1L3IA

Mt0146, the precorrin-6y methyltransferase (cbit) homolog from m. thermoautotrophicum, adohcy binary complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
186
structure length
186
Chain Sequence
MIPDDEFIKNPSVPGPTAMEVRCLIMCLAEPGKNDVAVDVGCGTGGVTLELAGRVRRVYAIDRNPEAISTTEMNLQRHGLGDNVTLMEGDAPEALCKIPDIDIAVVGGSGGELQEILRIIKDKLKPGGRIIVTAILLETKFEAMECLRDLGFDVNITELNIARGRALDRGTMMVSRNPVALIYTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, lyase
molecule keywords Precorrin-6y methyltransferase/putative decarboxylase
publication title The Crystal Structure of Mt0146/CbiT Suggests that the Putative Precorrin-8W Decarboxylase is a Methyltransferase
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 49
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.196: Cobalt-precorrin-6B (C(15))-methyltransferase (decarboxylating).
pdb deposition date 2002-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1l3iA00
2B25A 3IEIA 2I62A 5K0BA 1YF3A 5CVEA 1MJFA 3ANXA 3MHTA 1G60A 5HILA 3SXJA 2OYRA 4IV8A 5DT2A 2C7PA 1B42A 2PVCA 2ZZMA 1X19A 2FYTA 3C3YA 3DUWA 2PX2A 4NECA 4HC4A 3MCTA 4RTMA 5DLYA 2ZSUA 3B7PA 4GOMD 3FYDA 4Y2HA 5HOQA 1YFLA 1NV8A 3G5LA 2UZ4A 5DM4A 4ER0A 4RTRA 4GUAA 1UIRA 2PWYA 2PX5A 3DXYA 3GRUA 5CVVA 3THRA 2I7CA 3TLJA 3BUSA 3CBGA 3LL7A 4RSRA 2NNWB 3A7EA 3DR5A 2VDVE 2P7IA 2AOUA 5IKMA 4QPPA 5K0JA 4MHTA 3E7PA 4FT4A 3KQTA 3B89A 3KR1A 3HCDA 2NXCA 1M6EX 2PKWA 3A4TA 2JHAA 3G5TA 4P7FA 5DTRA 3NDJA 5K05A 2AOTA 2PX4A 4MWZA 3SR4A 3PFGA 3UJ8A 1F3LA 1QYRA 1XVAA 2O05A 2ZBRA 3AJDA 2HWKA 1X1DA 5C0OE 3S68A 3DLCA 2Y1WA 5DX1A 5LQKA 2JG3A 2IH2A 2AS0A 3RIEA 3I64A 2QRVB 3VC1A 3G7UA 5KS2A 2H1RA 2B9EA 2OB1A 2WK1A 4E2ZA 3LBYA 3FZGA 4XUCA 1VL5A 1AF7A 4PYJA 5BW4A 5CCXA 2QY6A 1XDUA 2ZVJA 3G2PA 4PWYA 4PYNA 5CVUA 2AN4A 3SM3A 3FYCA 2P41A 1PJZA 2WA2A 3HCFA 1WG8A 1P1BA 3IV6A 4GC5A 1RJEA 3LHDA 1IXKA 2IDJA 1VP9A 3CGGA 3MQ2A 2V74B 2YR0A 3TM5A 4YUYA 1JQEA 3G2MA 5EGSA 4YUVA 2VDUE 4PIMA 1VLMA 2G70A 3NVMB 3PS9A 2IP2A 2YQZA 2ZIGA 3BT7A 2PXAA 3SSMA 3B5IA 3OZRA 4RTPA 4CWAA 2IFTA 5ICGA 1R8XA 3EPPA 1SKMA 5DXJA 1JR4A 3WSTA 3UJ7A 3C3PA 5DRTA 1R6AA 1ZHFA 5FQOA 5H02A 3KQPA 4M36A 1IM8A 1EJ0A 4RX1A 3UJAA 4OQEA 1VBFA 1BC5A 3HNRA 3GWZA 1NW6A 1XDZA 5DM0A 4YUZA 5FHQA 1DUSA 1NBIA 5LQRA 2FK7A 1NW3A 1YUBA 2G71A 2P8JA 3I5UA 3HVHA 3QOWA 4QDJA 2ZBPA 2ZZKA 3BWBA 4IKPA 5FA5A 3UWPA 5C9ZA 3FUTA 2EFJA 4XUEA 1F38A 2F8LA 2PGXA 3OZSA 2PBFA 4P7KA 4BY9E 1NV9A 1YB2A 2V7EA 2VS1A 3SMQA 5K0EA 4LWOA 5E1MA 1FP1D 4RVDA 5C1IA 3GO4A 1JSXA 1VQ1A 3TOSA 2AOVA 2Y1XA 3CKKA 4YV2A 3DULA 5FTWA 3R0QA 3FPEA 3FRHA 5EMKA 4E31A 4RVHA 3TRKA 4YMHA 4HTFA 3BGIA 4F84A 1KIAA 1JG1A 2P3QA 3ME5A 3KQYA 5BP7A 3NJRA 2IBSA 7MHTA 4QVKA 3JWJA 3FUVA 5LR6A 1I4WA 4FR0A 2PX8A 5BXYA 4HGYA 4KW7A 5KYGA 4C07A 2VDWA 3PFHA 5K03A 2CWWA 4X61A 4P7GA 2I9KA 2NXEA 1I9GA 3OCJA 1X1AA 2EX4A 1FPQA 3H2BA 4PYOA 5E8JA 3FRIA 5P8WA 5FADA 1WXXA 5B1SA 4AZSA 5EC8A 5GIOE 1L3CA 4BLVA 2P40A 4BLUA 2P3OA 4FZVA 4YV0A 1QAMA 3ER9A 3JWIA 2XVAA 1NE2A 3FUXA 1KPHA 3PX3A 1Y8CA 3MGGA 2JHPA 2ERCA 1JTEA 4R6WA 1BKYA 2GAFA 2GB4A 5CVJA 4KIFA 4AUKA 3ORHA 1KYWA 3MCZA 4QTUB 5EIFA 3CJQA 3KPVA 1NT2A 3GJYA 2JJQA 3M6UA 3GRZA 4IV0A 3VSEA 1ZGAA 3AWIA 3KQQA 3U81A 2PY6A 2CL5A 3MTIA 5DX8A 3HTXA 3BWCA 3JWGA 3KQWA 1O54A 3KKZA 3LX6A 4KDCA 2YUIA 2ZBQA 3DP7A 3M33A 5E9WA 1JG2A 3DTNA 3QOXA 5FCDA 3LCCA 1P1CA 5D1HA 5D1NA 2ZLBA 2BR3A 4X41A 4DM3A 1RI5A 3B3GA 1RI3A 2JHCA 3A25A 3HP7A 3LDUA 4FS8A 5HEKA 4KDRA 3A26A 3NW9A 4MTLA 3A7DA 1QAQA 5DTMA 4ER3A 3DH0A 2YX1A 5HIKA 2BM9A 3EVDA 1G6Q1 1Z3CA 2AN5A 2B78A 5GIPE 5ICCA 4GBED 3BZBA 1R74A 3MAGA 4E33A 1TW2A 3G88A 5G02A 3LCVB 1EIZA 3NTVA 3OU7A 2ZIEA 3RW9A 1EAMA 2FHPA 2PT6A 5EQJB 3TM4A 3NDIA 3O4FA 1FP2A 2AVDA 3SSOA 3PTAA 3O7WA 4ER7A 5KQRA 2P7HA 3UBTA 3AXTA 5K01A 1IY9A 1P91A 2VZ9A 4GOND 1H1DA 2O57A 2O0LA 3HA3A 3DMHA 2ZW9A 2AOUB 5CVDA 5LQJA 1EG2A 5FULA 3HVKA 4A6DA 2ZWVA 2ZWAA 3AXSA 2ZFUA 2QM3A 2HR1A 3BKWA 4C08A 3UJ9A 3BKXA 3C6KA 5HFJA 4OBXA 2OZVA 5GOZA 4HGZA 1MHTA 3EGVA 2P3LA 3PLAE 1R18A 1ORIA 2GA9A 2G72A 3HCEA 3KQVA 4R05A 5EEGA 4YMGA 2C7QA 2O07A 3M6VA 3L8DA 4PGGA 4LWPA 3P9KA 3I53A 2EG5A 1OR8A 2GPYA 2ONZA 3OU6A 4IWNA 5DSTA 3K6RA 3V97A 1KHHA 4GC9A 3E23A 5EKXA 4QDKA 4FSDA 2PSSA 1RJDA 3LPMA 3JWHA 3OFJA 3BWMA 5E8RA 3UA4A 2XBMA 1VPTA 4OA5A 5DX0A 2GH1A 4M38A 5DM1A 1PRYA 5EMLA 3KR9A 5E1OA 2OXTA 3VC2A 4OX9Y 1D2GA 4U7PB 3KR0A 2HNKA 1G8SA 1ZKDA 3EVGA 3VYWA 5BW5A 3BGVA 1HMYA 1RJFA 1I1NA 4R6XA 2R3SA 4RV9A 3GIWA 2NXJA 4DZRA 4CXMA 5E9JA 2ZZNA 1SUIA 2BR5A 2FK8A 3G2OA 2IGTA 4KRGA 4PYMA 5ERGB 4E30A 5JR3A 5DTQA 4UOEA 5HZMA 3M70A 2Q41A 1G38A 2C7OA 5E1DA 4PYLA 4RTNA 1KYZA 2IH4A 1WZNA 4U7TB 4P7JA 4WXHA 3G8BA 5E2BA 5LQUA 4ZTBA 2HMYB 4R8SA 2DPMA 4PINA 4M7RA 3DXXA 2Z6QA 1BOOA 3M6XA 2I6GA 4R8RA 2AN3A 4AZVA 4X63A 1YZHA 3TR6A 3F4KA 2OBFA 4L7VA 1V39A 2Z6AA 5LQNA 2A14A 3KPWA 2ORED 4K6MA 4E2WA 3CVOA 4EMSA 5LSAA 1D2HA 1T43A 1XDSA 5FHRA 1NW5A 1L3BA 3QV2A 3KPJA 3B3FA 4QVGA 4C03A 1N7JA 1INLA 2JH8A 3EVFA 3OPNA 4GQBA 3UJ6A 1SVUA 4E2YA 3SX0A 3P9CA 4V0QA 2G1PA 4H0NA 3UFBA 1R00A 1L3IA 1L9KA 3UJBA 4ATNA 3FPJA 3UA3A 1RI4A 2YXEA 4WVLA 3LDFA 3HVJA 3V8VA 3GRYA 