3FMVA

Crystal structure of the serine phosphatase of rna polymerase ii ctd (ssu72 superfamily) from drosophila melanogaster. monoclinic crystal form. northeast structural genomics consortium target fr253.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
190
structure length
190
Chain Sequence
b'KLAVAVVCSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGMAFDKPNVYEFGTKYEDIYRDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTKEQFDIIVTVEERVYDLVVMHMESMESVDNRPVHVLNVDVVDNAEDALMGAFVITDMINMMAKSTDLDNDIDELIQEFEERRKRVILHSVLFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine phosphatase of RNA polymerase II CTD
publication title Crystal structure of the serine phosphatase of RNA polymerase II CTD (SSU72 superfamily) from Drosophila melanogaster. Monoclinic crystal form. Northeast Structural Genomics Consortium target FR253.
rcsb
source organism Drosophila melanogaster
molecule tags Structural genomics, unknown function
total genus 43
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fmvA01
3KSMA 4H60A 2JB9A 4YP9A 3IDOA 2M98A 1P6UA 5CNKA 1OXBB 4N41A 2WJAA 1A2OA 3GT7A 5TPZA 3TX6A 3T6KA 1MAVA 1YS7A 3A3KA 4RY9A 1USIA 5FWXB 4GPAA 3MIZA 4MS3A 3E61A 1NXPA 4FB4A 3O75A 1CYEA 1GCAA 3O2QB 4OLAA 4MLCA 4Z99A 4OG2A 4RWEA 3O1HB 5ABPA 6CHYA 3SG0A 1QQBA 3H5IA 1QP4A 4ETNA 1Z17A 1BDHA 4JB2A 1NXWA 3HVRA 1DC7A 1C0EA 2LIVA 1Y1LA 3HEBA 4Z4IA 1RZRA 1I3CA 5EWLA 3DBIA 3I45A 3TO5A 3GL9A 3GYBA 1LBHA 2WB4A 3EDCA 2E4WA 3URMA 3H5TA 4KVFA 4Q7EA 2PE5A 3IP9A 4MR8B 3Q7RA 1JLKA 2GWRA 1TMYA 4XXHA 4EGSA 1P6QA 3MM4A 2B4AA 1URPA 1ZDMA 3O21A 3NNNA 1JDNA 4OATA 1Z12A 3GBVA 3KKEA 2PUGA 4Q6WA 3VNBA 1MB0A 4F12A 2ID7A 2QR3A 4MR7A 3QLVC 4YO7A 4EUKA 1XHEA 3BILA 3LUAA 4TMYA 2NT3A 1JF8A 2RJOA 3A0UA 3H1FA 2GX6A 5DCLA 5DLEA 3RVLA 4ZPJA 4LE1A 4W5RA 3MQ4A 4TN5A 4MQFA 5DTEA 5JNRA 2MYPA 2LP4Y 3OQOA 1JL3A 1ZITA 4KPYA 2R25B 1A04A 4WZZA 3RVPA 2W42A 3FGZA 4QPJC 1U2QA 2FQWA 2NUBA 2R4QA 1XHFA 3GWGA 3I09A 3TB6A 2IDMA 1USGA 2WMYA 4PYRA 1AB5A 3LOPA 3HK2A 1KRXA 2QVCA 3CLKA 2FN8A 4LZLA 3CRNA 3N0WA 2IKSA 3GBPA 2RJNA 3N0RA 4WWHA 3N6VA 4O1IA 2BGGA 4RKRA 1CEYA 2JCGA 3UKJA 3KLNA 4IF4A 3BBLA 3RVQA 3K9CA 6ABPA 3EQ2A 1DBPA 3ILYA 4IRXA 5IEJA 1Z25A 4N47A 2XDYA 3RVRA 1D2AA 1LJUA 2FMIA 3A0RB 3NNSA 2CWDA 1JFVA 3DZDA 1M5TA 3EULA 4RDCA 4EVQA 2WJWA 2WRZA 4NCAA 3CZ5A 4HNRA 5IUJC 3F6PA 5ED4A 1BAPA 3H6GA 2A9OA 1NXTA 4LDZA 2PKXA 3KLOA 4JA2A 2JVKA 3CG4A 2GI4A 1YVUA 2E4UA 1T34A 4O5AA 5C5CA 3RVMA 3QK7A 1Z2EA 1XWWA 2V0NA 1AB6A 1ISSA 1GCGA 4W5QA 5EWMB 4ETIA 3HCWA 3C3KA 1LBIA 3O2SB 4G86A 2PUCA 4Z4EA 3EQZA 4CBVA 4NICA 1K68A 4W5NA 4MR9A 4D6XA 2QVGA 3HM9A 1VPWA 2FN9A 1DRKA 3OQNA 1ABFA 3LUKA 4RK7A 2FMHA 5TE9A 5KQLA 3JVDA 1W9HA 1HEYA 3CTPA 4Q6BA 4TLMB 3HS3A 3RH0A 1DC8A 4RZSA 4YR7A 4Z4GA 1YMUA 3E3MA 3D8UA 2GBPA 5GQSA 5KC8A 2FMFA 1L5ZA 2MYUA 5FWYB 3FFXA 2AYXA 1PHRA 3D02A 4MYRA 1H9CA 3GV0A 4MGEA 4MS3B 1FFSA 5IULC 4YLEA 4WXEA 2FW0A 4G97A 2VUIB 2IPAB 9ABPA 5I4CA 4RXUA 2QZJA 4JP1A 1ZGGA 1EWVA 3UK0A 1M2FA 1LJLA 1TLFA 2MSLA 1DZ3A 3P9YA 1QP0A 1EWTA 2E4YA 2FQXA 3O1JC 5EWLB 4EVRA 3LFTA 2WY2D 2AYZA 4P98A 5TPWA 1NXVA 2FQYA 1ZHHA 3ILHA 2Q5CA 2YHAA 2L2QA 4MS1A 4XLTA 4N0QA 1P8AA 2X7XA 5TQ2A 4ZJPA 1TJYA 1DRJA 4LE0A 2R48A 2F8SA 1ABEA 4S04A 4KNYA 4LDAA 2JBAA 1KGSA 2FEPA 3HDGA 4RXMA 1DBWA 4ZMSA 1YIOA 3LUHA 3F73A 5DGCA 1UDRA 3JTEA 4KRFA 2E4VA 2PMCA 4RSMA 3KTOA 4P1ZA 3O74A 3K4HA 3OLXA 5BR1A 4MR7B 2FLKA 5JNVA 3JY6A 5JNUA 2PL9A 1RPJA 2VYCA 3O2JA 3HSYA 2WWVD 5T7BA 2QXYA 1JX6A 3HV2A 1Z15A 4MQFB 5FWXA 4MLDA 2HQOA 1PEYA 1F4VA 3N0XA 3OM0A 3HXMA 1LK0A 4EVSA 2MSKA 3BRSA 1DCFA 3EODA 3MMNA 3C3MA 4YV7A 3JVIA 4ZMRA 7ABPA 1TVMA 1Z18A 1DJMA 4LX8A 4PEVA 1D4ZA 2MYTA 1BVHA 1JYFA 1YTUA 3FFWA 2PAFA 3F7NA 4HNSA 3RVOA 3OLZA 4EYQA 1DCKA 1QNLA 2PL1A 3CFYA 2FMKA 3ROFA 4HNQA 4MR8A 4KREA 1D1PA 5D2CA 3SNKA 4RU1A 4W5OA 4YWHA 1JDPA 1QPZA 3IPAA 4G0XA 4E7OA 3HUUA 3DLHA 1BA2A 3I42A 4TLLB 3QLVA 3RVNA 4DN6A 1A0OA 3LUJA 1DP4A 3CU5A 4MQEA 2RDMA 3CS3A 4DADA 5KQMA 2L19A 1W25A 2JVIA 1QP7A 1RNLA 4DQDA 1ZVVA 1ZY2A 1TM2A 1EHCA 4N03A 2HSGA 4L85A 4RK1A 3IP7A 1U0SY 2IYNA 4L4UA 1IIBA 3N75A 3QX8A 3HJFA 4RK0A 2FEWB 3HDVA 4JASB 3H5LA 3T8YA 3BREA 1MVOA 5KC9A 1GUBA 2LBPA 5PNTA 1U2PA 2PLNA 5IX8A 1NXXA 4ML3A 3Q15C 5IC5A 2L18A 1SXHA 4H3KB 2HJ9A 4RK4A 4RY0A 3MA0A 4YGXB 4G0OA 1ZESA 5EWJA 1SXIA 4KQCA 2FXIA 5TQ0A 1FFWA 4Z9BA 3SY8A 4NQRA 2OENG 4MRMA 1QQAA 4MR9B 3NHMA 2IPLA 5C5EA 3DLBA 3Q7SA 4MPTA 4ZYLA 5IEBA 1DG9A 5JNTA 3KHTA 2JK1A 2YHBA 3M6MD 4D6YA 3M9XA 3FDFA 3KCNA 3OM1A 3QEMA 5F64A 1NXOA 4EY3A 4JB0A 3FFTA 3QLUC 3CNBA 3KYJB 4HYEA 2FVYA 2QU7A 1ISRA 3VNAA 2O20A 2OQRA 4MS4A 2ZAYA 1K66A 1Z2DA 1RXEA 5KQGA 2CHFA 3A10A 3MYYA 2PUBA 3H75A 1D5WA 3G85A 4WT7A 3OLWA 1JH9A 5TQJA 3NNDA 3C97A 5B3JC 1GLGA 4B09A 4D74A 1OXKB 1FQWA 1D1QA 2A9RA 4KK4A 5JNWA 1YMVA 4UHJA 5HKOA 2KYRA 4O1HA 1QKKA 4FE7A 3NHZA 1FFGA 1NATA 1BDJA 1EWKA 5TPWB 4E7PA 2E4XA 2N9UA 1B00A 3NBMA 3HZHA 3LUGA 4MS1B 5TQ2B 5EWMA 2IOYA 4ETMA 2A9QA 2GKGA 3QELA 4G0MA 1BDIA 3Q41A 5HM6A 3OO1A 1S8NA 3QEKA 3I5AA 1ZH4A 4KV7A 3OQMA 3SM9A 1PNTA 3OO0A 3CZCA 4OTZA 4XAQA 1EFAA 2MYNA 4N0PA 4EYKA 4F06A 1APBA 4Z9AA 4IMJB 3DGFC 