1L3IA

Mt0146, the precorrin-6y methyltransferase (cbit) homolog from m. thermoautotrophicum, adohcy binary complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
186
structure length
186
Chain Sequence
b'MIPDDEFIKNPSVPGPTAMEVRCLIMCLAEPGKNDVAVDVGCGTGGVTLELAGRVRRVYAIDRNPEAISTTEMNLQRHGLGDNVTLMEGDAPEALCKIPDIDIAVVGGSGGELQEILRIIKDKLKPGGRIIVTAILLETKFEAMECLRDLGFDVNITELNIARGRALDRGTMMVSRNPVALIYTGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Precorrin-6y methyltransferase/putative decarboxylase
publication title The Crystal Structure of Mt0146/CbiT Suggests that the Putative Precorrin-8W Decarboxylase is a Methyltransferase
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transferase, lyase
total genus 49
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.196: Cobalt-precorrin-6B (C(15))-methyltransferase (decarboxylating).
pdb deposition date 2002-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1l3iA00
1RJFA 1ZGAA 1SQFA 3DXZA 3FRIA 5K0LA 5E2AA 1O9HA 5ICFA 2B25A 1YZHA 4BP3A 1Y8CA 4G56A 3NW9A 4P7JA 3EVGA 1EQAA 2IDJA 5ICEA 4PONA 3UJAA 4RTPA 3TMAA 5DTQA 4FSXA 1JSZA 1L1EA 4KRGA 3FYDA 4OA5A 3DXXA 4ER3A 5KYGA 5CCBA 4FS8A 2C7QA 3T0IA 4A6DA 2ZZMA 2O0LA 4PIMA 4RYLA 3EEOA 2DPMA 4PYJA 2QYOA 3FPFA 1XCLA 1UIRA 5DM2A 2ZW9A 2ERCA 2OKCA 1JQEA 3OZSA 3KQVA 4M7RA 2IIPA 1F3LA 2PWPA 3DXYA 3KR1A 3ORHA 1KXZA 3PFGA 4E2YA 3R9XB 1KPGA 3CJRA 1NW7A 3MGGA 1JG1A 4GQBA 4RWZA 5CCXA 3ME5A 3HM2A 3HVHA 1X19A 2PGXA 1T43A 3EVFA 3A7DA 4P7GA 5LQJA 1MHTA 5T6BA 5LQRA 2ADMA 3D2LA 3KQSA 3PS9A 4PYNA 3HCAA 5EEGA 5FA5A 5EG5A 3KQPA 2I6GA 1P1BA 1ZKDA 4C05A 5K09A 2HMYB 2NP7A 9MHTA 2ZBQA 3ELUA 5EQJB 4ISCA 2PY6A 5HFJA 5GOZA 1Q0TA 1VP9A 4C07A 5EMLA 1P1CA 4JXJA 5HEKA 4HG2A 3KR2A 3LX6A 2PX2A 4L7VA 2PX4A 4PINA 5D1HA 2PVCA 2V74B 3CC8A 3LECA 3A26A 5FWAA 1EJ0A 1KP9A 3EMDA 2B2CA 2ZWAA 2PV0A 2PXAA 2I9KA 4Z2YA 2AOWA 5JUWA 3DUWA 2O57A 2BR4A 3C6MA 2AR0A 2XVMA 1JG4A 5EOVA 2R6ZA 5E9WA 4HRAA 1YUBA 3E23A 2ONYA 2OY0A 1RI1A 2CKDA 4RTKA 1HMYA 3B3GA 1SQGA 2ORED 3GWZA 4MTLA 5CVEA 3ER9A 4HGYA 1NW6A 1XJ5A 3MB5A 4OBWA 3CVOA 3UJ7A 2ZLBA 5FUBA 3V8VA 3TOSA 2ZSUA 1NW3A 1N2XA 1XDSA 2JH8A 2AN5A 2YR0A 3FPJA 3I58A 3LKDA 4GOMD 1YFJA 3LPMA 2PSSA 5B1SA 5GM2A 5E9JA 3SXJA 4CTJA 3BT7A 3A27A 3BZBA 4BLVA 1ZHFA 2ZIGA 3LSTA 2E5WA 5E1MA 1NV9A 1KR5A 2BM9A 2FK8A 3TM4A 4CKBA 5EZSA 5FWDA 1YFLA 2PXXA 2XYVA 1JSXA 3G5LA 1D2GA 3EGVA 2KW5A 2NXEA 3P8ZA 3T7TA 3L8DA 3BXOA 4KWCA 4EKGA 3UJ8A 5LQKA 3OCJA 1TW3A 4AX8A 5T67A 3WSTA 4DZRA 3A4TA 3T7SA 4PYOA 1FPQA 2ONZA 2IH2A 1G6Q1 5DSXA 4ER6A 5FA8A 3KQOA 1AV6A 2WA2A 2OPBA 1VBFA 3GNLA 5DX1A 5ERGB 1RI2A 5E8JA 5EEHA 2Z6UA 1ORHA 4KDCA 5CVVA 4EKIA 4RTJA 1EG2A 1L3CA 3JWGA 3HVIA 5H02A 3UWPA 2C7RA 4FSDA 1XXLA 1M0EA 4QTTB 5GIOE 1KYWA 3HCDA 5C0OE 5JR3A 5BW4A 1L3IA 2Z6AA 4X41A 5DLYA 3KPJA 1VIDA 2YXEA 3PX3A 4P58A 2ZIFA 2WA1A 3VC1A 1P91A 2BM8A 5K03A 2O06A 3GDHA 3Q87B 4C4AA 1EIZA 1RI4A 2AVDA 2GPYA 2OB1A 5KQSA 4B17A 1UFKA 3BKXA 1SUSA 2UZ4A 4GEKA 5EIWA 1TPYA 5GWXA 2UYCA 5CVJA 2GA9A 3MAGA 5LQUA 2GH1A 3FTDA 2VDUE 3LL7A 3DLIA 2NXJA 3LDFA 3PLAE 1G55A 2UYOA 4WVLA 5IH3A 2B3TA 2ZTHA 3JWHA 4YUYA 3CJTA 2PT6A 1YZ3A 2IFTA 3HA5A 3CGGA 3S68A 3SX0A 5K0FA 4YUWA 3O4FA 3PX2A 4KVZA 3NMUF 4FT4A 3LCUA 2ZBPA 4RTRA 3R24A 1QAQA 2Y1WA 5FCDA 2ZZKA 1R8YA 3KQMA 3M33A 3P97A 3C3PA 4IKPA 2HNKA 3ELWA 5DXJA 4M38A 1L3BA 4IV8A 4RTSA 2AN3A 1MJFA 4HSGA 3FUWA 5HILA 3BGDA 3SVZA 1RJGA 4E2ZA 2BZGA 2EJTA 4MHTA 3MERA 5ICGA 2JHAA 3THSA 3A7EA 4PNEA 3GRUA 1QYRA 1R18A 1ORIA 2I62A 3GRRA 3PVCA 5FHRA 3OPNA 1JG2A 3UJ6A 2OO3A 4XUCA 3ID6C 3ELYA 1N7IA 5HIJA 4RTOA 2JHCA 1RJDA 1WZNA 1WXXA 3B3JA 3NJRA 2H1RA 3OE5A 3AJDA 3FUVA 4EK9A 4DA4A 2FRXA 2OZVA 3C0KA 3DP7A 3EVDA 3AY0A 4QVKA 4YV2A 5CM2Z 5DSTA 3TM5A 2QY6A 4F86A 4ER7A 3LKZA 5C1IA 4C03A 1X1CA 2C7OA 4KIGA 4RVFA 3GRVA 1VP3A 3GXOA 5DTRA 1DUSA 4Y2HA 5E1DA 5EGSA 3SM3A 4EQZA 2AOXA 3P9CA 3KPVA 4GOND 4PYMA 7MHTA 3GCZA 10MHA 3I64A 5CVDA 5CIYA 1OR8A 3VSEA 2XYQA 2R3SA 4C04A 1RI5A 4U7TB 5FQNA 1WY7A 3SSNA 5E8RA 2HR1A 2P3QA 4PIPA 5CVUA 4X1OA 2XYRA 4PGGA 4RTQA 4X60A 4HGZA 3E8SA 2PWYA 1ZGJA 3KPYA 1H1DA 2B78A 5LR6A 3KR0A 1IXKA 4GC5A 5EPEA 4RV9A 3UJBA 3OU7A 3G8BA 2EFJA 1AQIA 3R6TA 2OXTA 4E70A 2ZCJA 3G2OA 5DM1A 3KU1A 4QQKA 3THRA 3CBGA 1INLA 5EHIA 4DCGA 2G8NA 3KPWA 3OZTA 3PFHA 4KDRA 3UJDA 1G8SA 5GM1A 2VDVE 4GF5A 1M6EX 5K0JA 4E30A 1BHJA 4RVDA 3SR4A 3FPGA 2AS0A 3EVZA 5DPMA 5E9QA 3IV6A 5T64A 5GIPE 2EJUA 3BWCA 3M6WA 2IBSA 3NVKI 4R6XA 3O7WA 2P3OA 3P9KA 2G72A 3T7RA 3B89A 3HVJA 1O9GA 5EKXA 2P1DA 4DQ0A 5LQAA 3DULA 3GIWA 1VLMA 2EG5A 4HTFA 4QVGA 3HCBA 3I5UA 4XCXA 1AF7A 2H11A 2N47A 2HWKA 2ZFUA 4RTNA 1O54A 3LDUA 4KIFA 1UWVA 4MQ4A 3G2MA 5K0BA 1WG8A 3HA7A 3OFKA 4ER5A 2O05A 5FADA 5DT2A 2P40A 3EVBA 3FTEA 3HP7A 4DF3A 5BP7A 4YV0A 3GJYA 3LBYA 3SMQA 2P3LA 3G7UA 1ZG3A 2BH2A 1BKYA 1Z3CA 4YMHA 2F8LA 1N7JA 4E2WA 3G8AA 3NWBA 5DTMA 3FUUA 3UJ9A 3BKWA 4PGHA 1NT2A 4RX1A 4V0QA 1Q0SA 1VE3A 1R6AA 3O31A 3G5TA 2P35A 3TPZA 4C08A 3FUTA 1XTPA 1JQ3A 3TRKA 3LGAA 4IWNA 3FTFA 2AN4A 2PX8A 1D2HA 2IP2A 4DM3A 1XVAA 2AZTA 3G88A 3LCCA 4HTFB 2AOUA 1KPHA 4DMGA 3MTEA 4BLWA 5KS2A 4XUDA 4O29A 2YXDA 3TQSA 3HA3A 4RTMA 