1O9HA 2ESRA 2UYHA 4KWCA 1SUSA 4HTFB 5JUWA 1AV6A 1VE3A 3FTDA 1X1BA 3DMGA 1EQAA 4RVGA 3IHTA 4RTKA 5FA8A 4HG2A 2G8NA 5T6BA 2YVLA 1P39A 5EZQA 2YXLA 5FUBA 3RODA 4EKIA 2AOXA 3NMUF 1KR5A 4POOA 2NP6A 3GRVA 3GGDA 1AQJA 4AZWA 4PNEA 4C4AA 3HEMA 5EKUA 4B17A 1FJXA 3HCCA 4CKCA 4DCMA 5MHTA 4E70A 5EEHA 1KPGA 2IDKA 5E9QA 1NKVA 3EGIA 5CD1A 3CJTA 3FTFA 4RVFA 4RTQA 3P71T 4PCAA 1ZGJA 2HV9A 3ID6C 5EG5A 5EMMA 3KR2A 5LQAA 5K0NA 2NP7A 3P8ZA 4AX8A 4C05A 2ZCJA 4E2XA 5K0GA 3G89A 4ER5A 3G2QA 2OPBA 1X1CA 2AVNA 1XCJA 4EQZA 5CM2Z 4PYIA 2PWPA 1Q0TA 1JG4A 5E1BA 2HTEA 2FRXA 3EGEA 3EVCA 1UWVA 2CMHA 4RTSA 3LGAA 2OY0A 1HNNA 1RI2A 3R6TA 5DWQA 1QANA 2R6ZA 3HA7A 3KQSA 2XYQA 2LD4A 5DRYA 3KPUA 2VP3A 4RTLA 3GNLA 3SSNA 5KQSA 3DLIA 4RTJA 1XXLA 3ELUA 2P1DA 1SQGA 3HVIA 2YTZA 1JSZA 1KP9A 3LSTA 3OZTA 1JTFA 3MTEA 5FQNA 1TW3A 2UYCA 3TKAA 5DXAA 3TMAA 3OU2A 2AR0A 5F2OA 4LG1A 4F85A 2NYUA 1ORHA 2KW5A 2O06A 4QTTB 3T0IA 1YZ3A 5ICEA 3C6MA 2B2CA 3UJDA 4GF5A 3LKZA 3Q7EA 3KHKA 1KPIA 3LBFA 3OE5A 3FPHA 4G56A 4MQ4A 5F2KA 8MHTA 5GINE 3R3HA 1NBHA 4RWZA 2PLWA 3PT9A 3DMFA 2PXCA 4EKGA 2QRVA 3X0DA 2EJUA 3P2EA 5EIWA 5CCBA 3IYLW 4C06A 4EVIA 2AOTB 1QZZA 4OA8A 2H11A 2CMGA 3E8SA 3EVZA 3AY0A 2B3TA 3FTEA 3CCFA 3OE4A 1JQDA 1G8AA 5HIIA 3E05A 3HA5A 1NW7A 4BLWA 1N7IA 1YFJA 3GXOA 5EVJA 1Q0SA 1M6YA 3CJRA 3SGLA 2PV0A 3REOA 5FWDA 1FBNA 3KQMA 5CIYA 5K09A 1JQ3A 1TPYA 3T7SA 4YUWA 5EMJA 4FT2A 3GU3A 4HH4A 4QQKA 3UZUA 4CKBA 2Z6UA 5FWAA 2BH2A 1VIDA 2QE6A 3THSA 4DMGA 3A27A 1DL5A 4YV1A 5HIJA 1ZQ9A 4PCLA 2QYOA 4Y30A 2IPXA 2BR4A 4EK9A 2GS9A 2ONYA 2BM8A 2NXNA 2UYQA 2CKDA 3D2LA 1EJ6A 3I58A 3I9FA 5E2AA 3R9XB 4X1OA 2ZULA 3G8AA 3TPZA 3KQOA 3BGDA 4FP9A 4OQDA 1SG9A 4HRAA 2YXDA 3DOUA 1O9GA 3KPYA 3NWBA 4KIGA 4PIPA 5K0LA 5T67A 3TFWA 1VP3A 2H00A 3FPGA 2IIPA 4XCXA 1L1EA 2XYVA 5GM1A 4FSXA 3TKYA 1U2ZA 3TQSA 2OO3A 2PXXA 4X60A 3BXOA 3GDHA 2XYRA 3MB5A 4DCGA 4MIKA 10MHA 2FCAA 4JXJA 3KU1A 4PONA 4CTKA 9MHTA 2FPOA 5M5BA 3ERCA 4RTOA 5LQCA 3T7TA 4A6EA 5CUQA 3NWEA 4PYQA 3M6WA 3EEOA 1RJGA 1XTPA 2K4MA 2ZIFA 3P2IA 4YUXA 3P97A 3P9IA 5EPEA 3EVAA 4RYLA 4CTJA 4E32A 3DXZA 1WY7A 2XVMA 3PVCA 2JH9A 5T64A 3K0BA 5K8VA 3CC8A 4PGHA 4V0RA 4KVZA 5DM2A 3SVZA 5F2NA 1DCTA 3FTCA 3ELDA 4ISCA 3FPFA 5U4XA 3NVKI 2ZTHA 3EVBA 4LECA 1ZG3A 3HCBA 4GEKA 4BP3A 2E5WA 3LECA 5K0FA 1QAOA 2N47A 1BHJA 3R24A 5GM2A 5IH3A 4DF3A 5K0CA 3GCZA 4DKJA 1N2XA 2OB2A 3C0KA 4M37A 1D2CA 5EOVA 5GWXA 1SQFA 4OBWA 4AZTA 1G55A 3BWYA 3PB3A 3EMBA 2AOWA 2PJDA 3LDGA 5HIMA 5ICFA 4F86A 2P35A 2WA1A 1WS6A 3M4XA 1R8YA 3B3JA 3P9NA 1AQIA 4C04A 5KVAA 4Z2YA 1KXZA 5DSXA 3FUUA 2BZGA 4BP1A 4P58A 5DPMA 3EEYA 2AZTA 2C7RA 3LCUA 5GP1A 5EHGA 1WXWA 3HM2A 3UJCA 2PT9A 1UFKA 3PX2A 1NW8A 1M0EA 2IH5A 3ER8A 1RI1A 4QPNA 4DQ0A 3Q87B 4ER6A 2EJTA 4GOLD 2GLUA 4XUDA 4DA4A 2ADMA 3GRRA 2OKCA 4O29A 5EHIA 2UYOA 1JG3A 3MERA 3P2KA 1XCLA 3T7RA 2IBTA 4PYKA 3HCAA 1XJ5A 3LKDA 3ELWA 4FGZA 3O31A 3EMDA 4CKEA 3FUWA 4QQNA 4HSGA 2DULA 3ELYA 4GOOD 3EVEA 5EZSA 3OFKA
chains in the Genus database with same CATH superfamily
2QXYA 2FVXA 4J0EA 4AWXA 2BEVB 2I62A 1DO8A 1OZGA 3FYSA 1M2VA 4BCBA 3TO5A 5K0BA 5LD2C 1OLXB 5DIZA 1KK0A 3ANXA 5HILA 3IMFA 1UJ5A 4A5SA 2ZREA 4D80A 3ZZ0A 4EGAA 2C7PA 1V6SA 2NZVG 2IYZA 2PX2A 3TGLA 4HC4A 3G0IA 3MCTA 2NU9B 3V4ZA 1G21E 5KMGA 1SG0A 4JR0A 1S02A 1KJ8A 1Q3TA 2ASEA 2HRQA 1YC2A 3D5QA 2QL9A 3BAFA 3BJZA 3FNRA 3FJYA 4EY4A 2G1JA 1UCFA 1E0KA 1VIYA 1DEHA 4FS3A 4RPLA 4HQ6A 1KJQA 3OOYA 1A7JA 1MAAA 1FQWA 3MEQA 4IDGA 3X1XA 3IH5A 1H2WA 3BFKA 2MT9A 5FRDA 4ZHSA 1SD1A 4JB8A 4Z2AA 3VNUA 4U2BA 4B76A 2O8EB 3M5WA 1R6TA 3DHYA 4PZZA 2J9FB 5AVOA 3WLOA 1XMPA 3HFGA 3LUGA 1DC7A 1CVLA 2PXHA 1XVAA 1A9TA 3AJDA 1SHTX 2HWKA 1Z5WA 1HTTA 2XCIA 3CMCO 4RQAA 5DX1A 5JW6A 5GVSA 1R5NA 4EHHA 2JRCA 1USUA 2ZRNA 4F2DA 5CXXA 3LBYA 4L74A 1GTL1 1YE8A 2P9GA 3HH8A 2CJWB 5KTSA 1B26A 2W37A 3N2IA 3KZMA 1ULUA 4GP7A 6CHYA 2NO7A 3FKSA 2X5NA 3T38A 3AJ8A 1DCMA 4WGFA 2G80A 4UPEA 4LJSA 1NJFA 1GZ4A 5K6AC 1L8XA 4F5WA 5CT5A 3I1JA 1E77A 1X1TA 3K96A 3H5AA 1MUUA 5EGSA 3A4YA 4H0CA 4AY4A 5KOYA 5D3KA 3NDBB 1SEPA 2XMGA 1J20A 1MHPA 4J3NA 3ZZNA 3V7WA 4B6QA 3R9XA 1NNUA 4P4NA 1MVNA 3AUKA 3WJ1A 3M4ZA 5K8TA 4I55F 2B8TA 4PAOA 1NMXA 3QXJA 2X13A 2WYUA 4JJEA 4L5IA 3UJ7A 1Q0PA 4DIEA 4FE3A 1VXRA 1OAOC 4M36A 3WWYA 3H1AA 1YJXA 2R96A 1Q95A 4AZ0B 2VWQA 2I80A 4J91A 1ABFA 3GWZA 4R2WA 3STYA 3T3MB 4B7ZA 1RWXA 4TMYA 4NJEA 2EQ5A 1E98A 4IHJA 3YASA 4XM1A 2B83A 2RE8A 2J6IA 2GBCA 2VH1A 3T52A 1G16A 4KO4S 3CUVA 4RNDB 5F1PA 1M5UA 5IJ9A 1OLSB 3AEQB 2Z95A 3NS7A 1RHMA 2R1VA 4FOLA 3ZKWA 4B9EA 4D74A 4ZYZA 3PQ2A 5JLAA 1B73A 2PR7A 2XDQA 2FXIA 2XT9A 5LP1A 1ODCA 1I30A 1T6NA 2OLJA 3BPSA 4RE5A 5DBGA 3B1JA 7REQA 2VDRB 4I4IA 4MWEA 4EDHA 3OX3A 4IH4A 5TQJA 5JYEA 1G59A 2VPWA 4HTFA 4QREA 5JG7A 4D6PA 2D5AA 2WF7A 3ECSA 4ENRA 2YKGA 2RH8A 4MW4A 3OZBA 1T0BA 1WCXA 4QUGA 1X7ZA 4LYGA 2UZ1A 4GSYA 1LXCA 5AHWA 3WK5A 7GPBA 3FKJA 1C7QA 2DKFA 5CA1A 3SVTA 3BBPA 2G9QA 3KG2A 1ESMA 5E0KB 5JNUA 2ZWOA 2R47A 3LUJA 2ILVA 4X6UA 4LOLA 4TLLB 2OSVA 3ZDZB 5FFMA 4EMTA 4COKA 5E8JA 1VMIA 3O4JA 4LJ6A 4M8KA 4JJGA 5C3MA 1PT9A 2ENUA 2O20A 3UWMA 3JYQA 1YR9A 4QKQA 5C52B 5WRFA 1JDBC 3DZCA 1TA0A 5HJ5A 3BE6A 2ERCA 3S40A 2ODBA 