1CHNA 4LRQA 4F8JA 3H6HA 1JHZA 4W5TA 2I6FA 4KMRA 4M88A 4KZKA 2IPMA 4LE2A 5GOTA 1E6KA 5BRJA 5FWYA 1PNRA 2L17A 1PUXA 8ABPA 3OMXA 4GNRA 2QV0A 3H1GA 3EAFA 3CHYA 2PUEA 3DGEC 1Z26A 1Z13A 2H0AA 1YS6A 3TMYA 5JS2A 1ZAYA 3UUGA 1JBEA 1EAYA 1JWLA 2VK2A 2PUDA 3MF4A 3LUFA 4XFKA 4NCBA 4QYMA 5HQJA 3EJWA 3O1IC 3HO1A 4XARA 4RS3A 2PJUA 1ZN2A 2DRIA 4G0PA 3QX9A 1KRWA 5CNMA 3GRCA 2P9HA 2FEKA 2RGYA 2TMYA 1Z16A 1E6MA 3LUCA 3TD9A 3N8IA 4MQEB 1FSPA 2P4UA 3IP5A 1KMIY 2PUFA 3RVSA 4QICA 4G0QA 3ROTA 1QO0D 1VRVA 3FMVA 2PUAA 1USKA 1NTRA 2LPMA 4QYWA 1U04A 4JAVC 1VKRA 5JS1A 1NXSA 2FTKE 3JPYA 5IUNC 3LMKA 1SRRA 2JVJA 4OBBA 4PICA 3B2NA 1U8TA 4F11A 1J56A 1DCMA 2M1ZA 1JFSA 1QMPA 5EWJB 3IP6A 3KYIB 3N53A 2HQRA 3QLTA 5TQ0B 5TPZD 1WETA 3G1WA 2HPHA 5CHYA 4KFCA 4MRMB 4NV3A 1SXGA 4FE4A 1RXIA 2FSPA 4UHKA 1L5YA 4IILA 2ID9A 5KWSA 4H3HB 3H5WA 4EYGA 4Z4FA 3LKBA 1PEAA 3QEMB 5T3YA 3OLYA 4KK3A 2F8TA 3KJXA 4RV5A 3L6UA 2J48A 3R0JA 4G0ZA 2R47A 4XASA 3T38A 1RZRD 3Q7TA 3M9WA 2NZVG 1JFTA 3T95A 1E2BA 3KS9A 1GUDA 4MS4B 2NZUG 1YK1A 1SD5A 3LTEA 1YK0A 3RQIA 5FBKA 4PZ0A 3H5VA 3JS5A 3F6CA 2A9PA 4RY8A 2E4ZA 2JRLA 5KQPA 5HSGA 4Y9TA 5FBHA 3IPCA 4Z4CA 1NY5A 1M5UA 3BRQA 3H1EA 3OLVA 3S99A 2VUHB 3Q9SA 2NT4A 1M2EA 1ZGZA 3H5OA 5E3JA 4OLBA 5CNIA 4PE5B 4JOQA 4RK5A 4WXMA 2HQBA 2H3HA 1JYEA 4KQ9A 3HUTA 4Z4HA 1R8JA 1VLZA 2IPNA 5BQ3A 2FKAA 4N76A 1MIHA 1P2FA 4YS6A 2QSJA 3CKMA 3GA5A 3KG2A 4YCSA 3C6QA 3SAJA 3LKVA 4F3TA 5IUKC 2CD7A 5KI6A 1F51E 4RK6A 4YRZA 3RVKA 3QELB 3W9SA 4RXTA 3OMWA 5JNSA 4IMIB 4IGAA 5CNJA 1C4WA 2MSWA 4Z0NA 3RVJA 3LUDA 3QLUA 2B1JA 2QW1A 3C3WA 3CG0A 4S05A 1QO0A 5DKFA 3SQNA 5BRAA 1DBQA 2JBAB 1ZH2A 2FLWA 4G0YA 4MAAA 2CHEA 1E6LA 3L49A 3JPWA 4RKQA 4WUTA 5IBQA 3EGCA 1MB3A 5B3JA 4EYOA 2LUOA 2ZWMA
chains in the Genus database with same CATH superfamily
2IUYA 3WJ1A 2ZTVA 2JB9A 3TL2A 3WYFA 1CR0A 1YVDA 1N3LA 2BKEA 2GCOA 2PANA 3H97A 3SPXA 1U3FA 2DC1A 5GMOA 5C7OO 3GT7A 3NVAA 4W1QA 2WKWA 5B1YA 2JG3A 1FFXB 3KOUA 2GBIA 3QHAA 1D09A 1M73E 4I2VA 4ZCLA 3QKTA 3VO1A 4V1CB 3IPRA 3MIZA 4O2LA 1AQJA 3ZHUA 4RX1A 4MVXA 4RQBA 4F5YA 1SIOA 3I5UA 3COZA 3SG0A 3T3GA 5EIXA 1JG4A 2X2EA 5IDXA 2YY7A 1XX6A 3V8NA 1VJ1A 1T36A 2GH1A 2BJWA 2ZYDA 2AN9A 3OUTA 4XWOA 1Y5RA 1XMXA 4JVMA 1W85B 3OX1A 5G0TA 2JGKA 2FJPA 4WLOA 1TT7A 3I9FA 5E3HA 4M36A 4AS3A 3CVXA 4AG5A 2JEZA 3G8DA 4XYBA 3U9SA 1WOMA 4CXMA 2NTJA 2ZS8A 3ER8A 4OX9B 1TM5E 3TW4A 2XVAA 5AIBA 5LKAA 2MMGA 2HJWA 5F5NA 3GROA 2BKXA 4X94A 1ULTA 4L3OA 4BX3A 1Y6JA 16PKA 1G5TA 1XKQA 2HRCA 3DNPA 2QD5A 4E5MA 1QNFA 3C4QA 2OKGA 4J0KA 2Z9CA 5AK4A 3SC2B 3TM4A 3WQQA 4B31A 2ZSUA 2RH8A 4GR4A 3M8KA 1WDKA 3R3HA 4GPTA 3HB7A 4GX2A 2A94A 3ZLJA 2Z6UA 3FMFA 3LUAA 1ZISA 2CDAA 5G53C 1PL8A 2NT3A 3WDKA 1DVRA 3A0UA 2F1RA 2QTNA 5DCLA 4OQLA 3ROZA 3DZFA 4XD2A 2P4HX 3G88A 3MQ4A 3VHXA 3EC7A 2RK6A 4QEZA 1V5FA 3EARA 3HYTA 1AKVA 2Y0BA 3QE9Y 1UFKA 3OJEA 1I9GA 1ULAA 3KR0A 3IO3A 1RE0A 2QPOA 1PZXA 1NVGA 3B38A 5F4ZA 3F6EX 1K7XB 3VPCA 5EJ5A 2BFDA 4WADA 3WQHA 3JD4A 4BC0A 4OOFA 4BPRA 2H5LA 5HJ5A 1NNLA 1KO1A 1PJZA 2ORWA 2X0RA 5LFAA 3L0SA 3CLKA 3DE6X 3BFVA 5DRTA 2O5EA 2FR0A 1HM5A 3BMOA 2IZ7A 2PO5A 3CLRD 3H6KA 1SNYA 2FSVA 4MUKA 3HCBA 2QGZA 1WCIA 2P6OA 5DLDA 2G1AA 4L0DA 1KOGA 2J07A 3W90A 1TQHA 3CV3A 3NQ41 4V0MA 1REQA 3C5WP 2YZ2A 3T5MA 4O3MA 3B1XA 1GPNA 4YYZA 3WL8A 4GX0A 1DFGA 2DQKA 2ZBEA 2D1FA 1NZJA 2HQSA 1M67A 1Z38A 2GNPA 5FR1A 4KXNA 1Z25A 3DC7A 2X1VA 1N1EA 3BSFA 4DMKA 3NNSA 3Q1LA 4LJ8A 1M5TA 2G70A 1QVWA 3FPSA 1TXGA 4L02A 4NKRA 4FC7A 3K4PA 3OCUA 3KIPA 4OHWA 4P3KA 1UMBA 2CZGA 5JH7A 4PV7A 1LWOA 2A33A 2RSLA 2W83A 3GJSA 4C0XA 4OHXA 3P4UA 4L1KA 4A8JC 4DSAA 2WFZA 1NLZA 4UBLA 1SUWA 3CG4A 4LMBA 4Y7CA 4KWCA 1YVUA 2Q3DA 2X1HA 3PR1A 3P9PA 2QUZA 3LCUA 4MKIA 5HG0A 4W9NA 4B6SA 2V0NA 3K94A 4DR7B 2EF1A 2ZB4A 1CLUA 1XTRA 4MB6A 4PGMA 3V7FA 5CDFE 5IKEA 1ZMRA 3G1UA 4IJWA 4TSFD 3PRYA 4M98A 3ETGA 2XMDA 3GJRA 3W4IA 2J6CA 5FHRA 4Z4EA 1FLAA 3NI2A 2C2WA 1NQ5A 5JS8A 2ZOSA 4B73A 4CR6A 2KSQA 1DRKA 1NYQA 1JB1A 1KVSA 5G3ZA 1ABFA 2BMDA 2V4ZA 1KI6A 2EF0A 1V25A 4U7WA 1OLSB 3OZDA 4XIFA 2IV3A 3U56A 3NOXA 3PCTA 3DFKA 4JXJA 1DX9A 1ICIA 1UQTA 1VYHA 3DEIA 2NO6A 4C3OB 4YLGA 4BVGA 3HS3A 4EKGA 1Q0PA 2A4KA 3N74A 5EJEA 4TRMA 2GBPA 4IUYA 2GYUA 4C3ZA 2O3QA 3PENA 2J31A 4IJ5A 4YHBA 3TIVA 3BMCB 4Z54A 2DSTA 3AP1A 3INRA 1EH5A 1PZHA 1E9DA 2HPZA 3CEAA 4M0CA 2HA2A 1HDIA 2NSJA 4G25A 4NY1A 4R98A 2C9CA 3QVMA 1XEWY 4LKOA 4R68A 2P2YA 5FUXA 1Y3IA 4HDCA 3IAFA 5ECYA 3VR3A 1ZGGA 4XR4A 4QYIA 2V5UA 5A6SB 5FEUA 3F3MA 1JILA 3OOEA 1FZQA 1BVYF 1NG1A 1RI1A 2Q0SA 3CJRA 3DC2A 4FLFA 4IFBA 2BELA 4X8HA 4B40A 2WY2D 2EW1A 1AZLA 2C9DA 2WF5A 1TADA 1BA3A 1XQYA 3F5MA 3A6DA 3DE2X 4LRYA 3RSHA 4ALNA 4XGNA 5HF5A 2TS1A 4WV3A 4MS1A 4EMBA 1LPSA 3B1VA 2H0RA 5AR1A 3P7MA 2GK4A 2L42A 1H4QA 2HK9A 2JJYA 1IU9A 3LPDA 1W1WA 4ER3A 1S2IA 1A9OA 3B12A 3MJDA 4YT5A 5HFAA 4E88A 2YFHA 1MEJA 2OGUA 4WN9B 4KO1S 4XZ3A 3W3AH 1MW8X 4DCOA 2UV8A 3Q98A 1UBSB 4R3WA 3GXBA 3O74A 3UOAB 2P7HA 3KYBA 5DSXA 1AQIA 1V1RA 1GRRA 1M7GA 1SY7A 2F43B 2WJYA 3A70A 4MVJD 1NJ5A 4EHHA 4EMUA 5JNUA 5L3SB 1EEHA 1BWRA 1PU2A 2V0GA 2IITA 1E96A 3AU9A 4OUDB 1NVVQ 1M1NB 4KAAA 4W9MC 1AGYA 1Z2AA 1JX6A 3HV2A 3U4HA 5FAKA 4IH4A 4OH1A 5K8TA 