3H16A 3VGPA 3K0AB 1C1DB 3PQ4A 1XPRA 4LDAA 4L72A 3E05A 5EGSA 1PJRA 5CK4A 1KVTA 1JN0A 2I4NA 2VOJA 1MX1A 1GGKA 5L9AA 2CSUA 2YV5A 3U4MA 3DHEA 1KYVA 4WOCA 1QVZA 1WD5A 1QYIA 2R7LA 3P2IA 4HWGA 3K4QA 5I7FA 2VRCA 3Q6NA 4QYSA 3VX4A 4O4IB 4F9FA 3W4IA 4NEQA 1JR3E 3O8RA 1BHSA 2Y77A 4JN6B 4EMSA 5TQ0A 2XQGA 2P3LA 4K6CA 4ZJZA 2VHYA 4N12A 4GS5A 2IXFA 2CMDA 1J6UA 4GMDA 1PFVA 4ZCRA 4QHSA 5HDQA 2IKQA 4WXYB 1NRJB 2DMRA 3ZIDA 4IIJA 1I5OA 1H9CA 1VOTA 5BYBA 2D5AA 3H4MA 3NHAA 4BNKA 1XMSA 1FX1A 3ZX4A 1DXQA 3GLSA 2R5WA 3EGXA 1OD6A 4EEXA 4R1QA 1IJBA 1XQXA 2R8RA 3OIFA 3A0RB 1ZI9A 5C51B 4ADSG 4O3FA 5D01A 2CNWD 4DAEA 2XUFA 1EESA 2EJWA 3M6IA 4DNOA 1ESEA 3IO5A 4AM8A 4Q3NA 5D6OA 1SHTX 3NKVA 4S05A 4ARCA 1UKCA 1WMEA 1KARA 2J9FA 1P45A 1TJ5A 2Z95A 2ZRHA 3NKLA 3PUVA 4W82A 1E2JA 1S0UA 3TFQA 2OCKA 2FP4B 4JU8A 4QQ8A 4V0ME 3PICA 5B1DA 3MWGA 3S28A 3GP3A 4XVCA 2XITA 5LZ7A 3KEGA 5CDUA 3A7DA 1VSQA 3P52A 3UWMA 3NBUA 2E4XA 3DC2A 3AUJB 4L3VA 5BNWA 1KSHA 2XVYA 1SPBS 1DQNA 2ACWA 4RTPA 2F3PA 2FJ0A 2CB0A 3MNFA 3T52A 3IPYA 4UATA 1K6XA 5TJHA 1N6PA 4WK2B 4YQFA 3QVVA 5ER6A 4D3ZA 4Y2SA 2GYWA 1RD4A 1WVGA 4I4CA 4K40A 3SYLA 2DWPA 3BXZA 3RAJA 1NUTA 1ZN2A 2Q6TA 3PNKA 4UC0A 2QQGA 1X92A 5CFOA 5K0CA 3C24A 3NB0A 2FA9A 3OEED 1VDZA 1XMXA 4DCMA 2PRSA 4CJXA 2I6TA 3H9BA 5B6IA 3DB2A 1UPAA 2NO0A 4DR5B 2FSVA 3COPA 4UM7A 4ZK2A 4C7MA 4PHCA 2CCGA 2AA3A 1WEKA 4Q3LA 4TMXA 3ZD8A 1V2GA 3A6ZA 2Z1NA 4WNCA 1EINA 2C0PA 1DCKA 1FDSA 1GQRA 1JIQA 1WUIS 2GCOA 1JAIA 2IELA 3EH2A 3FF1A 3OOWA 3P9QA 3SDZA 2JAUA 5A5DA 3L8EA 6GPBA 1ZD1A 4KQXA 4QVGA 3QFTA 2JFBA 4LE1A 1FFXA 2I2BA 4GECA 4YASA 3D6VA 3BCRA 1E96A 4IGIA 1IXYA 1Q57A 3DYBA 1I51A 4QHYA 1LJ8A 1LNZA 5ISMA 1DAIA 2GN0A 1JV2B 1T9CA 2Z2XA 1R4MA 4FX5A 3QVMA 4MLCA 4OHRA 3V48A 1IN7A 1DFIA 2H2GA 2Q0HA 1EJBA 2ARKA 3NBMA 4MIOA 3VPHA 4EVSA 5E6RA 5LP6B 3ANNA 1RAEA 1XDSA 1M0EA 