1L3IA

Mt0146, the precorrin-6y methyltransferase (cbit) homolog from m. thermoautotrophicum, adohcy binary complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
186
structure length
186
Chain Sequence
MIPDDEFIKNPSVPGPTAMEVRCLIMCLAEPGKNDVAVDVGCGTGGVTLELAGRVRRVYAIDRNPEAISTTEMNLQRHGLGDNVTLMEGDAPEALCKIPDIDIAVVGGSGGELQEILRIIKDKLKPGGRIIVTAILLETKFEAMECLRDLGFDVNITELNIARGRALDRGTMMVSRNPVALIYTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Precorrin-6y methyltransferase/putative decarboxylase
publication title The Crystal Structure of Mt0146/CbiT Suggests that the Putative Precorrin-8W Decarboxylase is a Methyltransferase
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transferase, lyase
total genus 49
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.196: Cobalt-precorrin-6B (C(15))-methyltransferase (decarboxylating).
pdb deposition date 2002-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1l3iA00
3G2QA 3MGGA 4LWOA 4C06A 3UJDA 4YMHA 1RI3A 1NW8A 3M6XA 4PONA 1FBNA 3ELDA 3KPYA 1VQ1A 3ELYA 2NNWB 1B42A 1P39A 2ZSUA 4R6WA 4POOA 1IXKA 2AOUB 2YTZA 4LWPA 4PNEA 1MJFA 2G71A 3GGDA 3EVAA 1L3BA 4HC4A 2UYHA 2PWPA 3FPFA 3HTXA 5DM4A 5DSTA 4EKIA 5E8RA 3RW9A 3EVZA 4DF3A 3GRYA 3FUTA 2QY6A 3A25A 4E31A 5GINE 1D2HA 5FHQA 3V97A 4YUYA 4IV0A 2AN5A 2FYTA 1VLMA 2VDWA 5E1DA 4ER0A 4KDCA 4QQNA 2F8LA 4FS8A 4AZSA 5BW4A 5K01A 2NXCA 1SUIA 4M36A 2FCAA 5ICCA 4BY9E 2OKCA 5K0LA 1DUSA 2PT6A 3PB3A 3UWPA 2I6GA 4PGGA 2ZWVA 5EVJA 5HEKA 4Y2HA 4C07A 4RTMA 1L1EA 1I9GA 4FR0A 3ER9A 4F86A 5F2NA 4QPNA 4MIKA 2IDJA 2PXXA 4C4AA 3OFJA 3UZUA 2YX1A 5EZQA 3DH0A 4HGZA 1KP9A 3LKZA 3EVDA 5BP7A 4GC9A 1AQIA 3DMFA 3E8SA 1M6YA 3BGDA 3LCVB 3R0QA 5EEGA 1SQGA 5T64A 5DWQA 2VP3A 3REOA 3UA4A 3KPWA 2OO3A 3O4FA 5LR6A 3KR2A 2G72A 3OPNA 1H1DA 4RX1A 3R24A 5EPEA 4WVLA 1YFLA 1G55A 3M4XA 5E9JA 3SSOA 4PCAA 2JG3A 4YUZA 4ZTBA 1G8SA 1QAOA 4A6DA 1NW7A 1TPYA 2VDVE 3FUXA 2I62A 3ME5A 2G8NA 3OZTA 4R6XA 1SKMA 2YXEA 1O9HA 2XVMA 5DX1A 4B17A 3OZRA 3FPGA 5EG5A 4U7PB 3GIWA 1NW3A 2EG5A 4PYKA 3G8AA 3L8DA 2ZBPA 4LG1A 4OA8A 3TOSA 5GWXA 4RTJA 2XYVA 1BC5A 1EAMA 1SQFA 2EFJA 3LBYA 4U7TB 5BW5A 2EJUA 3I9FA 3KQQA 2OYRA 3EVGA 5LSAA 3EVBA 2BR4A 3VC1A 3MB5A 4FGZA 3PX3A 3MTIA 2XYQA 3C6MA 5DX8A 3BWMA 3IEIA 3I53A 1HNNA 3Q7EA 2JHAA 5LQCA 3G89A 4P7KA 5EKXA 2AOXA 4EVIA 4OQDA 4GOOD 2O06A 4FSXA 4UOEA 3UJ6A 2C7OA 3GU3A 1UIRA 5DM0A 4CKEA 2BR3A 2VZ9A 3T7RA 5K0FA 3R9XB 5KYGA 3MERA 2ZIFA 2OB2A 1TW3A 3HVHA 5D1NA 3KR1A 2AOTB 2C7RA 2ZW9A 1ORIA 1Y8CA 2JH9A 5CIYA 3ELUA 3E23A 3BXOA 5FADA 4V0RA 4AZWA 5K05A 3C0KA 2VDUE 4Z2YA 3U81A 4MWZA 5U4XA 5DTQA 2XYRA 3AY0A 1QAMA 2IPXA 1AV6A 1R8YA 1RI4A 4C05A 2QE6A 3PFGA 4O29A 2PKWA 3GRZA 1JR4A 4P7FA 3FYCA 3E7PA 2AOUA 3DXXA 4RTNA 2Q41A 3KQYA 3OE5A 2PVCA 4A6EA 1OR8A 5FQOA 5EQJB 1F3LA 5GM1A 2HNKA 2DPMA 1XVAA 5F2KA 5DTRA 3UJBA 2Z6QA 3G8BA 5EMLA 3UJCA 5EIFA 2BR5A 2PGXA 3LX6A 2NXEA 3GRVA 3CJQA 5K0BA 4DMGA 5HIJA 1D2CA 1JG3A 3VYWA 3ELWA 2ZLBA 5HILA 5KVAA 1EG2A 3G5TA 1WG8A 2I9KA 1X1AA 1L3IA 3KPJA 5C1IA 2OY0A 3HEMA 2C7QA 7MHTA 3KQMA 3LCUA 3DOUA 5G02A 3SSNA 4C04A 4RVDA 2ZZMA 3THSA 3LSTA 2HV9A 2HR1A 4CTKA 4RTKA 1DCTA 2PLWA 3JWIA 2YVLA 1I4WA 1ZKDA 3AWIA 2Y1WA 4RSRA 5DM2A 1Z3CA 1ZG3A 10MHA 5FWAA 3HCFA 2PSSA 5FUBA 5CVJA 3EVFA 1G6Q1 1V39A 3GRUA 1NT2A 3DULA 2ZCJA 2AOWA 4FP9A 5LQKA 2PJDA 2NP6A 4FZVA 1NW5A 3BWCA 3JWHA 1JQEA 2XBMA 5LQRA 4RVHA 2B78A 2PBFA 5KQRA 5DLYA 1WXXA 1JQ3A 1JSZA 2ZIGA 1NBIA 3NTVA 2YQZA 1KIAA 3LCCA 4MTLA 1F38A 4HSGA 4BP1A 1M6EX 1DL5A 1U2ZA 2IGTA 4DCGA 5CCXA 2ZZKA 1INLA 3GXOA 3IHTA 5HIIA 2UYCA 2CMGA 3GJYA 3HCBA 5CVUA 3V8VA 2CWWA 4KIGA 3G2MA 4QDKA 3UJ9A 3SVZA 1XDZA 1ZGJA 3DMHA 3DTNA 4R8SA 2C7PA 3EMDA 5DSXA 3DXYA 2OZVA 3SXJA 2OXTA 3LKDA 2QRVB 1FPQA 4H0NA 1BHJA 4JXJA 1NV9A 2EJTA 2H11A 2KW5A 5K0CA 2O07A 3FRIA 3OE4A 3GWZA 2P3OA 4DCMA 4GC5A 1VL5A 2G70A 4P58A 5T67A 3MTEA 5EKUA 2IBTA 4AUKA 1PJZA 5KS2A 3FUVA 3HA3A 4DA4A 2IH2A 1JTEA 3SSMA 4L7VA 2PXAA 5DM1A 3BWYA 3T7SA 2A14A 1YZ3A 5EHGA 2IDKA 5C9ZA 3GCZA 2ONZA 5K0JA 4WXHA 5ICFA 1L3CA 2DULA 3KPVA 4EMSA 4OQEA 4PYOA 3TFWA 4K6MA 3NVKI 1XCJA 2CMHA 3CBGA 3EMBA 3FZGA 1O9GA 1R74A 3B3GA 3TLJA 1NKVA 5MHTA 5CVVA 4PIPA 3KR0A 3P9IA 3EGVA 5E1BA 3JWJA 3M6VA 3TKAA 2P35A 2N47A 5DTMA 2ZULA 3GRRA 4PGHA 3DUWA 3UA3A 2Z6AA 4GOMD 1EIZA 3A7EA 2GPYA 3KQSA 1EQAA 2AOVA 4CWAA 3LHDA 2YXLA 3EPPA 2IH5A 5EIWA 1VP9A 3FPHA 4QDJA 5GOZA 5HIKA 3CCFA 1M0EA 1IM8A 3HCEA 2IIPA 1XXLA 3HP7A 3KQPA 4QVKA 5DXJA 3BZBA 2AVNA 1G8AA 2B25A 4DQ0A 1XTPA 5HZMA 1Q0TA 1QYRA 3HVJA 1P91A 3OU2A 1P1CA 2P8JA 5BXYA 2FHPA 1R18A 2BM9A 4F84A 5FTWA 2PX8A 1BOOA 3D2LA 3FTCA 8MHTA 3CC8A 2G1PA 2WA2A 2CKDA 4QTUB 3NWEA 5H02A 5JR3A 4RTRA 5DRYA 3ER8A 2LD4A 2PX2A 5FQNA 3PT9A 4E33A 3R3HA 4HTFA 2FPOA 3B3JA 3IYLW 2OPBA 4OX9Y 3VSEA 1YZHA 3SMQA 3UJAA 1EJ0A 4ER3A 3EVCA 3FPEA 4PYIA 4KWCA 4ER6A 1RI5A 4DKJA 2FK8A 3PTAA 1VIDA 3PS9A 2P3QA 4C03A 3WSTA 1YFJA 2JH8A 3OU6A 5FWDA 1FP2A 2E5WA 3KQVA 3S68A 2ZVJA 3KR9A 2WA1A 3A7DA 4QTTB 3TPZA 1AQJA 5CCBA 3X0DA 4G56A 4RTQA 3PX2A 2IFTA 3BWBA 4AZVA 3G5LA 4P7GA 5F2OA 1VPTA 3OCJA 2GH1A 2V7EA 1R8XA 1QANA 1EJ6A 3H2BA 5EOVA 3TKYA 3OU7A 2UZ4A 1XJ5A 3MQ2A 3MHTA 