2I1VB 3ZWAA 1FDUA 3MLBA 1WR8A 5DV9A 4HP8A 5FLEX 1QK3A 4OKSA 3ROKA 3TLXA 3TOSA 1Y9EA 3U19A 2HR1A 4C7OB 3FHCB 4HQ0A 2ATVA 1VLMA 3DDCA 3MINB 1JVNA 3ZQJA 4R0MA 1CUIA 3L8MA 4J90A 2YJTD 4PLPA 2Z58A 3JVIA 3SSNA 2FVXA 3ZW9A 5PGMA 2R8PA 3WK6A 4PC3A 3Q72A 1FRQA 1RQPA 1Z6ZA 3LNTA 3OZEA 3SDZA 3LP8A 3DULA 5FL7A 2WWYA 2I3BA 3G7SA 4ZO4A 1N2HA 4FFVA 1PYOA 4ZVPA 5L7WA 3L0IB 2W58A 5A4FS 2IQ5A 3GT0A 2WD7B 4JITA 1HEIA 1T91A 4GXTA 3L1KA 2GZMA 1A0OA 1IAQA 2NACA 4KE8A 3C6KA 4Y2PA 4M0DA 1NVWQ 3CS3A 3CSUA 2NZWA 2R2AA 3FDJA 4EPTA 2GPWA 1T2AA 3EPHA 3L5KA 1XT6A 1AV7A 2H1WA 5LU9A 3LK6A 3QX8A 1MD9A 4X60A 5B2FA 3GEGA 1G8HA 4B6FA 4EI9A 1F6DA 5EY5B 3DO8A 3FG9A 3L8YA 2DT5A 4Z9XA 4JJZA 5HF6A 1Z3CA 3H11B 4B85A 4Y2YA 5KC9A 2O6HA 5MGNA 2QLJA 3TEMA 2OCYC 1X80B 4BX0A 4HLDA 4LISA 1C3OA 4R8SA 3VU9B 1GPDG 4EY5A 2BD0A 5IVKA 1A2KC 1G8KA 1QU3A 1B6GA 5AICA 3TLKA 4B2LA 1HK7A 3QOXA 3KSRA 4FZRA 1DIHA 4JWKA 1VLLA 3IXMA 4YRRA 4YXWD 5AJZA 2IUTA 3ZOKA 3B48A 1NFFA 2FEXA 3BHMA 3ZLTA 5BOSA 5DFAA 2IY7A 1ZVKA 3EZ7A 1KSHA 2UVQA 4ZRMA 2YICA 3ZK7A 4RULA 1U8UA 1N8TA 5DNAA 4A4DA 1NHGA 4B0OA 4FT2A 4KWTA 3G13A 3OF3A 2XLBA 1VJGA 1RDFA 3KKNA 4XW2A 4WI1A 3W6ZA 4MIKA 4Y3UA 3HC7A 4CCSA 4HLCA 1H5QA 2PX8A 4HRXA 1JV2B 1QZTA 4Z0HO 4BLTA 1L7QA 1HG1A 1ODLA 4JUAA 1GZ7A 3NO4A 4HQLA 2PDAA 4MS4A 4ZALA 4ASUA 2VP0A 4A8JA 3A10A 4M6WB 5H7XA 1KZ7B 4G1FA 2J5XA 4I1SA 1ZRHA 1MB2A 4A6EA 2GAAA 3DKVA 1KO4A 2FX3A 2J9GA 1XGKA 1OKKD 2WWWA 1FYEA 3BCSA 1FNNA 1Z0AA 2H48A 3B3QA 3TOVA 1P1FA 3CRRA 4L95C 2UUAB 3ITDA 4ENUA 1XLVA 4RPIA 4ESOA 4NCJA 4RGQA 4UCXA 3NLLA 4NPAA 5CW2A 5C4MA 1ZCAA 2WOJA 1KFKB 2O5VA 3N2LA 3PF8A 4FFLA 4QQ8A 5DM2A 4LY6A 4YRGA 2XWPA 3IILA 5G1PA 4RH1A 4JU9A 4LBWA 4V2IA 3O1LA 1H8ED 5FI0B 2F59A 4FK8A 2NV2B 3WO1A 2FWPA 3IMEA 2HU8A 3SQXA 4PZEA 2GPAA 3O31A 5KTKA 2QV7A 3PGVA 3GPLA 3I6YA 3QXJA 3FYHA 3DOOA 4MYTA 4R5HA 5KHOC 1ZKDA 3TFWA 4OXXA 2MYNA 5F33A 4EYKA 3V4ZA 4F06A 1APBA 1THTA 3IMGA 3PC4A 4E21A 3DO5A 1RQ2A 1U3DA 3UV3A 3AKCA 1PG2A 1E4VA 3WNCA 3HI6A 3Q3EA 1W59A 1P4AA 1OX6A 4K05A 4BMSA 2I6SA 1AGNA 2IPMA 3M34A 2CFOA 2Y1OA 3I9LA 4PAGA 4RDIA 5FWYA 4LDJA 5AVUA 5EJMA 2ZVQX 3KQSA 2NV0A 4FEAA 1SPXA 1KEZA 1HKUA 5IBPA 1NXQA 3UAXA 3CHYA 4X64B 2OHXA 2PXHA 3M6WA 4US1R 3TVYA 4ZDJA 4LYJA 4D9CA 5IJ0A 3AOEC 2PUEA 2H0AA 1PT5A 1CEXA 1Z13A 2PGXA 2V9ZA 2PK3A 1P3DA 3KPUA 3TR0A 3WLQA 5LLTA 4DC9A 3D2LA 3N2GA 4R71A 4U2CA 1YHZA 3UOWA 3KHUA 4YC7A 1ACLA 3K9LA 3ZKAA 4DDHA 4HGRA 1KMNA 2GVNA 4B84A 2QT1A 4B3SB 1WZ2A 1KIMA 4H0CA 4ETWA 2PKRA 2HSJA 2Q4DA 2GD1O 2G1JA 5AXDA 4FFSA 2OV8A 4AC9A 1DXQA 4R6WA 4U9UA 1MG5A 3KETA 5KCMA 3GCXA 2CLHB 3BDIA 1CUDA 3Q7EA 5KSPA 1FSZA 1QVRA 3WBJA 1QWOA 2OILA 4GD3Q 1M0SA 2IK8A 2RGYA 3ZQ4A 1VIMA 4WSOA 3SX4A 3KYCB 2Z3WA 3RADC 1KY4A 1EB9A 2JZNA 4QVKA 2IY9A 2ZJ3A 3NT5A 5HK9A 2Z04A 5T64A 3RWOA 3P9SA 4M60A 3CLSD 2B1RA 4O08A 3ZHYA 2J32A 1C9YA 3JVUA 4X24A 3C3XA 4YX9A 2UUPA 4DYDA 2PXXA 5E1MA 2Z5LA 1VRVA 2A3NA 2J9RA 2VDOB 5DNVA 4NTZA 2C82A 4FINA 5BUZA 2G80A 4HUJA 4JAVC 3D0QA 1SRRA 5ELMA 4N5IX 2PZ8A 4OBBA 3UJ6A 1Z36A 1KY2A 2JI6A 4BWGA 2JAQA 4L4XA 2IBSA 1SVIA 4OFWA 2J0SA 3OT1A 5TEWA 1JZSA 2QD4A 4XWTA 3ICWA 5IG2A 2E18A 3DOFA 1L5WA 2PT6A 3K8ZA 3IS3A 1VECA 2VPXA 3O8BA 3QEOA 4MWSA 1PWZA 5IC4A 2JNWA 1WP4A 5JVDA 3DEFA 1M7HA 1W4LA 2W4MA 4OEHA 4UREA 5H4GA 3UMYA 3UPTA 1QFMA 1VB3A 4KSBA 4ZO8A 5AP9A 1W49A 1X87A 3RUPA 4K7JA 4LYAA 1GAWA 1QHEA 1MVNA 2ZRJA 1PT8A 4XYLA 1ZJWA 2ID9A 1OZFA 2VJLA 1S2NA 2X8WA 4JOCA 3H5WA 5AK3A 4KQIA 3RNLA 3T5GA 4LYFA 3DKKA 1TVCA 4PG6A 4FQ8A 4UUBA 3DFUA 3V1TC 1UJ4A 1Z88A 2ZLBA 3AB7A 5AWFC 2PS3A 3K1YA 4ZU3A 2O23A 4MRPA 3RC7A 3A6GA 3ZCTA 2X58A 3DBVO 2W6ZA 1SD5A 1N9KA 5JCZA 4P53A 1ZVMA 3M6VA 3ESXA 3WWDA 4DG5A 1Y63A 3JS5A 4D3YA 2P1RA 4DEVA 3NH9A 4C7BA 2YWHA 5JADA 1KAOA 5EKXA 1XDUA 3U31A 2VAPA 3S55A 4EJSB 2NN3C 1V96A 3C14C 1N92A 4RPCA 4XTCS 4Q93A 2O8EA 5CNIA 3ESDA 2VDQB 1I0IA 3F96A 5J23A 3MGKA 2HHAA 3NORA 5TLSA 3BGOS 2BUAA 1RJEA 4Z3DA 3UAGA 5K03A 2F4NA 1TUBA 2PUJA 1COZA 2JCYA 4NENB 4Q9LA 3H83A 5KI6A 1UJ2A 1AF7A 3QU4A 1ZRNA 4JT4A 5GJVC 4RK6A 3C3YA 4MP3A 5I9LA 3J81k 2QAGB 5JIBA 4I36A 4RAQA 3JQBA 3TI7A 2BHTA 3R5XA 4UARA 3T0IA 2QTCA 2WHRA 4FCVA 3HKBA 5JSZB 3DQQA 1XMJA 5A06A 2P78A 3FHOA 3QPBA 2B1JA 4JGIA 2QW1A 5KU1A 3OAAA 3C6XA 4S05A 4P6VF 1HE1C 1QO0A 4LJKA 2MDTA 1F2UB 1LBTA 3A3NA 4L5BA 4DLSA 2IS1A 1RYBA 3JYHA 2P91A 3GOHA 3PEVA 4G0VA 3BE4A 2VC2B 1U3WA 5JPCA 1T4GA 1JKXA 2R7LA 3QEJA 1TTTA 3AR2A 5EKTA 4RC9A 1W0KA 3ZWVA 3MAGA 5IBQA 4P7GA 3EGCA 1V7PC 2W6IA 1SXJB 4X6UA 3SCZA 3D9QX 1J70A 5I8ZA 3ZS9A 2ZWAA 4LXUA 3UJ8A 3X44A 1GPJA 1J23A 1PR9A 5JZBA 3KDSE 4PPGA 2XVYA 3B9BA 5JHHB 1OXSC 1VJTA 3KJFA 1NFQA 1MC1A 4KH0A 4BE7B 1SQSA 3SZOA 1GADO 2AKAB 3FYTA 3KZVA 3CUEF 2WM2A 4B4UA 1RZ3A 1SC3A 4N3GA 2XDAA 2L0XA 3BXPA 3HRHA 2C3PA 5HMLA 2I5PO 2V7QA 121PA 1ETUA 3IVGA 4L57A 2M6KA 4PR0A 1SC9A 3N8DA 1JXAA 5E6UA 1P19A 5ECDA 3I6ZA 3BRWD 1YC2A 5TMDA 3PXBA 1LW6E 3DMRA 3ZJYA 3AB3A 4UPDA 4I7EA 2RMKA 4BUZA 3DE5X 2ZYIA 2BGLA 1L7MA 2JARA 1D07A 4S3MA 5D1HA 3G9QA 1RYNA 5EWLA 4HNTA 2OHGA 2QZZA 3JARA 4FUQA 5DN9A 5AVZA 1NZDA 1LVGA 1PUJA 3U3XA 2E4WA 4N7MA 4CU5A 2YFYA 2WYUA 3IBYA 3NX4A 2HLNA 5JCXA 1A7UA 1U4NA 5TQVA 4YXFA 1T9KA 