3BRQA

Crystal structure of the escherichia coli transcriptional repressor ascg
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
275
structure length
271
Chain Sequence
TQTLGLVVTNTLYHYFSELLFHAARMAEEKGRQLLLADGKHSAEEERQAIQYLLDLRCDAIMIYPRFLSVDEIDDIIDAHSQPIMVLNRRLRKNSSHSVWCDHKQTSFNAVAELINAGHQEIAFLTGSMDSPTSIERLAGYKDALAQHGIALNEKLIANGKWTPASGAEGVEMLLERKFSALVASNDDMAIGAMKALHERGVAVPEQVSVIGFDDIAIAPYTVPALSSVKIPVTEMIQEIIGRLIFMLDGGDFSPPKTFSGKLIRRDSLIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulator ascG
publication title Structure of the E. coli transcriptional repressor ascG.
rcsb
source organism Escherichia coli
total genus 80
structure length 271
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3brqA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3brqA01
2GWRA 3OLZA 2FEWB 4MS4A 1RZRA 5EWMB 1Z13A 1LJLA 1Z16A 4JB2A 4RS3A 4Z4FA 2R25B 5TQ2B 3EGCA 4KK4A 4TLLB 4KMRA 1PHRA 7ABPA 5IBQA 3F6PA 5HQJA 4NCBA 1YIOA 1ZESA 1M5TA 3EQ2A 1GCGA 3OMXA 3LUJA 1YMVA 5EWJA 1U8TA 2JCGA 1RPJA 1MAVA 2F8SA 4MAAA 1D4ZA 4N0QA 2L2QA 3NNSA 3RVMA 4W5OA 2NZVG 2E4XA 1ISRA 3ROTA 4H60A 3UUGA 4KFCA 2PKXA 4MPTA 4MR7A 4RXUA 1ABFA 3MYYA 4JA2A 3QEKA 4XASA 4H3HB 2B1JA 2PL1A 2QW1A 1QQBA 3LKBA 4TLMB 3HZHA 2CHFA 1Y1LA 1NATA 4G0PA 1M2FA 1URPA 2JK1A 4ZPJA 3GWGA 4N0PA 4MR9B 3FFTA 4MS1A 4XARA 5BQ3A 5T3YA 1C0EA 3EAFA 4MR8B 4LX8A 3TB6A 3OQOA 4KREA 2QZJA 2PAFA 5TQ0B 1U2PA 2P4UA 4D6XA 5FWXB 1JHZA 1LBIA 2FTKE 1NXXA 2FMKA 2FVYA 4G0OA 4ZMSA 1EWKA 1QP4A 3IP9A 2A9RA 4FE7A 3O2JA 4CBVA 4JAVC 4RWEA 1BDJA 2E4WA 3H5VA 4RK6A 4RKQA 1KGSA 4PZ0A 2M98A 4MRMA 4ZMRA 3RVQA 1JF8A 3Q7SA 4ETNA 2CWDA 1VKRA 3JPYA 4FE4A 4F8JA 2L19A 1TLFA 1DC7A 3JTEA 3KLOA 3MMNA 4MLDA 3GA5A 4Z4IA 2E4YA 1PUXA 4N47A 1APBA 2GX6A 1BDHA 3BREA 3QEMB 3CG0A 1F4VA 1AB5A 5I4CA 4G0XA 4EYOA 5TE9A 4DADA 3RH0A 2PE5A 3TO5A 3UK0A 1NXTA 2O20A 3QLUA 1JYFA 3CLKA 5TPWB 3C3KA 4EYQA 4G0ZA 3NHZA 3T8YA 3HK2A 3VNAA 3KJXA 2R48A 1RNLA 4OBBA 4YGXB 1C4WA 1P6UA 3KTOA 4L4UA 2PUCA 3IP6A 3QELB 4IGAA 2FW0A 5DGCA 3OLXA 4IILA 5BR1A 1R8JA 3NBMA 4Z4EA 2JRLA 3M6MD 2IPLA 4MS3B 1TMYA 4G0QA 4ML3A 5ABPA 5HSGA 4F12A 4XAQA 5CNIA 3LUHA 3T95A 3QX8A 2E4VA 1SXHA 4DN6A 3T6KA 2LUOA 1GUBA 4HNRA 2FMFA 3DLHA 1AB6A 1ZY2A 2L17A 3F73A 3KHTA 3H6HA 3RVOA 4Y9TA 3HO1A 5JS1A 1TM2A 4OTZA 5PNTA 1KRXA 3MIZA 1YTUA 3OQNA 5DTEA 4PICA 1ZGGA 3CRNA 2JVIA 4QPJC 4WUTA 2WJAA 5KC8A 2QV0A 2QU7A 1ABEA 2AYXA 2RJOA 2J48A 3CU5A 5E3JA 4EYKA 2MYTA 1JFVA 4PE5B 6CHYA 1WETA 1Z12A 3HEBA 3RQIA 3HDGA 3OM1A 4LZLA 4ZJPA 4MQFA 2PMCA 3LKVA 2TMYA 1BVHA 4O1HA 1BDIA 1YK0A 2IOYA 1D2AA 3CZCA 3TMYA 4OG2A 1QPZA 5JNWA 3Q7RA 4Q6BA 3LFTA 5IX8A 1YVUA 4NQRA 5DKFA 4O1IA 1JH9A 2DRIA 4TN5A 3N53A 1KRWA 4QYWA 1EWVA 2X7XA 3SQNA 5JNSA 4EYGA 2NZUG 4S05A 4MGEA 3NHMA 1K66A 2ZAYA 2YHAA 2A9PA 3CFYA 3CHYA 3A3KA 3E3MA 3EULA 1PEAA 4EY3A 1NXOA 4NICA 1RZRD 1JX6A 3HM9A 1JDPA 2AYZA 3G85A 2WJWA 3KS9A 5EWMA 3G1WA 2PJUA 5JNVA 1LBHA 5TQ2A 3VNBA 4RU1A 2CHEA 3Q15C 3LOPA 4MLCA 1PEYA 4XLTA 5DLEA 5KC9A 5GQSA 1Z2EA 4KNYA 1YS6A 3JVIA 4B09A 5JNUA 1ZGZA 4F3TA 1EAYA 2XDYA 5CNKA 5EWLB 3OO0A 3QX9A 3MM4A 3SAJA 2PUEA 3FFXA 5BRAA 4WXEA 3CTPA 4W5NA 2E4ZA 3A0UA 1S8NA 1JBEA 1USKA 4YWHA 3BILA 1D5WA 2IKSA 1NXSA 4QICA 1VPWA 4G86A 1DCKA 4LDAA 2FLKA 1F51E 2FXIA 1MB3A 5B3JC 3KYIB 3N0WA 4MR9A 5D2CA 2W42A 3O75A 3JS5A 1ZH2A 4MR8A 1ZVVA 4Q6WA 4YCSA 2R4QA 5HKOA 1GUDA 5TQ0A 3EQZA 4LE1A 1ZITA 2FEPA 4M88A 2LBPA 3F6CA 2QVCA 3IDOA 