3BRQA

Crystal structure of the escherichia coli transcriptional repressor ascg
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
275
structure length
271
Chain Sequence
TQTLGLVVTNTLYHYFSELLFHAARMAEEKGRQLLLADGKHSAEEERQAIQYLLDLRCDAIMIYPRFLSVDEIDDIIDAHSQPIMVLNRRLRKNSSHSVWCDHKQTSFNAVAELINAGHQEIAFLTGSMDSPTSIERLAGYKDALAQHGIALNEKLIANGKWTPASGAEGVEMLLERKFSALVASNDDMAIGAMKALHERGVAVPEQVSVIGFDDIAIAPYTVPALSSVKIPVTEMIQEIIGRLIFMLDGGDFSPPKTFSGKLIRRDSLIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the E. coli transcriptional repressor ascG.
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulator ascG
total genus 80
structure length 271
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3brqA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3brqA01
3MMNA 4MQFB 1U8TA 4RS3A 1RZRA 2PUAA 3N0XA 3RVKA 3SY8A 4YLEA 4F3TA 3LUFA 3K9CA 4JB2A 4MYRA 1CHNA 3A0RB 3IP5A 1RPJA 1FFWA 3URMA 3H6GA 1K68A 3RH0A 3O2SB 3TO5A 1USIA 2FLWA 4HNSA 5FWXB 1JHZA 2QU7A 1I3CA 4MAAA 1DBQA 4PYRA 3KTOA 3RVJA 2GWRA 1E6LA 3H1GA 3QELA 4OBBA 3ROTA 3GBVA 3RVPA 2JVIA 1U2QA 4XARA 1YTUA 4RK0A 3FFXA 5ED4A 4Z99A 1DC8A 3HS3A 2QSJA 4MR9A 5JNUA 1FFGA 1LBIA 3L6UA 1ZDMA 2GBPA 5HQJA 3GT7A 4CBVA 3RVNA 2AYXA 1WETA 1XHEA 4RXTA 4MLCA 3H1FA 4YCSA 3O1IC 3CNBA 4ETNA 2VYCA 3LUKA 3BRSA 1K66A 3LFTA 2FN9A 4G0YA 5T7BA 1D2AA 1YVUA 4RV5A 2B4AA 1DCMA 2QVGA 8ABPA 5JS2A 1BDJA 1GLGA 2E4UA 3FGZA 3BILA 3I42A 1NTRA 2YHBA 1BAPA 4MR8B 5FBKA 5DCLA 5KWSA 1ISRA 1OXKB 2V0NA 1PNTA 5B3JC 3QLVA 4ZPJA 5IX8A 1U2PA 1BDHA 3SG0A 1JF8A 3OM1A 5D2CA 5TQ0A 4MRMB 3ILYA 1KGSA 3RVMA 4O5AA 5CNKA 2WWVD 3M6MD 1USKA 4EUKA 1M5UA 3R0JA 3JS5A 1YIOA 5CNIA 4N41A 2L19A 2WRZA 2I6FA 3C6QA 5T3YA 5EWJB 4S05A 5DTEA 1RNLA 3QX9A 1E6KA 3MQ4A 4G0XA 3BRQA 4B09A 2HPHA 4EVRA 3VNAA 2R25B 2MSLA 1YK1A 4ZJPA 2FXIA 4Z4HA 4XAQA 4XLTA 3T8YA 2OENG 4O1HA 2WJAA 1NATA 2HSGA 5CNMA 2PKXA 2LP4Y 4NQRA 3LUGA 4MQFA 3FFTA 2YHAA 4UHKA 4D74A 2PAFA 3FFWA 1PNRA 5IUJC 1ZH4A 5EWLA 3CLKA 4D6YA 1Z18A 4G0QA 4TLLB 3HV2A 1TJYA 4EYKA 3HCWA 2QW1A 4RWEA 2E4YA 4L85A 5KQLA 1BDIA 2LUOA 4KK4A 3GV0A 3HDVA 3IP6A 3IPCA 4KRFA 4EGSA 1VKRA 2MSKA 3LMKA 2FQXA 4Z0NA 1D1QA 1M2FA 3ILHA 3SM9A 3C3MA 4YP9A 3NNNA 2E4WA 3Q9SA 4Z4IA 4Z4GA 2RJNA 4Z9AA 5IULC 2RJOA 3RQIA 1MVOA 2FKAA 4ETMA 3HDGA 3QLTA 1Z2EA 1B00A 1M2EA 3ROFA 4HNQA 1P2FA 3HXMA 3LUHA 1ZHHA 4RZSA 3CHYA 3OLZA 4IGAA 2BGGA 4RK1A 4M88A 2IPAB 4DADA 1MAVA 4HYEA 1Z12A 2NZVG 1Z16A 5EWLB 1RXEA 4DQDA 4FE7A 1BVHA 4G0PA 2JK1A 5BRAA 1TM2A 2VUHB 4DN6A 3HSYA 5JS1A 1RXIA 3NHZA 5JNWA 2JBAA 4W5OA 4XXHA 1R8JA 3L49A 4GPAA 5BRJA 1JH9A 3H1EA 3H5OA 3MA0A 1NXPA 3H75A 3EAFA 5FBHA 1E6MA 2CD7A 4Z9BA 3NNSA 1PUXA 2Q5CA 1EAYA 1ZESA 1CEYA 5PNTA 3CU5A 4IMJB 3OLYA 3UUGA 1URPA 9ABPA 4MS4B 2M1ZA 5KI6A 5CHYA 1KMIY 4ML3A 1VPWA 4EYOA 4MS1B 3KHTA 2A9RA 4FE4A 5FWYA 5KQMA 4KQ9A 3CTPA 1P6UA 3C97A 2HQOA 3W9SA 5IUNC 2FN8A 2IYNA 4IF4A 3HUTA 4P98A 3QELB 4W5QA 4MS3A 4QYMA 3HZHA 1NXOA 3MIZA 3D02A 4WWHA 1YS7A 1EWVA 4O1IA 1E2BA 3KKEA 4MR8A 3SNKA 2B1JA 2MYTA 1JYFA 2FW0A 3CKMA 3UKJA 1C4WA 1YS6A 3KYIB 3NBMA 1ISSA 3TB6A 4MQEA 3RVQA 4MS1A 2FMKA 5DGCA 5HM6A 3SQNA 4W5RA 1KRWA 3VNBA 1IIBA 4RK4A 1ZITA 1TLFA 2P4UA 4MRMA 2OQRA 4EVQA 1QKKA 3H5LA 1JDNA 3F6PA 4MS3B 2IPLA 3DGEC 5JNVA 2PL1A 4QICA 1DC7A 3C3KA 1Z13A 3N0WA 1FQWA 3OMXA 5DKFA 5IUKC 5TQ2A 1EWTA 1XHFA 3JTEA 1JFSA 3GWGA 4N47A 5KQGA 3HM9A 1SXIA 3B2NA 3CG4A 2IDMA 1D4ZA 3GYBA 3MYYA 3KG2A 3T95A 2QV0A 1W25A 2TMYA 2A9OA 2JRLA 1GCAA 2HQBA 2JVKA 4PZ0A 2FSPA 1QP7A 2FTKE 5HKOA 3BBLA 1T34A 1MIHA 3LUAA 1NXTA 4RK6A 2FMHA 1FSPA 1HEYA 1DZ3A 3QK7A 4Z4CA 3DBIA 1GCGA 4JAVC 3H5TA 3HUUA 3LUCA 3CRNA 4ZMRA 7ABPA 1QQAA 1F4VA 3N0RA 3KSMA 4N03A 1D5WA 5KQPA 5EWJA 2WB4A 4RY9A 4NICA 3F6CA 3JPYA 4PEVA 5IEJA 4NCBA 5JNTA 4OTZA 3SAJA 2ID9A 4KNYA 2PE5A 4RK5A 3TX6A 1QO0D 3EQZA 2PJUA 4RK7A 2RGYA 1ZN2A 3FMVA 2VUIB 2IPNA 2MSWA 4Q7EA 2H0AA 2LPMA 3GBPA 3M9WA 1EWKA 1YMVA 3CFYA 2GX6A 2E4XA 2CHEA 2FMFA 1JBEA 1DCFA 2NUBA 2HJ9A 4W5NA 4YGXB 3K4HA 4RSMA 3A0UA 3TD9A 1ZGGA 3F73A 1L5YA 1DRJA 3O1JC 1U04A 3QLUC 2DRIA 2PMCA 4Z4FA 1SXGA 4Q6BA 1U0SY 4ZMSA 2N9UA 1OXBB 4Q6WA 4P1ZA 2H3HA 4WUTA 4F11A 4OLAA 3EJWA 1QPZA 1PEYA 4RKRA 1MB0A 1JDPA 2J48A 2HQRA 2FQYA 1L5ZA 1SXHA 5IBQA 5EWMA 4RY8A 4FB4A 3C3WA 2IOYA 1DG9A 2R4QA 3OO0A 1EHCA 2R48A 3RVSA 3CS3A 1GUBA 2X7XA 2QR3A 4RKQA 4MQEB 5BR1A 4L4UA 2E4ZA 3I45A 2F8SA 3EQ2A 3QLUA 3D8UA 3F7NA 1ZGZA 5TE9A 3HK2A 4LE2A 1YMUA 1DBPA 2A9PA 1USGA 5CNJA 4F06A 4G86A 5KC9A 3G85A 1AB5A 1PEAA 4YRZA 1JYEA 2P9HA 4JB0A 4NV3A 3G1WA 3O74A 2WY2D 3OMWA 1ABFA 2IKSA 2ZAYA 3MM4A 1EFAA 3OQMA 4JA2A 5B3JA 3DZDA 5BQ3A 2XDYA 5IC5A 2CWDA 4MPTA 4ZYLA 2GI4A 2NZUG 3OQOA 5TQJA 1QO0A 4LDZA 2PUCA 3KLNA 5TPWA 2PL9A 1VLZA 1MB3A 5GQSA 3OQNA 3HJFA 2PLNA 2PUFA 4RU1A 2LIVA 3Q15C 4WXMA 1JX6A 2PUGA 3N6VA 1F51E 2JBAB 4EVSA 2FVYA 3I09A 4PE5B 4UHJA 1BA2A 5GOTA 2MYUA 3DGFC 4QYWA 3HEBA 3A10A 5TQ0B 1JWLA 3LOPA 3HVRA 3EDCA 2FQWA 4HNRA 3IDOA 5IEBA 4W5TA 3QEKA 6ABPA 1QNLA 1QP0A 3DLHA 4WT7A 5C5EA 2F8TA 3GA5A 5HSGA 4KV7A 3FDFA 4MR9B 2ID7A 4N0QA 3UK0A 3IP7A 3O2JA 4H3KB 4YV7A 4RDCA 4LE0A 1JFTA 2WJWA 4RXUA 2M98A 4OLBA 5TQ2B 3E3MA 1A04A 2LBPA 