2C07A 2VDUE 2BMWA 1N25A 1BE0A 2B0JA 2QRPA 2WQZA 2XSZD 1XJWA 3PQ8A 5DTRA 3AF4A 1JWBB 1UXIA 2QTZA 2Y99A 3AOEA 3ZN2A 4IVPA 2H9IA 4EHLA 4H2DA 2EATA 2Q6TA 4NBRA 4C4YA 2ID7A 5BN3A 4MR7A 3D1LA 3OY7A 3MHTA 1KWKA 5IT0A 5LIPA 3UJCA 2B61A 3FSRA 3JWGA 3MVEA 4I1RA 1OI3A 2C4MA 2J6HA 1H0RA 2GEVA 2JAOA 2VOJA 5HS6A 4TVBA 4N18A 4TN5A 4C5CA 2GARA 5JNRA 2C4VA 1ILWA 2HOQA 1LX6A 2E82A 1ETHA 2PT9A 4AKIA 4DNOA 4KPYA 1A04A 3NHFA 3DV2A 1U2QA 3GELA 4N0MA 2AFHA 4MUMA 3HY4A 3U5TA 1OYWA 1PN3A 3WWZA 2WMYA 3HUFA 2NPFA 3RR2A 4AJPA 3ZNOA 4TKLA 4A2WA 3I76A 3W5CA 3OZUA 3RAFC 1SUAA 1YACA 2YUIA 3WGLA 4RJKA 4IIGA 1Z7EA 3BD9A 3MTQA 2P3LA 4GLFA 2D6FA 5CITA 2OHOA 5E4YA 5A1TA 1K6EA 1ZRSA 2ES4A 2F48A 1S0UA 2CBZA 2W6JD 2Y2UA 3BQ9A 3ST7A 4C0KA 3R76A 6ABPA 3C7KA 1WRBA 3DBRA 3JQ7A 2KBFA 1SOWA 1QHSA 2DPYA 1K8ZB 1CDZA 1N1DA 2FRDC 2O0KA 3BXFA 3KZNA 4FBMA 3R3XA 4GP7A 4JP3A 2IUUA 5T6MA 4IQ0A 3H99A 3JR7A 2IIBA 4DRXB 1W4AA 3THYA 4LXXA 1D8AA 2G17A 3HKCA 3F6PA 2J5KA 4TM8A 3W77A 1ONSA 1EXNA 3IJEB 2JIQA 3BUSA 4ND2A 4QPZA 5BVHB 1XQ6A 2JJ2D 2WU1A 1WB4A 1ZM4A 4KTVE 4X90A 1TYDE 4JA2A 2XA2A 4XE5A 5KDLA 5MFPA 5HKLA 5AJWA 2V7EA 3SYRA 3DLBA 2I7TA 2VNKA 1FE8A 3FCUB 1CY4A 3FAZA 3RC3A 4RHXA 2QD1A 1QBKC 4X3CA 3SC6A 3CJQA 3TPCA 3H2GA 2XQGA 4H31A 3V8PA 3TNDA 3RU3A 4N48A 3QGMA 3L0ZA 5IKOA 4OM8A 3UKDA 5I45A 4WECA 3WFIA 4R84A 4N65A 1XMVA 4NICA 5MHTA 3K05A 1TRHA 2QVGA 2WYIA 4KFSA 821PA 4RHEA 1MN6A 5BV8A 4JJEA 2C1EA 1NVVR 3JVDA 1QOPB 3BKXA 1YWGO 3TTSA 1P7PA 1SELA 4Q7JB 5ICCA 2AOVA 1YMUA 4LWQA 2QTVA 2Y66A 4CKEB 1ESZA 4KYUA 5BW4A 5C7LO 3GI1A 5C7YA 5KDOA 3TF5A 2ZVPX 3EIWA 2ETVA 4R9NA 3UW1A 2OVBA 1XEWX 3P20A 3ROEA 1RPZA 4NNPA 5H02A 1UFRA 1NR5A 2GFHA 3FWHA 4QT0A 4IMPA 4M7OA 2NSHA 1AXGA 5CAEB 2HYDA 1XIVA 2QHXA 4MV5A 3FA2A 2BFBB 4CV1A 3F3KA 4X7MA 4YRNA 1Y6GA 4J43A 3PA8A 1Z0IA 5J3JA 1A3CA 1XXHE 4FXPA 1MTOA 5LD2B 4KR7A 1QR6A 5ITVA 4CEHB 1NBWB 3LZDA 1NXVA 3QVXA 2BISA 3SMQA 2ZI3A 4L8FA 3KJQA 2R87A 3KNZA 1EWQA 3RYCA 1VP9A 4N0QA 1T3HA 2EX4A 3DF7A 4URZR 3I1FA 3IT1A 4F3NA 4DMMA 4F93B 1IUOA 2R48A 4BZZA 2A67A 3SQDA 4V0KA 3RREA 4NFSA 1N5OX 3SFVA 2KPOA 1T4MA 3TBFA 2WZCA 4AJ4A 4F3YA 2VYVD 1Z5WA 3OF5A 2Z8XA 4COOA 1CLEA 3KR2A 3KV1A 3NMUF 1HYHA 3OQHA 3S2GA 4BO8A 4YJHB 4QGFA 4EA8A 4LZOA 3ML1A 4GM0A 4XJXA 3W8EA 3TB4A 1BS1A 2AUTA 1EP3B 3D7MA 8ADHA 2AZTA 3NEAA 1SM4A 2HGSA 4UTPA 1VG9B 2VTVA 2PL9A 4YV1A 4K6FA 2ZSEA 4R1TA 3O2JA 1UODA 3H0EA 2C7VA 4BLQA 5LP6B 5FKJA 2OHVA 1ZZEA 1F4VA 1Z82A 1EAMA 4ZKDA 1W8IA 2H1LA 4TSFA 2HRZA 2G4LA 2W2QA 2XB4A 3OLQA 1MFPA 4LRSB 3O2NA 2J3MA 3BRSA 5J4LA 2Q41A 2H4ZA 2O8DA 4TXJA 1XF9A 4NABA 3D31A 1K5PA 1DJMA 2D74A 1HQYE 2Y0CA 3BWMA 3OZCA 3WA7A 3THWB 1UMKA 2D5IA 3UZUA 4XDHA 3WX0A 2PZEA 2AI1A 3W5IA 3P96A 1HFEL 1VGQA 3CSSA 5EIBD 1DTSA 2D06A 2YJ3A 1D1PA 3U4IA 1E2FA 3EVZA 1ZS9A 3W2EA 1LRLA 4RKWA 1FBNA 5CB4B 2V6MA 3A3OA 3DLHA 1HYGA 1BA2A 1UP7A 3G7NA 4LNHA 1PKEA 2RH4A 4HGYA 2V6JA 4QTXA 3W6UA 4RORA 4PYMA 2FMTA 2CLMB 3O84A 2Y6VA 3PDIB 2GLXA 1K5GA 2HSGA 1KE2A 2B7BA 2VZEA 5HX7A 1A98A 2H6EA 1Y8ZA 4BO1A 4D3DA 2P9JA 2QZSA 4I4CA 4IJUA 521PA 4RLHA 1UBMS 4GI3A 2O3TA 4OHOA 4PS0A 2EX0A 4R16A 3SD7A 4CIYA 1XTSA 4FMBB 4BX2A 4QATA 1AUVA 1H9AA 3H1BA 3O4GA 3QW4B 3PFFA 4G3XA 4I81A 4JJIA 5KHAA 5I7WA 5LXTA 1QIFA 1P45A 1J1UA 4RMIA 1UKEA 4HWGA 3U26A 3AHIA 4N0EA 4AFNA 4FOOA 4C1NA 1ZN9A 4ALJA 1Y8QB 4JBLA 1RM5A 2I4MA 4QREA 5FTMA 4C88A 5ULLA 2PX0A 3OIYA 2I7XA 1C1DB 5CIYA 1DELA 1L5MA 2FXIA 3PDHA 5AHOA 5JZVA 2NLOA 1JW9B 3PEWA 3AF3A 4IHJB 4NQRA 1HOTA 4A6XA 3EZLA 3AJDA 1NHWA 4MR9B 4DV3B 5EZQA 1HWYA 1SUDA 2Q0XA 4X95A 1LC0A 1IM2A 4C4RA 5KOJB 1IBKB 4WERA 1TCCA 5CEEA 4X65B 3MWDA 3UB2A 4ARCA 2XTZA 3BMQA 3FDXA 5K0CA 2BFPA 1JAYA 1RM4A 2FRDA 3HCOA 4MVJA 2VP2A 3ENKA 7REQB 2WFMA 4CQMB 4W7HA 1ZNWA 3CLSC 3EG9B 3FPKA 4DIDA 2GASA 4JYMA 2QVBA 3K0AB 8ATCA 3KLPX 3H9BA 3DJFA 5SY9A 1ZNYA 3GFRA 1KI1A 2BGMA 2Z9BA 3F8WA 3HJRA 4GKVA 4B2PA 1PQYA 1ZCBA 2OZVA 3DL0A 3K2EA 2WG2A 5KWEA 3H75A 3PFGA 5FA8A 4IIBA 1VZ3A 2BEWB 1W4CA 2PRJA 5AVRA 5DYGA 4AZWA 1PZMA 5JWHA 1PLLA 2HLDD 3HYSA 1QYXA 4NI5A 2O19A 4G9EA 4EHFA 2A9RA 2XDWA 5HDBB 3HRKA 4ZYVA 1YMVA 3OQVA 4UHJA 1ONPA 1P2SA 2JL1A 1NR1A 4C1BA 5JNWA 2HCJB 1A9XA 3RBXA 1EWKA 1D2NA 1GRNA 4OHPA 3JQ8B 1BS2A 1N0UA 5DXAA 4ADSG 2JCBA 3JCZA 1O8BA 4MAFA 4B6RA 1BE8A 3LUGA 5DX1A 4YALA 5A5FA 5EWMA 4EO7A 3DQPA 5B53A 1YXMA 3VPXA 1RWVA 1UFOA 2O14A 1L4YA 4AKTA 4YFYA 3JQGB 2O7NA 3MWYW 4B71A 5HWSA 1BDIA 1VXOA 3GCZA 4U00A 5ALRA 5REQA 4D97A 5A1JA 5HM6A 3S27A 4EABA 1BU5A 1J0XO 3V7UA 3OQMA 1ZBQA 2HCRA 5GJCA 3DKRA 4NU0A 4K2AA 2YL2A 1ORTA 2Z43A 4Q0MA 3HB1A 5C1DA 2YOHA 3L05A 3H5RA 4KVGA 1W0JA 1GVNB 2QE6A 5K8JB 3IR7A 2IELA 5IFLA 1G2QA 4GOND 5KJ1A 4TKVA 1CS0A 2LW7A 1RWBA 4LQLA 4AD8A 1T9CA 3QWHA 3C5EA 4W99A 3T3PB 3VKHA 1Y1PA 4KV9A 3QVKA 1XLTA 1Y4DE 4M88A 2DPGA 2HTFA 3G5MA 4KZKA 3SSAA 1SXQA 4EP1A 4IZ6A 2EGGA 2NUPB 3KB8A 8ABPA 1MU0A 1EVQA 4BBZA 3V8EA 1NP3A 1F12A 2E48A 1B23P 4E3WA 3F8TA 4NPCA 1GZUA 3RT7A 2ZE5A 4ZIRA 1YE8A 3CNOA 1VPDA 1J2YA 1E7WA 5TXGA 1XNJA 4YXWA 4WBNA 1JPVA 2NO9A 2QJTA 1LH0A 1IZ7A 2EAUA 1EWRA 2OAGA 3CMCO 3IQDB 5DDIP 1AHIA 1R0RE 2I8LA 2R5FA 2XAUA 3IYLW 1JHPA 1SB9A 1CT9A 2VK2A 3T35A 3H05A 2Q3FA 3QKSB 3QMMA 