4JOSA 3V4PB 1NQWA 5F9HA 3CF2A 4F8JA 2PA0A 2R1VA 3G88A 3VU0A 3UT6A 1Z73A 3S68A 4I4LA 2DR0A 3OJOA 4QWMA 1U5BA 3C6QA 4REOA 5E2AA 4DB2A 2RFLA 3QYPA 1ZGBA 3SHWA 3OT1B 5CW2A 4S2UA 1RPTA 3NHKA 6REQA 3KZOA 4EGSA 1EWRA 1FFBA 1PZHA 2PH7A 1SELA 3OQJA 4GPIB 2H08A 2II6A 4H18A 1F3LA 5GONB 2R4TA 1FDOA 1Y80A 2ZREA 3O21A 1ZGCA 2G06A 2PFSA 2XDQA 3BREA 5I48A 1S1MA 3KJHA 3MZ0A 4WFIA 1CRQA 3CSUA 2BFNA 3B52X 2NM0A 1GO2A 4Q1FA 2K2WA 4FBLA 3NWBA 2EKPA 2ORIA 4AJLA 2KBFA 2BIFA 2KX7A 3OTHA 4HNHA 4D3SA 3FB1A 4PN3A 3TZQA 2H16A 3LDHA 3KBOA 4WZBB 1ORDA 2ZUUA 5KTNA 3T4UA 3HPRA 5JSYA 3PX3A 4ENQA 1J1ZA 1G8AA 4N0QA 2JIPA 1YFJA 3ABSB 1LPAB 4CEJB 5L7WA 4HXGA 1KRWA 2OOKA 2ZCVA 2FZKA 1Z13A 2XX3A 1BGWA 2A0KA 3DZGA 3N5CA 3DMPA 3NHJA 3L8HA 4Y18A 5AVXA 2HSGA 3D6JA 2WPNA 2O48X 5A4JA 5IYZA 4BBJA 2AUNA 2B35A 3DLCA 3TWOA 1W9MA 2QRKA 1JR3D 5DLPA 1B73A 3RRZA 1MV5A 1N3YA 2A3RA 2WRZA 2XGGA 3QZUA 4B7CA 2O2SA 2UAGA 1D0IA 2A0YA 4KGZA 2X0DA 3DAGA 5DM0A 3SIXA 4K8RB 2O8EB 3PDJA 3FKSA 1HGXA 3DFZA 5DW3A 3VDXA 1NJ1A 2GNAA 3CVJA 4KLNA 5DP2A 2PKWA 5KQSA 2QE7A 2QUIA 3N0RA 4M83A 4EY5A 3A6DA 2VOEA 1W48A 1A88A 3RG2A 3WWZA 1TJNA 4RK7A 1KDRA 1XTZA 2H52A 3KVYA 4RQAA 1PP4A 2PWBA 3W4KA 1OV6A 2CFRA 3HVRA 3W6OA 3T35A 3LM8A 1V5FA 2RHOA 2VHXA 3FI0A 4FGLA 4FK8A 4IGKA 1RXEA 4UXHA 2O0LA 4B6GA 3ZLVA 3F47A 3OZAA 1GN8A 4ARVA 4O2LA 1W19A 3E53A 3W6NA 4AP9A 4R8RA 2IQ5A 3WOVA 4DV4B 1PJTA 3BHNA 1H3NA 1WKCA 4CUJA 4FN5A 5DWVA 3IR5A 4PBTA 1JHYA 1BW9B 3RSGA 2WMNB 4D9CA 1WCV1 4BFSA 4MJLA 4ZYZA 4BB0A 1K0FA 1Z2OX 5AVTA 3T7SA 3ROFA 3KEOA 4HLUC 3V6MA 1GG8A 3LBAA 3HH8A 3KE8A 4AMGA 5HDBB 2J5XA 3BRWD 4UFOA 4BMYA 3C8ZA 4K0RA 4ZCLA 1VPTA 3K0CC 4JZYA 5EJEA 4OHXA 4JROA 1L4GA 1T25A 3D7RA 1N33B 2ZOSA 4GGOA 5EESA 4Y2GA 1ABFA 2P0EA 2ZB2A 2IS4A 2PO5A 2G63A 3JQGA 3UM9A 1ZVJA 1V9LA 3RKUA 5J43A 3ZHSA 4UM5A 2QIPA 4WTOA 1YL6A 3S0JA 