5L53A 5DP2A 1UQUA 3CX4A 4R1SA 5HCIA 4IYJA 4FNMA 3TIIA 3L1KA 4BV9A 4CYMA 3N39C 2E4UA 2CV2A 3CB4A 3TRDA 3O93A 4HX2A 1GTG1 2QY9A 3L77A 3R7AA 2H65A 3K2IA 1W87A 4I5DA 3HMKA 3C1OA 4R1LA 4FINA 1VSVA 3QENA 4P98A 3DV2A 3LBHA 4DSTA 1XZLA 5DX8A 2VTKA 1E1MA 2FPMA 2GD0A 3H6KA 3B7WA 3QHPA 1LS1A 1G1MA 5TT1A 3RRBA 5BV1A 1UC9A 5FCDA 3TBKA 3R5HA 5EIXA 1I7DA 1U2QA 4B71A 3J80A 4HFMA 4DQVA 2BEJA 4UC0A 4FZ5A 5ITWA 4F3TA 1OU0A 2GBIA 2ZIUB 3EPRA 1AX9A 3KZNA 1NY6A 4HMOA 4WZBE 4L6IA 3K8OE 1EHIA 3FLMA 4JUBA 3LW7A 5KVCA 1C7JA 4ND3A 5HUHA 2B34A 3AV3A 4GYKA 2C7BA 4Y1FA 3AB3A 1WNFA 1AGRA 4V39A 3LX4A 4TKVB 1M1YE 5EZYF 1W25A 4TQGA 1IJBA 1T4MA 2GEBA 2OAQ1 2QR3A 2VNIA 3R0ZA 1E6KA 4G9BA 3TLGA 1Y5LA 3HWWA 3QE4A 5I9SA 3WRVA 2DC1A 4FTWA 2C4WA 3SKVA 1QHIA 1SKYB 3K32A 3ZE0B 1CUAA 5KOIA 5J4HA 4AYXA 2W83A 1Y3CE 3HHEA 3L07A 8ADHA 4XRRA 3MWGA 3S27A 3UBTA 4PZCA 1U63A 2X77A 3R5FA 5EESA 1IIBA 3NBFA 4XFDA 4BLPA 1L7BA 2OE2A 2GARA 1JAIA 2XIJA 4TL6A 3BKWA 4O4HB 2QN1A 1YS6A 4HWSA 5CGZA 4BFSA 4BX2A 4BV8A 4PHTA 4YP9A 2KMLA 4BNJA 2VP6A 4Y3UA 4PCUA 3MGKA 1LTHR 4Z7NB 5FR1A 5LUAA 1BIFA 4EYEA 5CCEA 4ZARA 2DWUA 3B51X 2GPYA 1G8PA 1QGUA 1CEEA 1EMDA 2XOEA 4TV9F 4UHCA 1GR0A 4GC9A 3H6GA 4NU8X 1DAHA 4XSGA 4KX5A 4ZT5A 5UKDA 3ZHOA 2Z9DA 1XU7A 3DB2A 3JYHA 4B35A 1P6UA 2O2CA 3PUYA 2X5XA 1OZAA 2XAUA 2OAGA 5B7PA 1EYZA 1YU6A 5AKJA 1MGPA 4UUQA 3OWXA 1KE2A 2VSYA 3FLAA 3P26A 3ZWCA 5EJ7A 1FDWA 2CVZA 2EFDB 2FEPA 2HLPA 2HY7A 2LIVA 3SHOA 3DA8A 1KEEB 2X2OA 4LMAA 2G17A 4PLFA 5HZMA 3M70A 5T7BA 3PXAA 4PICA 4RXUA 5B1HA 1JG7A 2ZBVA 4FHGA 1GXSA 5IAJA 3B9QA 4D3XA 4P7JA 5B2FA 1KVRA 1O95D 4LNHA 4WXHA 3KB6A 4EG8A 5JEDA 4OAOA 2R5NA 1NP7A 3WIDA 3BB3A 2B1RA 3ACCA 3OURA 4NOKA 4CL2A 1HFWA 4Y6OA 5IDVA 4HBZA 1Y89A 5JJBA 5JMTA 3CE6A 1BYIA 4ND2A 5ILQA 5CB4A 4V0MA 3Q5EA 4HNUA 5DYIA 2GWRA 4FZRA 3WKBA 4ENSA 2L42A 2X7HA 3T9FA 5AJWA 1L8AA 5EJ2A 5BR1A 4NF2A 4EY5A 2IHYA 1INLA 2ZRJA 4YPVA 5FBVB 4CUZA 1WOYA 4ZYUA 5HE9A 3FWZA 4V0QA 3G8YA 5FPPA 2PBRA 3ENZA 4WMLA 5DNDA 3UK6A 4O2AF 4B0OA 2X76A 1E4YA 1X8XA 4GRDA 3TZKA 2FR1A 3CLSD 2HB6A 3L4EA 4INAA 4N5DA 4OB8A 4RQUA 2JGRA 3CW2A 4KK4A 2ZUEA 1O9HA 3TB4A 2UYHA 3R0JA 3DWEX 3TX6A 5ALVA 1OXBB 2X22A 4YPOA 5CJPA 4GM1A 1EQAA 4RVGA 1TQ6A 5FUQA 5FA8A 4HG2A 4ZK6A 2B0CA 1L5FA 4UJ5A 3C97A 5EUBA 4JB0A 3K0AB 2AZXA 3AY3A 1LH0A 1MVLA 2OQVA 1HEIA 1RTKA 4RA6A 4ZPXA 3HJHA 4DCMA 5BQ3A 4E70A 4GU5A 1EHCA 1YHNA 1LTKA 1M0WA 5E9QA 4OX9B 3H42B 3WYDA 4XPIB 2I6UA 3GN2A 3RYFA 1QK3A 3NJ8A 2E85A 2A94A 1I33A 1TCCA 4I08A 5GJVC 2B92A 3QJGA 2BKXA 4ZQEA 3SZOA 1Y3DE 1QWOA 4KQHA 1A96A 1Y48E 4K03A 3GQBA 4HLQB 4E5DA 1RI2A 3MMPA 4L8YA 5EJ6A 4JA0A 5CYOA 5DRYA 3VMFA 2PZJA 5LJIA 4GRIA 1VDZA 1ULSA 2GN4A 2X2EA 1HZJA 1DWUA 3D3EA 1PSDA 4TKMA 4F0JA 4K6HA 2CW5A 2Z43A 3JD2A 3ZW7A 1PCXA 1F7VA 3CVJA 1KO8A 4CIYA 1PZXA 2DECA 2W9XA 3V7YA 2AR0A 4ALMA 3VNBA 1KVQA 4D9EA 3R8XA 1T0IA 2BAGA 2X0NA 4WCFA 4C78A 4WJLA 4TL7A 4DJDC 2R79A 1F2UB 2J9ZB 4N65A 1L7DA 3QU9A 4XI9A 1RYNA 2PGJA 2XRMA 1CUVA 4AJJA 1TM5E 2QWXA 3O6VA 1QHFA 3N59A 3ZXUB 1GTMA 2WG2A 1X0XA 4B3JA 3GFVA 3R3HA 5BR8B 3A1FA 3BH6A 1YJ8A 4LXTA 2IXBA 3RK1A 1NYTA 3JQ8A 1R6BX 2QA5A 1GSHA 2W8BA 5KYUB 4MCHA 2GNPA 3QELA 4O4LA 1Y4AE 3VFDA 4Q66C 5EJ8A 1DELA 2EKLA 3D6AA 4RQTA 3CXUA 2AOTB 1P7WA 1RVV1 5CMLA 4DLTA 4QQFA 3SKXA 4DBZA 3ETDA 4G1VA 1D6SA 4YCLA 2WIGA 4HPJB 4Q1FA 1YE5A 4OQ4A 3T5BA 3ICQB 1E1NA 1D6NA 2DH5A 4EBBA 3QXHA 1G8AA 3QLTA 4AF6A 2PFGA 1CUBA 1EXWA 1UBFA 2J0UA 2Q1UA 2R7MA 1CUEA 3HA5A 4G89A 3CJRA 3DKPA 4IFEA 4CFSA 2PV0A 2JLVA 2ZUUA 1UDWA 3KQMA 4KK3A 5CIYA 3IIKA 4KO8A 2VWHA 3EFOA 1Z5VA 3U4AA 2BELA 3SHVA 5CNKA 2ZJZA 2BCEA 2XWPA 3P9ZA 1U5CA 2DFNA 1SBIA 1W48A 4JMPA 4M0DA 2D54A 2BGRA 5BV2P 3JATA 2BH2A 4QTZA 2QUBA 1Y98A 2VYFA 3GDFA 3GVPA 3G2KA 1Q74A 1FUYB 5FI0B 4J16A 1Z73A 3JS5A 4M6WB 2IPXA 5ERXA 4LDJA 1LV8A 4EK9A 1WSWA 2NYAA 2IXTA 2I1VB 2WMOB 3OLWA 1T10A 2FPKA 4KIUA 4EG0A 2CNLA 3U4IA 5HNKA 2GXAA 5EE9A 5GMOA 4AC9A 1Z4QA 2OHFA 1M3SA 4CM8B 4CPDA 1KDPA 3HNOA 3DONA 3BJIC 4TV8F 3OLYA 2X0IA 3VPFA 2WFMA 1X9IA 2LCFA 3VAAA 4YJDA 1NRWA 3QUCA 4XCXA 2IT1A 3SF0A 1O7JA 3WMWA 3W8NA 5BN3A 2ZIWB 3ESXA 3KVRA 1GL9B 1YJAA 1FVOA 2IZOA 4G4SP 1JKFA 2ZU6A 3N2GB 2CLDX 3K05A 2FCAA 3CRW1 4L4RA 4NJMB 2YHBA 9MHTA 3CRNA 1JU9A 2REQB 4EA8A 3LNTA 3C70A 3P0RA 1KJNA 3VMMA 2Q46A 3KDSE 1IBCA 2V1XA 2OFXA 2ZJ3A 4O8ZA 1DXHA 2XRFA 4ZCMA 4ZEVA 5I7OA 3T9AA 3OQIB 2IY7A 3OE7A 4KLAA 5JXIA 4IO0A 3FVQA 3IS3A 4KBYA 3T6KA 3OEHD 4FMDF 2P2YA 1H2EA 2DF8A 3IIIA 4BGEA 5CBPB 1UZMA 2P67A 2JK1A 1JJFA 2QVZX 2RI6A 3VU1A 4KGZA 4KVZA 1IUPA 3I28A 4D3ZA 3ZGVA 2G08A 4WKGA 3ORRA 1T3LA 2HYDA 1Z6AA 1V4BA 3GXBA 4LCJA 3C3CA 1XTKA 4I0WB 3JZAA 3UF0A 2GRJA 3SR0A 4CN9A 2Q1WA 1FDUA 4I99A 5EOVA 4OBWA 1OX4A 2GEKA 1JJ7A 1OI4A 1HFJA 1RACA 3HDHA 5CAEA 1P4HA 5AKHA 5CFQA 5TEWA 3MIZA 1UBRS 2YOGA 4L78A 4AMGA 4J43A 2X4IA 3RSCA 4CDRA 1T6BY 5FEUA 4S05A 3GAMA 4MAMA 4WOCA 1E1RD 2GM9A 2JJMA 1EWKA 4J4BA 3G02A 3TJRA 3U4QA 3HTXA 3AEKA 1Z62A 2X3UA 4MUAA 1O5OA 3L84A 3ROTA 5KNDD 4CCWA 1GNLA 4BCCA 4NHOA 4RJKA 1FU7A 1A8PA 4LZPA 5LA6F 4KPEC 1EIWA 3FFAA 1N57A 4D8UA 4C88A 2VH5R 3FOAA 2IITA 2FPIA 1BG6A 2HZBA 3D6VA 3HCAA 3M6AA 4PRLA 4D82A 1P2UA 4FGZA 