1L3IA

Mt0146, the precorrin-6y methyltransferase (cbit) homolog from m. thermoautotrophicum, adohcy binary complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
186
structure length
186
Chain Sequence
MIPDDEFIKNPSVPGPTAMEVRCLIMCLAEPGKNDVAVDVGCGTGGVTLELAGRVRRVYAIDRNPEAISTTEMNLQRHGLGDNVTLMEGDAPEALCKIPDIDIAVVGGSGGELQEILRIIKDKLKPGGRIIVTAILLETKFEAMECLRDLGFDVNITELNIARGRALDRGTMMVSRNPVALIYTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mt0146/CbiT Suggests that the Putative Precorrin-8W Decarboxylase is a Methyltransferase
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transferase, lyase
molecule keywords Precorrin-6y methyltransferase/putative decarboxylase
total genus 49
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.196: Cobalt-precorrin-6B (C(15))-methyltransferase (decarboxylating).
pdb deposition date 2002-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1l3iA00
1QAOA 3BWMA 2CMHA 5DM4A 5FA8A 4YMGA 5C0OE 2ZIFA 3LDGA 2CKDA 1UWVA 2O57A 4M7RA 4E2ZA 1NBIA 4OA8A 1D2HA 4YV0A 3SVZA 4RTRA 4DA4A 5EEGA 5LQNA 1KYZA 5ICGA 2AOVA 3EVFA 3DULA 4PYIA 4NECA 5HIJA 5EMLA 5GM2A 5EOVA 1ZG3A 5GWXA 2ZZNA 3ELUA 5DSTA 3P2IA 2PWYA 2YR0A 3BGDA 3ID6C 4QVGA 3OU7A 4RYLA 4CTKA 1QYRA 2XVAA 5CVUA 5E1OA 3PFHA 2P3LA 4RVFA 3OPNA 3I58A 4HRAA 4GQBA 3SSMA 2PWPA 5K0JA 2FRXA 3C6MA 4CKBA 4E33A 3PVCA 3TM4A 3FRIA 3BZBA 1XCJA 4PGGA 4E30A 5D1NA 3G2OA 3MAGA 5E1BA 4RTMA 4QPNA 3OFJA 2QM3A 3LX6A 4QTUB 5FCDA 1RI4A 2G70A 3MB5A 4XCXA 1ZHFA 3EVDA 3FRHA 5EIWA 3CC8A 3FUVA 1D2GA 3KQOA 5K03A 3FYCA 4YMHA 2ZBPA 4KIFA 1WG8A 3OU6A 3EVAA 4PIMA 2AOXA 2ESRA 3KU1A 4CWAA 2P8JA 2Z6UA 3A25A 3HM2A 2PX5A 4HTFB 3BT7A 4KDRA 3MTIA 3FPHA 4P7JA 3VYWA 3TKYA 1N2XA 3PLAE 1XTPA 5T67A 5P8WA 2GA9A 1H1DA 2AOWA 5ICFA 2PXCA 2ZULA 3BWBA 4PINA 1AV6A 1HMYA 3GJYA 4XUEA 4CKCA 2NXEA 4FT4A 2P1DA 2OKCA 1RJDA 3KR9A 2OB2A 5H02A 3EPPA 5BW4A 4PCLA 2EG5A 3CJRA 3GRRA 3PB3A 3O31A 3DTNA 3FTFA 4PYJA 1JSZA 1VQ1A 4BP1A 2AS0A 1WXXA 4MWZA 2P35A 3M33A 3F4KA 4BLUA 2I6GA 3NWEA 5EKXA 3IV6A 3FUTA 3M70A 3PX2A 1WS6A 1NW6A 2XBMA 3KPUA 4YUXA 2IFTA 5F2NA 3G8BA 3DLCA 2IBTA 3UJAA 3B3FA 4PYLA 2V7EA 3JWJA 5JUWA 1V39A 2OY0A 3VC2A 4ATNA 3P9KA 1ORIA 3B89A 3GO4A 1G8SA 4RX1A 4FSDA 5CVEA 5K05A 4JXJA 2PV0A 4KWCA 2JHCA 1B42A 2NP6A 5DWQA 5BP7A 2PX8A 2OBFA 3DXXA 3LBFA 2AZTA 3GIWA 4HGZA 3G2QA 3OZRA 3DUWA 3R24A 4FSXA 1NE2A 4HC4A 3EGEA 4P58A 2ZCJA 1EG2A 2GLUA 3T0IA 1L1EA 3FUWA 2BM9A 4GOMD 3K0BA 1WXWA 4ER0A 5ICEA 2AVNA 5DTMA 3X0DA 3G2PA 3ER9A 3K6RA 4DCGA 2ERCA 4Y30A 3V97A 4KRGA 4R8RA 5K0BA 1KPHA 1QAMA 4Z2YA 1X1BA 2E5WA 3ELDA 5GINE 3HVIA 5IH3A 2AN4A 4F86A 4LWOA 2B2CA 3DH0A 2JHAA 4V0RA 3CGGA 2P3QA 2GB4A 4RTLA 3TM5A 5GIPE 3HCAA 3DMFA 3UJDA 5DTQA 4E31A 4RV9A 2IH2A 5KYGA 5KVAA 5HIMA 2JHPA 4DM3A 1JG4A 4YUWA 3KQYA 4DQ0A 2O0LA 3HVJA 3EEOA 2CMGA 1BOOA 2FPOA 3I9FA 3KPWA 1DCTA 4FT2A 3GXOA 1XDZA 4GC9A 1YF3A 1EJ0A 1UIRA 1N7JA 3CJQA 3LDFA 5E2AA 2ONZA 5K0EA 1QAQA 3BUSA 3E8SA 4IWNA 3ORHA 3THSA 3D2LA 3E7PA 1IM8A 1AF7A 4PYMA 1X1DA 5K01A 2B78A 2ADMA 3BWYA 4PCAA 5B1SA 3WSTA 3GRVA 3HA7A 3UA3A 4QDJA 4A6EA 1L3BA 3P2KA 3DOUA 3BGVA 5GP1A 4E70A 4HH4A 1X1AA 4X1OA 1JSXA 4GF5A 1KIAA 5K0FA 2ONYA 3E23A 2AOUA 1SQFA 5CIYA 3HCDA 5EHGA 4EQZA 2XYQA 3AXTA 5DXJA 5K09A 4RTSA 2IH5A 4KVZA 2G8NA 5K0LA 2EX4A 4XUCA 1U2ZA 3CVOA 5JR3A 2VDUE 3UBTA 5LQUA 4C08A 2NXJA 3IYLW 5DRTA 4AZWA 3UJ8A 1OR8A 2HWKA 3NVMB 4R8SA 2HTEA 4E2WA 3EGVA 2P7IA 4CXMA 1R8XA 2ZIGA 4GBED 3AWIA 5FQOA 1R00A 4AZTA 4RTQA 1KPGA 1M6EX 1L3CA 3E05A 4X61A 4RTNA 3BGIA 3V8VA 4R6XA 3GWZA 3LSTA 3UZUA 5EMMA 5HILA 5EMKA 4H0NA 4ER3A 1IXKA 3ERCA 2HMYB 2GPYA 2ZLBA 3UWPA 5CUQA 4E2XA 3THRA 1O9GA 4QDKA 3U81A 5GM1A 3CBGA 4PYNA 1Q0TA 3C6KA 3HEMA 3GCZA 3AXSA 5KQRA 4RWZA 3NTVA 2BR3A 1RJEA 3I64A 3DXYA 3UA4A 3I5UA 4BLWA 3ELYA 5BXYA 3R9XB 2Q41A 5DXAA 1TW3A 1WY7A 3G5TA 3KHKA 5ERGB 5CCBA 2UYQA 3QOWA 4RTOA 9MHTA 2I9KA 2EJUA 2PT9A 1SQGA 2V74B 1AQJA 4PIPA 1FPQA 3GRZA 3HVHA 2Z6QA 2YQZA 3UJ6A 4R05A 3T7SA 4DF3A 4ER6A 4HG2A 3HNRA 3LCVB 2H1RA 1JR4A 5LQKA 1INLA 3VC1A 4ER7A 2PBFA 1SUIA 2VDWA 4E32A 5EVJA 3DMGA 5K8VA 2B25A 1T43A 3G5LA 1NT2A 4U7TB 2P3OA 3LKDA 2Y1XA 3LPMA 2I7CA 2A14A 3P9IA 4GEKA 4GC5A 3KR2A 1RI2A 1YZ3A 2YTZA 2R3SA 1I9GA 3HA3A 3FPJA 3OZSA 4A6DA 1NW7A 3BXOA 3KR1A 5DSXA 3TPZA 2G71A 3CKKA 1NBHA 3CCFA 2XYVA 3TKAA 4EVIA 3KKZA 2GH1A 4EKIA 4EK9A 3RODA 1WZNA 4GOLD 2PX2A 3ER8A 4K6MA 2CWWA 4PWYA 5DPMA 7MHTA 4KDCA 3T7TA 2P41A 3HVKA 1JTFA 2H00A 3TFWA 5T64A 2F8LA 4RSRA 5E9WA 5GIOE 1FJXA 1XCLA 3I53A 1JG1A 1VP3A 4P7KA 1N7IA 5EHIA 5FUBA 1F3LA 5FWAA 2C7PA 5FA5A 3FPEA 3QOXA 1KR5A 4HSGA 4C06A 2BR4A 5F2KA 3HTXA 5T6BA 5HIKA 3A27A 3LBYA 5GOZA 2AOTA 1MJFA 5CVDA 2PXXA 5E1MA 2B3TA 3TRKA 1SVUA 3GRUA 4UOEA 3AJDA 4YUVA 3UJ9A 4F85A 4PNEA 3OE5A 1TW2A 1JTEA 2ORED 1XJ5A 3RW9A 4EKGA 3DP7A 1MHTA 5F2OA 4PGHA 4RVGA 2AN3A 1EJ6A 1PRYA 2LD4A 1Z3CA 3JWGA 5LQAA 5LQJA 2PKWA 3KQSA 4AUKA 1BC5A 4EMSA 5CD1A 3EVCA 4C03A 4DCMA 2OB1A 3ANXA 4OX9Y 2NP7A 2PJDA 2OPBA 1P91A 5EEHA 5ICCA 2OYRA 5DRYA 3VSEA 3M6VA 5LQCA 3B3JA 1EQAA 5HOQA 2PT6A 5FQNA 4HGYA 4DZRA 4P7GA 3DMHA 3FZGA 2ZIEA 3HCCA 5E8RA 1VBFA 1YB2A 1ZQ9A 1RI5A 1FP1D 1YFLA 4V0QA 