3BRQA

Crystal structure of the escherichia coli transcriptional repressor ascg
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
275
structure length
271
Chain Sequence
b'TQTLGLVVTNTLYHYFSELLFHAARMAEEKGRQLLLADGKHSAEEERQAIQYLLDLRCDAIMIYPRFLSVDEIDDIIDAHSQPIMVLNRRLRKNSSHSVWCDHKQTSFNAVAELINAGHQEIAFLTGSMDSPTSIERLAGYKDALAQHGIALNEKLIANGKWTPASGAEGVEMLLERKFSALVASNDDMAIGAMKALHERGVAVPEQVSVIGFDDIAIAPYTVPALSSVKIPVTEMIQEIIGRLIFMLDGGDFSPPKTFSGKLIRRDSLIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator ascG
molecule tags Transcription regulator
source organism Escherichia coli
publication title Structure of the E. coli transcriptional repressor ascG.
rcsb
total genus 80
structure length 271
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3brqA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3brqA01
3GYBA 1LJLA 2E4XA 3RVJA 1MVOA 3MQ4A 4L85A 5FWXB 5BQ3A 1JL3A 3URMA 4PZ0A 4G0OA 5DKFA 5JNWA 4RY0A 4KVFA 1OXKB 1U8TA 1F4VA 2M1ZA 2PMCA 3Q41A 1U2PA 4ETIA 4MS3B 1RXEA 1CHNA 3OQMA 2R47A 1TM2A 3A10A 4O5AA 4YV7A 1IIBA 3SAJA 4DN6A 5GQSA 2PL9A 3OLYA 3B2NA 3P9YA 4MR7A 3EULA 2L19A 4Q7EA 3H6HA 1Z12A 1EFAA 4JASB 1ZHHA 3T95A 1YTUA 1EWVA 3MYYA 2QZJA 2JBAB 3FFWA 3NHZA 3IP7A 3OLVA 3TO5A 1SXIA 5TQ2B 4ETMA 2W42A 1Y1LA 2F8TA 1FFWA 3CU5A 3I45A 3HEBA 2N9UA 1MB0A 5CNMA 3GV0A 2JRLA 3LTEA 3BILA 1Z2DA 4EVSA 2JCGA 5FBHA 1HEYA 4XXHA 4P98A 5TQ2A 3SNKA 5IEJA 1DJMA 1BDJA 1JDNA 4WUTA 4F06A 5JNRA 1NXSA 4MQFB 1Z2EA 3N53A 4OLBA 6ABPA 3EODA 3O75A 5CNKA 1P2FA 3JTEA 1JLKA 2HJ9A 3CS3A 1YIOA 3RVOA 2FVYA 3W9SA 1BDHA 4MS1A 5IUJC 3OQOA 1RXIA 1NATA 3EQ2A 3HVRA 1NXXA 1M2FA 5TPZD 4D74A 1DRKA 8ABPA 1PEYA 2PE5A 1BDIA 3OLWA 3BBLA 1PEAA 3M6MD 4RDCA 3GA5A 4F3TA 4W5QA 2A9QA 4D6YA 2YHAA 3QLUA 2FTKE 4LE2A 4PICA 2A9OA 4XLTA 3JPYA 4S04A 3HCWA 3QLUC 2PUAA 2ZAYA 3LFTA 4JB0A 4GPAA 1YMVA 2QVCA 1R8JA 4MR8A 4NCAA 2FMIA 1ISSA 1USGA 1D2AA 3RVQA 2JB9A 4MLDA 3E3MA 4EUKA 1D1PA 1DP4A 4KK4A 3LOPA 4NV3A 4YP9A 2ZWMA 1ZN2A 1YS7A 3A0UA 4NCBA 1TMYA 1JYEA 3N8IA 4WZZA 3FFTA 2FEPA 3BRSA 4G0PA 5EWLA 1P6UA 4JP1A 5IC5A 5D2CA 4DADA 4KPYA 4FE7A 4PEVA 5KC8A 1J56A 2BGGA 3Q9SA 3DLHA 2IDMA 4IGAA 5C5CA 3KTOA 3UUGA 4FE4A 2QSJA 4YWHA 5JS1A 4KRFA 5IULC 4B09A 3UK0A 3QX9A 4MAAA 4LE0A 1ZGZA 1E6KA 1UDRA 2CHFA 3IPCA 4ZYLA 5DGCA 4ZJPA 5TPZA 4KFCA 3H75A 1PNTA 3CTPA 4W5NA 2FLWA 3LUDA 3HXMA 4G0QA 3H5VA 5DTEA 1C0EA 4MR9B 2GI4A 4RZSA 4YO7A 4ZMRA 1ABEA 2WRZA 4KV7A 3DGFC 2VUIB 1YS6A 1D4ZA 4Y9TA 2CHEA 3HZHA 1DCFA 5EWJA 3HO1A 4LX8A 2E4ZA 4JAVC 3KS9A 2IPAB 5F64A 5FWYB 4Z0NA 5IEBA 4MQFA 5TPWB 5EWJB 3QEMB 2JVJA 3N75A 4JOQA 1VPWA 5FWYA 4RK7A 4G97A 3CKMA 3QEMA 1YMUA 4O1IA 3O1IC 3R0JA 4EYOA 4EYQA 4N47A 1AB6A 3IP6A 4EVRA 1FSPA 3CHYA 4E7PA 1JDPA 5TQ0A 3LUKA 2WY2D 3F73A 3O1JC 1USIA 2P4UA 2FW0A 1USKA 1DBWA 3QLTA 2MSKA 2R25B 3EAFA 3Q15C 1QQAA 1P8AA 4IILA 5IX8A 4NICA 2PKXA 4N76A 3NHMA 3LUHA 1FQWA 5BR1A 1H9CA 4MRMA 3L49A 2FN9A 5B3JC 2XDYA 5CNIA 2GKGA 2O20A 2B1JA 2OENG 5PNTA 3DBIA 3I09A 3H5OA 2B4AA 3KYJB 4MRMB 1XHFA 1TVMA 3O21A 3I5AA 4RY8A 2V0NA 1JFSA 2PUFA 5ABPA 5JNVA 4P1ZA 4MS1B 2FKAA 1JYFA 4W5OA 3LUGA 3SQNA 4EGSA 4F11A 4Z4IA 1E2BA 3RQIA 3TD9A 4MR8B 1U2QA 4ZMSA 7ABPA 2R48A 1ZH2A 1Z26A 4YS6A 2R4QA 3SM9A 1BAPA 1EAYA 1GUDA 1U0SY 2QV0A 4RWEA 3IP5A 4RKQA 5JNSA 4IRXA 3CG0A 1QP0A 4KNYA 1QMPA 4N0PA 3RVPA 2PUDA 1M2EA 3CZCA 1W25A 3CLKA 1GCAA 1GLGA 4WT7A 1SXGA 4H60A 1VKRA 3IP9A 3OLZA 5E3JA 1YK1A 1Z15A 2FEKA 4RXUA 4ZPJA 2FSPA 4QYMA 2IOYA 2F8SA 1ISRA 3FGZA 4HNQA 1LJUA 5TE9A 4EY3A 4PYRA 5TPWA 4S05A 3HUTA 1M5UA 3D02A 2H3HA 3QELB 5DCLA 3F7NA 4RS3A 3LKVA 1BVHA 3MIZA 3Q7TA 4G0YA 4YLEA 5EWMA 1VLZA 1MB3A 2NUBA 1QP4A 2VUHB 3NNNA 5KQLA 4IMIB 1D5WA 2MYUA 4RK6A 4MR9A 3SG0A 5JS2A 1FFGA 4OLAA 1Z25A 2NZUG 2ID9A 3O2QB 1NXVA 4RXMA 4KQCA 3RVRA 2LUOA 1JH9A 2FQYA 3MM4A 4Z99A 1ZH4A 1Z18A 1Z13A 3H6GA 4Z4EA 1C4WA 5I4CA 4LDZA 2FEWB 1JHZA 1M5TA 1FFSA 2E4WA 3EDCA 5ED4A 3C3WA 4EYGA 3BRQA 3QK7A 4RK0A 2E4YA 3O2JA 4WXEA 4CBVA 2RDMA 2VYCA 2QVGA 2A9RA 1RPJA 3H1EA 2P9HA 3C3MA 1SXHA 4KZKA 1NY5A 2PJUA 4HNSA 3JPWA 2E4VA 4EYKA 3QX8A 3KJXA 3MA0A 1YK0A 3DGEC 3FMVA 3ILHA 3LUFA 1ZGGA 3KKEA 4HYEA 4JA2A 3TB6A 5KQGA 2ID7A 3DZDA 3IPAA 3HDGA 3EGCA 1DC7A 1JF8A 2QU7A 2M98A 2LBPA 2PL1A 3O2SB 4YR7A 2FXIA 1DCMA 4RK4A 4XASA 3N0RA 5BRJA 1NTRA 2WWVD 4QPJC 1ZY2A 3KLNA 3KSMA 1NXOA 2NT4A 3SY8A 2QW1A 2TMYA 1F51E 4RXTA 4MS4B 1QO0A 3H5WA 4XFKA 3LUJA 3CRNA 3HJFA 6CHYA 3LUCA 2FQXA 1KMIY 4DQDA 3CNBA 4UHJA 2MSLA 3GBVA 2NZVG 1PNRA 1DCKA 4M88A 3RH0A 3JS5A 4MQEB 3GL9A 1ZAYA 1L5ZA 5TQJA 2IKSA 3JVDA 4XARA 5JNUA 4W5TA 2HQRA 2LPMA 1APBA 2PUBA 4N0QA 5HKOA 1EWTA 2HQBA 3GBPA 2IPLA 3F6CA 3HUUA 3K4HA 2WB4A 3OO0A 4ML3A 9ABPA 3HV2A 3OLXA 4Z9BA 3H5LA 2IYNA 3I42A 2X7XA 3L6UA 4G0MA 3CZ5A 4RK5A 2PLNA 1P6QA 1KRWA 3H5TA 3H1FA 5T3YA 2GBPA 2IPMA 3C97A 4NQRA 3RVSA 1QO0D 1NXTA 4F12A 3NNDA 4KMRA 1MAVA 2AYXA 3M9XA 2FN8A 4N03A 2L17A 4G0XA 1ABFA 2MYTA 4Z9AA 1TLFA 4IF4A 3RVNA 3T8YA 5KC9A 3N6VA 2RGYA 2RJOA 3GT7A 3H1GA 2WJAA 3HSYA 1W9HA 1E6MA 5T7BA 2HPHA 5HM6A 1U04A 3BREA 2QR3A 3LMKA 3QELA 3OM1A 3QLVC 3GWGA 3JVIA 1PUXA 3HM9A 4JB2A 3VNBA 1DZ3A 1EHCA 5DLEA 1URPA 1JBEA 3ILYA 5KQPA 1JFVA 