2P7HA 3FPHA 4AZWA 2VP3A 1YB2A 3EEYA 1JG3A 3HCFA 3CCFA 5BW5A 4AZSA 3BGIA 4RVGA 3AXSA 2JH9A 3OZRA 1EJ6A 4E31A 5K0CA 3KQWA 3LCVB 4EMSA 2GLUA 1PRYA 4FT2A 2BR5A 5HIMA 3AWIA 5F2NA 4POOA 4M36A 5F2OA 3X0DA 3EVEA 1FBNA 5EKUA 4RSRA 3C6KA 1BC5A 3M6XA 3JWJA 4R05A 4XUEA 2NNWB 4OX9Y 3E05A 4QQNA 3DOUA 3HCEA 4AUKA 2IH5A 2YXLA 4IV0A 5K01A 3SSOA 5BXYA 4P7KA 5DRYA 4EVIA 1JTEA 4YUZA 3MCZA 3ERCA 1R74A 2IBTA 4BP1A 3P9IA 2NXNA 5EZQA 4CKEA 3EGIA 5MHTA 4PCLA 3MCTA 3PT9A 4QDJA 2VDWA 4PWYA 2AOUB 3RODA 3A25A 1NE2A 1DCTA 5K05A 2A14A 3FUXA 4BY9E 3VYWA 2UYHA 1B42A 4FZVA 2EX4A 1G8AA 4GOOD 3GRYA 3HVKA 1IM8A 1I9GA 1KYZA 5E1OA 1JTFA 5HZMA 5KQRA 3KQQA 2O07A 3GO4A 1KPIA 2Z6QA 2AOTB 3LBFA 3KQYA 2GS9A 3EPPA 3DR5A 4E33A 5GINE 5KVAA 2NYUA 1WXWA 3K6RA 3SSMA 1P39A 3M4XA 2YUIA 2Y1XA 1NW8A 5FULA 4DCMA 5FTWA 3P2IA 1KHHA 3UBTA 4FGZA 4GOLD 3G2PA 3MQ2A 5FQOA 1NBIA 1JR4A 5CD1A 3ANXA 2QRVB 2CMGA 3E7PA 2XVAA 3IYLW 1PJZA 3NDJA 4FR0A 3EMBA 5LQNA 3OU2A 3UA4A 4UOEA 3P2EA 5GP1A 5DXAA 3FRHA 3ER8A 4MIKA 2QE6A 2WK1A 4F84A 2PLWA 4OBXA 4GBED 1SG9A 2FHPA 2JJQA 5DRTA 5CUQA 3REOA 3P9NA 3I53A 3EVCA 2BR3A 1R8XA 4YUXA 5EMKA 3UA3A 1NKVA 4GUAA 2B9EA 3M6UA 1XDZA 1XDUA 3G89A 2ZIEA 3NDIA 1SVUA 4AZVA 3UZUA 3HTXA 4YMGA 2G70A 2PJDA 5K0EA 2XBMA 1R00A 3DMHA 4FP9A 5K0NA 2I7CA 3FZGA 3TR6A 3KQTA 5FHQA 3DMGA 5E2BA 2IDKA 3M70A 4LECA 1G38A 1X1BA 1RJEA 2IH4A 3BGVA 5HOQA 3EVAA 2H00A 1TW2A 3KHKA 3OU6A 3VC2A 4ER0A 3U81A 2YQZA 2PBFA 3P71T 3M6VA 1L9KA 2PX5A 3NVMB 1F38A 4PYQA 4CWAA 4PYIA 3BWBA 2OBFA 3DLCA 4LG1A 5DX8A 3GGDA 4RTLA 2PT9A 2P7IA 5K8VA 5P8WA 3GU3A 2NP6A 1XCJA 3K0BA 4OQEA 1DL5A 1QZZA 2P8JA 2OB2A 3F4KA 2CMHA 5K0GA 1G60A 4QPNA 3I9FA 2UYQA 4MWZA 5HIKA 4R8SA 3QOWA 2FCAA 2IGTA 2OYRA 4RVHA 3NTVA 3V97A 3UJCA 3OE4A 4CXMA 4K6MA 2G1PA 3B3FA 2LD4A 1FJXA 3MHTA 2V7EA 3FTCA 3B5IA 2K4MA 1BOOA 2Q41A 3GRZA 3IHTA 3RIEA 1D2CA 1FP2A 4QPPA 3DMFA 3MTIA 3NWEA 5HIIA 1YF3A 5DWQA 2G71A 3EGEA 1M6YA 1NV8A 1QAMA 2VS1A 2ZBRA 4QTUB 3ELDA 3C3YA 5C9ZA 4CKCA 3DTNA 2ZULA 2ESRA 4ATNA 5DX0A 3Q7EA 4AZTA 1IY9A 4KW7A 1ZQ9A 5D1NA 3KPUA 4ZTBA 1QAOA 3LDGA 2FK7A 4A6EA 5G02A 4C06A 4OA8A 1NW5A 2FYTA 4DKJA 2PKWA 5E1BA 4Y30A 2P41A 4NECA 4LWOA 2HTEA 1U2ZA 5M5BA 2IPXA 3G2QA 4OQDA 5F2KA 1WS6A 2ZVJA 3HCCA 1AQJA 3KR9A 5U4XA 3PB3A 4R6WA 4E32A 2DULA 3P2KA 5EVJA 3TKYA 1I4WA 3UFBA 3HEMA 3TLJA 3QV2A 4F85A 2CWWA 3QOXA 3FYCA 4PYKA 2CL5A 3HNRA 1QANA 2AOTA 3B7PA 1JQDA 4PYLA 5EMJA 2NXCA 4WXHA 5EIFA 2ZZNA 1I1NA 1HNNA 1X1AA 3TKAA 2YVLA 2GB4A 2YX1A 2ZWVA 2VZ9A 4YUVA 1V39A 5EMMA 4LWPA 4X63A 5LQCA 5EHGA 1VL5A 2QM3A 2JHPA 2C7PA 5LSAA 2HV9A 1SUIA 1KIAA 2PXCA 3CJQA 2QRVA 5IKMA 3CKKA 4M37A 1VPTA 1SKMA 1RI3A 5DM4A 2GAFA 4CTKA 4GC9A 8MHTA 4X61A 1EAMA 3AXTA 3SGLA 3R3HA 3FPEA 2FPOA 2AOVA 4V0RA 5ICCA 3BWMA 4HH4A 1VQ1A 3JWIA 4R8RA 3LHDA 1NBHA 4E2XA 3H2BA 3BUSA 3IEIA 5EC8A 3RW9A 5DM0A 4PCAA 4YV1A 3R0QA 2YTZA 3OFJA 3TFWA 1X1DA 1FP1D 2AVNA 3DH0A 3KKZA 4H0NA 4BLUA 4QDKA 3BWYA 3PTAA 2JG3A 4P7FA 4U7PB 4HC4A
chains in the Genus database with same CATH superfamily
1G21A 4DLYA 2O8CB 2W70A 1DG1G 3QVXA 4M9UA 3ZS8A 3HDHA 2CNWD 1O0SA 2QP9X 3HFSA 3KZ1E 1J0DA 4G56A 2V55B 2WHQA 2IU6A 2XNHA 4I5FA 3RLFA 4TOIA 2DWQA 4M9XA 1JSZA 2XNJA 3ITNA 3FYDA 2C7QA 1U2RA 1L1QA 4A6DA 4P5PA 2WNSA 2RI0A 3QLJA 4L02A 1FLNA 3EGDA 3LRXA 2OZKA 1XCLA 3SQWA 3NTXA 3HN7A 1TQ6A 4RQAA 3VHLB 4XIFA 1C1XA 2ZI4A 1XL1A 4K3UA 3PFGA 2O8EB 3ORHA 1FFSA 1KXZA 5LM3A 3GB9A 3BJRA 3KOMA 2FX3A 1AXEA 2ZQYA 2C94A 3CRNA 4C7XA 5C8VA 1TKCA 3HVHA 4OOFA 4KX5A 2H52A 2IZZA 1IDN1 1ZFNA 4MQ6A 5CURA 2X13A 1E2LA 3NTOA 2QI9F 5EXEA 5H7XA 4KYVA 4C05A 5KTYA 1IBKB 4LEIA 3VO9A 5HM6A 1M6NA 1TEVA 1PBNA 1W88B 3GW8A 3O8LA 2HU8A 3HXOA 2C8LA 3S2YA 3OEHD 5FYQA 4MUYA 4B73A 4D42A 1IBSA 5EQTA 5FTNA 2PX4A 1M6VA 3EQ6A 3H6HA 1UC5B 1RAAA 2WBLC 3L0YA 2I9KA 2NU8B 1FZQA 3FWHA 4MYRA 5LYJB 1DDOA 2IHKA 2H7YA 4MCJA 1OZHA 2Z8ZA 4KITB 3QV1A 2AI1A 5IK2D 5FNZA 4FZRA 2EHJA 2Y0PA 5DNDA 5BQPA 5TLSA 4S2UA 2AI3A 2FJUA 2ZTMA 1PG5A 3RT7A 5JPDA 3ER9A 1TEZA 5KKAA 2CXHA 3HNPA 1CUFA 3ZVLA 4ARBA 3FF4A 1LJ8A 1E2HA 3AUSA 3MMZA 4KSBA 4O4IF 3L8EA 1NJSA 4AICA 2PAAA 1F0KA 5ECGC 4OXQA 3WGGA 3BCUA 1EA5A 3I58A 4J75A 5T8KA 1I5RA 4HGPA 5I4CA 2EKBA 4QU8A 3BZBA 4BLVA 2VUIB 1Z88A 3WYFA 2AB0A 2FK8A 2JIPA 4R2XA 1MFPA 2NTNA 1V3UA 2P9CA 2GZ3A 3MT9A 1V11A 1CYDA 4LJ8A 5JNSA 1WUIS 1Y1RA 1FXSA 1Q0HA 3EH1A 1Y3FE 2J5XA 4WZBB 5ALIA 3T7TA 1J8DA 3KSMA 1MH1A 3QG1A 4EZBA 5KBYA 3A6DA 3KEOA 1DFGA 5HR5A 4C3UA 1P7YA 1G9SA 3WL6A 1H5UA 2DJIA 4PYOA 5LZ2A 1N2HA 4L78A 3AHJA 3ZQ4A 4UU0A 4E4YA 3DJFA 2H9YA 5JROA 3RADC 3HEAA 1NBEA 5HX7A 2DBZA 5KQPA 4ZZ3A 1IHPA 5ERGB 1RPZA 2FWJA 1OD6A 2B20A 4LXGA 3S5UA 3WMRA 3SOZA 3OTHA 1YU6A 3HH8A 1CUJA 3G02A 2PUAA 4MYHA 4X85A 4PC2A 1WF3A 1HZZC 2L82A 3OM8A 1E1KA 2QW8A 4YJKA 1H94A 3UG7A 1NC3A 4IBOA 1U6KA 3I01M 5DLYA 1GRQA 5K8LA 1H1TA 3Q1LA 5KOJB 2FFQA 3BXEA 2B0JA 1XYVA 4CMHA 1K5DA 5G3ZA 3AERA 4BNMA 1P91A 3HYTA 2J6CA 1TRHA 2YBDA 3EXHA 1ZL0A 1M7GA 3GN1A 4BO3A 2GHRA 2LGJA 1D0VA 2IUEA 3CH5A 5A4DA 3U17A 3JYNA 2A9KA 2PKXA 3Q8WA 3R9XA 1F2TB 2YVKA 3I6ZA 2BKXA 4ILKA 4J6EA 2D62A 4L27A 5I47A 3GEGA 4UUNA 4WVLA 5E9AA 2CFTA 3JWHA 5CT9A 2QRLA 1G5HA 3DV0B 3HA5A 4LQLA 