1ORHA 3EMDA 3EVGA 2BR5A 3G8AA 4QPPA 4YUYA 3KPJA 3OFKA 4X41A 4X60A 5K0CA 4MHTA 4DMGA 2PSSA 3M4XA 3ELWA 2ZSUA 1P1CA 2YX1A 4RVDA 1R8YA 2IP2A 3EEYA 3LCUA 1UFKA 3NWBA 1JQEA 4FGZA 3TOSA 1VLMA 1YUBA 3FUUA 3R0QA 4LECA 1KPIA 5DX8A 3NMUF 2Y1WA 2G1PA 2DPMA 3G89A 5FHRA 2AN5A 5EGSA 2IDKA 2WK1A 2R6ZA 3EVZA 3LGAA 1XVAA 2AR0A 2KW5A 2HV9A 5IKMA 3CJTA 1SKMA 3DR5A 5HIIA 3M6UA 1NKVA 1L3IA 2ZVJA 2NNWB 2YXLA 3M6XA 1VL5A 3SR4A 2CL5A 1G38A 1R74A 1G6Q1 2PVCA 3BWCA 5MHTA 5EKUA 5HFJA 5DM2A 5E1DA 2YUIA 1D2CA 3LL7A 1I4WA 5U4XA 3G88A 2HR1A 3LHDA 3MCZA 3NDJA 2JG3A 2QRVB 5D1HA 4MTLA 5HZMA 3MCTA 4BY9E 1HNNA 1O9HA 1R6AA 1VPTA 3B5IA 3HP7A 2JJQA 3EMBA 4IV0A 4PONA 2FHPA 4RVHA 1Y8CA 3A7DA 4FZVA 1QZZA 1SUSA 1ZGJA 5DM0A 4M38A 2GAFA 2ZTHA 4GUAA 2N47A 3GRYA 4MQ4A 3HCFA 4FR0A 4P7FA 3PS9A 3SSOA 4YUZA 2P40A 4POOA 2YXEA 5DX0A 4XUDA 5LR6A 3P2EA 3FYDA 3Q87B 2PX4A 3FPFA 1O54A 5E8JA 2FK7A 1VP9A 1YZHA 3SXJA 4AZVA 1AQIA 4Y2HA 4C05A 4C07A 3R3HA 2C7OA 3MQ2A 1JG3A 3KPVA 3KPYA 3JWHA 3GNLA 4O29A 2WA2A 2ZZKA 4B17A 2AOUB 5CCXA 5FTWA 1BHJA 1I1NA 1KHHA 1RJFA 2FYTA 3L8DA 1ZKDA 2GS9A 2YXDA 5CVJA 3HCBA 5E2BA 4E2YA 2WA1A 2C7QA 1F38A 2PLWA 3P9CA 1KP9A 1KYWA 2OZVA 3A4TA 1X19A 4ISCA 4OBXA 1DL5A 2K4MA 3KQWA 4IKPA 4OQEA 4QTTB 5C1IA 4C4AA 2QRVA 5K0NA 3FTCA 3REOA 2FCAA 2ZBQA 3R6TA 1KXZA 4RTPA 5DTRA 5EIFA 3MHTA 3LDUA 4X63A 3ME5A 5FWDA 5DX1A 5E9JA 3FTEA 5G02A 3BKWA 2ZW9A 3RIEA 3TQSA 2IGTA 2IIPA 1FBNA 4WXHA 3NDIA 3B3GA 5LSAA 3P97A 3PT9A 4AX8A 3OU2A 5C9ZA 3BKXA 3A7EA 3SMQA 4C04A 1JG2A 2BZGA 4OBWA 3P9NA 4CKEA 5EZQA 8MHTA 3OE4A 4HTFA 2IDJA 1Q0SA 2NYUA 1EIZA 5LQRA 3KQPA 2ZWVA 3EGIA 3P8ZA 1TPYA 3A26A 4OQDA 5FULA 5BW5A 3FPGA 4ER5A 1G60A 1JQ3A 10MHA 3C3YA 5EMJA 3P71T 4PYKA 3PTAA 2IPXA 3M6WA 1RJGA 4U7PB 1NW3A 2Z6AA 4L7VA 1NV9A 2VP3A 3NVKI 1EAMA 3GDHA 3O7WA 4OA5A 2PY6A 2EJTA 3SSNA 1BKYA 2VZ9A 2UYHA 2G72A 5EPEA 2IH4A 3T7RA 1G55A 4KW7A 2B9EA 3IEIA 3LCCA 3Q7EA 1VIDA 5EQJB 2QYOA 1XDSA 3IHTA 3LECA 2ZBRA 5FHQA 1FP2A 1XXLA 1PJZA 4IV8A 4YV1A 2PXAA 2IBSA 2EFJA 3MGGA 1M6YA 2O07A 2PGXA 3KR0A 3NJRA 3EVEA 3DXZA 2BM8A 3G7UA 4DKJA 2XYRA 1JQDA 4R6WA 1X1CA 2AVDA 5DT2A 2O05A 5CM2Z 1NW5A 2C7RA 4WVLA 5FADA 3GU3A 3KQVA 1XDUA 2UYCA 2QE6A 3C3PA 3QV2A 5K0GA 4QQNA 2I62A 4YV2A 5DM1A 4RTJA 1RI1A 3UJ7A 4M37A 3SX0A 1DUSA 2P7HA 3O4FA 4F84A 3UJBA 5KS2A 5M5BA 3UFBA 5EG5A 1NV8A 1VE3A 2VS1A 3PFGA 2HNKA 3KQMA 3HCEA 3OZTA 4GOOD 5EZSA 2UYOA 2YVLA 2ZWAA 3LKZA 4ZTBA 4FS8A 2OXTA 3S68A 4KIGA 4GOND 4AZSA 2ZFUA 3MTEA 2JH9A 1IY9A 2AOTB 2O06A 2ZZMA 5DLYA 2H11A 3FUXA 5KQSA 3FTDA 2QY6A 2VDVE 4CTJA 2DULA 3GGDA 5HEKA 1L9KA 3MERA 3PX3A 2JH8A 3JWIA 1R18A 2NXCA 4LWPA 3DLIA 5EC8A 3SM3A 1QANA 3UJCA 3TMAA 3TR6A 3TLJA 4BP3A 3KQQA 3AY0A 3H2BA 1NW8A 1P1BA 3KQTA 3C0KA 4QQKA 1ZGAA 3HA5A 3OCJA 4G56A 2UZ4A 2BH2A 4RTKA 4PYOA 3EVBA 4QVKA 1SG9A 4LG1A 4PYQA 4FP9A 1P39A 2NXNA 1G8AA 2OO3A 3NW9A 4MIKA 1M0EA 1RI3A 3B7PA 1YFJA 5CVVA 4M36A 2FK8A 4BLVA 3SGLA 5E9QA 2XVMA 3G2MA
chains in the Genus database with same CATH superfamily
4OJYA 2X13A 1JJFA 1V9LA 2VT2A 4TTVA 2W37A 1FSFA 1M6VA 1KI7A 1PJ4A 1NVVR 4J49A 4JQCA 5AOBA 3RS4A 4BVGA 2BFOA 1NBIA 2HXYA 1L5RA 1ZUNB 2IHUA 3VO8A 1BXRB 1TECE 2W6NA 2X1MA 4REOA 1E4VA 1YSCA 1BEUB 1QCZA 3UM9A 4OO3A 2D8AA 1K7EB 2BMEA 3INTA 2PZAA 4MB0A 4NECA 5HKLA 1M2KA 4ZQCB 2I33A 2ECOA 3ROGA 1QQ7A 4BQPA 4EB6B 5JH7A 1XPRA 4FOOA 2FG7C 3QENA 5LQSA 4KQCA 3VHLB 1VYUA 1XMOB 1XRSB 4PSVA 2BEJA 4GBJA 4XWOA 4YN3A 3IMCA 3LUCA 2P3LA 2C04A 1NBOA 1LJ8A 1TF7A 1ZY2A 2JLBA 3HXQA 4KLCA 1KHTA 3AM3A 2Q6TA 3OKPA 4G81A 3GVXA 4KWEA 4HQ6A 4ETNA 2SICE 4JFAA 4XDGA 1F2DA 4Y1EA 4MHTA 3S0JA 3IQFA 2I2WA 3CMCO 3AG5A 3AUSA 2UAGA 3NWJA 4FFOA 1Z4PX 2KS6A 5DB4A 4JGIA 1AHHA 2FSUA 3RVQA 1QTRA 3O92A 4J75A 3KKLA 4DREA 2J6BA 2JGFA 4FLEA 3EFEA 5CRIA 4QDTA 4I55A 5A6SB 5HSGA 4E09A 3GFOA 5KNCD 4XYLA 1SBQA 3OU6A 4TSFA 4BO9A 2E5FA 4YHBA 3DF7A 5IVIA 1IBRA 4TUYB 4Y0VA 1N5IA 1XA3A 1PWZA 3ADKA 3D0OA 2P8JA 4MUJA 4UVGA 1RADA 2XMCA 2PX5A 1E0JA 3DL7A 4TLEA 2FWJA 4J94A 4EEZA 3ZWPA 4D96A 3TD2A 3TZQA 1JDBC 4Z99A 1JE0A 1XTPA 4HDSB 1RMTA 2HSWA 2YZMA 3TQHA 1DPFA 1SGWA 3ZLUA 4PINA 1QB7A 2H5JA 3ORSA 4QWWA 1ZOLA 1QPBA 2F6RA 4YV7A 1II8B 2ATCA 2WPNA 3MB8A 3UWDA 1VA4A 1IWBB 3WI7A 2AC7A 4HH3C 5EJEA 2ZBDA 2XCIA 3FMIA 3EPPA 4LBWA 5GVRA 4PG8A 5DLEA 1GVNB 3PJRA 3S55A 4GFDA 4O2RA 1SCBA 1W30A 1D2AA 3LHIA 2P90A 3I52A 5BVGB 1KK3A 3HBLA 3DKIA 4QJ5A 4WD3A 2A92A 1AKTA 3OICA 1IY8A 1EA5A 1FFEA 1NRJB 2AJLI 1MO2A 4YDSA 3NWEA 4R31A 4UMDA 5FWYB 3JZFA 1F5SA 4DCNA 3TF5A 5FT9A 2WIJA 1U0RA 4GOJA 3AJRA 5JSKA 3LUGA 1HF3A 3IUJA 1DPGA 4FFMA 4L5IA 3UMVA 2JPDA 2AUTA 4JROA 1RAEA 4ZT7A 3C70A 3C5EA 1IZZA 2CXPA 1Z26A 3L4KA 3MUEA 2EU8A 3GO4A 1UZMA 1T4CB 1KAGA 4F96A 2Q9BA 2O8BA 3QPVA 5AW0A 1SCQA 2WM3A 2AFHA 2D2IA 2VRCA 4GLFA 2BRUC 3EE6A 4BFLA 3HP4A 1NOKA 3STXA 1T0HB 4HEHA 3CRZA 4YCMA 2NZJA 1AKVA 1OBVA 4U9UA 1L7AA 2ZCJA 1KSGA 1G7TA 5ICEA 5JROA 4MA0A 1TTHA 1ZA2A 2BBWA 2I8AA 2V6GA 1CT9A 4WL0A 1KEPA 1O94D 2H2HA 2R8XA 1B93A 2A30A 2HSEA 2YWHA 3H05A 3ANTA 3NOVA 4WUVA 4X1IA 3V97A 4BP3A 1KF0A 3ELDA 4EVRA 1EX7A 3W9UA 4YAJA 4DZTA 2FNAA 3JRNA 5FRDA 2KB0A 4KAXA 2C4MA 4RKFA 3V2GA 4C7XA 4Q7MB 3VDQA 1MPXA 5G4KB 