4MR7B 1DCKA 2L2QA 4YWHA 5I4CA 1LJLA 2E4VA 2NT4A 3JVIA 3T6KA 4N0PA 3JPWA 4F12A 3QX8A 1QMPA 2FLKA 4TMYA 5KC8A 1NY5A 1J56A 5ABPA 3Q7RA 1GUDA 4ETIA 1C0EA 4KMRA 2PUBA 1M5TA 1A2OA 3RVLA 3KYJB 5F64A 4GNRA 4NCAA 3CZ5A 3LKVA 1FFSA 1S8NA 3LTEA 3H6HA 3S99A 2A9QA 1VRVA 1DP4A 1ZVVA 3IP9A 1LJUA 4XFKA 4YO7A 3CZCA 1A0OA 4Y9TA 1TVMA 2CHFA 3OLWA 4S04A 1NXXA 1ZY2A 3T38A 3N53A 3P9YA 3OO1A 5C5CA 5FWYB 3Q7SA 2L18A 4LZLA 4D6XA 5TPZD 4Z4EA 4KREA 4QPJC 2QXYA 4IMIB 2O20A 5TPZA 2KYRA 2MYNA 3Q7TA 1H9CA 3KLOA 3O21A 1NXSA 1P6QA 5DLEA 2GKGA 2W42A 3EODA 3EULA 2IPMA 1QP4A 4G0ZA 1JFVA 5TPWB 3KS9A 3NHMA 4JP1A 4G0OA 5E3JA 1QQBA 3Q41A 2WMYA 3EGCA 1DJMA 4XASA 4LE1A 2FMIA 3LUDA 4LDAA 4EY3A 4LRQA 3NNDA 3H5WA 3JVDA 4KFCA 1RZRD 1TMYA 2JCGA 5EWMB 1NXVA 1SD5A 1W9HA 4OG2A 4KK3A 2QZJA 3QEMB 4RY0A 3DLBA 1NXWA 1ZH2A 3O75A 4G0MA 4E7PA 4N76A 2L17A 3RVOA 6CHYA 3A3KA 4LX8A 4RXMA 2ZWMA 1Z25A 3O1HB 1DRKA 1Z17A 3H5IA 4H60A 3RVRA 2R47A 3LKBA 3OLVA 4EYGA 1APBA 1KRXA 3QLVC 1PHRA 2FEKA 2JB9A 3IPAA 4IRXA 1JLKA 1D1PA 1Z2DA 4MGEA 4MS4A 4EYQA 4TN5A 3KJXA 3H5VA 2PUDA 4KVFA 3M9XA 3GRCA 1JL3A 1YK0A 4MLDA 4WXEA 1ZAYA 2QVCA 4MR7A 1Y1LA 3CG0A 4YR7A 1DBWA 2NT3A 1SRRA 2RDMA 4F8JA 2VK2A 4PICA 4KPYA 4TLMB 3MF4A 1LK0A 3O2QB 3BREA 4KQCA 4E7OA 3LUJA 3OLXA 5JNRA 1CYEA 3GL9A 3I5AA 4G97A 3HO1A 1UDRA 2FEWB 4OATA 2MYPA 4JASB 4KZKA 3E61A 3TMYA 2FEPA 1XWWA 3N8IA 5FWXA 2JVJA 1LBHA 1AB6A 1P8AA 3OM0A 2PUEA 1ABEA 3KCNA 3QEMA 4YS6A 4JOQA 5JNSA 1Z15A 3JY6A 2AYZA 3N75A 4WZZA 4H3HB 1Z26A 4IILA
chains in the Genus database with same CATH superfamily
2H48A 1WVMA 2RHLA 2W98A 4KXWA 4QWWA 3ROMA 2D7DA 4HV4A 3I28A 1GFWA 3CVYA 1BKDR 3QVSA 3UHOA 1WZUA 2UV8A 3LUFA 4ZC8A 5CA1A 1O8CA 4F7DA 4K9NA 1QH0A 4BGVA 2PSSA 1PWHA 1FFWA 1HYEA 1QIKA 2WR8A 3DP7A 3K7EA 3OFKA 4HGZA 2RSLA 4YP7A 5ITZB 5C8YB 4EECA 2QUKA 2EZ8A 1JBKA 3GGOA 2VRCD 2AOTA 3JZAA 3DA8A 1Z5PA 2PMWB 1GNSA 4MCIA 3FOFC 3C6ZA 3UOGA 4OGGA 4Q47A 4TTVA 3PGA1 2I9KA 2EP8A 4XARA 4DVGA 4O8ZA 2GAFA 4WFJA 1DTWB 4QVKA 1TQ6A 3A1VA 1Y4DE 4HRXA 1H5QA 4PHFA 3RSFA 5HQJA 3RC9A 3DWEX 3OFNA 4ZXFA 3NDIA 4KWIA 1UBHS 1C0IA 1LI4A 3PNKA 1TQ2A 4ETNA 2WUEA 5ALJA 1NPDA 1QXSA 4ZZ0A 2WJPA 3ONEA 2WNHA 3MTBA 5ALFA 1WMFA 2HDWA 4BFVA 1OSNA 1VKHA 1NHWA 1ZK1A 2CNDA 1PYOA 4Y30A 5DHTA 4BO2A 4E6PA 5DSZA 1XN4A 2PRIA 1JDBB 2EZ9A 2WJZB 5TJHA 1KP3A 5JV5A 5KTMA 2V0GA 4BO9A 4ZJYA 2HIMA 1QIFA 3FPJA 4QGHA 4F4JA 2ZITA 5KWSA 2BL4A 2WTMA 1H1LA 1JV2B 3EPPA 2XEDA 3L92A 1YBVA 3H4MA 1I7LA 3DLCA 3HDQA 2QL5A 3K6KA 3RS9A 3U9LA 2VZ0A 3W7BA 1ULUA 1JF8A 3GG2A 3OM1A 1I30A 2HI0A 3GPIA 4O1MA 4TM8A 2GTIA 2Q7XA 3M5WA 2XTMA 4LJAA 4ERXA 3HB0A 4V39A 5I7SA 5JD3A 5IVPA 1ND5A 2FJUA 4LX0A 5BOVA 4H6VA 1SA0B 1Z4IA 3BXHA 1SIWA 4TV9A 3CRZA 3EZYA 4N8SA 1KK0A 1JALA 4FOPA 2WIBA 3VNRA 1FYVA 3TXYA 1GG8A 1MF7A 1WB5A 2CV2A 3P2JA 2YV1A 2VPIA 5G0WA 4DCCA 4OXNA 5AOVA 2B8WA 3NDBB 4UVGA 4L4ZA 4KXVA 5C81A 3HFSA 3HKCA 4EDFA 2F1OA 3GJTA 6ADHA 2YJGA 1BMFD 1RQ2A 4AMZA 3WGVA 4X61A 3DD1A 3W8FA 1AOXA 2PT7A 4DLTA 1SKYE 1SZDA 4MWOA 1R3DA 2H5EA 2C0QA 5KSPA 4XWOA 3O3MB 3LUGA 4GI1A 4I7EA 1V9CA 2KW5A 4DCTA 1K4MA 4WZBA 2QGFA 4NX2A 4Q00A 1F9AA 2O50A 3I4FA 3QF7A 5J9FA 4BZPA 5AFSA 4D6YA 5FBVB 4F4IA 2C54A 3OETA 5BSTA 2C07A 5ADUS 5MGBA 3PCXA 4HRVA 2FP4B 4E31A 2BF4A 5FUVA 1EM6A 3VDNB 5AI8A 5GGXA 1MEEA 1T2CA 2FPLA 3IPCA 4HDSB 4KRFA 2I3AA 2XT6A 5K3FB 3HZRA 5CLGA 3UK1A 1GLNA 2OQVA 4IDOA 3R7BA 2I03A 1TEXA 5LQRA 3A6GA 3T99A 2JHFA 3LBIA 1CS0A 3C3MA 4AZ3A 1E2FA 5D86A 4G4SO 4IWYA 5IKPA 1IPFA 3HKBA 3E4DA 1JDBC 3ORYA 4IFEA 3E53A 1YDGA 4NEGA 3A6KA 2XNSA 4A73A 1K6JA 1MVOA 3BD8A 1YQ9A 1B14A 3S1LA 4WCFC 3NV7A 3WOHA 2Q2WA 2RGNC 3ROFA 3I53A 4IUBS 3A6HA 3I9KA 4NL4H 5FTLA 4OI4A 2TMGA 1JEAA 4AJ2A 1KZ7B 3DM5A 3ZHVA 1RZUA 4LDPA 3WLHA 2D2XA 3P1JA 2Z4RA 4FYWA 3SK0A 3AK4A 3K96A 2GRJA 2WG0A 3HVUA 2ZK7A 1V3VA 1Y81A 4WRRA 1J8QA 3VNSA 2P77A 4D4MA 2ZDHA 3MINB 5DP1A 1ORVA 4OX9Y 1SOUA 3AUFA 5F2EA 5TF0A 1G6OA 2XB9A 3FI0A 3L8DA 1Q77A 2EIHA 4KXUA 2QD1A 2NTYC 1T3TA 2AN5A 3PC8C 1BSVA 5CH5A 4MPPA 4WD3A 3IS3A 1PS9A 1SRQA 4C2AA 4S2EA 1OGIA 4XXHA 1AF7A 2HR1A 1H85A 4GOKA 4RUKA 2JLSA 3OOSA 2P90A 4GXTA 5FV7A 4B6FA 5BRJA 1D04A 3NXSA 4MOWA 2R4UA 2ZIVB 2A9JA 4O4IF 5ALYA 1NMQA 1GTZA 3NH6A 5EE1A 5EKXA 1FFHA 4WACA 3S55A 5BV1A 2GN6A 4JYZA 2CD7A 2VP4A 4BVFA 2WQ7A 3WG9A 1EEXB 4CMGA 4EY5A 4YRQA 2WF6A 1H2YA 2Y67A 2OE2A 5PNTA 2JLQA 2PPVA 5G0VA 1T6YA 1U7HA 5I8ZA 5JSYA 1UDAA 1MB2A 2GXSA 3LOUA 3LX4A 4IBOA 3KHTA 4FYPA 1MMFB 3E5MA 3O4VA 3QE4A 3THXB 1MXHA 4XD7D 2EGHA 4V0RA 3IB3A 3QFRA 3W9SA 5CVTA 1OIWA 3PNLA 3O38A 3IPYA 1UM9A 4CZ2A 2AZDA 3EZGA 3O6VA 4ZI5A 2C2MA 1BXRA 3ZWPA 1IM5A 3IRUA 1BOFA 4O1IA 3WJ2A 2VQEB 3FAKA 4MKGA 2H52A 5CB6A 2BW0A 3OQHA 4NYMR 1EDDA 3HCNA 4JJ4A 5DGCA 3PEUA 1R00A 3DKRA 1XTZA 1ZJ6A 1QV7A 3BXZA 2YJ4A 3F6YA 3OCZA 1CF4A 2ZBRA 4RA9A 4DV0B 2ZTLA 1KR2A 2AOVA 2IEDA 4X3CA 3AP2A 4NBKA 2O4CA 4RTNA 3M6FA 5JQGB 1X39A 2E2WA 4UOEA 1FXUA 3C3KA 4HH0A 3RS5A 1FQWA 2DOKA 2VYFA 3EPRA 3QWFA 4KE8A 3WFZA 5KEIA 3JQ8A 2Y05A 3DDZX 4D45A 1A27A 2B69A 4XQGA 1S2MA 1E0AA 1ORHA 1RI4A 1L8AA 2I1LA 2OUKA 4F45A 4LKRA 3UMFA 4JXZA 3A8TA 4P08A 4B0OA 1HNWB 4HLCA 3P97A 1GCAA 2H2IA 3PFFA 