3NJ4A 3IAEA 5DFAA 5DMHA 4TV8F 4YBZA 3RH0A 3ZU3A 4JJEA 1Z6TA 2RHOA 4MPPA 3WK8A 1OWMA 3UUFA 1Q17A 1C3JA 5BV8A 4RKRA 3UT5A 4EA6A 1ZVQA 1RWXA 3N2GB 1E2NA 2XD9A 1UMCA 5THQA 3ZGNA 3MOGA 2XNSA 4TLMB 1QWOA 2BN4A 2JFYA 3HJBA 1MPXA 2CUZA 3H3FA 4EP1A 4RDIA 3ILVA 2GARA 3IMGA 2CFRA 5HW0A 3CLRD 3WI7A 1N2CE 3U1VA 5IULC 4IMPA 1QQ5A 2F1IA 3N86A 4DB4A 2FVXA 3DZBA 2WKQA 4XB6B 1AQUA 3PXGA 1RPNA 1NVUQ 4MLCA 3QOFA 4PSCA 2GXAA 4GP6A 2QRKA 3E81A 4D9CA 1WOMA 4RFVA 5ARCA 3CXRA 4L85A 1UWCA 2Y2VA 4YI5A 1PEYA 4DAEA 1SN7A 1FVHA 3HPQA 3EXFA 4DY6A 3HI4A 1MJGA 1P5FA 2PEYA 3ND5A 3ROFA 2I3AA 2OD9A 4G36A 3T1OA 5B7QA 2AOXA 2LKDA 3KZOA 2ZI9A 1BH6A 1X9GA 2BD0A 3CEMA 4LWZA 3BYZA 1TMGE 4DJFC 1YFKA 1Z5WA 3TTUA 4C04A 3UK7A 1JU3A 1QP7A 2UV8A 1E99A 1RWVA 1CS0B 2E55A 4R4JA 4JU8A 4OGGA 4XASA 4B83A 3CVVA 1SJ9A 1VBNA 4DSZA 4YJGA 4ESOA 2I34A 4X1OA 3P27A 4RTQA 3R0VA 3H13A 1CZNA 5DBHX 5TE9A 1PQUA 1WJGA 1L9XA 2EEPA 3O9VA 4FNOA 5GVSA 4GC5A 2WQ7A 3AW9A 5IK2A 5CFPA 3ZKAA 5LOVA 2X4LA 1S8FA 4RV9A 3U4AA 1ECJA 3IUNA 3FF1A 3Q72A 3P4XA 4ZREA 3MJRA 3RK1A 2PUJA 2IUUA 4FWIB 1P1KA 3DOCA 2X5NA 1X7XB 4JFRA 4AMGA 5C7IO 2IY8A 1M6EX 4G0NA 4UBKA 1BHJA 3BILA 3P0IA 4M1EA 5L3RA 4DLTA 1EX9A 2QAJA 2ZKIA 1P81A 3IILA 4EEXA 5GJBA 2HK7A 2X23A 1EA7A 1NXTA 4IWXA 5DW0A 3REGA 2O3TA 1O9GA 4RZQA 3CUWA 1D1QA 1PR6A 3JASA 3MOIA 4TMTA 5IBRA 1UXOA 1R0ZA 2O2SA 1U5AA 2OV3A 5C1DA 5G40A 1T1IA 5E7IA 1DAHA 1HWYA 4HN4B 2PNJA 4JLUA 3TXXA 5A2QA 5JJIA 2C1ZA 3HSSA 4B74A 3CRW1 4ZI7A 3VO2A 1W6UA 4DNFA 1J07A 2FZ4A 1O95D 2L2QA 2JGEA 1RWWA 5JAOA 4LJ5A 3AQIA 4EDHA 1C0EA 1P61B 2A3RA 5A3SA 1S2MA 3SQXA 2E4WA 1NVVQ 1ZG3A 4GGPA 1HOTA 5C4MA 1B23P 2WSYB 4IXDA 4V38A 1F1BA 1Z6YA 3KCQA 2JFHA 3A6JA 2MMCA 3AUAA 4PGHA 1MOPA 3MJHA 1NURA 1K66A 1O1YA 1TKAA 2BFDB 4O5OA 4AAYA 2PJRA 2OHGA 3LUFA 4IDQA 5IFKA 2REBA 3FUTA 3VTZA 5M34A 1Q12A 2O2YA 3GV0A 3OHSX 4LUCA 3PQ3A 1FXUA 4CM8B 3D8SA 4H3VA 1C41A 1DTWB 2H3EA 2O1WA 1TQDA 4Z8XA 3RREA 2FY8A 1KPHA 3MWEA 4YQEA 3JVVA 1G7SA 5FFMA 4WNAB 7ADHA 2YFKA 2Q3JA 3AU8A 3BDVA 3F7OA 1WKCA 1HT3A 2BHTA 2XXJA 2OECA 3FPHA 3EQ7A 3JD2A 1GL7A 4GOXA 1P6QA 1B16A 1E5DA 5FOSA 3UKJA 2WDZA 1T2CA 3GFSA 2X0RA 4JP5A 3OZRA 2RC5A 4RS3A 1YJQA 1A4IA 1SMKA 3EC2A 3A2MA 3L8CA 1P8JA 3OECA 1IZ9A 3MMNA 1K0FA 3O82A 1UDRA 3FMIA 3CUYA 3PXBA 3PA6A 1UPXA 4RD1A 1NULA 4IQFA 1PL6A 4NHOA 4J3NA 1I14A 3WRVA 4HV4A 3AHCA 1FLAA 1QG6A 4F6CA 4DT1A 5K8TA 2FZLA 2EFHB 1GLNA 2GVZC 2RGYA 4LJLA 4MWOA 3UCXA 4W5NA 2VP4A 3LKBA 2YNMA 4CV0A 5IVPA 2V3WA 2NUBA 2V6FA 4TKLA 3RVDA 3ZDRA 1OU0A 4OK3A 4B5LA 2F3QA 3R3VA 4X1YB 1DFIA 1J7KA 3L0CA 4NNJA 5TS3A 8LDHA 5DN6A 3TCNA 2B1RA 3ZE9A 4KK3A 1I10A 1RZ3A 1X7YA 3DFMA 1JLHA 1QE3A 3I2YX 4U8GA 4B85A 5I5EA 4I1PA 1W5FA 4MYTA 4H9GA 1ZN8A 2RI6A 3VYWA 2FP4B 4ALJA 3QWAA 3F6EX 1JTFA 2R60A 1K5HA 3WYBA 1RHUA 5D3MA 2H54A 1OZ0A 3PGLA 5SY6A 2BFEA 4P3OA 5K6RA 1V2HE 3DAFA 3AV3A 1M0TA 3JQRA 3PEUA 3G1UA 1NKTA 2G5PA 1MAWA 1T2UA 1WXWA 3COZA 4PHCA 5F7JA 1WKBA 4ZPXA 1FTQA 2BMAA 3USCS 4Q7QA 2QRZA 2CVZA 3L4EA 4CMCA 5L53A 4RACA 5CD1A 3DE6X 2VK2A 2XTJA 4G5YA 1HTBA 1YMUA 3ANXA 3E7PA 3GHHA 2X1VA 5K3FB 3ZDAA 1AM4D 3A1FA 2RGNA 1ZN7A 5IDXA 2BTOA 3RTGA 4FB5A 3OG9A 5FKJA 4AQYB 2VKTA 4YRGA 1ZJ5A 1JSRA 2I54A 2YZ7A 3P4UA 4M0LA 3OI7A 1P7WA 1Q83A 2X76A 4RAOA 4TYPA 4MQFB 1Y5IA 5F2EA 3LC1O 1SG9A 3SZOA 5U4QA 1T6YA 2VPPA 5DVZA 3WOVA 3ZIDA 1K5PA 1FP4A 5C8YB 3I2JA 2C20A 3IAM1 3PVSA 3ZY2A 4B45A 2I2BA 3P0JA 1C9DB 5JBNA 2B92A 5D85A 3DLAA 2R1VB 5E6SB 1ZJJA 3AIIA 2OZPA 3FNRA 3GIDA 1UM8A 3UYLA 1TJ4A 1EX6A 4WPGA 1BMFD 1NQAO 2RHCA 3LIIA 3KQTA 4M8KA 4TZTA 3CZCA 1KZ7B 3GJ6A 5IASA 3VOTA 1M74A 3QFCA 5A6VA 3KKPA 2GWHA 1L0BA 2ZP1A 3PEYA 4AS3A 2YMQA 4X65B 2JBAA 3U81A 3PEWA 1MJNA 3QEMB 5HHTA 2Q5JA 2X3UA 1AOXA 2QGNA 4LXYA 1SEVA 1Y7TA 1NDQA 2ET6A 4PYQA 4YECA 4DIEA 1SVIA 4FGJA 1BIFA 4DREA 3O3MB 4B6SA 3CX6A 3K0BA 3P19A 5EJMA 4N47A 4ZAYA 2VPXA 2CMHA 2H7VA 4X92A 1SA0A 1WCIA 2C61A 4J16C 4NBKA 1O95A 2Q1XA 4RF2A 3NTVA 4LIPD 4CGYA 3B3AA 1TD1A 1FS4A 1PLJA 1R5BA 3O1JC 2GEJA 5IVIA 1N8KA 1FJXA 3N75A 2OVFA 3DL7A 5TQ2A 5KMGA 3L4JA 3SC4A 2EDAA 2IW3A 5KVVA 4CZ2A 2I7VA 1SC1A 4RU1A 2WIKA 4L50A 1MRZA 1T5LA 4D81A 3C3DA 5BWOA 1OGJA 2ZPUA 2PFKA 2YV3A 1X8XA 2Y6UA 3C3YA 4EG5A 1DKRA 3DWIA 4KV7A 4NYIR 5IJAA 3TSWA 4ALMA 3E3NA 1PS8A 4C78A 5B12A 1CUWA 2OGUA 2QX4A 4DV0B 1XQVA 3NBAA 1CY4A 4XJVA 4UAGA 2PUBA 1EUZA 2J59A 3BXGA 4ICIA 1KZHA 4ZV4A 1QHSA 5JZBA 4QUDA 2X6RA 1JMYA 4G26A 4C76A 4ZV7A 3KWFA 4PBTA 3OQPA 1PJSA 2Z3VA 1VKRA 2HSEA 2ZIAA 4YY3B 5JCOA 2QUZA 5LMCA 4E32A 4TXNA 2O7QA 3WB0A 1Y1QA 1DJQA 1HE4A 1M5UA 4P08A 4ALIA 4GI7A 1RXYA 2WMOB 1KO8A 4BGVA 2BBSA 2CL5A 5LYYA 1O0CA 1TVEA 3O8CA 1UT6A 2DFTA 4PLCA 5AJUA 3CSSA 3BZWA 2Q5QA 3QXSA 2ZM6B 3V1UA 1UOQA 3KOOA 3EZXA 3MXTA 2Q7OE 5AJHA 2GB4A 3C3BA 4PW0A 2F43B 4GKJB 2HNBA 2ZSFA 1G6KA 2HPZA 1MHPA 4WQMA 4X63A 3SE7A 4LFBB 2ODEA 4HDRB 1T6XA 2W6PA 3T0FA 1H6AA 3IRUA 4P34A 2C4VA 4ZQBA 3T7CA 1U7ZA 3NBZC 1JDNA 4BYMA 5IN4A 3QE9Y 2QRVA 5IKMA 1EFPB 3CKKA 4OG2A 3M83A 3VNUA 4YCCA 1ZW6A 2F90A 2N9UA 5ESDA 3K5WA 4JYPA 2PAFA 3HYCA 5CLGA 3MPUA 2CB0A 1BD4A 2GF9A 1OPXA 4MRPA 3SGLA 3UC5A 2QG4A 2V8OA 2ZWOA 4FYJA 2JEYA 1A4XA 1NGSA 2Q62A 3D7MA 4E5NA 4AKIA 1TM3E 