5FWXA 3SM9A 2PUAA 2FKAA 4PEVA 1DJMA 4YO7A 3F7NA 4N41A 3H5LA 3NNDA 1DBPA 3BRQA 1OXBB 4MQEB 3KKEA 4W5QA 3RVRA 5KI6A 1I3CA 2QR3A 3Q7TA 2HPHA 4YV7A 1BAPA 1HEYA 2MSLA 5TPZA 3CS3A 2RJNA 4Z4GA 1A0OA 1NTRA 2NUBA 2WMYA 3GYBA 1EFAA 4RY8A 9ABPA 2JBAA 4OLBA 2JBAB 3C3MA 4HNSA 4LE2A 1W9HA 4MYRA 4NCAA 1JYEA 1U2QA 2QVGA 1DBWA 3QEMA 3URMA 1A2OA 3QK7A 4KPYA 1USIA 3N75A 3O1JC 2FEKA 5IUKC 3RVPA 4E7PA 2OENG 1NXVA 2LP4Y 2HQOA 3K9CA 1FFGA 1EWTA 5TPWA 1SD5A 3O74A 3EJWA 3SY8A 1CEYA 3HS3A 8ABPA 2PUDA 4Z99A 2GBPA 1GCAA 3QELA 2PL9A 1Z25A 1QMPA 3UKJA 2WRZA 1U04A 1BA2A 2ID7A 2L18A 3LUGA 3I5AA 3QLTA 4RXMA 1DRJA 2FN9A 3CZ5A 3ROFA 5KQGA 3H1EA 3B2NA 2VK2A 4KRFA 4MS3A 1Z26A 4N03A 5IEBA 1EHCA 4HNQA 1U0SY 4EUKA 1P6QA 1IIBA 5JS2A 4PYRA 2P9HA 3HV2A 1JFSA 1H9CA 2GI4A 5IC5A 2FN8A 2QSJA 1USGA 3C6QA 4D74A 5JNRA 3E61A 3Q41A 2F8TA 4JASB 1CHNA 3DZDA 4IMJB 1QO0D 4YLEA 1QP0A 3O2QB 1JDNA 4YP9A 4ETMA 5IUJC 1MB0A 5BRJA 1SXGA 4KVFA 1M2EA 2WY2D 3KSMA 5IEJA 2JVKA 3P9YA 2HJ9A 3OMWA 1DP4A 4YRZA 4Z4CA 5JNTA 4RK7A 1L5ZA 1DBQA 2R47A 4UHJA 1W25A 3C3WA 3DGEC 4JP1A 2OQRA 1YK1A 3RVNA 2BGGA 2FMHA 1J56A 4WT7A 1VLZA 4RK0A 3LUDA 3HJFA 4KV7A 4Z9BA 4YR7A 2Q5CA 4G97A 5KQMA 4GNRA 4EVQA 2FQYA 1ZHHA 3H5OA 4XFKA 3TX6A 3L49A 3OLYA 3N0RA 3SNKA 1NY5A 2VUHB 1KMIY 1YMUA 3SG0A 3IPAA 1L5YA 4JB0A 3H5WA 4NV3A 4JOQA 2WWVD 1XHEA 2N9UA 1ZN2A 2IDMA 4IRXA 2JVJA 5TQJA 5FWYB 3H1FA 4LRQA 1P2FA 3HUTA 2A9OA 5EWLA 4XXHA 2JB9A 2B4AA 3MA0A 5F64A 4F06A 3GRCA 1DZ3A 2GKGA 3H6GA 5HM6A 5C5CA 4MS4B 3CNBA 1DRKA 3TD9A 1MVOA 5GOTA 3CG4A 3QLVC 4EVRA 2RGYA 3CKMA 3L6UA 3KG2A 4ZYLA 3JY6A 4TMYA 3FGZA 3HVRA 5EWJB 2IPMA 4EVSA 6ABPA 5CNJA 2IYNA 2H3HA 4GPAA 3GT7A 3H75A 4RV5A 4LDZA 2PUGA 1K68A 3LTEA 2LPMA 3JVDA 2MYNA 2WB4A 3HDVA 1QKKA 1ZAYA 1JWLA 4MQEA 1A04A 4MR7B 5TPZD 3R0JA 4KQ9A 4N76A 5IUNC 2IPAB 3GBVA 4WXMA 3ILHA 1P8AA 1YS7A 3EODA 1XWWA 4EGSA 3HCWA 3GV0A 3OM0A 3RVJA 3KLNA 4MS1B 3NNNA 3LUCA 1ZDMA 1DG9A 5C5EA 4O5AA 1CYEA 1Z2DA 2FQXA 2LIVA 2MYUA 4RXTA 1E6KA 4UHKA 2MSWA 1TJYA 4RDCA 3I09A 4RY0A 1Z18A 2QXYA 3LUKA 3M9WA 3FDFA 2HQBA 3RVSA 4D6YA 1FFWA 3N6VA 4LE0A 4Q7EA 4MRMB 3IPCA 2KYRA 4RY9A 1SXIA 2PUBA 3KYJB 4P98A 2MSKA 1OXKB 2NT3A 1LK0A 2VYCA 2NT4A 3K4HA 4G0MA 3DLBA 4RSMA 3N0XA 1DCMA 3GBPA 1E2BA 2FQWA 2VUIB 3C97A 3IP5A 2M1ZA 1DC8A 4QYMA 3OLWA 2HSGA 1D1PA 3OO1A 4WWHA 1B00A 2V0NA 5KWSA 3O1HB 4RK4A 1QNLA 3Q9SA 2MYPA 4G0YA 3FMVA 4RZSA 1Z17A 4S04A 2E4UA 1FFSA 4RK5A 2ZWMA 2PLNA 4IMIB 1PNRA 1PNTA 4Z4HA 2RDMA 1LJUA 3D02A 4WZZA 4W5RA 3GL9A 1RXEA 1RXIA 1M5UA 3BBLA 4FB4A 4F11A 2IPNA 3M9XA 1NXPA 4E7OA 3OQMA 3MF4A 3H5IA 3D8UA 1E6LA 2I6FA 4ETIA 2ID9A 3QLUC 2FLWA 3HSYA 3ILYA 3JPWA 5ED4A 1VRVA 2A9QA 3H1GA 1ISSA 3IP7A 4RK1A 2HQRA 1UDRA 3A0RB 3O2SB 5FBHA 4DQDA 3H5TA 3LMKA 4KQCA 4Z9AA 1QO0A 2FSPA 3LUAA 5KQPA 3I45A 1DCFA 4KK3A 4L85A 5T7BA 4W5TA 4P1ZA 1FQWA 3DBIA 4IF4A 4HYEA 2FMIA 1GLGA 3LUFA 1JLKA 3FFWA 3O1IC 4Z0NA 1QP7A 1FSPA 1JL3A 3A10A 3BRSA 4MQFB 4H3KB 3QLVA 3T38A 1T34A 1Z15A 4KZKA 1XHFA 3RVLA 5B3JA 3DGFC 5FBKA 3HXMA 2PUFA 4OLAA 4RKRA 5IULC 3N8IA 4OATA 4YS6A 3HUUA 5FWYA 1ZH4A 3MQ4A 5CHYA 1QQAA 1NXWA 3OLVA 5DCLA 1D1QA 1E6MA 1SRRA 5CNMA 3O21A 3S99A 1MIHA 3RVKA 3I42A 3W9SA 5KQLA 3EDCA 1TVMA 2H0AA 2CD7A 1JFTA 2YHBA 3KCNA
chains in the Genus database with same CATH superfamily