4Y6QA 3RT9A 4CV2A 3FPBA 5GVSA 1TYAE 2XYPA 4AY6A 4C0JA 3KZ1E 4M8LA 1G1MA 4ESVA 1GGEA 2FQXA 5KHLB 1VG1A 2HBYA 2Y9MB 3DJYA 3KQYA 1GL3A 5IMBA 1COWD 5LXTB 3DL4A 4OQLA 2ZB2A 4QYIA 3MTBA 1NN5A 4RANA 3DCNA 5CDGA 5JXWA 1JWLA 3KAPA 4AJHA 1OJ7A 4ZDKA 1A9XA 4TRRA 1L1RA 2ONCA 1WM1A 2BTQB 2ZDGA 3ZU6A 1ONSA 3E8SA 3SF8B 4G8CA 4IJ6A 2BGGA 4B3JA 3VPGA 5KYTA 3F90A 4Z9BA 4B7XA 2Z5GA 3HEBA 4UVHA 4N5DA 3F6SA 4UATA 1ORTA 4XQCA 1ODSA 3QE4A 1LLCA 2VJPA 2FX5A 3CURA 5KCMA 2VQFB 3ANMA 2ZS7A 4OB8A 1QIIA 3H6KA 4V0LA 2PLFA 3OX3A 3W8EA 4RZHA 1M54A 1DQNA 3HCDA 4GLJA 5BUQA 1QZUA 2NLOA 2LCQA 3GCGA 3AIOA 1S3FA 3R6DA 3T5DA 2IH5A 2ZCVA 2OZKA 4GAEA 2DBQA 2PIDA 2EX4A 3D2AA 1NX6A 4IDEA 5DN6A 4O2LA 4PC7A 2JI4A 1TLTA 1I6MA 1W47A 2NXJA 2WAOA 4QBKA 2WI8A 4QGHA 5FAKA 5LU9A 1QFMA 1ZM2A 2HLNA 5GOTA 3M3DA 3IFSA 4BB9A 4MWTA 2O8CA 1DC8A 1RCFA 1DOHA 2PMDA 3UOWA 5IFLA 5J23A 3QE9Y 4TZTA 4UTRA 4DIOA 4HYTA 2NVOA 3LGSA 4Y1RB 3E05A 4X61A 3WKDA 1UPTA 3BGIA 4ZVVA 4DRZA 5IASA 1XZDA 3R23A 2V98A 4LK3A 1BU8A 2ZANA 2B1QA 3E5MA 4H1UA 4YMWA 2FWMX 4QGGA 4TWZA 4XQEA 3SZMA 2QLBA 1EIWA 4ER3A 4BWGA 1JDBB 4CR6A 2YFQA 2KJQA 4JC8A 3HWRA 2WSSD 1MA0A 3CUUA 4LYGA 4RHXA 1O9GA 3F5FA 3G2HA 3AKCA 1W5EA 4YAUA 3L4EA 1RLMA 2ET6A 1SCNE 2FEAA 3L2OB 3I64A 3NTVA 1SAYA 3QVUA 1AGYA 1P5HA 4TTQA 3RM3A 1YWGO 2R8RA 3JYOA 1WY7A 3G5TA 1TCAA 1V45E 1J5XA 1XNJA 4QBTA 5C4GB 3MJHA 1E2IA 3ZW9A 3UXEA 2EJUA 4TMYA 2QTWB 3SQOA 4WCFB 1ZFNA 3KB6A 5AM3A 2FW7A 2LNDA 3ANYB 4ND4A 3V1TC 4BNJA 4TLCA 3MILA 2XSZA 1OLUA 3KYDA 5EVJA 1F8FA 3O9VA 3USZA 5L3QA 4B9AA 4DR3B 1XZQA 5HPYB 2EKQA 3Q7RA 2YY7A 4G0XA 2YYSA 1IN1A 3VO2A 2FE1A 3CZ9A 5JECA 4B3MB 1P4GA 1YJQA 1NQVA 4GQIA 2OTCA 3IP1A 4R5MA 5AK5A 3E4DA 4X97A 1C29B 4NE7A 1YTLA 3A37A 2Q3FA 1AGNA 4FN4A 5FFMA 5DSXA 1AXEA 1DTWB 1CNFA 3A1TA 4C89A 4P6VF 1HDRA 1Z36A 1R0XA 1BEEA 3U4DA 2D4HA 1A2KC 2DQZA 1QX3A 1P9WA 1A98A 3M2TA 5JZSA 4DLPA 1PN3A 2PRYA 4R98A 1ZC4A 4AX4A 1XPJA 1AS3A 5DW3A 1VJDA 1CK4A 3TNYA 1Z4NA 2TS1A 3W04A 1PUIA 1F8UA 1WP4A 4WFQA 1G8HA 4TKUA 5HE9A 2C5EA 3H4TA 3E22B 4MVJA 4YAIA 1EJBA 5G3YA 2LWIA 4EYOA 2C2HA 3H11A 4PZ9A 3U37A 2XKKA 4TS3A 3TI9A 1SVUA 4EX6A 4D4GA 3QVWA 4M9ZA 3DONA 1MOSA 5AOVA 2N3ZA 1RMYA 2AX4A 2GLTA 4L28A 2G77B 1PWEA 1GTRA 1A95A 1QH8B 3TTTA 2XLCA 4EH1A 5IEBA 3ZS9A 5LQJA 3IIJA 3KQSA 4BOYA 4EMSA 3NYWA 1D2NA 1OGYA 3LU1A 1EH5A 5FP0A 2CLEB 2UZ0A 5FUXA 4JUBA 4C0QC 4F3TA 2NP7A 2ZJ8A 4FR5A 1RE0A 4O4JF 5T3YA 2F1IA 3D7LA 1W88A 3AJ9A 3M5WA 4Q3OA 1DO2A 1HK7A 1JU3A 1VDMA 2IPNA 2WFZA 3PK0A 1U8AA 2HQ1A 1V2GA 5CT5A 4N40A 5EPUA 5LCXA 2ECQA 3TOXA 2DWOA 4A10A 3PUYA 2WKPA 1G3MA 5B3JC 4LMRA 3QEAZ 2ZT8A 4KAJA 3DZDA 2VK2A 1LLQA 1AGPA 1VL1A 3B3QA 3AVTA 2GTIA 3AY7A 4F1WA 4GXQA 8GPBA 1ZUNA 2UXDB 3I61A 1ID8A 2ZSUA 2BEUA 2EYQA 1Y9DA 3CWQA 4BO4A 1YI8A 1EDOA 5K45A 2Q6IA 3JW8A 1QZTA 1U4NA 4I1SA 5CDYA 2I34A 4IDBA 5IABA 3EPHA 1YMUA 3R7LA 4TKUB 6GPBA 1KPIA 4A0RA 2ID4A 2Y1WA 4W63A 1XEWY 4BE4A 1ULHA 4JLDA 4CT5A 4S04A 1F2TB 1QHHB 1Y37A 2PKXA 1UBMS 1E3EA 3EB9A 3IC5A 2CMDA 3WTCA 4EX7A 3OQMA 1F0PA 121PA 1N7GA 1H93A 5T4HA 3WNDA 4BNDA 1K75A 2P78A 4Z5XA 1US8B 1XTQA 3MRXA 4JVSB 4NBKA 1UK9A 3CLSD 5DWDA 1NRWA 1Z4KA 1RQGA 1VE5A 5JANA 4L5YA 5KU1A 1D2CA 1GL6A 4OGFA 5REQB 3EDRA 3EIXA 2BMFA 3MJ4A 1QGED 5AI0A 3W5UA 4TZKA 3PXUA 3F6EX 1TI7A 1XLTA 4NPHA 2X42A 3D3QA 2RGCA 4GVLA 4BY9E 3LZCA 2FFQA 4Y2UA 4TLMB 5DLDA 3B5IA 2PDAA 1RC8A 2C07A 3V1MA 2ENWA 1CB7A 1Z0SA 3PPYA 5IAJA 1GILA 1VPEA 3QI7A 3K0CA 3MM4A 4GXRA 3Q72A 5LP1A 2G08A 2W2KA 3H0KA 5I4IA 1IZ0A 4JJAA 1E2DA 2Q6KA 4YEDA 2HCRA 3OOEA 2VUUA 3BFKA 1DRVA 4RL4A 1OAOA 1SC3A 3KYIB 3CGWA 1E6EA 4OMCA 3SXJA 5HUHA 2G83A 5AK4A 1C1HA 2GBLA 5KJFA 3T5AA 3JWHA 4OQYA 3K4QA 2H1FA 3LA8A 4J2OA 2VEDA 5TXGA 4B17A 1KHHA 3L8DA 3FE2A 4JWTA 3VYVA 1J5EB 1ZRSA 2YXDA 3SXPA 1G19A 2QMEA 3O4VA 5LUAA 2C7QA 4KFSA 2ZJYA 3H8WA 4V0MA 3ZNQA 2B4AA 4JJEA 3KS9A 3I6QA 3ST7A 4Z4FA 5K0NA 3AHHA 3NDBB 3MT9A 2XIQA 5DTRA 3TR5A 1LWOA 4CETA 1TK9A 3TRHA 4ZU6X 2ZW9A 1AO3A 3IPAA 4M0UA 3GJ3A 1TVEA 5D3KA 2CSXA 4NU6A 2AA3A 3INNA 4F71A 5BWBA 4TWAA 1E1CB 1VLZA 2CZGA 2ZRDA 4NVRA 1BCRB 5DEOA 4AY2A 1SURA 3MWJA 4HTFA 3G23A 2ZITA 4EW3A 4LXHA 5JEEA 2EJBA 4KOAA 5J5CA 2W6CX 4YIKA 3FPGA 1ENZA 1HM5A 1I5OA 4MCIA 2HDWA 4DQKA 1YOVB 2EF1A 2XAUA 4Y7CA 5EIOA 1J09A 3ZPXA 1Z75A 3IEMA 4IDGA 4L7VA 3T61A 4WA8A 2CEKA 3Q1KA 2Q4TA 1CDZA 2GYUA 4MDHA 1E96A 1QGZA 2INGX 2RHWA 3LOPA 5WRFA 1T8TA 2VZLA 1G55A 1B8NA 4DV4B 3IEIA 3ILYA 5KWJA 5CGQB 2WJ4A 5EKTA 5FHQA 2UUPA 4IV8A 1VKJA 5FAXA 1QCYA 3IDQA 4HNVA 4Q7JB 3O82A 5ALUA 3VH2A 5A4JA 1IXZA 5FI5A 4N47A 3C7AA 3CZ4A 3ETCA 3FRJA 2YJ4A 1UXGA 3PGJA 3RLFA 3RSGA 4AG3A 1PJRA 2PUTA 2OCDA 4OQNA 4R3NA 5FWXA 4D9NA 3WKAA 4L4YA 1N4AA 1JIUA 1W25A 4KX3A 3QKIA 5ITVA 5JSHA 2J7PA 4PC6A 1KFEB 5JATA 2NU8B 3CXUA 1JBKA 3D0QA 1R8SA 4U5QA 5IJAA 4HVCA 2BP7B 3CZRA 3GNTA 2CZCA 2HHJA 3HYTA 2YHUA 4YJ2A 1LKZA 3LCRA 2BFEA 1JFFA 4F1JA 1E6UA 1N3YA 2QRUA 1J8VA 4TROA 3RE1A 3EISA 3ENKA 1IXYA 4YNBA 4DEVA 4ENRA 5BWMA 1NIPA 3FCCA 4FGSA 3WB9A 4DKXA 4Q3CA 1HNZB 3T99A 3H9QA 5IYZB 2WAMA 5BR8B 1U2RA 4OG2A 2R96A 1OXKB 3B60A 3PX3A 2XOEA 5JDCA 5CR9A 5K5EA 2XNSA 1GAQA 1TZKA 3L6RA 4FYWA 5AR1A 1R18A 4I6GA 3TMKA 2WR8A 4YRAA 