1G98A 4TN1A 2OESA 1I30A 2PGOA 1ZZGA 2FKAA 3ETHA 4IS3A 4UE3S 3IPXA 2QUKA 4WL0A 5AVUA 5DM0A 1CEYA 1A3CA 4DADA 2RH5A 1JA9A 3DH0A 2CYBA 4QDKA 1GV0A 4H6WA 4P7FA 3U44A 1G20A 1NONA 2YV5A 1ZGAA 4GI3A 2W8BB 3FRIA 3SCZA 3SG0A 3ZQUA 5HSGA 3E9YA 1EZ4A 1DTSA 2A6PA 3CB4A 3IQWA 2P9GA 1AQLA 4FFMA 3DOEA 4PHFA 1Y8CA 3OA0A 1SZCA 4MITA 4NDNE 1H2HA 1R8JA 3DO6A 3JQAD 1EI9A 1SUEA 1Z2PX 2RHJA 1YQUA 3IA7A 1PGQA 3LD9A 4BX0A 4DNQA 2FRDA 5K6TA 2WVAA 1I4TD 1WMDA 4UHDA 3RFUA 4BB0A 3ZQJA 1G19A 4MCAA 2EJWA 1D9XA 4O4LF 3ZXSA 5M7EA 4FINA 1TZCA 5DLDA 2RHWA 4H6XA 3ESBA 2FE1A 1JQEA 2ATEA 1IG0A 3H6GA 3THXA 1V1MA 4M7RA 1O8CA 1Y9JA 2ZK7A 3GWGA 3GLIE 3F6RA 3MJ4A 1U2PA 2HA0A 1GR0A 2D5BA 1Y5NA 1JG1A 2D7DA 2GBCA 2R7AA 4F3NA 4GR4A 2DWPA 3EVFA 5HF6A 1DBSA 5FO1A 1QVVA 4N3NA 2PBRA 3I09A 3PS9A 4B2YA 4HAUA 4LTDA 3JAMA 1LEHA 1FFWA 4NCIA 1NQXA 1JUDA 1BMFA 1EUDB 1ZRSA 4IIXA 4PIVA 4QELA 1N5DA 2V8BA 2QU8A 4N8DA 1BJRE 1JV2B 1KO1A 1R37A 4XI9A 5EQJB 1GG8A 2PX3A 5GOZA 1P4JA 1P2UA 1QHHB 1TUEA 4CCSA 4LZLA 5IJ0B 2AG5A 4E1AA 3C8UA 3U5ZB 1JHUA 3JU3A 3MJFA 4KB5A 1Z38A 2QLNA 4WUTA 3THWB 1C7EA 1U3FA 1YBFA 1G4AE 2R6DA 4ZXFA 2R86A 1IONA 1XP5A 2AFHE 3ZNOA 1NOIA 4ZKDA 4I4TB 1E3EA 5CH5A 4ARVA 3W5BA 1UDXA 5LOVB 4LA4A 4UHFA 5EJ2A 4HWKA 4OOEA 5ALWA 5TMBA 1RIFA 4Y0NA 2I3BA 3KNZA 2V4MA 3U4DA 1P1FA 3FZEA 3KFVA 5DWVA 1Y82A 2BVNA 3SF8A 4X6UA 1AVTA 1SQGA 4IIYA 3OQMA 3GLGE 4HGYA 4D6PA 2IF0A 1U3DA 1E9BA 2WJAA 4C30A 4IGEA 4CPDA 4ZTZB 1CVIA 2ZLBA 2WAXA 4L73A 2PS9A 1E3SA 1CR2A 1GDHA 3GJ3A 3V8VA 1EB8A 4Q9AA 2QSZA 2XYGA 2ZR9A 4YI3A 3ROTA 3OSUA 5IM4F 1PP4A 2VT2A 4QYSA 2A94A 4RF3A 4Y2UA 2VDPB 1TYEB 2VTVA 4QYWA 5E1MA 1U3TA 1K4MA 1FVXA 4TUYB 5ADUS 3CWQA 2D1FA 2ZSAA 4CKBA 1CV2A 3ND9A 1XIVA 3EIWA 2OGTA 1PYOA 3HB4X 2H5JA 3KJNA 1JPJA 2G1KA 2GESA 4RJIA 1YZTA 3P2MA 1G16A 3BK7A 3ZBQA 3OQHA 3G79A 2VO1A 4FBGA 2REQA 1EHIA 3EDCA 3KJQA 3A6KA 1ZH4A 3RYCA 3H87A 3MTAA 1NY5A 2ONZA 4OUDA 1XVIA 4ITVA 3FR8A 3UG6A 2VTKA 3AP1A 3WYGA 4S35A 3CW9A 2WA2A 3M9LA 1I6MA 5FWNA 5KTKA 2VL7A 4Q1BA 3ZGYA 3VR1A 5DMXA 2O8CA 1JHZA 2CE2X 4HRYA 2J5QA 2P9TA 3PNOA 4KDCA 2X5KO 2VIIA 1CF4A 2G77B 3U7RA 3WJAA 3ZPXA 1WKVA 2G67A 1ZRMA 1NASA 3D0KA 3GLQA 1FXWA 1XXLA 4JP8A 4LCBA 4MUIA 3ANNA 3X1DA 3R6DA 4A7PA 1LZKA 3GJSA 5ENVA 4JY7A 3VR5H 2GI4A 5CLJA 1UP6A 1H9BA 2OCIA 2P4QA 1LA2A 4DDMA 3UAXA 1DX9A 1K88A 1VCNA 5F23A 1U3VA 4K9NA 4MULA 3GDHA 4AULA 1T9ZA 4DR6B 4RORA 3WR5A 1XZNA 3BFXA 3VR6H 5B5SA 1QIFA 4LOAA 4LDJA 4PO3X 4DCNA 4QFDA 3KE9A 1H9CA 2AG1A 2NQTA 1GFSA 3MAGA 3OQVA 3R6LA 3H0CA 4FMDF 3NANA 3ZY3A 3QXCA 1ZR2A 3TTWA 4IRUB 3BE5A 2BHNA 2VF2A 1ZIXA 1H0SA 2P68A 4GX5A 1YMVA 3IDQA 1GG2A 2H1WA 1Q91A 4QUJA 4R1MA 4JEUA 2GM5A 3PC8A 3TSZA 4D0GA 4R7ZA 5ALUA 5AJYA 1RAIA 1W88A 1CTQA 1A7AA 4QBIA 3T5TA 2ZZKA 3UAYA 3JQAA 3N59A 1G6OA 3G2LA 3CW2A 1N2OA 5SV2A 2C4TA 1TT5A 1EZ1A 3UANA 1T35A 5KSYA 3WAKA 2IPNA 3IUSA 3HVUA 2QEQA 1HA3A 3H4IA 2HCJB 3P9QA 4IGIA 1LRLA 1YR9A 1U28C 5LYJA 2JHAA 1DAKA 2J09A 2GJAA 3ENVA 4F7WA 1CQWA 4HQNA 5ILQA 1Q1ZA 1KNQA 4L5BA 5HZKA 3S8YA 2CSUA 1YE5A 1DIBA 2GAIA 2X0IA 3ELYA 5IKPA 4U0KA 1Y6ZA 3RSHA 2WV9A 1B26A 4JT2A 3OOHA 3DS8A 1HG0A 1A88A 2PPVA 3MUFA 2WWTA 1L5HB 4N48A 2N3ZA 4QVKA 1D5CA 3VO8A 2CXQA 1G8PA 2ZBFA 1QHFA 2POCA 4QYIA 4BO2A 2WIFA 2I80A 3DZFA 3LKZA 3JALB 4CMEA 4RVFA 1PGOA 1KK0A 4PFQA 4QOHA 4EG6A 2EKZA 2L69A 3ITDA 5CNMA 3QWBA 1X80B 4M0MA 1ZSVA 10MHA 5CIYA 2ANCA 4GX2A 5KNCA 4BNYA 2DQSA 3OZIA 4LRTB 4H17A 2PKCA 2Y93A 4UQOA 3QWIA 4NEGA 1G0OA 3ZGLA 16PKA 4KKXB 1V7QA 3D3WB 1RQLA 2ZRKA 3QFSA 3UXEA 4CEIB 3Q5GA 3QUSA 4C01A 2EFJA 2OXTA 1TX4B 1VLZA 2WU3A 1ZMOA 4MUMA 4Z0NA 1BVRA 1O4WA 2JIMA 3IEKA 4BB6A 3PFHA 4B3RB 3OCUA 5JYBA 1CDEA 1Q2UA 3JVEA 5HF9A 2VT6A 3HJNA 1SR8A 2R2GA 4EG3A 2JJ2D 3ZVMA 2J3MA 1GKKA 2HFJA 2CZGA 1A69A 3I42A 4BFXA 4X1IB 4UQLA 1ELOA 2W93A 3HUFA 3NBKA 5DJ5A 5A7GA 3L05A 3IXQA 3DBOB 1N6IA 4MVWA 1BMTA 3E9CA 1Q1QA 3IBFA 3H86A 4I1SA 4CLRA 1C81A 1QCYA 3MS7A 2CJFA 3ROKA 2AWNA 2HO4A 1NNLA 3HC7A 5KOJA 4BQNA 4DV7B 2V6GA 1URPA 3HKDA 4AKGA 1G8KA 3LCRA 3VPCA 2Y68A 1V8PA 1OU4A 2OGWA 2R1UA 3ASYA 3PRHA 4MW2A 1P4HA 5DBIA 3T5DA 3E9RA 1QV7A 3HA7A 1TI7A 3IUJA 1QX4A 1YL6A 2QMYA 2RK3A 3V1TC 2MTBA 2P40A 1JFTA 3HJCA 4IMRA 3G5MA 1F2TA 3SC3A 2IYAA 1N4DA 4ZQCB 1U4OA 1JHDA 3OOJA 3NHKA 2BHSA 3EFOA 5IWAB 1EP2B 3DV0A 2SBTA 5FFNA 1ZH0A 4GM0A 1JAXA 4O0MA 2QRUA 3U4CA 3H2JA 3NWPA 3QUAA 1HUQA 1YSCA 1BHSA 3QQPA 3GBSA 4BNTA 1DAMA 1RCUA 3I05A 3Q2KA 2ZUVA 3F4BA 3EGOA 3HJHA 5IJXA 3G0DA 4W82A 4YRZA 4AXXA 1PJ8A 2B4QA 3RAGA 4MAFA 1DADA 3ILYA 4UEQA 5LLDA 3MINB 1C7FA 4ZDWA 1Z4NA 1D2HA 2IP2A 3RE1A 1GYPA 2J3EA 5JLJA 3WIEA 1YV9A 2QM0A 4HTFB 1AMNA 1CUZA 5IYZB 4NS1A 1YS9A 4WY5A 4O5AA 5DM60 3ADOA 4TZ0A 1X7HA 4GPBA 2ODTX 3JRNA 4TV9F 1P4GA 3LVBA 1KWGA 2AEJA 2HA5A 2QZZA 4BECA 1W5AA 1WXGA 3I04M 3WMFA 1ZD3A 3A28A 4Q1CA 5BW5A 1ZGHA 1S8OA 3AXSA 3U4IA 1PEDA 2WDPA 1OLUB 3D8UA 4EMSA 4V1CB 5TSDA 1TAHA 2HMAA 1UMKA 2WF9A 4W9RA 3V8RA 5CB8A 3N0WA 1R3DA 3M8KA 1S96A 4PQGA 3X0DA 3Q3GE 1GOTA 4OIFA 1UKYA 2VAVA 2Q46A 2HWYA 3N0RA 4FDTA 1TA9A 1MD9A 4IV0A 4NH0A 3SSOA 3FDXA 4RHXA 5DP1A 3WL5A 2HU7A 4OP3A 1Q0ZA 3PU6A 2VYVD 2GNPA 2P2DA 4F6LA 1OLXA 4RD4A 3WDMA 3WMXA 4PVCA 2BP7B 