2ADMA 4IKPA 3FUUA 5E1OA 5E9WA 4P7JA 3SR4A 1YF3A 3VC2A 4GQBA 3LDUA 3PVCA 1X1BA 3M70A 4YUVA 4YV2A 2BH2A 2JJQA 2PX4A 5T6BA 5K0GA 1N7IA 4E2YA 4E32A 3G2PA 1KXZA 2UYOA 3E05A 3T7TA 1I1NA 2P41A 3P9NA 2NYUA 5ICGA 2H00A 3KHKA 4C08A 3C3PA 1N7JA 2WK1A 1SUSA 3SX0A 3FTEA 5E2BA 1KHHA 4PCLA 3M6WA 3M6UA 5DX0A 3EEYA 3QOXA 3GNLA 5B1SA 1SVUA 3THRA 1HMYA 3I64A 4F85A 4EK9A 1NV8A 4RTSA 3K0BA 4GOND 4Y30A 3AJDA 4EKGA 4PYNA 3UFBA 5EMJA 2NP7A 3HM2A 2O05A 2Y1XA 4GF5A 2B9EA 3FYDA 1ZHFA 1FP1D 5LQJA 2AS0A 3DLCA 3NDIA 3JWGA 3HA5A 4MQ4A 3ERCA 5DRTA 3MCTA 4QVGA 5DXAA 4YV0A 2I7CA 5JUWA 3M33A 5K0EA 5CD1A 5HFJA 4CXMA 1NW6A 2OB1A 2PV0A 2PX5A 3AXSA 4RTOA 3UBTA 1YB2A 5CUQA 3P71T 4RVFA 5LQAA 1BKYA 4RTPA 2ESRA 2B3TA 5CM2Z 2YUIA 4AX8A 1X1CA 1L9KA 3GO4A 5LQUA 3CVOA 4NECA 4RV9A 4MHTA 4PYLA 4LECA 4YUWA 3UJ8A 2ORED 1AF7A 1TW2A 2AN4A 3DP7A 5KQSA 2YXDA 3PLAE 1T43A 3NJRA 3O31A 1ORHA 2P7IA 1XDUA 3FUWA 3KQWA 3P9KA 1NE2A 2P7HA 4V0QA 4E2XA 1RI2A 9MHTA 3TMAA 4HH4A 2R6ZA 3BGIA 5IH3A 1X1DA 5CVEA 4E2ZA 1RJDA 4PINA 1JTFA 2GB4A 3KQOA 2JHPA 2ONYA 3EGEA 4RVGA 2OBFA 2AOTA 3A27A 2GLUA 3UJ7A 2P1DA 3HCDA 3C6KA 3HCAA 4CKBA 5DPMA 4GOLD 1VE3A 3NDJA 2GA9A 2O0LA 4PYMA 1NBHA 2UYQA 1O54A 3G88A 3KQTA 4GUAA 1JG4A 1RJGA 4XUCA 3DLIA 3TQSA 4RYLA 2VS1A 3BKXA 2BZGA 4M7RA 3I5UA 5GM2A 4BLUA 2ZIEA 5GIOE 4YV1A 1VP3A 2GAFA 2V74B 3LBFA 2JHCA 3NWBA 1WS6A 3DR5A 4YUXA 2P40A 3P9CA 4EQZA 4BLVA 1WXWA 2H1RA 1WY7A 5ERGB 5ICEA 5GP1A 5E8JA 5LQNA 5FA5A 5C0OE 4M38A 5EMKA 4IV8A 3KPUA 5EHIA 5GIPE 1VBFA 5FA8A 1KPGA 3P2EA 2B2CA 4KRGA 4FSDA 5E1MA 2ZTHA 5FCDA 3EVEA 1KR5A 3EGIA 4GBED 1UWVA 1XCLA 2NXNA 3LGAA 4ISCA 4X63A 5EGSA 3G7UA 4E30A 4AZTA 2HMYB 1MHTA 3LPMA 4QQKA 5E9QA 2FRXA 1RJFA 4FT4A 3LDFA 5DT2A 4HG2A 2HTEA 1X19A 3T0IA 4DM3A 1JG1A 3LECA 4KVZA 5FULA 3ID6C 4ATNA 1WZNA 3GDHA 4KIFA 2AZTA 4KDRA 2ZWAA 4PIMA 4CKCA 1FJXA 3FTFA 2AN3A 4DZRA 1RJEA 5HIMA 2ZBQA 2ERCA 3RODA 3TM5A 5EC8A 3K6RA 4XCXA 3LL7A 4X61A 2IP2A 2R3SA 3BKWA 4R8RA 3CJRA 3EEOA 4CTJA 4RTLA 3P2KA 5IKMA 5E2AA 1KYWA 4QPPA 3DXZA 2IBSA 2FK7A 3BGVA 2XVAA 3NVMB 4E70A 3I58A 2NXJA 1P1BA 3HNRA 1JG2A 2CL5A 3KKZA 1PRYA 2PY6A 3HA7A 1Q0SA 2EX4A 1ZGAA 3ANXA 5P8WA 3ORHA 3CJTA 5K0NA 3FRHA 3SGLA 4ER5A 4KW7A 5K03A 1KYZA 1QZZA 4RWZA 3SM3A 3B5IA 4PYQA 2AR0A 3IV6A 3P8ZA 1QAQA 1KPHA 4X41A 4OA5A 5EZSA 2QYOA 2O57A 3TR6A 4HRAA 1YUBA 2QRVA 3Q87B 3BT7A 1RI1A 3NW9A 3HCCA 3OZSA 3C3YA 3QV2A 2K4MA 2ZFUA 3HVKA 4XUEA 1G60A 3MCZA 4XUDA 5M5BA 2AVDA 4X60A 1UFKA 2HWKA 3RIEA 3QOWA 5EEHA 3P97A 3O7WA 5FHRA 1D2GA 3PFHA 1G38A 3NMUF 3MAGA 4X1OA 3B89A 4BP3A 1N2XA 4PYJA 3CKKA 1ZQ9A 3A4TA 3AXTA 1JQDA 2PXCA 2YR0A 1SG9A 3KU1A 4R05A 3TM4A 4ER7A 2BM8A 3FTDA 4E2WA 4YMGA 5K8VA 1JSXA 3DMGA 1XDSA 5HOQA 3BUSA 4M37A 2GS9A 4PWYA 2Z6UA 3OFKA 3LDGA 2QM3A 3B3FA 3P2IA 4OBXA 3A26A 3TRKA 4BLWA 2ZZNA 5K09A 4GEKA 2IH4A 3HVIA 5EMMA 3F4KA 2PWYA 1KPIA 2PT9A 3CGGA 3FPJA 4FT2A 4OBWA 5CVDA 2ZBRA 1R6AA 3B7PA 3G2OA 4HTFB 2P3LA 4HGYA 1IY9A 3R6TA 5D1HA 1R00A 4IWNA
chains in the Genus database with same CATH superfamily
1PTJA 1XRNA 2I1WA 3E61A 4K40A 4CI9A 2ACVA 2EW8A 3QX7A 2PGIA 4YP5A 3ZNOA 4GFDA 2HD4A 3LK6A 4YH1A 4NQZA 1QGDA 2PL5A 5JAQA 1V8FA 3LF2A 1XZEA 3ELYA 3BORA 3PUJA 4FDMA 4QUAA 5B1YA 4HV4A 4R9NA 2I55A 1J24A 3LU1A 4R1QA 2RG7A 2HK6A 1MJFA 4OQFA 5KHAA 1C2YA 4FHGA 3I9OA 5FOSA 4ZGBA 2UYHA 5JFGA 2X0NA 5DM4A 4A6XA 1NVVQ 4OU5A 2BP7B 3EVZA 1BX3A 1MVLA 2Q5FA 4MI1A 1FS6A 1AXRA 1QTIA 1D2HA 4DF3A 1E96A 3NETA 3CEAA 2EV9A 2Y1CA 1UBOS 2MSDB 4YN3A 2IV2X 3RTEA 1VLMA 4PZEA 2RCYA 4C4SA 4DRXA 2O8DA 4ER0A 4KDCA 4MH0R 3PDIA 4C0SA 1XVVA 3K0AA 5HDQA 5KTKA 3BE5A 2PQMA 2QVZX 3HUFA 4IUBS 4MUKA 1IN1A 4QHSA 4TYYA 1L1EA 5JDIC 1JPJA 2Z5VA 3CTMA 5CXSA 3RVQA 5F2NA 2XZOA 1KAMA 5DSZA 2VOJA 3GLSA 4TPKA 1QUEA 4I2VA 5E9AA 1E79D 5BQFA 1IN4A 5HJ7A 2PD3A 2ZIWB 2DQZA 3GBPA 4OF4A 4O2BB 2NU9B 3D6UA 4X66B 2F8MA 1NU8A 4UHJA 1KJ9A 4QDOA 4MR8A 2BGKA 4ZI5A 1RBYA 1U9IC 5C3UA 3LVBA 1VE7A 3IXMA 2LXNA 3WKBA 1LZLA 4DEYA 3D4IA 1HTWA 4EPVA 1E98A 1SCNE 4GT1A 3BSSA 2PD4A 5L7WA 3GPLA 4BL5A 2IYRA 2BKUA 5G4KB 4NMWA 5ESXA 1TPYA 3U9LA 4G0UA 1XLWA 3BK1A 1WQ3A 4RPCA 1M54A 3O2QB 3AHJA 2VPZA 2OD9A 3UWMA 4JWTA 4FB4A 4WXEA 1BW9B 4D4GA 3KYDA 3O3OB 3JR3A 1UBKS 3PQCA 1HE3A 5D51S 4CMBA 4E5KA 4ZYXA 2I1LA 3AQ4A 4TTVA 2WQ7A 4CM8B 1AKYA 2ID7A 5LL6P 5CDFE 2P6OA 3KQQA 2WHPA 3ETDA 1N6PA 3OLYA 4KPUB 4F06A 4FGZA 2Z04A 2PBZA 1UMCA 3KZCA 3LQRA 1EZ1A 1GZUA 3VXKA 4GRDA 3PFNA 2DR0A 3A4LA 5FTNA 7YASA 3FKSA 4UVHA 3NEJA 3QEMB 1A2OA 2UKDA 2BR3A 2ODEA 2D1SA 3JQGA 3OC6A 1W8DA 1Z7BA 2HBRA 3AG5A 2HJHA 1E2QA 4B6FA 4N4AA 1J0EA 4UFOA 5TVGA 1JMKC 2QI9C 3PWSA 2ZW9A 3HR4A 3L79A 2BRUC 1TI7A 5CIYA 2DFPA 4QQFA 3BXOA 1Y1SA 3P7MA 4RORA 4Y6OA 1QO0A 1JHPA 3OWHA 3JATB 5CVCA 5K3SA 1N6RA 2NO0A 3R3VA 4JQCA 4MWZA 1JKFA 1ULSA 3N0TA 1QAMA 1V3UA 1CVLA 2IPXA 4D42A 2DX7A 5TS3A 4BU1A 4P0PB 3IBTA 4B7ZA 4C0KA 2GEUA 5HF5A 1WA5A 2JD2A 3F7OA 1IBLB 2XMCA 3K5PA 1J8MF 2V3VA 3NT5A 3W3AD 1KEZA 4OBEA 4FBLA 3ZCRA 3AVTA 1XU9A 3CTPA 4QOJA 1L7RA 3UW3A 3MA0A 5AJTA 1SK8A 3KOOA 5GM1A 4A0FA 1W2WB 2PFSA 5F2KA 5DTRA 3SCZA 5IM4F 4O3MA 2BP7A 3BJEA 1WJGA 2UDPA 1QE5A 4PC2A 2JIOA 3W0LB 1LDNA 3WOVA 1USIA 4CFZA 1LSUA 3UOWA 1PWYE 