1SD5A 4LDAA 1CEYA 1NXWA 3D8UA 3F6PA 4RU1A 1JX6A 3K9CA 4Q6BA 2L2QA 1QKKA 1A0OA 3HK2A 5B3JA 1LK0A 3TMYA 1Z16A 3JY6A 3G85A 5CNJA 1VRVA 4FB4A 2GWRA 1OXBB 1Z17A 3RVKA 4F8JA 4MPTA 5FWXA 2JK1A 4TLMB 4UHKA 1SRRA 3FDFA 4MS4A 5GOTA 5HSGA 4RSMA 4EVQA 2FMKA 2H0AA 4HNRA 4LRQA 2LP4Y 3Q7RA 3KLOA 3OMWA 2JVKA 3OMXA 1PHRA 5EWLB 4Z4FA 4YRZA 3KCNA 2PAFA 3S99A 4LE1A 3O1HB 1WETA 2A9PA 5KQMA 4MR7B 4TN5A 2FQWA 4O1HA 3ROTA 3VNAA 3A0RB 4TLLB 1QNLA 2HQOA 4LZLA 3LKBA 3IDOA 3NBMA 1S8NA 4Z4CA 1RZRD 1A04A 3MF4A 3UKJA 3M9WA 1BA2A 1YVUA 1D1QA 2JVIA 1DRJA 4OG2A 1RZRA 1DBPA 4WXMA 5CHYA 2CD7A 3N0XA 2WMYA 4YCSA 3OO1A 2OQRA 5IUKC 1ZDMA 1QQBA 5IBQA 1KGSA 5TQ0B 3TX6A 5C5EA 3KG2A 3Q7SA 2RJNA 2YHBA 4H3HB 3C3KA 2GX6A 3RVLA 1MIHA 4MS3A 4YGXB 3NNSA 2HSGA 3LUAA 3CG4A 4Z4GA 1DBQA 4D6XA 1DC8A 2PUCA 2NT3A 4MLCA 3GRCA 2IPNA 5FBKA 4G0ZA 3EQZA 3RVMA 1JWLA 1GUBA 1QPZA 1T34A 1ZESA 4IMJB 3C6QA 3N0WA 4W5RA 2KYRA 4PE5B 1ZVVA 3QLVA 1CYEA 2FLKA 1RNLA 2JBAA 3T38A 2QXYA 2I6FA 4Q6WA 3OM0A 2L18A 2DRIA 1NXPA 4OATA 5KWSA 2VK2A 4MGEA 3DLBA 3G1WA 1KRXA 1LBHA 4ETNA 3H5IA 3O74A 4H3KB 2MYNA 3OQNA 1LBIA 1JFTA 4QYWA 1QP7A 4MQEA 1L5YA 3E61A 4L4UA 4OBBA 4QICA 4RKRA 4GNRA 1GCGA 4N41A 4WWHA 1K68A 2MYPA 4TMYA 3ROFA 2E4UA 2FMFA 3T6KA 2AYZA 2FMHA 3CFYA 5BRAA 1XHEA 2PUGA 1I3CA 2Q5CA 4RY9A 1XWWA 3HDVA 3MMNA 5HQJA 3KYIB 4Z4HA 5IUNC 5JNTA 2CWDA 2MSWA 2WJWA 3HS3A 4G86A 4OTZA 3KHTA 1EWKA 1B00A 1E6LA 1A2OA 3QEKA 4KQ9A 2PUEA 4RV5A 1ZITA 3FFXA 4RK1A 3EJWA 3A3KA 2LIVA 1AB5A 1K66A 4XAQA 2J48A 5EWMB 4MYRA 4KK3A 1TJYA 5KI6A 1DG9A 4KREA 4E7OA
chains in the Genus database with same CATH superfamily
1Q21A 4WSOA 1KOGA 4EGFA 2VRCA 3BJRA 1ZINA 4D4HA 3JV7A 3NIWA 4DLKA 5BUCA 2BKLA 4FZVA 1OXKB 1U8TA 2PMCA 1N5KA 3OOJA 1K0FA 1SVKA 4HVTA 1E9SA 1VJ0A 1XKLA 3LF1A 2Q46A 4ZT6A 4BLPA 3IPRA 4OKIA 1IB0A 4GPD1 2XE8A 2ZYGA 3BXOA 4DN6A 1ENOA 4M36A 2PL9A 3HR4A 4GSYA 1G18A 4NOLA 1U98A 3B2NA 3KZVA 3TQSA 3W9UA 1V8PA 2L19A 1Z2PX 2AMVA 3ETCA 4S2UA 3PFWO 5E2IA 5EGNA 3W1EA 4A0HA 5HUHA 1QO9A 2YASA 3W7BA 4IDPA 1U8YA 5AJZA 3M6XA 4YROA 1YR9A 3FFWA 5BWOA 3O38A 3PL5A 1FFWA 5F1YA 3L4JA 1U0GA 4ZEWA 2Z8YM 1JEAA 5LQJA 1AV6A 3FETA 2R8OA 1E77A 3B3QA 4DMLA 4D4IA 1E4EB 4BOYA 4GRDA 1DJMA 2V7VA 2H3EA 5AVKA 4BO2A 3PBKA 2O3RA 5DHQA 1N8KA 2ERCA 2H2FA 5EIFA 3NHPA 3FKSD 2ODNA 5F76A 4JKYA 1DTEA 4RA9B 1Z4QA 2G6TA 2VQDA 1FDTA 3ZHRA 3D0OA 2AKYA 4CKWB 3PGJA 3NI2A 1JE0A 2RI1A 4OXXA 2N1BA 3LV8A 4RA6A 4AKEA 4HWTA 5BWNA 1E69A 4WLNA 4DUZB 4BXOA 4HMQA 5JASA 1MCZA 3IAXA 3VH2A 4K9PA 4EVIA 1FP4A 3CO5A 4PHHA 4ZVRA 2YRFA 3LLMA 1E5QA 3KYCB 1Q0QA 2A5JA 4JEMA 3TRIA 1PU2A 3PDCA 1CY6A 1QVVA 3CT6A 3ULKA 2ZSAA 1P6XA 3BB1A 1BDMA 2IUFA 2JA2A 3KU4A 4X91A 3JQ8B 4B7AA 2BFMA 2PKYX 4RPLA 4ZYVA 5EG5A 1NM5A 3Q12A 1VYHA 4DXAA 4AO8A 4ZJUA 1P9WA 1EH5A 1CULC 2QVCA 1GUAA 1XTTA 2AG6A 4RH3A 2FMIA 3HXLA 4YV1A 2VF5X 3OIYA 4MDFA 3JCZA 2IYRA 2H7XA 1C8KA 4IDGA 3LT1A 4MWGA 4H7HA 4GE0A 4OHFA 2ODQA 1XNRB 1NOIA 1Z07A 1Z5WA 1NGSA 4HOYA 3C4QA 5LZ9A 3AHHA 3C3EA 1FQJA 4B73A 3UF0A 5F7OA 3KUDA 1YB6A 1RHQA 2N47A 3U3ZA 3UO8B 2GXAA 4KPYA 4FM9A 4PEVA 1RXUA 3TRFA 4PTLA 3AVQA 1QZ3A 1U3UA 2IGTA 4REQA 4YMLA 5C8DA 1PYDA 3ETJA 3ICQB 4Q05A 3JZDA 5FA6A 3PNSA 3VZBA 1YJ8A 3C5VA 3GZNB 3IR7A 2CLOB 3NXSA 1UPTA 1R37A 1EIZA 1WBDA 2UXDB 4RUKA 1OHHD 3O5AA 4Q01A 3ENKA 4IQ0A 1O08A 2Z8XA 4TTSA 1PGPA 1Z5VA 4FKZA 3B3FA 1JN0A 1I5EA 4XUEA 5IXYA 5EZQA 3UFXB 3EBOA 4GOND 4QPCA 1MC4A 4HUJA 3A9VA 1JPVA 4BNDB 1X7GA 4R2HA 2NPIA 2JI4A 4I99A 4CHGA 2PLRA 4FIZA 2JASA 2Z4RA 3WGNA 1T5BA 2H7YA 1T25A 2HDOA 3BXXA 3GEGA 4O3FA 5KWEA 1JT2A 1ZQ9A 2GNPA 2X4LA 5EKSA 5TPWB 3H2HA 3UT5A 1I4OA 1P0FA 3GPCA 4LRUA 3ETGA 1GAEO 2WKQA 3OX2A 3HEMA 2FA9A 3A7DA 1OTHA 4HLUC 4UFOA 4X61A 1XU4A 5T4BA 1Z33A 1L5LA 4TYMA 3S2GA 1P60A 1UBOS 2VP9A 3TUJC 2B7CA 1I4LD 2ZTMA 1IONA 1IOWA 1V43A 3KKQA 5A4DA 3NEYA 1MIOA 4WNYA 4CWAA 4RTKA 2DT5A 1LSOA 3IP6A 3IV7A 5F78A 5CFNA 2UV8A 1NASA 3PGKA 3TLMA 3WLJA 1JDPA 2FKNA 2YJGA 4PS0A 3S29A 5AP9A 3UWOA 3RB8A 5JRZA 5JYEA 5KIAA 4EB0A 2F8LA 3ZYCA 2H2HA 5JS6A 4LDRA 1KMCA 1ZBQA 1VXOA 2HHAA 3L6EA 4YI3A 5LOVF 5EZ6B 2FV8A 1D2MA 1SXJB 4KFSA 2GN8A 5B4TA 1L3CA 4H0CA 4NICA 3I9V1 4HRAA 5FUQA 3DAGA 1H9CA 4MYHA 2DQYA 1W1IA 2VNJA 2ZJZA 3PU6A 2Z1MA 1C1XB 5DZSA 4BFLA 2BFFB 1N9GB 2B98A 4FC7A 4DR7B 1JHDA 1SA0A 2Q1TA 4NS4A 4YUZA 1T3SA 3TSAA 1U90A 2Z3VA 4FW8A 4OFWA 4JLNA 2HXYA 2ZYRA 3LLUA 3KSBC 4DR5B 2P67A 2R6DA 1P19A 4FCWA 2GYYA 4MEJA 1Z28A 3G9QA 3MLEA 3UWKA 4GYWA 3OA0A 4ZARA 3I30X 1U2QA 4YP6A 1SCAA 4ZYTA 5FTMA 1VP9A 3BHJA 1LEHA 1VBFA 2AFIE 3CNEA 1EAYA 5D5HA 2OHHA 3AHIA 4G1BA 1BS2A 4IF6A 4LYHA 3CX8A 4V39A 5D3KA 3PFBA 2I4RA 4PAMA 5D3QA 1YJCA 3F7OA 4RL4A 4IZOA 1ZRSA 3PT5A 1BXRA 3C3DA 5KWIA 1ZI6A 1GCAA 3CLKA 2GERA 4UHHA 1BVUA 4Y9UA 3AF2A 3G0IA 1VZ3A 1MA3A 2ZTHA 2D62A 1YS2X 3N5KA 2WM3A 1ZI8A 2GJ8A 4OBWA 1K86A 2HJGA 2ZYWX 3D64A 1RYHA 2O06A 4K9LA 2FU5C 2CF6A 5K3OA 1G5IA 1HYQA 2XEDA 1YOBA 4S05A 3INRA 3M33A 4ZIRA 4DNPA 1YZYA 4P5DA 4N5NA 4ZTBA 5JDCC 4IEEA 4H4CA 4UCFA 3QU9A 5CP8A 5EWMA 1QP4A 4YJFB 4UM5A 2ZI7A 5AW1A 4M1ZA 3NWJA 2A9FA 3GEIA 4S24A 5HS4A 4M46A 2FN7A 4I1UA 4ZVQA 1I80A 4YJ3A 4DIKA 5AK5A 4CKZA 4LEIA 4YRSA 1E7MA 