1QQ6A 1CZKA 1NG9A 4YRCA 1YB5A 2V55B 3ADKA 1N3YA 4W9NC 3SEFA 3ELYA 4DB4A 2YS6A 1MORA 4NTZA 3EVEA 1SKAA 3Q1LA 2D7JA 3GA5A 1UKVY 2WWWA 3ETNA 4J4HA 4JKIA 1O08A 4EGFA 1MRSA 2J5KA 2VI5A 3ZD9A 5J4KA 3V2UA 5IZ4A 3K2QA 2A9RA 1N5OX 4HNSA 4IV8A 1QHYA 3U1TA 2HLNA 4WXMA 1YOVB 1KOLA 2GEJA 4FYWA 2G06A 2ORYA 4HQRA 1XX6A 4X45A 3WL5A 1YFLA 1TJNA 2A9FA 2ZKIA 4GKBA 4ZO8A 3WI7A 1NV8A 3E18A 4GI7A 4PTYA 4U0KA 3TKLA 4B6RA 3OUZA 1KEVA 2ZAOA 3KC2A 2RHLA 1F7UA 3A2KA 2VUTA 1SCBA 1C1DB 3EDMA 3I30X 4HDQB 2EJCA 2PZLA 3WZ2A 2O0HA 3L6CA 4TRRA 2PTHA 3H1FA 1UP7A 1T5OA 1YB7A 1UMDA 2R25B 1J21A 2VF2A 1TJ5A 4B82A 3MCVA 3W5UA 1YQGA 3FHCB 4AP5A 2RH5A 5CLJA 2VPQA 5CIQA 1F1JA 3L0CA 1OCEA 2HSGA 3AU8A 4NPHA 5IXYA 3OPMA 1IN6A 1Z37A 1ZD2P 2O05A 1AV7A 2ZBRA 4D41A 5JCOC 1NLZA 1ZWLA 2WV7A 3Q40A 1N9KA 1YUMA 2X40A 3CEAA 2O50A 1BEUB 1JFFA 2PFKA 4HSEA 3RVPA 4NARA 4BBAA 5KS2A 3WGVA 4BVHA 2IBMA 3AB8A 3U60B 4B44A 1HDIA 2CGEA 1E1CB 1P1JA 2GBGA 5D3MA 2O6LA 2EKQA 3R6WA 3SM3A 1ZH0A 2P41A 1LC0A 1LBQA 3WWZA 1P1BA 4JBWA 521PA 4DY4A 4D5GA 4KQ9A 2WR8A 3BRSA 3BCRA 3QXCA 5B58C 1NN5A 1QO0D 1U3CA 4C0KA 1F6DA 3WZMA 1H6DA 3A2LA 4WOBA 4M7OA 3GUHA 2BC9A 4AO7A 4EGCB 4Y2VA 3INTA 1O8BA 1G41A 3A1DA 3KAQA 4KMRA 4W9RA 4QUAA 3H2YA 4B6JA 4BRZA 2P1RA 5BN4A 2X1VA 1MOZA 4XLZA 2FETA 3WB0A 2XEXA 1CY8A 3K9HA 3UKOA 1ID1A 3WSTA 4BB6A 3AUSA 3K0FA 2W58A 3CF4G 5I7EA 1P2FA 3KJNA 4D9HA 1OW3B 5BNFA 4ZJPA 1CYEA 4S3MA 2I0FA 3FOEC 4BX8A 1IZYA 1E4VA 2RI1A 3D3WB 5JE8A 3R7DA 4EBFA 2FG5A 2QX8A 3BX1A 2Y0EA 4I4TB 3RCBA 4F97A 2O8DB 5KTTA 3K0EA 4ZO9A 4WCFC 4JJFA 3D8TA 2AC7A 4XUEA 2WU8A 2OD9A 1D1PA 3Q8MA 1WB5A 1NJ5A 5EXPA 4R3WA 3GL9A 1XTUA 2JCYA 3H18A 3IXMA 4ZOLF 4ACBA 2GXSA 5K0EA 2CLHB 3OEEA 1RXIA 4KPYA 4HUJA 5I7UA 5L4SA 5JD6A 2C2WA 2VHZA 3AI3A 4YV2A 1OVMA 5F77A 3WQSB 3LPLA 4PRYA 3R7NA 3U3RA 5I3ZA 5CX1A 4AY3A 5EJ4A 3TLCA 4E5KA 1I3CA 4XGNA 1ZAKA 4BQPA 1X87A 1H0HA 2JFZA 2ZIAA 3CPSA 2DQSA 3QWIA 2Q8NA 2AMLA 1ATIA 1FNDA 4H3KB 2AFVA 3CH4B 4N18A 4F5ZA 4CTNA 4MROA 2P5SA 4DVGA 2X9NA 3EN0A 1S01A 1T24A 5EQTA 1QIDA 2A9VA 2XF8A 4RVOA 4B87A 2JIZA 4BB5A 4GE3A 3PQDA 4EUKA 3OLZA 4U7WA 4OGFA 2O3QA 2I4RA 1PD1A 1CIJA 3IO5A 2KLBA 3IVAA 1WXQA 1S3FA 1SA0A 4N0QA 1TLFA 2EX4A 3H8VA 4PRZA 5DYWA 3KTAA 5REQA 3TOZA 3FRIA 4LYYA 3BWDD 1Y3IA 2R7LA 3IPLA 3O8DA 5L3SB 1L1RA 2IQ5A 4UVEA 5EC8A 4FXPA 3DHWC 2DXIA 4UTRA 1N2JA 2F8MA 1BE6A 1KTIA 3ER9A 1PNRA 5FR2A 2IEIA 3QVSA 5CBPA 2C5GA 2CHFA 4G6ZA 4YJHA 3WIVA 1TDJA 1I2ZA 2Y71A 4KIFA 4AS1A 4J16C 1XLVA 3VI4B 4DLUA 2QTLA 1T5DX 5HPYB 5HM6A 1DKQA 1NA5A 2B30A 4AK9A 1D0VA 1NF3A 4S0ZA 3ZW8A 2IUFA 1RHUA 4UTVA 1FJHA 4R1TA 4EAAA 2Q6LA 2B36A 1GZ6A 1KA9H 4GAEA 1G8YA 4PY2A 3BDVA 1SUDA 1NC3A 2ZBQA 3M33A 5H70A 3NG1A 4JL6A 2W6ID 4K6GA 1I2BA 1JEYB 2ZAMA 2ZVPX 2VJMB 3DV9A 4MVXA 3VYVA 3BQNB 3N0WA 3VQTA 1ML4A 1RI5A 1RKQA 3MJFA 3TQIA 4N49A 2QM0A 4BWFB 1CY7A 1Z0JA 2YJGA 5J2UB 5HF5A 3WLIA 2G36A 1QAQA 5T4FA 5AIBA 3QPWA 4BMDA 3WGOA 2H7VA 1EGMB 5AXBA 4URYR 2BM9A 3PIDA 4LMRA 2RFLA 3T06B 1SXHA 1ZOSA 2XXAB 1KBQA 1YQTA 2FZVA 4HNVA 2CDNA 4DV1B 1U0NA 2M9MA 3I6QA 3QFTA 1GAQA 1L7EA 1OKKD 1NBAA 1QH9A 1OFGA 3ANYB 2Q8PA 3IDOA 2Z04A 4HQOA 5DNWA 3RGGA 3RO7A 4C7KA 3T7IA 4EY6A 8LDHA 3UH1A 2VBIA 4DMHA 1G0NA 1FNNA 3E2PA 4HWGA 2ZE8A 3WFIA 1BCSA 1E60A 2OV3A 4GNRA 4QHYA 4HDNB 4ICIA 4BBPA 1WB9A 3DNMA 1MKYA 1E61A 1FU4A 2GCGA 3ZBPA 1IM2A 3K4PA 5BOVA 4RMHA 1CR4A 4TQ9A 3C98A 2WTXA 3HJAA 2JGNA 4MZXA 1C41A 2JGMA 2NU6A 2DHRA 4DQLA 4XOIA 2WC1A 3RBXA 4GG1A 4QASA 4M4SA 2R7NA 1F06A 3IPAA 4JX9A 2FJUA 3JAKA 4KKXB 5CPFA 5AJXA 1FOEB 1TZKA 5IBPA 4O63O 5HFJA 2OZVA 5GOZA 1DDOA 2DQKA 1L7OA 3GRKA 1QVWA 4N39A 2ZYIA 1ORIA 2B0JA 3FSRA 3GAZA 2BCGY 4ND7A 3A6GA 1YBFA 4GXRA 2H1IA 3BMNA 3QJYA 2QKYA 2IP1A 2MYUA 3E0QA 3L7MA 5DSTA 2HYIC 3RWBA 5BSTA 3DE6X 1LI4A 1DPGA 1RYDA 5JZBA 2BKAA 2F9FA 1ZH6A 3CLKA 3W5VA 2XBMA 2H1OA 1G2OA 4ND8B 1JB9A 1L4GA 2ZSEA 3QYAA 2XWJI 3VC2A 2ZT8A 1MRZA 3VU0A 3ILHA 5FOQA 1T2EA 3DZIA 1M8JA 2ACVA 2RK3A 1B3RA 4LXHA 4C4YA 4EG6A 1HMYA 1RJFA 1YJQA 1TM4E 3O8OA 2R3SA 2FWJA 4ZV9A 2P5TB 1WTCA 5IHPA 5EXEA 1E62A 3B9RA 2BR5A 5ERGB 4KRGA 3LRTA 2HU2A 1PKXA 1TEHA 1T2DA 4H1UA 5JH7F 2X9VA 1U6IA 3VH2A 3RV4A 2YYYA 1P6XA 4AJIA 1P0FA 5G1NA 3NI2A 2BDTA 4BNLA 4C22A 1TEZA 3Q85A 4RETA 1ENYA 1WZUA 3A6DA 2P9TA 5H4HA 1E3EA 1GNQA 3TW6A 3Q9NA 3ZTYA 3RV3A 4C87A 1R0RE 4IR7A 2C96A 1XDWA 2OECA 2AN3A 3KAPA 3FG9A 4YRBA 3AL0C 1S7CA 4Q4LA 1IL0A 4PSUA 4LFAB 4J49A 1Y5MA 2BKLA 3F4KA 5DEIA 4KXUA 1O5TA 4EMSA 2C5BA 1AQ6A 1DEKA 2ORED 3RIHA 3I6IA 4IHKA 1ZCZA 4HGPA 5BT9A 3L4SO 1BXGB 4C3ZA 2Q2NA 1IN1A 2Y67A 1GUBA 1ZO8A 1GNPA 4BAZA 2H92A 3EUWA 1KYVA 2WTAA 4B6FA 1BEEA 3PFNA 4R2MA 2OCKA 4TXJA 3GLTA 1Z6TA 4A2WA 2C94A 2YMLA 3HVJA 3JWEA 4MJ3A 3QWFA 1SB8A 1RXEA 1KI7A 2PDAA 3B6JA 3QEOA 1JMYA 5EE5B 5J2TF 4EG5A 3PGLA 2Q9UA 3HEBA 2L69A 3VZDA 2N9UA 1T8RA 3E8XA 1CY1A 1XTZA 4Z9YA 2G8NA 5CDFE 2JI7A 5KSPA 2YC2C 4O8CA 4JGBA 4C89A 1XGKA 4DYDA 4C4AA 1QLJA 1XHLA 2QD4A 2QXUA 1DC8A 1U8AA 3E53A 3L8ZA 4XX0B 2G76A 1LDMA 2FSGA 4X44A 1FJXA 1NG1A 1AM4D 1DAEA 4YT5A 4BZPA 1G7TA 3DPUA 1QPBA 3U17A 4OQPA 1O9BA 2BTQB 5E6UB 4E5SA 2PSJA 4MXDA 2NOAA 2JNWA 3MYRA 4KMSA 3D6JA 3FNFA 3U3JA 2ZCJA 1CUSA 1JHQA 4H08A 