5K3BA 4NP6A 3O4RA 5AW5A 1PK8A 5JUWA 2WDZA 5EIBD 2VPZA 3M4XA 1KIAA 4HFRA 4H31A 4XSHA 1KFBB 4UXIA 3OCUA 4LXTA 3QK7A 1KH1A 3LG2A 4EMTA 3HXKA 5SY6A 1FEZA 4WN3A 1C3XA 4RENA 1F4VA 3U4AA 4BVAA 1XVTA 4OY3A 3GFPA 3KOXA 4DA9A 4ZANA 3HJGA 3VAYA 3J80A 2GETA 3Q10A 4HTFA 5CH8A 3UCXA 1V0JA 2CXQA 2J3LA 1QDLB 1NGSA 4B17A 1L4MA 5DPMA 2C0PA 4MX8A 3ZE7A 1P91A 2RGBA 2DHRA 3EH1A 3I9LA 5DHRA 1N33B 1ZN2A 4PGMA 2R8ZA 1G8YA 1B2RA 1V16A 3I0MA 4BDTA 2X8AA 3CFYA 2UYGA 3C7TA 4ER3A 2CB0A 1FNMA 1G8GA 2W6PA 3PR2B 4OYYA 4CM1A 3EMKA 3K4HA 3UPDA 1LBQA 1KYXA 5CG1A 2CK3D 3O1JC 4PTYA 3LGAA 4B9AA 1EI9A 1SELA 1ISMA 4IZIA 3G0CA 4LQ4A 3BXPA 4ZI7A 4UVDA 4IRUB 5ECYA 5CA1F 3N05A 4Y2SA 2JD2A 3OPNA 2BMWA 2SKEA 3B1XA 4IDHA 4RHCA 4ESVA 3MWEB 2YV4A 3LY5A 4JKOA 4LISA 5LLDA 1ECCA 2X8WA 3SFVA 4BVJA 5HZKA 2HQRA 4M0PA 1AUOA 1T0JB 4NBRA 4D9HA 3V1KA 3DOUA 4F2HA 3CZAA 1V4VA 1DG9A 1VCOA 4HAUA 4I50B 4YFVA 2R4QA 5G1PA 1N6NA 3VR4H 2WSYB 3PTZA 1BCRB 1ZS9A 4JBNA 4YJDA 1Z9BA 4XRGA 1ZGBA 4KBFA 1OC4A 1VIMA 2BTOA 4RLFA 3L6RA 5ALHA 3TEMA 3SMVA 1K2VN 1YE3A 4FN4A 4ZT4A 3WP1B 5EUMA 3K70C 2JFNA 1K8RA 1P8JA 5IM4F 1PF7E 2V7QA 4HDRA 4M3NA 3RARA 4F5EA 2DWQA 2ZXEA 4Z7OB 2HMWA 1UBNA 3OMWA 1JEEA 2MR5A 4LWOA 2ZAYA 4YCCA 2Y6UA 1AHPA 1W4LA 1ZH8A 2H07A 4ALMA 5GONB 2NTEA 5L4NA 3AYXB 4R0MA 4E13A 1R6DA 2DBRA 1KSHA 1RRVA 3A4LA 4HPJB 3FYUC 1YQXA 2GQ0A 2VP2A 4XJVA 5F98A 4HXFB 5CJ2A 3UJPA 5IHPA 5KOHB 2PUHA 2C2OA 1O08A 2COUA 1X94A 4IXMA 4MW2A 3KDSE 4FILA 1DKMA 5CM9C 2ZRNA 3N6VA 5BMOA 5AM5A 4DJAA 1E6WA 1XOIA 3BD9A 3RT7A 3FLMA 3R9XA 1A71A 2ZSUA 3RS4A 3V4LA 5T5QA 3OPYI 1YONA 1N5DA 4AY3A 1XTBA 1CUBA 4I1VA 4DMRA 4HCJA 5IEBA 3MS7A 1D8TA 4ZU1X 4YJ3B 3G9XA 1O0CA 5FAKA 4HF7A 2OCBA 2DPYA 4CDRA 5C53B 1S89A 1PTKA 1QCCA 4MR9B 4TKUA 4HGQA 3Q7IA 5GM1A 3TI7A 1O58A 4J29A 1EFCA 2WHQA 1W0KA 4FC7A 4IIBA 3VR6A 3AONB 3O2JA 4B6QA 2WINI 4CQLA 4RDCA 4WNIA 4DLLA 1UM8A 4REOA 1JG7A 2JEZA 3SHFA 3T5PA 4I1RA 3QOXA 4G63A 4KE9A 4AZTA 2ZI6A 1KC1A 4JLMA 1QAOA 1RXCA 3NAZA 5I4CA 1EGAA 3STUA 3GGCA 1A8PA 1JA9A 1XEAA 3MGKA 3AL3A 3WQBA 4EHKA 4RMGA 3W5HA 4JYAB 1E3WA 5AKGA 2WP8J 3R0VA 2Z5LA 1ORTA 4L3VA 2ID8A 1N7IA 2G17A 4D56A 1QUEA 9LDBA 4YMGA 4IOKA 2BKXA 3LPCA 2VDWA 4M9SA 1LNSA 2NYRA 1QHNA 4G37A 4L3WA 2R65A 1KKUA 4GNRA 2HUNA 3N7UA 2DSNA 2R7KA 4J0DA 1M1ZA 4C21A 1NU8A 1T9HA 2OOSA 3U49A 3CIOA 3X1MA 3U26A 3RRMA 3ZEIA 1SWWA 2JFQA 3IYLW 3RDPA 1J2YA 3TNFA 4D4HA 4YHHB 3KXKA 3ICPA 3P19A 4I50F 1U4SA 2ZJZA 4QTTB 1R50A 5J58A 3MHPA 2EU8A 3COSA 1I7NA 4FOTA 2A14A 1DAFA 2FPIA 4QGFA 1GADO 3UB4A 4XEUA 2HLPA 1RWXA 3CEPB 5BRNA 1WPQA 4R2HA 3P9YA 3SBEA 4DMFA 4B0PA 1DAPA 2B3TA 2PA3A 1C9EA 4D6XA 4CETA 1T13A 1NWCA 2XW6A 3HYRA 2YRFA 4XIYA 2PQ0A 1IL0A 3IALA 5CW1A 3WE7A 3AVVA 1HQDA 1FJ2A 3GP5A 2WYVA 1IZ0A 5TNXA 3CVVA 5T4FA 4RTPA 1WCWA 4S24A 5HJEA 1FUKA 2IYPA 3EISA 1E6UA 1HZJA 2V96A 3OT5A 3AFHA 4KTVE 2QM0A 2W22A 3DR3A 2VTDA 4OP2A 3TBHA 3G8AA 4B3DA 4UE3S 4IX9A 2Q8QA 3CX6A 3D6UA 3QU7A 2V5AA 3FPSA 4KVZA 4LDAA 1T5TA 2ZSAA 3IA7A 3KU4A 1QMGA 3ZY6A 4LFCB 2Q5EA 4H08A 5CFOA 2ZAIA 1TT5B 1D9XA 1NG9A 5I4BA 1Z6ZA 1B6GA 4OG2A 1T9ZA 1PZFA 2X1VA 1Z2OX 1JVNA 3M8KA 4KK3A 4QUAA 3NI2A 4HMOA 4EATA 4HT3B 1IB6A 5LB4A 2G8NA 1YZQA 3GDFA 4ZVLA 5M7EA 1PG0A 5TVGA 3KKZA 4FYMA 4F6CA 2PTGA 3D8RA 2VI5A 4TVKA 1APBA 1SZPA 4OLJA 2Q7DA 1ZD2P 2WWFA 4XVQA 4CEIB 2P7HA 3MHTA 2OB2A 3PDJA 3QFHA 1PZXA 2PMBA 3G2LA 1ADJA 2VHQA 1KAMA 1CJSA 4L75A 2NU9B 1UXKA 4YR7A 1IU9A 1PN3A 5JYCA 4NYJR 2E37A 1SRRA 4KDFA 3DV0A 4M2LA 3AKYA 4GQAA 2Q4RA 1NF3A 3U6BA 1OH6A 1EQ2A 1ENPA 1UKCA 2VK2A 4BV9A 1YA8A 4H7PA 2BR4A 2SCUA 2VPTA 3EIFA 1E59A 3FR8A 1J8MF 2IHZA 2WAXA 3EVGA 1JR6A 1CYEA 1LQTA 1UDBA 2FWNA 1JHYA 4XWWA 3R75A 3DF7A 4JIMA 1LPNA 1NVVR 1NUHA 3KKNA 4IZOA 3RRNA 2ZFUA 2BZSA 4B7XA 1A9PA 1XWWA 1G1MA 1FW6A 1AKWA 2J07A 4I4NA 4AX8A 4TXHA 3OMLA 3FB1A 4DY4A 1LF0A 5FL7A 3L04A 2DCMA 1H05A 5HVNA 4PNEA 2ZI3A 2IK8A 3Q3HA 4DSNA 1I9CA 2CJPA 4LXXA 4M1WA 5E1DA 3K70D 2C5LA 4RS3A 3RHFA 2WABA 1XLTA 2LR0A 4M0MA 1Q14A 1J0CA 5FO0A 5JI3E 1NURA 9ATCA 2FUNB 4ZYYA 1PGQA 1W8IA 3NALA 2XKJE 4IKOA 4PQRA 3EPLA 3DZIA 2AWNA 2B78A 3TO5A 4F86A 3HKDA 2FLWA 1OLOA 1NL3A 1QHGA 1PQYA 2QD5A 2XYRA 3QMVA 3WZ2A 1DBQA 2V4ZA 4EGQA 5FWNA 3HR8A 1LC0A 2XVAA 1VZ2A 4YC7A 4QODA 1BRMA 4N39A 2H0QA 4W1PA 1VG0B 4F8EA 1ICEA 3JYLA 2AZXA 2V3VA 4YP5A 3PC7A 5H68A 3RABA 4E5YA 1SKUA 1ZCJA 2OLJA 3DLPX 4K46A 1LBIA 3L6UA 1M83A 2LKDA 3L6EA 3AVOA 4JKIA 2ZRQA 4TMFA 3M6VA 1Y1SA 2I6XA 4C4TA 1AZTA 1U2ZA 1Z28A 4G1EB 4CGZA 1DIBA 3WHLA 4EENA 1A2BA 2WLSA 3WYBA 3OEWA 5JECA 2FUKA 1OROA 4ZEOA 3BGVA 3EHDA 4MV0A 1SB8A 1U9JA 2OUIA 2Q1WA 3LFTA 4AKSA 1NBMD 4DM3A 4BWVA 2NSJA 4UFOA 5IASA 1YVUA 2FN7A 1WVIA 3BX1A 1J4AA 4OLHA 5F1YA 2P2YA 4DT1A 2FWBA 4WPGA 2EKPA 2XX3A 3EVDA 4K6KA 4TVOA 1XQYA 3T7KA 3GZNA 1NTRA 5DGDA 4V1CB 5U4XA 3S81A 3Q4GA 4TLDA 3AY6A 4XRRA 2B7LA 3CCBA 3LFHA 3S6JA 2UU9B 1ZO8A 2V0NA 3FVQA 1W73A 4HS9A 1OYYA 1JEDA 4PY2A 3L5OA 5ESRA 1ZKDA 2EL9A 4WECA 1H2XA 1HLFA 1HK7A 2YYSA 1KDTA 1SUBA 2B6HA 1NYTA 4HNHA 4PXSA 3BWVA 4WOPA 2D8MA 1SVSA 2F3PA 2X2OA 4QX6A 3BMCA 3DSRA 2O3UA 3IT1A 4KLRA 2OZKA 4L02A 1J70A 4WL0A 4YRKA 2WRZA 3F96A 1N9GB 3WMEA 3AVQA 4R40A 4BV3A 