3D6FA 3NOXA 4OBEA 4UBIA 2WHPB 2OZEA 1F4PA 4DKXA 4EJSB 3Q9UA 1GGFA 5U4QA 5EKSA 3NOQA 1WZ2A 4OXIA 2A58A 4TRMA 4DLNA 3UWSA 2IHYA 1Z16A 2B78A 2NNWB 4W1RA 4US2R 3T4XA 4TKUB 1XMQB 2POQX 3Q8MA 1WXWA 3CONA 2X9GA 4AMYA 2W2OA 1V16A 1PNQA 1ZJYA 1GADO 5I4CA 3PKZA 5KDDA 1HE4A 5L4SA 2DCMA 4ECEA 4PFKA 1E2MA 4HGPA 1G8YA 1QBKC 2NZVG 4YMUA 3CF0A 3NEJA 4BQPA 4GPEA 1YCHA 3BHJA 3GDGA 4UUAA 5J2TB 4DR1B 4MXDA 4D9GA 4BNDB 2RAUA 2PL1A 3VDQA 1Z8NA 2YJTD 3GFGA 2Q3DA 1RBZA 2C4HA 2JC3A 5CFNA 3GNQA 2JK1A 4R16A 4MV8A 3U49A 2I4LA 3U80A 4DJJA 3PD7A 5KNBA 4IH1A 4LY9A 4BMZA 1X87A 2NUAA 2QM8A 4OF4A 4UTRA 3HCRA 2O8CB 2WD8A 4FGSA 1U2PA 4EDFA 3LWZA 3WISA 5SYMA 4JMPA 1BO6A 2YWJA 3WYFA 3ZHRA 5A5DA 4CLOB 1NXXA 4GLJA 1QB7A 1HA3A 1FEZA 1QSGA 1XOIA 2WP8J 2HL6A 2FGJA 4FE7A 2HMWA 2BPOA 3DO8A 2B20A 3M34A 3PE6A 4IIVA 4PZYA 1ATIA 2X3UA 4WK4B 3OP1A 4G1UC 3LY5A 3RLFA 3FZEA 5AUQA 2K6GA 3ZH2A 1OJ7A 1IM5A 4WLVA 2CWDA 3R9IA 3IFSA 1FOEB 4DM7A 2V1UA 4YAUA 1QAMA 5K0NA 2Y1GA 2YV5A 3JTEA 4B4OA 1SG6A 3KLOA 5HFAA 3W5VA 1BE1A 2F4VB 2X6QA 3IULA 4RLSA 1H2EA 3H2ZA 4K9OA 4FLFA 1RCFA 4BXOB 3B1KA 1QO9A 3PENA 3H19A 4KE6A 3UY4A 3KPJA 4IWYA 5JCZA 3UATA 4WN9A 2O2YA 4ZWNA 4UARA 1SFRA 1TFRA 1KSFX 1WL8A 5G02A 2ZI4A 2EFYA 1ZVJA 2HBYA 3COZA 2ZG6A 1XTUA 1YJBA 3V2UA 1QH8B 3C8HA 4CV1A 3K1YA 1TIBA 1I1QB 3NC0C 3CUYA 3D0OA 1K3UB 2EKQA 4FBMA 1Z4LA 1SKBA 1TM1E 4PQYA 5DWDA 3VC2A 1XQYA 2F64A 3DZJA 3WL7A 4B48A 5A5GA 1QG2A 3NX4A 5GV8A 2IP2A 4V0QA 5TMEA 3U26A 4ML3A 5BSGA 1Q1EA 1ZO8A 2HB6A 5JHHB 4BIMA 2XZLA 2AFHB 2OLJA 4XEUA 3HC7A 3BM5A 4BNXA 2P6PA 1G60A 2Q3EA 4XGQA 4KP7A 2MT9A 1DCTA 3F46A 3BGOS 1G3MA 1YB6A 1KY3A 3F73A 5DX1A 3RVOA 2D5LA 4J0IA 4UHBA 2PX6A 4YGYA 4Q7KA 5GTDA 4H6WA 4QM7A 1FVHA 3EOZA 2JJ2A 3O83A 1ZGGA 2OZLB 1Q1ZA 3NH9A 4PICA 2GZDA 5GVSA 5J4YA 2IOQA 4C4SA 2D06A 4O63O 2LKCA 2HY7A 4ZEMA 3W04A 4YWHA 1Q7RA 1R9JA 2ARKA 2MINA 2QR2A 1GM5A 1WULS 5JASA 1Z5GA 3ZKAA 4LXIA 3DQPA 4FEGA 3FUTA 2VJDA 2MYTA 4JL6A 2Q2WA 3HEBA 2O06A 3ENVA 4YP1A 4XX0A 3ZDDA 4P31A 4FS8A 5F7XA 2E18A 2DH5A 2I76A 2Z3ZA 2HZ7A 5LQMA 2Z43A 4Y2SA 4ZOAA 5HZGA 2AK2A 1E7QA 2ZREA 5IDXA 3OVMA 3PXGA 1FDSA 2R6JA 4L74A 2ZU6A 1YAJA 3EG5A 1GTMA 1KMHB 5EHNA 4DM3A 1FSZA 3DEIA 3D8TA 1F1JA 4FP9A 3ZHOA 1RDFA 2NZUG 3JD1A 5FUVA 3TDKA 2BJVA 2YHAA 1D3AA 1F14A 4XVUA 1FZTA 2RCNA 3LCVB 5B37A 5K0BA 3BA1A 1XMPA 3NWJA 4TTAA 3UW3A 3LL7A 4ZHQB 1RZRD 1E1DA 4GBGA 1JDPA 1C50A 4J0GA 3TVTA 3U39A 3AP1A 4ER0A 1UEIA 2Z2ZA 3AB8A 2YUTA 1R6DA 2ZSHA 4IHAA 4JT2A 4R9SA 3U6BA 5KOIA 2I2CA 4QNNA 4W82A 1SUBA 3A28A 1ZQ1A 4YMVA 4L22A 5BNTA 3Q8WA 2P77A 2NU9B 3T0GA 2ORIA 4OFBA 1ZGZA 1JW9B 2AN4A 5DSZA 3VVCA 2OO3A 3HKBB 2Q6IA 5DNWA 1BHSA 1WBJB 4GOJA 2ZAIA 4M9QA 4MA0A 4R1NA 1CBUA 1VG0B 3NCTA 5FR1A 3QG5A 3CTPA 3AVXA 1ISMA 1YVDA 3QVOA 3DCNA 4HZUA 3UGTA 1XPJA 2IKQA 2H2IA 5AVJA 4C1NA 1HWYA 4WHMA 4BC1A 1VPWA 2IKSA 5IC6A 4J4HA 3ICOA 5L51A 1TQHA 3H4TA 3M2PA 1UKAA 1CUAA 2AXEA 3GRAA 1SCJA 3HO8A 4KSCA 1J8VA 1SHZA 2Y1KA 1K6JA 5JY1A 4LOJA 1AURA 2PEZA 3BGVA 1UPAA 1GPH1 3MT7A 1F2TB 5FEUA 3ADCA 2QVLA 4DUYB 1IU9A 5FWXA 5BQXA 5KWIA 2BM0A 3RVDA 4ZVLA 3P0RA 4IDPA 2FE4A 1O1YA 3AF5A 5CYOA 5DT9A 3TB4A 3T3DA 5BSKA 2OQVA 4OXQA 1UH5A 1IJBA 4H7KA 1N78A 1ZONA 5BR4A 3EGOA 2B2XA 4NYMR 5ECDA 1M2GA 3ZU3A 3TZEA 3EQ6A 2RJNA 1MO3A 5AK5A 2JG3A 3GYBA 1ECGA 1OX4A 3DVQX 3M70A 4OLBA 4GNKA 2R0QC 3WQBA 4HDRB 3HKCA 4HQOA 2IXGA 3QTTA 1NJ6A 1EDDA 2JGAA 1ZP6A 2YJ6A 5EKUA 5FOUA 2ZPUA 4GZ3A 4K9PA 1VE7A 5DLDA 3WRXC 4B5LA 4J4TA 2IEZA 4YT2A 1NYQA 3DUWA 4WBNB 2W4MA 1U1IA 3K2QA 4BEJA 3HDQA 1HE2A 4RDIA 5EA2A 3RODA 1R5BA 1UC8A 4EF6A 1VECA 2HMUA 2VRCA 3L7JA 1BCSA 