2FX3A 3G1UA 1W4AA 1K7YA 1OX4B 3FPLA 3M70A 4FIDA 4F6RA 1I1NA 4TXHA 2B8EA 3DAHA 1C4WA 5CLGA 4TSRA 1XD2B 2QUKA 1AH2A 3UMCA 1I0IA 2D7DA 1AUPA 1RWPA 1HRKA 3E1GA 2LDBA 3QSYA 2R8XA 4DJDC 3BRQA 4RK0A 4BHTA 4BBZA 1FY2A 4ZCPA 2VYCA 3GJXC 4GYJA 4A23A 5B7QA 2DFPA 2J4FA 2P9HA 3KT3A 1XR3A 3KWJA 3LCVB 1F1JA 4P08A 1UK6A 3KEMA 1GPWB 2K2QB 1D1TA 1UBHS 1OBVA 2VDOB 1E2EA 3VXKA 1IRXA 2ECKA 3WLEA 3KJXA 1P5JA 4PRYA 4L08A 4Z0PA 3LUFA 4JA2A 1FNMA 2Q3HA 2VLBA 1HSOA 2BGNA 2Y0EA 3I37X 2XMBA 4OB6A 4NDZA 1H1LB 1QQ7A 2FW7A 4O2BF 3WQHA 1E2NA 3K6SB 4JP2A 2FSHA 2NO9A 1NWCA 1NYLA 4V0QA 4PN3A 3Q6NA 5IWAB 2FXIA 4RK4A 5U4QA 1DBIA 3N0RA 2Q3FA 1MZPA 4JJEA 3BEOA 4LXQA 2BSXA 3FBWA 4R0NA 5TS3A 1Z6ZA 3ZI4A 3SX4A 1KWGA 3DMRA 3R0QA 1A9SA 3AI3A 1Y89A 3I76A 4JX9A 4B34A 3MJSA 2VCYA 3W1VA 2IH5A 2FFBA 1O9HA 3AR6A 4XVHA 1Y8QA 4BEWA 1N2CB 4F6LA 4NL4H 1XZJA 3K9BA 3GBVA 4GICA 4JXJA 4BX0A 2XI4A 5C5IA 2VJAA 1TA0A 2GESA 4MTCA 1P3DA 1BGWA 2C31A 4A8PA 3L6RA 1M6VB 1Q83A 2H1RA 3GAZA 3GIDA 4DMRA 3SDZA 1IY2A 4K3UA 3MPOA 1C1DA 3RQSA 3VGPA 1H4TA 1C7EA 1T9HA 5DX0A 1EUCB 4I46A 4KYUA 1EGAA 2WIGA 1K88A 1BHQ1 4LV5B 3F6CA 3AF6A 4QYIA 2PNJA 2BP7A 1O5OA 5C7IO 9ABPA 1H3FA 3OLXA 2DGDA 4DWVA 1ZRMA 2ZRKA 2ZCUA 3H19A 4JFAA 2IYNA 4CLOB 4TKZA 4X45A 2O6HA 2CMGA 4LWPA 5B6PA 1IZ0A 2KJQA 4QATA 4LHXA 3L01A 2HU7A 1L4EA 3LCRA 2X3FA 3V1LA 3VO9A 3ZLJA 2ZUSA 4KMRA 1Z5PA 2ZR8A 2ACKA 2I66A 1JTFA 3HCPA 2O2CA 4ZO6A 1FB5A 1GPDG 1OJLA 1D8AA 3C5CA 3RVNA 1C4OA 1L6RA 4CMGA 4O2RA 2BRUA 2FSUA 2PT9A 1J0DA 5I45A 3OJOA 1IUPA 4RCZA 4ARUA 4AD8A 4MW0A 2XWJI 1SHKA 4JEHA 4DOMA 4MI3A 1PBTA 4EHAA 4H2DA 2Q5EA 3AEQA 4G56A 3DAOA 4RTLA 1Z0IA 4JI5B 2V7XA 3MXOA 4V1CA 1FFHA 4I5IA 2EJUA 1R4MA 2QVZX 3ANLA 3E0XA 1F6DA 1XMVA 1WUYA 4RC9A 4DARA 1UDWA 3IKVA 5A6SA 5CG2A 3TZLA 3E15A 1RAHA 5T6MA 3R74A 4M8SA 5GM2A 1LK7A 5HZGA 5E1BA 5DSZA 1RYYA 5ECDA 3T7JA 1PO7A 1L7NA 3ABQB 4OGWA 1ATZA 1UBFA 2OTCA 3FG9A 3LSTA 5FULA 2B5WA 4L6CA 3ELWA 5E7MA 3WNBA 4KQ2A 5ETJA 3A4TA 4INJA 3LAWA 5DGIA 3D4LA 5CH3A 5H70A 3S7ZA 1I1OA 3GLFA 2YIVX 3OP4A 1SRRA 4I2VA 4DA8A 1U9IC 4D0RA 4RAQA 1JDSA 5AKZA 5J59A 4XVQA 1HNWB 3Q8XB 1E4YA 1F20A 2FPOA 3LVRE 1NFRA 1XEWX 2PD4A 3TR0A 3NVKI 2BFPA 5B2EA 4K6MA 4V03A 2PZAA 4CMIB 3PXCX 1XA0A 2GYWA 2JF0A 3BMQB 1LQUA 3K0KA 4O1HA 4ENPA 1R16A 1OIWA 3UJCA 2AK3A 4P4LA 2G5TA 2I4IA 4TLLB 5JQGB 4CKCB 4LZLA 1UAYA 2SBTA 2YV2A 4ITUA 3SVTA 2OCIA 3U3RA 2H4JA 1Z5GA 4TTIA 4PYOA 1Y3HA 4UD6A 3W7VA 3LT0A 5IPFA 2EKQA 1O77A 3A58B 4XKJA 3QKRA 4MVJM 2BKAA 4LNUB 3NHRA 1HZZC 4LX0A 4PO3X 1QCZA 1Z73A 3U7HB 1XDWA 2CCKA 1IY9A 3GJ7A 4YJ3F 4AG3A 3KM0A 1KGSA 1H0RA 1Q1QA 2NAFA 4FONA 3LY8A 4TX1A 2R6ZA 4C01A 1FMJA 3MOGA 1IE3A 4PYJA 3WLNA 3CB4A 3QWHA 5EQJB 1SB9A 2D5AA 2QUJA 2QAJA 2DU8A 2ZVDA 1UODA 5CVJA 2JBHA 5DN9A 4DLAA 2I7VA 3T3IA 3E27A 1KETA 3TG8A 1FQOA 2E5FA 3OQ6A 5J43A 4QL3A 4B2PA 5H16A 1G6Q1 1GEEA 1MMFB 2KYRA 5TARA 4CPDA 1O94C 3PDHA 1T9KA 2R44A 3S55A 3W8DA 1VM6A 4HXYA 3TVTA 2KX7A 4RF4A 1C8LA 4QAQA 3SF8B 1EE9A 5BQPA 1E9EA 5JOQA 2GTHA 4MGEA 4KAAA 1RBMA 4TS1A 2ICAA 3CPHA 2IXEA 4HPXB 2B4YA 2FFHA 3PQFA 4RPKA 4XWYA 1Q6ZA 1JQ5A 1NQ5A 3WAKA 4MRRA 1SEVA 2P30A 4L2IB 4F4JA 3GLGE 1KF0A 1LBIA 1N6HA 1PTKA 5JVDF 2OD9A 4RNCA 2E4AA 4D46A 721PA 1UP6A 2ZRLA 2ZJ0A 5HIMA 4QICA 4O08A 1NVAA 4TV8A 2X9QA 3C7TA 3D3EA 3KD2A 3QKSB 3DBLB 3REGA 1R2QA 4Z8YA 1IWBB 2XUGA 1RQXA 2JIPA 3T5CA 3LL7A 4G5FA 4JA0A 5IZ4A 4AICA 2CFCA 2PQMA 1A98A 2Q6VA 4K88A 4MIEA 5DNEA 3RASA 5LM3A 2C7OA 2ODAA 3KHTA 1K4YA 1B00A 3A70A 1HZJA 1P7ZA 4HGPA 4RIGA 1K7SN 3NBYC 4WASA 5A6VA 5CB4B 3FFXA 3J7TA 4F85A 2ZRAA 3JSAA 3RRYA 5GV7A 1SC4A 2VPXA 1P0CA 3UK1A 1O97C 3GIWA 1Y3CE 2CK3D 4MYRA 1ESDA 3QENA 3UOAB 1SUCA 4EA8A 5IJ9A 1BO6A 2UZ3A 3C6YA 5ALTA 5G0VA 2PZJA 4XZ3A 5LZ7A 3WB9A 1R8XA 4CKBA 1WUIS 1MVOA 3MCAA 4FDAA 3L7BA 3BIJA 4UAVA 2ZSIA 2XUHA 3AFHA 3CEMA 3G59A 3OOEA 1Q1GA 1W5SA 2VNIA 4QX6A 4RY0A 3S3TA 5JNWA 4K26A 4DYDA 3Q41A 2HCRA 5KJFA 3TNFA 3L79A 1Z39A 4IIBA 4LSMA 5BN4B 4AB1A 4HQLA 2PGXA 3JARB 1RADA 4O4JB 3TIXB 1TM2A 4DLRA 4YR9A 4QLBA 2WYOA 4CG3A 3LDGA 2XYQA 1NI3A 3WLTA 3UMYA 1PZEA 1E1RA 3KZKA 3C6ZA 1BFKA 2H1HA 3HRKA 3ONNA 2FCAA 4J1QA 5E4FA 4BLQA 2B1QA 3GHYA 4JX8A 3EG5A 3E18A 5KNBH 1FP1D 3W06A 3RUFA 3OLVA 3ACBA 2J3QA 4LWQA 1JZTA 5K6RA 4ZDJA 1AF7A 4I50F 3ONFA 4NU0A 5BWBA 2AOWA 3DQQA 3OFJA 1Z2DA 3CUUA 4AW9A 4GQAA 1KJIA 4EVSA 1Y5LA 3WK6A 1ZUD1 2H5EA 2IDKA 1RXVA 4E33A 2WJIA 3MJCA 4YLYA 1FYVA 3NHBA 1L8XA 1J0XO 3T9EA 3VH3A 1X3SA 3DDOA 1RAFA 3BJMA 3AUSA 1A50B 1RWVA 5FCDA 4K9NA 1ZOIA 3I6BA 3O4FA 3EIFA 4MQ6A 3ZHZA 2OV1A 3HACA 3K8ZA 1W2GA 2GYVA 2QQGA 3DV9A 5WRFA 4RTSA 3MVEA 2AW5A 2VNSA 3W3AA 2QJRA 4Q4CA 3HVRA 1IU9A 3SR3A 2GLUA 4GBED 4MGIR 4A2PA 2GBLC 1GCOA 4JVSB 4WESB 4F3TA 1GWNA 4W5QA 1NVFA 1QV7A 4OA5A 2YS7A 3FTDA 3LRXA 4FDTA 5EJIA 4D6YA 5IJ0A 3QLUA 3LTNC 3H9GA 1BE0A 2G88A 2X4DA 5IC4A 1GR0A 1ZP6A 3WK8A 5AHOA 5KWSA 1FP6A 2B9VA 2CDCA 1TMOA 3U4DA 2SNIE 2WOOA 4UUOA 1JKJA 2B6NA 3H3FA 1E3WB 2JS7A 1SQGA 3DG9A 3RT9A 2A0UA 5K0CA 4RFSA 1J7KA 2HA6A 1U99A 3CPEA 4I9FA 3CLSC 3A1VA 3E3MA 5BSHA 4NV3A 3G0OA 3R0VA 4Q3OA 3EXHB 4B3HA 1X80B 1TMYA 1P1JA 3B1XA 5AR1A 5FPTA 5C5DA 2FI1A 1OI4A 2FEPA 5EWLA 1XALA 