1W36B 4QATA 3VUFA 4DIOA 1BX0A 5M2QA 4PSUA 3EXG2 5FV4A 1HQKA 3G5LA 3IAM1 4YRDA 3IRVA 1J7JA 1DAEA 1G6HA 3HNPA 2R25B 1AGPA 4QO8A 4Q39A 5J5VA 4HDSA 4CV2A 4BNDB 3BL8A 4C7BA 2ZYSA 2XKAA 2A0YA 3FBTA 3FNFA 4EARA 4XLTA 2HTEA 2BBWA 3HN6A 2GHIA 2Y1GA 1MU0A 2WJAA 3ND6A 4R71A 2DKFA 3L4SO 4YDHB 4W4TA 4M21A 1AQIA 1M2OA 1L0BA 4UNNA 4RGVA 4UHKA 1FTQA 4CCYB 1C9NA 3K8YA 3MAAC 1ZM2A 4R0NA 3T9AA 3C6MA 3G82C 5AW6A 3D3EA 3UAWA 3ZGNA 1JPJA 2ZYVX 3EB9A 3MMSA 1GY8A 3K31A 4GOLD 5JWRA 3EIOA 4EEKA 4LMBA 2Y77A 2QW1A 1G98A 4RWEA 5H81A 4UC0A 2P4QA 3T1TA 2W43A 1P77A 2DQ4A 3DTVB 5T6MA 1OPRA 5EKSA 1OBHA 3EF0A 1VLVA 4JT8A 1Z5OA 2D2VA 3L0CA 1OPXA 1QFZA 4P2BA 5E7IA 4LCBA 3SVLA 2QB5A 7MDHA 3PXBA 1FQKA 3L1VA 4LYFA 1Y5IA 5AK4A 1Z0AA 1PG5A 2IXFA 1T5HX 3MGGA 3EBLA 3JQFC 3R5HA 5L3QA 2QBYB 3MINA 5JC1A 3E0XA 4Z4IA 4G8BA 3E8SA 4ZZ1A 3E3LA 3RAFC 4JH0A 4RTSA 1J9EA 3CF4A 5F35A 3S3TA 4JI2B 3QWHA 2JHAA 3R6GA 2R84A 3AVWA 2ALJA 1SVIA 2PL5A 2PO5A 3GXBA 2WFMA 3PRYA 1TJ5A 3ADCA 3UPUA 1JB9A 4FYKA 1VJCA 4XIGS 1PFWA 4YROA 1S2LA 2O07A 2WQZA 3UK7A 5G40A 4AKIA 4YP6A 3D3QA 4ZXPA 4J2OA 2B3DA 1LNZA 3FWYA 1IY9A 1HETA 2IOHA 3C48A 4XB6B 2ODNA 3LUPA 1A8SA 4M0EA 1K8QA 3UF0A 3BORA 3O3CA 2FI1A 3VZBA 5A2QA 3LBAA 3VPGA 3GLQA 4ARZA 1XF1A 3R6LA 4M99A 1PJZA 3C8ZA 4OH1A 4CQNA 3MZ0A 1XGKA 4YREA 4FE7A 4DJEC 2IX3A 1VQ1A 1PTJA 4KYVA 3B1JA 2Z2JA 3HBAA 4TZKA 4ERNA 4DN6A 1V45E 4M38A 3HSYA 3WSTA 4V0LA 5L3VA 2P9YA 1ZH6A 1V6SA 2ZAMA 1B15A 1QYIA 1OMOA 3F78A 1VBFA 2FPMA 2OXIA 4QPDA 2XE6A 1M6VB 1WCXA 1Z29A 1DLJA 1RWKA 2CE2X 2P9JA 2MSDB 3F90A 3MEQA 4LJSA 4ZARA 1T4DA 3IUYA 2R6ZA 5DXJA 4ZC1A 4GX5A 1O94C 1ZESA 3HR4A 3CU5A 1JR3E 2AEMA 1IZ8A 3IELA 3KFLA 4DSOA 4UREA 1CF2O 1ZQ1A 2V4UA 1MG5A 3GP3A 3BCRA 1JXQA 3PG5A 3TTVA 3TTTA 1AM4D 4UNRA 3CUSA 4DDVA 4EYOA 3H87A 1QB7A 3RM3A 1JSLA 2Q8PA 3D8HA 3EGEA 3PLRA 4LW8A 4M9XA 3ZCXA 1VGVA 2FFQA 1N0WA 3G2PA 5AKIA 4YRSA 3DBRA 4PN3A 1MIOA 2MMGA 1EX7A 2RKBA 3HUTA 4MRVA 4UKDA 2MINA 4AO8A 2HFKA 3SYLA 4N5LA 5K09A 2A67A 4Q1FA 2A94A 3NCTA 1R6BX 4IDBA 3MIZA 4WWHA 4GBMA 1G3UA 3E23A 2IS4A 4OK3A 1LVUA 4BO0A 1ZD8A 5INTA 3KKEA 1MUUA 3VSCA 1WTAA 2B1JA 1CR6A 3OEYA 1I10A 3PXUA 4P4UA 1RYNA 3G5TA 2PZBA 1IUOA 4DR3B 3AEZA 3AF2A 3O3OB 3ZNPA 2HK7A 1HOXA 2I34A 3HU1A 1TW3A 3CSDA 5GY7A 5U9CA 1WUHS 2Y66A 2FQQA 3OP4A 2PMDA 3ESDA 3VNUA 3DHEA 5FTMA 1DC3A 1EYZA 4XM1A 1TAQA 2YQ4A 5G4LA 2WQ6A 3A70A 3KR9A 3QU2A 1R5OA 4GFDA 4Y1FA 5FAXA 4H15A 2HMVA 3C24A 2C1XA 4RLQA 4YYEA 2Z0MA 5IUKC 1KPGA 4M22A 4ZAFA 1QRAA 1HM5A 1EWTA 4COOA 1WXGA 5GADl 1YVRA 1NVTA 4DLXA 2WFLB 4EQZA 2ZAOA 1E5XA 1G9TA 1YAHA 2FSVC 3DMGA 2BFCB 3W2IA 3CUWA 2ZRAA 1HZZA 3JATA 3OT1B 2ZB7A 1MD9A 1PBNA 3ETCA 4G89A 3VYTB 4ZDIA 1LX7A 1H93A 1LA2A 4OHYA 2O48X 3LDUA 2DE0X 2Q4BA 1JDJA 2ATEA 3CLRC 2FTKE 5KNBH 3BBLA 4YDSA 1V16B 1XZFA 2J41A 4XQ9A 3I8SA 1N8SA 1LU9A 4RK6A 4DFDA 1W0CA 3P2OA 2AXEA 3DO8A 4DGSA 4AZVA 1OYWA 2QPAA 3A14A 2O2IA 2Q1TA 4N03A 4G1BA 3MWDA 5HCUA 4L2IA 1WNFA 5ALLA 3EGDA 1PR9A 4AUMA 2X6TA 2WB2A 1KA9H 3HU5A 4HSGA 4DRXB 1RLOA 5KTYA 1YRLA 2ACWA 4OTZA 2ID9A 1N6HA 2CWWA 4HLDA 4AZSA 4DB2A 3GNQA 2NYUA 2VHVA 5AUPB 2VSYA 5K8CA 5EIXA 3DOFA 2C58A 1I2DA 2C5EA 2A1TR 2JJMA 1CY2A 1PR3A 3AFIA 4YQYA 1U2DC 1ZC4A 2IPNA 1EE9A 2QYOA 2ZJ2A 1GL7A 1I2ZA 4MIYA 5JALA 2E4XA 2CHEA 1NI4A 1HDIA 1AK2A 1DFGA 1RKBA 3CEHA 3DAHA 1Y98A 1YZNA 3IE2A 3RIMA 4ZHQF 3P32A 4RDIA 3KVYA 1NUQA 4OK5A 1XA0A 2DRIA 4J4BA 2FX2A 1AMUA 1JQLB 1XWFA 2Y1DA 2YNMC 1GTRA 4QT0A 4DMMA 1I01A 5LYJF 4JIGA 5BSEA 1G41A 1LTHR 2P2GA 3CVOA 4Q6WA 1XFAA 4P1ZA 5IAJA 2OA0A 5BURA 5K05A 1JAZA 3D64A 4QVGA 4LPKA 5J2TB 2PWPA 4LJ7A 4LRTB 4P4SA 4LF5B 4DABA 4JLSA 1GPJA 1QH1A 1Y6JA 2Y0EA 4FFVA 1CYDA 3GFFA 1GTSA 2PFGA 4LF6B 4CLEA 1YB2A 4R4JA 4X1IB 1KOFA 2FZEA 1F5NA 3GVXA 4FK8A 3SDSA 1XAJA 2HHCA 3BYZA 4KRXA 1NBWB 4CQMD 4N40A 4CM7A 1E9EA 5JSHA 5HKLA 1NNSA 3DMFA 3DZCA 4R8LA 5HKKD 5D85A 5SZHB 2VHZA 3A9VA 3U3KA 1U7OA 3DOCA 1WUIS 4XA8A 3NONA 1A72A 3EQ6A 3G23A 1RLMA 4E14A 1GTG1 2GJAA 3IQXA 3NOQA 3ZHYA 4HWGA 3TI9A 1NVFA 1WZ2A 3RIHA 4GSYA 1EFAA 4R9VA 4O59O 4ZKEA 5FIUA 1Y3CE 2ZPUA 4MH0R 2DHCA 4B4WA 4JXKA 1OWLA 4MV7A 4Q34A 4RVFA 3TE6A 3CW2A 1Q7BA 2WJYA 3SHWA 3U4CA 1RE0A 3CPJB 1X8JA 2VP6A 3N5CA 4G4GA 3TQHA 5EHZA 1OBOA 4I5GA 4LHVA 4NBSA 2AFHB 4NZPA 3QKRA 2NZWA 5GQSA 2IV2X 3V5NA 2W2MA 4TKZA 4EHLA 1PVDA 1AK9A 3KT8A 2JI7A 4EVSA 1XZLA 3SKYA 3LX8A 1ZN7A 1P61B 2A1TS 1IBLB 2P0EA 1BA2A 1CJBA 4RPJA 4PX9A 3ZS9A 4MWDA 3A10A 3B3FA 5KOJA 3U7IA 2HLDD 3HDTA 3V8VA 4KQXA 2IODA 2W00A 4ZVSA 1HEUA 4BLOA 1LJ8A 4EY3A 2FFHA 1JHOA 2HJWA 1RQNA 2B34A 5FXMA 1J8VA 1TO1E 4K86A 2H2DA 5IH7A 4EI8A 3I23A 2WHEA 4KGXA 3UJAA 4EIWA 4F0JA 5TIIA 3NKLA 4QT4A 5J5AA 1X1DA 1BN6A 1U4NA 5JROA 3H0CA 5FPQA 4AJIA 4CLRB 3ZH9B 2VIIA 2QROA 3OTHA 4UW9A 2H2WA 2IHYA 4HYYA 1O4WA 4K9LA 1G5FA 3ONDA 4OUDA 1VCNA 4AJ1A 1SOWA 4YY3B 5CD9A 1QZUA 3GLKA 2I6TA 3SLRA 4WKGA 7REQB 2NT4A 5L6MB 2FPIB 4LSMA 5H0IA 3T6KA 3AUYA 4PCAA 1W1IA 2FY8A 1JEYA 3OIFA 4IVRA 2YYAA 1RVV1 4U7HA 4TTQA 2QW8A 2Q62A 2W6QA 4QRDA 3HWWA 3L7MA 4BJHB 4CPDA 3EXG1 3U4MA 4GKBA 2O7SA 4KHZA 1O5IA 3PC6A 2BM0A 1A5SB 3I6ZA 5EXSA 5EE0A 5A5DA 1RQLA 5D5PA 2UZ0A 4P2GA 1SUPA 3L4EA 4NARA 