4OYYA 3RSQA 3VDNB 4ZI7A 2A57A 3VNVA 3O2JA 1VLHA 4U7DA 3WLLA 4B7CA 1HKUA 5DHFA 5JOQA 1DQYA 1ZK2A 1JG4A 3FHOA 3OAAA 4ZV7A 5FUWA 4OM8A 3UT6A 4BAGA 3NBAA 4NV3A 1EGAA 2W6NA 4PXSA 1QANA 1H4SA 3KZVA 1QOZA 1LLCA 1TYZA 2XYQA 3WP0A 1JILA 2IF2A 4Q03A 3BWXA 1HDCA 3SHTA 2JBAB 3DLIA 2V5AA 4DJEC 4I9NA 2V7XA 3QPVA 3B2QA 1JSZA 1KP9A 3DDCA 3L1IA 1II8A 3G5MA 3MTEA 4ZOEA 1JEDA 8AT1A 2G3YA 1UBKS 1H5QA 3AUFA 4JEUA 1ZW1A 1MP0A 3TMAA 1N6NA 2KE5A 4AJ4A 5CCDA 3W2IA 3PZRA 5ED0A 4QARA 2YWCA 1BKSB 2XUPA 4RM3A 3LLUA 3VR2D 2WWTA 3T0IA 2VTBA 3EZFA 4DJTA 5C8VA 3HS3A 4TTSA 1YKFA 2B2CA 3IEPA 4K6KA 4LZZA 3JZFA 3EEFA 4GF5A 3SN6A 4IIUA 4Y6LA 3FPHA 1OFIA 3I6BA 1SBCA 3MRTA 1KTVA 3GT4A 3NRCA 2EQAA 1TLLA 3DUFA 4LISA 5C4IA 4IDPA 3FD8A 3L6DA 4JJZA 2QRVA 2WM3A 4M22A 4YACA 2CV0A 5I3CA 1BFKA 3IDZA 4CI9A 5BSUA 4QXAA 4C06A 4RPKA 2J0QA 1OMOA 3KKMA 2C9CA 2WKSA 4KYTA 1XPRA 4UTZA 4N12A 4GPBA 4F2PA 2CUKA 3HCOA 4F5EA 1X7GA 3F67A 4HGOA 7MDHA 4MP3A 4ZCSA 5ECYA 2W6ZA 4Q6BA 4I50A 4J0GA 2J87A 1BD3A 2WIFA 1J09A 1I3LA 1N8NA 4MEAA 5K2MA 1H9BA 1E20A 1I36A 3PD1A 5CX4A 5FUXA 3S1AB 1Z4MA 2X0KA 3F90A 4Q4JB 1S1CA 1KKMA 3QLUA 3RUFA 5J4LA 1GA4A 2Q1YA 1SPXA 3ZQKA 1JHXA 4J03A 3T7SA 3K0CA 4D4KA 2GERA 4HNTA 1J2JA 4DADA 2P2LA 1ZA2A 3UZUA 3HO6A 3KXKA 4O25A 4XM0A 3F6EX 3D8UA 3AY7A 3NEAA 4B34A 1E3WA 2HXSA 4E07A 4IGEA 2EEZA 2EFEB 2AW3A 3CIOA 1TC2A 2XGOA 1DTSA 1E2NA 2R68A 4OHCA 2GS9A 5AH0A 3SAJA 4D9CA 3PNSA 2N46A 4BNDA 2IV3A 3KQKA 2ZRGA 1PEDA 2YWBA 4KQXA 1JKIA 4ALLA 2W42A 4BQFA 3LVQE 2OG2A 4F60A 1GAEO 4ENUA 5CFRA 4D02A 3NYWA 4S1PA 1VJGA 4L0QA 5K9ZA 2VJPA 3MFQA 5BURA 2FMUA 1YSCA 2XYVA 3PUJA 4MI6A 2AZ4A 4FKMA 3TKYA 2PXXA 3OM9A 2AB0A 4C0HA 3R8CA 3GLGB 1JKXA 1V1JA 5DBHX 1RADA 3I37X 3T1HB 2W5UA 2AG0A 4BLQA 3SFZA 2CJFA 3I01M 5FI3A 3BHNA 3G0GA 3NHFA 2YXBA 5E2IA 1XEFA 2K4MA 2JFVA 1YDEA 1ACMA 2UVDA 3BIXA 2DB3A 3U37A 1VM6A 4QEKA 4KO1S 3CG4A 5A2GA 1V3TA 1T2UA 1EVEA 1JPNA 2H1HA 1BAPA 5NULA 5HJEA 3OLXA 5K8VA 2Q8QA 1YJBA 3HUEA 2WE8A 3UAOA 4BPRA 3G6KA 4XIGS 2B7BA 3PXGA 5U4XA 3I92A 4QECA 4AF7A 1SIOA 2DPXA 4O2BA 1N36B 4DWJA 4LTNA 1BA2A 3DTVD 3IAS6 4FN4A 4I9HA 2C88A 1PJBA 4YFVA 4BMXA 4IZHA 1EWVA 4MMYB 5CXSA 5FPHA 4O2LA 4ZO4A 1B1CA 2CF5A 3DC2A 2H9AA 4C0QC 4ABTA 3WO1A 4RF2A 3M81A 4WNCA 4AZTA 2XY4A 2YXPX 1CY4A 2O14A 4QRIA 5BUZA 2HQOA 2WA1A 3MGAA 4UARA 1WS6A 3QRWA 3IC5A 1E2LA 4EJFA 4QO7A 1JKMA 1DBQA 4CQMB 5IM4F 1MX3A 5FTMA 4AP9A 2H1CA 1U7WA 5CFPA 2BGTA 1MV5A 5LB4A 4D2IA 1N32B 3U13A 4JBYA 3HUUA 1T13A 1M0EA 4XVRA 4JU8A 1NUPA 3UHOA 4D99A 4HJXA 3M3HA 3ZEIA 3E3LA 2IZ6A 2WJPA 4EPYA 1GA6A 3IUMA 5I9IA 1ECJA 4Q3OA 2UYOA 2OA0A 4PGAA 4NK5A 3T3HA 2I1QA 2OBYA 3T7RA 1B93A 2G63A 1JP7A 1H85A 1QV6A 1RYHA 3B1KA 4FD3A 4YI5A 3N2KA 4Q48A 4XR4A 3B5JA 3CUUA 3MLAA 4J0QA 1M1NB 4UAVA 3V3KA 1ZICA 1TAGA 2PGAA 2GCIA 3GIDA 4WN9B 3D7RA 5G53C 5C51B 1ZH2A 2ODTX 4LQ4A 2AXEA 1SXQA 3COJA 1WHTA 4Z9FA 3WKEA 4EATA 3VR5A 1Y1QA 1D2EA 3C3YA 1C1XB 3NWOA 2W2MA 1AUPA 3MMSA 1JU4A 2F6RA 1UQRA 3Q9LA 1T5IA 3MWEB 4LFCB 2PMDA 1SVOA 4LZLA 4MPPA 4MPRA 1EG7A 4R8KA 4ZGGA 5FWYA 1FMFA 1TCUA 3NC1C 5FOVA 4FGSA 4MYTA 2PWYA 1BHQ1 4FZJA 2OORA 4ETMA 5E7MA 5I4BA 3VVBA 3A7EA 1S8FA 4QPPA 5K0JA 3HXOA 4I9UA 2GRUA 3N8DA 3LT0A 3O8RA 3HCDA 1N9GA 3O74A 3S55A 2FUG1 1RKBA 1D4OA 2PX4A 3S1LA 3V3TA 2BUCA 3B13B 5DYGA 4BS9A 4G0VA 1MT0A 3IBFA 1AGYA 5I8PA 4IWYA 3DLCA 3H9CA 3OMWA 4DYVA 1KKUA 3GJ6A 1EB9A 1DTWB 2VJKA 3K9BA 4GOKA 4D7AA 1UFOA 2JANA 3DTTA 4J7XA 3AL3A 1SVMA 1XEXB 4J94A 5CVUA 5IN5A 2HCBA 3HVUA 4UU7A 2B4KA 2QXTA 4JUDX 3FDZB 4K1XA 1ZAYA 1CJKC 4J8PA 1U0HC 4YRJA 4GZLA 3Q3EA 2B1JA 2DHQA 1IXKA 3LY7A 4B3MB 1G4AE 2BBTA 2X5JO 4AUEA 5ER6A 4HDRA 1EEHA 5T3UA 1CS0B 1G19A 3KTOA 1KSFX 3ZNNA 2J3HA 3I8SA 2WFZA 2FZCA 1HBJA 2YQZA 5TPZD 1VLZA 2DQZA 3M82A 3O3OB 4PHGA 5J1SB 2YH2A 3LC7O 4CFZA 5TMPA 5BV8A 2NSJA 4AJ1A 3CLRD 4HAUA 2W2KA 4DDUA 1BGWA 1NW6A 4FEAA 1QBGA 5EQDA 4D25A 3K1TA 3KYBA 4OBBA 2WUGA 5MF6A 5AM5A 1T36B 1XD2A 4A5OA 4JN6B 5FA5A 1GFIA 4LE0A 1OE0A 4B47A 1UKYA 1R6VA 2A5LA 3JQGB 4J7CA 2YYSA 1H9AA 4JC4A 2NSHA 1K8ZB 1FDIA 2CB9A 2YRXA 2QQGA 3HKDB 3PVSA 4IOKA 1SUPA 2VAMA 3ZDYB 1JXAA 3LCMA 4LXUA 4MRMB 4Y1GA 3UC5A 1E5VA 2VATA 5E1MA 5EWMB 3DGFC 1XDDA 3JRXA 1DLIA 3UUEA 4JSTA 3CKKA 3OA2A 5C3UA 4UVIA 4M53A 1OREA 2HMAA 2XTZA 3MINA 3NAQA 4NOJA 4XYMA 4ND1A 4C9BA 4NEGA 3BGOS 4LZWA 1KIAA 2BZSA 1R0BA 1P5FA 3EIOA 3SHFA 3NJRA 4PPGA 3BYZA 1GAWA 2IKQA 5LDGA 3JWJA 5K4HA 5LZ4A 4UBJA 2FB9A 5AKYA 3ONDA 4UHHA 3WLAA 4FE4A 3HACA 2PRZA 3QXGA 1QIGA 4LZJA 5BVGA 4Y2TA 4N82A 4PC7A 1CP2A 5C4GB 1Z7WA 1U7PA 2CWWA 2MU1A 2WPDD 2Y4OA 5E95A 1EESA 1L4YA 4ASUA 4A15A 2NT4A 1UBCA 4GI3A 4DGSA 4W5TA 3X1YA 2ZQ5A 1C3EA 2H29A 2OV2A 4QYMA 3QLUC 1X92A 2BGKA 2C1ZA 1F0YA 2XYGA 4LKRA 1X7DA 2R8OA 3K0CC 2Z5VA 4W5NA 4KN5A 1P4AA 3TTYA 1N5JA 2VQ6A 4EHKA 1KPHA 4TROA 4TS9A 3K6SB 4MS3B 2JHPA 4CKCB 1R12A 1WKCA 3V00A 2VNSA 4NXMB 4FQ7A 3TLXA 1BKDR 1JJVA 5EIFA 4L5CA 3WWOA 4G0ZA 3REFA 5I4KA 3QYFA 1NBOA 3UWOA 1DPFA 4N0DA 2JJQA 5IWAB 2WJZB 4GMKA 4ZMBA 3CWZA 3L6UA 1F60A 3KWMA 2O5RA 4EWLA 1O54A 1W5AA 3OTHA 3PD7A 2QG6A 5AVKA 5DSZA 4AAYA 3GJXC 4I3FA 3L01A 5LZ8A 3U7EB 1UOQA 4XARA 3AFGA 3QXXA 2V65A 3CN9A 5D8DA 4ZICA 2VHJA 3B3GA 