3LLSA 3UJHA 3C1OA 4KQ1A 4OY3A 3SF8A 3EEFA 4BNTA 3GD7A 2JIRA 1GCIA 3KKKA 2PY6A 4UD2A 1AE1A 4DXDA 2RHGB 2PJRA 4E94A 1E2UA 4O4JA 1H2YA 3V8MA 2DBYA 1BXGB 1PG0A 1RQGA 4N54A 4F5WA 1J0DA 1JAHA 5EESA 4UUAA 3TD9A 1UPXA 2YQ5A 3O8QB 4YJGA 4AWXA 2CSXA 1PKXA 3RV4A 1I6LA 4OXIA 3GYGA 2P4UA 3WGGA 3DDOA 3IEIA 3ZE8A 3W5AA 2AGVA 2QRJA 1H2HA 1OKKA 5ALDA 4F86A 4BY9E 3GVIA 4KDRA 2JHGA 3ROTA 1XRMA 1GKKA 1KZYC 2O50A 4AF6A 2C8KA 4TQGA 1IHYA 1PE0A 4RJLA 3KZ1E 4TTVA 2AI3A 4TTTS 5LP6F 1WD5A 2X5JO 1NTRA 1X2BA 3KPYA 1Q0HA 4K81B 1HDGO 3D7LA 1K5DA 4B7UA 4C01A 3D4LA 2ACWA 2ODBA 1SMKA 4RKYA 5EXDA 3KQTA 1M6VA 1J56A 3MWGA 2ZBGA 4DR4B 1H8EA 1YFKA 2BH9A 1LGYA 3OEEA 3QW2A 5EWJB 3GGJA 5B1SA 3ZY5A 4EDHA 4HYYA 3EF0A 4NCIA 2VH1A 3PX2A 3FOFC 2GPTA 2HPHA 3A06A 2BWJA 4EFLA 1A8IA 4U7TB 3RSGA 3V7NA 4XQEA 3Q2IA 2OBMA 3INYA 4LNUB 1RJGA 1YOBA 2BP7B 4DIEA 2VHWA 2CXPA 4MLPA 2PL3A 4D57A 5CB4F 1RADA 1YDMA 3QEMB 3FF4A 1XZIA 2F9LA 2P9GA 1P0MA 4IHKA 3ZYZA 2HHLA 4YK7A 3VR4H 1NLYA 5I5GA 4S1PA 3AL2A 4ZC1A 1G9TA 1JP7A 4QUDA 1FUIA 3N2KB 3DXXA 2C2XA 2Y2VA 3GB9A 3Q3VA 4NFYA 2EJCA 4D44A 5BMVB 3R77A 2XCUA 4AMBA 4ZQFA 4Y9TA 2XHZA 3TDNA 5DK6A 3IE0A 4LOAA 1HFWA 4W1RA 5DHQA 1QUFA 1UR5A 2AUNA 1QRSA 5G2OA 4CLOB 4HQKA 5CFMA 1L3CA 3ELUA 3RRXA 2MINA 2OCDA 2C0CA 3G6KA 4HNUA 2NQ8A 1AHNA 4HEA6 1R66A 2W7TA 2X3FA 2B6NA 1OI2A 3K35A 4DV6B 3MUEA 4IHJF 3AHDA 5AH0A 3GRAA 3O6VA 4EFKA 1CB0A 3QELB 5CYFA 2P3QA 2Q1WA 5C34B 4CUZA 13PKA 4QO8A 3DAFA 4BTVA 3AY7A 1OILA 4MIYA 2MSWA 3UGQA 4OMFG 1O9BA 3WQSB 5F12A 4BNDB 2H07A 1F2VA 5FFFA 1E20A 1MABB 4HDAA 4JJGA 4WOBA 2WVJA 2C59A 3OQJA 3RABA 2PQ0A 1QVVA 2FW9A 1BQEA 3KJHA 4LV6A 3BERA 1AXRA 2CF5A 3LT5A 1UXGA 3CR8A 3BFXA 4J49A 4PC1A 2FLWA 3R5JA 4KB5A 2J7PD 3VPHA 5LN1A 4CDNA 2NVWA 4OJYA 1N4AA 2ZRLA 1G55A 3N6XA 3DA8A 1SA0A 2LCIA 1UBJS 2OAEA 2ZYHA 2O57A 4AW9A 2YVKA 5DI3B 4P4SA 1QRRA 1J0BA 4UBKA 1L5VA 2G63A 3JD2A 3REFA 4YMLA 4C6HA 4BGDA 1EK1A 3I9KA 1ECLA 4I4TB 1EP9A 1CE8A 3WNBA 1N3BA 1UP4A 1AX9A 2EP5A 3BC1A 3QWIA 4MMZB 1MO6A 2EHJA 4NDAA 3TQQA 4CEJB 1BKDR 2D1YA 3K16A 1KK1A 2HUNA 1TU3A 4RY9A 1R4MB 3HU1A 3AEZA 3SOZA 3SYNA 2IUFA 4F4FA 1NNSA 1OC4A 3OCXA 3Q87B 4MS3A 4ZXPA 2GB4A 1CYEA 4KXMA 1IULA 1KC3A 2LV8A 3O1HB 4R6XA 1J6UA 3N76A 4Y1EA 3D3JA 4F2PA 2HMUA 3T1HB 1EI9A 2CNBA 3WVNA 4MRSA 4A6DA 4D8UA 2WDZA 3ROMA 4RD6A 4DJJA 1C0EA 1TQDA 4FR5A 4ND6A 5HKKD 3MJRA 2CNWD 3ZGVA 5AVJA 2G0NA 3OOSA 2O8CA 1QHHA 4MCHA 2CMKA 3NONA 2FWAA 2QNBA 1XA4A 3BVPA 3IP9A 4QUGA 5GV7A 3UOGA 5CCXA 2Q4TA 2ZBDA 3UF0A 3ZZNA 1DT5A 1KERA 1W8DA 2RARA 3D4OA 1QC5B 3X1WA 2DUMA 1KSFX 4WCFC 2F1IA 3CNEA 1ULBA 2I4OA 4FHZA 4YJFA 2X2FA 4NPHA 4AJ2A 3NVMB 4BP8A 2FETA 1GG5A 2QMQA 1HY3A 2RAFA 4B2IA 4UAVA 3UBMA 5KJEA 4LEIA 3M4XA 5CFZA 5B58T 1HE8B 4M0PA 2LCFA 4IEEA 3QV1A 4AXXA 4EFNA 2YIVX 4CMAA 2AN1A 4IDQA 4QXRA 5GWXA 5LQAA 3DT8A 1U11A 3CF4G 3QHQA 4KG7A 2Q6OA 1H1TA 5JROA 1ZITA 5JSHA 2DFNA 3MS4A 3MGBA 3SQLA 2XADA 2FQWA 3VDMA 4KWHA 1TGVA 1WBJB 1JA1A 1I1HA 3IV6A 3LHSA 4QWMA 1KJYA 3RYFB 2BGNA 2IDMA 1PR4A 2C83A 3BQNB 1ZJYA 2DQZA 4XYMA 1T9AA 1USUA 3U3JA 3STVA 4Y67A 4Y2SA 5I8PA 2QN3A 3NDRA 1WUKS 3OOWA 4EY7A 5FBZA 2OLEA 3BL5A 4OBWA 3W5VA 1H94A 1YR9A 5IJAA 2WM9B 3WMEA 1UBKS 4DBZA 5G0UA 5DGHA 4PZYA 1XZPA 1CP3A 4KR0A 5K0ZA 1TZCA 2YHIB 1JYSA 3I6IA 4NE2A 1F8GA 5FT9A 4C6TA 1QQ7A 1Y1RA 2ASVA 1SU4A 3CH4B 4MYDA 1CUZA 2XIJA 2A57A 1TECE 5CP8A 1H6AA 3DTNA 3WIOA 1TCUA 4LIPD 2HZBA 1XCLA 3VR5H 2V4MA 3S7TA 5DHUA 5DXFA 3BRWA 3HL0A 3GP5A 3PPWA 1TUGA 3EA0A 4EDFA 5B6PA 1PIWA 1L8LA 2RI6A 4MICA 5B55A 4HJRA 2G08A 5H1YA 1P4GA 1CULC 2GHIA 2YJNA 3FTQA 1CNFA 1XAHA 1KR2A 2GD6A 1P91A 1TYAE 2I8CA 4IDDA 5C7IO 1ZEMA 1XQXA 5T6BA 4CMGA 2OXCA 2WJ6A 3QH4A 3ODPA 3C3KA 3M1LA 3IUEA 1IZ0A 3ERCA 2XSZA 5EIBC 4X63A 1H2FA 1NOJA 1VFNA 3CXRA 3EQZA 3ZWXA 2VPIA 3MRVA 4CBVA 3S8EA 2JCVA 4UU0A 1V11A 3HCAA 4G4GA 2PUVA 5BMVF 1FU7A 2ZJOA 3BFPA 2Z5VA 4XJVA 3C98A 4RYDA 1GZ4A 5EYPA 3A6ZA 2Z2JA 1AQNA 2ODAA 3DOHA 4W63A 1OY1A 2M6SA 3D3WA 3RH0A 4EB0A 1EG2A 5ITZA 4K9OA 1MC4A 3ZDCA 3EN0A 1OFGA 2QG4A 1PRYA 2CDBA 5CM2Z 4A7PA 1H2AS 4YFVA 1SC1A 2WIKA 3WKDA 1AN9A 1U99A 4KE7A 2Q5FA 3ZBPA 1WU7A 1W93A 1UMCB 5BNFA 1YV9A 1HXHA 2OUIA 5ALQA 3A6LA 2V55B 5EEGA 2ERXA 3GH3A 3ORRA 4FXOA 3U4AA 2AFIA 3CUTA 1HH4A 3P0HA 3ONWA 3MTBA 3WGIA 2WAOA 2N0SA 5AQ1A 2Q3EA 1D9ZA 3MJTA 1M1YE 2MSLA 1E8MA 1QP0A 3P9YA 4D92A 3VU0A 4EVRA 5A0VA 4X84A 4N1AA 5C18A 4Q47A 3PWSA 1I33A 2UYGA 2H8KA 2BONA 1IY9A 3LSYA 2GPSA 3MCTA 1T26A 3IPYA 4ZAYA 1Y9AA 5FHQA 3OE7D 5G4KB 3SSOA 2RGRA 3UHFA 5ADVA 4OGKA 2UZ0A 5K8VA 1VSUA 2FFJA 1KI7A 5DO9A 2GRJA 3IE2A 3FSEA 1TJ4A 1JQJC 3B20A 2ZVDA 1SVSA 3IBSA 3HDGA 4F97A 2H85A 5L9AA 2QAIA 4ZMSA 1DTEA 2C92A 2H4XA 2G06A 3LUHA 4Q4JA 2YV1A 1R0LA 3JTEA 2B2NA 3WISA 2GUWA 3B6EA 3EGWA 3KUUA 1YA8A 4FJ0A 4I4TF 5F7XA 1G6HA 1BWPA 1X7HA 4A26A 1UQUA 2X6QA 1NUAA 3KM0A 2J3QA 4CM9A 4DLBA 3RSCA 2JLYA 1ADFA 1E60A 1XAIA 2JJ2A 1GLVA 1XD2B 4B82A 1E3SA 3FDZA 4MQUA 5CCDA 4ZI7B 3K1AB 3I73A 2F90A 5DXJA 5HDQA 1CRWG 4BNYA 2HA0A 1QGUA 4BC1A 1R5NA 4D0NA 5DHSA 5T7BA 2VYQA 3WWCA 4HDMA 2JHPA 6LDHA 4G9GA 5AI5A 3R7AA 3WLLA 3CCFA 2NXEA 3QFFA 4DUYB 3N0XA 2XE7A 1NTOA 2CYAA 5B3KA 3CF0A 2IZOA 2PSEA 2CD9A 1ZCZA 4GRDA 4G1UC 3A26A 