1D0VA 4Z9YA 1D2RA 3ZVNA 1L1RA 3PQ5A 3ER8A 4EHNA 2BBOA 4PLZA 2NUTA 4X54A 2NU8A 1PZEA 3AVPA 3UJ7A 1SQ5A 2HH9A 3OO1A 1PGNA 1PV4A 4GUDA 3L8CA 2C9OA 3E35A 1VTKA 3WHIA 2HCTA 2VF4X 4PAGA 5FTNA 1JS1X 2DYKA 2O20A 3QBDA 1UJBA 5ITZA 3H7AA 5J4HA 1M73E 4LYHA 4OI1A 3MPOA 5TLSA 2BUAA 2IYEA 2IW1A 2AL7A 3X0DA 2CFTA 4W5HA 1MJFA 1CR0A 3NHFA 3KLOA 4N3BA 5IDYA 1N2IA 4AURA 4AYWA 3TGPA 3PIRA 1KEWA 1QGUA 5DGTA 1F60A 5TMPA 1P1KA 4B4OA 4IV8A 5BNIA 4C2UA 3FTFA 2QN2A 4TTIA 2YJ6A 2OGZA 3FRHA 1YUNA 1O5OA 2YWFA 2DFKB 5FFMA 3SU8A 3WLJA 4TSKA 1I14A 3GLFA 2X86A 5CB0A 1HBJA 1EK5A 4B3XA 2WNSA 1UFKA 2Y6VA 4JQYA 1EINA 1FRQA 1NXVA 1ZCAA 2XB8A 3W06A 3IAS6 1RBQA 3KL2A 2WIGA 4LAFA 5IT9A 1I3OA 2WHPA 3QW2A 1NVGA 2QW0X 3NDRA 2RCNA 3H05A 4AYTA 1MJGM 2PMFA 5DCWA 2GLTA 2F6RA 2Q2NA 2R6GA 3QPAA 4GVPA 1XDDA 1RC0A 4I9GA 3O1HB 2VRCA 2ZWAA 5ERXA 2RBEA 1YDWA 2JF0A 2R47A 3IP8A 2IHBA 3NYRA 3IVAA 2AW3A 4CU2A 5CA0A 3PJGA 1PHRA 2OO5C 4U5XA 1P29A 5FYQA 4FGSA 5K0ZA 2UDPA 2V97A 4MGEA 1XBTA 4O4LB 4NWIA 2EW1A 1LX6A 4MPJA 1NM5A 1TCUA 2WWHA 4HWTA 4A1FA 4U00A 5KYXB 3V8MA 1USUA 2R1TB 2ZKIA 2I2WA 1E9BA 4OAPA 4IG9A 3P0JA 4L27A 2NT3A 2RDMA 1L5WA 1SVOA 2G9QA 4BZZA 4IG4A 4YIKA 3I6QA 4GZ5A 3LDFA 1IJFA 1OH5A 4Z1MA 2DMRA 3MF4A 1MNQA 6LDHA 1YBHA 4S1NA 4G4IA 3DBHA 4M89A 3OLXA 2WD7A 1C30A 1JJBA 1KO1A 3L7JA 3MRXA 5BWOA 3HO1A 4ZT2A 1VZ3A 5DW3A 3UT0A 1Q1BA 4KXXA 4JR2A 1EX6A 1EGHA 2CFSA 3ZWQA 5AVUA 3AUJB 1P0QA 2GAJA 2CYAA 3PPVA 2Z8ZA 3BG5A 2C5FA 1UPTA 4MWGA 4QEZA 5E1BA 4HX5A 4LXQA 3GUZA 4BEVA 2B20A 1IN4A 2FMXA 4JXXA 4LWQA 4D9CA 5JAIA 4E1BA 2B4TO 3K8OE 3K9FC 1C14A 4DUZB 1WZIA 1KDPA 1X7WB 3L07A 1UOPA 3MWFA 2PZMA 1J90A 3HN7A 2JW5A 5HF5A 4IEFB 1DBVO 3WGMA 2FRXA 4HNAB 3RODA 1GU0A 3SIPA 4Y6RA 1SOAA 2Z1MA 2Z57A 3S70A 5IS2A 3LQFA 1S1MA 3S8YA 2E48A 1KYWA 2PZAA 3X1DA 2AGVA 2DPMA 3E9CA 4GLFA 3V97A 3O3NB 3LLUA 4GQIA 1RAFA 1SHLA 4ZHQA 2P4SA 5AVZA 1XL1A 2GWRA 2O8DA 4U39A 1R88A 4F2WA 4O2AF 3V46A 1LVHA 4GKVA 4LC1A 4MV8A 3D81A 1ZOLA 1NQ5A 2LRHA 4COKA 2Z5FA 1OAAA 4X24A 3UUEA 4Z99A 2RD2A 2YWGA 3BB1A 2YX1A 2I91A 3U7GA 2HIGA 5DTJA 2D59A 3F1KA 1X86B 3D5QA 2Q5IA 1Q11A 4OUKX 4AK9A 2AYXA 1HZZC 1XHEA 4RXTA 2GM5A 4ZQCB 1EEHA 2VYCA 2XZOA 5KTRA 1K66A 1ENYA 3NATA 2IRWA 2E55A 2X5OA 3RUEA 1JI3A 2OXFA 4TZTA 4ICIA 2C9MA 5EIAA 3ONVA 3NEJA 2BPOA 2BF7A 5ALKA 3NHYA 2IC5A 4TOIA 3NMUF 4KPUA 3B6JA 4YCBA 3ISTA 3DWFA 5L7TA 4JV5B 5DN9A 2BGTA 2PZLA 3JQDA 4QLAA 4DA0A 2VSXA 3AW8A 4RJ2A 3W2TA 1U98A 1LDYA 3UH0A 4QJ4A 4S1PA 4QOGA 1U0GA 1R5BA 1KKLA 3OA0A 4W9NA 1KGSA 4O5AA 2V5UA 2YBEA 1O4VA 1EFPA 3AX6A 1N1GA 3IV9A 4A91A 1UDCA 4MW1A 4B85A 3X1ZA 1HPLA 4DJTA 1XLTC 3Q40A 3AL0C 5C1DA 2RE8A 5HKAA 3BT7A 3RVBA 3E58A 4A23A 1DSSG 5DNAA 2R8YA 3QPWA 1KWKA 5CGZA 2D4HA 1E3JA 2GARA 1V1RA 4QDZA 2BM8A 3OT1A 3D54D 3NAGA 5KNBD 2M6KA 1XPUA 2ZUEA 1T8PA 4FJ2A 2AMLA 1REQA 2OZLB 3I2FA 4L15A 1Y8QB 3I9FA 4PLTA 1F14A 2P6NA 3QVJA 3TAXA 5HP4A 2YHAA 5KSZA 2VTBB 1Q83A 3CR3C 3L9WA 2NYAA 4FDVA 5KOYA 2IYTA 5KVSA 4C1BA 3BWEA 5JANA 5EXPA 3HCWA 1HYBA 2PUVA 4TVBA 4DCGA 5IC4A 3DZ8A 3EIXA 3K2EA 3V4OA 3QHAA 2XQIA 3DCJA 4B87A 3SF8A 4D46A 2AFIB 2W6NA 3GV0A 2RK3A 5ILGA 3TTYA 3P9QA 1VKRA 3R3UA 4G85A 4EGSA 2FQXA 3ICQB 3W78A 1V5GA 3PDIB 1KAOA 1M2FA 1BGWA 4L7QA 2ZUVA 1C0PA 1RKXA 4XYLA 3QFTA 3DQPA 4P0TA 4PBSA 2HA6A 2RKWA 4Q7MB 4LHZA 3B8EA 1SG9A 3B9PA 3NHAA 5HIMA 4AW9A 4EO4A 4EABA 5DM2A 3IODA 2ZQZA 1JTVA 2DQYA 4A0QA 4RF4A 5HTKA 2XSZD 2CXRA 2O2ZA 3ZE8A 1B00A 4HAVA 1GGVA 3LCCA 1JHVA 3C15C 4YT5A 3DMTA 4DHEA 1YR7A 1W2WB 3FYSA 3OJCA 4HK4A 5B55A 1XMOB 5GTDA 3LUHA 3EVBA 4RIGA 2O7VA 4MI3A 4K9OA 1HLDA 1L5NA 3IJPA 1VMIA 3C8UA 2ODTX 3NS7A 3TR6A 5C3MA 1I94B 3OIWA 5REQB 2NZVG 2X8BA 1JEJA 5CDUA 3RHSA 3OSZA 3WAGA 1V25A 3THWA 3H8JA 3AM4A 3A3PA 1C1XA 2JK1A 10MHA 5LMNB 5CT5A 1RXUA 4CV1A 3G9UA 5A62A 2VUHB 1DJQA 3OY7A 2QG9A 2I2FA 2BDUA 1Z56C 5IKXA 5DHSA 1ZUWA 4DCVA 1I2CA 3N0TA 2OGWA 2GVNA 1CY6A 2O2SA 1TJPB 2R8EA 3FNRA 3U3JA 4GMHA 1XDZA 3MA0A 3OH8A 1X74A 2I54A 3TW0A 2HK8A 2IYXA 3DE3X 3JZIA 4MVXA 1PJAA 3GAMA 4C08A 2O8BA 1UEJA 2H4YA 1UL1X 3A32A 2VJMA 4L9WA 3DCYA 2LCFA 3QKUA 2QU8A 4O08A 4DEXA 3GCGA 5JCPA 3OEED 1Q3KA 1T25A 2GEDA 2R8BA 4AJPA 4C5CA 3PJEA 3OZGA 4BY9E 4EZEA 2ZYRA 3AB8A 2XNKA 2G8LA 4P3PA 3U4HA 4AMYA 2YHUA 4P34A 3PGMA 2GK4A 1PSDA 2FN8A 3QX3A 4TWJA 2NO4A 3WL5A 4TPKA 1DKQA 3U31A 3QXJA 3AY3A 3AM1A 2B7BA 3ZGZA 4UJ3A 5HIIA 1R6XA 1E2BA 5D3KA 2GA9A 4QDOA 2FR8C 3AF5A 4S1VA 3TRIA 1C4WA 2PLFA 5GV7A 5JS8A 3KYDB 5JAPA 5A4JA 3B51X 1LY1A 5HR5A 3ZDXB 2Z2ZA 5HCIA 3I2IA 4D8UA 4CKWA 1BWPA 2HWXA 2NSLA 5ALGA 4DTCA 5BPHA 2W58A 3SSAA 1WXEA 3FNGA 4EW3A 1FRZA 1T43A 2BFDB 4QEKA 2V7VA 3JYHA 1IXYA 1DC7A 1NR5A 2XGSA 5M3BA 5LU9A 1ZIDA 5DKFA 3SFTA 2G0TA 3R5SA 2O8CB 4PLGA 2XYHA 1KDOA 4FHFA 1UWCA 2O1WA 3S2YA 3Q1KA 3ZDYB 1VDZA 3ZIUA 1UC4B 4ZKDA 1PT5A 1QF9A 4DG8A 5JXWA 1NJ8A 2C29D 2H5IA 4GRDA 2IYWA 5KZMB 4D41A 2OQ2A 1TEZA 1N5RA 2GEBA 3N2KA 4DM4A 3ZJYA 5LA6A 4HY3A 3A1CA 3VPCA 2YY7A 2JIQA 4RTRA 2CE7A 1JFRA 1HI9A 4TLAA 1HDGO 2UUCB 5BV2P 2OORA 1B16A 2EQBA 3H5TA 5EINA 4A92A 3FX2A 4BMNA 4RQAA 1WM1A 4RIFA 3H4VA 4U3JB 2ZR7A 4BTEA 2YMPA 3SM3A 3K73O 1W2GA 4R68A 3CO0S 4NNOA 2G1PA 3AHJA 3ZXSA 3LRPA 