4OGGA 3LBYA 1AG9A 2I4LA 5T41A 4DKXA 4ARZB 1Z5OA 3G1TA 2BFWA 1HK7A 3HGQA 4HI0E 4IGAA 1KO1A 3CLHA 3I01M 3FTNA 2OZLA 4FE4A 2ZDHA 3A4IA 1E1LA 5JS1A 3QH4A 1SRQA 1CUUA 1RPAA 3EE6A 5EZ5A 2W43A 1KJ9A 3QX9A 4L9RA 3H7AA 2ATEA 2R7MA 3KV1A 4MA4A 5AOBA 1ZD3A 4AJ4A 3NP9A 4REMA 3TECE 4KVGA 4GQIA 1A7UA 4HXFB 4JS0A 2HK6A 2XQKA 3VR5D 2ZTVA 1L9KA 2EJTA 4TMXA 5FPQA 3DZHA 2F62A 3IEKA 4RQUA 4RZSA 1E3JA 1GARA 3PC7A 1PG5A 1OXVA 2R751 4FYMA 3ZDEA 4YAIA 3GJ4A 4OEHA 1D4ZA 2QP9X 1TZKA 2CHEA 5ED0A 5HIIA 2R62A 1FBTA 1RHKA 4RF2A 5E8RA 2AQHA 2M9MA 2I8LA 4XVRA 3PC8A 5EWJB 1ZHFA 3LYUA 2IH4A 3P0RA 4XWKA 3H83A 2LDXA 4KQMA 4D9GA 1QHSA 2GO7A 1GGJA 2DHCA 4QGHA 1NVVQ 1S96A 4BKMA 2F3RA 1Z68A 5J2UA 5J63A 3C3XA 3I9LA 4KE8A 4XLZA 2ZKLA 2O5CA 1IEXA 2D5IA 4GZ3A 3UHAA 1ECCA 3ZDDA 4QNRA 1FYEA 2B4KA 4IJWA 3B70A 4PHGA 4ZT4A 4JC5A 3GVXA 2PX0A 2XUKA 2DY0A 1K06A 2WSIA 3C8HA 3FI9A 3FNRA 2YFHA 4M6WA 4WKNA 5FNVF 4TTRA 4CQMA 1BJKA 3F73A 3RW9A 2WY2D 4H4DA 3KSAC 3FOEC 1USIA 3GGDA 1HR0B 1H2RS 1OTYA 3SFZA 2G72A 5AHWA 3DHWC 4EA9A 5F98A 2NZ2A 1P0PA 1YZTA 2QRVB 3LM8A 4IS3A 4PLWA 3IAEA 3GLIE 1YBVA 3ZXXA 2DG2A 3GGJA 3SJUA 2Q8NA 2G04A 1P8AA 2JAXA 2K4MA 3T15A 1OH8A 1QQAA 5I7UA 2JI9A 3A4VA 5FL3A 4KR9A 4R81A 3WLHA 1QK3A 2Y0PA 2O20A 3IILA 1JBKA 3QITA 4Y2JA 5KYGA 4PXAA 2AMLA 1OZFA 1HYBA 4I1RA 1X9IA 2ACVA 4FNMA 1W7AA 4UXJA 3EYWA 1TKBA 5DX1A 5FPKA 1MGOA 1OMOA 1FVFA 5LCXA 2FZGA 1E0SA 4TT3A 1ND6A 4ND8B 2F90A 1JFSA 3CNHA 1O57A 4UMVA 3RWMB 5B36A 1JYFA 3PGVA 3MJEA 4CFSA 1GUZA 3H6KA 1ZG3A 1VJCA 1E2BA 2IP2A 5E3HA 3FJOA 4PQGA 2J8ZA 3UOGA 1RYBA 1R9MA 3BD9A 4RABA 3ZXSA 4Q34A 1TGVA 5F4BA 1E4EA 2HMSA 3E3LA 4UNRA 1N0HA 3TBFA 2YHIB 1M6HA 1C7FA 2DKFA 4WZBE 3CZCA 3GJ8A 1BVRA 4C0HA 2WHEA 1ZK1A 3QVSA 1WCV1 3RI3A 1Z3IX 2ZJ4A 5A5EA 3LKDA 3IP9A 2X3YA 3AP1A 3QW4B 3ANNA 2X9GA 4O4HA 3U6BA 2P3SA 4Y7DA 3ZDBA 3QVKA 1FW8A 2HEIA 5ALNA 3DKRA 5CH8A 2I3BA 2FOLA 2PRYA 2H4ZA 1EBFA 4YIKA 1A95A 4J1TA 3SSMA 1DRVA 2ZI5A 5JZSA 1BCRA 2PSEA 3VRHA 1WXQA 1N3LA 1W94A 3R9XB 5C4IA 1MJNA 3MCWA 4INPA 5D1HA 3FLBA 2R0QC 2O6LA 1M5RA 3QELB 2G36A 3RSSA 1DQSA 2ID4A 3ROEA 1SUWA 1VLZA 3UA4A 3JYOA 4M0PA 1JH8A 3I52A 3MHTA 1D5WA 2FWJA 3SZMA 1B73A 2VHUA 3BXPA 3NQ41 2QYOA 5EE9A 5JAPA 3OT1A 1VCHA 3M49A 1BGXT 2CJFA 4QVGA 3OF2A 1L7BA 4TMVA 2VBFA 1P72A 1NA5A 1Q91A 2HRDA 2XF2A 2GAAA 4TMZA 2H65A 5K3FA 4E31A 3HL4A 3TK1A 5EIBD 1PTJC 1CY4A 1XXHE 1Q20A 2JLBA 5EJ5A 4Y1EA 2ZE5A 1ZVJA 4V2UA 2RFLA 4J6EA 3MA0A 3VO1A 3PI6A 5EUBA 1DTSA 1MC8A 4L5AA 3GZNA 3ISJA 2V7GA 3EGCA 3ZXYA 2HO4A 3DB2A 1QIEA 1RYDA 1GTRA 2IS6A 2UVDA 4NARA 3LRPA 2LVBA 2WWVD 3BHIA 1RKVA 1ATIA 1KQOA 3HA7A 3JQQA 3KLNA 3KSMA 5A5DA 5J2UF 4LY9A 3SY8A 4XH9B 3RADC 1XCLA 4DQLA 4BYMA 4R8SA 5C8YA 3WLOA 4MS4B 3NAGA 5L8VA 3HN7A 2DKOA 3KLBA 2CFSA 4UAUA 4EKYA 3ITDA 5JSFA 3HJGA 5B58T 5DM0A 1NQTA 1QFXA 3N1UA 2PH5A 3RNLA 1JWAB 3WHKA 1A8HA 3ELBA 4YUXA 3M1LA 5ISMA 2J3JA 4HTAA 4PN7A 3C3JA 3JS5A 1UM9B 2QGNA 4B6QA 4DIDA 4TYWA 2L0XA 3R3SA 3OTGA 4TVOA 4EWLA 1GFIA 1L1EA 4GLOA 4GZMA 4BNKA 5L51A 2RG1A 1NKVA 1EUDA 4FYVA 3EEYA 1NRIA 2POQX 2EBHX 2MSEB 1KZ7B 3JAWB 3YASA 1P2BA 3DMGA 1T3ZA 2XNJA 1PKEA 1EWQA 4JV5B 2HCFA 3G82C 4J1TC 3STXA 4CHTA 1VG1A 3DW3X 4IIFA 4TWAA 1TEVA 4G67A 4I4LA 4IUBS 3L7IA 4G0MA 4KWEA 1RYMA 3Q0IA 4W9NA 1KO7A 4DMHA 1YXMA 2QUHA 3OMLA 1G6OA 4ECAA 4DV3B 3VNVA 2NVUB 3DOIA 4FCCA 3K9HA 1TL7C 1VB5A 3REQB 2CEAA 1JQEA 3UB3A 3VHXB 2ZPUA 4F3RA 2MYTA 2DT8A 2NW6A 3FLEA 3JWEA 1JDJA 2RGYA 3ZVNA 5KTMA 1O6ZA 2NU7B 3DQZA 3UGJA 1B3RA 4IWYA 1AMOA 2PG3A 4LJYA 4HK4A 1JR6A 5TRTA 4U7WA 4M1WA 3KFXA 3ER9A 3HM9A 1U3GA 1I0ZA 1UBEA 3M1AA 3A6HA 1URPA 5HSGA 1XPOA 4NAHA 2XB6A 4F9GA 2XITA 5IFKA 4YC7A 2YJZA 4KN9S 3EWNA 1SKYE 1XIVA 1F0PA 3PQ3A 4Z9YA 1ESEA 2B6HA 4BX2A 2G09A 3LDUA 3FR8A 3THOA 2BM9A 5I7VA 1FU8A 1PR5A 1NW3A 1XQ6A 5T4EA 1QNFA 3AESB 3H84A 1NG1A 2YHUA 3RYCA 1ZK0A 3SOPA 1T3TA 3FPKA 1XCOA 1WB5A 3TKYA 4DMFA 3KOZA 2F3QA 1UDCA 3F46A 5DWQA 4TLMB 3TRDA 1TJPB 5CXXA 4CUJA 4K03A 2J6BA 4MP8A 2HRZA 2A3NA 3RJZA 3MXTA 2PMFA 1ZU4A 4ZRNA 4AS3A 1QQ5A 1T4MA 4PLCA 1PHRA 3KYBA 1DWOA 4YRZA 1Q0UA 1ODSA 1R5JA 2C83A 1MF7A 1H2HA 1Y9ZA 3NONA 4KIJA 1VIVA 4K3VA 1DAMA 2DPHA 3S99A 2ASVA 3FM9A 2OY0A 4A73A 5CCBA 4NWIA 1W96A 2JK0A 3QU2A 1XP8A 2O8DA 4I8IA 2XKJE 3HDHA 5KTOA 3P0EA 4N5IX 1BZYA 1T6ZA 1RZRD 4WLEA 1A04A 1RVDA 3IXQA 5IBCA 3M9WA 4J16C 1JQKA 1YA4A 1MPTA 1IJBA 1M34E 1M6YA 5E9QA 4CG1A 3S1SA 1RWQA 4NOKA 1RZRA 4D26A 4HBZA 1ZD9A 3PPWA 1IATA 3RJ9A 4CMAA 2GR9A 2ETXA 3H2YA 4JUCA 3LA8A 3CX4A 3T54A 4RA9A 2X23A 1BMFA 1BXGA 1ZN9A 2VJPA 2DJIA 3KDAA 4FFBB 3TZBA 4ALLA 4EK9A 3EW7A 5BSGA 1ZBDA 3KFVA 2VT3A 1YDGA 3ZWXA 2AEJA 2ZJ5A 3DEIA 3C3KA 3L18A 5KKNB 3ABZA 3GY0A 3V46A 2Q0XA 2G1JA 3D7SA 3NANA 2JLSA 2NTYC 3IVGA 4OQZA 3T3HA 4F8YA 1AKYA 3L77A 1Z0JA 3M4NA 1RQ2A 3LC7O 3NBQA 2EFCB 3T1QA 3WMRA 1K8YB 1VC2A 1Y81A 4BWGA 1NUQA 1XYVA 4AMYA 4L51A 3FB1A 2QMZA 3GFOA 1FXUA 1ZJWA 1XMXA 3MSXA 1RWKA 4DLUA 2NVUA 5JZ9A 2PSHA 3INNA 1N5MA 1Z83A 3LQFA 3OU6A 1EYZA 2YWBA 4JJGA 4P53A 3UCEA 4ZYWA 4Y18A 4Z9XA 5MN5A 1E4VA 1YB2A 1XCJA 2OHGA 2QZZA 3B6JA 4JHLA 4U4AA 5DK4A 3WY9A 5BW8A 2H1IA 3CF4G 1KJNA 4DUGA 3G1WA 4UJ5A 4F45A 5F73A 1HY3A 2VPIA 2J9FA 3KB8A 