1XZMA 4NR0A 2Z1MA 3O74A 2B61A 2QU8A 3MQ2A 4RPJA 4B35A 3ZHSA 4DMCA 3E4DA 3F6SA 5IWCA 3OKAA 3R5TA 3E9DA 3TKYA 1X7WA 4D9CA 2ZVPX 3RTCA 3QNWA 4K6MA 2ZKLA 3TM4A 5A02A 3UBTA 3ZNPA 4BLRA 1ZCZA 3LUGA 1GY8A 5C5DA 4N3GA 3WNVA 3P0IA 1N6NA 5EGNA 4LSMA 1T8YA 3Q0IA 3RS5A 3R7BA 3RSOA 2LWIA 1FQOA 2HRRA 4D2IA 4GO1A 3ZDZB 1KI4A 4JENA 4MJLA 4KO2S 4HQNA 3RAPR 1H93A 3W3AD 2W8ZA 1V8BA 4QQKA 2GBGA 3A1NA 3OHPA 3M7IA 4O08A 1QHFA 5EJ6A 2H52A 1LZKA 2WSMA 3BRWA 3G2JA 4V39A 4D4KA 4HSEA 5BWOA 4MRRA 4UU8A 4FOSA 3WNDA 5CB4F 3FDXA 4ZRDA 1EINA 4NZPA 4PYMA 4W9MC 1LTKA 4KXNA 3TLJA 4BVAA 3HEMA 4BQIA 2FZ5A 4PIMA 10MHA 4H7HA 1DUVG 1Y4AE 4QNMA 5DM1A 3FBTA 2HSDA 2CE7A 4C0WA 5G3ZA 3AUJB 2ZEJA 4RMHA 3SC2A 2CLKB 1DWQA 3CIOA 3OQPA 1R6XA 4JK3A 4JR1A 4F6CA 4K6FA 4LCJA 1L5ZA 5JRZA 1JJIA 5EESA 5FOSA 2VJCA 3CMMA 3QOWA 3CZAA 1UFOA 5KJ1A 4TKVA 1FK8A 3N8KA 4FYIA 1LLDA 3T7RA 2NMVA 2PAAA 3WWCA 3DAYA 4GLFA 2OR3A 1HDYA 1SOUA 1E2JA 2PFSA 1CULC 3UAGA 4DBLE 2EJCA 3FCYA 1AA6A 2FQQA 5EXDA 1QGOA 3GNTA 1XN4A 2X22A 4P6VF 2MMCA 5LQCA 5BT9A 1JGTA 1OBVA 2Y0CA 3C74A 4Q1BA 3ZQJA 4DLYA 4BNJA 4GLLA 5GONF 3R6WA 3QE9Y 1DL5A 4GUAA 2XUIA 2HHCA 4J7UA 5CXQA 5IF9A 1D4AA 1HLDA 2V3VA 3SG0A 1N0HA 4DLTA 2FJPA 1A9XA 2RHJA 1ETUA 4QOFA 1ZJ4A 9LDTA 2Z1DA 3PIIA 3WGTA 5CB6A 4H6PA 1FNMA 2NVUB 1YAHA 2FPOA 2XAUA 5TQJA 1PV2A 2ZSJA 5HUJA 2P75A 2Q0XA 4TL6A 4EYSA 4ZCRA 1GNPA 2AS0A 3UHOA 4C9BA 3G9QA 5A1JA 4LXTA 1XZ8A 1NFFA 4ZO4A 4NCNA 2FJUA 3D31A 5KTPA 3ENWA 1SC6A 1TRHA 3UPDA 1ZEJA 2J59A 4AY5A 3A2NA 4KWCA 1T9AA 4NBLA 3PC4A 1ARZA 4XWAA 3BXEA 2QBYA 1Y3HA 4LZPA 4NFLA 1ACMA 1A98A 4BE7B 1I7SB 1D2HA 5ALOA 5A03A 4RULA 5AW8A 2PU5A 4F2PA 3U7HB 1T5LA 3M5PA 1HURA 1IEVA 2K7ZA 3NVDA 2Z57A 3NWBA 1WZCA 3OU2A 3ZKWB 2VZEA 5CNJA 2ZSUA 4RD2A 1NN1A 4KQ2A 3WY9A 1MKYA 3V7WA 4FTWA 4LEIA 4F4UA 1K4KA 1AUPA 2WABA 4ESHA 2H8GA 4WLOA 1ZAYA 4JVLA 3K5HA 2GCGA 1TTPB 3V8BA 1UBCA 1E92A 2ACKA 3EVEA 3ROPA 4EP1A 1PDVA 4KYIB 4TQAA 3D2CA 4HQRA 2LTAA 1KKLA 1EK2A 4H0FA 4PC6A 1N0IA 2RH4A 4C06A 5HSGA 3H0CA 3EHEA 3D4PA 4MS1B 1NURA 4C14A 1DG9A 3JYNA 4OM8A 3NBQA 1EFPA 5LA6B 2CCKA 4TRRA 3HBFA 5I47A 1EUDA 3PE3A 4TL9A 3UMSA 4YAGA 2H4WA 5KOJA 1Z47A 5E1DA 4YRMA 4GL2A 3A11A 3PUVA 5HF9A 5FTLA 4R7GA 4U7FA 2H1RA 1PJ4A 1T9GR 3EXHA 4QKQA 2LNDA 3UCEA 4FYXA 4WA7A 2XLBA 3LYAA 1R27A 2ZBRA 2M9MA 1TTQB 4XVHA 2WWRA 4JLAA 3F90A 4EWLA 7ADHA 4RORA 4IQ4A 1AV7A 1TC2A 2NZ2A 3ZGZA 5IH3A 4C89A 4CMIB 1HKUA 1KVRA 3EIFA 4H59A 4NK5A 3TXXA 4CU2A 4E1AA 5HRAA 6ADHA 4EF4A 2YWGA 3M4JA 1IULA 1F2DA 5LP1A 1CY1A 2XIQA 2F9FA 3B3FA 3LNCA 4NHOA 3C97A 2ZDGA 3V6LA 1A96A 3QENA 1G6Q1 1S96A 2CL7X 4NVRA 3F78A 4RE5A 5K2OA 3WA7A 2P9BA 3ML1A 2RI0A 1QIDA 4JJFA 2V74B 3EBOA 3IIKA 1QC5B 3X1XA 1JBKA 3CWZA 3MJ4A 2PSFA 3QKRA 4KWEA 4MDYA 5ERYA 3DV9A 3HXQA 1IBMB 5K3SA 3G8YA 2C98A 2PVPA 5KOYA 5CJJA 4KODA 5DNAA 2BTQA 4IQGA 4D9JA 3I32A 2R6AA 4TX1A 1G3UA 3OCYA 4M0UA 4QFMA 2NG1A 3D59A 5WRFA 1PQPA 3KZXA 2W2KB 1IY9A 1IHUA 4FB4A 3GLSA 3GQBA 4L78A 3TTXA 1IB6A 2PA0A 1N8NA 1YCGA 2XMDA 1MAWA 2F2TA 3MF4A 4UUPA 3U7FB 2CUKA 5IAKA 4JC0A 2ZJ3A 4LNAA 1H2YA 3JWIA 3L0IB 4EITA 4QULA 1KQ3A 3JR3A 3CUKA 3FSJX 1R18A 2Q49A 1AG9A 4L3VA 2FLWA 3ILYA 5KNCD 4WERA 1P2VA 5KTOA 1JEQA 3R24A 1QKJA 4X1KB 4C78A 2FPMA 2IYSA 4G0VA 5KDOA 4QYIA 4IGFA 5EIWA 5B7GA 3GLFE 2Q1UA 4M1OA 3SJZA 3ZCUA 2OV4A 4DQDA 3NQ41 3X3HA 4P0QB 2QENA 3GLUA 4H1TA 3DDSA 2E48A 4IDBA 1TUGA 1SVSA 2E82A 3QTLA 2AOTA 3O9MA 1JHXA 4P1ZA 1EUQA 4KWIA 3ZY6A 5KBYA 4U6NA 