3AU9A 1SUSA 2J5QA 3NQ41 1CR4A 4PZUA 5IT4A 5F12A 4LJ6A 5BN3B 2OESA 3B85A 3F5DA 2I6UA 4X7RA 1QAQA 3KLMX 2J87A 1UXGA 5EZQA 5AVJA 3RASA 3WBKA 4BIMA 4XQCA 5AKHA 4ASUA 4CQJA 2QTVB 3SQWA 4O4JB 4U2FA 5K4AA 5JYBA 2YVAA 3ASZA 2XRMA 1BH2A 1Q17A 4OJNA 3GOQA 2FSSA 3FSGA 2XZTA 3VZCA 2HJ9A 3EOBI 1IVYA 1IBSA 1UANA 1EUYA 1U3CA 1BD3A 4NJEA 5GV8A 4LHWA 4MW6A 5EP1A 2NUPA 4EPRA 4DILA 4IDGA 4PC1A 4JBIA 4ZREA 2YW2A 3GHYA 1JDTA 3BGWA 4B45A 1FXWF 3STXA 4D9GA 5LL6P 4H4CA 1TJ3A 2GN9A 3HCPA 3PXEA 3TZBA 2JS7A 4B33A 2OPHA 2ODAA 4BGUA 3BDIA 3PRHA 1PNQA 1XVUA 2J3QA 3Q0TA 4HKTA 4KUGA 4ZZ2A 1L5ZA 1KQGA 2R1TA 1IBKB 1TECE 4KMMA 3Q3JB 4BV2A 2WWGA 3FDJA 5L8VA 2YNMD 2C00A 3JZFA 4QDXA 1RAHA 3BD7A 5LB2A 3TCXB 1SOMA 4BJ1A 1M2VB 3WGYA 3KRTA 1T2UA 3I2YX 3K5WA 5HJ5A 1DADA 3ESCA 4FOLA 3TM5A 2DERA 2NSYA 4KPGA 5C7OO 4RYLA 1TUGA 3GYGA 2YIMA 1Q3TA 4IQ0A 3VKGA 2AFHA 2C20A 1NRWA 3QE0A 1U28A 2O2XA 2A9PA 3HI4A 3DW1X 2EYQA 1D0IA 3ZQ4A 2NO6A 1XXLA 1XMIA 3G1WA 1G7RA 2DLDA 4MHTA 1FFAA 3N58A 1EQUA 1MBZA 4OB6A 3KKOA 3OX4A 4YACA 3HKEB 4J3NA 2I7VA 1XD9A 1Y48E 2EC5A 2OOKA 2QM8A 3L1KA 4MUAA 4R2JA 4HP8A 4BQRA 1IY2A 2OMKA 1JTEA 1B2LA 5T8KC 1PFGA 3PHJA 5DHFA 5EHXA 4OHBA 1RBZA 4AY6A 2XF8A 2IP2A 3OKPA 1NU6A 2ZWPA 2D7JA 1KO7A 3E2MA 4BFLA 3OQNA 3UQYS 1QTQA 3GVHA 3OOYA 4CRWB 2PUFA 3D6VA 3JZDA 3V7FA 3WLAA 2NAPA 5C46F 2RIPA 3AR8A 5CX1A 5JDCA 4G0NA 4LDJA 4YRGA 1KJIA 5KINB 3A6LA 2ACVA 2HO4A 2G4CA 3N8KA 3OQ1A 4KO8A 5ALTA 1G18A 2VDQB 1GLVA 2KS6A 4CF4A 4FHEA 2HBRA 4TKVB 4RULA 3OPYA 1Y3DE 3WGOA 5LYYA 5K0EA 3Q8LA 4ZALA 3WLTA 2AWOA 3DXYA 4GM0A 1UKVY 1I2AA 3C3YA 3IP7A 2Y1EA 4NENA 1WHTA 2YVQA 5DHUA 1U7WA 2QE7A 3HB5X 3N59A 5L7WA 4XUEA 1TYZA 2EKBA 4H6WA 1VBMA 3HNOA 4H4EA 3E3MA 1KNQA 3OWOA 4IJMA 1KAHA 3ANMA 5EPUA 4E5DA 2C96A 3GFSA 1E3EA 1DXQA 1KDYA 1QPBA 4BNJA 4BVLA 2OHIA 4CM9A 1UINA 4KH0A 3G2KA 4MVJF 4Z0TA 4WINA 1QMPA 1VFNA 4TMYA 1OOEA 4FFSA 4M1OA 2NXNA 4C0JA 2J8ZA 4UTZA 2IJGX 2QD3A 5LWQA 3KD3A 3ZYZA 5HHTA 1JECA 2BEKA 3JVUA 4P7FA 4F84A 3RYIB 3F4BA 2DUJA 1EJ0A 1XU9A 5F64A 3EXHA 3CZ5A 4OHMA 1WQ4A 2N75A 1X8LA 1AHNA 2OFFA 4GBED 3UJBA 1TTHA 2VOEA 5K51A 2TSYB 3HCRA 5HBRA 1IJKA 2Y9MB 4IGEA 2CVFA 2O8BB 3AM3A 4RMIA 4WFKA 4N18A 1QGUB 3WGNA 1TTTA 2OGTA 1Z35A 2OAEA 3VNVA 4U9IS 2KLHA 2WJVA 1HYHA 5JS6A 3TSOA 2NUAB 2XQKA 4YJ3A 2HF2A 1N1EA 1QH9A 2O1EA 3II6X 2B2XA 2IUTA 3IQFA 3P45A 2H4FA 4ZQBA 1G4UR 4PBRA 1EFRD 4DDUA 1IZ7A 2B21A 1WLYA 4MWSA 4YCNA 1LI7A 3CN9A 5BYBA 1F2VA 3U4IA 2F9FA 3LK6A 2JL1A 3P5SA 1RRPA 4R2WA 4GBJA 3OE5A 3GFOA 4M0DA 2BBSA 4NBTA 4TQ9A 2VS1A 4ZI2A 2YZ7A 3G59A 1KYIA 1G2QA 2C78A 2GTPA 4KO4S 4O4HA 3F97A 2BGRA 1PVOA 4QQFA 1YBFA 1PJQA 3DV0B 1UPFA 3HWSA 1Z38A 2HF7A 1NUTA 3MFYA 3ON5A 1K98A 4Q9IA 4IS2A 3S2UA 1JQ3A 1T5LA 2W42A 4G0ZA 5JAZA 1WF6A 4JQSA 4MW4A 5FL7D 3CEMA 4KC0A 4IIJF 4R2MA 3TSYA 1T5BA 3VTFA 1UXOA 4B82A 4UMVA 2UYHA 5A03A 1ZIYA 1KGDA 3G2MA 4MQUA 5DT9A 2CKDA 1SHKA 1U6KA 4CWAA 4QXQA 5HPYB 1QE5A 3AR7A 3EPKA 2PLRA 3LBNA 5A4KA 1AUXA 1BZYA 3EQ7A 2FFBA 3HKCB 2R8RA 3AEQB 3TCNA 3PV0A 2AEJA 3DYIA 2PSDA 2QTCA 3TMKA 3LZCA 1MEJA 2EKDA 4K8OA 3U7EB 3CCCA 1DCTA 2QIOA 4NNPA 6CHYA 4I9FA 3NP7A 3QBEA 4UDOA 3PFNA 2W9XA 3B8HA 1KRXA 3I1IA 2IKQA 4PTZA 2IYZA 3G79A 4XCVA 4TL9A 4YRRA 4FZJA 1I2MA 5HF9A 1VLLA 3ELBA 5HILA 3WXMA 4Q7KA 1GR1A 2B9EA 2VWQA 3F6EX 3GRCA 1ZAYA 2BM9A 2AFIA 4H59A 3CG0A 4YRIA 4ZOLF 5EC8A 3A6ZA 3EVEA 2DUNA 3GJ4A 1GZ5A 3KJQA 4AU1A 5YASA 3D2AA 1NVBA 4MWZA 2FMTA 2FFRA 3LPNA 3MCZA 3PU6A 3MB8A 4JVSB 3GPCA 3MGAA 3KELA 1GOTA 3BQ9A 1YRBA 1QZZA 4HZGA 4YNBA 4XWTA 1ADBA 1MH9A 1E6CA 3RVDA 4EL5A 1GG9A 2O23A 3I5AA 3W2FA 4D9BA 4F8YA 5CFLA 3BWCA 4PR3A 1GCUA 3FRJA 2FF7A 2ZJ1A 4M54A 4URFA 1WB6A 5AJVB 5FWXA 3N2LA 3TFOA 1U6JA 1BKYA 3KJGA 4ZT3A 3H2JA 2HIHA 1Q84A 2HF8A 1B6SA 2PHZA 1OKKD 3DV9A 4L22A 4OO3A 4WVLA 1V11A 5LZ8A 2SCUB 3T0GA 5LXTF 1U5CA 3K6RA 1E89A 1GYRA 1CUZA 2FZ5A 2D0PB 1P9NA 1QQTA 1WO8A 2AUTA 1RU3A 1N2CE 2QAGC 2ZSKA 3AFOA 1L5HB 4LNHA 5LLSA 7YASA 5KYWA 4QHTA 3RLIA 4TL7A 1M34E 4EJ2A 4R9SA 3UMBA 5I3CA 2J5XA 1GXSB 1LDNA 2D00A 1NYRA 4OA5A 3SJAA 2I5PO 1KR5A 2XYVA 5FI5A 4JY7A 1SNYA 4LQDA 2RARA 4REQB 2GF2A 3F3SA 1XA4A 2OTCA 5G1OA 3IAHA 3Q8KA 1USIA 3C8MA 3QVTA 2NU9A 4F5YA 2R60A 5CXQA 1QGOA 1QU3A 4PHCA 4PYRA 3KTOA 2X6RA 1ZPDA 1T4GA 4TWBA 4G5RA 3DHWC 3CE9A 1FFCA 3TNDA 5JSFA 4QJ3A 1PFVA 3P0IA 1ZMBA 2J7PA 1ZOPA 1RWNA 1S2DA 3GGPA 1BNCA 4UBNA 3KVNA 3BS4A 2IOFA 1FDVA 1K06A 2C9CA 1ZC3A 2JKVA 3HS3A 4NSNA 3SC2B 3V1TC 2XCSB 3HKDB 5AK5A 2CXUA 4IQ8A 1DOAA 1PRYA 1GQRA 1Q1GA 2OHJA 2XHEA 3QU5A 3WNQA 4HPXB 3D0KA 5BR4A 1NDQA 2VHTA 3RUPA 2QTHA 4LSWA 3A1TA 3VTAA 4BU1A 4YCSA 1ODCA 2HTFA 5KJCA 5KMGA 3IOYA 2E5WA 2XUPA 1VCHA 4UTXA 1RZVA 2POCA 1P45A 1WABA 2J6IA 3QGMA 4KV9A 5FULA 2AXQA 1EM8A 3W5JA 5T7BA 3OJEA 3NRJA 2IXBA 2X9QA 1QBKC 1XD8A 4QE3A 3ZGXA 4C7XA 5LQCA 2Z6AA 2QVGA 4ARAA 1IBCA 4BAZA 5DISB 3G5UA 1FNBA 3G8BA 3KO8A 2INGX 3O47A 3QWBA 1RQXA 4HJXA 5AVXA 3ETHA 3JRWA 3FNHA 1YZTA 5B4TA 3QA3E 3TJMA 5DULA 1OXKB 2MTBA 2XYQA 3B60A 3NU1A 4ZPJA 2M32A 4I1PA 1ZXXA 1EH5A 3LY8A 4R8KA 1I24A 3HYTA 5GMOA 3C6XA 4UHHA 1K3FA 3EWIA 1TAUA 2JZCA 2OPBA 4ZYTA 4N0DA 1KMQA 1ZONA 4P38A 3THXA 4EK9A 3GJXC 4FGKA 