3F3YA 5REQA 2V1XA 4B34A 5EFOA 2P4EA 3LUCA 4CHTA 1OAOA 2R8ZA 3IJRA 4OHVA 5FTLA 1OH7A 1KY4A 3AG6A 5DIZA 2F1RA 2W37A 4QBTA 2GCNA 3T5BA 4LOLA 3UJ3X 1UFQA 3TGWA 1G6HA 1PU2A 4RSHA 4XQ0A 4Y2PA 3DCNA 4P3YA 3M5CA 4AF7A 3RFTA 1P62B 1WB6A 2VP3A 3HO6A 4YRTA 1V9SA 1A9PA 4MQBA 2F1HA 1MOZA 1C3VA 2V7VA 4QSMA 4HRYA 1Y81A 3BTVA 4XB6B 4YGXB 5FADA 3RUFA 3RVMA 3KETA 1Y6GA 1BAPA 3IDOA 2BFBA 2DH6A 4JELA 3IJPA 2X8JA 4DQXA 4PIPA 1ESNA 4RA9B 2JK0A 2V3WA 1TA4A 1U4SA 1EE1A 4RAQA 1B23P 4LE0A 3BIOA 3L7CA 3OVMA 2Z5GA 1SB8A 1JW9B 5EIOA 2WJPA 4CLHA 3WDSA 1FMFA 3UJCA 3G0IA 4ZYTA 1ESDA 4DCOA 4CV0A 4PZPA 1NMEA 3QVWA 3EGDB 1NJFA 4BHTA 4RZ3A 3QPBA 4X20B 4XM0A 1RYZA 4W5QA 2XCOA 2VRWA 1V41E 2FW9A 1OX6A 1QMGA 3KSUA 4FOPA 4IYRA 4ZOLF 5ANRB 1AQNA 5P8WA 1DQRA 1FTGA 3QYAA 5FWXB 1YZTA 3FR7A 1P5ZB 5BWOA 3ZVNA 1N0UA 2Q5JA 1DPGA 2X0RA 3NHMA 5DNEA 2RAVA 1LF5A 2P41A 3PI6A 1UAGA 4LRTB 1UJ5A 3ZKWA 4F9TA 3QE0A 1ETHA 1UXJA 1H4SA 4EY8A 3U7GA 2R96A 4QBKA 4A8JC 1Z5VA 4G1MB 3U7EB 5HSGA 2HRRA 3PX7A 5CDFE 5F1PA 3QLTA 4GIBA 4JMLA 3IAM1 1AUVA 3W3AD 4OJYA 4V0QA 1IHYA 4PIVA 1DKNA 2R1ZA 3CX4A 2INGX 3ASVA 1Q19A 4RO0A 4UM9B 3UUFA 1G19A 3SJZA 4IFIA 4KYUA 3AV3A 1KJZA 3DA8A 5EJAA 3RYFB 5TGDA 3I6YA 4UQPA 2B8WA 1XJ0A 2EFEB 4UDOA 2FG7C 3DVLA 1CX9B 2AR0A 2JFHA 2A3NA 3E3AA 3PUXA 1P74A 4FFOA 3UB4A 5IZCC 5H3HA 3OKAA 3U37A 3B3AA 3I34X 1GVHA 1U2GC 1WD7A 2AFHE 4BUZA 4DMUB 7AT1A 4PCLA 1CJCA 3LF2A 3PLRA 3P5SA 4UD6A 1HTTA 3CZRA 4FGWA 1QVWA 2EKZA 3EK2A 3KPUA 2L17A 4MAAA 3ZLBA 3L6BA 2XWJI 2F4NA 1F4VA 1R18A 1UBMS 5F52A 4L74A 2WYUA 5LM3A 1RRVA 2EFGA 1XC7A 3SICE 2DFNA 2IEAA 2V7WA 2YWRA 2ZAYA 1J8FA 1FE8A 3ROEA 3D3NA 3SBOA 4ENTA 1E2NA 3NAMA 2R6DA 3ICWA 1EXWA 3LG2A 1SC4A 4KN5A 4MYHA 1ISIA 3HL4A 3VAAA 1NNEA 4A8PA 5JJIA 1CQIA 5A3RA 4U7TB 4KC0A 3SJCA 1P7WA 3DAPA 3K1YA 2ZDQA 4HV4A 3QWFA 3AOEA 5BWMA 3EOZA 4RACA 2PO7A 3OJCA 