1FFHA 4WN3A 3ZW9A 5HJ2A 3ELWA 2H1OA 2GN1A 2UZ0A 1FYWA 1MMFB 4Q15A 1E7QA 1M1YA 3WK7A 1EBFA 4CL0A 2Y76A 1FXSA 2JL1A 4XW2A 4YI5A 4PHTA 4L4UA 4ZCPA 1LI4A 1CVRA 1EM8B 2YIDA 1HTTA 4C7JA 1PLKA 2QTAA 1UDCA 3OTOB 2XGJA 1NJFA 3MJTA 1BXGB 2C9OA 3EGOA 2A5LA 4HZUB 3ANYB 3JYHA 4PSAA 5BVHB 1K5PA 1VHJA 1JFVA 2C3OA 5GOTA 4KSCA 1IXRC 4O2BA 2NU9A 1DG9A 5A4JA 1YIDA 1L8OA 1V25A 2NX2A 4HXGA 4R1SA 2IPLA 1BDBA 4BN4A 2OSVA 4QGHA 3HBJA 3GEEA 2IEAA 3V48A 2QGZA 5AVYA 3OZBA 2PBFA 3GMDA 5IK2A 3OBIA 3OPMA 2CK3D 3IAS6 4LY0A 2GHRA 4MRVA 4CNQA 4R54A 2J9ZB 3NT2A 4MWEA 5G4KA 3JQEA 3UAOA 1LRKA 3MS4A 1MQ9A 2P9GA 2AW5A 3QE0A 4XGKA 3FOCA 4LRUA 5C32A 2CJWA 4P4SB 3QMVA 5AM4A 5BV1A 4QYTA 4CM8A 2Q4EA 1BA3A 3R6LA 2PS3A 2YHBA 2IWHA 4H0NA 1BHJA 1QH1B 1SHZA 1WZUA 1Z45A 3CUKA 2I66A 1PGQA 2KW5A 2NUPA 3GP5A 3GRFA 3M8KA 3ORQA 4KPUA 1P0FA 4QNMA 3WK9A 3ILHA 3WLNA 1BWSA 2RARA 3ASVA 4D4HA 2PGAA 3KAQA 3IO3A 4FCCA 4ECAA 1Q3HA 5EKUA 2NAFA 5KKNB 1TK2A 2IH2A 2V4ZA 3QW2A 4DC1A 1GO2A 7REQB 4B3XA 3QEMA 1ILWA 2OSBA 2XHEA 4Z7QB 1IZ0A 1PIWA 3THWA 1GZDA 1Q83A 4RH1A 3GCZA 3GEIA 1C80A 3BTVA 2GK6A 4Q3KA 5D7BA 5K0JA 1YZNA 2H2IA 4PYRA 2RGAA 2BFNA 4K6MA 4CF5A 3FZGA 1ZI6A 2I6UA 2ZYDA 5F4ZA 3SD7A 3I45A 3MAAC 3N2LA 5IUJC 1EFLA 3REGA 3JATA 1JHDA 1HEUA 1UXHA 1XMXA 4KMSA 3QFFA 4WCFC 2F3SA 1FDSA 4L28A 1U5CA 2J33A 1UKYA 1G3UA 1SN7A 1GAWA 1S7GA 1NVMB 4MWSA 2WFLB 3G7SA 2ABWA 4ZALA 2X8LA 2ISCA 3FWYA 3C6QA 1JKJB 3IJPA 3MRTA 5JVDB 3IJ5A 1TF5A 1GFIA 4DDMA 3PQ2A 1FTNA 5HMLA 2IH5A 2ATCA 2H57A 1VP9A 1SNYA 2QJTA 3CSUA 4ND5A 1FFXA 4TMVA 4LMBA 1XCPA 3HN7A 4MSUA 2JCVA 1RM0A 3N1UA 4HJRA 3U7EB 1DQSA 1LLFA 2G07A 4HLCA 4FE3A 2GYWA 3S5JA 3ZXIA 4A5SA 4F7DA 5ISMA 4RBNA 3H2KA 5D86A 1PI3A 1AZWA 1IJKA 3LIPA 1PSZA 4UXHA 4U2GA 4JX9A 5C3MA 3CWQA 5IRCD 2VYCA 1Z2CA 3PXAA 1V0JA 2C5SA 1HQDA 2XXJA 4BVKA 4GMGA 1JU4A 1T5LA 2FJ0A 3C4QA 3G0GA 4HEA6 3RANA 4JI6B 2PSDA 2KX7A 2KJQA 1BXGA 1SZJG 3BMOB 2HBZA 2DUWA 3PT9A 4C2AA 5EHXA 2OV3A 3B3JA 3KVRA 1IY8A 1VGRA 2B8NA 1LC0A 4HZUA 4WKCA 5HF8A 2NUAB 3MF4A 3ZWMA 2OPHA 2JD0A 4GZMA 4Z4FA 1FSZA 4NONA 4Q5IA 5AI6A 4DKJA 4I1OA 2L18A 2I1QA 2VSFA 4G67A 2Z95A 4OH1A 2BBSA 3FMGA 3HC7A 2AUTA 4J0CA 1E3QA 2E3JA 1OTXA 1T15A 1YFJA 2CLHB 3M49A 3OCCA 3U7RA 4Q3NA 4JYZA 1PJCA 4H60A 4JNCA 1SRRA 4RTQA 1RHKA 4XCVA 3KSAC 1F2UA 2ZE6A 1OAOC 2HPVA 2I2XB 2PH3A 2GJAA 1FMJA 1EJ6A 3DTVA 4MP6A 1O97C 5CXXA 2QR5A 3L1KA 1Z0SA 3UH0A 3W6ZA 3RVPA 1I33A 3DWEX 3PFWO 4HGRA 4GQBA 4KVGA 5IJZA 3KLMX 2HRQA 3GW8A 1GTMA 5JWRA 5K0GA 3VR6H 2BV3A 4DNPA 1Q7RA 3UHJA 4HFJA 2QMEA 4P4SA 4H3SA 1Q74A 4LSZA 4LIPD 4ZXFA 5B3KA 3OAAD 5BT9A 2ZSEA 4MP3A 4BGUA 5AVWA 2YHIB 1SH7A 1QH1A 4TSFD 1HT1E 1H0HA 4IKEA 4YRRA 2QPAA 3AF4A 3U4AA 3W5IA 1GPKA 5IDYA 5CFRA 2FG7C 3ZNQA 1KZ6A 4CQMB 1SVNA 1N7JA 4MDHA 2CBGA 5HTOA 2XDQB 4S24A 2CT8A 1MVNA 1SVUA 3ZVMA 2IW3A 4C0JA 7REQA 4B47A 3K31A 5BV2P 1F20A 1YRHA 2JBHA 1TCVA 3IMGA 3K0BA 1CUUA 1Z62A 2WDZA 3GJZA 4PO8A 2FPRA 2G0AA 4J1NA 4Z1MD 4XKJA 4NDAA 4UJ5A 3BFVA 2IJGX 5AK6A 1FVOA 1JEDA 4DV7B 3GLHE 3N2ZB 3VH3A 4DTCA 3LUPA 1LBHA 2R66A 3MCTA 4H9GA 4YA6A 2BKLA 4TQAA 1JKMA 1DWQA 2HJGA 5ELMA 3C7KA 4RJ2A 1SXPA 1KWKA 2NZ8A 1VDMA 5CH3A 4UXJA 4LRXA 1OGYA 1YB2A 3DMTA 2ODQA 4RVFA 1P3Y1 1XIVA 2EEPA 2WFLA 4KGZA 3PK0A 5HJ5A 1D0IA 1G5TA 3FGZA 3IVGA 2ESRA 2D2IA 4W8HA 4X45A 3UK0A 1FLAA 3WLQA 3L0PA 5LYYA 5JVDA 3ESDA 2VT7A 2GRAA 4HVAA 3AVPA 3LBIA 5A6VA 4YUAA 1O03A 3RG8A 4ALIA 5L95A 1Q1QA 3ST7A 3OQIA 2YXDA 3LYHA 4GOJA 3SZGA 4NCNA 1WEKA 1HZZA 3BRWD 5H4HA 3SYLA 1YQDA 2PO5A 1ORHA 3EAGA 4XWTA 2XEDA 4YRPA 1CD5A 2A3RA 4NPHA 1TVKB 4JBXA 1R4NA 1X1QA 4CM4A 3UPTA 3QMMA 4ON9A 4DLWA 4M86A 3ZD7A 2VTVA 4HX5A 2VZEA 3AKEA 1FE8A 1G5IA 1PR3A 2DMRA 1MTOA 1VJCA 4L9AA 4WKBA 3D0QA 3LBHA 2B20A 5LMZA 5KVVA 2BTQB 2ONYA 3INYA 1NMSA 1GUFA 1W46A 3AF1A 3SQLA 3Q2IA 5DNYB 4HNGA 4MYRA 3F6CA 4O59O 1TL7C 2FX2A 2NZUG 4Y6RA 3UJ7A 3WLSA 3W1WA 5LP6C 3ZZMA 1B2RA 2NUAA 2WAOA 3QVGB 5E7JA 1WLSA 2UZAA 3MIIA 2H7VA 3LCRA 4C14A 3E1KA 3T0GA 2X0RA 1ONSA 3FDXA 3FJOA 3K72B 1O54A 4GUAA 4M2LA 3V8MA 3ZHUA 4RHFA 3RLIA 3SQDA 4BCCA 2B30A 1B3BA 4YV1A 4D9EA 1MEOA 1AY0A 1I4DD 5JIBA 1E6MA 2PFKA 1BMFD 4E6PA 4FMDF 3KPUA 4EPWA 5D85A 1GPYA 3IDFA 2IHBA 2ZTLA 1J97A 4LXHA 4TYPA 3SX2A 5MGNA 1T2UA 2WM9B 4MQEB 3T95A 3JX9A 2ALJA 2BMVA 2DUUA 3OLWA 2R65A 4GXNA 4ISCA 2OZLB 3HH8A 1F6WA 3NH6A 4OI4A 2DETA 1DC5A 1DBSA 4FILA 1EU1A 2FZCA 1VL6A 1LW6E 2F67A 2OV8A 4DIBA 2N1MA 3A10A 2H4ZA 2YHIA 1DV1A 4KVZA 1FJXA 3EGCA 4DJJA 2FUCA 2WB4A 3GLKA 4FMPA 4BMSA 3PGLA 4RPLA 3OQVA 4CQMA 4DIEA 3RODA 2H9AA 2J9FB 4JR0A 2VWPA 3VHQA 5AVQA 1R5BA 1EP3B 2YIVX 2IP2A 3AUJB 1OLOA 2X0IA 1U2PA 2QN6A 3WGHA 1P31A 5BT8A 1NBME 4F71A 1OFVA 3FPBA 1K3UB 3O73A 5EHQA 2ZIUB 3OQMA 1U31A 4R1PA 1ZOSA 3DZCA 4GBJA 2JDID 3UO8B 1CNMA 1LSSA 3BGVA 4GWKA 5DCYA 2QI9F 3R3UA 1R6XA 3RG2A 2P2LA 2GCPA 3ZE2B 1T0JB 4PVCA 2XGMA 3QBEA 3Q10A 2ZS7A 2ZJZA 4J7XA 1Z16A 1N2CA 1W1IA 3PGXA 4WLUA 5K0NA 3TSYA 3W8DA 4D0SA 1XZKA 3O9MA 5DO9A 1SHJA 1DTWA 4TTSA 3OOEA 2ZJFA 3PYMA 4K03A 2GZRA 3NAMA 1I10A 1L4KA 2O2XA 5E3IA 1YVDA 5FTLA 3K71B 2F8SA 4D9JA 4QPZA 5A4IS 1QF9A 3VKWA 4XM1A 4DJFC 2CHEA 3EPRA 5C80A 4CL2A 2W4MA 1KBQA 1LRJA 2AWNA 1QF6A 1D1TA 3WMEA 2AX3A 