3PUYA 3TMKA 4DTIA 4Z0NA 3QW4B 1NI4B 5C8VA 1D03A 3PQ7A 4YRBA 1FFDA 4OFXA 1F17A 1SUIA 5FNZA 1ZD2P 2EFEB 1GPMA 5LBTA 2EJWA 4BKPA 1AT1A 1GU7A 3S29A 3QQPA 1HLFA 1OIXA 3HXMA 1Q1AA 5FBKA 4KEAA 1P74A 3ZHVA 2RD2A 5IULC 4PFSA 3DYVA 2X0DA 3RU7A 4MPDA 1EDEA 4XDZA 5F78A 4TMKA 3PQ2A 2IJGX 4Y6GB 3C3YA 1V5IA 3I12A 3VVBA 4ZYVA 5A3VA 2R1VA 4JC5A 5D1HA 4R2MA 2P91A 3MJCA 3N8NA 1YQEA 3QVXA 2JAOA 2FOLA 4GI3A 4FSDA 3BTVA 4M9CA 5HP4A 2E6UX 2ATIA 3CZPA 4N7BA 4PHFA 4PYRA 1PSDA 2HADA 3NGXA 3UJAA 3NIDB 4M0LA 4PONA 5E9WA 1T9BA 1EJ6A 1BMFD 1FMCA 3TD2A 2VJMB 3BA6A 3VGPA 4BP8A 2BI7A 2BL4A 3HACA 3MCWA 5CA1F 1D6NA 3OFVA 1FNBA 1R1DA 2GDJA 5G4LA 4YJ2B 4D44A 3I4CA 2HLHA 1EK0A 2Y67A 3OFND 3ZGLA 4ZAFA 5A4MS 1DO8A 2IUEA 1T6ZA 3EG9B 5DNUA 3CZMA 3E1GA 1RADA 5AOAA 3SE0A 2NZ8A 3BL8A 1FJ2A 2DKFA 4AP6A 3PXCX 2DPMA 4S24A 2F8SA 1X0VA 4UNIA 3RVMA 1M6VB 1BVRA 1PL7A 2E4XA 3C4VA 2PT7A 5HE8A 3BWVA 2GZ2A 4G24A 1RYBA 3DW3X 4YRRA 2IH4A 1K3FA 2R2AA 4WACA 4CNQA 3OUTA 3HXOA 2OLKA 3FWPA 4ZVTA 4GFDA 1DX4A 1MC4A 4FI3F 4WEQA 4CMAA 2WA2A 4N0PA 3UMBA 3WIEA 1QUEA 4Q66C 1M2OB 2X40A 1ZW1A 1I0LA 4MV1A 4EI9A 3GIDA 1X8LA 4MICA 3WGYA 5JAQA 4EI8A 2DETA 1VHTA 3ZY3A 1TAUA 1DIOB 1I3OA 1O94A 2C97A 2Z6AA 4P3PA 4G0OA 4JEHA 3A9WA 4DY6A 5EXXA 4CBVA 3U5TA 2BKLA 5IFLA 3H5VA 4PX9A 4Q0MA 3FW1A 1I4TD 3O8OB 3C8UA 4N5LA 4RKQA 5HTKA 3F5MA 4RD6A 4BNHA 5B7PA 5JW6A 4Z0TA 4CM9A 5KSZA 1EJ0A 1BX0A 1Q92A 2VH5R 4YPVA 1JE1A 2EFCB 3FZYA 3TLEA 3DHEA 3GGJA 1FA9A 4Y6RA 2R85A 1D9ZA 1FMLA 1XF1A 2NYAA 4ARVA 1EXMA 3ORSA 4WFKA 4WVLA 1ADBA 2A78A 3CPHA 4F96A 1APBA 4FWBA 1I3LA 2DFLA 3AKYA 3CRQA 4HYQA 4KHPB 3BX1A 3NJ8A 3ISTA 3PFKA 3IUJA 3LVRE 1MPXA 1QG4A 4F21A 4BECA 3U3ZA 3DV2A 3JATA 1YXMA 2F3SA 1G2IA 5KOHB 3CLKA 4JLDA 5L3SA 5TPWB 4M1MA 2FHSA 7YASA 4KACA 2C9ZA 3SYTA 4E94A 3B7GA 2XD9A 1XU9A 1CYDA 3G1UA 4YGXB 4HB0A 4EATA 4LUCA 3E53A 3U4QA 1L9XA 2CXHA 4XD7D 1HT0A 1P4SA 1RXYA 1RWXA 2AOUA 2FPPA 3BSWA 3M6IA 3AL2A 4LISA 4F1WA 4B3HA 2OEPA 4PR0A 2CXNA 2QOEA 1QE5A 4MUXA 3E8MA 1R0CA 2RH5A 2ZUUA 2CNKA 3CRVA 3OE5A 3QFHA 5D3QA 4ZREA 1X8XA 3VR3D 1JB1A 2OKGA 5DRYA 2UUPA 1A5AB 5FHRA 2EF0A 1KI6B 1GA6A 5K01A 1P5RA 4XR9A 2PFGA 1ZY2A 4LXXA 3QU9A 5T3UA 3UC5A 1ORTA 4QIHA 2OG2A 3H5NA 4ESEA 5PNTA 5KYTA 3MIZA 1KRXA 2QMEA 3K0AB 3U3DA 4EUHA 5A5VA 4U6SA 5CLFA 3GAFA 1WE2A 4MSUA 2OHGA 3GOQA 4BNYA 1VHJA 2ZRKA 2NU6A 4S0XA 1ABEA 1MNQA 2TECE 3UK7A 4BRSA 3KQSA 3ZXSA 1M2VB 1FL9A 4RHCA 1ESMA 1XEWX 1THZA 2EFGA 1ZVKA 3HYRA 5EVJA 5HVNA 3TF5A 4TTRA 1N36B 3IB6A 1H3FA 3NVAA 4AKHA 4Q9AA 1FJHA 1LQ2A 2QDXA 5KSPA 1E2UA 5JYEA 1K0UA 3DMPA 4X90A 4ZCIA 3CW8X 3TMYA 2QTLA 4KZPA 4OG2A 4D96A 2O0KA 3TW8A 2HHHB 2C8JA 2YC4C 1YVUA 4I1RA 1ZRNA 3KWJA 5EL0A 3DPUA 1SURA 3NTVA 3UQYS 4B47A 3JAMA 3KOOA 1EVIA 3GFVA 1M75A 1NVKA 4YAJA 1A88A 1QZ3A 1GGNA 2BE9A 2WF6A 3G7UA 4QDZA 1N3YA 2FPIB 1XVTA 1E1NA 1WABA 2VAWA 3HBMA 2Z3WA 1GGKA 4MI1A 4CQLA 2B21A 2XNHA 5EHIA 4YXWA 1L1FA 3PXUA 3E3MA 3LYHA 1PEAA 3R3UA 2PWAA 3PGVA 3WBBA 5KX5B 2YN4A 3ET5A 1UIRA 2TYSB 4JP2A 3WK4A 1N6IA 1YGPA 3HM9A 2Z83A 4NDAA 1XNHA 4OHXA 4WKNA 1E3MA 1XYYA 3I37X 3B1ZA 4EA6A 4RTQA 1GHTA 2E49A 3R3SA 5JVDA 5IWAB 1KI9A 3VR4D 2REBA 3GLFB 1IPHA 1WAMA 1O57A 1Z28A 1LX7A 4B6JA 3JVIA 3CZRA 5I4IA 4A6EA 1OX5A 1OHHD 2B3TA 1W9MA 3E23A 4Q03A 5K4AA 4YB8A 1B41A 3I5MA 3IX7A 2YYSA 1B42A 1ENOA 5A5FA 2TMGA 3ROXA 4HHEA 5BRAA 3OCVA 3C3XA 1J9ZA 4ZRNA 3PNBA 4BAGA 5AIAA 2Q99A 5A3JA 3LY7A 2J87A 3B1WA 1VMKA 1N4AA 3D5EA 4QJBA 1PBTA 