2OORA 3COSA 3G2JA 3PE3A 1M5RA 1NVEA 1BS2A 2O7VA 3K05A 3K2QA 1LQTA 3TLJA 2HDOA 2DBYA 2FPGA 1SC1A 4KPUA 2I2DA 5TPZA 3ZU2A 1FSPA 5KSYA 3TW8A 3BREA 4TTIA 1T9BA 3MINB 3K5IA 1AKWA 3GFBA 4AJEA 3UHOA 1Q92A 4MHOA 4KQXA 5ALPA 4ZI7F 4DV0B 2HT1A 3E61A 1EK5A 3I3OA 5CB4F 2H4XA 1NJ5A 4YJFA 4ARBA 3U4QB 2IDZA 2ILTA 3EW9A 1RI3A 3PQEA 4EYSA 1JEYA 3WLTA 4YMTA 1PGPA 4QECA 3SGLA 5E9QA 1YVEI 1L7QA 1E4EA 2HWWA 2QTAA 2ZROA 3QWAA 3TDMA 3V8NA 1LUAA 2DWUA 1M7HA 2MINA 2J7KA 2QU7A 2WHPA 3FF1A 4KAFA 4L4RA 2EGHA 2TYSB 5DHRA 2LDXA 3NBYC 2CKDA 1E3QA 1F2UB 3G7SA 4U0KA 4DNPA 4MJXA 1OCEA 3OPVA 2E48A 1CRWG 1HDEA 1QO9A 1E5LA 4ZAGA 2I4NA 4HQKA 4XW2A 5AKHA 2ZZNA 5GWXA 5JMTA 4I9HA 1JVBA 4I46A 3TZLA 4UC0A 2H9AA 2X0KA 4M76B 2YR0A 1Z5PA 3HN2A 1DCKA 1NVBA 1HSOA 3NTQA 1MVOA 3CZPA 1JT9A 3DWGA 3O8OB 4J0DA 4PZZA 1IBMB 3YASA 1YU9A 2P68A 3A6EA 4TYWA 3DV9A 1KZ4A 1VJ0A 3HCPA 2PLAA 1V8FA 4GQBA 1IIRA 1EFPA 5G4KA 4F9GA 5KQPA 2HZBA 2G9NA 5EKDA 4K3UA 2YS7A 1LFAA 6PFKA 1HUQA 4LJ6A 2VJMA 5KJ6A 1KQ3A 1V7CA 2XNHA 4G0NA 4NJEB 3LX6A 2FZGA 2EP8A 3EVDA 4K87A 1GVHA 4R16A 5ENVA 2IYFA 4OSEA 2BDUA 4MV8A 5BW6B 1TM4E 3SJ7A 2J9FB 4M9CA 4YMHA 1P7PA 3NAZA 4KIFA 5IC5A 4IRUB 5F52A 4ZAZA 2WQ7A 4H6VA 1FQWA 1MGOA 3SK0A 1EX9A 2GCOB 3A6HA 5CFMA 2JDIA 2YCBA 4KN9S 2QAGC 4KDRA 1FMTA 4B73A 4TWRA 3TKYA 4R9VA 5AVVA 1H2EA 4PYRA 3LTNC 5E6RA 1U99A 5AIAA 3S3TA 4X1KA 2O8DA 2PXCA 2B9VA 3L7IA 3RTDA 1V35A 3MXTA 2IIVA 4O5OA 3M34A 1D6NA 3W1WA 1O0SA 1B00A 3I1FA 2OKCA 5DGIA 2OG2A 2Z5LA 2IY8A 4URFA 4PU0A 3DWEX 1W49A 5BW4A 5DE3A 3SI7A 3KKEA 1OROA 2YWRA 3OM1A 1ZOIA 4QTXA 5B7NA 3WMWA 3V2UA 4MWZA 4YPFA 1EU1A 2IYVA 3REQB 3QELA 4FILA 1XJCA 3F6CA 2RCYA 2F55A 4E1AA 2GN6A 3FVTA 4CL8A 5TJ9A 2YKGA 2HF2A 1NW6A 2GN8A 2Q4OA 2Q3DA 1L7PA 2DQ4A 2NAFA 2EWMA 3CO5A 2G06A 4Q24A 5EHNA 4D4IA 2IBTA 4YYEA 4NU0A 2QZ9A 3QITA 2W22A 2EP5A 4C88A 2R00C 1L7OA 3RUIA 4H3KB 5IFKA 2PGNA 4KRFA 1LPMA 3E70C 3AF0A 4AY4A 2JHCA 3G0GA 3K1AB 2G0NA 1Y3HA 4Y0NA 3DBVO 5J59A 1WMSA 3HB5X 1EDBA 5KKCA 3A9WA 1GPKA 3CINA 3IVCA 2W6JD 5CFQA 3EGEA 1NSFA 1FJ2A 1WDWB 3UENA 1TVKB 3BWXA 3QX7A 1EBBA 3CV3A 4WOJA 1D6SA 1I3NA 3G2KA 4XYEA 2RC6A 4NEHB 2P1ZA 3W1EA 1IEXA 2BLNA 3ROQA 4Q4JB 4WGFA 4EZBA 2VSOA 3ZWXA 3K15A 5EP1A 1VSTA 2IZZA 2ZQYA 4AKEA 1QHIA 3BEOA 3GZNB 1I4LD 4DQVA 4EA7A 1N6HA 1OXVA 1G42A 1YJ5A 1E2HA 3K2IA 3ZBPA 4BQOA 3SYRA 5L3RA 5JIBA 3HCAA 3AT1A 2IH2A 4RE5A 4UUNA 2G0AA 1YXMA 3UJPA 4ZQFA 1DAFA 1JG4A 4PIVA 3ZE8A 5DNEA 3CR3C 3WLQA 4I66A 3WYBA 4EZEA 4NU5A 1X0VA 1P1KA 1X7XB 1Z6AA 1YZLA 2CMGA 1GTVA 2QTVA 3AP1A 4UMEA 5CT6A 1FE8A 4BN4A 1VI6A 5FWYA 3KQLA 4CNQA 3KU4A 3ZHXA 5DJ5A 5JSYA 5E2AA 2BKAA 1GQ2A 1W5AA 1N9ZA 2VAWA 1O6GA 1B43A 4MJLA 3T1VA 2QN3A 4IWNA 4L85A 3OLQA 1W4BA 2V0NA 4OYRA 4ABTA 1NULA 1Z4IA 4QYSA 3K6SA 4OLAA 5C8DA 2XMQA 3CVYA 3T5TA 1NG9A 3A4YA 1N2JA 2AG5A 1UQUA 2O7NA 1U11A 1IUPA 3BGVA 4FQ7A 4JR2A 5KYKA 4GZMA 5ABPA 1PNRA 2XGSA 2FRDC 4RORA 2ZIXB 4LV8B 2VWGA 1ORWA 2E49A 2XEXA 2ZBFA 4C29A 4F6RA 2G76A 2GK6A 2XYQA 1BRTA 4MVJH 1TMKA 1U9IC 2MSCB 3C7TA 2YJ5A 3AXTA 4PFQA 4TM8A 4XEUA 4BLPA 2Q07A 5E4FA 1T2NA 1IY1A 1Z4JA 2J3JA 6AT1A 3UBTA 4LV5B 3U49A 1EFDN 3LLUA 5AM0A 1WDTA 4LF6B 4JSTA 5FOVA 1ZGCA 2QVYX 3H5RA 1OR8A 4GHWA 4YP7A 3JVEA 2WF8A 4R2XA 4Z86A 3L8ZA 4ZVMA 1YVRA 3TB6A 5CB6A 5BQPA 1UPXA 5AW4A 4LFAB 3HR7A 1N6RA 3KDPA 5EJIA 1X9HA 4CRWB 1PL0A 4W4TA 4AZTA 4RTQA 1M6EX 2A5DA 4EYEA 3QUAA 2XQKA 3C7DB 3EFHA 4WK4B 5J2TF 1ICIA 2IU6A 1NGSA 4GI7A 1KH1A 4A2CA 3DBRB 2IX3A 2QR3A 3GWZA 4MKZA 5NLLA 3UMGA 4B7UA 3VV3A 4CZ2A 2VH1A 3JARB 4RACA 1JLHA 1YR8A 2JAOA 4CBVA 4CV0A 4W5NA 4E5MA 2GPYA 3R7NA 3DSRA 1IOZA 1W9HA 2Q2NA 3GLSA 5CUQA 4PVDA 2REBA 3CNBA 3IL2A 3EOBI 1Q0TA 2ICAA 2J6IA 3NP7A 2ARKA 3PEVA 3CEPB 3ENWA 1KMIY 2AZDA 3E27A 1H6DA 3IS3A 4HNQA 4BQFA 4R0NA 2ZRHA 4Q9NA 4BLWA 1Y4DE 3I2YX 3SS8A 5CG1A 1PSZA 1TW3A 2F1OA 4DA9A 5IYZF 3THOA 1IUKA 2QNBA 1V7PC 5JH7B 4S2EA 3CWZA 4F9EA 3S40A 2BD0A 4FDTA 5IEJA 4CL2A 1QDUA 1SQGA 4DQUA 2WFLA 1L4HA 3KFVA 3GD5A 2YQZA 3PHLA 4ER6A 4OBBA 5TF4A 1NR5A 4CMIB 1JR4A 1M75A 1LNQA 2BHLA 3N2GA 4RGQA 3SC3A 5L3VA 1T3GA 2VHQA 2FA9A 4OFZA 3ITDA 3TTXA 4M0FA 1N9KA 4MUFA 4KXQA 3S2FA 2AEJA 2P3OA 4C4OA 4YR7A 2H2DA 4OOFA 4CKWA 3C4VA 1L6RA 3PHCA 5BW8A 1IRXA 2OXFA 3B38A 4JB0A 1L5VA 3W6UA 3THXA 2J41A 2G7MC 4D9CA 3HA3A 3PP8A 2AN1A 1FSZA 1VXOA 5BPFA 1MJGM 3VHXA 1P77A 2FZ4A 3UHFA 5FNZA 3WOVA 1I4TD 3BXFA 4J6FA 4O33A 5H3HA 4INPA 3DBHA 4RENA 3UGQA 3V8BA 1YZKA 4YMUA 5LIPA 1QF6A 2YVKA 4N6GA 4BMVA 2XTZA 2FPSA 3M5DA 2X9GA 4ACAA 2XXAB 1NIJA 4QG7A 3Q9LA 4WNIA 4BKUA 4TMKA 2C3UA 4GRAA 3IEVA 4TWJA 1QLWA 3FFWA 1H2ZA 1G8GA 4L9WA 5EHIA 2GCEA 5CA1A 4WY2A 2VPPA 3O4HA 2ZRCA 3CUEF 2ERXA 1DFGA 1TO6A 4TMVA 3Q7SA 1LWNA 4B0PA 5LDGA 1GCOA 3I2FA 4BU0A 3LFHA 4KRXA 3NC1C 1HYEA 1KMHB 1KJQA 3D6VA 4PLCA 4Q16A 1NJ6A 1NU6A 1IU9A 4XDHA 3TRKA 1C81A 5L4NA 1QQAA 3F5SA 2HZ7A 4BCDA 2ZR8A 1CEEA 4PNEA 2HJSA 3WLFA 3HV0A 1E9VA 3DP7A 3GBSA 3GJ5A 1NRIA 3FTQA 2AQKA 4MKRA 2LD4A 1TEXA 4ZREA 4G63A 3QFTA 2JNWA 5GJCA 3ZXYA 3ZE1B 4DB4A 2R1UA 4GGMX 2QMQA 2OPBA 2VP9A 4PRYA 1QVAA 2Q9AA 4I50F 3UQYS 5HOQA 4XXHA 5I7RA 4Z4QA 2YYZA 1YQQA 5DKFA 4AXXA 4Z6KA 5IULC 4P38A 3WOHA 3L6EA 1LBHA 1OX4A 4XM0A 2D0IA 