521PA 1RHQA 3E4CA 2X4DA 5I7AA 3F67A 2GKSA 3A4VA 1XFDA 3GZNB 2PX3A 3HWWA 3OOYA 3PFHA 4OQZA 2GUWA 2BCJQ 4UEOA 5G2OA 4AZ0B 3K6JA 2EDAA 1PL6A 2GN8A 3E35A 3NVDA 4A2PA 1VL0A 4AS2A 1KNQA 1NP3A 3L41A 4Y8VA 1ADGA 3DO5A 4MVJF 3GOQA 2W70A 4YT2A 3RFVA 2H7YA 2PUBA 1VPDA 4L73A 1UJ5A 4OJMX 4WOCA 1CTQA 1PJ3A 2J45A 3IHWA 4S1WA 5I9SA 2GS9A 3R3ZA 3INGA 1SXJD 2I4RA 4NSNA 3L06A 5CH5A 3QVGA 2JASA 1Z9BA 4YBZA 3ROQA 4BQFA 1Z2PX 3OF2A 3UCFA 4HQ6A 1P2SA 3CGGA 3P4UA 4HTAA 4DUYB 1M5RA 3EH1A 3WWZA 3HO8A 3K9WA 1T8UA 4ZWNA 2IOFA 3GCWA 3G2QA 3HDYA 2ZUSA 1UDAA 1CJCA 3NDRA 3AFNA 3IODA 1E7YA 2VJAA 4W1PA 3V8BA 4P34A 4AURA 1TTTA 2GTPA 4ZU6X 4EF5A 1BTOA 4POOA 3OTHA 1UZNA 3WKCA 1B8OA 4DREA 2XE6A 1TRHA 4KDEA 4Z9AA 2WIFA 1NIJA 1OHHD 2TMGA 4KFRA 4KKXB 1K9SA 3DPSA 1H8ED 1PEYA 3DL7A 3GEGA 4KKVA 3W7BA 1ULHA 1D9XA 5KAPA 4OX9B 1LWNA 3T8YA 4XWAA 2V7BA 3JQAB 3AY6A 4J0KA 1C9NA 2CB0A 4D3DA 4ES6A 1SVSA 3TRIA 1U9ZA 5ARBA 3J80A 1RYZA 3HMQA 2X9GA 4JJFA 1FTQA 2RSLA 1YONA 5KNBD 4WESA 4JT4A 1XZQA 3Q7SA 4HVCA 5BORA 5FT9A 2RHCA 1G20E 1K0FA 2W6JA 4OB6A 4BFYA 1SBZA 4FZJA 4RIGA 5I7SA 2AX4A 3M2PA 3PB3A 4Z9BA 4YDQA 1A0OA 1O5IA 1Z07A 4GKVA 2J5KA 4TLEA 4BB5A 4G0OA 1HYQA 2ODTX 2FFAA 4RACA 2C2WA 1UBSB 2VATA 4X0EA 5KTRA 4CQNA 2FWMX 2E0IA 1SWVA 3AFMA 4MIKA 1CF9A 4OG2A 5IKXA 3Q15C 1L8QA 4GRIA 1KFBB 3AIIA 3U3MA 3AP2A 1BROA 2CL7X 4CR7A 5KX5F 3LCVB 3NTLA 5F77A 3PI7A 4IOJA 3U3XA 2WTEA 2B6HA 2DF8A 5DWQA 5HQ3B 5K3OA 4HAOA 1Z47A 1R6TA 4WBNA 1G9TA 2NPIA 4IMJB 2WAXA 1YR6A 4G1FA 4L51A 4XM2A 2RGXA 4UTPA 3ILVA 3SK0A 2QMZA 4I1YA 3VH4A 4KUEA 1IZYA 4PPNA 1TC2A 1KTVA 5AVOA 1SCDA 3OT1A 1H2YA 2G1KA 4O6VA 4R31A 1XRSB 5EKTA 1G1AA 5ER9A 3WLRA 5TS2A 2QX4A 3N3BC 1JBQA 1U0OC 4NYIR 1W36B 2K5UA 2H1FA 4DC9A 1S96A 1Q0ZA 3FPGA 4FHFA 1AKMA 1AZLA 4A2CA 1ODJA 4HWKA 1NVTA 1NAIA 1OWNA 5JNVA 2XYVA 1BC5A 1PFYA 3AL2A 2V1UA 5JS8A 3S2IA 4LN1A 4A3SA 4AZ0A 4C01A 3LQFA 3LLSA 5K3DA 1P9LA 1TIBA 2J07A 4JHLA 7ABPA 3BE8A 5L4SA 1TIKA 5C8ZA 3RSCA 4AN0A 5EWMB 2MYNA 3RT7A 5LQCA 1SM4A 4P7KA 1HY3A 4QICA 3CLHA 1OASA 2J5RA 4UCQA 3VKUA 3VOTA 4IQ0A 2WI8A 3MBOA 1Z5OA 3MRXA 4Y2QA 2WC1A 5ALEA 3UG7A 4MP8A 1R9JA 1UDRA 2D1RA 4DA8A 1EDOA 3TMYA 1W44A 5TSDA 3NZEA 3MTGA 1KH3A 1U99A 4YMUA 1UOPA 1RTKA 4B3FX 721PA 4F6RA 2ZRPA 3L8CA 3DMNA 5K05A 4JLSA 1H2HA 1WU7A 1FJHA 5B64A 4CEIB 2O2SA 1L4GA 1UT6A 1IJBA 4CW7A 3LLUA 1JS1X 3VR5H 1ZSNA 4Z5XA 1LLQA 1LS6A 2WUVA 3FYCA 4B6JA 1K92A 4D74A 5GQSA 3OF3A 3OE5A 2GVDC 3NYRA 3TYXA 4E1BA 2GXUA 3EIFA 1CY1A 3PC4A 5CNIA 4D9GA 3RH0A 3B5EA 3QVVA 1XVAA 1Q15A 4FKBA 3TNFA 5EMLA 1XWFA 2V7QD 3I1IA 5AJZA 1NQ5A 2JIMA 3JQAA 4CDNA 2H4WA 2Y1KA 2FW6A 2XKAA 2PGXA 1H85A 3Q6MA 4L75A 4L6CA 4LXUA 4RMJA 3WV4A 1XZAA 2G25A 1C8BA 2POQX 4OXKA 1D2CA 5J43A 1KYIA 1XB2A 2IXEA 3FRJA 4R01A 2FG5A 2JFGA 2ZLBA 5KVAA 3HWRA 1RZ3A 1WG8A 3MWLA 2CMFA 3JYPA 1LBSA 1HLPA 4D99A 7MHTA 3A1TA 2MDTA 1C3JA 4XASA 3L1JA 4NBRA 3THSA 1AU9A 1K7EB 1SPXA 3OIVA 2JI4A 1G98A 2I5PO 1YS9A 3BXXA 3DDSA 1SEVA 4QFBA 3UMYA 1OFIA 1ZJWA 3QVLA 4BKOA 1C5KA 1E2HA 1NUAA 4IVNA 4HDSB 5JYDA 5D00A 2ASEA 4PN7A 2BHRA 5EUBA 5CFOA 4H4EA 4BNXA 2YRFA 3PWZA 5G0VA 5B2FA 5KWVA 1DRJA 4MWTA 3SXUB 3K05A 4BS9A 1JIVA 3B9PA 4FZVA 4RHXA 1UC8A 4BLRA 2GFQA 4MHOA 3ADDA 2J9GA 4MIYA 1QS0B 4QRHA 5BNWA 5FPTA 3WXBA 1MB3A 1V3VA 3IMEA 1JQ5A 1SC9A 1NPYA 1RNLA 2VYFA 3MMSA 3MBKA 3N7UA 4KAJA 3R3XA 3AETB 1SOUA 4WL0A 3VYUB 4OKSA 3DEJA 1T9GS 1Y6FA 1LJ8A 5T4FA 4ZEXA 4E51A 4CLDA 3H11B 1GKLA 3SAJA 5LMUB 2IEBA 3GJYA 4I1SA 4K9KA 4PX9A 4BB6A 2YVQA 3CMCO 3WSWA 2H08A 1NWHA 1EZZA 1YJXA 2HZ7A 3JAMA 3GEPA 1ZGJA 3QEKA 3M1IA 2NO7A 3G2JA 3WB9A 1XA0A 1PE0A 3DXYA 5ALYA 2E6UX 5J5CA 1D03A 3RKRA 4J7CA 5HUJA 3F3SA 4M0UA 1LFDB 1V7PC 2AWOA 1BJTA 4PGMA 1SR8A 2H11A 5FFMA 5IANA 1PUIA 1MB4A 5I9IA 2BYTA 2XQVA 4UTZA 4UDYX 5LYJF 3B6KA 3B1JA 2PUHA 5IBCA 3PQ6A 4J03A 2J6IA 5EWMA 1G42A 4C76A 3BDAA 1IHUA 2V5AA 4G0QA 4D3XA 3T9FA 1L5RA 2QD1A 3A04A 3COSA 4R2IA 4X6YA 3VBEA 1D09A 1N75A 1N8KA 2PGLA 5C9ZA 2PT7A 3RYCB 1AKEA 1ICEA 5HGXA 1L3CA 1V26A 2O6HA 4G8DA 3U7GA 3H7AA 3U1VA 3VNVA 5JPDA 5EQFA 2HAEA 3M9WA 3B3GA 5I3ZA 3ABIA 3FZQA 3KE9A 3V42A 2Q3CA 4P33A 4AJ1A 1N6IA 4BMYA 3FZEA 1HT3A 4KPFC 5KNDA 1JLHA 4D4MA 1QFMA 2Y27A 4BB9A 2X5NA 4CEIA 1SBCA 3IIJA 4GU5A 4AC9A 4KG7A 1E2EA 1WVIA 2ZYVX 1Y5MA 4IW3B 2H5EA 2WJYA 4LSGA 2ZJAA 4MQMA 4CKCB 2QX8A 4PTYA 3TLCA 3RGGA 1I2MA 3WOHA 1PT7A 4WSOA 1GPWB 3V9AA 5JQWA 1I7DA 3BEDA 4J49A 1FFCA 1V9CA 2Q5HA 1WB5A 4LS3A 3DM5A 5BPHA 1HYHA 3D59A 4KXLA 1V2GA 4G3XA 2HDNB 3G8DA 3KB1A 5HCUA 2MSKA 1R66A 3ZHCA 5CYOA 4ZAGA 4YR9A 3QKWA 4MRRA 3VTFA 4EI7A 2CY0A 3SXPA 2UUPA 1JR6A 2JIPA 2ZU0C 2RHTA 2YXBA 3Q3JB 3W9BA 3DPIA 4FYJA 3HL4A 4Z0PA 1MX1A 5JTTA 3QPBA 1HL7A 3C5HA 1CHDA 3SZUA 1GOTA 2LUOA 5I9TA 2VRCA 3NHUA 4O2AB 3ND8A 1TFUA 4RH0A 4RKQA 2X1HA 3UWSA 1DXHA 1S9DA 2D1YA 3DFFA 4LV8B 1X8KA 4ZRNA 1JNXX 3A0UA 4HDSA 1GGJA 5T4BA 5FOXA 3RC8A 4MUIA 3A4NA 4LJLA 1MZPA 1JBEA 4C2BA 2PZ8A 5JFOA 4WJKB 3FIJA 4II2A 1RI5A 3EEFA 3FXAA 1AG9A 4G5XA 4S1TA 1T29A 2P9CA 5AM0A 3SJBA 3TPFA 3ZU2A 5FKJA 3WSTA 3TRHA 4MLZA 1T1GA 1QS0A 1OXUA 4ND8B 3A7DA 1JB1A 3EVNA 3X0DA 4RQBA 3QWBA 3I8SA 1QCYA 3DVLA 1T4MA 3EWIA 2JJ2D 3BWBA 2CXTA 3AETA 5ALUA 5IN5A 