3AYXB 1KDPA 4D02A 3WIVA 2ZUUA 4GOOD 4RHUA 2HJHA 2ORIA 3L8HA 3DAYA 3FB4A 4ZI2A 3A9CA 5H83A 1UZMA 2Q3MA 3DTVD 2ODNA 4TRMA 1YR6A 4W5WA 2JW5A 4ZVKA 4CMIA 1F9AA 1CW2B 3DD1A 1QHXA 3NI2A 3ILXA 3ONWA 5KCMA 3VKVA 1FY2A 3PEEA 4JJGA 2P4UA 4H59A 1VIAA 1R6UA 5JSUA 3N58A 3BE8A 3M4XA 2Y9MB 2YUIA 1GCIA 1NW8A 1EHYA 5KTMA 1QG2A 1UINA 1KHHA 2PQ0A 2GF0A 3C3JA 1YDMA 4XUGB 1MBZA 1OA0A 2X9VA 3ZZUA 4ZOBA 1L4YA 2YIJA 2ID4A 1IAVA 2X2PA 4RL4A 2X3FA 4E5UA 4W1RA 1W52X 2I4OA 1DOAA 4O0LA 4DSOA 3FRHA 1PT6A 2QZSA 3CA8A 1QFSA 4YMIA 3PGVA 4JENA 2XUHA 4XGNA 2H5IA 2QORA 4FC6A 5CUQA 7REQB 1Y3AA 3EA5A 2Q50A 4KDFA 3SKVA 2LDBA 1YK0A 2BR3A 1M2FA 5CBPB 4FI3F 1K68A 1RXSA 4MV4A 1IUPA 4WXPA 5HKBA 1A50B 3M6UA 3MTJA 2C4UA 4R0NA 2G70A 2QLFA 3DQQA 5BWMA 1YC2A 4N12A 1P5HA 4UM5A 1COWD 4DXAA 4ZTUB 4IH4A 5A9TA 5B3JC 1VFNA 2JJ2A 1JKIA 4N5IX 5FH9A 3AFMA 1P2VA 3UHAA 1RLOA 3D8NA 3I5MA 1V5EA 4G85A 3KM0A 2BFDA 1EP9A 3VC2A 1NMEA 4V3BA 4BN5A 3RC8A 2AG0A 2WF5A 3LX5A 4YYEA 3N5KA 2V5UA 4G67A 4TSRA 4EELA 2QUBA 1JAZA 1T2VA 3ICOA 1SVWA 2OBYA 1R4NA 2YICA 3BWBA 1MF7A 1R4ZA 5J9FA 4CM8A 1P2DA 2J1LA 4JI8B 4ZV9A 5M2QA 3MCUA 1EXNA 4JNKA 1WPRA 4D26A 3K9HA 3BHJA 1JIUA 3M5DA 1G60A 4WNAA 2UYQA 4OFWA 4R5HA 1UKAA 4E46A 1EWQA 4BZZA 2HOQA 3FOCA 4N65A 2GZAA 2G1PA 3NKLA 3M3PA 4S0XA 4TWAA 4F4HA 4EECA 2UU9B 2ANBA 5FUYA 2K7FA 2VRBA 4HGQA 3UN1A 1OE0A 1AGNA 3HP1A 3MSXA 3EUFA 3IT2A 1FX1A 3BCHA 3PCXA 2WU0A 4KLAA 4LZAA 5H5JA 4RABA 4B71A 1EWVA 4HNTA 2GBLC 1TNDA 2V59A 4JC8A 2VS1A 2ZT7A 4TLAA 3N76A 4PZ9A 1N32B 2ZPAA 3PFBA 1BX3A 2TMKA 2R11A 5GVRA 4A2PA 2AHOA 3GFVA 5DX0A 1C7IA 1GG9A 2NTVA 4LCJA 4Q66C 1ABBA 3OO1A 8AT1A 3PC2A 1TADA 1AQ6A 4WBNA 1XN4A 4HNRA 2FYTA 1K6EA 2ZAGA 1E2JA 1Z5GA 2PKWA 1NVAA 3ILSA 4X1YA 3VJKA 5LP6F 4E07A 3Q7PA 2IPXA 4XLZA 1TU4A 2H4WA 2QRHA 3E1KA 4IXNA 4B35A 2TMYA 2HBRA 2PMEA 3R3YA 3X1KA 3HEMA 2DJ5A 3B53X 3MS4A 4U7DA 1HKHA 2BSQA 5E3JA 3B7PA 2QD3A 3ORFA 4FBLA 1EGVB 2VJKA 4TKMA 3U7QB 1N0VC 2C7VA 1GU7A 4C4XA 5C37A 5H8WA 1M2HA 1TDJA 4XVCA 3OKPA 3JWEA 4KQ6A 1JBEA 1Z28A 4PRZA 1M54A 1RWOA 5EHGA 1VL5A 3GBPA 1BMQA 1G5PA 1ZESA 3CY6A 3I34X 2Z5FA 3K2BA 2YWGA 1XMIA 2HF7A 2DH5A 5K3FA 3GQBA 4U39A 3WLHA 4MQEB 1GZHB 2VYQA 4CTKA 3AEKB 4OLJA 2JLSA 1C1DB 2A78A 1D8TA 4MQFA 1YZVA 4OHFA 1PFWA 4MDHA 3ABIA 1KI7A 2VYVA 4J9VA 1IY8A 2PHZA 3IUQA 1VQ1A 4H4EA 3ZE8A 3MLEA 1NBHA 4MI1A 2DR2A 3BUSA 4DNOA 4MZDA 5DCYA 2BAGA 3RC9A 2HY7A 1N2ZA 3F3YA 4I08A 5JBQA 5JLAA 3UF0A 3S8EA 1L4KA 4C6SA 3PD0A 1OUMA 2B8WA 4H0NA 4P92A 5GONF 4BWFB 1LK0A 2J7PD 3CNOA 3F47A 4GDMA 3LOUA 3CRVA 5GY7A 5ITVA 2C83A 1X13A 4JH0A 4LPKA 4FU0A 5JXWA 3NB0A 4DV6B 3IRVA 1DKNA 2PZJA 3GP3A 4DY4A 4PONA 3GMIA 2QRGA 1H2XA 3QEMA 1XZ8A 2AV6A 2PS1A 2YV2A 3DXXA 4NZZA 3MBIA 4RJ2A 3BEOA 5ALRA 5IBPA 1H65A 1DT5A 4HGOA 4M53A 4CM9A 2CLHB 4YRBA 3PXUA 4CL8A 4N8SA 5A2GA 2XECA 1GZ6A 2IYUA 1RE0A 2ERCA 4UD2A 3VH3A 4D43A 4CTOA 3SLGA 4L4UA 1Y1LA 5PNTA 3BH7A 1BZYA 1I2ZA 1E0JA 3D5QA 3K8ZA 1FLVA 2AUMA 1SUDA 1H3EA 2XY4A 3Q11A 4EL5A 1LU9A 2QVZX 3SNKA 4YPFA 2C3PA 1IN8A 1Z6QA 4NMHA 5JZSA 2Q4EA 1Y9DA 4P3YA 3UTCA 5D5QA 2AW5A 4F5EA 1U4SA 1HK7A 1ISJA 5CNIA 1E92A 3KUDA 3QNWA 2IPAB 3C8MA 1UOPA 5EEGA 2VHUA 1QDEA 4E5YA 2I6GA 1COWA 4TWJA 2EVWX 2NP7A 4N0DA 3U7GA 1SKUA 2C9CA 4UM7A 3ZXXA 1E60A 3JZIA 3TINA 3AJRA 3H9GA 4C1NA 1NR5A 4NDAA 1SUWA 4JU9A 4YT5A 3TK1A 1YGPA 2F1HA 3PPVA 3KR2A 1T4GA 1I4EB 1EXMA 2PX2A 4MPTA 5IH7A 5TGTA 5D87A 2GCGA 4BDTA 4C6TA 1G291 1N3LA 2K7ZA 2SHKA 3AC0A 4Z2YA 2AOWA 5TJ9A 2GTIA 3WLTA 5IT4A 4O1MA 1T3GA 4FFLA 3E18A 4A4DA 1TA0A 3TGPA 3RIGA 1BD3A 1ONPA 2GR9A 3FY4A 3H5IA 2JK1A 3EZ9A 3H1EA 3JRWA 3LF1A 4S1NA 5KSWB 1YKGA 1OV4A 2EX0A 3DZDA 4O63O 4TVSA 5J23A 4JLDA 3O75A 5KX5F 3IIMA 5KTPA 5EMHA 4P3NA 1H6CA 4NG4A 1DO2A 1NW6A 3RS8A 4Z7OB 2XT0A 3K16A 1MP0A 3UJ7A 1DCMA 1L5RA 2CN1A 3N2NA 4RQBA 3WGHA 4NFSA 3WAGA 1KP3A 4UEKA 2ZSUA 3K2EA 2AFIE 2BFPA 4WNCA 4K0KB 4HDRA 2IZ6A 2PTHA 3QE3A 3CLTC 4IL5A 1KI4A 1S7GA 4CLOB 1XPUA 1KI6B 1JI3A 2C2GA 3AF3A 5BPHA 1KKUA 3H1AA 1VJTA 2E5WA 3V80A 4EKDA 1EFPA 2XKJE 4G0ZA 5M29A 1RABA 2XR1A 1XEFA 1BGWA 2HDOA 4MUJA 1Q84A 4HMQA 5AJZA 4JLAA 4EABA 1ZQ1A 3W5AA 1F8YA 4A0QA 4DXHA 3ROEA 5C8ZA 1KZ6A 2XCIA 1UZAA 1QVAA 1P9NA 2VXYA 3ISTA 2BSAA 1WZ2A 1QC5A 5IF9A 1GGNA 1XZMA 3QVUA 1PS9A 4ZYYA 5LQKA 4M1KA 3EXIB 4N3CA 3IE0A 5T3YA 4JLJA 1EM8A 2J9YB 1JHOA 3B1VA 3PR2B 4LDNA 3ZW8A 2HZ7A 3CEPB 3D7KA 5DSXA 4MICA 1ABEA 2UZ0A 2XB8A 3U48A 3FW1A 1QF6A 1GPDG 4G1MB 4R9RA 1J20A 1VBFA 1YA4A 3AUKA 4HQ0A 5BN4A 5DTIA 4NI5A 4GWKA 5KJ6A 5MGNA 1JF8A 3PLNA 3S28A 4C5BA 1Z7GA 1M8JA 2BGGA 2NU9B 1CZOA 3VFDA 3RSGA 1RKBA 4UHKA 4UULA 1KSGA 2C5EA 2FR0A 3OMXA 5FUQA 3B6MA 3K8OE 4H7DA 4RK6A 3WYNA 1UXHA 1VIDA 2P9QA 4AU1A 3P94A 5KNBD 1POWA 1S3IA 2WPNA 3MF4A 3JYOA 4I4IA 4B3GA 3WLRA 4EZIA 1R64A 1J33A 1QZUA 3CRQA 4HZGA 2GPYA 2V7XA 2ZJAA 4YGXB 3WJ2A 1UFKA 3S7TA 4BLRA 3GUUA 1V3TA 2P4HX 4ZU1X 5CVJA 1V8DA 5KTRA 4DDWA 4CR8A 3QHQA 2JD2A 1KRXA 4DPMA 1E2MA 4GH5A 4WADA 2UZ1A 1XQ9A 1HKUA 2ZIWB 4N0QA 3E5MA 1N6NA 2FMFA 5TX7A 2WZQA 2BZ1A 1YNOA 4I1VA 1ZICA 4TXHA 2QUIA 3GFGA 3T9BA 3UEOA 3FHCB 2DX7A 1JL3A 2BHLA 3OQ6A 5LA6B 5CIWA 2UDPA 4W7SA 1QHHA 4X5OA 4D46A 4PXYA 1AD2A 1YAJA 3P97A 4LE0A 5IJ0A 4HAOA 