2XPCA 3RJZA 3LV8A 3VJKA 3T41A 4Q6BA 4FFLA 1GDTA 4MR8A 3N3BC 3EQ8A 2XB6A 1M1NB 3FWNA 4KR6A 4Q1CA 1Y1KE 1YZFA 3UMFA 3EMDA 2P9ZA 4PLTA 1A8PA 1EFVB 2AFVA 3QY0A 4U2BA 3ZK8A 1XALA 3VU8A 4ES6A 3BXEA 1G0OA 3G49A 3K4HA 3FZQA 2AJCA 3EC1A 2CD7A 2J0UB 2YRXA 4BNZA 1PG2A 3V8PA 2VNIA 4DQDA 4L57A 2JLWA 3RO7A 1W0JD 1FFDA 4LECA 4H7EA 2OENG 3Q4GA 2GAIA 4RPHA 5JNTA 4PEVA 1F51E 1K6MA 1RHUA 3V7WA 4HVAA 2YN4A 3GZTB 3NYQA 4Y1FA 2WK1A 4GI5A 4K1LA 4BDTA 4PPFA 3W5AA 2QM0A 1ODIA 2V5AA 1RACA 3BQNB 4EF6A 2ES4A 1NKVA 3LIPA 1BQ3A 3C1TA 3ZIUA 3ESBA 3Q9NA 2ATXA 4K9SA 4A0SA 3WLSA 2CBZA 3CNNA 4GMDA 4NZ9A 1QOPB 4IUDS 4C1NA 4CDNA 1JALA 2W8ZA 5BVHA 3WL7A 2HX1A 1OH8A 2YIMA 1ECPA 4XA8A 1EGAA 1N5OX 1SBIA 3BWDD 4RJJA 5LP6A 5KMGA 1DELA 2R8YA 5HZMA 1R6UA 5D5HA 4ESEA 2HU8A 1NBEA 2VT6A 2X9VA 2VSFA 3CNHA 4BLTA 4EL5A 4NE2A 5BMVB 2W2NA 3OQ1A 5A5EA 3DAOA 5JSZA 1WA5A 2GAFA 1NQUA 1ZONA 3WA7A 4GUAA 3ORYA 3HCFA 2DTXA 3SSOA 4A26A 2WJ3A 2Y93A 4FFNA 2GJAA 1Z4MA 4YCNA 1Q12A 2IU4A 1MRNA 2IUFA 3RS2A 4KUGA 3W2GA 1XQXA 5GJVC 2VF4X 4J0HA 1YZHA 4Q12A 1AQIA 3KWJA 3N2KB 1H2WA 5T6MA 1NUHA 4MWGA 4Y9UA 1P1RA 3GJXC 3PXAA 2ZYTX 1VZ2A 2RONA 2DBRA 3IKMB 3ITKA 4JP2A 2VYNA 2NSJA 2R7AA 1I7PA 4GOKA 4FE4A 4ZOAA 2JAUA 1X19A 4OQEA 1GNRA 4YH1A 2AJDA 3KQWA 4O4JB 1VRWA 1A5SB 1BWSA 3EEBA 4LXIA 4HGOA 2COKA 4XTCS 1RP7A 3REOA 1UZLA 1PZHA 2FCAA 1I7NA 4DILA 5AFSA 1YDMA 2NU9B 4LQDA 3VMMA 1O1YA 1I3OA 3LXRA 1PGOA 2FVXA 1U0SY 1I0IA 2NVBA 1OTHA 4RJLA 3IUPA 2Y0DA 3DEHA 3GVCA 4KQGA 2AJBA 3I2KA 4G5HA 1LD3A 3TZBA 3HL4A 4OQQA 4QSHA 1J2TA 4KZKA 5BXQC 1HE1C 3F0TA 1AQYA 1TO1E 3OJWA 3VR5H 2C2MA 2GHRA 3FBGA 4OFBA 2VTDA 1XA4A 1E5QA 4OQDA 1JBQA 2ID7A 4IX1A 1Y9EA 4ZCMA 3EEFA 1RIFA 4PNPA 4MYSA 5FOTA 4P92A 4DR6B 1NW3A 2VK8A 3NRBA 2Q7DA 1LNZA 5IMSA 2EATA 3K9LA 3OZBA 3C3CA 2AW5A 3PCXA 2DUJA 3PIIA 4LDAA 5EXDA 1TUGA 4B8ZA 3KDAA 5IUJC 5BSVA 3PNPA 2PD6A 1VIDA 3FMOB 1D1TA 3V7UA 2GRAA 3OEHD 4OQMA 4E1VA 1XDSA 3ZHSA 1XXLA 2P4SA 1RKBA 4F8JA 4R1QA 4GXNA 3VAZA 2PR2A 1Q0RA 1YVDA 2XUAA 3NJRA 4HN4B 1A4UA 3UCEA 1YS2X 2VDRB 3MTGA 5DISB 1RHJA 2BI4A 3STWA 5CM2Z 1N1MA 1NZJA 4MMXB 3IDSA 3Q8WA 3C8UA 2ZJOA 4FMBB 3RABA 4YO8A 4YJ2B 4QQNA 4ZCQA 1XZBA 2WB2A 1GITA 1FLNA 2X58A 4LZJA 1P60A 3R20A 1VKZA 4JUDX 4YJ3B 4Z0NA 5D6NA 3TRJA 3KEQA 4AUEA 1KJWA 1IWOA 1YBMA 2YW2A 1H94A 4EVSA 3FCEA 2MYPA 1T2DA 2YJ3A 4HFNA 2YVLA 2IRWA 1FRZA 4URWR 5JTTA 3F6PA 4EA8A 4FKBA 1U5BB 1Q6YA 4CEJB 1SQ0A 1M34A 1U0TA 3MWGA 4LOJA 4RH1A 4BBAA 1UOOA 3OHSX 3BXPA 2HLPA 5G2OA 5BN5A 1VA5A 4I9GA 3HPRA 4ZMRA 2FZCA 2EW1A 1D4AA 1K97A 1VSBA 2AYXA 3OZVA 2IEZA 3I1IA 4WH0A 5BT9A 1ADGA 4DV1B 1VJ1A 4GT1A 4UAGA 3H2BA 1NW8A 2GA8A 3OQIB 4EG7A 1U5AA 3GRPA 2HBZA 3L1HA 4NZYA 2QQGA 1JKFA 4RIEA 1WDLA 4HF7A 5JLAA 3SKYA 5EHXA 4UAVA 1QFZA 2P2ZA 2BLLA 2W2XA 4F5ZA 1DEKA 1G9XA 1A2QA 4D8YA 1E2BA 3TW8B 2PWAA 3EQZA 4DARA 1G18A 3HB1A 3R7DA 2YICA 1XMPA 1FA9A 2GJ9A 2PTGA 2JVIA 3PQ6A 2Z8ZA 2QMHA 4LBVA 1H2XA 2OGTA 4LMPA 4ZO6A 2WYHA 5K3FB 1HL3A 3ZVRA 4BUJA 1RD4A 3C8HA 1J20A 1Q0PA 1RPTA 2C4NA 2ZIFA 4YROA 4P82A 4AQ7A 4Q01A 2MYNA 4WXMA 4AMUA 4L0QA 3IULA 4P33A 4DM4A 1D2HA 3WLKX 1FZQA 2J59A 2OHHA 4AJ1A 1OX4B 4OJKA 3AU8A 4EY7A 1KBZA 2Q3BA 4O4LA 2Q0QA 3GLIA 1P7ZA 2WSLA 5SYAA 3IQDB 3UG6A 3AHCA 1Q0ZA 3RAEC 1KZYC 3KAJA 3ISTA 4G8DA 1MX5A 1M72A 2VEOA 3FNGA 3F47A 5T5QA 1WJGA 2V58A 3OU7A 5ECGC 4P3XA 3D8NA 5PGMA 2HMAA 3TQTA 1Z12A 2BISA 2O6HA 3K16A 1T9HA 3KC2A 1U8FO 3HBNA 4EHAA 1AH2A 2FW0A 4UTOA 3RCBA 3I0ZA 4F06A 1FNMA 1JU4A 3JQ9A 3GNQA 1QE3A 2CT8A 3I42A 4KGZA 2YIVX 4CKBA 1PT8A 3LUJA 3EY9A 4WESA 5AVRA 1G5TA 2WFMA 3OD5A 4JX9A 1V11B 3LT2A 3VR5A 4E30A 4EOGA 2C9OA 2IEBA 1GZUA 2HU5A 2PKQP 4BBJA 1W19A 4BMPB 3ETNA 2R84A 3I3SR 3K4PA 4X65B 1XCPA 4DPKA 1TYEB 3DCYA 2YXBA 3CRW1 1DFIA 3I9V1 5J2UF 5D7NA 5F73A 4JJ7A 4XTRA 3EOAI 3GLRA 3VO9A 2JCBA 5TRTA 4ESOA 3UAYA 2R4UA 2WYIA 5ALTA 4CLDA 1GTZA 1ATIA 2ESRA 1M3SA 1HH4A 2JH3A 2VNJA 2WW8A 1ANKA 4OKSA 3OLYA 4K03A 2DHCA 1UDXA 3UK1A 1T4CA 2NO6A 1OUMA 1SUWA 3C45A 4O1IA 1K98A 1V71A 2VTKA 3LMKA 5CNIA 1MEOA 3VVMA 1AV6A 1Y8QB 3DMPA 4EO7A 4KXVA 1NTOA 5FOQA 1IHUA 1HXHA 1Q83A 2P1DA 5JS6A 5KJCA 3WLIA 4FYHA 1H4TA 4HBZA 1KVTA 3OZFA 4PNHA 1B41A 3EZXA 3R6GA 4JYPA 4D8WA 2WJIA 4K2AA 4LVUA 2Y76A 3CH7A 2X15A 2UYYA 2OEPA 2X4LA 5CHEA 3JRXA 5DBEX 4BP1A 1UPAA 1ZAKA 1WXXA 3LP6A 3DO8A 2X1HA 4O02B 4YO7A 3THYB 4OOEA 5B7GA 4MUIA 1WMBA 1VXRA 4J7CA 1SPBS 4WXRA 3TD6A 4ZTUB 1JT2A 2LKDA 4I1YA 4OLJA 3TZKA 4DXHA 3HXMA 2JKVA 4D0NA 3BCUA 4ONEA 1Y6JA 3ZV6A 1ZUD1 2R7KA 2J87A 2PS9A 2VYQA 3Q15C 4JELA 1SH7A 4PYLA 4UCFA 4X8OA 3ZV4A 1FB5A 1C4KA 4BMZA 2QVZX 2NYRA 3BX1A 3V8MA 3N8NA 1XPUA 4FSDA 1RHQA 2PZJA 4KX5A 4IOLA 4NRDA 2BKVA 2B5OA 4PFSA 3GLVA 3D4OA 5DBOA 5H59A 2E4YA 2OBFA 1SVMA 1Q91A 1LJLA 3GT0A 1AKYA 3BYZA 1E4OA 3R9XA 3DUWA 1D4ZA 1OU0A 2VRBA 1XTIA 2VDOB 4WZZA 4NV0A 4REMA 4N8EA 3Q41A 4QEDA 3UMRA 2WMNB 3IEXA 4W82A 5BV7A 5K20A 1QFSA 4XOIA 4MNTA 4M9QA 3TE6A 1A8IA 1BW9A 2EL9A 4FNOA 3H1AA 3U3ZA 1OFIA 4TLAA 3PX7A 1ZSYA 4OB6A 3HVIA 3JZIA 3X1YA 2QL7A 1GZHB 4OK5A 1SWVA 3CG0A 4D6YA 3GK3A 3DOCA 5I4KA 3GD7A 1JKXA 3RR2A 3ONFA 3PJGA 2C58A 3F7NA 1ZNYA 3TTVA 5HNKA 2FZKA 1PSWA 1H0HA 4RV9A 3ON5A 3GAMA 4P5EA 4RJ2A 1NASA 