4CUKA 2HA7A 4ETIA 1ZVVA 2A1TS 4L3WA 4XWWA 3H11A 2ADMA 1WB9A 2LPMA 3EDRA 3ZCXA 1N36B 1EUDB 3OVMA 5HHTA 2BFBA 1WZEA 2EATA 4QGGA 4U6SA 2BH2A 1XRRA 3AG6A 2IU3A 3ANMA 5BQOA 3G9ZA 2WT8A 3HKCB 2FW1A 4BC0A 2QUHA 3KXKA 1PGJA 2I7TA 2IVFA 5H5JA 3RFFA 4PBTA 2HYIC 1EX6A 2A67A 3VTAA 1DLJA 4LOAA 3EG9B 2JGNA 1RAGA 4KLAA 3L4BC 3AILA 3ZTYA 2IEZA 3QRWA 2HSWA 5FD8A 3FWKA 4YWJA 3NIDB 1D7OA 4BYMA 2CCJA 4DCSA 1QQ5A 1YZQA 2C99A 1CR0A 3QTBA 3BJIC 2VNJA 3ESRA 2XUJA 2OE2A 4M46A 2Q5LA 3KCQA 2C9CA 4FOLA 1ZIDA 2Q4TA 2IP1A 3RARA 1N9KA 1RKUA 3MJEA 2O05A 2WJJA 1H5NA 2Y1XA 5HUQA 4N0PA 2YHSA 1GU7A 3H2GA 4HNAA 1H3NA 4N7JA 4QTXA 1PWXA 5C1OA 2ZSBA 3R20A 4JJIA 4QVGA 3W5VA 4LXGA 1GNLA 2Z6VA 3BE4A 1VHLA 3ZH9B 4B7CA 4BAZA 4IZOA 1SBIA 2ZBGA 2H5JA 4FKZA 4NC9A 2PX5A 5HK9A 3OM8A 3HV0A 2VCYA 3G2LA 5EE1A 4ZVUA 3SZLA 4E14A 5I8WA 3GWGA 4LOJA 2XUHA 5CM2Z 3F9RA 3H8SA 1S01A 2PL3A 3GO4A 1JL3A 4FINA 2OCIA 4FMCF 1OREA 3BCSA 3HQ4O 3JQRA 4R8VA 1Z4IA 2CCGA 1J1ZA 4Y6LA 4C5AA 1I4LD 3RIGA 2F00A 2JEOA 1GA6A 1O2DA 4YLGA 4EY5A 5DLEA 3L4SO 3VM6A 1H4SA 2QUZA 3BJRA 4RUKA 2MINA 2EKPA 2J31A 3G1WA 4XE5A 1I0LA 5C4MA 3OQHA 1I5OA 1TJNA 1XDUA 2O3SA 1E0KA 4XB2A 4YJ3F 4CN8A 5HW0A 4EENA 4AECA 1U6IA 2BFAA 4HFMA 1PJ4A 5TDHA 3BGIA 4KTVE 4XB1A 1N9GB 4DR6B 4FXPA 1GUBA 3N8NA 1I36A 2VH1A 4LNUB 4TUYF 2G3YA 2OBFA 3KOMA 2VUHB 2I4MA 1T9HA 3RV3A 5A1JA 1A8IA 3HCNA 3FA2A 5IT5A 3FFAA 3R4CA 4FSHA 1R6VA 3KJEA 3UUEA 4DCNA 3JALA 3KQTA 3PIIA 5KYXA 2I34A 1P5JA 2WR8A 5BSTA 4B33A 4BKMA 3BKXA 5FL7D 1OX4A 3THOA 4KQWA 4RV5A 2ZIEA 5KQPA 4IH9A 4ND8A 4AKEA 2O2IA 4MVJD 1BVHA 5JZSA 1ZBQA 3QLUC 2BONA 3LYLA 3GJSA 2OAGA 1EQUA 3NKVA 5I5GA 5ICEA 3N58A 1PS8A 2GBCA 3WSVA 5K0SA 2YJ4A 1T4GA 1VC2A 1DQYA 2I6QA 3SF8A 3WY9A 3ZD8A 1X14A 1VBFA 2NW6A 2OCBA 2X23A 2C0CA 2PYIA 3FR7A 3SNKA 3IA2A 1MCZA 2VZLA 1Y3IA 3LVQE 5FCDA 4UTRA 3ZLTA 5FBVB 1EUDA 4Z8YA 1VMDA 1L4NA 4CG0A 5B1HA 2C5AA 4JUDX 3ZWQA 1RJFA 1OIWA 2HHLA 4I6EA 4AYTA 4MKRA 4AY4A 2CHVA 1DJLA 1XZIA 1TYCA 3FROA 2X14A 3PXXA 4LJYA 4CMCA 1X9GA 4NL4H 1Z39A 4TV8B 2OOKA 3RAPR 3WZ2A 2L17A 3EG9A 3II6X 4ZDWA 4Z1OA 1XMVA 2ZUFA 1KIMA 3USCS 3DPUA 4G0WA 2ZBQA 1I80A 3ENKA 1OAAA 3OZWA 4ED9A 2Q9UA 1R7RA 4RPHA 1F2TA 2CE2X 1FX1A 3Q7QA 2WQ6A 1V4NA 3EEOA 1EVJA 1NOIA 3BRQA 4OHCA 1QYVA 4NEHB 5AKYA 1I94B 2DH5A 3S0JA 1DOAA 2BGNA 5GVSA 1Q95A 1UF9A 4QEKA 2HOQA 1U8XX 5IT4A 3Q5DA 2IXFA 4JCCA 1RZRD 1Y8RB 2EX4A 3GNTA 1NXVA 1ZGAA 5HZGA 3VI4B 2JFOA 4CM3A 5FUYA 4E5DA 1K98A 3GAMA 3JQ6A 3M4JA 1Z6PA 2G5TA 2C83A 2YQ4A 3HYSA 4IVRA 5FNZA 3H05A 4E0BA 3ZTWA 2JJMA 4N0EA 4RS3A 1MPTA 3O95A 3C3AA 3NCTA 3RRBA 5JFTA 4NX2A 1J00A 3A32A 4N01A 4OHKA 4E03A 3BT7A 4MIEA 1T6NA 3QVUA 3OZSA 2LV8A 3A6ZA 3C3YA 3R5JA 1IAVA 3QYAA 1UXOA 1YVUA 2APJA 3CRMA 3BCHA 1E3LA 3FVQA 3FUCA 1AQUA 1KKUA 3L04A 2QNBA 4Z4QA 5B58T 1CC1S 3F9CA 2EZ9A 4NG5A 2GPBA 4YASA 2P2ZA 4HADA 1A77A 4LY3A 1XDSA 3WICA 2ZEJA 4LNUA 4G26A 2IBMA 5A4MS 4X97A 3ZJVA 3H9QA 1U28C 3MAJA 1E1RA 2JK0A 3KJFA 2Z30A 4MAMA 2JAXA 3P2IA 1SOAA 5A1TA 4K46A 4P3YA 1T4BA 4DQLA 3QXSA 2OK8A 4FFVA 4HTFB 2CLEB 3LY5A 4HGYA 1I24A 1VA5A 5JISA 3OE7D 1TZKA 1MOSA 4Q00A 2PK3A 1W1UA 3M3DA 4F2WA 2C98A 4LWOA 5JC8A 5A5DA 3PC6A 3D6NB 3S7ZA 2V7PA 1VFNA 1ZY2A 3ZHSA 3I8XA 4C3UA 3TIVA 3IE1A 1JHZA 2HDOA 1JXMA 5D3QA 1JWAB 5CPFA 2NADA 3TIFA 1PYGA 3BD8A 4JLVA 4PNEA 1G2QA 2RGYA 2VHTA 3B3AA 5I47A 3EVAA 1M0WA 2NZJA 2P9YA 2J7PA 4HMQA 3N6RA 4KIJA 3S1LA 3RFUA 1USVA 4G2NA 2A5JA 3ABOB 2C95A 5DGCA 5IKEA 5FHQA 1OROA 4ZPXA 5EFOA 3V97A 1E2PA 3L0ZA 3HPQA 2IHJA 1P1KA 4IINA 2DPLA 2QROA 1BVUA 4TV8A 5WRFA 4EB6A 4COOA 4BECA 5F78A 3C5WP 3S2GA 2OQRA 5ENVA 1N2EA 3ZQKA 2OKCA 1UK8A 2GM5A 1KFEB 1NVAA 3E9YA 3MT9A 3ZQ4A 1RXEA 3CY6A 1B8VA 5BSEA 4N9WA 2FN4A 4S05A 2C78A 4GVXA 2VZ8A 4HWTA 1MAHA 3AOEA 3OFJA 2YX1A 3BL8A 3R1IA 1CNEA 1ANKA 1Y5LA 3DOHA 4YRGA 3QFTA 4YJFB 4RO0A 4IX1A 1GFZA 1KZGB 5JLJA 1EBUA 2YYZA 4KI0A 4DCOA 1JVSA 3ZG6A 2E48A 1SBYA 2C31A 3DBLB 1LQ2A 2C2ZA 2QMQA 3HKEA 3KAPA 3LXRA 5FI5A 4EHIA 1Y8RA 2VYQA 2OO3A 2DQYA 2QP9X 1CUZA 4OVKA 3O4FA 2IV7A 2MSEB 3ICCA 2A0WA 1H1DA 3A8TA 1PJAA 1V16B 1J2JA 1XD2B 2B36A 2J3DA 2QRQA 4NYMQ 2XKBA 3PWTA 3EJ6A 1PD0A 4I5GA 1L1QA 1KI2A 4M1WA 3DFUA 2HGZA 4M87A 4G37A 4MLCA 2H1HA 1J8QA 2YZMA 3K35A 2NVWA 3UHAA 1PZEA 2CL6X 2AF4C 3HJFA 4IQFA 1UFVA 4B83A 2I3ZA 5EJIA 1JN0A 4IGIA 5JH7A 4CM6A 2H2AA 3IQHX 3DBRB 3OX1A 4CM4B 3BN3A 2FWBA 3WX0A 3M2TA 1ZVJA 1V1MB 1GAXA 1I2AA 4NH0A 4EVSA 1VE5A 3LBYA 4P35A 2J3IA 2JI9A 3QY9A 3N9IA 1DRVA 3QK7A 3SIRA 2PMCA 2FZVA 3VR3D 1ZM3A 3WLAA 4EKDA 2PT5A 4K9LA 1FTYA 2BFPA 2V7XA 4Q47A 2WUGA 3HDJA 3PUHA 3QE4A 4AS3A 3MTIA 4I1PA 2O6LA 2WAAA 4OI0A 2OV6A 3TW8A 2OBYA 1FFBA 2I3DA 2R62A 1USKA 3AT1A 4FQ8A 5A0VA 3EHDA 4EW6A 4RDIA 5AW8A 1E2MA 4F5EA 3V4ZA 2BI8A 4FSXA 2IP4A 3LUFA 4HQKA 1CZRA 2IUSA 4IHJA 3LM8A 2DTEA 3ORRA 1OB2A 2JLVA 3LT1A 2BMAA 2Q5IA 3LWNA 3MERA 2QL6A 3H1AA 4GMXA 4C6RA 4L6AA 1TW3A 1MZVA 1U0TA 3HVHA 3H4MA 3O2NA 4LTNA 1YE3A 4URXR 4WNAB 2FPSA 3HABA 1MP0A 3OJFA 4CKBB 3ANTA 1XTKA 4RHTA 4XJVA 3ET4A 1OFUX 5I8ZA 2UU9B 3D6VA 3H5TA 4ZAWA 1GSOA 2IS1A 2PKWA 4NTZA 4PLGA 4BNZA 4P7FA 1SC4A 2YJNA 3WP0A 3ZWBA 4F8YA 2G6TA 2Q2WA 2HNAA 4IXMA 4TSKA 3R7WB 1XPRA 4BO5A 4U9HS 4OHPA 4B3DA 