2C3MA 2V6MA 5KKNB 4PAOA 1RAAA 2VBFA 4XW2A 1KY4A 1II9A 3FVTA 3M6AA 3WQSB 3IBSA 1YQTA 1XFDA 4U1RA 1EXMA 4ZI3A 4DIDA 4OHCA 1C41A 4D02A 4XWYA 1JFLA 1MQSA 5KU1A 3THYB 2OB1A 4O25A 5HZGA 1LGYA 2GJKA 1ZX1A 1XWIA 1F2UB 4P53A 1FU7A 4JL5A 8LDHA 2PGNA 1KEUA 2JFUA 4D74A 3ZI7A 1K5DA 2DF8A 2WVAA 1ZH4A 3A05A 1GKKA 3OPVA 4GDMA 1ORDA 1B8UA 4X8MA 1UQRA 4ZVQA 5FUYA 5BNTA 2C61A 4O0MA 1EUZA 5H70A 4CI9A 3L0YA 5MGNA 1IM8A 1NOKA 2CYBA 3PFKA 4G23A 4L8GA 2OO5A 5F33A 4US1R 1FE8A 2AX3A 3BCUA 3V4PB 3RSGA 4E32A 3DJYA 5JI2E 2ZB8A 5DCUA 2W2VA 3B20A 4TUYA 1JMYA 1NW6A 3AIOA 4L95C 2A4MA 3L7KA 1GRRA 2I2XB 3SZGA 3CSSA 4EX6A 2HJVA 5C4IA 2FQ1A 3TLBA 1TF2A 2CLOB 4RYDA 5LJLA 4H1UA 4INZA 4P7JA 3KXIA 5IVIA 1XTUA 2X9NA 5TT1A 1D6SA 1W47A 3VOAA 2W7TA 1VG8A 1LDEA 3L7BA 5ILOA 1YU9A 1RJFA 1PWZA 1L5RA 4K8RB 3LUBA 1U3FA 2CBXA 1P2BA 2D1SA 4E2WA 2JIZD 2ZI5A 1NJGA 2XI4A 4B32A 4AULA 1GTJ1 1MX1A 4YMUA 1Z34A 1G19A 3CZRA 3O4IA 1IK4A 4IGAA 3BXEA 2I7XA 5B7NA 2XR1A 1P9RA 1ZH0A 3M0EA 1QTIA 2XGGA 4BQIA 3MS4A 4LRXA 4O2BB 1RXEA 2CVHA 2ZWIA 3WIDA 1GGFA 3KX2A 3MFQA 4JWTA 2EJCA 3KLBA 4YAKA 4CCAA 2C77A 3AI7A 3FPHA 2E1RA 3RU9A 2Z04A 3SXJA 4W5OA 1NVAA 4ZU3A 3H5RA 1X6VA 4NOJA 3PJDA 3UUFA 1QF7A 2GRAA 1U7ZA 4UAVA 4YBZA 3ZHRA 3GMTA 1D6MA 3WDSA 2YY5A 4W5RA 2QBYA 3TPFA 2ZRGA 2Z4SA 2GPTA 4LNUA 4DOMA 2L69A 3EEBA 4KIWA 1V47A 3VC7A 4PS0A 4B2IA 4GR9A 3MJFA 3UUGA 1GTVA 1P4HA 4P6VF 4EL0A 9ABPA 1AQNA 3U44A 2SECE 4PAQA 4C06A 1HL3A 1JQJC 3LQYA 4IOJA 5DP2A 2EG9A 3RWOA 1YQEA 2HY7A 4U9UA 1CNEA 1NJSA 2V1UA 4MVJA 1KY3A 3H99A 3EDYA 3AJEA 4OGKA 1T2EA 1Z0JA 2G25A 1KAQA 4IF4A 1GNLA 2FRVA 3GQVA 4KR2A 3AUSA 4MS3A 1EWQA 4I3GA 1O54A 1Z0FA 1EHIA 4Z9XA 2QS9A 3IVRA 4KB5A 1E2HA 3RK4A 1DIHA 4F4UA 2Z1DA 4NE2A 4Z4FA 1NC1A 2NNLD 5AW3A 1ISSA 2R79A 4MLPA 2VATA 2XTJA 2F9LA 1ZI8A 2J4FA 1OHHA 3RS3A 4JLPA 5AK3A 4EF6A 3LSYA 1AXRA 2PXAA 1E3IA 3EMBA 1Q50A 2JGLA 2ILTA 4CDMA 1ZUNA 1UBJS 2ZXUA 5B1IA 1IJBA 1II0A 1J42A 1WDWB 2GT1A 2H17A 1G20E 3PHCA 3G17A 3HR7A 3FGOA 4NFHA 1SBTA 5SYMA 2VDNB 1M8KA 3D9QX 5CRIA 3UWKA 3T3OA 2ERXA 2BEUB 3AEKB 4BB6A 1ZIXA 2AG0A 3ELDA 4HVCA 3BBPA 4JOSA 3IOEA 1LS1A 2OP1A 4G65A 3ZQJA 5KQGA 1V5WA 3B2NA 4NFYA 5LCXA 2IDMA 1D4ZA 2ET6A 4HAOA 5F9HA 5ES3A 5HOEA 2WU4A 1E60A 2AXPA 4KTTE 5UKDA 3H1TA 1M8JA 3L7IA 3EVZA 4JGGA 5K45A 1MVLA 2A0KA 1CTQA 3A9TA 4IINA 2MSCB 1XMXA 1T34A 3KE9A 4BNFA 4AO6A 2ZR8A 3KOYA 1W76A 1OFGA 1PD0A 1YDEA 4G5QA 3JAWA 1T29A 5DVZA 4X94A 1UMCB 1YRAA 3BRWD 4FMCF 4L72A 3LUCA 4LWZA 3RSLA 1ZD4A 1J8DA 3Q6NA 4W5WA 2WB4A 5KVQA 3JPYA 3IAAA 4Q4DA 5T64A 3S28A 5BXQC 3VU1A 3RU3A 3UXEA 1V7QA 3PIDA 3TTXA 3O8OA 1E2JA 4F1JA 2D5IA 2FPUA 3EXIA 3UIEA 4BLRA 2A5LA 3JD2A 1F5SA 4NFLA 4FNAA 5ECDA 3DMTC 2HUPA 1OE0A 2W71A 1MPXA 3ZNQA 4ZYXA 1EDOA 2EQAA 2X4LA 2VPYA 4UE2A 1W88A 3TM4A 2MSWA 1VMDA 1CY0A 3AB7A 5CX4A 5LQUA 2OG2A 2ZSFA 1PQPA 4DSTA 5HCNA 1L5MA 2BLNA 2FYTA 4FEAA 1IEXA 1PJCA 4EJSA 4OQNA 1DTEA 4U02A 5KTNA 1SURA 2R5NA 1MTZA 3MSXA 2BTEA 1L7VC 4IAOA 2A5JA 2D1TA 4IOMA 1RQPA 1YB5A 3ZIDA 4EAQA 5MF6A 1C29B 1KAEA 5C3UA 3QEAZ 1JA0A 1RJGA 3D1JA 1U7DA 2FR0A 5KIAA 2UXCB 1T3SA 1PCXA 1L5QA 1S01A 4EY4A 2J48A 2OCGA 5ALXA 1A95A 1PJTA 2QX9A 3JTMA 1A5ZA 1KAGA 2H5JA 2I7DA 4BB5A 5ALWA 2RB4A 5JAUA 2EJUA 1ZOOA 4YQZA 2IUFA 4P31A 5DMHA 3F49S 2FPSA 4PG5A 5BR1A 1PIWA 3QLUA 1XDGA 1F6DA 1Z4NA 2XUAA 4MHOA 1Q15A 4BFTA 4KFUA 2Q2VA 4G25A 4L57A 5B2ZA 5TE9A 1WY7A 2Y0DA 3BQNB 1U0BB 2VR1A 1DX9A 4R9UC 2IYLD 4RJIA 1ZOSA 1SU8A 2F1RA 5KC9A 2J0SA 2ORVA 1E8NA 4OJTA 3PXXA 3GJ8A 3NANA 1WSAA 3BPSA 4DNXA 3IX7A 3MM4A 4JLWA 4JBLA 2P27A 4DARA 4HYTA 4DBLE 3VPHA 1G3RA 4PGAA 4AKGA 4DMUB 5BT8A 1EVZA 1O6GA 1R6VA 3EXAA 3ZR4B 2JH3A 4TKVA 5KYWB 2IUEA 3EZ6A 2JKZA 2PWYA 3KR1A 1ID8A 1YR6A 4LNAA 1EXWA 1CDEA 1II8A 5FNVA 4UU0A 1F0YA 4G9EA 2RG7A 1FP1D 4N5IX 1GZSA 2FF5A 2HBYA 2X13A 3QTTA 4X45A 1MXFA 1R0WA 2EHDA 2QGNA 3K16A 3G0DA 4HLUA 3VX4A 1G4HA 3FN4A 3FCAA 1RQRA 4HHEA 4KU4A 1FW8A 1U5BA 2RGDA 3W04A 3ZJ4A 4LDNA 1EE2A 3HVRA 4DY6A 1XUOA 2EQ5A 4IJVA 2RG1A 1PL8A 4KXYA 2QL9A 1NX9A 3H84A 4HH3C 4IVNA 3W8NA 2BFWA 5JFOA 1R10A 3MJSA 3WHPA 1WB9A 2NV6A 1S3FA 3DNPA 5D3MB 5DK6A 4TMZA 3H2BA 1KU6A 3KHSA 4S0XA 1TZCA 2FB9A 4TKMA 1OA0A 1Y63A 3KUUA 2X5JO 5CVUA 4G1MB 2E18A 2V6GA 2DEUA 2IIPA 3BK7A 4H2DA 4F12A 3JYNA 2XBLA 2VH1A 1AC5A 4K2AA 4LY6A 2Z3ZA 2C99A 1DBRA 4TXNA 3ZOZA 2NX2A 2ZJYA 4ETIA 4FWIB 1Z4PX 4P3XA 5DZSA 2JLZA 2J4DA 1UBKS 2QZZA 5G02A 4DSZA 2ZIXA 3M5PA 3RUCA 1QH8A 2J5RA 4LDRA 3LKVA 3SYRA 4ND5A 1QVRA 4DJ5X 3IERA 1CK4A 3FTQA 5BV7A 1KMNA 4F2PA 4OKSA 5J5CA 1JAYA 3HA3A 2BR5A 4PPNA 3FPLA 2BZ0A 1A0OA 4XJSA 3UMCA 1PGOA 3M3HA 2UZ1B 2CHFA 4RVOA 1KH3A 4PS1A 3P2IA 1VE3A 3SYMA 1P3DA 2IQIA 1CQXA 1W93A 5DX0A 5A3SA 3NTVA 2X1MA 5JW6A 4PXYA 2WWIA 3FDZA 5EUBA 4A6DA 1MX5A 1VJ5A 3FETA 3WYGA 1RP7A 1DO2A 1D8AA 1IZ9A 2JASA 3MOIA 4D9FA 1AGNA 4LOIA 4FI3F 7REQA 2IPMA 1YD7A 4TWIA 4C4RA 1IVSA 2CCKA 1NDHA 2DT5A 2UUAB 3H2GA 5SZIA 1BJKA 1DEAA 8AT1A 1QC5A 3UN1A 1ULSA 4DS3A 2H4WA 3R6WA 1O9BA 3LAWA 4HMQA 2VT3A 1SD5A 2WV7A 1XZHA 2VTKA 1WCIA 2JD1A 3R8XA 1OFIA 2JLYA 2OXRA 4RY0A 4W6QA 1H8HA 4PWYA 3DFMA 4B3IA 1CD5A 3LCJA 2AJLI 4RJKA 4O63O 3E1KA 1PP4A 4GL4A 2WD9A 4KBYA 5CDTA 