4C7OA 3ZDEA 2AK2A 3NV9A 3LFUA 3VR1A 3PR2B 3TX2A 4YXWD 1JTVA 1QE0A 1XRLA 3W34A 4YMIA 4ALLA 2O6LA 1DQZA 2W2PA 1GJRA 1U7TA 1ODKA 1PFVA 1RWVA 2ZWMA 4I1PA 5LZ5A 3CJQA 2Z2YA 2ONZA 5F33A 4MJ7A 1E2JA 1YA8A 4LRQA 9ABPA 3LE8A 2BFCA 1CVIA 2Q4EA 1OBFO 3OESA 4X0EA 1L4MA 2C9DA 3QBVA 1WNFA 2Q1UA 5KDLA 3AHGA 4UD2A 1ZD1A 5JMWA 3R75A 1UADA 1CJBA 1EXMA 2ADMA 4MV0A 5AIBA 1JIXA 3QY9A 1L3BA 2ZOSA 3FB4A 3K1YA 5DBHX 5H5JA 1S3GA 2ZB7A 1U7XA 1Z6PA 4NFYA 2X7JA 2AQ8A 3EARA 2AOUA 3LD9A 3ROXA 4OBEA 4YMVA 4WMLA 2X3YA 1SXJE 3FIUA 3LCMA 4MJ3A 4P0TA 5JSUA 4NY1A 4TL8A 2W6ID 4KYIB 5IVDA 2G8NA 2ORWA 1WQ1R 1TM2A 4MW2A 3ANNA 1AKUA 4V38A 1XZKA 5A4AA 1ZHHA 3H1EA 1H6CA 4H2DA 1H0KA 1P9NA 4GMFA 4N7JA 4Q82A 3KSMA 4WCFA 3AKEA 3GVPA 4HUQA 2CVZA 3DKRA 2WINI 3PQFA 4Y67A 1C41A 1E79D 3QA3E 4MTCA 4BNNA 3LL4A 1L3CA 3N9IA 2PSJA 1VBNA 1AQNA 1QRTA 2EW8A 3C3XA 4IQGA 2DFVA 2J9FA 1NATA 1LBIA 1SVKA 3LSTA 5DI9A 3RTAA 5KVAA 4LOAA 5BN3B 4ND8B 1N5MA 4G5OA 4ZI2A 2GZMA 5H81A 2BFPA 3GCDA 3TBHA 1TC2A 4MA4A 4F3NA 5IVKA 4IQ4A 4WY5A 4E7OA 4R1OA 4FHGA 2NZ8A 2C20A 1ODFA 2FMHA 1DKQA 2D3TA 3C5HA 1D5WA 1RJEA 5CXQA 2DSNA 3I5UA 1UR5A 4RYDA 3A04A 9MHTA 2JZOA 2C2GA 2HAEA 1ZGGA 2PT9A 3NLLA 3PT5A 2MCFA 4AJKA 3EH1A 2Y0BA 5ECDA 2D0OB 4TQGA 5JDIC 4HWKA 1S5PA 5TQ0B 4UTPA 5LQKA 1INLA 3GROA 4LXGA 4LY3A 1NOJA 4YP9A 2Y67A 3RUFA 3SVTA 3BMOB 3AC0A 3QI2A 4R1LA 3FB1A 4Z3DA 1WETA 5GONA 1JX6A 3RQSA 4MV1A 3D2CA 5KSOA 4HYQA 3ZHYA 4KLRA 2YCLA 3ZLBA 4E2FA 3BMOA 4NAHA 1CUSA 3PNSA 4YGXB 5JY1A 1UMKA 2RMKA 3IHLA 1SOUA 2BHSA 3R1IA 5EMHA 4DJFC 2X4GA 1E4EB 2HSJA 4HAZA 1NW7A 5FPTA 2EYUA 2OGUA 3PF8A 1EGMB 3AR3A 4LQLA 2H4JA 5DWVA 3WIBA 3DWFA 4EKIA 3TEJA 3QVTA 1U28A 4QQFA 2WVGA 2Z83A 3NEPX 2OV4A 4E5PA 1H5NA 1CY6A 1YDWA 2RJNA 5IC4A 4QFCA 2H00A 2F8LA 2PL1A 5JO0A 4MEAA 1RYEA 1KTIA 3LF1A 3ICWA 4MWOA 5LYJA 5AVSA 5E6UA 1PZEA 4G0UA 1VP3A 3TLMA 3DTVB 3L8HA 3GP8A 3WJ2A 2RK6A 3V8RA 4HSGA 3E9DA 1L8OA 4GW3A 2EJWA 1D3AA 1RYNA 1DINA 4EG0A 3LBYA 3PQ7A 2AOTA 4NENA 2P30A 1JHOA 2ZAGA 3FY4A 5CVDA 3FHOA 3P0RA 4XPIA 3ZCQA 2X7HA 2PCLA 3WL3A 4HNUA 3QVKA 4RKQA 1QHSA 1W6UA 1CLUA 2ZB3A 1MO5A 3O7MA 1KO8A 4WK2B 1KMHA 2B5WA 3X1ZA 4XPIB 2ORED 1NNEA 3OKFA 4KDFA 1UEIA 1YFKA 2LCIA 3GEHA 3QTBA 3RUDA 3NBUA 3KHTA 4US2R 5L53A 3W9YA 4LI0A 4NS4A 4KREA 4EY4A 1ECCA 2R7LA 5EEHA 3UAXA 1SUBA 3JQ7A 3M81A 5UKDA 2HA0A 4M87A 5E6UB 2O3JA 4Z9XA 2LIPA 3E81A 4C0HA 3A6DA 1Q3TA 4CCAA 4RELA 1EJ2A 3ZQUA 3QVMA 1HOTA 2OBMA 1UDCA 2JFNA 1MV5A 1FP1D 1RQRA 2BJWA 3GPBA 2MSNA 3H9CA 1SUDA 1QR2A 2EJCA 2FN4A 2JLUA 4RCZA 5C7LO 1GGVA 2G28A 4RNDB 1X7WB 4P84A 3UB2A 3AB8A 2ZIUB 3AINA 3NXSA 1E1YA 3TAXA 1R8YA 2F3PA 2YJGA 4QQ8A 5ECYA 1FPMA 4B6EA 2MTBA 3BJZA 1NI5A 4FW8A 1UBCA 2AEFA 2QD3A 1T36A 2BFWA 3QBTA 3F9CA 1NY5A 2FWBA 2CXXA 1T15A 4EHDA 4ADSG 5JJ5A 1UDRA 3RRYA 5EGSA 2IDKA 4C0BA 5FUMA 1AUQA 3IX7A 3WGTA 2GZHA 1TUEA 3CY6A 1R0WA 3DR5A 1T0PA 1UZUA 4N6NA 2NNWB 4CM3A 2QTVB 2JI6A 5BN1A 5JRZA 2DR0A 2ZRMA 2C8JA 1WHTA 4YASA 2E1PA 5DULA 5JE8A 1YO6A 1Q11A 3V8QA 5IKEA 1T0BA 3KBOA 4U7HA 4ZAXA 2HMSA 2HW8A 2HHCA 3PEYA 5IJWA 4H7DA 3WK8A 2I6TA 2HLHA 3DVSX 2VHWA 2AE1A 2XAAA 2FUEA 3JYPA 4Q4HB 1JSRA 2DOKA 4LRSB 2P4HX 3OEED 3BSWA 4K46A 1GIAA 1LSOA 4IF4A 4RVCA 4K0KB 3R5XA 4L95C 1NNI1 1YR3A 1XZGA 2G9RA 3DVAA 2N47A 2WEKA 2HIGA 2EBUA 2MSEB 2ZWOA 3EGDA 1B4DA 2IYYA 2JFVA 2R6GA 4W99A 5CAEB 5C8YB 5IKXA 1HDZA 1WU7A 4Y9TA 4LGVA 1U9ZA 1Z29A 2K5UA 4TQ9A 4CEHB 5KAPA 1RKQA 3Q85A 1RXUA 2OSBA 4R3WA 5HJEA 2Q1TA 3CLKA 3RHSA 5KYYB 2XJ4A 4DR7B 1RXIA 1ZJWA 2PXHA 3R3YA 5IJ9B 1OKKD 1P0FA 2BFFB 2FR0A 4QICA 4XUGB 5E2BA 4TKVA 1MX1A 2RJOA 4ZVPA 5TIIA 3U7RA 1HEYA 2LZ0A 2NO4A 4WUTA 1LZKA 3WLLA 5A62A 1T1EA 2DT8A 1QLHA 4PQFA 2PAFA 3K1ZA 4RK6A 1Z0UA 1O8BA 3DDZX 4MQFB 4AIIA 1J7KA 3QFSA 5IVHA 5LMZA 2RBKA 2QMUA 5FDFA 2FEPA 3D3KA 2AZXA 4MYUA 5AXCA 3N2ZB 2GILA 5FTMA 3FOCA 3DNFA 3IGFA 2NQ2C 5CLLA 1GFSA 2BF7A 3TQIA 3L3BA 4ENSA 5L7WA 4BNLA 5GV7A 4YT2A 2QG4A 3NORA 3OU2A 5JCOA 1NJ1A 5B58T 1QBKC 4OFXA 1YIOA 3URMA 5JAHA 1GLGA 1RLJA 5EZQA 3W06A 3T5GA 2WQ6A 2GZAA 2IDJA 3ASYA 3HN7A 1ACLA 2NYUA 4GG1A 3HDYA 5JTUA 5KNDH 3P2YA 4FZJA 5FULA 5DHFA 3SKXA 2KYRA 5KUTA 2FW8A 4DLYA 1ECJA 3A9CA 1GSOA 1GLNA 2PT7A 3BGWA 3O03A 1C8VB 1DAMA 4QG3A 1N2HA 2C29D 1RPJA 1DX4A 2YBEA 1ZK3A 1GSHA 4MUHA 2IIBA 1SU4A 3CRVA 3GDHA 3M1YA 4KGXA 4C0XA 5JLJA 4IKOA 2N1MA 5FFFA 4BJ6A 2WG1A 2XWBF 5DCYA 3RVOA 3MTDA 3JV7A 1M33A 4LA4A 5JISA 1R5OA 4IDDA 1T4DA 1YCHA 1GRRA 2KE5A 2HKIA 3O5AA 1XMVA 4CKBB 7REQA 1FX0A 1WV0A 3LP5A 1AQLA 3NALA 4QOHA 2H1VA 4HWOA 1Q0LA 2QTMA 1K3UB 4C3UA 4IWYA 3G7UA 2W2QA 2ZI6A 3UMJA 4R69A 5DW0A 1N8KA 3PTLA 4C4SA 4B4DA 3W2IA 2ODTX 4OMFG 2C54A 1UKCA 3D3WA 4DR4B 3E1GA 4AZ3A 3SVLA 3U16A 3AFNA 3ISJA 1DUSA 2NACA 5EY5B 3N0TA 4N65A 3C74A 1P4RA 1J8FA 4PLPA 2IXDA 1VCOA 2HMWA 3UJBA 1DLIA 2ID9A 2PMEA 1QQ5A 2GSWA 2VWPA 1YRQA 1GRVA 2W4QA 3HO6A 4G5FA 4PZCA 5AQEA 4YPVA 5KTOA 3HJUA 5ELLA 4B3IA 1B8OA 4AZSA 3ZY5A 4NYIQ 4TWIA 4EP1A 5AOCA 3W3AD 4QOSA 4TYYA 4PZPA 1DUVG 4XDZA 3FLBA 1D1PA 4K9NA 1K8QA 3D7RA 2B2NA 3J80A 2FQQA 3B70A 3FF4A 3AUUA 3DLIA 5EC8A 1JN0A 3FYSA 4BO0A 2ACEA 3SEZA 1SXGA 1P1BA 2AI1A 1E2UA 1DC4A 4B9EA 2HFKA 4CT0A 3C0KA 5F9HA 3JATB 3HU2A 3H17A 