1OJLA 1C1YA 2AZDA 3HP7A 3ZDEA 1VSQA 2A84A 1Y1RA 3I1IA 3JXEA 5AVVA 4CQLA 4ZAVA 2NAPA 4RNCA 4EUSA 2I2AA 4IH1A 4NATA 1TO1E 1P1KA 4RQBA 3N8IA 1QZ3A 1YVEI 3WNBA 3OY7A 2Q6KA 3KJZA 3HGMA 4Y7DA 5HSGA 2PCJA 3TDKA 3KDAA 3KTFA 1I32A 3CONA 4EX6A 4DMRA 1TK2A 3HBMA 3JPWA 2VK8A 2YWXA 2ZTMA 3G1UA 4E33A 2JLZA 1K89A 5KJ1A 3IRVA 1V8OA 3D4LA 4B83A 3LT1A 2X1MA 3DDZX 3NTVA 4F8JA 2GHIA 1E59A 4IHJF 1Y3BE 4Z4QA 1HO3A 4PGFA 2DBRA 3EIFA 4TTRA 4YTEA 3KVNA 5KWJA 3KBOA 1T8TA 3DOHA 4K9KA 5KNBA 1U8UA 3ND8A 1CEQA 3F5MA 2QDKA 3RBVA 2CNKA 4QEDA 5I7RA 5IDWA 1OF1A 2PUTA 2MHCA 4NZOA 5CVDA 3WHLA 3AXSA 3ZQ4A 5CW1A 4ZXPA 1P7CA 3C3AA 5BSVA 5DBEX 1KDTA 4IKEA 4C08A 4BGDA 1J4AA 2DVMA 2YDXA 2AL7A 4ZEXA 5HQ3A 1P44A 2OFFA 2VWGA 4D9FA 5JNSA 4YIHA 2W2LD 3G23A 4FC6A 1U80A 1GQOA 2O07A 2H16A 4MKXA 1Q7TA 1Z6GA 1Q0UA 2JBWA 3DCJA 3L8DA 5FPTA 4YRMA 4KQIA 1LB1B 1A0OA 1GRNA 3V2HA 4JLBA 4FBLA 1VMAA 4OFZA 5CA1F 1KHHA 3UMYA 3IX7A 4QAQA 5EKXA 2AFHB 1B8UA 1EINA 1RCUA 3QA3E 3JVEA 3BWMA 4LY6A 2VA9A 1T9CA 3F3YA 3NYIA 2UKDA 3ISJA 3OPVA 3ETCA 2VXCA 3GZNA 1PLKA 2MYPA 2GN6A 4GPEA 2X5OA 2CCKA 3SC2A 5IT9A 1UAAA 2Q2OA 3EVGA 5HE8A 2ERYA 1NXVA 5IG2A 1GPBA 4Z3KA 2WM2A 4HP8A 3VZQA 5DNEA 3ZZUA 1P5HA 3C5VA 3HGTA 2AT1A 3CM0A 3E9ZA 2C29D 2IGTA 2ZE6A 5KOJB 1TUBA 2CE7A 1K98A 1TMOA 2KHZA 2D62A 3P0IA 4FDAA 3ZCRA 5ECWA 1CQXA 3GK3A 2M1XA 2FPPB 2QR2A 4U7TB 4MTCA 1ZSVA 2Q1SA 1UWCA 4J1NA 4MWOA 4A26A 4QT0A 3GY0A 4EKEA 3N74A 3HU1A 3WIBA 4JLAA 3Q6NA 3TBHA 5L9AA 3ZVKA 4AZVA 4EL0A 2XAAA 3MC1A 4U2DA 3B20A 2FF7A 1QCYA 3IMCA 2WJHA 4RFSA 1ENZA 2RC5A 4CHTA 1XC7A 5KJFA 2WQ6A 4N54A 4QE3A 2Z6AA 3KPWA 1Z34A 4WDQA 4IIJF 5FLYA 5G4KA 2JLRA 1J5XA 5IJZA 3EZXA 2NO4A 4ID3A 3KPJA 2I6FA 1K4MA 2Z2YA 2Z6VA 2QV0A 1QCZA 2VIIA 1BMTA 1ZCFA 3QYJA 4C03A 3EVFA 2BFFB 2W71A 1JWAB 3LBIA 2VQ3A 4HAOA 5CFNA 2Z08A 5JBQA 2FWBA 2AMJA 4E22A 5GTDA 1NI5A 3BXXA 4BNFA 3LH5A 3VNAA 3CT4A 3G2JA 1O58A 1FUIA 3N5CA 1G4UR 1CNEA 2OV1A 2C92A 1NX9A 1IWBB 3JSXA 3X2FA 5JUWA 1CW2B 3EUAA 3I9V1 2H7XA 3GPDG 3KT6A 3JQ7A 1V35A 1T35A 4V2UA 3H0KA 2YVLA 2G9UA 1QIEA 1L5SA 3PKIA 4WBXC 4XGIA 1MVOA 2WFLB 1KR5A 4DCGA 2E21A 3R3SA 1J25A 4K86A 4MRPA 1SXJB 2DTDA 2VNJA 4OLBA 1M5RA 1C29B 3KV1A 4TMXA 3ESCA 2WFAA 4BVKA 5A7FA 1LLUA 3G0CA 3QA9A 1M2GA 2Q4RA 4DG9A 1NUSA 1RC8A 2QUKA 2XQFA 4KQGA 4HI0E 2W7TA 2NP7A 4M86A 5KREA 4XTCS 3P8ZA 1P5RA 2V96A 4C4SA 5K0GA 2QRJA 2WWXA 3B9PA 2D5CA 3DBHA 2AVNA 4GS5A 3CEMA 4MHSA 3CIFA 4KPUB 2XKJE 3ESDA 3EXEB 1H4QA 3WDSA 3RU9A 1GQQA 4DUGD 5FL7A 4OXXA 2G4VA 3NM5A 1DXQA 3GEMA 1L8LA 1U8XX 3NH9A 4PTZA 4UKDA 1FXWA 4RDXA 1BFDA 2L19A 4P3YA 4LDRA 2FX5A 4DTIA 3L06A 5F21A 4P1ZA 3B1VA 1D5CA 1PE0A 3BXGA 3P0HA 1BMDA 4AJHA 2FPLA 3A4LA 3L7OA 1GPMA 3TKAA 4B3BA 1E3MA 2GJSA 3O4HA 4TZTA 3LYUA 4WZAA 2GYWA 4RXMA 3UMSA 5K3FA 3WMRA 4IFIA 3W9YA 3AK4A 2PUFA 4WRRA 4EW1A 4MS1A 1EK1A 2ZAYA 3B3AA 4BZQA 2NSYA 5JAQA 3T1YB 1JWLA 4IW3B 3UJDA 4MVJH 2Z4SA 3HJUA 1W9MA 4K7JA 2QLLA 3I6MA 3KUDA 1C50A 2ZJ0A 3DJYA 4G4IA 4NYMQ 2CL0X 2I7TA 3IBYA 3JYOA 5J40A 3HZHA 3VVLA 4A8PA 1N2BA 2CB0A 1QZTA 2PLWA 2XZTA 5ALZA 4C4XA 2ZSFA 2UZAA 3NYQA 3FTPA 5B3KA 3GHYA 3W5DA 2ZI6A 3ZV3A 5EIWA 3T95A 4FWTA 3UAXA 2IY9A 1PK7A 1QGED 3DDWA 3KLOA 3E9NA 2H11A 4GL4A 2BUBA 5D5HA 5ALSA 4LHXA 1M75A 1YK1A 2AXQA 4JU9A 3OE4A 2A88A 1TLTA 1BW9A 2Q5LA 4Y2YA 3E05A 1NW7A 1FCJA 4C1NA 3H5OA 1H8ED 4X1KA 1ECGA 4FR5A 3F97A 4MV4A 1JAYA 3CRVA 1U1GA 3TFQA 1PGPA 3OJLA 3D2CA 3QKWA 5GGXA 3DV0B 1H2HA 4JT4A 5K09A 5AW3A 4PIVA 1T0UA 4U3JB 5C1BA 1RXUA 5EMJA 5CEJA 3V8QA 4B40A 1QPZA 2XRZA 2VFAA 3NPAA 1ESZA 4LYDA 4X8OA 4US0R 3GUUA 4PAMA 3RGWS 3VNSA 3NDRA 2PA3A 2C95A 1NDUA 2R6GA 1IN7A 3AI7A 4MVJE 4ESOA 4CDNA 2XWBF 1IBLB 4UBKA 1RYYA 2D3TA 3E5MA 1C3OB 1QIMA 4PLPA 5B2ZA 1TM7E 1L5NA 4NLLA 1VJTA 5AT1A 3DOUA 4CE6A 1S7GA 1BMFD 4GQIA 4CLOA 5KZMB 4DC0A 1M2NA 1WRBA 5TPWA 3QU5A 3WXMA 3KWFA 1CHDA 5BVHB 4KNYA 2HCJB 2H00A 3RUIA 4Q6WA 3NRJA 2C20A 2E82A 4FSXA 1H3NA 3PEFA 3OUTA 2OBBA 3A9RA 3IAHA 3MQ4A 3NM4A 4B7UA 4HO1X 4OEHA 1OXMA 2JD2A 2WF6A 3N1UA 4I2VA 4AUNA 4PONA 3MT8A 3C43A 2QRGA 4HB4A 1L7PA 3GEGA 2NG1A 1H0KA 4BB9A 3RM3A 4UEWA 1M1UA 3L7CA 1MABB 3P2IA 1IM5A 2R2GA 3LQKA 2WJ6A 3MQFA 3ZK7A 1BTOA 2Q7DA 5BV7A 5M29A 4L4XA 3AVUA 4I46A 4PTLA 2JH9A 1C0IA 2R7AA 1P77A 2H48A 2XNKA 5AW0A 3S2SA 2Z2XA 1H93A 1N5RA 1MC8A 4PGHA 2YWJA 1GYQA 5DM2A 4EI7A 5F2NA 3PGXA 3HKEB 4LECA 3EVBA 4O3MA 4X7PA 3EOAI 3TNDA 5LQMA 4B4DA 4GO1A 2YFQA 2RHMA 1HETA 2XMRA 2Y1EA 4DA9A 1D03A 5KQLA 1QAOA 3D5EA 4NESA 3RF6A 3KHTA 3ACDA 4OQZA 4E7OA 2WUFA 4G0UA 1WMBA 2AD5A 3L0SA 3WICA 3PB3A 4ZAYA 1D6JA 1GCOA 2DUUA 4EENA 4Q37A 1G8KA 3MNFA 4F86A 2P35A 5LKRA 1H1LB 2ZIVB 3ORQA 4RIHA 4CU2A 2V0NA 3PU6A 1Y7IA 1KXZA 5H59A 1PJSA 4W8OA 1Q1EA 2DZDA 3MFYA 5DPMA 1EP1B 2WYWA 4H6WA 3LCUA 3E7DA 2HAEA 4JSYA 4KGDA 5BYJA 3FOFC 2YV3A 2PVPA 3W8FA 2PMEA 3Q8WA 5EZ6B 2VYNA 4X1YB 1HKHA 3Q87B 4A8JB 2FG6C 1UBLS 4ILKA 5C37A 2O8CA 1L5WA 3WLHA 2IX3A 2NVOA 3CO5A 1FMTA 3EW9A 3V4RA 1W5BA 3HXMA 3KT3A 3BXHA 3BHIA 4RSGA 1ARZA 5HTKA 4KFUA 1W88A 4DPMA 2CHUA 2AX4A 1H2RS 4JY7A 5AW1A 1QHNA 3VOBA 1Z47A 3AT1A 1OJ7A 1QLWA 1SMKA 4TKUA 4TYQA 2GFHA 4ARAA 4YHBA 3CNNA 2PSDA 2OBMA 1MN6A 3H0EA 4KQ1A 5C8YF 3NONA 1UC4B 1Q5PA 1US8B 