3KQNA 2J4FA 2R7NA 4FFNA 1SOVA 3A4MA 4LX8A 2WHEA 1X1SA 3KD2A 3WK9A 5MN4A 2L69A 2PAFA 3AUYA 4WCFA 2IV2X 4GOXA 5KIAA 1BN6A 2FPSA 3ILXA 4PCAA 1H4SA 4RU1A 3VC1A 1I7NA 5HIMA 1QPZA 3MT0A 2DE0X 1DXOA 2JH3A 1EKXA 1CDDA 2AEMA 2YWRA 3IPAA 4O1MA 2G8NA 4I4LA 2ZZNA 4GYWA 3UNXA 3ZWDA 1SZCA 3OQIB 2I03A 4FMDB 5EE9A 2AJDA 2G07A 1NI4A 2V58A 1N9ZA 4HH3C 3MGCA 3RSZA 3UGTA 4CIXA 3U4QB 2DXIA 5E7QA 1OH5A 2ZRHA 2OCGA 1BDMA 1ZY2A 3ZHZA 4RVOA 5CFNA 4RHCA 3I04M 5K4HA 4Y6PA 2QN2A 5I48A 1XE3A 4RWZA 3ESCA 2PWBA 4BLOA 2X86A 4F6CA 5CEJA 3KOMA 3WHLA 3L6CA 2Y9PB 1JIXA 1Q0LA 1HNZB 1B8VA 3H2SA 4PHFA 3DT9A 4R0NA 1RMYA 3C39A 1TM3E 2NZJA 3FOAA 3JTMA 4NCHA 1PS9A 2IP4A 2Y92A 2AG5A 2NXJA 4Y98A 4CUJA 4KR2A 1ZHFA 3Q15C 3BORA 1Z7YA 4G09A 3V97A 1SFRA 2HJ9A 1UWVA 1PL7A 2OBNA 1JRLA 3EIEA 3K0FB 1YVPA 3O8OB 2BDUA 3K53A 2PYDA 2X0EA 5A3RA 3V1UA 1V9LA 1QG6A 4REQB 4YTEA 1MX9A 2VYVA 3GK3A 3SVLA 1E77A 3MCUA 2X2OA 3NBXX 4MRMA 3IEPA 3AFOA 4R81A 4MPTA 4ZYLA 1CCWA 1E1RD 3OESA 3S7ZA 5AESA 1LJ8A 1H3NA 1JVBA 1WF3A 3GFQA 4TT3A 4UTXA 1OF1A 1Z07A 3KCNA 2GOYA 5DBFA 2PGIA 3THSA 4Q1CA 3V8RA 1J97A 3A05A 3FLBA 4TLBA 2R4TA 4LHXA 4DQ0A 4EHAA 5FBVB 3RD5A 2VLBA 3ABQB 1DLIA 3M0EA 4HRYA 5JXJA 3G79A 3GFBA 1ZVQA 1WE2A 1VCMA 3HDJA 4RJTA 3RIYA 1B6RA 1YGPA 5FBQB 3G85A 4E5VA 2WINI 4EPRA 5I3CA 1PV4A 2O2EA 4Q66C 2O4UX 2Z0MA 2R7MA 4QOSA 1CFJA 4GZ6A 4K87A 5F7ZA 3AEUB 4ACAA 1JG1A 4CM4A 4KK4A 2FP3A 4PG7A 4PSCA 1GXSB 1E3DA 3EIUA 3I5XA 1NATA 1VI6A 2G9NA 1XTQA 4AB1A 3FPGA 4N8SA 4EX7A 3DTTA 3EYWA 5TQ2B 3IQHX 3PL5A 2C57A 4GVPA 3N7AA 5YASA 5BUQA 1E0AA 4PIMA 1FLNA 1TO6A 3F4KA 4CLXA 2FMXA 1VE5A 2QRGA 1CUYA 5IRCD 5JCJA 3HYNA 3T7AA 5G0SA 1D6NA 3BFJA 4QUIA 2DCUA 1E62A 5CTAA 3PIRA 2IYEA 2ZSHA 4P3NA 1WOYA 3K4QA 3PFHA 2BDTA 1P73A 3MERA 2V7PA 5E4FA 4B5LA 2W0MA 2DETA 5CVCA 2CXNA 2JDID 4PM4A 1IONA 5EINA 3PGJA 4FHDA 3WFZA 1EIWA 3DGFC 4XTRA 2F6RA 1SEVA 2CV1A 1PNRA 1U9CA 2Q5EA 2Z8YA 4HMQA 1G60A 3SJAA 3L7BA 4PLHA 1E3WB 1EFUA 2NZ8A 4H08A 5FJIA 3C7AA 2QV0A 3TOZA 4XJSA 4TS9A 1ORRA 1QHXA 1YZUA 2YWFA 1ST3A 4N6NA 4RUKA 1GGNA 3D8TA 1DXYA 3OC0A 3S2FA 3EK2A 3BCHA 4WVLA 4CGZA 4GYYA 4DV4B 1ICEA 1N6NA 1FFXA 4M0LA 4RTJA 4JA0A 6YASA 3VC3A 5LWQA 5TC4A 4WFJA 1DDGA 1KC1A 4QOHA 4V1CA 3I2KA 4OU4A 5BNIA 1NW5A 1H9BA 4F6LA 2V4UA 2KHZA 3FIJA 3I9V6 2NTYC 3E5MA 2VCEA 2ODTX 4IIEA 1H5NA 3NIBA 2O1XA 4FFBA 3B52X 3V4RA 3V00A 4NCBA 2WSLA 5JAHA 3DLPX 4EG0A 2P9EA 3N87A 1UAYA 1OZ0A 4XM0A 1B8NA 3KPJA 1QQTA 3FHJA 1KOLA 2RIRA 3OP4A 1A50B 4ZVNA 1O6BA 5BWNA 2HJVA 3KTAB 1ENOA 4ZICA 3RC8A 1YHYA 1SUIA 2ID8A 1L4FA 3C1TA 2XRFA 3ZY6A 1Z0DA 1HR0B 1UJ6A 2IDJA 4R4JA 1DEHA 3L2OB 3VGJA 4ER0A 3GLIE 3P94A 4O59O 3ACDA 1J7KA 3W7AA 2YFKA 4YMGA 3SNHA 2IXFA 3HPRA 3VR6H 2DY0A 4PC2A 2I2FA 2HLDA 1VJ5A 1U0FA 2NW6A 1C5KA 1KARA 1P7YA 2GFIA 3IHTA 4FIDA 4NESA 4RADA 421PA 3NHPA 4DTCA 1HE3A 3SC2A 9LDBA 1Y6FA 2VQFB 4C2UA 1C7FA 2YR0A 1QIIA 2GHRA 2LKDA 3PVSA 4S1OA 2BSXA 2MCFA 4OV6B 3JPYA 2CUNA 3KOYA 2NZ2A 2QD2A 1SC4A 5IUNC 4W7SA 1DQRA 3DXYA 2JVJA 3P0JA 3WLIA 4BV2A 4EEKA 5G41A 3A1VA 3WWEA 5JPIA 3HABA 2C2OA 4DWVA 1H2WA 4GGPA 3RS2A 3ZI4A 1O77A 4IJKA 4K86A 4DVGA 4QFBA 4S12A 2O7QA 5JCPA 4C7XA 2GBLC 2P0AA 2XJ4A 1Z68A 4D9JA 3U3MA 3IBFA 3O95A 1QIMA 2IH4A 1XA3A 2NV6A 2OP0A 1QB7A 1RIFA 2FG5A 3A8TA 1KEWA 3BL8A 3HJBA 4OQFA 3BXXA 1GPH1 3CPHA 3ZBQA 3ZQ6A 1X7DA 4OKIA 4D80A 3L7IA 4ZI2A 4MIEA 4FMDF 1ZHOA 1MEOA 1F3OA 2PBZA 1VOTA 4AKGA 3HNRA 3EXG2 3I1JA 2AQIA 2JLBA 2R47A 3M9WA 3MB8A 3FNGA 5BW8A 1YQGA 5KNCD 1K63A 2FHPA 2WFLA 3KS9A 1E92A 2NZUG 3ILVA 3MMXA 4J03A 1YK0A 4GPBA 1SKAA 3MMZA 1PZEA 2Q6KA 1M1ZA 2AG8A 3M1IA 3ONVA 1KNQA 2NSDA 1YQDA 3PUXA 2YCBA 4G4IA 5J4YA 3BS4A 1U7PA 5FF9A 3IA7A 1AO3A 4IIVA 1DQPA 2VUHB 2Z4TA 2RGEA 2ATXA 3P19A 2P4SA 2GSDA 1XVVA 3CWZA 1ILEA 1WV0A 4FQ5A 3WLEA 1NMEA 4D8XA 3EPRA 4GM1A 2R5WA 3U39A 4J0GA 1NDHA 1L6IA 3LFHA 3ANSA 3WGNA 2P6PA 1ESMA 1G8YA 2OM6A 1XK7A 3KAPA 3DOIA 1IEXA 4XVQA 3DEKA 1XMQB 3LLMA 2WJVA 2QG9A 1IQ0A 3A9CA 3GNQA 1VCOA 3R6GA 2IKQA 4Z53A 2RK3A 2V7VA 3B13B 2IYVA 4L4YA 1JQAA 1U1EA 4DGSA 2BGTA 3NM5A 2VNIA 3JQQA 4AAYA 4DZRA 4QXPA 4LTNA 4LK3A 1E4YA 2B4QA 1USWA 5FIUA 4UUPA 1RHKA 3PT5A 4KMOA 3TX2A 4WKNA 1U6JA 4G0YA 1ZK2A 2CHEA 4E6EA 4GI7A 3A6JA 3B6KA 2BEVB 3N2EA 2QQGA 2Z95A 1NIPA 4AJIA 2PZMA 4G26A 4KZPA 5KNLA 1OLSA 4YT8A 1CRLA 1TQ6A 2BZ0A 4P92A 4G84A 2ZR7A 1EFPA 3EDQA 3IDOA 1ZXBA 1P6UA 3K5PA 4ZCIA 1V41E 4CL2A 1EB8A 1O54A 3P27A 2H5JA 3FH0A 3AM1A 1X7ZB 4JFRA 4B3HA 3RJ5A 1FYFA 4C08A 5M5BA 4AKHA 1MNQA 1JHMA 1Q3HA 4R2LA 1XRLA 4J75A 2DHQA 3BMCA 4OK5A 4RMGA 1JR3D 2R6AA 4RPJA 5IF3A 2A9VA 2XNSA 4CV2A 1X7WB 2ZGVA 1PJLA 3IIEA 4FD3A 4AM8A 4DSOA 3S2UA 4Z7NB 1XKLA 5B4VA 1MGOA 5A6SA 3EWAA 2EKDA 3CM0A 1YDEA 4OHCA 4KACA 3SZMA 2G8LA 4E5UA 1TGYA 2X8AA 1HBJA 2PV0A 5HBRA 5L3ZA 4CMBA 1Z62A 3PKIA 2BZGA 1GILA 3COJA 1T4CB 1WDTA 2AJLI 4KVFA 1S9HA 3U0VA 3URMA 4ENPA 1MX1A 3CW2A 4MRRA 4E08A 1G63A 1JG6A 1X0XA 2ZBQA 3RJMA 3B3GA 3K73O 1P6QA 1FP1D 1E5DA 1E6EA 3U3ZA 2XQFA 4LJAA 4X7RA 4I9UA 1C7RA 2O52A 4OBEA 5C1BA 4WN9A 4WA7A 2QUIA 2ZUSA 3KKEA 5IABA 4OFZA 4P33A 1J5PA 3TW6A 3O93A 1N2CA 3HWSA 1GU0A 3QLVC 4EELA 1Y3DE 4QJIA 4ZQGA 3GPCA 3OSZA 4RHYA 2F43A 4NHOA 2Z8YM 3PC2A 1I4LD 2HM7A 2VJMB 3TCKA 