4KQHA 4WKPA 3DOOA 3SZRA 1RLTA 3ZTYA 1T5HX 3RV3A 1E1RD 2OCLA 2VTVA 3L0SA 4OMUA 3R8FA 3KUUA 3PKJA 5JBNA 5TMPA 1GDDA 3CLHA 4OQ4A 4W5RA 3PICA 1I2ZA 2YRWA 5ER9A 4B4UA 2O5CA 2EX0A 2R1TB 2XMGA 3DOJA 1CJTC 3PQDA 4B3CA 4ZWNA 4UDOA 1UJCA 2GCOA 3NHSA 2EFHB 3O21A 4H77A 2ZSAA 3FUVA 3HJFA 4PAOA 1RIIA 3W4IA 3O6VA 5LQCA 4Z51A 3AFMA 1V25A 5JWOA 2P67A 3ZQJA 5KQLA 4D98A 5H83A 5DF1A 1J0BA 1T10A 4R7GA 5I47A 4OA8A 1MH9A 3PI6A 4YV0A 3SVZA 5KWIA 1XZFA 5B4VA 5DM70 3PDWA 4RTRA 1KYZA 1RAFA 3MQ4A 1TIKA 2JCVA 1A69A 3VKFA 3DVLA 3HBJA 4RQUA 3QX3A 3OD1A 4CM9D 4ZCLA 2XMPA 4IPTA 5JS2A 1YULA 2DP4E 3RREA 2O2ZA 4J43A 4W5OA 3TVYA 4ZXPA 4CKCB 1BQ4A 4Z4HA 3SZLA 4JA0A 4LYYA 2ODQA 1E1QD 1JEOA 1ZGZA 1AMUA 3CKMA 1V4BA 4F11A 2LP4Y 1XCJA 2PZGA 1HE3A 1WQ3A 1W581 2QB5A 3IUNA 2YY6A 3PFIA 1WW8A 4LWQA 4MRSA 4D3FA 4EF4A 5HQ3B 1I1OA 1ZYUA 1NVKA 2RGNA 3UYLA 4F3RA 3RAFC 4QO7A 5EIWA 3K9CA 4L3OA 3L40A 1EG7A 1D2GA 3I5YA 1II9A 2JASA 1UBLS 3FYCA 1KY4A 4FDAA 1JILA 3DAPA 2O54A 3QUSA 1TGYA 2FG5A 5IM4F 1ZUHA 2ZSHA 4WASA 1BJTA 4Y7DA 2P62A 2FDCA 2OG1A 3WA6A 2DB3A 3IUSA 2YZKA 3GH1A 3QVOA 1C7QA 2J5QA 5EQFA 3ZGYA 4Q1FA 1I5EA 4KQ6A 4P3OA 1WEHA 5L45A 5AQ1A 3LC7O 1YQXA 5MGNA 3QWFA 2HYDA 1Y3FE 3UK6A 1SU6A 3OX4A 4UU1A 2DUWA 3QF4B 4JI6B 4CM4B 3MOSA 4WIAA 5IUKC 4MDEA 3LG2A 1HTBA 1UJ4A 1CEQA 1E5VA 2Q0SA 1RJDA 4HH0A 4RHYA 1T0JB 3ZXIA 3R76A 4DBLE 2BEUB 5HMLA 1EVEA 3E5HA 4J0CA 4N3AA 5J2TA 4B82A 1PFGA 3BE6A 2CNNA 5TC4A 2PZ8A 2DAPA 1NXXA 1O03A 2IDMA 4PYJA 3T9CA 2PT5A 4PQYA 3OA2A 3B8EA 3OF2A 4FLMA 4KMSA 4B6FA 2C96A 5JD5A 3A14A 3UT5A 3IE0A 4CEHA 2HDHA 2FN8A 2ORYA 4DBVO 2GASA 3NBQA 4EVQA 1S1CA 2REXB 4QUAA 3G9TA 4J29A 4KQ1A 3FVVA 1G5HA 1V11A 3KLMX 4LXXA 4G0QA 1JDVA 1A9RA 3KPUA 2RKBA 4R9RA 2F62A 1OF1A 1U1DA 5TSDA 5CDFE 5JNUA 3B3FA 3NO4A 4V2IA 3VC2A 1ZUIA 4ID3A 1B74A 4FE3A 3RGWS 3AV0B 3BL6A 5LXTA 4YJ3A 5CVEA 5ED4A 1R6VA 2Q50A 1EUQA 4WKGA 5K8JB 1MJGA 2V0CA 1K9VF 3GZJA 4D57A 1VB5A 1VBMA 3C3WA 1MB0A 1RM3A 3ND7A 4YREA 4XQ9A 1MB3A 4NJMB 4U39A 3C41J 4J2TA 4NEGA 4KACA 4M7WA 4FHFA 3EVNA 3JZDA 3UGJA 3WBBA 3SBOA 1N78A 5AP9A 4JUFA 4JHLA 2BWJA 5AI5A 3ZNNA 4MI3A 5K0BA 3OMWA 3OZCA 4NENB 1BYUA 4DUZB 1D2RA 3ROZA 1LZLA 2OZPA 1K08A 3R0ZA 4ZVOA 4US1R 2VP0A 4N82A 4URZR 1A8SA 2QORA 4TTSA 4M1SA 3RC7A 5BUCA 5DI3A 4C2AA 4ZAWA 1E1RA 1JGTA 4XH9B 4I1RA 4C6RA 3UJDA 3H9UA 4PBRA 2OLKA 4QDXA 4K7JA 2AXQA 2RHOA 4FNGA 2IS2A 4YUWA 2V97A 1G9TA 4P86A 2GHQA 3FOWA 1YL6A 4QFDA 3K70C 2BCJQ 1E3WB 3HM9A 4S1VA 1O08A 1VMEA 4JJ6A 3KOXA 1IZ7A 2A0XA 4D99A 3DR3A 5L3ZA 1V8DA 1L7RA 1RBYA 1CRQA 2CF5A 2ZUEA 4W1QA 5KNLA 1U4OA 1TYCA 4GYYA 4ICIA 3G5AA 3EXAA 3BWYA 1JH9A 4LCEA 4OLBA 2VT3A 3HA7A 4QOEA 2IUSA 3M9LA 2HA7A 4EGCB 1L8QA 5DHPA 1Z5VA 1L4BA 5ETJA 5BUSA 2AB0A 5JQGA 4AKIA 2VXOA 4Z9YA 3WDKA 1EFUA 5ALLA 1ETUA 2X5NA 4JP8A 2XGMA 2GZDA 5BNFA 1M0SA 2IYNA 4A8PA 2QPAA 4MRPA 2HIHA 4F1KA 1W87A 2WUDA 2WIAA 2VO1A 3GC6A 5LOVA 3THWB 2XKBA 2Y99A 1FDOA 4UEJA 2GCPA 4D4MA 3UH0A 2JDID 2O0MA 4YUAA 2CF6A 2WMYA 3QNUA 1CERA 1KEEB 1EWYA 4FX2A 3ZBUA 3CF2A 3OOWA 2YJZA 3QW4B 3HACA 4ZJZA 4OFWA 5IAEA 2HWKA 4HT3B 4I4NA 3T7AA 3P9PA 4JN6B 4E2WA 1IPFA 1WZEA 3I28A 3S81A 1NMSA 1U9JA 3AEUA 3L1VA 3FH0A 2R44A 5A6SA 2B4QA 3UZUA 1EPUA 4JR1A 4WZ6A 4TOIA 2JGLA 5TY0A 3H1BA 3L6CA 5C5DA 3OUZA 2Q29A 3GEEA 2PQMA 3ZWYA 1N5LA 1PK9A 1RVDA 4FM9A 1T5TA 4Y6GB 3F46A 4CMCA 3AXSA 1SR8A 1ZCFA 2ORIA 5F1KA 4M53A 3R44A 3DXYA 3GARA 1H2YA 4X45A 3DM5A 3FDZA 4KV7A 3ZDYB 2F4VB 3K3PA 2YFHA 4MV7A 4RTOA 3HNOA 4XX0B 3S29A 3MGKA 4BVBA 1WEKA 3HVHA 1NN1A 2XMBA 3EDCA 3IPRA 4NZNA 4R05A 5CD9A 1RZRA 1BHO1 3DF9A 2XUKA 1JW9B 4TWBA 2PQ6A 3KCNA 3RSHA 1E2PA 1U8UA 1VI2A 4GI2A 1XRRA 1ODCA 3DMGA 3FDFA 3LIIA 3BWVA 5FL7A 3G5LA 3T1QA 5JAZA 1NI4B 3Q2OA 1CJVC 4HXFB 2PANA 1U0JA 2NUTB 2PRJA 2ZRFA 3SPXA 4BIIA 4TTJA 1N9GB 2I78A 3VNRA 2YWXA 3E7WA 3BFVA 2UZ1A 3TDKA 4A0GA 3UH1A 1FZTA 3AFOA 3MFQA 3LKVA 3CLRC 2FEWB 4OGWA 4MQFA 2JFBA 1VC2A 2XYVA 3A8TA 3MN1A 5DTEA 1JDJA 4FCTA 1WZNA 3NU1A 1YHZA 3AEQA 1ZX1A 2YN2A 3OQBA 1P5ZB 3EC2A 4J0IA 1XQ9A 1S0UA 4I5DA 2APJA 1B8VA 4AS1A 1ARZA 1EFCA 2D2VA 5FIUA 1PJCA 2PU7A 4JJ4A 2ZBGA 2AIRA 2CJPA 1T34A 1TM1E 2V3WA 3BGOS 1XNHA 2IW1A 3M4ZA 3ROEA 2XNCA 4A7PA 1TC1A 1EUDB 3PC8C 5G0WA 4DOMA 5JRJA 3D6NB 3HJAA 5TPWA 4X1IB 4BB5A 4BL5A 1WXHA 1P8JA 1U31A 1TQ2A 2ZJAA 2B69A 2ECPA 5LM3A 1E6KA 4RSMA 4WXEA 2J3DA 4KE9A 4CFZA 1OZFA 1C9KA 4DCCA 4PTYA 3HGMA 4G37A 4X66B 3H13A 1MIOB 4X6YA 4XYMA 1SXPA 1PBNA 3QUQA 2WLSA 4RDCA 3SBDA 2D06A 4ARUA 5KBYA 4HYYA 2VJQA 2ZI3A 3QVSA 4R54A 4ZOEA 5J63A 1EFPB 1E59A 1HDYA 3PYMA 4RS3A 1VPVA 1X3LA 3C7CB 1NVXQ 2G5CA 1PO7A 5CTJA 3D1VA 3N58A 4ZKEA 5IUNC 5IM5A 2E6KA 5FJIA 3TG2A 1W44A 2II6A 4K05A 1ADJA 5JOQA 1BX0A 1GTJ1 3UANA 1XEXB 2W2LD 4MUEA 5IZCA 1U3UA 3Q6IA 1DOZA 1ULSA 1RKVA 4GIBA 4PPQA 1BA2A 3WNVA 1NVGA 1TRHA 1UEXC 1MGPA 4FHCA 3HCCA 4JUIA 5DYTA 1ZQ9A 2W90A 5EIAA 3ROMA 3NJ4A 4I8XA 4FGUA 4YUYA 2RBGA 3GB9A 2VBIA 4OHRA 4Q66C 2A5LA 2ZVDA 2BTEA 2D5BA 2ZKIA 4NBWA 1Y8ZA 3D6UA 4OHMA 3HSSA 2OQ2A 1UMDA 3TOSA 3MWKA 4WA7A 3U0VA 1X7WA 1SC9A 2EP7A 2EZ8A 3NUZA 1JEDA 4M2LA 3EMKA 2G4VA 4R2HA 2QMYA 4WOBA 2WY2D 3GG2A 4ZAVA 2FMKA 1FDTA 1J8QA 1X9IA 2BGIA 3ODPA 2GERA 2AUMA 2JEYA 2R6ZA 