4M8SA 4H7EA 2IUUA 3THSA 3ZN2A 3L01A 2W8ZA 1DRKA 2A88A 4UEQA 4PQGA 5TY0A 3ZLVA 4BLWA 2BD0A 4E5MA 1ZNZA 1XLUA 2J3KA 4Z2YA 4KR9A 3USZA 1F0PA 2FEKA 4CQLB 4BTLA 3ACCA 1JLKA 1SQ6A 1TC1A 2VHCA 1EVKA 2ZT5A 3C4QA 1XAIA 4M6WA 4PVCA 4Q7JB 4AUEA 3GJSA 4D0RA 1RADA 3VR0A 1OWPA 1HG0A 4YYZA 4F5ZA 1AQLA 1UJ4A 3VAZA 1ZJ5A 2O57A 4O33A 4NULA 2OBLA 4TLMB 4NKRA 1V43A 1PJ8A 4CIDA 3JV7A 4EF4A 1N6KA 2CXPA 1AKQA 3AGPA 4ACBA 2QSYA 3N8GA 4LBWA 1SR8A 2PUBA 1SKMA 4A8JB 3CY6A 2H1VA 2H63A 3CUTA 5F1OA 1KVSA 3WICA 4CL8A 2J3DA 5IMBA 5KWIA 4NY1A 4XYGA 2ZB2A 3E61A 2WHRA 3QJYA 2FEPA 4MV4A 4ZGBA 1AB6A 1F3LA 4IJQA 2Q7OE 3NRCA 1GQOA 1YBMA 2A0FA 2HX1A 1JDSA 2UYYA 4P82A 1M10A 2Y0CA 5FJJA 3RTEA 5BW5A 4PNHA 1N7JA 1U6IA 4HNGA 3N75A 4HAXA 1P5HA 4WZZA 5DNCA 4FKZA 4OBWA 4A82A 1VYUA 1CJUC 2Z6VA 3U7JA 2RONA 2XMQA 2NGRA 4FR5A 5AXAA 3UWMA 5IAAA 3ENNA 3K20A 4KJZA 1JNYA 5HFNA 1NN1A 2VK4A 3AF3A 1CY1A 3S2GA 2AJCA 5CLIA 2C88A 3G02A 1DS6A 1DQNA 1JLSA 2AMJA 2X3YA 5D87A 3H97A 3URMA 3IQWA 4X63A 2QRHA 3RH0A 4YJGB 4LMRA 1EFTA 1PDWA 2QU7A 2E82A 2YXBA 1KO4A 1R0LA 4PZAA 1YE8A 1YCGA 4AO7A 1OTHA 2BISA 4MO2A 5AHRA 4XE5A 2JZOA 1BN7A 4JNCA 4YECA 3FPCA 3EEFA 4MJLA 2QUIA 1UWKA 1M67A 3CWQA 4Y0VA 1ILWA 4HQNA 2VXBA 4REMA 3GEBA 2X0EA 3C5HA 4GGPA 1IN8A 2QTBA 3N0VA 1WETA 2LKCA 2ABWA 3O26A 1YZKA 1KXZA 3ZDDA 3R0XA 3A6EA 4NF2A 4JEUA 3VZRA 3ZGLA 4OHPA 3CNNA 1A9TA 1RJDA 1E5LA 3Q6MA 2VZ8A 4G2NA 3LXMA 4OF4A 4W9RA 5JJIA 3GNLA 5BWBA 2VK1A 2ZJFA 3AHFA 2ADFA 2OCAA 3DKIA 3MCTA 3QBTA 4O4LF 2FETA 4UM5A 3V7YA 3VJMA 1M7GA 5FOVA 4CM6A 5CA0B 4NJEB 2E4UA 3AFNA 5CVJA 5KQRA 2XE7A 1U99A 1XRRA 3QFCA 4MMXB 5FBKA 4E2FA 1FMLA 1OKKA 5A02A 4FC6A 3SN6A 4F91B 2PKEA 2G9RA 3T5AA 5IJAA 3QYAA 4K1XA 2CVOA 4NRDA 1V4BA 1SB9A 4KQIA 2FDRA 2R7LA 4U2CA 1C8KA 5THXA 5FEUA 4W5JA 2ATVA 5AKEA 3PNMA 1Z68A 4C29A 5CFRA 5CNIA 2F62A 4ZAZA 1D1SA 2BGKA 2VQFB 1W4RA 3EW7A 1ISJA 3GMIA 3P9KA 4CF6A 3OX3A 3AB3A 3DJFA 4RD6A 2H9IA 4S05A 2RI6A 2AR7A 1E5DA 4OFBA 2H2GA 4PXAA 3E8MA 5BORA 1SVUA 2PV0A 4DCSA 2H9AA 4AZWA 1XZMA 4RIIA 1JHDA 5JCXA 1UFVA 1YK1A 3E7PA 4BNGA 3A1WA 1A4RA 2Q0QA 4XAQA 3IUMA 1U5AA 3AHGA 1OU4A 1RXWA 4P22A 2AKEA 2J0QA 3OCWA 4N49A 1EFPB 4OHOA 1UADA 1Z5UA 4G01B 3O94A 1T6NA 3L1IA 4AY5A 4AY2A 1BQ3A 3IXMA 3VH2A 1PNRA 5LJIA 1T2AA 3FZGA 5IUJC 1TZKA 2CDAA 2LV8A 5EZYF 4ZOBA 3ZHOA 1T8TA 3I9OA 3N86A 4II3A 1JQAA 3UM9A 5K0NA 1ZK3A 5J47A 1THZA 3CISA 3PRJA 1E0JA 3BICA 4GT1A 3M4ZA 4JT9A 1EUQA 9MHTA 1POWA 4MQ5A 1CBUA 1MT3A 5HK9A 3ACDA 1O87A 2ONKA 4LHXA 3TWOA 3RAJA 1ZUIA 1ZUHA 3SX2A 3OEEA 3MC1A 1HDEA 2Q0HA 3UGQA 4CHGA 2Z8YA 5BVHB 3OKFA 1TQDA 3F4LA 3GH3A 3HMKA 3R9IA 3ETJA 2A0XA 2ZU0C 3OIDA 4OEHA 4JI1B 1JR2A 1W85A 5EZ5A 2FOXA 4Z9AA 5IULC 1YTLA 3SI7A 5A6VA 3U5TA 1FSFA 4J0IA 3M49A 1LKZA 4DIEA 5AP9A 4CFYA 1P5JA 2DAPA 2PH1A 4HPWA 1Z47A 4DLVA 3LYLA 2DTEA 3GUVA 1L5LA 5AUOB 1H66A 3QKTA 4EG3A 5BNWA 1JXAA 1XT6A 2ZUDA 2JCVA 1B74A 2VAXA 2VJPA 4N7RA 5ADVA 2OYSA 3TIIA 3NBKA 1G63A 4PAWA 3REQA 4YA6A 3BF7A 4LF8B 1M2HA 3RTAA 3RTDA 3MRTA 3ILSA 4P4SB 3C6BA 3UHJA 1FTYA 2H4XA 2PIDA 3V32A 2L0XA 3A9WA 3DPIA 3IUSA 4FFBB 4KIFA 4LRUA 1DX4A 1LRLA 1Z12A 4N7JA 3VAAA 1EGMB 4JBXA 1FUEA 1ES9A 1QFYA 1C4KA 2BN4A 3H9GA 4N82A 3S5JA 4B8ZA 3HE3A 2GEKA 1ADCA 3GF4A 5B64A 5LOVF 2G1JA 1E1NA 3IXQA 4CL2A 5IAOA 2RGUA 3E7DA 2V3WA 3O0TA 2XB2A 4FP9A 3R40A 2YJNA 4A0RA 5CH3A 4RCZA 4F1WA 4RH0A 2F3QA 1L7BA 3PKIA 3JQQA 2JARA 4IX1A 4WK4B 1ZP6A 2B30A 2ANBA 4DWVA 1RJ9B 2C4VA 5FPHA 3H5OA 2JDID 2CXSA 4ZOAA 2NVUB 1UH5A 1EUDA 1O6CA 4KXMA 4LGCA 1EAYA 1P7WA 2EFGA 1C1HA 2PTHA 1QONA 3GT3A 5AI6A 1L4LA 3IAEA 2JGEA 1KMIY 3R09A 3AZQA 4CKCB 5A9TA 3AVUA 3BE4A 4FYJA 4EB3A 2DLNA 3B6EA 4HD8A 1E96A 4MUXA 2BMFA 4RVDA 5FNVB 1P2VA 2PT6A 2Z9CA 5THKA 1BHSA 3L1JA 2WILA 3ROPA 1ZIPA 2D3TA 4HUTA 2K6GA 4PG8A 2YUIA 3HU2A 1V39A 1AKUA 3I73A 1AU9A 3CTMA 1CVLA 3A28A 3BCHA 4FEGA 4K81B 5CLHA 5AVYA 4C4PA 1XRNA 4MZXA 2QTGA 2B1IA 3ET5A 4O4IA 2JIZA 3T7EA 4B6EA 2PL3A 2UZ3A 1F9EA 2ZRJA 2VZEA 1Y1QA 3LQ4A 2J67A 5LN1A 3K4QA 4WESA 2ZIXB 2O19A 2FCAA 3GEGA 2AHOA 3H5LA 3F6PA 5E2IA 1PS8A 2IPLA 2KQUA 4C88A 3SLKA 4LV8B 2NQ2C 3C5EA 1DAKA 1L7NA 2MOKA 4J7XA 4BRZA 1TPZA 4JB3A 3V42A 1JU4A 1QS0B 1EFHA 4FFOA 4PANA 3DFKA 1U02A 2FZ4A 5K0TA 3LGXA 1JFSA 4G81A 1P19A 3L7AA 3PL5A 3G0GA 2ZPAA 4PRYA 1K5HA 4RZQA 2N3ZA 2UAGA 1K6EA 4NJMA 2R1VA 1XKXA 2H4JA 5CW2A 1U1EA 2IEAA 2JVKA 5DTIA 1QG0A 2O2DA 1UAAA 3DZGA 1SBIA 2AOTB 5GP1A 3VSBA 2FMHA 5A4MS 2K4MA 4ZN6A 1B8OA 4CYMA 2I4OA 1T0BA 2FPXA 1WMSA 4HDNA 4HOYA 4RJJA 1TVKB 1HQCA 5DN6A 1E9VA 3GLTA 2PQMA 4HAZA 4E22A 3NT5A 2PY6A 3OBBA 1XEWX 4EYSA 1U2DA 3B6KA 1OX6A 2XIJA 2PQ6A 3MIIA 4LBZA 4EW6A 2QAJA 2NO5A 5HWSA 1G38A 1QHSA 1UUFA 3CZQA 3WFJA 1JDUA 3GQBA 1E2NA 1DXYA 2RGNA 3GOHA 1JVSA 2XT0A 3A4YA 2PJUA 4R1PA 5C4GB 4E15A 1OLXA 2DHDA 1DMRA 1OV4A 1KK1A 1JEQB 1RKQA 1YR8A 2CXOA 2WYWA 1OI7A 5TS2A 4PPGA 4W5NA 1DT3A 2H92A 1KZ1A 4RSMA 1U8UA 5BSWA 4ESHA 3F73A 1EVLA 3P9RA 2IYSA 2XLCA 4JUFA 1VIAA 4L0CA 1EP9A 5EG5A 2AEFA 2P30A 3V8BA 4OYLA 4AJKA 4KXLA 4P58A 1CP3A 1FC0A 3WRYC 1XCOA 1PNOA 1USVA 1W48A 2QUAA 4OLAA 3S2IA 3U80A 2GWHA 1AO3A 5AI4A 2EEPA 5F1KA 4EKEA 4AJHA 2I0FA 1FDSA 3S1AB 3AERB 4WLOA 2G9UA 2I62A