1LBSA 2Q3DA 5CU7A 3LCRA 4KN8A 3DCIA 1JUDA 3I01M 1H94A 1K86A 3ORRA 3RD5A 2DUJA 4RV9A 3UJ7A 3O94A 3UICA 1ODFA 4RPGA 4YIKA 2RI1A 3GFPA 3ZTTA 1WOYA 5LFAA 5HXAA 2GZMA 5MN5A 4MCAA 2BJVA 1P0IA 3IO3A 4RBNA 5IC6A 2O0KA 5AK3A 2EX0A 5LYJA 3ZE9A 1BDJA 1NP3A 1VE1A 3NRCA 5FTNA 4AK9A 5LUAA 4BFCA 4KFCA 4IQ8A 1JQLB 2G67A 1FB5A 1X94A 3DVSX 3H4IA 1HLDA 3CNHA 3VU9B 4CTJA 5C7YA 4C1NA 4QUDA 1XDGA 2AN1A 1IPFA 2BR4A 2F6RA 3N0TA 4FYIA 4N9QA 5CRIA 4GR5A 3FROA 4PTZA 3T41A 1RYYA 5E9AA 3QA3E 2CL7X 1V3VA 1ORTA 2OYCA 1QO0A 3RHTA 3TPZA 4XEHA 4X97A 4EKGA 1GKUB 2WWYA 2PVSA 4JIMA 4MVJP 1G5HA 3ONVA 2JHPA 3AOGA 1A50B 2QSUA 2CYCA 2XUDA 3K9NA 5KQPA 1QR2A 1U9YA 1WCIB 1N6KA 1J8YF 1YB6A 3PGXA 2Y76A 3A10A 4PHTA 3WY9A 1I7PA 2C9MA 4N3BA 4YP7A 4D0RA 5H70A 2ZYHA 2AI2A 3BN3A 4H16A 4RC9A 1H4QA 1S9HA 1DC6A 3EEYA 3RVKA 1YUMA 5LQRA 3IELA 2ZS8A 1PK7A 2H5IA 1XTPA 1G9TA 1X8LA 3GMIA 2G28A 1XTKA 2RK4A 3JPWA 4RMHA 1FFEA 1KY5A 4Q3DA 2OV4A 4TM8A 3RUPA 3OM1A 5AUPB 1QRSA 4KK3A 1ZM3A 1PTJC 2X5OA 4F3TA 2O8BB 3BPSA 3LOQA 1UJNA 3I6ZA 5EWMA 3LF1A 2GRAA 4RJ2A 4RPKA 5I9TA 5E9QA 2WHYA 3VVBA 1E2BA 4RH1A 1U7TA 1ULUA 4E94A 4RJKA 2QRZA 4WK0B 3DSRA 4DMMA 4I9GA 2R1TA 4G0ZA 4CEHB 1NZFA 5K0FA 3STYA 2PZEA 1PR1A 3E9DA 1JHPA 2V9PA 4NRDA 4WZBA 4XCXA 3RTDA 3I37X 3ZJTA 1CZUA 1Z3CA 2CHQA 2ODQA 4OHWA 4DC9A 3S8YA 4GKKB 3FVTA 1MF7A 3G49A 4QDJA 1ZJ6A 3L7LA 1GRVA 4OBWA 3USCS 4NNPA 1I1NA 1GTG1 1JSLA 4BEBA 3K35A 3LK6A 2JIOA 3QITA 2RKBA 2HIHA 1XMJA 3JZIA 4JLOA 4JVOA 3R20A 5EQDA 5J59A 4BXOA 3E7WA 3M4ZA 1HF3A 1TIKA 1U80A 1X7XB 2HH9A 4CCAA 2QXYA 1ZD5A 1YZVA 2IW1A 2R11A 3F74A 4FT2A 4KRGA 3BWDD 3LPDA 2J7PA 2PMBA 3OC0A 5DLDA 3QE9Y 3NMUF 1T5DX 1NVFA 1NJSA 1PX0A 1JR4A 2MINA 3DD5A 4W5TA 3TR6A 4KDCA 1ICEA 4TYYA 3W78A 1NVAA 1RYFA 3NC4A 1I7DA 1UL1X 2QZJA 3STVA 2XNKA 1N7GA 2ID8A 4INOA 5FF9A 3V4FA 1AHNA 3ADBA 3C3PA 4NZPA 5CG1A 