1TQ8A 4ZAGA 2VQ6A 1V8DA 2QZSA 2AG0A 5ARBA 4M0UA 4RJLA 4BQFA 4EHFA 3R3ZA 3SQMA 1X8LA 1R3DA 2XTJA 4MW1A 1N2CE 2JARA 2Q99A 2VDUE 2WYWA 4KLRA 3VHXA 4RTQA 3H2JA 2K5UA 2PTGA 4PNZA 4UHCA 4XWTA 2BEUB 2JIOA 1DIAA 1RRMA 1CQPA 4OLFA 2DH5A 5TXGA 4JGBA 3ROMA 2QRUA 2B99A 1QAOA 5THKA 2C8JA 1CZNA 4R9NA 4RY9A 3AM4A 5B5SA 3RO7A 1OFHA 3NWEA 1FJ2A 2EFJA 3DPUA 1YZFA 1XJWA 5HHTA 3THWB 3KQMA 2W6IA 3E9NA 1PS0A 2VPZA 1A9TA 4F93B 4GXTA 5DYGA 4JI3B 4HDKB 1AQNA 5LNK6 3L82B 5LU8A 2IBMA 4P3KA 5KNBA 2EWWA 5NULA 5KU7A 2J48A 1TM3E 2I2WA 4ZOLA 5KI6A 1YS1X 5EMKA 2RAVA 3UB2A 2X58A 5J5AA 3EDOA 4W8OA 4KAFA 4CUZA 1IUKA 3PQ7A 5GADl 2OGWA 1EVKA 4HAWA 5EYPB 3UJPA 1P7YA 4PR0A 3EXFB 3S1AB 2RH8A 2WIKA 3EISA 4CKBB 3A1FA 3QM1A 5K0BA 5JXWA 2HTEA 3DZIA 1KAHA 2A30A 3EYAA 1J9GA 3G9TA 1CY1A 1C3JA 3OT4A 2HZBA 2IXAA 5CJPA 3U4MA 4NBRA 3IQFA 1N2GA 1EGHA 4OD0A 2FX2A 1I32A 4JC0A 4FZRA 3UHFA 2B78A 3OLYA 2RKWA 2IU0A 1R27A 2IELA 3ZWYA 1NY6A 1EFAA 1YDMA 2AI3A 2OORA 3DLCA 2W7TA 4OHKA 4PBSA 3BZBA 5HW0A 3LVBA 2J3KA 4ETMA 3U3KA 4U3JB 4AN1A 3KAPA 4CF6A 4MHOA 1JVBA 1X0XA 3K16A 4KBFA 1JA1A 1XLUA 1V3QE 1FP7A 3PHHA 1IEVA 3FDXA 4OY3A 5E38A 3Q8MA 1US8B 4B76A 3P9KA 4BFXA 4DY4A 1NMXA 3CEAA 5A9SA 1U3TA 4P32A 4V0LA 3LLSA 4YAJA 1HDEA 1TJ3A 1UBJS 3KKNA 5KYVA 5KB3A 4EKEA 2HA7A 4BVBA 1LNZA 2NXWA 3JTEA 3QBDA 5J1SB 1N6RA 3T9CA 1N6NA 1SWWA 1V3VA 2WU8A 1IN7A 1FYXA 2CNKA 4MRVA 2DVMA 4UNNA 4F1KA 2CFIA 6YASA 2RHDA 3O8BA 5I3CA 2SECE 2VATA 4D42A 3M6MD 4MKRA 3IELA 2H1VA 3U4QA 4HQ6A 2XT9A 1EFPA 1CT9A 1J0AA 2W98A 4J4HA 1DIBA 2PL3A 1QJCA 4R6WA 5ESXA 1I3OA 4EHNA 2NPOA 5CFMA 3JPYA 4IKEA 1XCGB 3JWIA 4WOKA 2FG7C 5ALQA 4QRIA 3V5NA 4BB5A 2AJBA 4OJKA 4HLNA 3E9DA 3TTTA 1W6UA 1JIJA 5FAXA 1N8TA 3V34A 2J87A 1ISSA 3SXUA 3A2NA 2CZCA 1NQUA 3T12A 3DE6X 2ATVA 2QTAA 3D3NA 2O23A 4U7JA 5DBOA 5EAIA 5EQDA 5HCUA 4A9AA 3OBBA 1G38A 1RFLA 4S1VA 2D0IA 3O8CA 3MS2A 2XB8A 3I92A 2X8WA 2EZ9A 1W8DA 1F6WA 3QVWA 4HDRB 5EEGA 1H85A 5E0OA 1P0MA 3FFTA 5EOVA 5E6SA 1O97D 1DGQA 3ZIAA 2WUGA 3JQDA 2FSVA 2RBGA 1E66A 2X9LA 4RESA 1EVIA 2HWWA 3RJ5A 1J5XA 1PFVA 4ANFA 4F5WA 4BP9A 2LE0A 2FWPA 3T3NA 1DO0A 3D54D 3GOQA 3VU9B 4X66B 3DTYA 1R4NB 1GCIA 5DU2A 5GONA 5BSFA 1E2QA 1SBYA 5F5NA 1Q3KA 3LXUX 1YR2A 3HCOA 3BULA 4EATA 4JUBA 1UEIA 3QY9A 3TUIC 3ENQA 2ECOA 2B82A 4K6KA 3P96A 3RLIA 2XSZD 2QTHA 4P2GA 3T5TA 2ZUTA 4G0QA 2QXTA 4L76A 4PZCA 5JYDA 1AQIA 5FBZA 4G36A 2XGJA 4W5WA 1QE5A 4JBWA 4L4ZA 1RBYA 1ZWLA 2E9SA 3OQPA 1XZIA 5DFAA 3LFHA 3W3AH 3G5TA 4HSEA 3LL4A 1RAIA 4MUBA 2PX4A 2Y0DA 3PVSA 4FFNA 1LY1A 3L7KA 1N25A 2HIMA 1F8YA 1FMTA 1NLZA 3KV3O 3D3QA 3H9QA 3LZ6A 4D3XA 5FWYB 1A9XB 4NKRA 1YZUA 4UHFA 2O8BB 4CM9D 1A97A 1AKUA 3FUXA 3R7AA 2ONZA 2R8RA 3H5AA 1EK6A 2P8SA 3RWOA 4B84A 3D6AA 3Q5GA 4ARAA 3RS3A 4ZVMA 3KQHA 1KIMA 3WP1B 4UVDA 2BY4A 2FETA 3MRSA 3U40A 1TUBB 3JZMA 3VC3A 1EVYA 4JLAA 3X1YA 4BKQA 5JUWA 4IJ5A 2YXNA 1RRPA 2RAPA 5DGDA 2PUVA 3G9UA 4Y2VA 1NFQA 1PJ3A 4D96A 4LCBA 4ZN6A 3REOA 2WG0A 4ZGWA 1Q1BA 2LCQA 2FF7A 4S3MA 4GL4A 1JKMA 5LXTF 4E7PA 1RMYA 4EVRA 4B4VA 5BOSA 2VNHA 3TZHA 4EQ6A 1I8TA 4XIFA 4OX9Y 3BKWA 1U65A 3P8ZA 2Q1UA 4IG9A 3O8OA 3A9WA 3ORHA 1KO4A 3SYLA 2ZZMA 4LQCA 3WIEA 4EF4A 1ZM3A 2J5RA 3RTAA 2XUPA 4WLUA 1ESNA 1NSFA 5JJBA 1M6VA 1IOLA 2PKXA 1QCDA 1J20A 1SM4A 3T5AA 4A8JC 1JR3E 3RARA 1VG8A 2ZWOA 3N74A 1CR0A 5I7AA 1FMFA 2LKDA 4P22A 3TCKA 2VF4X 4K8OA 1C9MA 1WOMA 1N1GA 2ZRFA 4IINA 3ZU3A 5THXA 1JE1A 2E18A 2QRKA 5D87A 2V7QA 3K4QA 5D00A 4D8UA 3AC0A 2B4AA 1TF2A 5HQ3A 3H1AA 1JLLA 1QPGA 3IHKA 4MRMB 5IT5A 4CLOA 2DZDA 2ISCA 2Z0MA 1T8WA 5I8PA 5ITVA 2HNAA 4DT1B 1KARA 1NVKA 1LLQA 1MX1A 1OAAA 2EX0A 3Q88A 3LUGA 3N9IA 4LQ4A 3PTZA 4YVFA 4J4BA 3RSZA 1CDDA 3EUEA 5EA2A 3PNMA 3PHBE 7ABPA 5KDOA 1V26A 4YT5A 3CR7A 4XR9A 1BAPA 1F2TA 4C3OB 1NR7A 1SCJA 2XE4A 4FYIA 3CLSD 3DEZA 2W2OA 2QVYX 1MJGA 4HADA 1PSDA 1ZH0A 3DVSX 5CT9A 3VDXA 4ZKEA 3ADBA 2FHPA 1DKUA 1U2TA 3A04A 1E0DA 3TOCA 4YP0A 5KQSA 1UAAA 1YCHA 3TD6A 1SK9A 1YB5A 3ZGZA 1PZNA 4JT4A 3WWYA 3GAFA 1QR6A 2NU6B 3H0CA 2IW1A 1WY7A 4LZNA 4HGOA 1L7RA 1YVEI 4JY7A 4H1VA 2NV2B 1DQPA 4OP3A 2X1MA 2OXFA 5TF4A 2RKBA 1OLXB 2C5BA 3WGOA 1DJNA 4RD4A 1K6EA 4JI8B 3I3SR 1AU9A 2GZMA 2NUPA 4FDLA 4KQWA 4NP6A 3VTFA 3ZE6A 3QPCA 3E53A 3R9XA 2O8FB 5FYQA 1OT3A 4KGDA 1PZGA 1R4MB 1L4MA 2DB3A 4MR9A 4F21A 2YZMA 1Z82A 2IYEA 1OPRA 1BYUA 1OFUA 4W82A 4HVLA 2FZWA 4NZYA 3PJDA 4RXMA 1H9AA 3NBZC 4YXWA 1JEYB 1KJ8A 3IDSA 1W49A 1L4HA 2HOQA 3BA6A 3IJ5A 5MN4A 3TDMA 3HO8A 1N2OA 4RIFA 1GNRA 5I4CA 4LDZA 1W8IA 1XI2A 1MAHA 4B85A 2X1LA 1WCIB 5LB4A 4X7RA 3GA0A 2JG3A 4RVSA 2FUG1 2PS1A 4WH0A 3H3XA 3EZ9A 3R7FA 5D3MB 4EKNB 2GDZA 2J9RA 4PWYA 4ER6A 1BKYA 5ENVA 3W5CA 5SV2A 5E95A 2ES4A 4UTOA 1HORA 1Y1QA 2UU9B 1ZA1A 1B43A 2NP7A 2P4QA 5SYMA 4ZOBA 1CZUA 3RU2A 1KR2A 3M6IA 2BMWA 3ZHTA 1UJ5A 3K9QO 3H11A 3H4TA 3OFSA 4LECA 5AUOB 1VHDA 5KQGA 4AJHA 4YJFA 3WR5A 1W47A 5AQ1A 1N34B 2CLIB 1VCOA 1VB3A 4F5YA 4JK3A 1FJHA 1ZS9A 4HUQB 2O2IA 1G7RA 2YXLA 3O2SB 4K9RA 3TVYA 3Q85A 3FRHA 1ZVQA 4POAA 4NCHA 4D0SA 1WQ4A 4QBHA 4MKZA 4N3NA 2BC9A 1W85B 5CVUA 3ITEA 1CJBA 1KE2A 2QT1A 3CSSA 1OH6A 3KPJA 2V6MA 3MJRA 3FTEA 3ESCA 3D81A 1GQFA 4E6PA 2VT6A 2FRDC 2AQKA 3HJFA 3GJYA 1YS4A 3ZI0A 