4L0DA 3SZOA 4EB8A 5C7IO 4KB5A 1Z45A 2X1LA 4RC9A 3FMVA 1BAPA 2GJSA 1L7NA 1K7XB 2C1EA 4YJHA 3CJTA 4PM4A 4R2WA 3CNLA 3DOIA 3M6UA 5JBQA 2ZVJA 2R86A 3M6XA 1QK5A 4ZRNA 3CCCA 3H2HA 1T29A 3NDPA 4DTCA 1C7EA 5G0VA 4B32A 1T2CA 3I73A 3VDRA 4ZYWA 4BQQA 4JOCA 1RQNA 1VL0A 3VZBA 2C4HA 2ZAYA 3A9TA 2P5TB 3NDJA 4X95A 4LGCA 3N0XA 2GVZC 2ZYAA 4D25A 3RH0A 1OB5A 4LJ7A 2QUIA 4ARIA 1N2BA 1DC7A 1YJCA 2FP4A 3KQHA 2W6QA 4DLSA 5ALVA 1R6AA 2JK1A 4P3PA 4PZAA 4BZXA 5JBIA 1WPQA 1JDZA 3NWPA 1QS0A 5IG2A 4PHHA 4YQFA 4W9RA 4BVHA 3VV2A 2FEXA 3BXZA 2CV2A 3FTNA 2QN2A 3L49A 5TVGA 4CIBA 5K2OA 1HRKA 2D13A 1THTA 5ARCA 3IB6A 1K7CA 2WYOA 5IBRA 3WP1B 1SD1A 5BQOA 1QQTA 3LBHA 5JAPA 5FPHA 5JNRA 1QJCA 3HBFA 4RVNA 1K7YA 3NHFA 3UN1A 1OLXA 2FYTA 3EWNA 2NZVG 2X4DA 3FI0A 3H1PA 2I1LA 4H9GA 3G59A 3D6TB 1SQ6A 1N1EA 1U90A 4E51A 5HRAA 4RVUA 1Y6ZA 3C6YA 3LUAA 4X8MA 4ASUA 4E07A 2QRVA 3GAFA 4NMXB 1AIPA 3PKZA 1Y5RA 4QJBA 4ZO9A 5TX7A 5CYFA 1DADA 1KXZA 5TGDA 4FSHA 5EIFA 4DV5B 1BVUA 4X63A 2AG8A 2EZ4A 1ACJA 5DX1A 5F12A 5BYBA 3W78A 1U0LA 4B46A 3ZKWB 1IEQA 4HQNA 2HU2A 3B3GA 3NDIA 4WXHA 2WD7B 1E3WA 1O9BA 1V5FA 3ESYA 3OJLA 3S2UA 3TD9A 2I2XB 4BJHB 1VHDA 3A7EA 3PQ5A 4YAGA 2Z4SA 5C9ZA 2BTQA 1EGVB 4OBWA 4NYJR 4AMZA 4CKEA 3EIEA 1F8YA 1YCGA 1WL8A 2IHZA 2J67A 2JHFA 3NJ8A 4MKXA 2COUA 5FORA 1MW8X 5LJLA 3DEIA 4JS0A 2QS9A 1KP3A 3HU5A 4KR3A 1E1CA 4O5AA 4DG9A 3OUTA 4II2A 2FJPA 3IR6A 3WO0A 3BIXA 2H92A 1XKTA 3JVUA 3W5BA 5DLPA 5ITZA 1HG0A 3GJ6A 2W2OA 4O1HA 5JHHB 4ZMBA 4KQIA 2A58A 4UM7A 4YLGA 3SKVA 3UJ8A 4DNFA 5FTLA 1FFGA 3R3JA 1KI9A 2Q21A 3EA4A 1LY1A 1O58A 2ACWA 1K5DA 3QKRA 1XQWA 2ZBRA 4LXYA 5KTNA 4MRRA 2OO5C 1FXSA 2YUTA 4WKOA 3RC1A 5KYNA 2CUNA 3DE1X 4YHHB 3X2EA 1R9NA 1J2UA 4OXNA 3U0BA 3RC8A 2E37A 3JALA 4R4JA 1JHVA 2EFGA 3UC9A 2DQYA 2IEYA 2P2CA 4MS4B 2GKGA 1NBMA 4RH3A 2NU8A 4B2IA 5F3WB 1W73A 3GCXA 5EWMB 4Z2AA 1XVIA 4A16A 1N5RA 3C3PA 1HR0B 1UKAA 2Q5OA 2H85A 3CB2A 4MVJP 5DM1A 2PUCA 4QXQA 3NKLA 5FWXB 3VNSA 4NIMA 3OPQA 2W6MA 3EBLA 1NVFA 4HMQA 2FPLA 2OK8A 5FPKA 1VI5A 1UBRS 4LRUA 3PNVA 3E03A 3LQQA 1JPJA 1KS2A 3U9TA 3HZRA 3F7TA 3SXUA 1KVUA 3PIRA 2WICA 2WIBA 4WZBE 2MINB 4FS8A 4UQOA 4ZTBA 3VR3D 2WUEA 4GOND 5AUNB 1RQPA 4KITB 2I4TA 2J1LA 3CHYA 3TLZA 3TQCA 1XCMA 2PMCA 3IBSA 5EIBD 2ZYHA 5KQSA 1K2VN 2GX6A 1MJ5A 1Q22A 1OJLA 2QYHA 3QYJA 5EZYF 2B0JA 2OL4A 1SA0B 5F4BA 2IZ1A 4C2BA 4YA6A 2RHTA 3FCAA 4O4IB 1AHNA 4FEAA 5ALOA 5EMNA 3ZDFA 4LC1A 3SC2B 4C22A 1XZEA 3IP9A 2BDEA 1P19A 1DBRA 4YXWA 5BY2A 5JW6A 2QPTA 2ZUBA 4LBYA 2PUFA 3NONA 1R27A 5J2UA 1H1TA 3HYCA 3K20A 3FLMA 4N0DA 1ZGAA 1XZHA 4JKYA 5TS3A 4RDHA 1P81A 3RYHB 5ALRA 4QVKA 1IHDA 5DNDA 1TF5A 1A04A 2BELA 2PFSA 3E2MA 4PYQA 3JU3A 4OHCA 4RULA 2GN0A 4PZ0A 4K9KA 1FTGA 2A9JA 3QEKA 2R79A 2WOOA 4M1ZA 5AK3A 1TK2A 3AHIA 1W34A 3B1FA 3F5QA 3HWWA 1RZ3A 3RJMA 1TA0A 2XOKD 4EARA 5BR7A 3BWMA 3DV2A 1XZ8A 4HJXA 4OU4A 2B7CA 3QHQA 1DKMA 3VBCA 2O4CA 4ZK2A 1IH8A 4MCAA 3TZ6A 1EM8B 1CR2A 1OIWA 3NANA 3OLCX 4GZ3A 1Z2AA 4OHOA 1W2GA 3IJ5A 3JD3A 3NVAA 2O3SA 4QNNA 5GPBA 4RFVA 3VYUB 5AUPB 3OZEA 4OI4A 4XWKA 5IK2A 3DULA 1MORA 3HK2A 3SFVA 3BDAA 3WGGA 3BGDA 5CFLA 2XHEA 1X7GA 3OIWA 4FGJA 4MUKA 3ZY2A 5FKJA 3EYWA 1KMCA 1QYRA 2NVWA 3FPKA 1VKRA 1MA3A 5C1DA 3FLEA 3PFHA 2G36A 2I3ZA 5ESRA 1GG5A 1EM6A 1Q5PA 4KN6A 3WLOA 2DEUA 1DGQA 3WGQA 5K8UA 4RLQA 3GHHA 5AUQA 4CYMA 5DHTA 3RC2A 1S8OA 3P9YA 1IWPB 3LX4A 4QGFA 4RPKA 4LDJA 3TW0A 1V9CA 3ZW8A 4RTMA 3GGPA 2IBMA 1A1VA 2CLSA 2X0IA 2I6UA 3KJGA 3F7OA 2J9ZB 1OV4A 3LY9A 2ALJA 4IOMA 4RSHA 4U7FA 5FNVA 2X14A 3C3BA 5A0TA 4KBYA 1CUGA 1F2UA 2ZYRA 4YAOA 1OXXK 4LJKA 5DT9A 1TZBA 1L5OA 2WPDA 1G64A 2HA2A 1O4VA 3HM2A 1DBQA 3IQIX 4HTFB 3VR2A 4CR8A 3FPHA 3RBXA 1WZIA 3UWMA 2I76A 1K5PA 1NRXA 3F3MA 1BX3A 5KTPA 1ODTC 3IPCA 3U7IA 4JV5B 2Z56A 2J9GA 1A27A 2A9VA 3FOFC 3L1JA 5TEVA 1WSAA 3ADDA 5BQFA 2E7ZA 4RHCA 4LEIA 2WU0A 3U61B 1X7YA 3IEKA 1YRWA 2D7JA 1GRNA 5F7OA 5HM6A 3EZFA 2IE0A 4BEWA 4FJ1A 2CFIA 4B4OA 3HHEA 3I04M 2FPIB 4R8VA 4DJJA 4DRYA 3BH6A 2N46A 4MS1B 4EG6A 1X70A 4GU5A 721PA 3ZD8A 1PQUA 3A4IA 2E4VA 5C81A 3X44A 1TZCA 4OH7A 2IUUA 2HCFA 1ORRA 1ZCAA 2PJRA 3KD3A 1KIFA 1R12A 2G5TA 1G20A 1RMQA 4PPNA 4EYKA 5IJ9A 1QO7A 1WS6A 2OLEA 2VJMB 4R9NA 1RWMA 2YASA 2PYDA 5K3BA 3D6AA 1MAWA 2AC2A 4FMDF 2AMVA 4PGFA 5A9SB 2VP2A 3IAFA 3L5KA 4ZI3A 3E0XA 4FOPA 3C98A 2PNJA 4W6QA 3TLAA 5EAIA 1G8SA 2JLCA 3ZH2A 4D82A 5K8TA 2UKDA 2PV0A 1YJBA 3QNWA 5I8PA 2CLFB 4FYJA 4L74A 4P22A 1Z07A 3UIEA 5EE0A 3CW2A 3L5OA 4LYHA 3G8CA 3ZXSA 4DDWA 1Z8DA 2OBNA 3ABQB 3CF6R 1FXUA 3H84A 1U2GC 1OYYA 2QF7A 3E1KA 3GEMA 3NUGA 4KYTA 5BSFA 4KZPA 4GOMD 2QLJA 2BM9A 4YPOA 3JAKB 1MTOA 4EABA 2WHYA 2XWSA 2GSDA 3DFFA 2UV8A 1CE8A 1HRDA 5AVQA 1WB4A 5A3JA 2CLOB 5AVUA 4OHVA 4D97A 2J8ZA 1HNXB 2G09A 4TXMA 3RUCA 4BXOB 1JFTA 3PXEA 2VCYA 2BC9A 4XGKA 3EVTA 1ILWA 3VX4A 4IJUA 5LUBA 3PUKA 4NBVA 4V0RA 1ULUA 3ZWOA 1DQPA 3DUFA 2DECA 3KCQA 2VHEA 4FZ5A 1E1DA 5AWFC 3B52X 3RVKA 3TFQA 5I7FA 4JYBA 5J4VA 3I83A 5KYGA 3D7KA 3PXCX 3KJZA 1O5TA 3PJDA 1GEGA 5CG2A 3T9FA 1WB9A 1WXGA 4EGFA 1GA4A 1GLVA 1OI4A 3ABSB 4MAMA 4P4UA 1DBWA 1EQUA 1PJ8A 3MUOA 2QUAA 4R1UA 5DN9A 1E3SA 3WQQA 3AH8A 3VKWA 3DBHB 4G65A 4CUJA 3DC2A 4E3WA 1CDEA 5ESXA 3C5VA 1NNLA 3THSA