5FOTA 3ZCQA 1O4WA 3CR3C 4AMBA 3SC4A 3OLYA 3IODA 1NP6A 4UMVA 3EGCA 5IUJC 3PB3A 1P33A 4AG6A 3PSAA 4AMZA 2VPZA 5E3IA 3DCYA 2UZIR 5LBUA 3UWPA 2ZWPA 1EA5A 2XYQA 2P9QA 3CNLA 3WDMA 2JA2A 4K9PA 4A03A 1A5ZA 2P1RA 1BXRB 2R1UA 4F91B 4R69A 1MABA 2H4FA 3KQMA 3WGLA 3T1NA 1CQPA 3GLFB 3Q7PA 4MRVA 4C5AA 4BTEA 1I3OA 2GAOA 3S7ZA 3U61B 2CL0X 3H0KA 3T3EA 3AUKA 1KNQA 3JQAA 4DHEA 5IC5A 1Q7RA 4Q3OA 4XI9A 4E7PA 1GPUA 3HZHA 3N05A 3PQEA 4AO8A 1RMTA 2GEUA 4MH0R 2YOHA 4UDYX 3FX2A 2JCYA 2XB4A 4A5OA 2WHXA 2O1SA 2ZGVA 1TZMA 3CEHA 5EPEA 1EEXB 4G41A 2ZYTX 3TFWA 2Q7OE 2OFXA 2QTZA 4JKOA 3NATA 4DBVO 1H4TA 3JAKB 4DF3A 1C30B 4KOAA 3ZE1B 2CVQA 5JAZA 1BYIA 3MCUA 4EKYA 2X42A 1SU8A 5KX5A 2P8SA 1BE0A 3D0KA 5BQ5A 2VHZA 3D2CA 4ZI7B 1MB9A 3FUTA 2IY8A 3WZLA 3AVOA 2CZCA 1Y4AE 2CDCA 1N8KA 1ODCA 3IYLW 4EZIA 4QJ3A 4ZCTA 4LJ4A 3W8NA 4B74A 1KAEA 4MEAA 2O14A 2ATIA 4RF2A 1KDVA 4MEBA 1UPBA 2IDJA 2BAGA 3DXZA 3LPAA 3OH8A 4MS3B 4PAOA 3OZGA 3BQ9A 4U63A 1OA1A 1KFJB 4B6QA 5JCZA 5CA1A 1XZLA 2BH2A 4QNRA 2B1JA 1EPUA 3GRVA 1E3DA 1HOXA 3ACBA 4F71A 4DBZA 3FNHA 2QWXA 1KK1A 5MDHA 1QE0A 4WUVA 3CRMA 1GIAA 2OO5C 2Q5QA 3HU3A 1CDZA 1II0A 4TKVB 1G6Q1 1R10A 2G1UA 2J6HA 4KEAA 5K0TA 3C6BA 1R0SA 4ZOAA 1VLZA 3QNUA 4CIAA 3U4HA 4XFDA 2AFIB 2ZRKA 1JG2A 4B7UA 4GQBA 2QD5A 3EUWA 3LLCA 4G0QA 3O0DA 4HNSA 4BVEA 5F5LA 2VYFA 2NU6B 4WW0A 3A1NA 1CJKC 1K5GA 5FFMA 3MWEA 3AJ9A 5HUQA 3ZLTA 1JHRA 2H0RA 1WO8A 2P40A 3UHJA 1FL9A 4C07A 5CDTA 1KI9A 1BRTA 2Q1YA 4PAMA 4BC1A 3OZFA 4QU0A 1VE3A 4X95A 2GEVA 4A8TA 5AHKA 5BRJA 3KWLA 4E5YA 2QPOA 2Q0SA 1QF6A 4ZCMA 4D46A 1ZYUA 1Y9ZA 4CG0A 1HTWA 2JLSA 2QORA 3PWZA 5LA6A 5BSTA 1YFZA 4M0EA 3INNA 3AR9A 1GR0A 3RAPR 2NVBA 4BKOA 3PNLA 1NMYA 1RWWA 4NF2A 3ILVA 4JC4A 3AHCA 2XPCA 2WZCA 3NW9A 1P1HA 1Z4MA 3O82A 1G8SA 3C39A 1ULSA 3P9IA 1PG2A 2IHTA 3B6ZA 3VSEA 5FAKA 2NO5A 3OZSA 4WMLA 4DDVA 3PQ6A 4I9HA 