4KWIA 5HZMA 1TIKA 3CINA 3K32A 1WKVA 5F7ZA 3NWBA 5IK2A 5I4BA 2W6ZA 3BPSA 3FOZA 1CETA 1XTRA 2ZFUA 4OM8A 4C7BA 1N0WA 1NF8A 3EBPA 4ACBA 3NH9A 1KFBB 4LG1A 1B42A 4YGYA 4H7IA 4J0GA 4TRRA 3P5BA 1HT3A 3A6FA 1D2CA 3GD7A 3I4LA 2NXJA 3TL3A 3VPSA 3WL6A 4CKWA 2XQGA 5DM2A 2PUBA 3DNMA 4N0QA 4KOAA 5IM4F 2IPLA 3K70C 5ALIA 2CXQA 1P1KA 5ALFA 1PQYA 1Q84A 3H5LA 4PQFA 4S1OA 1SEPA 3L6UA 3Q3VA 3B3GA 2OCBA 3LPMA 4LS3A 4WKPA 4Q1DA 5KSOA 5KOYA 1D3AA 3EA5A 4Q1CA 4GWKA 2E6UX 4DCJA 1ZGAA 2G17A 4CL0A 4NQRA 1OGJA 4MNTA 4RPGA 2VXCA 2KHZA 1A71A 4AVYA 5L7WA 5U9CA 2FUNB 1FTNA 1W5AA 13PKA 2YMMA 3KVRA 1WNTA 4GBGA 4RVGA 1H6DA 3SBXA 3PRJA 1J1IA 4FQ7A 1DV1A 5K3AA 4E94A 4YLGA 3WLIA 3T7DA 3EF3A 1M2KA 4RD3A 1ZUWA 5CIWA 3AINA 1Q5PA 4YUYA 4HEA6 4RL6A 1I7SB 3FW1A 5AQEA 1TKRA 3LMKA 4HH0A 3OM1A 4UQPA 4LY6A 1MTZA 3E58A 4IOJA 4XGNA 4KHPB 4HFJA 1LPSA 5IKOA 2NVWA 2QR5A 3DDNA 2FB9A 4QYIB 4IJVA 1R18A 1IQRA 5CK4A 3X0DA 3RC2A 4MI9A 4EENA 5DHFA 1ZMBA 3KHUA 3VU8A 4CEJB 1IMJA 2F2TA 3F6PA 4ESOA 4UVIA 1DLJA 3KEGA 2NYVA 1Q0LA 2QMOA 4JL8A 2NQTA 2PX5A 3HADA 3NC4A 4LJ7A 4FP9A 3VAZA 5IT0A 5K51A 2DCMA 2C54A 5EY5B 3TTUA 4FXPA 1E9BA 1YB1A 1XXHB 3SF0A 5HRUA 1SXJE 1TYBE 1WUHS 1YR8A 1I24A 1S2MA 3OHSX 4POOA 5KPDA 1L7OA 2HIAA 3GNTA 5F7XA 1XHLA 5SYAA 2HYDA 3PDUA 2EQBA 5AW8A 4IQ8A 4X1IB 3LQRA 4WLOA 1ZUNA 1GV1A 3HU3A 3MMXA 4IDQA 4LRQA 5EIWA 2Z95A 3DDUA 4O4JA 4KE6A 4EZIA 4LKOA 1XD8A 3GBSA 3ZH2A 4C4RA 5C53B 3ACCA 1VI6A 2PMDA 3I5XA 4I6GA 2JIZA 2CNDA 3CW9A 3ILXA 1DELA 2QMYA 3AGPA 4EM6A 4LYDA 3VNAA 3ME5A 5CAEB 5LWHA 3UJDA 3DLPX 1TCVA 2WUVA 4G1UC 1AUXA 4BNMA 3VR6D 3R6WA 1RJDA 2QN1A 3LKBA 4HB3A 2KI5A 4TSKA 4HJXA 1L5HA 4CMKA 2JGDB 1L8LA 2C0PA 3IE0A 2C84A 4PGFA 2AFHE 2VYFA 1M1XB 4YBRA 4OG2A 5NLLA 4DGQA 5CHYA 1HTBA 3AJ8A 3JQAA 1WMFA 3WGQA 4R71A 1TKAA 2IU6A 3IQGX 1HDZA 4I4NA 5HKLA 3U3OA 2CF5A 2I2XB 2OQRA 2AOTA 2PVCA 3KPWA 3QI7A 3KZXA 1EDZA 4IAOA 4KTTE 1KEZA 3D9QX 2H7CA 2VAPA 1FSZA 2BR3A 4NV1A 4OHXA 4WHMA 1SNYA 1RLMA 1WDWB 2BBSA 3EDQA 5C3UA 3TX6A 4GZ6A 4JOSA 1IK6A 3BHNA 1L4YA 3Q7SA 3LXXA 3CZMA 2YHBA 4QOHA 4Y2GA 1BHJA 4CF4A 4EUSA 3I58A 4NJOA 1BS9A 2VP5A 4TL8A 3WRXA 3C4JA 3HXOA 3W04A 4MDYA 2JEOA 2FZKA 3KB1A 5ELMA 3H9CA 3WTBA 2R84A 2WVAA 3PCTA 5AK0A 1I4DD 3I61A 1ZXXA 5G1PA 2PN1A 1XZCA 2E48A 3MWEA 4K6OA 2UZ4A 1FZTA 2ZIWB 5FBKA 4I7EA 4FHGA 4WXPA 5B1EA 3AL0C 3VYUB 1JWLA 1XAGA 1Z2CA 1YBHA 4PG7A 3GVPA 1CFZA 5KJCA 4HYTA 2K2WA 4X00A 2REBA 1OYVA 2YDYA 1WKCA 2NO0A 3WYDA 3QVTA 3QX7A 4TS9A 4JSYA 3OPXA 2LRHA 2L18A 1XRRA 4J90A 3CPSA 4P34A 1R0SA 4Y0AA 3PEFA 4PZUA 3DE4X 4PRLA 1T1JA 2PIDA 3IV9A 1TD9A 3TQOA 3WDSA 2Y1DA 4DQ0A 1Z2NX 4MDHA 1CY8A 3E9QA 2Z6UA 1JEYA 4TKLA 2R1ZA 3ZCUA 1J7JA 2GM5A 2IY8A 3EGEA 3B6IA 1Z8FA 2IF0A 5J4KA 1N36B 2JGIA 4QYTA 4P7FA 2RGUA 4Q3BA 1CQZA 1VLVA 4E3WA 4W9MC 4ER3A 4L8VA 3AM1A 4UEOA 3IP3A 4ZV9A 3LZCA 5BV8A 4QGSA 5AVVA 1DKOA 5HOEA 4US2R 2BV3A 2ORVA 3I8SA 5HIJA 2NO5A 2PQ6A 1SR8A 4DCTA 1MNQA 2XDQB 3CRQA 4TQAA 2Y9MB 5EXEA 1OSNA 2JIBA 3PXDA 3JAKA 1YACA 4KAXA 4EMSA 4Z4HA 6GPBA 4C88A 3U31A 3FSRA 4IHAA 1XAJA 1TT7A 2GOYA 5TT1A 5CA0B 1RLUA 5IW8A 1E3TA 1JUDA 4DHEA 3DE0X 5D8DA 2P2CA 1ULTA 4OUDB 4MROA 1XDDA 3LRTA 4K6FA 5JHHB 3IO3A 2C61A 3WGVA 2OAP1 5TB5A 2I6TA 2Z56A 1DG9A 4PZYA 5IMBA 2H48A 2QTNA 2YJTD 2ONYA 3FDZA 3G2HA 4L2IA 2VL7A 1V95A 4JJ8A 3CEPB 3B3JA 3IAFA 2E4XA 4AY4A 1EAMA 4XQ9A 2JLCA 3PUKA 3O1LA 4GOOD 4H15A 5G4KA 4EBFA 4KLAA 2ZW9A 5J5CA 1ONSA 2EEZA 4JYCA 5TMBA 5D5QA 5BQ3A 1F8GA 1TJNA 5TX7A 2C2HA 4G0OA 5CAEA 3AJRA 1PSWA 3KB2A 5AI9A 3WQRA 4DV6B 1GU0A 3OJCA 3TS1A 1QRSA 4GR5A 2Y0CA 4UPEA 4KMMA 2AN1A 1HQDA 2HMYB 4B87A 1CRLA 2WD7A 1MO5A 1QRUA 3HVJA 2I8AA 2XRMA 5DVZA 3RDPA 4NY1A 1JSXA 2J6CA 2ORIA 2ZB3A 1C30B 3QKWA 4CQLA 3NOXA 1GAXA 1HO3A 1E98A 3P0IA 1L7AA 3OLCX 3QWAA 4EFNA 4EKDA 3TXYA 1M0WA 2F8TA 1AQLA 3LX5A 2VLIA 3W6NA 4KPEC 1N4DA 2D1YA 2ZZKA 4C0QC 2HRCA 3GX1A 4ZT7A 2X8BA 3HKBB 4X6UA 2EAUA 4DR6B 1I7PA 4I5GA 3SC2A 1F9AA 1HWYA 1YKFA 2CBZA 2ZYSA 4FFOA 3RFFA 3WZMA 2PZGA 3ML1A 4ZPXA 5E3IA 3H1PA 4PLYA 2ZRHA 4L5BA 3U49A 3NTQA 3GCZA 3SI7A 3AMVA 1HXHA 4H1WA 1VL0A 1WBBA 2ZAGA 4GECA 2NUTA 3DMTA 1IB6A 5KJEA 4D9MA 2ZWVA 4DAEA 1QLWA 4ND8A 4FBMA 3NHFA 3BXFA 1UXJA 2CHGA 3CEHA 1U4SA 2ILTA 3BJZA 3OCVA 1NQOA 3ZLVA 4QQRA 4DNFA 4ZTZB 1BKDR 3UY4A 2O4CA 3LOUA 5EVCA 1CR2A 1KFKB 3OLWA 3CPJB 3PC3A 1GPYA 4OXKA 3H2SA 4UU7A 1K89A 3RS8A 1OA1A 3GA5A 2AOUA 2H2GA 4CM4B 1Y3DE 4MP6A 3AUFA 5I7HA 2DTEA 2IY9A 4IIGA 3KEOA 2YC4C 2CLSA 4PBRA 2GRAA 2HWKA 4RHEA 3R7NA 1UZUA 1EP9A 1R0RE 2CUTA 3HCWA 1WXWA 2W2VA 1YZGA 3AETA 3G7NA 3KYDA 3MZ0A 4E46A 2O2YA 1MX5A 4MH0R 1ZYUA 4R98A 4K2AA 5HS6A 5ALPA 2WAMA 5CLJA 1N2CA 3T06B 3I6QA 5JR3A 1K1EA 3RV4A 2PEZA 3H9JA 2VNAA 3DH0A 4PX5A 1N9GA 1JFLA 1DWPA 2WTMA 2OCLA 3ADOA 1NP7A 1PR9A 2ZREA 3EEBA 3ZTTA 4C0AC 2PUJA 2GKOA 3GEPA 1PR1A 5F4ZA 2XZLA 1MHTA 2C5GA 4N82A 1E9CA 1G3UA 3CF4A 2IDMA 4DPKA 4MI6A 3EIHA 2H9IA 1FRVA 1Z6QA 3N2NA 4EI2A 1D2HA 4DE5A 4UKDA 4BASA 4CDMA 1V41E 3LWBA 4YCLA 4EFDA 5JTUA 3EUAA 3WGJA 1JQDA 1OZGA 1R8YA 2B61A 2P90A 2DWPA 4G09A 3IUSA 5LZ4A 1XK7A 2CC2A 4UE2A 1WUJS 2XRFA 4DCUA 5KO2A 5H9VA 4GQBA 4GMXA 5DH9A 3HKDA 3H5VA 3TLGA 2ALJA 2X6QA 3ZGVA 2C5SA 1FVOA 5DEIA 