3KYDA 3OTWA 3HWWA 3DYVA 1HT2E 1YZGA 3IQHX 2KWIA 1R50A 4U2FA 3THWA 1EXDA 3F8TA 2BEJA 2VJCA 2ZAMA 2ZJ8A 3EZ7A 4I4TA 4MXDA 4M76B 5C31A 3MERA 3PXDA 4PN7A 5FWYB 1VLQA 4K9DA 3K6SB 4KR2A 1UJNA 1V6AA 3UJ6A 3GEIA 1QIEA 1NG1A 3Q5EA 3GT0A 2NZYA 5BVGB 3IELA 3H9JA 3OLWA 2NO9A 5AI5A 4DYHA 4FN4A 1PIWA 4PVDA 2GLXA 5DXFA 2BCGY 2FLWA 3ZH2A 1O0BA 4RESA 2ZYGA 3WWDA 3DP7A 3FMPB 3B8EA 4J8PA 3MWDB 3MK31 2G07A 2J3LA 3U7IA 4CF3A 5DSTA 4DBLE 2X2FA 4IVRA 3HXQA 5BV7A 3RT1A 2AZDA 3ZDZB 4M7WA 4C03A 2QTRA 1CIVA 2WAYA 3E3OA 4FX2A 4JQYA 4HSEA 5B6JA 5B7NA 1I5EA 1EWYA 4C7OA 2JRCA 3EVNA 3F90A 3FOWA 4B7UA 4UE2A 5JRDS 3KTOA 4I9FA 4KMMA 4RCZA 4KRYA 5I7WA 2I6QA 5ALTA 1XMVA 3C3AA 1F48A 1SGWA 3R3WA 2HDWA 2I8AA 3DF7A 5FQNA 3VTKA 5LNK1 1I7QB 2AUTA 5C7YA 1A98A 2ZR0A 3NIFB 3KQKA 2P3QA 1NMQA 2IPLA 2ZSDA 2NX2A 2HR1A 4N5LA 4M0DA 1F0PA 3BX1A 2DFNA 2JGAA 4OI2A 2NTYC 1AIPA 1BRTA 4JC5A 4V0ME 1PWYE 1BAPA 5AO9A 1N75A 4KN5A 4L8GA 4BAGA 3KQUA 1Y7PA 5JVDB 4DWVA 5IHXA 1QZXA 4WCFC 1H05A 3WXBA 2PIDA 2XGJA 2MU1A 4KDRA 3TI9A 3IULA 1G8SA 2ID9A 4FFNA 4L8YA 5GM1A 3RHFA 5AW1A 3NRCA 3ISVA 3QX3A 4G97A 1JBKA 2CHQA 4JLMA 1EE2A 1O6FA 4JLOA 2HKIA 3S5JA 5I01A 1ZUHA 2B4TO 3D4PA 4WEQA 3WQRA 4ETWA 3M49A 4MJLA 1T9CA 3S40A 4ZYUA 5KYVA 4JBYA 5LQAA 3IDAA 5LZ9A 4R7TA 4AZ0B 2XB4A 4Q24A 5CB4B 2RJOA 1IJEA 1DS6A 3UOAB 4YUXA 3EZGA 3LQKA 4LZOA 4O1IA 4Q3NA 2QTLA 2H11A 4D9FA 2H08A 2L17A 2UUPA 4QUAA 3HXKA 1QZ3A 2Y77A 3FAKA 2GPWA 3WKCA 2JAUA 4NYJQ 3S0JA 5E7MA 2GN0A 4ZO6A 5EXXA 5CAEA 1NLUA 2O05A 3TXYA 2W2LA 2XKKA 5AKYA 4JL5A 4GXQA 4R81A 3NDPA 1U8XX 3IVMA 4I46A 2HBZA 2R6FA 4GXRA 1BWQA 2BFNA 4Y9UA 1Y6GA 3DWGA 1W5SA 4BMCA 2OFXA 5EIBD 3DC2A 4ACBA 1Y1PA 2BH2A 1RYHA 2D5AA 1P6XA 4BGUA 2H1VA 3TTXA 2NOAA 1LUAA 5EWMA 3DMRA 3HQ4O 4HRVA 3ZU5A 1J39A 4DCJA 2EW8A 3C5CA 4OAPA 1D09A 1U7OA 4ZCIA 3K9WA 3OMWA 1PK7A 2JVJA 1VMEA 3NIWA 4BL5A 1U04A 2QD4A 4ZVOA 1MGOA 1JIQA 2O2IA 1AK2A 3AHFA 3KEFA 4J0GA 4QU5A 3LF2A 5DI3B 4FQ7A 1V95A 3UAZA 3K9NA 3PGJA 3VAYA 4DG5A 1JEJA 1QNLA 2C57A 4JS0A 4U4AA 4WK0B 1A5TA 3WBKA 3NFRA 1TCBA 2IX9A 4PNZA 4BQRA 4DMKA 3LCCA 1JBQA 3VZBA 3KT0A 2CLCX 2GZ1A 1OYOA 2RGBA 1MQSA 2WD7B 1NUSA 3G5UA 4MQBA 4Q3EA 3LS2A 2OORC 1KR2A 4RTMA 2P7HA 1AZTA 1FFDA 4R1OA 4N01A 3S2ZA 1GNTA 1PHPA 3EEYA 3A6EA 4MR7A 2W6OA 3DHWC 3H05A 5L7YA 4Z4CA 1EJ6A 1Q14A 1YASA 1XMPA 1E4YA 4INZA 5K0CA 1A9XB 4CMKA 2UUBB 1JECA 3AO0B 3E2PA 3NTRA 2OTCA 4BUCA 3U9SA 2GYVA 2WHRA 3W8NA 2Q6OA 1JDBC 4CT0A 1FVOA 5K4GA 1WAMA 3WX0A 3KVVA 3NH6A 3RROA 2NWQA 3NAMA 5KJFA 5EKUA 4O2BB 4WI1A 5K6AC 3DOUA 3HCEA 3G13A 4X7PA 1P6UA 4JBXA 3HYNA 3KEMA 2K87A 2XOXA 3IL2A 5DRYA 2A1UA 4FUTA 4EAAA 3WK5A 1WMBA 2PLFA 3LUJA 4LXUA 1L4LA 3EGIA 3LNTA 2YOFA 1ZM3A 3B6ZA 3GAMA 4MQLA 1Q77A 4N7JA 1S3SA 2MSDB 3MMPA 5D6OA 1C80A 4ETIA 4CEIA 1V16B 4F5WA 1XDGA 3TW6A 2WP0A 1QHNA 1MOQA 3TUIC 4QUGA 3IUMA 4TGLA 3ZVNA 1B0AA 1ML3A 4B09A 3GFBA 2BRUC 2CJPA 4K87A 5MGBA 3QEKA 3WOHA 2EC5A 4ETNA 3PK0A 3IQEA 1SIWA 2OCAA 4GRIA 4MMXB 3MJDA 4Q05A 2DCMA 3I1FA 1T5TA 5B4UA 1Y89A 2GEFA 1M2OB 1XALA 3IYLW 4IQ4A 4JR2A 4IFEA 4QQRA 3N1UA 4BMNA 1EYZA 1P9OA 1IQRA 2AR9A 2OAEA 2PZ8A 4MVJI 1B4DA 4N0EA 2QE6A 3K94A 1X7WA 1Y6RA 2H8GA 3VPGA 3TE7A 3VR2D 1ACMA 3ZZMA 1WULS 3TN7A 1K6JA 2WTNA 3FOAA 1SHLA 3DCJA 4KFRA 2FPIB 1E6LA 4IHJF 5JAPA 3DMPA 3OIYA 1KGSA 4LC0A 4E7PA 3ZLBA 4HB4A 2B4YA 2C82A 3QX9A 1E1LA 4EFLA 3LXUX 4RKQA 3HDGA 1R00A 4FUQA 4HNGA 1WVIA 1JFSA 4Y2SA 5T57A 4CODB 1N33B 3O0DA 2IH4A 2AEMA 3QVWA 1JZQA 2CJWB 2CZCA 2Q2QA 2UZ3A 3BGVA 4N5NA 3SX4A 4D99A 2YOGA 1MN6A 3EAFA 3QU2A 4GHWA 2DUUA 1KRWA 4ZIRB 2GMWA 3IUYA 3L4SO 2AQIA 4DWWA 3QI7A 4I2VA 1ADGA 3AEYA 1LPAB 1CK4A 3IQZA 4YWHA 9ATCA 4TYNA 1ECGA 3DLCA 3MINA 2YHIB 3OCYA 4AY2A 4QTXA 3GU3A 4GKVA 2ZJZA 1ZD5A 2DR0A 4DXDA 1MEJA 4I3HA 3RWMB 3MGAA 5IYZA 1MB4A 3FTPA 3JVIA 4HD8A 4P4NA 4NU8X 3SAJA 1FNNA 1XVLA 7ABPA 3PC6A 1Z4JA 4RKWA 2B2NA 4H16A 4GYJA 3WO1A 5BRJA 2EBWA 4RULA 2Q41A 5A4IS 1FP2A 3ZWPA 2JLUA 4V1CA 1F7UA 3U4QB 3U6KA 1IATA 2SKEA 3ELDA 3PEVA 3HI6A 2O5CA 1QO0D 4CF7A 5E6UA 4JUBA 3HADA 3TJZA 3DCYA 1EFUA 1M5TA 3KPUA 2IYYA 2X4GA 3AVWA 1XWWA 2PYDA 4Z0PA 4B9EA 5LZ4A 1Q3TA 5AOCA 3HRKA 2XADA 3FDIA 4P4TA 2NSJA 5HQJA 3MUOA 2ONJA 3VO1A 2QU7A 3IE1A 3I6MA 1HRDA 1WL8A 3CUKA 1RPTA 3URMA 5A5GA 5LB2A 1WS6A 2CDBA 2ZUSA 3G1TA 2FN4A 4QYMA 3PB3A 2BP7A 2JLWA 3T99A 1QUFA 5BY2A 2QP4A 1T15A 1SVMA 2FETA 4HQLA 4HWPA 5BR8B 3FDZA 4PYKA 1JDPA 5ITSA 4IIBA 2PRJA 4B2PA 2I99A 2ZYRA 2D2EA 4MUXA 2VJYA 2WT4A 4G5RA 4GM4A 3RDPA 1FQWA 3RRFA 1F51E 2WIBA 4L4ZA 5EMMA 5F1PA 5EXSA 5FBLB 5JEDA 5THXA 3CZAA 2GUWA 4OHYA 1GPMA 4NJMB 2JHPA 2QPTA 4GSLA 4L7QA 4BGDA 1T5HX 5CB6A 5BW6B 3EE6A 5BMVF 3N8DA 1QIHA 1ZISA 2OHXA 2HPAA 4O1HA 2GCEA 4MKGA 3INYA 2JFVA 4M37A 3MT8A 1SKMA 4ZHQB 1RI3A 1LSJA 4M8IA 1PX0A 3O03A 1SVSA 1PUIA 2JRLA 3X44A 1ZJ6A 1MW9X 3BHNA 2X9GA 3VMFA 2WTAA 3SIPA 3EXAA 4ZK6A 4J90A 1UAYA 5ICCA 4YNBA 1DQSA 4HUTA 3Q1KA 3YASA 1HH4A 5FOUA 3Q3CA 4LCEA 3L1UA 5J4LA 2PBLA 4KV9A 4S1WA 3ZHZA 3A2LA 3KKZA 3QWHA 1Y8RB 5ULLA 2KBEA 1DAGA 1OTHA 3I2GA 1WX1A 1A0OA 3NHZA 2IU4A 5EL0A 3L7MA 2RIRA 1U5BA 4U9IS 1Y3HA 4ZGGA 1D9ZA 1JHXA 1D2AA 3HXMA 5FL7D 3A1CA 4RA6B 1RFGE 2I22A 4RVCA 1HT1E 2AN9A 4G0YA 3WWEA 3MW8A 