1HX7A 3IUPA 5IM5A 1VXOA 4N8SA 1B41A 1X19A 2YV1A 2O8BB 1G2IA 2O2DA 3DUWA 4C0JA 1QTQA 5KB3A 1JFSA 4MW9A 3LLCA 3D8BA 3INNA 3UY4A 2ZRMA 3GBPA 5DM4A 2VDQB 4YK7A 3CSDA 2OMKA 2XXJA 3ROQA 1ADGA 1UIRA 4UPVA 5CVVA 4QLBA 4Z4FA 4YJFA 4RGBA 2E2WA 4BNGA 3EQ7A 2MMGA 4KUEA 1CY6A 2RJNA 5BQXA 5BXQC 3TIXB 5ISMA 1W36B 1U8FO 4W8GA 3UKJA 1E64A 1CQWA 1GRRA 1PBTA 3R75A 5JVDB 3TSCA 4QVIA 3ZLUA 3VZSA 3UJ8A 1KERA 2J6CA 4RMJA 2QTCA 1EVQA 4RANA 1SCQA 3FFBA 4IFBA 1JDJA 1MJHA 2Q9AA 3EXIB 3QX8A 3RASA 3UCFA 3KALA 2FFBA 2HHHB 1XTJA 3MLBA 4D9IA 2JLAA 1LRLA 3R74A 3RIYA 3E2MA 1P7PA 1XYGA 3NVDA 4V0LA 4RH1A 2WF5A 4YRRA 3ZWNA 1N2CE 1RWNA 2L17A 3L8FA 2QPTA 3LT2A 3ZHVA 5G41A 2C9OA 3AQ4A 5LLDA 1PJZA 1KAHA 1R0CA 3L6BA 3LOQA 3MB8A 3QUTA 4TLAA 4G4GA 4LV5B 3V7FA 3VGPA 1VE6A 2ZJ4A 1SUFA 4JXZA 1SXGA 4WNIA 1U3GA 2V45A 1GV1A 3BGWA 3JALA 4YUYA 4F04A 2J5QA 1ZUIA 3THXB 5FIUA 1IQRA 1TQ2A 2R5WA 4C29A 1C4WA 3NVMB 1XJQA 4HTAA 3PE3A 4E4YA 4D4JA 3E22A 2FLVA 2JDID 4JT9A 5DW0A 1DIOB 1QTNA 2BJVA 3QF7A 2P4UA 4GZMA 5KEIA 3T0FA 5HQTA 4J7UA 1FUEA 3WA6A 2PMCA 2OXCA 1RBMA 2A9PA 4E1VA 4AMBA 4B3TB 4JWTA 3AYXB 1XFDA 2Y1FA 1E8MA 3L7KA 3U5ZB 4TVKA 1H66A 4OQEA 5AUNB 5JPCA 1GLGA 3QFCA 4WGGA 3QNMA 4ZKDA 2YYZA 1W85B 2O7NA 1A1VA 3D8SA 3WGHA 2FPUA 1U8TA 1GGKA 3A2MA 1YZYA 1OB5A 1PUJA 2C8VA 4MW6A 4LXXA 4JLWA 3PNQA 1TAUA 4WN3A 5IVIA 3LVRE 4EQ6B 3L18A 5LWQA 3DDNA 5KYWA 3BL5A 2HU5A 4S0XA 2QYTA 1JEOA 1DO2A 1VKZA 3F7NA 5DN6A 4DNXA 3EOBI 1I6LA 1UFRA 4BHTA 4ZJUA 2ZYWX 1TYEB 2FFHA 4PR3A 3PF8A 4V1CI 4M9RA 2Y1XA 3DULA 4OI4A 3R0QA 5BSHA 3DZDA 1K0FA 1LPAB 3K9LA 4RVHA 5JCJA 4X3PA 1WXGA 3ZE1B 1CY0A 1DGQA 4FFRA 1CUYA 3T9CA 1P9NA 1JG1A 4LF4B 2OHOA 3KQYA 2Z98A 4JLSA 3UVEA 1IOZA 4ZVMA 2GWHA 3TAHA 5JSHA 4DV4B 3NETA 4B74A 1K8YB 4DLNA 2V7TA 3RBAA 1NYQA 5F76A 5FLXA 3L8MA 3BTOA 2BONA 4OJTA 3WLJA 4B3GA 3D7SA 1MX5A 1YR8A 5H80A 4AECA 2I4IA 3I76A 2FZGA 4QOEA 4M99A 4Y9UA 4DREA 5B3LA 5KPJA 1HV8A 4NS4A 2AR9A 3NTLA 4FZVA 4AS2A 1YMVA 3S28A 3KLNA 3SZ3A 1JE0A 3UTDA 2Y4NA 1Y8CA 3SCZA 2QK4A 4MDEA 2YOFA 1WM1A 1XWFA 1I1QB 4F6RA 2ZQZA 1UZLA 4FVTA 2EX1A 3RC7A 1N5MA 2CLLB 5KIAA 1I80A 1RQPA 2GTIA 1WMEA 1ZGBA 1OHHD 1Q17A 1EAYA 2QQ0A 2GPBA 3EXHC 1ISRA 1Y81A 2JI4A 5IYZB 1C9JA 2HK8A 1Y0BA 3JQDA 1JT2A 1QH0A 2HJGA 3FZNA 1L4KA 3OESA 2IYPA 3PXXA 5AK3A 5U4QA 4L5YA 1XCMA 3E70C 2PL9A 3M2TA 3TCKA 3UG7A 1K4YA 2HL6A 2R44A 2VK2A 4IJWA 3HU5A 5K3EA 3PNBA 1E9EA 4ERXA 3UMBA 1PHPA 2NADA 4MINA 2VZ8A 5HIKA 3BILA 4M0MA 1WD7A 2XX3A 1IQPA 4JVSB 4P3NA 1H2YA 4REOA 4TYYA 4UNIA 2P0AA 2EF1A 3EIHA 3LP5A 1U9CA 4KSBA 1PJRA 3ROPA 1DAMA 1JHOA 3SD7A 4AKEA 4IP0A 1JHYA 2FFQA 1U0FA 3BMQA 4PHHA 3SXPA 1XZQA 2WILA 3H13A 5JCJD 1FTWA 1N77A 4IIJB 4ZHQA 3URMA 1SCNE 4ND5A 4JP2A 1VBNA 3KSRA 2QPLA 4OJQA 1Y8ZA 3SEAA 1ZCJA 2V9CA 2COEA 3OOHA 4HLUA 2GFIA 4DEXA 2I2DA 2AYXA 3DM9B 1LDGA 3LA6A 4OHWA 2DJIA 4P4SA 4OJNA 1P8JA 1XV5A 4DE5A 4YR9A 1YGPA 4UUAA 3OPYB 3AM1A 1KOFA 5B3JA 4EI8A 1A9SA 1SCIA 2QPOA 3DMHA 2GZMA 2VRWA 3F3MA 3GNQA 4NCJA 4U7FA 1BCRA 5LQJA 4W5OA 7YASA 4MUEA 3NM6B 4MVYA 2VBCA 4YMLA 1NVEA 2E6KA 3P20A 2PH1A 5DE3A 4NBUA 1DE0A 2AWOA 2KYRA 2NU8B 4ZTZB 5B1EA 3EGVA 1NUTA 4RD6A 1QX4A 1ZD8A 2GA9A 1VI2A 2GT1A 3HCEA 3KXLA 3QI2A 1WUJS 4OQMA 3UQYS 1GDHA 3AUUA 2AE1A 1WHSA 2ONZA 2GBPA 3KUKA 4G9EA 4LJ7A 3DL0A 4Y2GA 4TS1A 4QDKA 1PGOA 2HH9A 1EM8A 2C2GA 2HSJA 4H3HB 2YASA 1K5GA 1GT91 1HE3A 4D0RA 2P9EA 3FZYA 4IDCA 3ZU3A 3AI1A 4OL0A 4RS4A 1WQ3A 1VGQA 4NFSA 1JMKC 1T8YA 4EB6B 5T8KA 4WJZA 4MWTA 4BFUA 1KDOA 2FSVA 3QG1A 4E1BA 2FZ5A 3PFBA 4KXQA 3U31A 1TUEA 2EZUA 3A6LA 2R6DA 4C6TA 2QZPA 2N3ZA 3F2IA 4LDAA 5BV0A 2QM8A 1IG0A 4RTNA 4B43A 3H5RA 4YAJA 2I2FA 5CHYA 3QNUA 1USVA 1FX1A 2IC5A 2XB8A 3CUTA 2ET6A 4AU1A 1KWGA 2JIMA 3GGOA 3R09A 4MK4A 1FVHA 4MGEA 2RGDA 3AVQA 1VECA 1BOOA 3D3JA 4KG7A 4R2IA 1M76A 5LOVA 2PJZA 3AR2A 3U7RA 4E1AA 1YBVA 1J2YA 1C3VA 4M54A 4P92A 3VBEA 1NNEA 3FVTA 5IBQA 4EVRA 4L7VA 1WY5A 1RYBA 3O7MA 2BZ1A 3Q8KA 2XQJA 3COVA 4H15A 2POCA 2YFYA 3M9LA 3PQCA 1MR3F 1NW5A 4FXOA 2QS9A 3SZLA 4R9VA 3DEJA 2XKKA 1CR0A 3MPUA 3OZDA 3DKRA 1I4EB 1VRWA 2LXNA 3OIYA 1EFVB 4H0NA 3F9IA 4J0IA 4TVOA 4URUR 3ZK9A 1RQ2A 5HXAA 4OLAA 4K0KB 2P6UA 2IDZA 3P94A 1JDNA 5DGHA 1GG8A 1QZUA 2ZB2A 4MWCA 1ONBA 1SUSA 3BT7A 3QVKA 4MVJI 4B3DA 5TDHA 4ZVQA 3FTDA 2BBSA 2H63A 4D57A 2R6R1 4IMJB 2F1RA 2FZKA 4XXHA 5CLQA 1AGNA 2ZRAA 2FTKE 3B6EA 4R1MA 3AEUB 3GRVA 2B82A 3DM5A 1Q44A 2RONA 4II3A 2ZR9A 5SZIA 5E6RB 1NDQA 3A6EA 4C5BA 1U02A 2WF9A 3PTLA 4LHSA 4CTMA 5KNDA 2GTHA 5KYKA 2BZ0A 1EXNA 5DWVA 2GYUA 2ATVA 1F9EA 3B5EA 3CCCA 4TTVA 3RAEC 3E3OA 1F8GA 2O0JA 1YQUA 1P2VA 2F90A 2SECE 3LZDA 4MMXB 4WFQA 3ICOA 3PCRB 3QWAA 2LKCA 4EJSB 2R66A 3L79A 2EGUA 2BEUB 3D0QA 2YV2A 3D1VA 5F5NA 3G89A 4YXWA 1C30B 2QF7A 4H7PA 2F43B 1OLXA 1OV4A 4HWKA 4RTSA 4G1BA 3PNYA 3R3VA 4UAJA 3W5SA 2OY0A 1AS3A 2AEEA 2PN1A 2WM9B 3ILXA 1MNQA 2XD4A 4WY8A 2NU9A 3RNLA 1O2DA 1KIFA 4GMFA 3PUZA 4CKEB 3GMSA 2VP3A 5K6RA 4CIAA 3Q6IA 4P6VF 2Z30A 3ELUA 3TF5A 4DMFA 3ZQJA 4BMNA 4DXHA 5HYVA 2Z56A 2YNMA 3QV1A 3MGBA 3OU2A 4G4SO 1JQBA 3KZKA 4Z1MD 4JELA 4NG5A 1BE0A 3LRXA 5JJ5A 3B1XA 4XJXA 1GNSA 2HU8A 1UPBA 3IAAA 3Q4GA 2MSLA 4ESVA 3OT4A 2W6JD 4OHPA 2O8EA 2FAXA 1PUXA 2O5CA 