3O82A 1DFGA 3G8BA 3MCVA 4LMRA 1KSFX 1P5FA 3AK4A 4KE7A 3KL2A 2C94A 2Y1DA 3LSYA 1QOQB 1R27A 2CN1A 3O1JC 5HIJA 3W5BA 1SU7A 3BSYA 1NX9A 3D8BA 4FYXA 3WWDA 4HL6A 4ZAZA 1EK2A 4Y7CA 4TT3D 1XJQA 3HEMA 4O4HF 4UCXA 3TXXA 4UOZA 1ORRA 5B4VA 3V4FA 3LF1A 2CNDA 5G02A 1NP6A 5L3SB 1YKGA 3VSBA 1RPJA 5EJMA 2F3PA 3OI7A 2VQDA 4EJSC 1OD6A 4PS0A 3JWIA 5EZYF 3L2OB 5L4LA 4YJFA 2YWDA 2PL9A 1ZISA 4NBKA 2FE1A 4KXYA 5K3BA 1V3TA 3HCFA 4LC1A 4O4IB 3PDHA 5FP0A 3WADA 5IXYA 3DULA 5JAMA 1EWQA 3O3NB 3PXUA 2IYXA 1NW5A 3I2JA 3JVVA 2CVFA 2VP9A 5F5LA 1RXUA 2ZIGA 1VTKA 2I6FA 2DYKA 2R86A 1DELA 2H16A 5FBWB 2WUFA 2FUEA 1XRJA 5TJ9A 4MTLA 3VKVA 3QU9A 4TYNA 4TLAA 1DOHA 2H54A 1U2ZA 1N3BA 2UYGA 3GJ0A 3UTDA 3SFVA 1KBZA 4DGSA 2QMHA 3FWPA 1K6MA 4B3BA 2CWWA 4HBZA 3B52X 2D4HA 3BD7A 4KAAA 5BUSA 3ORSA 5F51A 4AMZA 5J4YA 2P4SA 2X9VA 3DMHA 5A4AA 2AG8A 2N1BA 4L22A 3HUTA 5KC9A 1V1MA 1MIHA 3AIMA 3ITKA 1W87A 4GM1A 1YMQA 1JJVA 1KVTA 3NXKA 5GJBA 3X2SA 1UBGA 3MLAA 4X1KA 3BFXA 2HQ1A 1XTJA 2HCRA 3NGLA 4TTPA 3OIFA 1XCOA 4COKA 5EJ7A 3C74A 4URZR 5JD3A 3SSMA 2PXAA 3BWYA 3COJA 5DYNA 3PC8A 5CFMA 1IUPA 1C41A 4X6UA 1F14A 1PSDA 2IYPA 1SRQA 1UKAA 1AF4A 2VR1A 1W75A 5I7UA 3NJ4A 4PYOA 1Z0FA 4DCCA 5A9SB 1XCJA 4IFEA 3D8HA 4EQ6B 4WNAA 3I8OA 3LA8A 3H4TA 3L7BA 4ND6A 4FWTA 3PPVA 4I3GA 1E3WA 1UOOA 3N7TA 1ZR4A 1P7YA 4M1YA 3BQ9A 4FFMA 3R9KA 3EGVA 3SPXA 4KE9A 5ITVA 1LPMA 1ZP6A 2VYVD 1II0A 2FKAA 3H8JA 2GJ8A 4EZEA 4TWAA 4IUDS 4HAZA 4RJLA 3JD0A 1AGXA 1EIZA 3C3KA 1XMOB 1GN8A 5EAIA 3V2HA 5J1SB 1QIEA 2K2QB 3CR8A 3R7WA 3SDZA 3F3MA 2JW5A 3UCXA 5M3BA 5K6AA 1ZNXA 5LBIA 1UJ4A 1Q84A 1ZU4A 2F4VB 2VTBA 2WYVA 1CJMA 4FX5A 4QLOA 3UT6A 3NP9A 3NIFB 5G40A 1M0EA 3Q72A 1VRCA 3KQPA 3D8RA 4QJIA 2PS9A 5LXTB 1OZFA 5DN6A 2DBQA 2QQ5A 5IC6A 4AZ3B 5EYPA 2NIPA 2ATEA 4FPXA 4V3CA 1Q3TA 3TCXB 1TGYA 2KWIA 1W5EA 1Y3FE 4YCCA 3NYWA 4G1BA 1WQ4A 1EVEA 1GL3A 4PSCA 4ZODA 3UF0A 5HIAA 3CF6R 2P65A 4W6QA 3LC1O 2G1PA 5JR3A 1O95C 3PQDA 4CU5A 1I3CA 5CK5A 4TWIA 5L3SA 3D7RA 3ER8A 1RS0A 2BEWA 5HF9A 2WICA 5K4AA 4N3BA 4YO7A 4BYGA 5DISB 1VL8A 4P98A 3RYHB 4N1AA 4REMA 2CXOA 2L19A 3USZA 1F0YA 1A9YA 4S2EA 2QHXA 2HA4A 3BIFA 3Q6NA 4QBKA 4ETMA 5H9WA 3KV3O 2CLDX 1A7UA 3PS9A 4KCGA 4RZ3A 3KSZO 3RADC 5FWDA 3S68A 5E6RA 4O4LF 2ZDGA 4LK2A 4BMPB 3V4RA 1HFEL 1U1EA 2C4WA 2WA1A 3EXG1 3BBLA 5CCBA 1U5BB 1IVSA 1DC8A 5JECA 4P84A 5B12A 1HWYA 1UOEA 3G5LA 4HYQA 4WHMA 4AZVA 4YDHB 2X9LA 4HKTA 3HZHA 1R8XA 1UM8A 2O48X 1K1EA 3AW9A 4GDFA 1YL5A 1CSEE 2CFIA 2WYOA 3ABRB 3LYAA 3SR4A 1SWWA 4GZ5A 4DR2B 3LP6A 2NPOA 5JAUA 1JQKA 4WJZA 5JSKA 3ETGA 1N7IA 3R7NA 5B1DA 4U3JB 4E2YA 1OFHA 3NBFA 1EESA 2FR1A 4MI9A 5KYUA 2OGWA 3P9RA 1P8JA 3BMXA 1NR1A 2HHCA 4J1TA 4E5UA 5CYPA 1XEWX 1JDSA 2GBFA 1C3XA 2QMUA 2O20A 3EZ6A 3ZGLA 1J1IA 4L50A 3RM3A 4CNBA 5ARCA 4PZ9A 1LVUA 3CVWA 1GZSA 4ITVA 1YDGA 2CBZA 1MHPA 4GDMA 2YWBA 2PUVA 3GJ3A 3I64A 4OFXA 1BXRB 4JYMA 1JA1A 1QRTA 4GOND 3DFKA 4FGJA 5EIBC 1VE6A 2F8TA 1R0ZA 2QD5A 3PYLA 2ORYA 2WF9A 4QWWA 6YASA 5LMNB 4P0QB 1MABA 1NUUA 4BNIA 1FP1D 3WNZA 1BQEA 4BVEA 4DCTA 5A9SA 4EQ6A 1H0KA 1L5LA 4M0CA 1KRWA 3O84A 2MSNA 3BH7A 2Q4RA 2W2LA 3CYFA 5EGNA 4ZCLA 4YAIA 2YY7A 1SAYA 2F9LA 3AXSA 2DLNA 4JBIA 1DINA 5JAIA 1TM3E 4BJ1A 5C8VA 2ERXA 5JALA 1GPUA 3IUJA 5JE8A 3A4YA 1AXGA 1QKJA 1T8PA 1RYHA 1QM5A 3DSRA 1X1CA 1PF7E 2VSOA 4A0SA 4JITA 3DKKA 2I54A 4YUWA 3DDWA 3ILSA 4D7AA 2GWHA 4DOMA 1AF7A 1XZLA 2ZUBA 1VSBA 2A4MA 3DP7A 3KXDA 3MC1A 4HDNA 3OIDA 3U4CA 8ADHA 5MFZA 3WK5A 3PQ5A 1ZICA 5LXTA 2IYYA 1XEWY 2R5FA 1MH1A 1SB8A 1WCYA 1AZSC 2ZR0A 3DQZA 3K8QA 4BHTA 5BSWA 1FQJA 2VUSA 4EHJA 2R6ZA 3EEQA 3ONFA 4E2ZA 1ZITA 2ZBFA 3W9UA 1QH0A 2A58A 4RVSA 4BTVA 4AK9A 2K6GA 3DGFC 1IOVA 1VHWA 3GCDA 4QU9A 3RVBA 4EJ2A 3TXAA 1PK7A 2VT3A 4X62B 4N54A 1V95A 2Q6OA 4P8RA 4U8HA 3VR4H 5DHTA 3V8NA 1DX6A 1C4WA 3QE9Y 1KSJA 1SCQA 1VE3A 3RYHA 4BLOA 3UT5B 3L7AA 4CCWA 2DFNA 1JEEA 4PQEA 1R3UA 3TWOA 2UYQA 3GFTA 3JQ8B 4RC9A 3EARA 2DHDA 2QVXX 1TTHA 4I5EA 4Q3OA 1CFZA 4ZGWA 2W6IA 3DCYA 3EEBA 4ZTZB 2P9JA 3QSYA 1J5PA 2V74B 4Q9DA 2JHCA 4JU9A 1KDTA 3O8OB 1U5BA 4EITA 3NUQA 5THQA 1AD2A 3UH1A 3QLJA 1E1CB 3LQQA 3PWKA 5C0OE 4IV8A 1DQZA 2B1JA 4HRXA 3RUCA 3SZRA 2NXWA 1ACMA 2DT8A 2GETA 2H1CA 5BN5B 4RPKA 2ZTHA 3A1VA 4QOGA 3VYRB 4EHKA 2ZM6B 2JFWA 3E5MA 3L7CA 3MMPA 4HN9A 4PSUA 2P1ZA 5CHEA 3VRHA 1S8FA 1L7MA 4MB2A 4MW9A 3G7UA 4E30A 1XZCA 4ARBA 5K0ZA 3G9TA 2VDRB 4JI1B 1TTQB 1F0NA 4M7OA 2JLXA 1ZJ4A 5BWCA 4C6SA 1JDTA 2XB8A 3QXGA 3N8HA 4FYWA 3VH1A 4PIMA 2Q1UA 4EDFA 1ZRMA 1FU4A 1OZ0A 2DQKA 3BHNA 4R1LA 2JAHA 2QRUA 1M2VB 3KJXA 2ZJBA 4G97A 3R7DA 2R0QC 1BJKA 1P4GA 2OZKA 3OZFA 1GNSA 5KDLA 2ONKA 3DAPA 4TYWA 3CLKA 3IAFA 2MSCB 1YBVA 1O6FA 4FOOA 621PA 3UAGA 3L07A 3P0EA 4BLSA 3C3BA 3LL7A 3FWZA 3E7FA 4TQGA 3X1ZA 2CFOA 1BXRA 4JEMA 4EJMA 5HKKD 1MFZA 2ZSIA 3CJRA 4IG4A 5CA0F 4RF5A 5IEJA 1L5QA 4ARZA 1CU1A 2IBSA 1K6XA 4RZIA 4J2TA 4MGEA 1D4OA 4JB2A 4LF7B 2Z43A 4RD1A 1NZJA 3QWIA 3SZ3A 3UV7A 1JR2A 4HT3B 3VHXB 1FDTA 3KXLA 1EP1B 3KKZA 2HLDA 3MWYW 4R2LA 3X1MA 1D8AA 1P2TA 1A9SA 1Q0SA 2C2YA 2ECFA 4QREA 2NYRA 2FE4A 1X2BA 2H52A 1KJ8A 3ZXXA 1JDNA 1SPBS 2EGUA 4WFJA 5I51A 1SOVA 3NRCA 1YJQA 2IEIA 5A3VA 2ZP1A 3GYGA 4CEHB 2RHWA 5JCJA 3Q1LA 3D7NA 1OLSB 2AR0A 4IJKA 