4M88A 1XNJA 5GAJA 3NW9A 2CDCA 3O8RA 2XRYA 2B4AA 2QL6A 3ECAA 5AW8A 2PQ6A 2GN4A 3G49A 1V2GA 3OA2A 3UO8B 4AF7A 3EF3A 1PZHA 2P9FA 4DLUA 1EDDA 2WU8A 4AZ3A 2QYOA 4F4DA 1IVSA 3E9DA 4IIJB 5IN5A 4BNZA 2BOVA 4KXFB 2V7UA 4RENA 4WCFB 3KUXA 4ME6A 5AJXA 4BATA 3GG9A 2WYHA 1A5ZA 4OU4A 1PYGA 4ROSA 6REQA 3COPA 4LRSB 5ALSA 4F1KA 2VNSA 4PNHA 1JDUA 3NS7A 1C9JA 4YP1A 3UENA 5BSRA 5JPCA 3RVJA 3VOSA 5DZSA 4C88A 5I3CA 4P7GA 4ZYVA 2VKQA 4GLLA 4GGMX 5AXBA 8OHMA 2HIGA 1NLMA 1UXGA 1NFFA 2FPUA 2ONCA 4H3HB 1TQ8A 2Q4RA 1KA9H 2WUFA 1VHJA 4S1OA 1M2VB 1NBME 1R6BX 1V0JA 1EGQA 1KFBB 1WDLA 2HGZA 2PY6A 3OEWA 4FD2A 1DJNA 3TIGA 1VP9A 2WABA 1NAIA 2FV8A 2JF0A 2VJPA 1QGYA 2HSGA 3ZU2A 1GNVA 4Q7EA 1DI0A 3HE3A 3KC2A 4LOKA 2I2FA 3LX6A 4TS4A 4EHAA 4PINA 4ZZ2A 2P9YA 4MB0A 2AXNA 2IHJA 2EZUA 2FMIA 2FSGA 3HKCA 3O2JA 4FLMA 4U6QA 4RZ2A 4XYGA 5HJEA 2ZT8A 1Z0DA 2DC1A 3B6IA 5EHXA 1Z7EA 3L7NA 1OWLA 4IV5A 1L5KA 2ADOA 1GSAA 4H1VA 4JLKA 1E77A 1U2TA 1MAHA 4YJFA 4FJ0A 4LX8A 1ECLA 1QYDA 2BGNA 4W9NC 1NIPA 3HCPA 1C8VB 4GZ3A 4QBHA 2DWUA 4PE5B 4BZXA 1Q22A 5E9WA 1MKYA 2QVLA 5B2FA 2HMUA 1H2RS 4EATA 4CQMD 4P7BA 1RI1A 5JH7A 3AP3A 2VUTA 1D0SA 2FW6A 4BFVA 1QOQB 1HDEA 3GELA 1MT3A 5CFRA 1SK8A 1G4UR 1XJ5A 1GTVA 1RWBA 3C98A 3U7QA 1KO4A 4KE9A 5HKAA 2PUEA 1ZNXA 4GMXA 3GH3A 4FHDA 4A26A 1NW3A 3RV3A 1XAHA 2AN5A 3FUCA 3WV4A 1O96A 4Q4AA 1WV0A 3LPMA 2J9FA 2PSSA 4J76A 4RF5A 4B3BA 4WK6A 1QO0A 2WHPB 1IRXA 4UHBA 5BURA 4CTJA 2WAOA 3PFCA 3WHLA 2NT4A 1ZHFA 4PPYA 4B2IA 3ENQA 3UW1A 1KWKA 2YWDA 1N2CA 5AICA 1DQRA 4H6VA 1AC5A 2PUHA 3P32A 4MQEA 1BWSA 5FWDA 3AEKA 3P9RA 1QFXA 3N3BC 3U44B 3MRVA 1L8QA 1T3SA 1R2QA 2NO4A 4C4YA 5D6NA 1JAHA 4PQEA 1YRQA 2BBWA 1P0QA 1W85A 3AKDA 2KE5A 3ABZA 3F1KA 1CG6A 4MWCA 5AXAA 2IEBA 5T67A 1PZNA 1TT7A 2X58A 1U9YA 2HMVA 1IZ8A 3C3WA 3CT6A 1VL1A 3JQCA 1BWPA 4B7CA 2MIIA 1XJQA 2C96A 3ZWXA 1G6Q1 1JDBB 2QTVB 2WYUA 5ALLA 3W1WA 2W4IA 2ZSEA 1GR1A 4B81A 4YRKA 3DDSA 2R8OA 2P62A 3FZQA 1EFRD 1PK9A 1EDOA 1G2QA 4G07A 5KNLA 2V6JA 4HQ6A 4IW3B 4W6ZA 4J94A 4RTJA 2G7MC 1L3CA 1NI4B 5H02A 2O5RA 5JSYA 5DIFA 3BL5A 1KTVA 1YB5A 4IHKA 4IIEA 4LYHA 4UD6A 3UUEA 4WINA 3RYHA 4PSKA 4HEJA 3W4IA 4AG5A 1KVUA 1YR8A 2C1XA 3E35A 3OWHA 4TMWA 3UPTA 2V4ZA 5TEWA 3KKMA 2ES4A 3VPHA 1M34E 1A9PA 4TS1A 3O4HA 4ZYWA 1HL7A 4IVQA 3SJUA 3ZHSA 3E0XA 1C8BA 2UYCA 1AS2A 1JQKA 2GYYA 4CFSA 2KPOA 2VQDA 1U31A 1LRKA 1EK2A 2ZR7A 3KDSE 4KJXA 5ALJA 3LDFA 4ENTA 3WTCA 2UYOA 4R9SA 1DRWA 4E03A 4YRLA 3CJTA 4IDFA 4E6EA 1AE1A 1VHDA 4CF6A 2VN8A 4EJSA 2IYZA 3O4FA 4JP2A 5E7QA 1D2MA 4WDRA 5FL7A 1H66A 3P0HA 4EW6A 5IARA 5DYTA 1AHPA 3OZXA 1QH8A 3JTEA 2ZQ5A 3JZDA 4I2NA 3C3PA 3D2CA 1QGUB 2HNKA 3DKPA 3ELWA 2C8KA 3HLTA 4RHTA 4C7MA 3BQNB 2ZRNA 1Q44A 1ODFA 2W71A 4M2LA 4MX8A 4XZ3A 3I6BA 2D1QA 3IMFA 2HBQA 1E2KA 1JHRA 1ST2A 5EINA 3WMGA 5KNBH 4QZVA 1OZAA 4QXRA 4UBMA 1PDVA 1V7ZA 1MW8X 3INNA 3C5HA 1SHJA 4GIBA 4GZ6A 4CCYB 3LWDA 4QUIA 4C3OB 4KIWA 2FN9A 3X1XA 4DBLC 1P60A 5FUMA 3VR4D 3ACBA 2ZDQA 3TJRA 4IMIB 1DINA 1KI9A 2VJMA 2HBYA 1X1CA 5J2UB 1X86B 3SF0A 3R1IA 1XQXA 4BEJA 2ZI3A 1K7YA 1K2WA 1XCOA 3P9CA 3QU7A 1XRQA 4GOND 4JI0B 3L79A 3VSEA 2QLLA 3E7DA 4NCNA 3WFJA 1SU8A 3E9NA 4N54A 5TARA 1U2GA 2NPIA 1TCAA 3E03A 2G76A 4IKEA 3RLIA 1IL0A 3GCWA 4KU4A 1N8TA 1NRWA 4WLEA 2QY9A 3ZV4A 2HCBA 4AT1A 2XDWA 1QRDA 3N2KB 3P0FA 1Q5PA 4E5SA 5LR6A 4J1SA 5JZMA 4M0KA 5FI3A 2LCIA 5HKOA 5JPIA 1OA1A 4CQMA 3G8BA 1OYWA 3IKVA 1YH3A 4BZPA 3IP5A 5AVZA 1UH5A 1K2VN 2OOSA 3KU1A 4NBLA 1M7HA 4R1NA 2LRHA 4EARA 1XNQB 5C32A 3VU8A 1DXQA 2G8NA 4MW4A 1UFRA 3UJDA 2H2IA 1V7CA 4P1ZA 3KVRA 4BO9A 4AKSA 3DDOA 2M6SA 1KAGA 2O3UA 3S3TA 1NF8A 2O0KA 4EGCB 1AG9A 2AI2A 1BN6A 1OAOC 2WB2A 1S02A 3EULA 5DHAA 3NVKI 5C5EA 3FIJA 3HVJA 4RY2A 2YRWA 2Q1TA 5B58T 4YMUA 3M6AA 1J06A 5FV7A 3U3MA 4RIFA 4P3XA 1YRWA 5JFOA 3CEHA 3SBDA 1G41A 4JSRA 4GLJA 2HWKA 4RK4A 1YVPA 5JISA 2QQ5A 3EJ6A 3NFYA 1ILWA 1E58A 3NR2A 4I6EA 1NYQA 3IJPA 5CW2A 3MELA 1XLVA 4ZRNA 1PSZA 2P91A 13PKA 3IX7A 4K6HA 1SVNA 1JDSA 5A0FA 3SDZA 3G7UA 3ZV7A 1PTJC 3IV7A 2G28A 3DOOA 1SOMA 3L6UA 4PANA 2BKEA 1SCQA 5CHEA 1S6YA 4YMHA 2XDQB 1EFRA 4LVNA 3BZUA 2MR6A 4MVJF 1EB9A 3CRMA 4YAJA 3PHJA 3RRXA 2AMFA 3OPQA 1XEWY 5K3EA 5K8UA 4RHFA 2GD2A 2RJNA 2J07A 1DAPA 2G9RA 4BP9A 1L5YA 3MJVA 1X1TA 2RHDA 3ZXIA 1KERA 2YRFA 3K31A 1A5SB 3KJIA 4LRXA 2FWAA 3GFOA 4G4JA 3KAJA 3W6ZA 3ZCPA 2AOUA 2GFIA 2GO7A 4DMGA 3K6SA 3ZWQA 4B3DA 3G2HA 3JYHA 4G8JA 4TWRA 4WZAE 4ZZ1A 2BFFA 2YXDA 4QX6A 5HBGA 3TQSA 5JSHA 1ZGZA 3IC5A 4OLBA 4RZUA 4J2HA 3O2NA 4HZUB 5EZYB 3EGXB 1SEPA 5TJHA 1ZMRA 5CCEA 1BE6A 1P0CA 2H1IA 4KO1S 4MVJM 1XJ0A 4Q3KA 5HS6A 5B3JA 5EKTA 5DNWA 3RUFA 2GEKA 2ZYIA 1IQUA 2GLUA 4NULA 4FR2A 1EFVB 1OOEA 3RBXA 3SYNA 4DMLA 1HDOA 3W05A 1XA0A 2QI9C 5LDGA 2HF2A 1U2SA 3VC3A 3J7AC 4KR6A 1F4LA 3EFHA 4NG5A 1ZOIA 2AYZA 5TGDA 2D0PB 1FBNA 3EVEA 3NO4A 1EVJA 3MOSA 3W79A 3ZKWA 2NNWB 3NORA 1GPUA 3H7IA 2HRZA 4UDNA 3OQIB 1E6EA 1QHIA 3MMSA 4F38A 4ZYTA 1N77A 1FRZA 2FPRA 1RQXA 3GPIA 3PE4A 3AR5A 4G89A 4RA9A 3HHPA 2G0AA 5AFSA 5BOSB 2IBTA 1E6KA 2DBRA 1OI2A 1KI3A 3RFCA 3U13A 5EAIA 1YDFA 3BH0A 1DCTA 4KQ1A 5J59A 4AMVA 4PX2A 5B1HA 2ZIXA 1X7GA 3FUXA 3IBSA 1B42A 1GYRA 4L8VA 3U26A 3O8BA 3LAWA 1KPIA 2GBLA 1WP9A 3CZQA 