1DKNA 4R3WA 2YJZA 3NHPA 1MD9A 3HJCA 4RADA 5IBRA 3CPSA 4E51A 3EGVA 4MR9A 3JQFA 2QZ4A 4G67A 4CXMA 2O2CA 2Q45A 5A6SA 2OUIA 2BEKA 1HQDA 5EHQA 3WLOA 1ZVVA 4N0EA 1YDEA 1XLTC 4TMXA 5DP1A 4XRRA 3PA8A 4NS4A 2RFLA 2FY8A 5K2MA 2ZLBA 5AJHA 3WGHA 4QC2A 3H7IA 3PV0A 5JTUA 3KC2A 4PZLA 3VX4A 3L0DA 3ZN2A 1M8JA 3NANA 4QBTA 1U65A 2FV8A 5FPTA 4V0OA 5IANA 3RYCA 3KKEA 4MYCA 4W5QA 4QM6A 3IR6A 1ZM4A 4EPWA 1EKXA 1G1AA 1P73A 2D1QA 2OFWA 2QD4A 2MSLA 3ETGA 4N8EA 1M73E 1NP6A 4NWIA 5DYTA 1A0OA 4O2BB 1NTRA 3N7TA 3NDRA 4X7MA 3STHA 1DTWA 1AY0A 1J00A 2EGGA 2PMKA 2G9VA 3OF2A 3LQQA 3C6YA 4I1IA 1DBWA 3R7LA 1PI3A 2XDQA 4C7VA 1Y6ZA 2I2BA 1Q17A 1ISIA 3QTBA 4LVOA 1OWNA 3SU8A 1X42A 1PW5A 1NZDA 2XOXA 1HBJA 1T2FA 2VJLA 1GL6A 5DBFA 4D7AA 2Y71A 1S2GA 2VJBA 5JYDA 1EE2A 1XTKA 5I7UA 4GKVA 1I7NA 2CVHA 1UINA 1N2GA 2QJRA 2WE8A 4OJQA 5C35A 2BMVA 3PFWO 3G8DA 3KELA 2IS6A 2EWMA 1Y9DA 2C82A 4MEJA 1KI3A 3U81A 2F8MA 3UMFA 2FXVA 4PX2A 5C31A 4L08A 3VTZA 1A77A 2L18A 2R751 3OOWA 3WJAA 4JIMA 1OLXB 1MO2A 2VQ3A 4TMVA 4MWBA 4KRFA 4BNLA 1ZN9A 3KYCB 2BKVA 4RIHA 1WCWA 1SELA 2VUTA 4N03A 5JC1A 3PWZA 3CLUD 2VKTA 1MXHA 3FBWA 4F71A 2P9HA 1NVFA 1V8FA 2PL5A 2PVSA 3HVUA 3PQ3A 3UK1A 2HDWA 4K2HA 5D3MB 4I4LA 1H2ZA 3W7VA 2NXNA 3TQQA 4NK4A 4WKPA 3WK9A 4J0DA 1HE8B 1IHPA 4NCKA 3IUNA 1TM7E 1UOQA 4FSHA 1RCTE 3G7SA 2OGTA 3JAWA 3EZGA 4RCZA 5AUPB 1WP4A 1C0PA 1Z38A 3P97A 3DXXA 1GCUA 1XQ1A 1OZAA 1H23A 5CG1A 2I91A 3FOFC 3ZCQA 1GD1O 3MTEA 3WS7A 3NKLA 1ZUNA 2B7LA 1M3SA 1W5TA 2ZRQA 4WXHA 4GS5A 5F9MA 3W34A 1NSTA 4RTKA 2IGBA 1Z2PX 2N0SA 1W25A 2NSJA 4BNZA 1DZIA 2GJKA 2W6MA 4M9XA 3KPUA 3VOBA 2O4CA 3L6BA 1A27A 1LPSA 1SZPA 3CSUA 4QUGA 3C3PA 4RK0A 1I4LD 1EFUA 1M0TA 2JH9A 3I6BA 3IUBA 3NBZC 4KV7A 5EZSA 3U4DA 2GRAA 4DCPA 1AN9A 1H8EA 3NUZA 1GARA 3AGPA 3X1YA 4RA9B 1T6BY 3K71B 2R86A 2C00A 2RGCA 1L4UA 3M33A 4AJPA 1WTCA 1JKJA 1I32A 4QVKA 1ODLA 2I87A 3L8ZA 1FPMA 3KXLA 4XGIA 3M6LA 1VLJA 2VA8A 2EJUA 3GJYA 1RJFA 1GDHA 4YJDA 5LP6A 2GRJA 2O19A 5IVHA 5DSTA 5MN6A 2PYIA 2IU6A 2XXBA 3KUUA 3AERA 4QYSA 1D8AA 4RH3A 2QN9A 3SYRA 4PYNA 2C07A 4YRAA 3W5SA 1UDXA 3W9YA 1QKIA 3PT5A 1UT6A 4A8JC 4Q4HA 2QXUA 1N5OX 3T7AA 1BXGB 4Q21A 2V7GA 3T3HA 3EYWA 3X2FA 4AUMA 3V1NA 1BVUA 1FTSA 1X1QA 3EXG2 1H6CA 4J6FA 5NULA 1M83A 3JWPA 1G20A 1O54A 2WA1A 2DFDA 3N6RA 5AM1A 2HSJA 1DEKA 3N70A 3R5FA 3WLHA 1WUHS 2Z9CA 1VYUA 2ZJYA 1WUIS 1VDZA 1N5DA 1TUBA 2WSBA 3TQOA 1AQJA 1JIQA 2C3OA 3QA3E 1PLJA 1BA3A 1DBVO 2ZUTA 1XZIA 3HY3A 1DRKA 1L5RA 1YZVA 2ATEA 2EFHB 3DZ8A 4HLCA 4R8RA 1MBZA 2NV6A 4A82A 1OU0A 4JBXA 5B4UA 2AEMA 3FCUB 4PINA 3EGDA 3MUFA 1PL0A 2A2ZA 2R87A 2WE7A 2C5BA 3KG2A 5JCPA 1JMKC 1MTZA 3JY6A 1US8B 2HC9A 4PLGA 3HVRA 4AY2A 1QQ7A 4K9DA 5FP0A 2J67A 1KO8A 1N2EA 5EQDA 4X60A 4DFDA 4LHSA 1RJWA 3FHCB 2D1YA 2BM1A 2P6UA 3BB3A 3TNDA 3ZU6A 4A4DA 2A35A 2D1FA 5ITVA 4NV1A 1BN6A 2DULA 2LPMA 1B73A 4XPIB 3ZZTA 2B8EA 4BZZA 5K51A 3JWHA 4L0QA 4P53A 1EX9A 4YHBA 1HFJA 3QQ5A 3UZUA 3VHXA 4ITRC 4URXR 1QUFA 3BWMA 1GQSA 1T8SA 5G4KA 4IMRA 4YRQA 4XGRA 4ZT6A 4QPCA 4XWKA 2AH5A 3FPBA 1YR8A 3EXFB 3I04M 3KLNA 3PQ5A 3W3AH 2H4YA 4CL0A 5C5EA 2Q4OA 4E12A 3DLTA 5CLIA 1BNCA 4ACBA 3GUZA 3PR1A 4KPUA 1C2YA 2QS9A 2FQXA 1L7NA 2MYUA 1IAVA 4G8JA 5AJWA 1E6KA 5G0TA 2MSWA 5JSKA 5ADHA 3CEJA 3RSLA 3EIUA 5A9SA 1EFTA 3ELYA 2FOXA 2WAYA 2ZR9A 1FP2A 3OPNA 3PUJA 4TVSA 3T5BA 3SDZA 4AN1A 4N9QA 2HZBA 4X41A 4EHJA 2C0QA 5L95A 4ZZIA 5I5EA 3P45A 1YRQA 5F7JA 1UKVY 3PITA 1AC5A 1X2EA 1YE3A 2LV8A 2J9YB 3WP1B 2VYCA 