1IQ0A 3JQRA 5FLXA 1VKZA 4O2BA 4EEKA 3A4TA 3OCUA 3OI7A 1C8BA 3BZBA 2OAQ1 2XZLA 3EPRA 4WZBE 3SXPA 4C3OB 2ID9A 5E0OA 2VPIA 4AY4A 5BUZA 3PK0A 1D2NA 1W36D 1DKMA 1VA4A 1R27A 2VDWB 4DSTA 4UXJA 1RAAA 2A2ZA 2R87A 4UTPA 3KQUA 3U6KA 2YJGA 4TVOA 2W2VA 4HDMB 4JLUA 1YV9A 1G0NA 3U44A 4BFVA 1W75A 4AJ9A 1L9KA 3MT8A 3NTOA 1ND5A 2BZGA 1Z37A 3L1IA 4BP8A 1JFRA 1LNQA 1T5TA 1ZUHA 2AXNA 1SVLA 2ZKIA 3EY9A 4YA6A 1Z3IX 1H23A 3PFWO 5C4GB 3VTKA 1VBMA 2G5TA 4C2TA 1WG8A 2Y1EA 3LQYA 3P94A 1SCDA 1XCLA 2PR2A 1A4IA 2SICE 3IUNA 2ANCA 1Y3HA 3V2UA 5A2QA 3W5AA 3VU8A 3R40A 3FPFA 1FUIA 1UC4B 1CE8A 2A9KA 3KYDB 2IQIA 1WNFA 1EDOA 1YDHA 1T6BY 4A27A 3VDQA 4YALA 4CQLB 1I32A 1WHTA 4J0FA 4JDPA 2VHUA 4ATNA 1A77A 4QXPA 2NT4A 4XOIA 4RF4A 3ZBQA 1GUDA 1NATA 3M5WA 2O5EA 4MOWA 2BHTA 2IHUA 3AEQB 4AS3A 3PEVA 3KHKA 2J5RA 3JWHA 2CK3A 3NPAA 1KYQA 1P1JA 4XDHA 3N2IA 4EW3A 1UMBA 3WWCA 4CMCA 2VATA 3ECCA 1HZZC 4OXKA 4K9KA 2QRGA 2ZSKA 2PQ6A 4DYDA 4ZQGA 4HC4A 3TIFA 2WF9A 3HDJA 4QGBA 1F1BA 1WZEA 3I01A 1XZEA 2YIMA 1JSXA 3RREA 2BHRA 1JQAA 2ZATA 1T4CA 3NHSA 1PFWA 3OG9A 4HZUA 1FJ2A 1DRKA 2G88A 3BKXA 4QFCA 5JV5A 4WESB 5B30A 1W29A 1WDTA 3LVQE 2VBCA 4MUHA 3TIGA 4CYMA 3BHIA 1B2RA 2AL7A 4R31A 4YDRA 1XU4A 4JAVC 2NSHA 4EOGA 2EJUA 1NLFA 2NZ8A 3GLIB 1U8EA 3JAWA 2A0UA 4BN0A 2BRUA 2FW1A 1KPGA 2Q1WA 3KQSA 3O8OA 4PU0A 5K9ZA 1OC4A 1K98A 3UNXA 4UMDA 1E2KA 10MHA 1TRKA 3X1XA 3RYHB 4UDXX 4TKUB 3KTAB 3P4YA 3SXUA 3PPIA 3KFVA 3WMRA 9ABPA 1QAOA 1K7XB 2UKDA 2VJPA 3QGMA 1KOJA 4GX1A 4QHTA 4JS0A 1JDVA 3MT9A 1YSCA 3QMVA 4BGVA 1A4UA 4DDKA 5AVOA 4CUZA 3QKSB 2Z9BA 4QLAA 2WG1A 2Z08A 4IXTA 4WEOA 4Q3CA 1W85B 3R44A 3TQFA 4TV8B 3I53A 4NH0A 2AG6A 1PNOA 2H7VA 3FBWA 3ZGYA 3PEWA 1ZAKA 3EYAA 1BKYA 2YMQA 2FKAA 3OC6A 3WB9A 2SECE 1SRRA 4TMKA 3G59A 1K08A 3HB9A 2EERA 3NHFA 1CZLA 2X5NA 2ON6A 1D0SA 2OCIA 3CMMA 3SHTA 4DV1B 4J4HA 1M34A 1QHHB 