3J7TA 3KQYA 5TF0A 3NC1C 2RH8A 3C1UA 2NADA 3VR4A 2ZM5A 4TKVB 4DTCA 4ND7A 3RVQA 4K8RB 1MB0A 2VDMB 1I1OA 1X15A 1LJUA 3QE4A 4BFWA 3MYRA 3L7LA 2CLLB 2PS3A 5LQSA 4DCMA 3AINA 1RYFA 4WEOA 4URVR 5CT5A 4HBZA 1WHSB 3N6VA 3I1YA 4DDHA 4G0MA 1VZ3A 4Y1RB 1ODIA 1L6RA 1A7KA 2OOKA 2QAGC 2WWGA 3EG9B 4KLRA 4U63A 3DOHA 4WUVA 5EZ6B 5J2TF 5CB4A 1XMOB 4MPDA 3NHAA 4F84A 1KZYC 4G4GA 4MIEA 4XIYA 2H1HA 2XZDA 4S1VA 3N9IA 1LW7A 1U2DA 3O94A 2HA3A 4HDQB 1VYVA 3GVIA 4CMBA 2OCXA 5L7WA 1PJQA 3EIUA 1NKVA 3I1JA 5G1PA 2XHZA 4FFBA 4TROA 1XDZA 3NDIA 1LI4A 4L5AA 3HGTA 4AZVA 4O2AF 4LNUB 1YZYA 2PJDA 2YQ5A 3EOBI 1RXCA 2HT6A 2RGGA 3D6HA 4FHFA 4LBZA 2PL1A 7GPBA 2XLCA 3DM5A 4DLWA 1TM5E 2Z09A 3BM5A 2B35A 1K6XA 3HYSA 4MGYR 4BLTA 1RIIA 5HGXA 4BRSA 3FDFA 5J63A 4R9NA 4ER0A 4L9RA 5M04A 2Z98A 1WTAA 3FCEA 2C31A 5DGHA 2Q6KA 1I7DA 1O94D 5CDTA 1MG0A 3AF0A 3CKLA 3QXJA 1U7HA 3KLMX 2D2VA 2O20A 1S3FA 1TK3A 4RH1A 5ETJA 4UBNA 1QYXA 2HX1A 3T15A 3OJWA 1PFVA 3R4VA 1H8HD 3FNBA 3Q7IA 4BZQA 3HUEA 4FIDA 3DFIA 2WD8A 1IBRA 2QVBA 4LV6A 2FCAA 2ZIUB 4IHAA 4E1BA 4YP6A 4EW1A 3B3FA 3H8VA 3O4GA 3MHTA 4Y2VA 5NULA 1BOOA 3ADBA 4EBBA 3EGCA 3LL4A 3TDMA 1R0YA 1A9XA 3I8XA 1J56A 1U3GA 4M98A 3TUZC 3F98A 2AK3A 1G21E 3ZHQA 1Z63A 1PWZA 3DKVA 3IBTA 5HTOA 1O9BA 1II0A 1ZEJA 3RV4A 3TRDA 1N5MA 3DL2A 1I01A 5BYKA 3AR2A 3ETNA 2Y1GA 2YC2C 5FAXA 5FB3A 4YJ2A 1QV9A 4KGDA 2B9VA 3GLIA 3WLAA 5KCZA 1H2ZA 2FK7A 4WD3A 2XUOA 1SKYE 4GR9A 2AEFA 3K4PA 3FTQA 4RE6A 4RY9A 1SIUA 5G02A 3LWBA 2Q7XA 4PV7A 3BXFA 4KR3A 1MXFA 4NECA 3ODPA 2XT6A 4II3A 4OGFA 5EIAA 3PX7A 2DQKA 4M9CA 4N82A 5DO9A 1CKEA 1RRKA 2CHGA 3KR9A 3A4LA 1V16A 1CFZA 1OI3A 2DULA 3E5RA 3KJFA 4JI1B 2IZ1A 2V5VA 4ADSG 4CUKA 3EDOA 1UEJA 3PHGA 4TTSA 2VQFB 1NBAA 1XROA 4XDGA 1O3YA 4YUVA 4PC3A 1MNQA 1NI5A 4ESEA 3ZHRA 4R7GA 1FU8A 4O3MA 1REQA 3PV0A 3TMKA 3CUVA 4Q82A 1OQAA 2PXCA 1OTYA 1W19A 4K2HA 3C45A 4PRLA 5DWDA 4CKCB 1MC4A 1M2OA 4R3NA 1NJ2A 1P62B 2E4VA 2VWQA 4U6NA 1ILEA 3CX4A 4MRMB 1QQTA 3SQMA 3V8EA 4B6JA 4EB6B 1Z0AA 4DQDA 1LW6E 4PZYA 1IJBA 1W49A 4KR7A 3JZFA 5ELLA 2BTQB 4BJ1A 4Q12A 5KWVA 2XTZA 3OCVA 4K88A 3OIFA 2X19A 4JHXA 3ZXUB 2PGJA 4AXBA 3GQVA 4D3ZA 5L4SA 5IT9A 2ETXA 3R0QA 3EXG2 3N74A 5JY1A 2I29A 1WMEA 4HWTA 4IVPA 4LS3A 1PGJA 2YCBA 4AD8A 1UWKA 1FRNA 1RJFA 3GZTB 2OXFA 3ZK7A 5BORA 1BXZA 3GJXC 2UAGA 3QM1A 3HCWA 2BBTA 1MDBA 4EJMA 3QVVA 1JALA 1IY1A 2VBCA 4WSOA 1G63A 3TMAA 4ZIRA 1APBA 3TIVA 1UDAA 2IYQA 4HNHA 1JEEA 4HTAA 5G0TA 4DCVA 3NTQA 1VLLA 2PUDA 2O0LA 4RYLA 3WA7A 1NTRA 1LVGA 1YQDA 1Z6AA 2EATA 3C5VA 2YHIA 3L7JA 3K35A 4DMCA 4EF4A 3CLHA 1UIRA 2ZW9A 1LLQA 2B3DA 2Z8YA 1C30B 3OX2A 1ZUNA 2QZ9A 1C9KA 3KQVA 2Q1YA 3KR1A 2ZI7A 4FPXA 3W2EA 1FX0B 2ACEA 4X90A 5SZKB 3A70A 3T61A 5JRZA 4W9MC 3IBGA 3OJFA 1NBOA 2O3SA 4B7ZA 1OFHA 6CHYA 5AK5A 4INOA 1TTQB 1XTIA 3AEQA 4C0KA 2OP1A 1XPJA 5T6BA 3OQBA 1OH8A 1UPCA 4JR1A 1NFRA 2W58A 2W48A 4O4JB 3LQQA 2OM2A 1CUIA 9MHTA 1NNSA 1IHDA 1THGA 2W2KA 4B82A 1O87A 1KAHA 4G2NA 4X8HA 4TVBA 4C07A 2WKWA 2XCOA 4H1TA 2XCLA 4KQ9A 1WUHS 4A8JC 2R48A 1CJSA 1W0KD 3CO5A 4NAHA 5I7RA 4KFCA 4L7VA 4F06A 4DDKA 3HY6A 3TBFA 1O94A 1U8ZA 1L8OA 1KXJA 3U5TA 2C8JA 1IDOA 4Z9AA 1TJYA 3PD1A 2XZOA 1Z6ZA 3W77A 3E82A 4GRAA 3QBJA 1I0LA 4WHMA 3WC4A 3DDUA 2AR0A 1H8HA 2JD1A 4ENUA 5C4IA 2R6ZA 5KTTA 2XNDD 3IQXA 4XJTA 3TDNA 4RTKA 3AUTA 4LSWA 3GWZA 5DGXA 4TSFD 3W8FA 3VPXA 1N4AA 2FZWA 2V45A 3BHMA 3VJLA 4DR2B 2PH5A 3KXKA 1A95A 5K3AA 5SICE 3T9AA 4EI9A 3CVOA 1DHTA 3VNBA 2PLNA 4UVHA 1YJ5A 4TL7A 5FPTA 4NFHA 4JOCA 3F6CA 4I81A 3PA8A 3AFOA 3QPVA 3IHWA 1CC1S 4TS3A 2ECOA 3ZD6A 1DQNA 3IKTA 1DIHA 3BD8A 1GT91 1NZFA 2TECE 1FFYA 2FG7C 4Y8VA 5D3ZA 3S44A 1KQFA 1R4AA 2V7TA 3TW4A 4ZHQA 2PO7A 5FNVA 4EHIA 5JO9A 1XTKA 3ZZNA 5EZSA 5ES3A 1O6CA 3G0BA 5LL6P 2PM8A 3D4BA 3G5LA 4KWIA 2PSFA 1NXSA 4XGIA 4DQKA 2NUPB 5IZ4A 1ACLA 3JATA 4C43A 1N6KA 1Z39A 3STVA 3OBIA 2XEXA 3D0QA 4DRXA 4N6GA 5HQ3B 1HG1A 4DIDA 4GL2A 4ES6A 4F5YA 3WNQA 5ADWA 4CVNA 3QEJA 4X7BA 3P20A 4JSTA 1E5VA 1T4BA 1Y8RA 2FZKA 2YXBA 4FEEA 4LC1A 1L7QA 1XTQA 4Q9HA 3QMMA 5F4ZA 4AJ2A 2B98A 4E09A 4EG8A 2XWPA 3FTNA 4Q01A 3V2IA 2G9ZA 4P9NA 1RI2A 221PA 2N1BA 5EEHA 3CUUA 1Y63A 4EGQA 1RRCA 1BROA 5L45A 3ZJUA 2QYSA 3UJNA 1GTZA 3H19A 4YCAA 2C04A 3MT7A 4M7OA 3PGA1 1TF5A 2UUAB 2WWHA 2M9MA 3KT6A 4MH0R 5JR3A 4TRNA 1QGZA 3T54A 1MENA 1H5QA 4QAQA 1HQKA 3IT1A 2Z5GA 4IDCA 2EAUA 1NSTA 2ZIFA 3S81A 1CB0A 1L7VC 2DKNA 3IAS6 4OVKA 4WCFA 1WSBA 2WTBA 4O02B 3H75A 1CNMA 1A9RA 3BKXA 4G63A 3RF6A 1EIWA 4Z54A 3WLEA 1S4MA 3OTIA 4BU0A 2GPAA 5F5XA 4BGIA 3OIDA 3OFVA 2AXQA 1J42A 3DLIA 4EEKA 1UK8A 2I3GA 2ZRLA 5T3UA 3LIPA 4YUYA 1X38A 2IFTA 5KWJA 3NGMA 1L4FA 3A6FA 5F7XA 2QAGB 2E21A 1PGPA 3FBWA 4R54A 2GTPA 4NBVA 4BU1A 5KWSA 4EMBA 5DXJA 2HJ9A 4IEEA 2G5GX 1K92A 4M38A 4N4AA 4YH1A 4A15A 4BKMA 1P77A 3PNQA 3AIMA 3I0NA 2DKOA 1U1IA 1OIWA 4YA6A 4ZT7A 3WTBA 4ED9A 2GHQA 1KARA 1PBTA 2QENA 1FYWA 3A7EA 2A5FA 4NZMA 1CY7A 4M0PA 5JSQA 2PRIA 2ZWMA 2Q5IA 2OLKA 4I5EA 1K9VF 2VCHA 1X77A 3JQGB 1M0SA 3CKYA 1XRMA 2J4DA 4MR9B 5KYYA 4KNWA 4K9SA 4RXMA 3DCNA 3TCKA 4OY3A 5KJ1A 2C5SA 2OZVA 2VDRB 1UR5A 3FOEC 4MW9A 3GGOA 1AKUA 4HB2A 4NBRA 3QTBA 4OHMA 1T6ZA 3ENWA 4PC1A 2DMRA 2W6JD 1TXGA 1OB5A 2ZAYA 1LBQA 4ZOEA 1UZNA