4PC7A 4BZWA 5IXJA 5JS7A 1CDDA 1P33A 1T8WA 4FEAA 1YDFA 2W98A 1CS0A 1H5UA 1RTTA 5KYKA 3UKDA 2QTWB 1C7JA 1EQ2A 1R5NA 2DWQA 3AGPA 2WWIA 1N0HA 4HRAA 4XIGS 3TFQA 4AFNA 3QITA 1U1CA 1BG6A 2BHSA 1G60A 2P9FA 3D7MA 3MCZA 4ZYZA 5HM6A 4TZ6A 3DCJA 3LO8A 2XQFA 5EEHA 2J5XA 4NBVA 1HYEA 1DTSA 3UW1A 4PZPA 4F8EA 4IIJB 5G0WA 1NUTA 3A4TA 1U9YA 4OQMA 2W2KB 4LDAA 1VJ1A 1EDZA 2G04A 2R84A 1QYCA 3E03A 3L0OA 5ALIA 3TM4A 3K09A 1EM6A 2RH5A 3P0IA 4LJ4A 3IDQA 1GFSA 3E0QA 4R3WA 3SHQA 3HL0A 3TZ6A 3LRPA 3TQRA 4PWYA 4ZAVA 2DJ5A 2OGTA 4LDZA 5EIHA 1W25A 1DU4A 2LKDA 3WLFA 1JG6A 3W4IA 1T36B 5ENDA 4AG5A 4EYSA 1CRPA 4X9XA 3GT3A 4BVJA 1ZA1A 1HDXA 3UT5A 4P54A 4Q1FA 2C8KA 4D79A 1F17A 1YFKA 3JQ8A 1SZPA 5HX7A 1HC7A 2H9YA 1N6HA 3R6TA 2QMYA 1I2CA 3C87A 3H0CA 4LW8A 1YF3A 4IWNA 1BMDA 4TXMA 4RVUA 4S1PA 5HP4A 3UJDA 3C3JA 1ZU5A 3IQIX 3O8OA 2HK8A 2C07A 2N46A 1XNGA 4P7BA 4TMWA 2CNKA 2J0QA 4KMRA 1E1CA 1Y3HA 3Q2KA 2X1LA 1GEGA 5FNVF 3X1KA 3BDIA 4XEHA 1A88A 2GZSA 1SZDA 3OCVA 4ENRA 1CUFA 1VYHA 3IHKA 4CCYB 3PI6A 3PTLA 1WHTB 1XEXA 4OQLA 4PZCA 1SBQA 1DEAA 1XTVA 2Q9AA 2ZPAA 3EOBI 4KOAA 4M9CA 1QH9A 2ORVA 1ETUA 3Q0TA 5A2GA 5E1DA 3ISJA 3N59A 5F1YA 1FFGA 3F8WA 1MAWA 1PEDA 1JKXA 1TVCA 2C77A 4JVSB 4QQNA 3FFTA 4UE2A 3AHFA 3WTCA 4NZYA 2DKFA 4HWOA 4CF7A 1A04A 4EKNB 4V39A 5AHXA 3D5QA 1K3FA 3I52A 3F47A 2IDJA 3T4EA 5KCZA 5LJLA 3E8MA 3PFKA 4WK4B 2D5IA 1P7CA 1XKQA 5BP7A 2DGDA 4HLQB 3E8SA 1V37A 4MKXA 4J1SA 1F4PA 4Y1EA 1CK4A 1RAFA 3H17A 2FMFA 2Q2NA 3DE3X 4JSTA 1K3TA 1M83A 4PHFA 1Z34A 4IM7A 4WXYB 4QJ3A 3O47A 5B55A 2VP3A 4JN6B 4QODA 4W9MC 1UAAA 4DJTA 2C3MA 1NFQA 2QTMA 2PE5A 2I03A 1HA3A 3BXPA 3V2GA 5JCOA 3SJCA 1PDWA 1ZUNB 1Z17A 1G55A 3QLVA 5DNVA 1P0QA 1OLSA 2C0QA 2FF5A 4IJ5A 2VQ6A 4RL4A 5J2TB 1G38A 3L6OO 1JU3A 1E7RA 2XR1A 3CZ5A 3KUCA 1F8YA 4NESA 3TQQA 1PV4A 4LCJA 1SKMA 1DIHA 1O9HA 2XDAA 3EXG2 1EEHA 1GLNA 1OY1A 1YZYA 2RHMA 3DDHA 1FNBA 3IAS1 5TGTA 3VPAA 3W90A 3W8FA 1GN9A 1QORA 2H31A 3B6IA 2JI6A 2QDXA 3WLTA 2CVPA 2XE8A 1LH0A 4R7ZA 4E5SA 3SJUA 4N65A 4OPMA 2RGEA 4IIJA 5BW5A 4OGWA 1ILEA 1ZGBA 3R44A 4U00A 5A7HA 1DKQA 2D3WA 5CDYA 2W2KA 3UK7A 3MB5A 5F76A 3WZMA 2BMFA 2C03A 4XDHA 3V4SA 3FCAA 5KJ6A 4ZU1X 4YALA 5AM5A 4D8XA 4EYOA 3S55A 3UMMA 3BIWA 1WXQA 2AOXA 1SBHA 3OWXA 5G41A 4B0PA 1O3YA 3RRNA 1YVPA 1DJOA 3RT1A 4PAWA 1UIRA 3PQ7A 1H2BA 1T36A 3LA6A 4YCLA 2XF2A 2W2NA 3HXOA 2GGSA 4J76A 4D82A 3LC0A 3R3YA 4MV9A 2POCA 4NCHA 3PFFA 4K6CA 3V7YA 2A86A 4DR7B 1G59A 2Q6TA 3E27A 4G0MA 4D25A 4AKHA 1TZBA 2UUOA 3I28A 3M3PA 2QS9A 3PVZA 4MYUA 3E9MA 4GYKA 1EYZA 2A9QA 3AESB 3H16A 1A95A 4R2KA 4IZHA 3TSWA 1YHNA 4HDKB 3EQZA 1XPJA 2HSJA 3IAM6 4H6XA 5DTQA 5KTNA 2OFXA 4NLLA 4I36A 3FF4A 4YRBA 2GASA 3ESYA 4O29A 4MQFB 3B6ZA 4PS1A 1R0CA 1RZVA 4Z53A 3NONA 3O21A 5AI8A 1YU9A 3SICE 4RTNA 4A6EA 4NMHA 1FRFS 5JO0A 4MWCA 5FQOA 5EQJB 4AY6A 2Z3VA 3OMWA 3CG4A 4CCYA 5A06A 2DXIA 4GAEA 1GIAA 3AF2A 2FZEA 2YFQA 4LDJA 3S2EA 2FMIA 4OP3A 5J40A 4OGFA 3I62A 4DCUA 1YI1A 1N3YA 2I29A 2QSUA 2VF5X 3G5TA 2CVQA 4DSZA 5ITSA 3UOGA 4FZ3A 2O8NA 3F6SA 4OO3A 1GVHA 5AQ1A 1SCBA 1ZK2A 2Q5OA 2HA3A 4DPLA 3W5DA 3LLCA 3EJWA 2J9RA 4I0WB 1DO0A 1CDOA 4OL9A 1G66A 3KZVA 2DH6A 3LX5A 3CLSD 3ZHYA 1U2RA 3CNOA 1I4WA 4FCVA 4FYHA 1HDGO 4AY2A 1PP4A 1X80B 1JAYA 2W0SA 5C18A 1K2WA 1O6ZA 1U0FA 3B8HA 1V45E 4XZ3A 3ZCVA 2OO7A 3CB4A 4ZEMA 5C1DA 3ZGNA 3KLBA 4Q9KA 1B6RA 1VCMA 2V7UA 4MQ6A 4WKNA 2HMUA 5L3RA 5U9CA 3NTVA 1ZUNA 2PDAA 4NXMB 3DKRA 3LCCA 5FAXA 3OLZA 4XVRA 4ABTA 5J2TA 2ZZKA 5BN3A 3IBFA 1IQRA 4PO9A 2EBFX 1IUKA 2YN0A 2BFEA 2FOIA 2CZQA 2JRLA 4DWJA 1JDBC 1WB4A 1ZK4A 2R2GA 3DT6A 3I1FA 3JV7A 4RH3A 3EAQA 4QLBA 2RBEA 4R69A 2JKZA 3B12A 4MGHA 3TIXB 4HLDA 1SB9A 5BN1A 2P77A 1MT3A 4QGFA 5F2EA 4IDOA 5CCDA 1N7HA 1TAHA 3TTTA 1T8RA 4LJSA 1XWIA 2IYZA 1WUJS 3HNOA 1P4JA 1X74A 3F2VA 5IASA 1NW4A 4R1MA 4AKSA 2V8OA 2J4CA 5CT6A 3HXMA 4FU0A 2G70A 3MELA 5T67A 1C1XB 3I23A 3TTWA 3DBHB 4OGGA 1LBTA 3TSCA 4MRPA 1RLIA 5KS2A 3HA3A 4QXMA 3K70B 1JTEA 4U2KA 2WM2A 4WGFA 2Q1WA 3KB8A 2EERA 3W6NA 3W4JA 2O50A 3MCWA 1M73E 1CDEA 4NVRA 5EHGA 4C4TA 2XUKA 3TZHA 3DV0B 1Z6GA 3TBKA 4NS4A 4Q21A 2GMWA 3W3ZB 1QV6A 1CQIB 2Y0EA 1EFTA 1SJ9A 3L93A 3LDHA 3N86A 5TF0A 5BNIA 4IIUA 3AESA 4BO3A 1YB7A 4MAAA 1NSYA 4REQB 4BX8A 1W36C 3PXDA 4HDKA 5IVKA 1OWMA 1ZD3A 3P9IA 3SS7X 5BR7A 1MAAA 3GV0A 3PJDA 1FOEB 2VT6A 3GP8A 4UM5A 1P2BA 2HUNA 3LUHA 4C7VA 2C3YA 1EDBA 4BQSA 1XNHA 1VG9B 4JQSA 4ZVLA 3UK6A 2AD1A 5LUBA 1KS2A 1Z8NA 4LXYA 4R4JA 4ALKA 4F11A 1SZCA 3MZ0A 4M60A 5ALOA 1IDN1 2C5FA 1XP5A 1CZNA 2QXUA 2UZ1B 4W5RA 1XVUA 3UWKA 5BW4A 4EG1A 3WHLA 1G8AA 2IHYA 3Q7IA 5HK8A 4Y3UA 4GZ6A 1QYRA 5LA6B 4F1JA 1WMAA 3LFHA 4WY2A 1LUAA 4HCJA 4LF4B 4JWKA 2BDUA 4TL8A 2GPWA 3LUKA 5JZVA 1VLVA 1FDRA 1WEHA 3TZBA 1U7TA 2E2WA 3K9FC 1XG5A 2EJWA 4HO1X 1V9SA 3M0EA 4MV7A 4QTUB 4YQZA 5FIUA 5JQGF 4BV3A 5DRYA 1FCJA 4GS5A 2BW0A 1UEIA 5IABA 1B15A 3JQ9A 3QF4B 3R3HA 1PL7A 2AC2A 1NI3A 2ZETA 1GZHB 3UB3A 1R2QA 1X80A 3I6IA 1GGKA 3FCYA 4DNXA 5JRZA 4PYIA 3PD7A 3P4YA 1H05A 1LF5A 2RB4A 4TKZA 5CGZA 3DE4X 3TJMA 1ABFA 2JH8A 3PJGA 4BMVA 1YWGO 3IMKA 3E9DA 1VI5A 3BMCB 5F33A 2EL9A 3TPZA 3HYTA 4TN1A 3CZ4A 4ETWA 4YI3A 5DGTA 4KR9A 2QZ9A 4N76A 1DQNA 2GH1A 2UZ4A 2VI5A 1SCKA 3IQWA 