3H2IA 1ZUNA 4DJEC 4N3NA 5AQ1A 3ELBA 1PZGA 1QO0D 3P71T 3WLTA 3MHTA 4FSXA 2G1JA 5DBHX 1YZLA 4JLVA 4BEVA 4BO6A 2AYZA 3I6MA 3QVGB 1O08A 2OORA 3W9UA 1YVPA 1HFKA 1O6ZA 2ZSDA 3HDYA 4QM7A 1R8SA 3KAJA 3TLMA 5JYBA 1W87A 1YRHA 1Q2XA 2X2EA 2MTBA 4PZCA 1DADA 5FP0A 1O8BA 1E94E 6ADHA 1H2BA 4EG3A 4ZRDA 3R3XA 3ELDA 4DCJA 5A71A 4BLSA 4P35A 2QAGB 1SVKA 1G8FA 2ZE5A 3NOOA 3OEYA 2CKDA 4BRZA 2BJWA 1AMUA 4MA5A 3N0WA 3TXXA 4FNGA 1RHJA 2QY9A 4OQPA 4G1EB 4XB2A 2AKEA 1WQ1R 1TAQA 2PWAA 3DHVA 1FYWA 3KB1A 3CXUA 4XR9A 4FGUA 4C0XA 1ZGGA 3WRWA 3GFGA 2GN6A 2G25A 2WU3A 2HA0A 2PRYA 4HGNA 5K0ZA 5LKRA 5G41A 1VYUA 1ND6A 3KIPA 4MV1A 5DCYA 3RS2A 3INYA 3G7NA 1AHIA 1Z5PA 4N41A 1Y1RA 2J3KA 4OU5A 5CVVA 5JY1A 3WAGA 1AJEA 1IN1A 2ODPA 1JDBB 2ALJA 4FEEA 4FYJA 1PGNA 2BFPA 3MN1A 4FDUA 2QNRA 1U0NA 4GQIA 1CDEA 1Q1EA 4Q39A 1SKMA 4D8WA 2IH5A 2J9YB 3IQZA 3IGFA 3WP1B 2Q4TA 3KTOA 4NJMB 1H2XA 1KFCB 4CM3A 5T5QA 3NASA 2HI0A 2FVYA 1Y8RB 2X5JO 3IBFA 4MVJG 1KMCA 4YNBA 4GWLA 3KSAC 3ZHXA 4LXYA 4TLBA 4KH0A 3TYXA 1TCVA 2XXAA 4NBWA 5TMBA 5K3AA 1DBRA 3LOUA 3RPEA 4NYMQ 1HPLA 1NASA 1FNSA 2ENWA 3CZAA 3O1JC 1JFFB 3KV1A 2C77A 3KC2A 1E3SA 1PS0A 4JIGA 1D7OA 3QJ5A 1E99A 4BMPB 4O6VA 2VQ3A 3O73A 4LSZA 3DTVA 4QRIA 2KWIA 1W76A 2B37A 4P5PA 3W7VA 1SMKA 2I67A 5LU9A 3CRVA 2ADFA 3F6CA 4PSVA 1A82A 4TL6A 3KJXA 4B6PA 2QN8A 2XUIA 4P4TA 4ASUD 1PWXA 4JJZA 3TTSA 2HDNB 4UBJA 2BDUA 5BQFA 2BHNA 1C9JA 4QICA 4K9QA 2WQ6A 3VKHA 3S2SA 4IRMA 3ZU3A 3FLEA 5JYDA 1MAUA 1XWWA 3F6EX 4GP6A 2CVZA 4KRXA 4AULA 1IG0A 1P18A 1Y3AA 2IHJA 3JD3A 3OOHA 3WNVA 5ITSA 3ON5A 1DAPA 2JF0A 2YL2A 3C16C 4BB5A 2CUTA 3EVCA 3SVTA 5JNTA 3NT2A 4QO7A 1GYRA 3F6RA 1NVMB 3IQHX 3WLMA 5KNLA 1J9EA 4AN4A 2GLXA 3AGQA 1GKKA 5EMLA 1P6UA 1Z7EA 3K1AB 4QNMA 5IEJA 3W6UA 1MUUA 4IUDS 2O2YA 4KMSA 1QH8A 4NJEB 1QRUA 3JQAD 4LF4B 3GMSA 1SA0B 4JLJA 3PITA 4DXHA 5K8JB 3OE4A 4BYMA 5EE1A 