2Q62A 2X42A 1P18A 3ZWOA 3Q7IA 4OUDA 3FB4A 2NVUB 1M1NA 5EG5A 3EZXA 5GPBA 1BYIA 1FJHA 1Q91A 1SKUA 3KXKA 1P75A 3PFBA 4MZDA 2D8MA 4YAFA 4ZAWA 2ZBUA 1DG1G 2E6UX 3RYHB 4IDFA 1Y1SA 2R25B 2NO4A 1I4WA 2G5CA 4WZZA 5ARCA 4DILA 4C7OA 3EASA 3MINA 3K72B 5GOZA 1PQPA 4QA9A 4NEQA 3GAAA 4WK2B 5ESRA 1X19A 2IOHA 2LDBA 3OZ7A 3COSA 4H1HA 3ORFA 1USGA 1EESA 1OWPA 1YC5A 2RGWA 4NECA 5LDGA 1KRXA 1A5AB 2M6LA 4ZT7A 2TRSB 1KI2A 3K92A 3NC4A 4W5JA 1XNHA 3N6VA 4IIHA 3W06A 5EE5B 1FB5A 4ZARA 2APJA 3HBMA 4WBXC 4UEQA 4UM9B 1QYWA 3KTDA 2D2VA 4MGHA 5BQFA 4WZBB 3RVQA 2ODPA 3HV0A 3C41J 5IEJA 1TF7A 2UYYA 3MRSA 3P45A 4IXNA 5EZ6B 1BFDA 1LJUA 1MRSA 3RKRA 3V1LA 4DARA 4RDXA 5C53B 4UDYX 4PU0A 4RBNA 3W8RA 2G4VA 1S3FA 1KBZA 3BGSA 3IP8A 5BW6B 4RENA 3FPLA 1RIIA 4LGVA 5BSGA 2GBLA 3J80A 1JQBA 1T2CA 2DFKB 1JMVA 2VWQA 5LQRA 4KXWA 2H1CA 2W6CX 2VK8A 5HKKA 5NLLA 2OT3B 2XRYA 2GI4A 2BR3A 4O4LB 3H11A 3FWKA 3UC9A 3NKLA 4ZQCB 1WMDA 5EIEA 2IYWA 1TA9A 3MCVA 1L1QA 1R0YA 4YMIA 3DVLA 3PEFA 2NNLD 1HORA 1M74A 2D2FA 4NMMA 1OH7A 3HCDA 3KZOA 3HCWA 4O8CA 2ZETA 3AR8A 5KINB 4BMYA 3GLGA 1H1DA 2CK3D 1JFFA 2O2JA 4WXPA 4W5NA 1C7IA 1SIBE 3BXHA 3KSUA 4KC0A 4XRRA 3QE3A 3RFCA 3TPFA 3WGUA 1FYWA 2NMVA 1XJ0A 1RXYA 2IHZA 2J5RA 2QAGC 3DR5A 1VL8A 2ATIA 4GQAA 4RACA 2HMTA 2OYRA 2XRZA 3P5BA 3MJHA 3MS7A 3H87A 1S8FA 1KOFA 3JV7A 1Y1KE 4FOSA 4JLPA 4Y2QA 2OV6A 2PNFA 4J4BA 4R9SA 5ANRB 5K3FB 3ZHRA 5D3ZA 4GZMA 3QX7A 1C4OA 1EFDN 1U8ZA 3BZBA 1N1GA 1OGIA 2EIXA 3PP8A 1HQKA 3HKDB 2MYUA 1V7CA 3LK7A 1PHRA 1J1IA 2QN9A 4P4NA 1ZQ9A 4M6WA 5KPDA 1K0FA 1X9GA 3TSAA 4M49A 4S24A 3RF7A 3UUFA 4BNVA 3WJ2A 4FS3A 2VWGA 4BE4A 3RTDA 5B3JC 4I5GA 4W5HA 1EWVA 1JXQA 2ZQYA 2R65A 1NA5A 4OGFA 5HFJA 3VR5A 4F2DA 1GL6A 1DZ3A 2AOXA 1JLSA 1MV8A 3E3NA 2FQXA 5DLPA 1I32A 3L79A 1HUQA 3L84A 1IC6A 1RLIA 2EFHB 2G1PA 4TKMA 3IKJA 3DLIA 2P40A 4EEXA 1Z8FA 4CIWA 5I8WA 4X8MA 3D2BA 1T4DA 1TJYA 2G83A 3P5SA 3G9TA 4A27A 3K0HA 1RLJA 3DD1A 1B76A 3LU1A 3L7DA 5L45A 4PYIA 2POCA 2OC9A 3UKOA 1GFZA 5KNCH 3EY4A 2QLNA 4TMKA 5A2GA 4Z9YA 1M83A 2QXUA 5I7AA 1QHIA 4M3NA 5HTOA 3E81A 1VYUA 3IAHA 1MBZA 4B7AA 1Q0RA 1M2JA 4EM6A 4R2HA 4FGSA 4CPDA 3K4HA 2X0KA 1JJFA 2QE7D 3PITA 4KO3S 3UV7A 1W34A 2RHMA 2WSSD 4QDOA 4MO9A 4EFDA 4ER5A 2SKCA 1EGQA 5JJKA 1X1DA 1EFVB 5ADHA 5KO2A 4OX9Y 3E82A 2VYCA 2WWVD 3HSYA 3OOHA 2XCIA 1UT8A 4MWDA 2GJSA 5J1SB 3V8VA 1UH5A 2QUAA 4FOTA 1J0CA 5FOQA 3BFKA 1P3Y1 3AHHA 3OMLA 3HFSA 1NBAA 2WIFA 2V1XA 4O2BA 3U81A 1PZFA 1QB8A 1VCHA 1U0JA 2G0TA 5DT9A 1Z35A 3C3MA 1RM3A 4ZMRA 3N2ZB 3QWAA 5JU6A 3KAQA 4UBMA 4GI2A 4X62B 1NMZA 3GRUA 4PEVA 1D4ZA 1VIYA 1JIKA 1YTUA 5DH9A 2YY6A 1DWQA 1S01A 2IFTA 3F7NA 2ENUA 5H3LA 1MX5A 1YE3A 3BGWA 4AMGA 3UIEA 4MKRA 1O95C 1P5JA 1P7ZA 1B15A 2F8MA 2WIGA 4BQQA 3GZTB 1VHQA 5KNBH 5EUBA 4B3GA 4UDNA 3DWIA 1R0SA 1VBKA 1I2DA 1I2ZA 3BH7A 3KYCA 3QLVA 5EHGA 4S0XA 3RSSA 3ADCA 4OD0A 1YR6A 2OBLA 3IO5A 2QN7A 1B8UA 3ZU3A 1DWOA 3K5WA 1RNLA 3QG1A 3GFGA 2C4KA 3R5HA 1V2GA 2NUTA 4N03A 4CI0B 3DOCA 4RK1A 2GK3A 1G3QA 1U0SY 3L7NA 4CF5A 4F9FA 3EXHC 3DMDA 1IRIA 2ZRIA 1NQWA 4LXGA 4L5YA 3HJFA 2FEWB 5ALEA 1A5TA 2OC4A 2YVQA 4JASB 4PO8A 3W4KA 3WK7A 3C24A 3T4UA 3WBBA 4KPUB 4R1OA 4DUZB 4Q3AA 2JEOA 2Z08A 1ZU4A 4LVUA 2H1FA 3H7IA 4D4JA 1QBGA 1WP9A 1GUBA 3CPEA 3T9BA 1V7ZA 5D5QA 3C7DB 1NXXA 2JD0A 2NU6B 2Z2ZA 4FCCA 5UKDA 5KYTA 4LC1A 4RY0A 5DYWA 4KHZA 2FCRA 1XD8A 2YUTA 5C52B 1M2WA 3UJ7A 3E22B 3DV0A 2FCAA 3U6BA 3SX0A 4HAZA 3TUZC 3ZV7A 4RLSA 4R7ZA 5KB3A 3PUVA 2V6BA 2I6XA 4ID9A 4OREX 1ZD9A 2XEXA 3IALA 4BMXA 2V7GA 3GIWA 2J3EA 3MN1A 1G20B 4H4DA 5A4IS 4ZD6A 2XIQA 4LZPA 4R41A 5CFPA 2C84A 3GT4A 3NM4A 2CLDX 3STWA 2AX3A 2DCMA 1WX1A 4XQCA 4DBLE 3KEQA 5JNTA 1EK2A 2KM1A 2E87A 1VHWA 1XU9A 1UFQA 4NVRA 1JZTA 1T5HX 4PSAA 5F64A 3VKUA 3O4FA 2P9TA 1I1OA 4P38A 3KYJB 4MQ5A 1KFBB 5TMBA 4TSRA 3LBHA 2ZRCA 2JS7A 5JD4A 4R1SA 1U1IA 5LPNA 2AD1A 5G3YA 2O20A 3VNAA 2OQRA 3I8OA 2JCSA 2ZI6A 5KHLB 3T1TA 3TBHA 5KQGA 3ZWBA 1FUKA 3OIFA 1WSBA 4BLPA 1BO6A 2H1VA 4XD7D 1JH9A 4P4LA 4O4LF 2RGAA 3R5TA 1GLGA 4PLYA 3DEAA 3M82A 3G82C 4V0QA 1OLOA 1QGED 1OX5A 4DMRA 4WJKB 1GL7A 4ZVMA 4BZXA 3CVOA 2C98A 2HNAA 1I2BA 3IRUA 3L4SO 1H0HA 2WUEA 2XB8A 4RA9B 3EZYA 1X74A 2WYOA 4HWTA 2E4XA 3IMKA 4PHTA 3ZR4B 3ZU5A 1B00A 3KQMA 5DGDA 4EG5A 4ZAZA 4NENA 1G41A 5INTA 4C2TA 4ZK6A 2YRXA 4JZKA 4LMAA 4BV3A 4DCSA 2QAGA 3Q8MA 3D6JA 1DPFA 4G0MA 1PT7A 1FVXA 5K20A 2OBYA 3BMNB 2VP3A 4YCMA 1KDTA 3TEJA 3LJKA 2QRUA 5JSZA 2C9ZA 1EDZA 4AS1A 4KV7A 3KRTA 1NUHA 3GEIA 2HF7A 3JYNA 1XLUA 2A0YA 1Z6PA 1DKRA 1PW7A 1QGDA 1LVHA 2J3IA 4N0PA 1NOIA 1XA0A 2VT2A 3LWBA 1CJBA 4INOA 4XUDA 4TYWA 2HLPA 4BOYA 1DJNA 3NYWA 5M29A 4EA9A 1BJRE 2IP2A 5D3QA 1JJ7A 2PIDA 1J9ZA 1EM6A 3DOEA 1T2FA 2NYVA 1YIAA 2VLIA 2RC6A 5EL0A 4DWWA 5JWOA 4KMRA 1J4AA 2XITA 3BPSA 2FW8A 3FNEA 1X1BA 4WGFA 3OMXA 1SZPA 2O2SA 1C7ZA 4MUHA 5K3OA 1PV1A 3H1GA 4Y1RB 3IKMB 2WB2A 2Q6LA 3PEEA 2R6FA 1HE2A 1JDBB 1QIKA 2NYAA 4XVRA 3RG2A 1O89A 1QG0A 4HFJA 2Q9UA 3P2EA 4U02A 2JEYA 1N2XA 1Q7EA 1WU8A 5KYYA 5FPYA 5DM1A 5F73A 3LIPA 1TT5B 2CEKA 4DLTA 3AC0A 2PUDA 4XFKA 3AXSA 1E1RA 4AUKA 1DXHA 4MHTA 2VHJA 1KETA 2PMKA 1WUJS 2ZS9A 2I4LA 2B4TO 4I8XA 3LW7A 3OHPA 3HO1A 3N3AC 5JDCC 5LP6C 3A9RA 2XKAA 1KRWA 2XR1A 2YVUA 3BTSA 3KXIA 