2I4TA 3K94A 4TS9A 2DG2A 4CLRB 2FWIA 4OAPA 4P7JA 1RYFA 4EG0A 4F92B 5K5EA 3T1VA 5TMDA 1DDGA 1WUHS 2F62A 4H6PA 3IP1A 4GLLA 1XXHB 4BIIA 3C8HA 1EHYA 3UMJA 2R6JA 5KQLA 1KXZA 2WWYA 4KFCA 1JHVA 1Y33E 1TGVA 2WBLC 3F6PA 3HY3A 4CKZA 2XGGA 1LK5A 3GG9A 1UPUA 3R9WA 2NYUA 4NEGA 1VPWA 4UCFA 4LPKA 3U56A 3PRKE 1FVFA 1URPA 1CQJB 3OP4A 2CXQA 1GWNA 3T3OA 1VMIA 2ZYAA 1YDWA 2IE8A 5BSMA 4B3SB 1C1XA 3DBHA 1AH2A 2G1AA 2X2OA 3G8YA 4BQRA 1BN7A 3RIMA 4LJ7A 3C16C 1G5PA 1GPH1 3LE8A 3QIAA 3R0VA 4Y2RA 3BGWA 3SLKA 3RYTC 2YBDA 5LIRA 4NJMB 4AB1A 2R6DA 2CUTA 1O1YA 1U0NA 1DJPA 2BFFB 2X41A 3DV0A 2XQGA 4GF5A 4K3UA 1K5GA 2N9UA 4O0LA 1NPDA 4WY5A 5G0UA 3RS7A 2WPDD 4MQ4A 3UAWA 2GKOA 4KQHA 3T1TA 4ASUD 2YIMA 2ZRNA 1E60A 1N5DA 4REQA 2VDKB 3IDOA 1HQYE 3UHOA 1VCIA 3IVMA 2QF7A 5I9MA 5LQAA 3OEHD 3IXLA 4HVTA 1A7JA 4PEVA 2BJWA 2QTGA 2JFBA 4A91A 1ESDA 1GDHA 1UXJA 4MRSA 1RBMA 1W4ZA 1B8PA 2Y6UA 3M4ZA 4K26A 1YKSA 3UJ8A 2ZYRA 5KVQA 2PQ6A 1QVRA 2GRJA 2UZ1A 3PP8A 4HDRB 1L7AA 2P5YA 3IAAA 3WGIA 2W2XA 1Q1NA 3O31A 3CUEF 3FMIA 3CX7A 1RIFA 1TM5E 3HY4A 1ZX1A 5CH8A 4UHKA 4JJ8A 1P19A 4RD6A 4BEWA 4FOSA 2W6CX 1X7WA 4J0DA 5IH3A 4HFRA 4KXMA 2QM0A 3MD0A 1TC1A 1WU8A 3MVEA 4OJYA 1U7XA 4UHCA 1KDZA 3ZQ6A 4AJKA 4YJ2A 1K66A 3G8CA 5AXDA 2JHPA 2ZYWX 5AKEA 1QZTA 3B2EA 2A88A 3L0SA 4WLNA 1MOZA 3PD0A 3A6KA 1GUYA 3QF4A 1YZUA 1IK6A 3FOWA 4L95C 2OCDA 6GPBA 5TLSA 1F9EA 2HRBA 3MWEB 4GMKA 5BSRA 3V1YA 2WJ4A 2TSYB 2RHRA 4INZA 2N3ZA 5AW4A 5AKIA 2JGJA 4AYXA 4OXIA 4ZQGA 3SJ7A 3ISVA 2BTEA 3QX3A 2AJTA 3AHEA 2QG4A 1MPXA 2HK9A 3E7WA 3NVAA 4LTDA 4PSVA 4UBIA 3I5UA 4Z9FA 1WF3A 2G9ZA 2I87A 1P7VA 2OC4A 1I1QB 2BZSA 3G85A 3MQ4A 3BMCA 2JD1A 3NPMA 4X71A 1CEEA 3SFTA 2CJPA 3UQYS 3V1TC 1VLQA 2VEOA 1RYEA 4M38A 1JEJA 1PEKE 1KMNA 2FWJA 4I19A 4KRGA 2Z0MA 2XOKA 3L02A 3P5SA 4XD7D 4CLRA 2Y0BA 3EVEA 4TXHA 4B6OA 4EUEA 3VX3A 1LB1B 2FVXA 3AOEC 1M76A 3FGNA 4N6GA 4QASA 4LJ8A 4U7GA 3UV3A 1JFTA 1Z4PX 4FIZA 3AF6A 4Q4AB 5GAJA 2TRSB 1P45A 3N0XA 5JV5A 3B7GA 2D6FA 3O03A 1P81A 3D3WB 1QNFA 1YQTA 1ZIXA 3RKUA 2GBLA 1CQJA 3EK2A 1TLLA 2H1SA 4EG3A 1UIMA 1LV8A 1SKYB 3IKMB 3TTUA 4URHA 4EO7A 2JI7A 4F4FA 5HF6A 3RT9A 4J91A 3WI7A 3R3SA 1CERA 2WWHA 4K9PA 1E9DA 2CNLA 4U7HA 3I30X 3SQXA 1K6JA 3DBVO 4U0JA 4X7MA 5EL0A 5E2AA 1CUAA 1KYWA 4INOA 5F3WB 4NAUA 3CF4A 5AJVB 1ODCA 2P9HA 1OXMA 3JVDA 1J2RA 4QT0A 2AFHE 1GKKA 1ECLA 2JFFA 3HEAA 4MROA 4WRRA 4CG3A 2C5BA 2FPMA 2Z4TA 2I2BA 5ECYA 1VLJA 1JHYA 3KEFA 5K8IA 2AFRA 4C0AC 3W1VA 3TMKA 2VXBA 5B53A 1SUPA 1QVWA 1STOA 3MOSA 2FZ4A 3B5IA 3GELA 2EJBA 3DEYX 3KD3A 4BNWA 3SE7A 3E6AA 3P8ZA 4DWVA 2XZTA 4I6JA 3BF7A 2IF0A 1NVKA 7GPBA 4P9NA 1RHUA 4OA5A 3RUFA 1SIUA 4FFRA 5BMOA 1UMDB 1PQWA 3ODGA 5DW3A 5CFQA 3GPDG 4JB8A 2GJSA 1PVOA 4BMXA 1XPUA 1X0XA 1WPRA 5J23A 4PNHA 4XIFA 4IYJA 4GKKB 1P9NA 1PV2A 2F4NA 5LIPA 4B6PA 3QOWA 1LLCA 1NM5A 4CIXA 1PN3A 1YR9A 2ATVA 3CUVA 3A9VA 3MGKA 2HU5A 3AXTA 2W00A 3LQYA 3RVLA 4ZCTA 3KU1A 5K8VA 1DCKA 2VF7A 1MW8X 5JT1A 1SXGA 4MO9A 5SYAA 3MJVA 1T24A 3GXBA 4IGAA 3UOAB 3UUGA 1YI8A 2PVSA 1CUGA 2VK2A 3CSSA 2PUTA 3E3NA 4LV6A 4WIAA 5SYMA 3VR6D 5NLLA 1GV0A 5E4YA 2Z6UA 2BBOA 3LDGA 3MWEA 2ZZNA 2V1XA 1XL1A 3AF5A 4GEKA 5EMMA 4DG5A 2ETVA 1IOZA 1E9VA 4RFLA 4OBWA 1IVNA 4RQUA 5F12A 3IB3A 1VJGA 1E6KA 4MA5A 1R00A 3PA8A 4MW5A 3LZCA 3RBXA 3HLKA 1FFDA 2DPXA 2QLNA 4PONA 2ET6A 4A8PA 1JR3D 3C85A 1CCWA 1ODFA 1I6LA 3I34X 3R5HA 4MQ5A 2JAOA 1SGWA 2C9YA 1NMEA 4WVFA 2QIPA 1XF1A 1IIRA 3NHWA 3TK1A 1D1PA 2GARA 4DDKA 2D8MA 3GD5A 3RC7A 5B7GA 3KE8A 4OLFA 4CMHA 2GYUA 2ECQA 2HWYA 4MK4A 4DXHA 2WJVA 5BUQA 2EZ8A 2QQGA 1ZH4A 5EP3A 2IQ5A 3WK8A 3WB1A 5HS6A 4MW4A 3Q8LA 3NO4A 1OU4A 3B5JA 2CEAA 4Q4AA 1LS1A 3D4PA 3IRUA 3FCUB 5FUXA 4NZOA 3GK3A 3S7TA 4BMNA 4Q9NA 1C3OB 2ZKIA 3D3WA 1JTVA 1C3EA 3DKIA 5YASA 1FMLA 2P6NA 1KWGA 1G63A 4PG7A 1NU6A 3CEPB 1O94C 4J16A 1ISJA 3KBOA 4M1TA 1BVRA 3LI2A 5B3AA 1EWYA 1RYMA 5A0FA 1G5HA 1Z6XA 2EZUA 2WWXA 4GGOA 1TM7E 4UOQA 5CT5A 3DH0A 2OHFA 4NE9A 5ABPA 3KT8A 2X4GA 3GZJA 1ZK3A 4BGEA 3EIOA 4YCNA 1HPLA 2XPCA 2FJUA 1C4XA 2OWDA 2VNKA 2E55A 2AI1A 3AV0B 4TL9A 1BAPA 5CURA 3T7KA 4C0XA 4DV0B 2VUUA 3MINA 2WZDA 3AB8A 3O1HB 1W2HA 2WMDA 3QBVA 1RRVA 1T0BA 3UWOA 4EYEA 3ROFA 2FSVA 3KR2A 4FMBB 1BS2A 1GTVA 1H69A 2J87A 2SKEA 4RK4A 5JHHB 5EPEA 4JXZA 2C8VA 2VHZA 2CD9A 3TLZA 1YFLA 3SSOA 3FE2A 2Z2YA 2IODA 3C1AA 1KYVA 1QBKC 1G8SA 1JQBA 1T1SA 4QSMA 2OO5A 3M6MD 4KQKA 4W5OA 1UMDA 4DQDA 4L4SA 2AEMA 5I7VA 2DU8A 3N2GB 1XLUA 4JLJA 1TO1E 1B8UA 2V4UA 2ZPUA 1T2NA 3K9LA 1YK0A 2P9QA 4OSEA 4JDPA 4ZQFA 4CCAA 3OA0A 4Z6KA 2REBA 1KZ7B 5F7JA 1ENOA 4ZI2A 3K8OE 1EFPB 1U2GC 3ACDA 3LRXA 3BRWA 1G8GA 3WIVA 4KACA 5C7IO 3C6MA 3WLJA 1GGVA 3Q7EA 1TADA 3T34A 4E21A 1CIPA 2HLPA 3S81A 4EVIA 4B7UA 1GQSA 2VKQA 3VPHA 4EHLA 2ZVPX 2HT6A 4QU8A 3ZOKA 2C7OA 1HR0B 2I2AA 4DV5B 3HK2A 1AXEA 1SEPA 1Y6ZA 3O74A 1O6CA 3RAJA 2AQKA 2ZIFA 4C4YA 1GNVA 3H9JA 2AOTB 3ZCUA 2GSWA 1SXJE 4PWZA 3IDAA 2RC6A 2JFVA 4KI7A 1KDOA 1S2NA 3ADPA 3ZJTA 4L5BA 5LD2B 3T7CA 1IEVA 3NYQA 1WMFA 2Q5JA 2Q28A 2F3QA 3T5MA 4AUNA 4AJPA 2M98A 4PG6A 1ZPDA 5BOSA 3OECA 1OYVA 3KKQA 4ZOLF 1LPSA 5EMNA 4BIMA 1FY2A 5JHGB 2Q41A 4QL3A 3IP3A 2EQ5A 4K9NA 3STYA 4M0KA 3HJAA 4INJA 3J81k 1XN1A 1JMYA 5FWNA 5KSPA 4OU4A 5C34B