5AVTA 3HDTA 2OZKA 4RPHA 3EZYA 1XTRA 2HK6A 2HU7A 4HTFB 5AUOB 3P4XA 3K8ZA 2ZW9A 3STTA 4XCXA 2VHCA 1L4BA 5AW7A 4HEQA 4BWVA 2O05A 3A05A 4WNCA 2N47A 3OO1A 1BQEA 2NN3C 3BORA 4L4SA 5JXIA 3M3DA 4ZVVA 1LQUA 3VC7A 4Y2YA 2QTVB 5D6NA 1DXHA 1ETHA 4P8RA 3B20A 3SLGA 4P7FA 1IEQA 1FFSA 2OB1A 4KYTA 1ZMOA 2CHGA 3ZZ1A 3AFHA 3UICA 1ZHFA 1N8KA 1NG1A 2PXHA 2G9UA 1FRQA 3SQWA 2PD3A 2NYVA 4LK3A 3R9KA 3WLJA 3B6EA 2AR0A 3D3JA 5L3ZA 1L7OA 3LBYA 3FCAA 1A7UA 1Z08A 2VNAA 3TQSA 4B3MB 2YINC 1LVGA 2WDZA 1VJRA 2IYYA 4HFJA 2N3ZA 5LMNB 4MVJM 1THMA 3B9RA 3W1WA 4XDGA 3GJ4A 3P2KA 3HWWA 4OA5A 3NKVA 2YZ7A 2ID4A 3DZBA 2Q4DA 3H97A 3JZMA 4TSFD 4XIJA 3H2YA 4IEFB 5HCIA 3QLUC 3AF6A 2VQSA 2P6MA 4XGKA 5GMOA 1Y8ZA 1FW8A 4YRIA 1MOSA 3FTQA 3HRHA 3TGPA 2VJAA 2ZJ4A 3L4KA 2XRZA 5F98A 4KQIA 1ECPA 3V1UA 2IS2A 3EXG1 4KQCA 4KRGA 4LFBB 1M6WA 4RMNA 1BW9A 1YKGA 1O2DA 1V96A 2ZTVA 3IR5A 5CDGA 1UBGA 4ESVA 2BZGA 4XYBA 1XMVA 2EZ8A 3QIAA 2AC2A 4PAOA 3RRYA 2I1LA 4A2CA 3O1IC 5FFFA 5AVWA 2AEFA 1KZ6A 2J30A 4FQ8A 1C8LA 5F12A 1OBCA 3TW4A 5K8IA 4UCXA 1RPNA 1UC9A 3E7PA 4RL6A 4HXFB 2O2HA 4KZKA 3CINA 2QTCA 4K8RB 3RVLA 3WLQA 4F9FA 4HDMA 3U4MA 1Z88A 4EKYA 1DV2A 3AK4A 1M7BA 2VDWB 5DXAA 1OC4A 1TD9A 2FG7C 2C3PA 2JKZA 3L02A 1TD1A 3FNGA 5CJPA 1W1IA 1MO4A 1DARA 3GMIA 1PUIA 5IJAA 2QD3A 3S55A 1D1QA 1ZUHA 4KR2A 4YJ3B 4D0SA 2D2FA 1ZK4A 3KD3A 3MJSA 1JR3A 2VATA 1OT3A 1QK3A 3OI7A 4QEDA 4Z0PA 4MCHA 2QUIA 3BXOA 1TJNA 3O6VA 3KTAA 1Y5RA 3IT1A 1MRSA 2J3HA 4LJYA 4Y1GA 3UFXB 4E15A 2A1TR 1MZVA 3HBLA 3WSVA 4KYVA 1QE3A 4AJEA 5AH0A 3IQDB 3LFHA 1S2DA 1HV8A 2V6FA 3K32A 1NNSA 4HWKA 5JR3A 2H57A 2JZCA 4NESA 2IYRA 2I2AA 4CEIB 5CFZA 1G3QA 1EE9A 1UAYA 4WXRA 4XM0A 3N8DA 3F9RA 3K0EA 1EPUA 1QGZA 3D4NA 2ZRGA 4PYIA 3B51X 3BWEA 1XRJA 1FDTA 2DUWA 4IGEA 2XT6A 3GBSA 2BJWA 5ANRB 4MO2A 1Z7WA 2DY1A 3K73O 4TYQA 1JHAA 1LF5A 4BGUA 4DB4A 3G0DA 4RXUA 3SS9X 3USCS 3ROEA 2HUNA 2ZVDA 1D1SA 1JQAA 4YT4A 1NFQA 4GMKA 4DAEA 3T1TA 5TXGA 4Q3NA 2C42A 1QXSA 1R0YA 2BSAA 4B6EA 3AVUA 5KTTA 3TFWA 1VJGA 2J3MA 1D6SA 3FUUA 4FZVA 5GGYA 4MR8B 3VR5A 4LX8A 3TB6A 3K6RA 3VR0A 2CUNA 2X6TA 2BRUA 3KL4A 2DTEA 4FFWA 2W93A 3DHNA 4J0HA 4A5OA 3ISVA 4P58A 4UC0A 5ARDA 4B0OA 2D62A 4BVFA 4DSOA 1WS6A 3HBJA 1C1DA 3PGA1 3K70C 5EPEA 2FVXA 4CZ2A 3BD8A 4ADSG 1UXKA 3ACDA 3WMGA 2Q3HA 2M98A 3IALA 4HFRA 4A6PA 3IE2A 1BXRB 3TSWA 2PCLA 3GJSA 4GG1A 4BTEA 3THYA 5COAA 1KC3A 2YICA 2PWYA 3WQHA 2XAAA 4HOYA 4K26A 5FF9A 2CVOA 1OH8A 1OYOA 3LYUA 3MEQA 3AFGA 1S01A 3L4SO 4QFBA 1Z0IA 2O8VA 4F93B 2DQKA 2H4HA 4YXFA 2DYKA 2ZAMA 2HPAA 2XGSA 1NQVA 4IAOA 2A0FA 4GE0A 3RH0A 3W8RA 4MCAA 3UK0A 1WWKA 1Y9AA 4LOAA 1YCDA 2OO5A 3ZE7A 4UVIA 2V7EA 2HWXA 1M10A 1P60A 2IRWA 2WM3A 1CZUA 1T9HA 3BWBA 4Z2YA 2J0SA 4LDRA 3BMNB 1VLHA 3WL6A 1NNLA 2CFOA 4D99A 1TZCA 4GPD1 1P6UA 4KPEC 1MAAA 3IAHA 3TXYA 1CY2A 1SBZA 3WKBA 4ZOQI 5BR1A 3PPXA 5GWXA 2QK4A 4QHYA 3TH5A 3RYIA 3GN1A 5I7SA 3T1HB 2CDCA 2PZ8A 1KK3A 3H8JA 2B4KA 2ZE5A 3M6MD 3D64A 3PFHA 4CFYA 1T6YA 1XFAA 8ADHA 3E03A 1OQAA 1AKEA 5KMGB 4BDSA 1WBBA 4X63A 4B7ZA 4RTSA 2FPWA 1SOVA 1HZZC 1UKZA 1DT5A 1SXHA 2J7PA 1JDSA 1L5WA 2Q0QA 4K9SA 4BB6A 5KYWB 5LLTA 2ZRLA 4QSMA 1HDZA 1OY1A 4IEEA 4DIMA 6GPBA 3ADOA 3IAS6 3HA7A 3BDVA 1HFEL 4P7BA 2X41A 1NRJB 5CD9A 5AOBA 2ZXEA 1Y8AA 5TQVA 1N6HA 4UPVA 2P6OA 1X6VA 1HLPA 1QHSA 3CNHA 4R81A 3RIXA 1B0ZA 3RBXA 3LP5A 1MG0A 3MRTA 1U28A 3DZFA 4JJZA 1FYXA 3PEYA 2SNIE 4TLEA 4A5SA 3UPTA 1IFXA 2AUMA 1XVVA 3ZE6A 2DPXA 5JATA 2UXBB 1AKRA 3OICA 1F20A 