4NBTA 5T8KA 3V1TC 3EMDA 2ZEJA 4DLLA 4TKVA 3ZDAA 2QBYB 2RI0A 4ND1A 3SIXA 3K53A 4C0JA 3I9FA 1A27A 1Z37A 2QKYA 3KJFA 5FOQA 1EBUA 1UJBA 1OQAA 1WD5A 2JJ2A 2XNCA 4MUIA 1Q2XA 4HFRA 2WHXA 4NAVA 5F64A 3UXMA 1DV2A 4H77A 5JANA 1Q16A 2QD5A 2YDXA 1RVV1 5B37A 1SHTX 4MB6A 5CTJA 4CCYA 3ROQA 3VYTB 3QX3A 4P2BA 1REQA 5D7BA 1I5OA 2IDJA 4UBMA 4CIYA 3N75A 5A02A 1N3IA 1PD1A 1OH5A 4TN1A 4R41A 2VEOA 4IRMA 3U7FB 4C3ZA 3KQYA 1JJVA 3RSOA 4W6QA 3DMHA 3RS7A 5EVJA 4Z53A 3B36A 5IN4A 4D9NA 1XOIA 1JMKC 5JCOA 5HILA 1PGNA 4PO1A 4BGUA 4EYKA 3MYRA 4I50B 4MYUA 2TSYB 4TKMA 4UULA 4YRDA 3OCCA 1U2EA 4E15A 3KQKA 2B2NA 2WF8A 2QNBA 3RC1A 1GTJ1 3D8BA 3RRFA 2C96A 2YVQA 4TZ6A 5K0FA 1ODIA 1QV9A 1STOA 2G07A 3RRNA 3IALA 2R25B 4TSFD 1T8PA 3OE4A 2JI7A 2C5LA 4LXIA 4B3XA 3C3CA 4G5GA 2EFHB 1FTSA 3AQ4A 2PZKA 4JYAB 4IIDA 4G6ZA 2XDWA 5DMXA 2CXNA 4RLHA 5CLIA 2GKGA 4YJDA 3U61B 3T1HB 1QU3A 5JAQA 3HRIA 3WLAA 1PZHA 1QF9A 1TVMA 1GA1A 2QROA 2OMKA 3LW8A 4FGLA 4RY8A 4ZEMA 5JNVA 1P73A 5JWHA 2JGRA 2O3QA 4CTMA 5B30A 3L46A 3MS4A 4QT0A 3QY0A 4TWZA 3STVA 1AUQA 2E82A 1FTWA 1ML3A 3GDGA 1TTQB 5CPFA 4QTXA 5EE1A 4EARA 4EGSA 7MDHA 4LN1A 4F84A 3W90A 3P2KA 4F3CA 1PL6A 3EA0A 2XB4A 1R9JA 1WMBA 3P2EA 4G3XA 4PPFA 4Q19A 3Q9UA 4RKQA 1I33A 3QYJA 1VMIA 1TJ4A 1XKQA 1E61A 2XMCA 2VP2A 4HQOA 1FK8A 4TUYA 3UPDA 2QMEA 1VPVA 2J46A 3IUBA 3WWEA 4HDSA 1U2GC 2J31A 4DHWA 1H0KA 3UC5A 3COSA 5ALEA 2EGGA 3OQHA 1OPXA 4ND6A 5E7IA 4B40A 9GPBA 4ABTA 2E5LB 1NLUA 5JSYA 3ZTWA 1BX1A 2GHIA 1ODCA 4AQYB 1P5HA 1XV5A 4ZV7A 2PX2A 4KAJA 1ZKDA 4K46A 2IZ1A 4E22A 5JY6A 1EEXB 3WTCA 5KVVA 3IOBA 4M8IA 1COWA 1RQ7A 1ECLA 1V37A 5DJ5A 3VVBA 4FGSA 4KMSA 3PPXA 4ZO8A 3MIZA 3Q7TA 4CG0A 3ICWA 2UUBB 2VUHB 1S8FA 3C6MA 2FSSA 1YC5A 2WIDA 2XKBA 3QBTA 4O02B 5DI9A 1ISHA 3S2EA 3W2GA 1SKMA 4P0TA 1M83A 2WUWE 4CIXA 2AF3C 1NJSA 4KQEA 1MIOB 2ZP1A 3F2IA 4H08A 4MIYA 1D4AA 5F7JA 1KMMA 2O8FA 3JYLA 1ORVA 2QPAA 1NSYA 1X1EA 3M5DA 4BLOA 1WXDA 3EA4A 4BRZA 5BV2P 1Y4UA 5TF0A 3ESYA 5MF6A 2FEWB 1UADA 3CKLA 2Y2UA 1IH8A 3EDCA 3TSOA 3UAGA 3T35A 3ZV3A 4CTNA 1XAIA 2YJ5A 5TMPA 2EX4A 3O2JA 2Q9BA 2XJ9A 4PXSA 1N6IA 3FOBA 4WCFC 1M76A 1YQDA 2G63A 1OXUA 3HWRA 3AG6A 4CT0A 4HDNB 3QFCA 3WIVA 4GLJA 1EDEA 5FV4A 4TYQA 4E5DA 5LXTA 1Z36A 1ORIA 3FMVA 3I2JA 1ZGGA 3HBLA 3L5KA 3BEDA 4YRFA 1A69A 4UCQA 3TB6A 1YKSA 2FZ4A 3IPAA 4PNPA 4A1FA 4WZ6A 4IHKA 1CJVC 1LA2A 5EJAA 1MJFA 1TEXA 5C7YA 3FUVA 1NBME 3ZWOA 5LFAA 1SKYB 4FOLA 1E1QD 3VR4D 1CUZA 3CSDA 3V80A 1EESA 1ZY2A 3DXFA 5AVQA 5BURA 3CEJA 1PDOA 5JFOA 5F2EA 1IN4A 3D1LA 3SFVA 1ZRNA 1A2KC 1QB7A 3IUYA 3RYHB 4DG8A 1N2SA 3DNFA 4L27A 2QT9A 1UPFA 4BB0A 4ID9A 5TGTA 1IHUA 3D6HA 2KPOA 3WHPA 4QSHA 2D0OB 2VP0A 2H54A 3DAYA 1MC5A 4NR0A 4QFMA 4Q4AA 4YMWA 3D5EA 1BJRE 4DREA 5HYVA 4ESVA 2DEUA 1PNRA 2V7BA 3NVDA 4NQZA 4U0JA 2B7LA 1AO0A 1EB8A 1PDWA 1X9HA 2IZZA 4Y2PA 4E09A 2RKOA 1QQTA 5FHRA 2IKSA 3JVDA 5CA1A 2ZBQA 1FS4A 1WW2A 4WOBA 2ANCA 3FPAA 3OZXA 5BW5A 3GCWA 3MWKA 1G8FA 2QAGA 1DO8A 2IRWA 3AZOA 3DO6A 4TLAA 4WV3A 5CT6A 3NCTA 4QA9A 2LW7A 3G79A 3UHJA 2P11A 4Z9BA 4PYQA 1LBQA 2CT8A 2PYZA 1T4BA 1EFVA 5IBRA 3HYTA 4RK5A 5KSPA 5HOQA 4OL0A 3OZDA 3H18A 4IP0A 4QBTA 1IK4A 1H2EA 1PX0A 2C3UA 3B1VA 3IMEA 4IKPA 4P3OA 3SOZA 2K7FA 2GEVA 4BNZA 2QTRA 1NXTA 1H0SA 3KOWA 2IK8A 3NNDA 2OOKA 2GHQA 4G24A 4NBNA 5HCNA 1EP3B 2ZBDA 4BUJA 4DDKA 3EEOA 4C7VA 1ZEJA 3DJYA 4XSHA 1M0EA 1WWKA 2GD2A 3O93A 3CX6A 5JARA 1L4NA 3D0KA 4HY3A 1JKJB 1UC8A 2MINA 3QLJA 3N2LA 4IQ4A 2HJWA 1PQWA 2GAJA 2HB6A 2RCNA 5J2TA 3DOHA 1C3VA 1RM5A 4YI5A 3TZEA 4AG5A 2WF9A 2WWFA 4NBVA 1TZ2A 2VXBA 3JVIA 4G1CA 4D81A 4JB2A 3QG1A 1AHIA 1EHCA 1VI5A 2VHJA 2WI8A 3K2QA 4LJ6A 3ILYA 1U80A 4MV9A 1Z0FA 2F3PA 4C9BA 1XTSA 5KQPA 5DXFA 2O2JA 1CEYA 1R10A 2P6OA 2G9RA 5CLHA 5LUAA 4P92A 5TEWA 5DM70 1IRIA 1QOZA 2O2EA 1IHPA 2W2NA 2VKQA 3IPYA 4MW5A 1E6UA 1NE2A 3HA5A 3NT5A 3STHA 3BFPA 1IQ0A 1GZHB 3Q6MA 2D6FA 2RBEA 4BAZA 3NRBA 3GUUA 2QN7A 1PYGA 2MSCB 2ZOSA 4BP1A 3CH7A 2WW8A 1OIVA 4DLPA 3F8SA 3RVKA 4F8JA 1LPPA 2H07A 3DT9A 4EH1A 2O19A 3T4EA 3B9PA 2G1PA 4UHKA 5PGMA 4E6EA 4W7IA 4B0PA 4BUZA 2FMKA 4HNRA 1LQ2A 4Z7JA 2V74B 3B7GA 3M82A 1BIFA 5LPNA 3GQBA 3OMWA 4IICA 1W76A 1WSDA 3FHJA 2ZWIA 3PUJA 1VL2A 5CM2Z 1DS6A 4DWOA 3L1VA 3LW7A 5HM8A 1GGEA 2J5KA 4B45A 4CGYA 1MOPA 4YT2A 1DX9A 2BZSA 3FUWA 3WB1A 4R1NA 2WD8A 2DMRA 3RRXA 4BO5A 4OU5A 3HM2A 2WFLB 4HD8A 1NV9A 5AJHA 4DC9A 3CZPA 5GJVC 5AD1A 2JBWA 2BMEA 2Y1WA 4R2KA 5DOZA 3VR3A 1KJWA 3W5IA 2FSFA 4BVJA 4QECA 4BN0A 4KITB 2P9FA 4KSBA 3DP9A 3BS4A 4E5YA 3BWYA 3PC2A 3LPAA 4TYPA 2BUCA 4E5VA 1K8XB 3H42B 5TVGA 1IJEA 4WXYB 5CB8A 4M22A 2TMDA 2CD7A 2GETA 4ZGGA 1H6BA 2WMYA 4BE7B 1LPMA 4D8XA 2R7LA 1T15A 5BQ5A 1X7DA 3SE7A 4Q9LA 4M0EA 3R3WA 4FCTA 5M29A 2C5EA 3CVOA 4FHCA 1ZWKA 2EEPA 4KVZA 1RRGA 4A2CA 5TQ0B 2OHIA 3HYNA 4FBGA 3R6TA 1DMSA 2YBEA 2YWCA 1Y3BE 2Q1XA 5KOJB 2IA5A 2NSJA 2YVUA 2FP4A 2X8AA 4WXRA 1Z6YA 3DHYA 3OIVA 3IXMA 5FBLB 3ICCA 2A0WA 3EGDA 3M1IA 2B0JA 4Y3UA 3H3JA 5AK3A 5EMLA 3MMSA 4ZAYA 2P65A 4F2DA 2VTBA 3OOWA 3WQQA 3I1JA 2D13A 4CTJA 1SBQA 5LC1A 3RIGA 1RQRA 3UQZA 3O7WA 1GG8A 4PPGA 3O4JA 2G4VA 2R6JA 1VP3A 5CA1B 1NWHA 4IJKA 2CVHA 3OOHA 3WKCA 5K5EA 2P9EA 1PJTA 2QX4A 3X2EA 3TWOA 5L4LA 4P6VF 