2IYRA 1OYVA 1S2LA 1VPDA 1VLJA 2HNKA 3EIHA 2C98A 4RQBA 1JU9A 4DSZA 3ZTYA 3SQXA 2EC5A 2R8BA 3DNMA 3RKRA 1GPBA 3EQ6A 2QDKA 3SD7A 2MSKA 4R41A 3RYCA 4HJXA 3EVTA 3I83A 2CMKA 1L5YA 4W5OA 2DEUA 4GZLA 2AMVA 3F8TA 1XPJA 3LX5A 5DDIP 2OQVA 2PZKA 3RRBA 3UFXA 3I2GA 5KYUB 1PLKA 2VUTA 4WZAA 2LDBA 1MHPA 4A2CA 5JVDF 2BL4A 1R12A 2BV3A 2EYUA 3V9PA 3DDHA 2COUA 3DS8A 5KB3A 5ITWA 3HZZA 5LWHA 4OI1A 3HCRA 3V1YA 4GX5A 5JS7A 3TOCA 3MRXA 1Y4SA 1DEXA 2ISCA 4PZAA 2MT9A 3OAAA 2IYWA 2Z4SA 2RGEA 2TRSB 2XMZA 3UJ9A 4J2TA 1MRSA 2B7CA 2R6JA 3WYAA 2RG7A 3B1YA 2B9VA 1VI5A 4AWBA 3ZHQA 1RIIA 2X19A 3VTFA 1ES9A 4Q9HA 2Y1FA 5C35A 4EQ6B 3NOVA 3PIIA 2J41A 2VP0A 3AB8A 5CPFA 2IYQA 4KODA 2JGDB 3P96A 4ERNA 4DMHA 2HJSA 3KQWA 3WDLA 2OM2A 4IRUB 4EG7A 1KGSA 3CCCA 5CB0A 3F73A 1XEWX 1R74A 1V3UA 2WIFA 4KAFA 1DE0A 4QU8A 3T3DA 4QAJA 3R9XA 1ESMA 2VTVA 1WSBA 2NYVA 1HDRA 4ZVRA 1O95A 3FDJA 4QG3A 1QHNA 1CF4A 5AESA 2QVBA 4J07A 1EUCA 1XDDA 1K3UB 2PT7A 1NSTA 3GJQA 5CXSA 2JBWA 4BBAA 3NVDA 3T7IA 1Z4LA 3U3OA 2XGJA 1TM7E 1YJCA 1E3JA 4HH1A 5JCOA 1VQ1A 4F4JA 5GVSA 1G2OA 5IABA 4MQMA 3PD7A 1H1DA 1PQUA 3HV2A 3T7JA 1ZA2A 2OHFA 2ZSAA 3R0ZA 4NX2A 2A1TS 2XMRA 3UAYA 3GZTB 4EDFA 1HQKA 4LWQA 4D26A 2VJAA 4UE2A 4R6WA 4XLTA 4ZVUA 3TW6A 4BMOB 3TTWA 4H35A 1NDQA 3NCTA 3W34A 1XD2A 2O2XA 1FUKA 4RDIA 3L7IA 4LYHA 3AFHA 3HXMA 4RK0A 1G55A 1JQDA 2CBZA 4JENA 3WYGA 1U7UA 4Q1BA 5JJLA 1ZRMA 1O5OA 4DMKA 1IBSA 1K5DA 1VRVA 1VI2A 2P6NA 1K8RA 1U3UA 1JG3A 1VGQA 2OD9A 1AZLA 5KUTA 3TEJA 3AEXA 4C0WA 3KQVA 3VPAA 4XVUA 1BVYF 1XRJA 5A03A 1ZHOA 5IM4F 3T9EA 4YPVA 3MAAC 1MHTA 3L0IB 1RDFA 3KWMA 3EPPA 3SC6A 1RPZA 2XIQA 5JXWA 1AK9A 1Q92A 3CT6A 4RK6A 3VH1A 4F7DA 4TSFA 2HRZA 3LUDA 1KVUA 4NBKA 1TKRA 4XQ9A 2QQ0A 3NDJA 2QLTA 5KDDA 3AJAA 1M8PA 2I76A 5CA0B 1J7JA 1JDJA 1KAHA 3SIRA 3U2QA 3UOAB 1H3EA 4FSDA 3R3ZA 4UVDA 3AHIA 1RM3A 1V16B 3DR3A 1EP9A