3MZ0A 2J9FA 2IHZA 3LBFA 4OIFA 1USKA 3EH2A 4WERA 1EFUA 2CFTA 2HHJA 3ZLTA 4AT1A 2V3WA 3RRMA 4BRSA 1Z88A 1XTIA 1YRWA 2XE4A 5DEOA 4ZVOA 3X0DA 1M1ZA 4LVCA 2CBZA 2GK7A 4GR9A 3OMXA 4Z0HO 5EYPA 3THWA 1LBIA 2CJWA 4WTOA 3X1ZA 2PX3A 1GM5A 1KMHB 1UL1X 2QGFA 2GFQA 3EVZA 3MWDB 2B3TA 1ZD5A 3TQQA 2A1TR 1ZRSA 3RSFA 3OIVA 4H1TA 2PNFA 4D0LB 4BLWA 4V0NA 2CMKA 5FBRB 1NVAA 3I8OA 3LXXA 1B7GO 1OXUA 3QBTA 4QELA 3F9CA 1QO0A 4RHYA 2OYCA 3V42A 3ULKA 1GJRA 1FRNA 3HLTA 1FBNA 4LIPD 2PGIA 5IBRA 4FJ2A 4W5HA 1EUDB 1G20B 1SNYA 2GK3A 3GJQA 4FGLA 5HGJA 3WNCA 2ZXEA 1PYOA 2JGLA 3DAFA 1MQAA 2GI4A 2WHYA 2UZ3A 1EKXA 4RENA 3HRHA 4AZ0A 4PVDA 3LCRA 5JS1A 2BR4A 2VJLA 3CLHA 2PS9A 2UYQA 2X1LA 1N6LA 4QPJC 4DDMA 4Q12A 5DXFA 4GH5A 2GDZA 5CNIA 3FMOB 2XXBA 1SFRA 1URPA 2DH6A 2NUPA 2WAOA 1N1MA 1LSOA 2B8NA 3C3MA 3CUWA 3GLVA 3GJ7A 3P9SA 4MQFB 1S0UA 4RLHA 4YBZA 2R85A 4FMBB 3JQPA 3LF1A 3UAZA 4CMCA 4EPRA 2WWHA 1VP3A 4Q3KA 5KTRA 1OLSA 2C8LA 2F00A 3VYSB 5ILGA 1LPPA 3QFFA 4PO8A 4X60A 4R84A 1EZ1A 1Z6PA 2RKBA 3LY5A 4YRDA 5I8WA 5JZOA 4XIYA 2AWNA 2FH5B 2ID4A 4XGRA 3AM3A 1M8GA 1ESNA 1G5FA 2BEKA 1SC6A 3RFUA 4RTOA 2PS0A 5AM2A 3TYXA 1MD9A 3IODA 3RJTA 3TSYA 1VMEA 2FI1A 4QBHA 1SUWA 4IF4A 4BKRA 1Z33A 1L7VC 1MQ9A 1JR2A 2CLEB 2VC2B 3EVAA 4G1MB 4HLUC 4QFBA 5EPEA 2XVMA 4XEHA 3WMXA 4JC0A 4CTJA 5JYCA 3OF3A 3TTWA 1B4DA 4BVLA 2VJOA 1GNRA 1KI9A 1TU3A 4AJNA 4CMHA 4E94A 5B3JC 4MDFA 4KDFA 2Q6IA 4INOA 3FPFA 2WTEA 1KMMA 4FC7A 2HA5A 2F4NA 3NHUA 1VE1A 2BMAA 4MAAA 4CIVA 3AHHA 3OOSA 1IFXA 4D4IA 4I8IA 3BK7A 1U5AA 4O0LA 1XVUA 2CNWD 4HN2A 1TZBA 2ID9A 3B6MA 1RLJA 4PXYA 5M3BA 1GL3A 5A2QA 5JBIA 3ZDCA 1P1IA 3R3WA 1XD8A 4FJ1A 2VDWB 5FX2A 1DS6A 5JNLA 2BFEA 1G8JA 2AOWA 5ICFA 4BXOB 5T57A 2R6FA 4DA0A 3U7JA 1F8YA 2VXYA 3V8RA 4DM7A 4GQAA 1TX4B 4ZMSA 3ELBA 2IHBA 4GLFA 1Z39A 3AERB 1TO2E 1T4GA 1PNVA 2RCYA 3VR1A 1PKEA 3AJ9A 6Q21A 4GVLA 5GADl 1T26A 5D7BA 4UPDA 4WLOA 5AUPB 1IVSA 4E7PA 2F8TA 1R4NA 4I50F 1QORA 2A2ZA 2HQRA 2IU3A 4QHTA 4DDVA 4NKRA 4BQIA 2EX0A 2FSVC 3FIJA 3VSAA 4CT5A 3GJ3A 2HW8A 3R9KA 2WYIA 4PLCA 1V8FA 2CSUA 3E4DA 3SYKA 4EUEA 2NM0A 4EDFA 4I3HA 3IP8A 3N6VA 3QM1A 1M10A 2WBLC 1LJLA 3CEPB 3V1MA 4AXXA 2F1HA 5CFLA 4X7RA 2IYSA 3NHBA 3TZQA 2VOJA 2RGYA 3SJCA 1A4XA 2OSBA 1XG5A 4B6OA 1P74A 2JAHA 3DHVA 4L4YA 4NV0A 3ND6A 2FW6A 3NVAA 5E6SA 5FLKA 4Y0AA 1BJKA 4TKVA 1ABBA 5JADA 3T9EA 3OFNA 2A8YA 4OFBA 1IWOA 4Q00A 5TQ2B 1CPYA 3SXJA 1NJ8A 4X1IA 3UV6A 4MP8A 1V9CA 4F46A 1VIVA 5BN1A 4YMTA 1WMSA 2YVQA 2Z8YM 1YQQA 4WA7A 1XB2A 1N7GA 3L43A 2B99A 2E87A 3NV7A 4F3KA 1E69A 3Q3JB 2NVUB 3EIEA 1FRVA 2J4DA 2OCAA 3CBGA 3LL7A 4H4CA 3H9GA 4G65A 2IEYA 1PFYA 3DZKA 9LDTA 2HF9A 4EEZA 1E7QA 1VG1A 1ULAA 3IQDB 3KQTA 3KR1A 3ZD6A 3IOEA 5A4JA 2NXCA 2Q3EA 3CW9A 1EK5A 1ZIPA 2ZTVA 2VVTA 3COYA 4L7QA 1K6MA 4O4HA 1Z4KA 2IYQA 5F3WB 2VPXA 5KWVA 1FRFS 3PUIA 2RB4A 2DM6A 4MAFA 5E3JA 2FWIA 3I2JA 1IH8A 3TXYA 3C4QA 4G3XA 4EO9A 3LOPA 1H4VB 1E9CA 2QN9A 3A3YA 2VJYA 3I64A 4FE7A 4PSVA 2IYRA 4P2GA 2H1RA 1HYGA 3UAVA 4EELA 1FSSA 4CF4A 3DEIA 4G2TA 4A0GA 4EM6A 4PYJA 3ZHCA 4F92B 4DWOA 5IUNC 2PLNA 2OWEA 3KYIB 1OT3A 4JI6B 2CD7A 2QQ5A 4ZTUB 5HIAA 1F3OA 3LUFA 4O2BF 3P2YA 2HGSA 1VJCA 4N5HX 2ZITA 1JUDA 2XUFA 4PO9A 3UMCA 5ERYA 3KXIA 5JWRA 3F47A 4OXKA 2WINI 1VP9A 2KBFA 1C5KA 3FNIA 3TM5A 1V16B 1KEUA 4PLVA 1P9WA 3ZXSA 4AM8A 5IXSA 4X65B 1ZM9A 3IDFA 1ZEMA 1KEEA 3H4IA 4GL2A 5HWSA 3AKYA 3SIRA 3UN1A 5TVGA 3U80A 3B5IA 2VAWA 1TCBA 3FKSD 3ODGA 1CIVA 3EPPA 1KAQA 1NVDA 3QLVA 1SKQA 4W8HA 1K7XB 1ZIOA 3IAM6 1YBHA 2C61A 5H02A 1XRSB 4L6AA 5DLEA 3RAPR 1SZJG 4G2NA 4YB8A 2VJQA 2MYNA 1BC5A 5AVZA 5L6LB 2TYSB 3MBKA 2CXUA 2YNMC 3FB4A 4L28A 3O8LA 4II2A 2P8JA 1KI8A 4ZANA 5KC9A 2Y1OA 4EGQA 4I1SA 2CNOA 4N3CA 2E4XA 4B0PA 4X90A 2OGTA 2ZJ2A 3R2JA 1CUWA 4WUTA 1NV9A 2JVIA 2VP2A 1YUNA 4G24A 1X74A 1OWOA 4TPKA 1IZ8A 5JJCA 1RRKA 2CFOA 3DMPA 1FVFA 3PRKE 1Z15A 2VLIA 5FNVF 1JQKA 1WF6A 5C1IA 4B33A 9LDBA 4CG0A 2O6HA 5FTWA 5KDLA 4E31A 5F3DA 5ALKA 2J3MA 1W44A 5JD5A 2NTNA 3C15C 2AFIE 3X43A 5LYJA 1CT9A 2YZ7A 2FDXA 1EX7A 1THGA 4L5JA 2V58A 3LQ2A 3EY9A 1KJYA 1AKRA 2I54A 3BA1A 3ICCA 3JD1A 4EHBA 4G8BA 1ZM7A 1I4WA 5K3SA 1QK5A 2IP4A 2GPTA 1V5GA 3EARA 4KR7A 2CYBA 1FFXA 2O23A 3D3QA 1QH1B 2IS1A 1WOMA 4FCCA 4X61A 1N33B 3BREA 4QU5A 3HDGA 4BOYA 5JWHA 3MCUA 5E4TA 3NTOA 2NN3C 1FPQA 5BO5A 1RMYA 2AN1A 2YWGA 4CG3A 3KSMA 1JIXA 2C04A 4J0KA 1QRDA 2QVBA 4XPIA 5CURA 5FADA 5B1SA 3Q7PA 1PZGA 4IRUB 4EG3A 2IUEA 3ZDBA 1L3CA 1VKHA 1J42A 4AL4A 5CH5A 3ADPA 5HUJA 4P53A 4TUYB 5LBIA 3FDFA 4P38A 1HURA 4RMIA 3ORHA 5JFOA 2Y9MB 5B7QA 4FGUA 3ACBA 4JCCA 2QMOA 4P3KA 4BQSA 3KPVA 3OI7A 1L1FA 1NT2A 3U9TA 1Y6FA 3GJYA 4MEBA 1Q0ZA 1SZCA 1ZGAA 4GDMA 3BZWA 3AIKA 5JPDA 5IEBA 4DMLA 1A97A 2E4WA 2RK6A 4S1WA 4DDTA 5IRCD 5JTUA 3KKZA 2ZB7A 1I2AA 1Q50A 1WZIA 2K2QB 3DZJA 3C41J 3DD1A 4OYLA 3DTNA 3C14C 3G7SA 4QQRA 1GU7A 4HDKB 5CLFA 1JVNA 1NP3A 1TVEA 3F98A 3L05A 1JPUA 2O2GA 2WKRA 2C31A 3A04A 3F5QA 2RH9B 2Q5EA 5FI1B 4O5OA 3WFJA 1MO5A 3EFBA 3MELA 2HZ7A 1NQAO 4GUDA 4A7PA 1CD5A 4E5YA 4HVCA 3IMEA 1F2UA 2VEDA 4JYBA 2BFDB 3GFOA 4JNKA 3QPBA 5DASA 4NPCA 4UJ3A 1G3MA 1DXOA 1N75A 1YCHA 1J5PA 1RAHA 3DP9A 4QDTA 4CM1A 1R8JA 1BHO1 2G6BA 2R8ZA 5AESA 3K30A 5DGIA 3KSDO 1IAVA