1SVKA 2ZCVA 2WU8A 3B7PA 4INZA 3ADPA 3NC1C 2J9ZB 5DCWA 5TEVA 1GAEO 1P2DA 2D7JA 1OBVA 1RAHA 5A05A 1KH2A 4CZ2A 1BNCA 4J07A 2K2WA 4BAZA 4IWNA 2Y0DA 5JANA 1C4XA 3B5IA 3NRJA 3IVAA 2BMAA 5A71A 2WLTA 1J2UA 1GAQA 4K40A 1U1FA 2LNDA 4HN9A 4AIIA 3W5SA 5IT4A 1YZFA 3CGWA 3E3LA 1I3NA 1J39A 4QHTA 3T5CA 8AT1A 4AQYB 1CRZA 1D0VA 1JE0A 3NU1A 1TKBA 4YJ2B 5GJBA 3GRKA 4GIBA 4NCKA 2O7VA 2JFQA 3KR9A 1UJCA 1R18A 2H7CA 3LI2A 1OQAA 1V5GA 3PB3A 3E8SA 1ZGAA 1ATZA 1XMSA 3TNLA 3U0BA 3G1WA 3BQMB 4BECA 4G1CA 5A03A 2FW6A 4KR6A 1O95A 3UTDA 4A1FA 4E2YA 3FBGA 5CYOA 5D3KA 4OXRA 1TAUA 1NBIA 3K31A 1YAHA 2V7WA 3HQ4O 1WS6A 3INNA 4KU4A 1FMTA 5AK0A 4HS9A 4DEYA 3MJFA 4G41A 2H11A 2F1HA 2OG2A 1EM8B 1PX2A 4J4TA 3BIWA 2ILVA 1SBYA 1X77A 4G0ZA 3LC2O 5G1NA 5KYUA 1EA5A 1NRWA 3VH1A 2F1OA 7YASA 2WABA 1M75A 4KWIA 1F1JA 1Z4QA 5JECA 3EXHA 3FVRA 5DYTA 1WPGA 4NCNA 3WKEA 3EXG1 3PQ5A 3UATA 5FBKA 4A16A 1NC3A 1JKJB 3F6CA 3UFXA 4D2IA 2JRLA 3ND8A 5ADWA 3TRFA 3PJGA 3IPCA 4JLUA 3VNQA 2V45A 3HR4A 2YTZA 1WZEA 3I2FA 4DLZA 5KYNA 1WVGA 3V42A 1G38A 1PVOA 1WPXA 4LYYA 4GXRA 4WLNA 4URFA 2WV7A 4JXKA 4IV8A 1DQZA 4XB6B 3SVZA 1QTNA 1IEVA 1XTVA 4GS5A 5FORA 4DRXA 1XP5A 2OCPA 1G98A 3VR6A 2P90A 3SJZA 3U62A 1XZNA 3L4EA 1NN1A 4KSYA 1KSJA 2QRVA 4IIJB 4WXMA 5U4XA 2CVOA 4XPIB 1S2DA 5BN5A 5BVHA 3U09A 3KJNA 1RXWA 1E0KA 1IHXA 3FVQA 3SI7A 3DAPA 3ZVLA 2ZDQA 2QM3A 5L4SA 4MUFA 4RXTA 3O92A 3ICCA 1M1YB 2VJBA 1GU7A 2VDKB 2C97A 3DKPA 1UPAA 2QPLA 3ND5A 3O82A 4LFCB 1R9JA 3RHTA 1VL2A 1I2CA 4M8LA 3BE8A 1P6XA 1HFJA 3ZDRA 1J2RA 5IDVA 4WACA 5K0JA 1SXPA 3KJZA 1KAMA 1H2BA 2JBAB 2OESA 1FNCA 1ZPDA 2JBWA 4WXHA 3Q2OA 3S1AB 3NHUA 2ZSAA 1ZC3A 4WUTA 1Z56C 1NAHA 2CFIA 4JJ6A 1L5HA 5TARA 3W2FA 4NMHA 1I2MA 1JECA 3FMOB 5IJZA 4KQFA 4Q9HA 4PCUA 3U49A 2IXBA 2BM8A 4FMCB 4YA6A 4YP9A 2M98A 1AZSC 4EZEA 4YMUA 3RIMA 2AD5A 2FNAA 1DIGA 2C00A 2V65A 3GLKA 1SRQA 2EG5A 4FUTA 3D8RA 4ID3A 4IXWA 3UMBA 3Q3HA 1OPRA 3NATA 4MEBA 2OZEA 1ULUA 1M1XB 3KCQA 1GCAA 4OLAA 4M8SA 4MLCA 3TKAA 5BPHA 2XTAA 4HNVA 1JLHA 1LV8A 4CG1A 5CAEA 4JQCA 1BDHA 1IZYA 2BFBA 2P69A 5IAAA 1PBNA 1KQNA 1SH7A 2P5UA 4C76A 4ENWA 2GZAA 4KJXA 3PQ6A 1UBRS 1JA9A 3GYBA 3HLKA 4IAOA 1X1EA 1IN5A 4JR0A 1G4AE 1A7AA 5HYVA 1OFHA 5DHRA 3A2KA 3E53A 3Q7RA 2EC5A 1UWLA 1X92A 1CF4A 3F2VA 2FF5A 2BZSA 1O0CA 3A9UA 1VPVA 1YR7A 2QTMA 1S8AA 1ZWLA 4F8YA 1JDNA 1QRTA 2B69A 1NLMA 5LU8A 3NWJA 3NKFA 4BU1A 2JJ1A 3D1JA 2VTKA 2KB0A 4YJHA 1DUSA 1PJTA 3H9UA 4B47A 2W2XA 2W8BB 3ONDA 2PGDA 4M37A 2ISCA 2UYCA 2HHHB 3OUUA 2GESA 1CUAA 3K20A 1FP6A 2WWIA 3K0BA 3NV7A 4MJ7A 1JF8A 1AA6A 3CJTA 3F3SA 3LDAA 3DH0A 1ZIXA 3AINA 4A23A 5TRTA 5TT1A 2O3JA 1M2VB 3WL6A 1OU0A 5JDCA 5LP6A 1U2DC 1ACMA 4TL6A 1LFAA 2O1SA 2YHUA 4ERXA 3PUHA 5KREA 1GOTA 3OIWA 1A2QA 3RM3A 5JQWA 1UP6A 3EVDA 3BICA 1XYGA 1CV2A 3H2BA 4FNOA 2WR8A 1WZNA 4RF4A 2ON6A 1YZLA 5ALJA 5EQDA 5B4TA 1E7QA 1OXTA 3OG9A 2ATEA 4OYLA 2LKCA 3TI9A 2VBGA 5FB3A 3QNUA 4GDMA 3KKPA 2PCLA 3QBVA 1JSCA 4A03A 1WB9A 1V8FA 3TH5A 5IM4F 1GNVA 3EIFA 5C3UA 3WKCA 8MHTA 4GZ3A 3Q6IA 4TYPA 1B7GO 3PFKA 1NLUA 3QPWA 1JIQA 3QTLA 4KL8S 4TMFA 5CB4A 4WGGA 2DHCA 4CMKA 1KU6A 2EWWA 3PDUA 1JR3A 2WWHA 1QIDA 4TZTA 1Y4AE 3PFIA 4JUIA 2IYYA 4KBYA 3U60B 1TEZA 1R88A 3DZDA 3EULA 4YJ2F 2WJWA 3E7XA 4KRGA 2J3DA 1CBUA 3N8HA 3R0QA 5IUJC 2X41A 3PQ2A 3GJ6A 1LK7A 2GEFA 2HWUA 1V4BA 2ZI9A 3NHRA 4KSCA 3ECCA 4Y2XA 5KVCA 2GXAA 5CLFA 3LOUA 1JSXA 4LXIA 1HZJA 4WKBA 1JEYA 3G8BA 4IYJA 1II8B 3O4IA 5P21A 2Z6QA 1U8AA 3INGA 4FBGA 1GUYA 1T34A 4JUDX 1XTBA 4YP0A 3PUJA 1PSZA 1B14A 4NBSA 5C5CA 5DWQA 3BCRA 2ONYA 1ELOA 4X3OA 3RTGA 3IAAA 1Y8QA 4RVDA 1W5TA 4WK0B 2OCIA 5C31A 1AXEA 3TXYA 2R44A 2WV9A 4C0QC 4D6PA 1C1DA 4CKBB 1I51A 3JQRA 5TMEA 3E0XA 3O2SB 4IHJA 4QGGA 2WSBA 4YQZA 3L7AA 1UEXC 4NZ9A 5H81A 1CQZA 4MR9A 4BAGA 4TTJA 1O8CA 4PSDA 4EO4A 3GLFA 1E7SA 5IMBA 3IDSA 4IO0A 3NUGA 4PY2A 3JRXA 1T1RA 1VL6A 4PG4A 7REQA 1IHDA 1RC0A 1ZXLA 2AG6A 2EKBA 1SUBA 4QNMA 4Z4GA 3MAAC 5E9AA 3EG9A 1QANA 4ITVA 2W9XA 4YMSA 4J16C 1EFKA 2WTBA 1NPYA 3FOEC 3GV0A 2WNIA 2XUDA 3GP3A 3R3VA 4IIJF 4JGGA 2C42A 4MYHA 5EMHA 1KK3A 2BEWA 2O2XA 4WLFA 2R8RA 3ZH9B 2H2IA 5H4HA 4RZIA 3QF4B 4S35A 5D6NA 4A10A 2V6GA 1Q0SA 2Z30A 4KLAA 3TIFA 4CM1A 5C5IA 1I6KA 2QYOA 2WC1A 3EGXB 3ZE2B 1T9DA 3FTDA 2ZT8A 4G8BA 3KYDA 1CG6A 1TQ2A 2XMPA 2ZR9A 3TRIA 4DCJA 3O1JC 4C21A 3IESA 3DDUA 2MMCA 4BAUA 4FYMA 1LXCA 3WGVA 2XMRA 4XX0A 4HLQB 2AI2A 4WESB 4O2AA 5FOVA 5LJLA 1FDVA 4X0EA 3L40A 1F4LA 1L8OA 1ZG3A 1CPYA 3GG9A 1N3IA 3M2TA 4HEJA 4LBYA 4XEHA 4AX4A 4ZGWA 3V55A 3JQGA 4N39A 1W1IA 3TTYA 1WQ4A 2GNOA 3ZDEA 4ZCSA 1T2NA 3VKVA 4KJZA 4PXSA 4D8VA 1FMLA 4XQGA 2PKWA 2E4VA 4HAIA 4FMCF 4C4TA 5CW1A 4L8WB 4CWAA 3LDUA 1ZD8A 3TR6A 1QONA 5L6MB 1GGHA 3OLXA 1YQXA 1KJIA 3JY6A 3JYLA 1L6RA 1QO7A 2P65A 2ZRMA 4MWTA 5LZ5A 5KDDA 2QLMA 2Q7DA 1M3SA 1KZHA 2PVSA 2X22A 3KP1A 3OZIA 2ZIXB 1CUGA 2NUPA 3K2BA 4UASA 1GG2A 2ST1A 4HK4A 4ND4A 4IDBA 4QC2A 2WTMA 3UH1A 4DLNA 4DQVA 1O2DA 4I1PA 2CVHA 2ZJZA 4PNZA 4NULA 3SR3A 1ZBDA 3R8FA 4KKVA 5JS7A 2HL6A 1Q7BA 3MWEB 1FW8A 2Y27A 4HWPA 1Z6GA 5F7OA 2JI4A 3SIRA 3GRPA 2B78A 3GA0A 3NWOA 3UT6A 3VU8A 5D00A 3WY9A 4YV7A 1VJ0A 1Z18A 2W2LA 3A58B 3GRFA 4XIIA 3WGQA 2PTGA 5DIFA 1VKOA 3QKSA 3GLUA 3PFWO 5HIAA 3BZUA 2HMWA