3I5MA 2QDXA 1FA9A 4AYWA 2AG1A 5FUXA 3WV5A 4N39A 5DM4A 4Q4JB 4F7DA 1VHJA 3WZLA 1VJRA 1T36B 3ZR4B 4DSZA 1N75A 4ETNA 4IWNA 4IFTA 3AF5A 3QA3E 4IDNA 1NI5A 1X38A 1RE0A 3PRYA 3RIXA 1C0KA 1WULS 4FX2A 4KEAA 2H5LA 2FRVA 4I5DA 2X77A 4F9TA 4BPBA 3HCAA 1SELA 1JJ7A 2D2IA 1F2UB 1DIGA 4F1WA 2C7RA 3MCZA 1CY0A 3I53A 2BMDA 2XHEA 3CA8A 4DJFC 5CDYA 4JP8A 4QHSA 2RGBA 4UCXA 2QAGC 4TMYA 2E4UA 3RAEC 2AYZA 3Q2IA 1XHEA 2Q1YA 1I3CA 1MN6A 3CCFA 1R64A 1GOTA 3D2CA 3LYHA 4IQFA 2JHFA 3G8DA 2QLLA 1VBMA 2EATA 4O29A 2MSWA 3O83A 4G0NA 4L1KA 3SEAA 5ALGA 1E6LA 5KYUA 3A31A 1D8TA 2PUEA 4DY6A 4J7XA 1ZITA 4BX8A 5CEEA 1JHOA 3WK4A 1L4BA 3L1KA 1SUFA 2JKYA 4FMBB 3EIEA 1SCKA 5I7OA 2PR7A 1FJXA 1UP7A 2D4HA 4U6SA 5CFQA 2BN4A 2ET6A 4D4JA 3B5IA 1E60A 1ZJYA 2VHCA 2YW9A 5AVZA 1OY1A 2ZT6A 4RTRA 4MO9A 3LHFA 2Z83A 2QTTA 3FLAA 3PUWA 1JTEA 4OHZA 3VH1A 3PTAA 5JEDA 1E5DA 3HE3A 3GH3A 4QAJA 1T3LA 2GCNA 5CDHA 3URMA 1EVEA 3L43A 2MWMA 4TVSA 3PUHA 3C48A 5K0SA 5JXJA 2W58A 1ZO8A 2AOXA 3QSGA 3NUZA 4AJEA 3QVLA 5LD2C 1L7QA 2ZK7A 3D8NA 5EP1A 1ZOPA 3BAFA 4NG4A 3GQBB 1K08A 1E1NA 5HJ5A 2J07A 3JYNA 2ZANA 5P21A 2JAHA 3SAJA 1U81A 4IV8A 3PFNA 4DMUB 4D7AA 1K4MA 2B4QA 4D79A 2APJA 5GZ3A 1WOYA 3D7RA 2H2DA 1Y0BA 3EH1A 5CR9A 4V0ME 4HEHA 3RRJA 1M6WA 4XIJA 2ZAOA 3O8OB 1Z56C 2HCBA 3MYYA 1UZNA 2AXQA 2NACA 4OBXA 4CMEA 1YVPA 3HKCA 1I7QB 2NO7A 3VNUA 1U3DA 3ZD6A 2PANA 3KJHA 3MUFA 4YHHB 2Q5JA 3WK7A 1DKMA 4BQNA 3U4AA 2P2NA 5KJ1A 2JRLA 3FTQA 4E4TA 3U3JA 5A3VA 3QXHA 1RI5A 5DWDA 4P98A 4YPFA 5DLDA 5IKMA 1L1FA 1GY8A 5TDHA 3EXFA 5KCZA 3GNQA 1T8RA 4EQ6B 5JNRA 1ZHOA 4K7JA 1CUFA 3WYGA 3Q7PA 4B33A 5H3LA 4RGQA 1JU4A 2CVPA 4U2GA 4Q1AA 2ATIA 2P5YA 4E3ZA 2P2GA 1M75A 2WJVA 4YT4A 5JZOA 2WWYA 1TTPB 1N5OX 2H4WA 2Y99A 1MOSA 4MOWA 1JLKA 4UU0A 4MV8A 5HFJA 4D3YA 2QGZA 3PZBA 5IUJC 4EG4A 2HV9A 1XL1A 4CMBA 1VI2A 3NEAA 2OFWA 1YIAA 1HDIA 4K9SA 1M2FA 4IO1A 2GPAA 1SCBA 2E6KA 3H9EO 3HVIA 4N9WA 3MTIA 3J81k 2AFHA 2CVQA 3HZRA 4EGAA 2VQEB 3CWQA 1VKOA 1EXMA 2WIBA 1AQUA 2A9QA 2I91A 4YMUA 4KXXA 2CMHA 3CUKA 2IQ5A 2AH5A 2V3VA 4K6CA 5FFMA 2AJTA 4XYEA 1QYCA 4BFZA 5A06A 1YMVA 5DI3B 1E9VA 1IHOA 3TLKA 1E96A 1R8JA 2HWUA 5F1PA 3MT9A 1USGA 5DE3A 5MFPA 4L5JA 1FUIA 1P39A 3PYLA 3UJ6A 2AYYA 1ZIPA 3DL2A 4P58A 1UZMA 2ZYTX 4YJGB 3WB0A 1CX9B 2C7GA 2IOQA 1E9DA 1TFUA 2G83A 2B1GA 3JQGA 2FGJA 4CU5A 5C1BA 1RAEA 3ICPA 3UK2A 1P6UA 4JP1A 4KUEA 1LPNA 2DHQA 3ICVA 3IPXA 4JROA 4PQEA 4TQUS 5K09A 5KC8A 1U0BB 1M8KA 3WSVA 2FHSA 3N3BC 3DL0A 1QHHA 4GM0A 3DTTA 3AUTA 2DR0A 3DZKA 1I3NA 3FMGA 1XB2A 4Y67A 3U4QB 5LSAA 4K8RB 2ZE7A 2JL1A 4W7HA 4EEKA 3ND9A 4H6WA 1ULBA 2PH3A 3B6MA 3P52A 2A0KA 3VTZA 4ZYLA 3AL3A 3B82A 1FQKA 1AGPA 5BWMA 1WBJB 1XZFA 2WM9B 2XBUA 3T7KA 4H16A 1CLEA 2VVTA 4JQOA 1V35A 1LDEA 1XZPA 1ZXLA 3V7YA 2KWIA 2QE7D 5GONF 1PQUA 5G3ZA 4CCYB 4JEUA 3TRHA 3EPKA 4LX8A 4QGAA 1DKNA 2I5PO 2ZYAA 1M2GA 3CURA 2PIAA 3UKOA 2ERYA 2XOEA 3R7LA 3T4XA 3IT1A 3CW2A 3WMXA 3RJMA 2J6IA 5JALA 1Q1ZA 2PRSA 3QHAA 1WA5A 1ID8A 3LO5A 1WHSA 4FFRA 4EKIA 3HA2A 2V7WA 2RHRA 2HUNA 4RK7A 1X19A 4FT2A 5CU7A 1OFUX 2PZLA 2WFZA 3PDWA 4OAPA 3TZKA 1F8FA 2OPHA 3M4YA 1Y3FE 3QJYA 1BFDA 1N7JA 4OLBA 1VSQA 2ZE8A 4G65A 1UMDA 3W0LB 5AKYA 4RLFA 1QFZA 1U8ZA 3UVEA 1AB6A 5KTRA 2IWHA 5KYWA 1U0JA 2HEGA 3L06A 1QH0A 4G26A 3LUKA 1NVTA 1AX9A 1VE9A 3P7MA 5FDFA 5HR5A 4DWWA 3Q98A 1IXSB 1O6GA 2OYSA 2O2XA 2X13A 3FD8A 1TKCA 2N75A 1NMYA 3CC8A 4HWKA 4X62B 2EJCA 1NOKA 4KKXB 4XPIA 1N5RA 3JR7A 3EAFA 3ROPA 2G9VA 4IXNA 3L8GA 4L74A 3RBXA 4PSDA 1ILEA 1PRYA 4UQOA 1Z62A 2AWOA 3VZPA 3WGIA 3FWHA 2FPUA 1N6LA 2FZVA 1EVQA 1OKKA 3AHJA 3RG2A 3UJ3X 5B64A 3OTOB 1XBTA 3TLEA 3ZWCA 5CNIA 3R8FA 3GP5A 3OTWA 3I09A 1CKEA 4FJ0A 4R9VA 2QMUA 1E1YA 4KRGA 3G6KA 5A0FA 1Q3HA 3S6JA 2DR2A 3KZMA 4RELA 3C3AA 4U7DA 3KTAA 4W8HA 4N6GA 2Q5LA 2A0XA 3VHLB 3C2QA 2C03A 1T1EA 4P1ZA 4C0LA 4BFCA 4YMSA 1CJTC 4UBJA 5L7TA 2VCHA 3VR6H 4F11A 2R96A 2H52A 2XA1A 4ZC8A 1JMYA 1WF6A 3TDKA 4G9EA 2C2XA 4MV6A 4F4DA 1E7WA 3VKWA 5LQDA 4JBGA 1PCXA 3QVGA 1N5JA 1XTZA 1N0IA 2C59A 4R83A 4BJ1A 2J7KA 2PMKA 4RWEA 5C7LO 2I33A 1ZN8A 2ECQA 4IYJA 3RSCA 5BN1A 1VLJA 3E48A 4R3UC 2NYUA 3IUMA 3N59A 1GGMA 1M2EA 1V5GA 5DNYB 4ZVOA 1IBSA 1BW9B 1IG3A 3IDAA 1KI6B 1ZD4A 3PIDA 4ZHQB 4ZTUB 1SA0B 1T4DA 3ANSA 4S35A 4EY3A 5EP4A 1FUUA 3I0MA 1F38A 4CF3A 3PB3A 2XUDA 3JQPA 4IOMA 4QUJA 2XMSA 4ICIA 1RP7A 2Q3DA 2BF7A 1JQLB 1BVHA 5KYYB 4QT4A 1ADFA 3GEEA 2C7BA 4MWZA 3A37A 3KSDO 2EKBA 2P41A 1OCEA 3OE7D 3EIWA 3OKPA 5LP1A 5JS2A 1HMPA 1ZW6A 3DW1X 3EVFA 4ZK6A 4BLVA 1L6IA 3NU1A 4M6WB 2WHPB 3RVRA 2LUOA 3FMPB 5TSDA 1JTVA 3KVNA 4RZXA 5D51S 4CV2A 1RD4A 3NTUA 1RAAA 3ZWDA 4BFWA 5TY0A 3K5WA 1N0VC 3OZ7A 2Q27A 5L9AA 4N12A 2VFAA 3CF6R 4MWDA 1Y9JA 4OIMA 2E4WA 3C3WA 1L4GA 2BOVA 4JXKA 1SU6A 3NPMA 1P5RA 2GXSA 1P3JA 1R9GA 3K2BA 5CA0F 2JCBA 3TTYA 4WPGA 2GVZC 4QDXA 2ZSFA 1S3IA 5EYPA 1PR6A 3WWCA 4JLMA 1HF3A 1TLTA 2QHXA 2WTEA 1G1MA 2JGDA 2ODTX 3FROA 3DV2A 2BZ0A 4QPZA 5LNK1 1R8QA 1KR5A 1Y9EA 3GT0A 4GDMA 5FOSA 1UBUS 3DTNA 3V9PA 2HKIA 1M1NB 2JHPA 3RVDA 1KYQA 3UATA 4RGYA 3LXRA 4B7ZA 5LLTA 4BMSA 2IUTA 4AZ0B 5HP4A 2P35A 4N5HX 1VMEA 4DIUA 1VE1A 1WP9A 2C2WA 2XIJA 4FBLA 5M7EA 1HL7A 1PT5A 1G21B 2NT4A 1CQJA 2G5PA 2O8NA 2QW1A 3DC7A