3T7KA 2AX3A 1NVVQ 1BVHA 1FDRA 3NETA 4FDMA 1HX7A 2DWCA 2QMYA 4AX8A 1VCMA 1MG5A 4HMQA 1OLUA 2WAXA 3R7SA 3BN3A 1CJCA 1MAHA 1NMQA 1H2HA 4JLOA 5DULA 1FFYA 1MP0A 1AS2A 1EWVA 2LIPA 1YL5A 2H16A 3OZ7A 4V1CI 3JQ7B 1E69A 1JUDA 1LPAB 2VZ0A 4ZO6A 5H81A 4PPQA 5HJ7A 2X5KO 3C6ZA 4JXZA 1HSZA 1QLWA 3RS0A 2WWYA 1V11A 2PRJA 1E1CB 3HGTA 5MFZA 2D8AA 2WJWA 4Y0NA 1JLLA 4JBIA 4C4XA 1QIKA 4DMUB 2YXBA 1RZ3A 4BLVA 4I1OA 1OZ0A 2AMLA 4MUFA 1V1RA 2AI2A 2EYUA 5FTMA 3K20A 3N1UA 5IT4A 3HXTA 1Z82A 3LM8A 4TTTS 5J9FA 4JP5A 5G53C 2VPPA 4IIJB 5H70A 4JLMA 2FP4B 3OCJA 5DXJA 1QVAA 2EWWA 2IU0A 2BHTA 1NULA 2WD7B 3MM4A 5ENVA 1W5EA 4KUEA 1CVRA 4LI3X 3CE6A 1WBDA 4QUAA 2E0IA 2E4ZA 1DIGA 2ZYUX 4ZT7A 3SZUA 3Q7IA 1OYYA 1QE0A 4P2BA 2CEAA 4N5HX 5AM5A 1OZFA 5ALXA 3BHMA 2FX5A 1Z3IX 1VFPA 2HA6A 3DEAA 4W99A 3G0CA 4BRZA 1GYRA 3AWIA 3KYIB 2GXQA 3OIYA 2J3EA 4HYTA 4C3OB 1OB2A 1GNQA 1HEIA 1J99A 2BKXA 2H5LA 2WJ4A 5C81A 4JR2A 5KUTA 4HDNB 1PRYA 2LBPA 4OHZA 5LUAA 2ACVA 4HRYA 5BOVA 2VBIA 1WEKA 5DMXA 1RHQA 1WCYA 1L5KA 2IE0A 3DBVO 4LI0A 1NW8A 3U9LA 1E2NA 1ZH6A 1IWPB 1YONA 2RIPA 2C5GA 2P4HX 3B9PA 1FDVA 3W5AA 1PZMA 2JPDA 2FFBA 3DNFA 2C92A 3CO0S 4KUHA 3W6OA 3KB2A 3FPGA 2PXCA 5FOWA 4IVQA 2XRFA 3E4CA 4P83A 3UT0A 3VU1A 3RBZA 3GG2A 4KE7A 3WI7A 4FLEA 4LX0A 2W37A 4X94A 4M8LA 4LE2A 1W8IA 1GGVA 2IQIA 4WZBA 4CIVA 1OGYA 5F73A 2VYND 2OXFA 2NW6A 3WLTA 1I51A 4LV6A 4D79A 2YCBA 4FI3C 3BH0A 4WLFA 2CDAA 4CLEA 5H4GA 2GM5A 4YT8A 2QD5A 2LVBA 1YJAA 3HZOA 2O1SA 3H9EO 1A72A 1U3WA 3KQQA 4LJAA 1J8MF 1I36A 1U11A 1UDWA 3FFAA 1Q1QA 1T2AA 3L01A 5G3YA 2YC2C 4BNTA 4CIBA 1P61B 2C77A 5F1KA 2GZHA 2NP6A 5FTWA 1CJUC 2CYCA 4W5WA 4DSNA 2QRGA 3CH4B 2DBRA 3L1UA 3HJGA 3B12A 2PO5A 2R7AA 3PXAA 3VHLB 2FN9A 4ITUA 3IMFA 2ZB8A 3V4PB 2VJNA 4XYGA 3GY0A 5GJCA 4Y2HA 3AHDA 4OQXA 1G2OA 3MAJA 4PAMA 1AQIA 1DFIA 4BNMA 2NXCA 1VZ3A 5M34A 3C1UA 1P77A 3PFIA 5TDHA 1SHTX 1XIVA 3PQCA 4D74A 4UPEA 1Z6AA 2AE2A 4DNXA 3KAJA 2JBWA 5SY6A 4PWZA 5BN5A 2V7XA 2VP6A 1AZWA 4R9NA 4AJKA 2NU7B 3ZJUA 3CJRA 2GKSA 3JCZA 4IIBA 4L8FA 3EZLA 2D2IA 4HX9A 4FYMA 5JH7F 2IX9A 1TT7A 4FMCB 4HWPA 3OF3A 3FDIA 1X13A 1CSEE 3OMWA 2DHDA 5HM8A 5I8PA 3C98A 1LPBB 2JCVA 3LDAA 2YV1A 4MUHA 4S1OA 1N2IA 4E4RA 4GZLA 3QBJA 4ZI5A 1DBQA 4UOZA 1U8UA 4KPGA 4UHJA 1W0CA 4YJHB 1HZJA 5HS4A 2CLDX 4JLVA 3VR2D 5JTTA 3B53X 2OQRA 5LOVF 1BHQ1 3IBTA 1U7UA 1J56A 1J6UA 5DBHX 1VPLA 4M7RA 1YSCA 4G97A 4ZYTA 3UJ8A 4Y2RA 3QXHA 5K8JB 3I4LA 3MB5A 1GFWA 3O8BA 3BFKA 4AO8A 1O96A 2W2NA 2JFPA 3L49A 3QXCA 5L9AA 2FSGA 1PR0A 4UCFA 1XROA 2VUHB 5EQFA 5THQA 1TX4B 4PCLA 1RTKA 3UYKA 1X1AA 3ESQA 1RXUA 3IA7A 1CLUA 2XEDA 3ZDCA 2PMBA 3F1KA 1FBNA 1JDUA 1L5MA 3JQ6A 3HUFA 4HRVA 4J07A 4KTVE 1XVAA 1NVDA 4WK6A 1XHEA 4R8KA 2N9UA 5JPIA 4JB8A 2WD9A 5DWVA 5EMKA 3ZH9B 5B7QA 3QIVA 1B26A 3QV1A 3GI1A 3OJFA 5CJ2A 3VHRA 1YMQA 3ELBA 2O7RA 3KJHA 1NV9A 4HAYA 4ZYUA 3UNXA 1CUHA 4C7OB 3I9NA 3LF1A 3LLMA 4I9NA 1O89A 4B81A 2I62A 2J9FA 3OT1A 2Q3BA 4XYEA 2JB9A 1AJEA 2XHEA 4QDXA 2JLWA 2ONKA 2X76A 4DLLA 1GT6A 1WG8A 2Z8YA 3GLFA 3VKHA 4GVLA 3EEBA 3PVCA 1OSNA 1RABA 2X58A 3PR3A 2H00A 2DZDA 1K3TA 2VDOB 5B4TA 5KTRA 2B4QA 3IVXA 2PH7A 4HDAA 3TAXA 4DR7B 1GRRA 1XXHE 5DYWA 4NPAA 4HDSB 3RUFA 2RGYA 2C88A 4RF2A 4U3JA 1H22A 5ULLA 1RLOA 3S40A 4QLBA 1IBCA 1MO6A 3TQCA 4ZYLA 5CDFA 5BUCA 1M74A 4RVCA 1V6CA 1Q77A 1ZM7A 3B9BA 2X8JB 1XDWA 5HMLA 2IDJA 1NMYA 3BWXA 1EM8A 4N49A 2XDWA 4FYKA 3FAZA 3KKMA 1W0JD 3C15C 4FQ7A 4RVSA 4UFOA 5B2EA 5K09A 3GLTA 1QHXA 1EFDN 3GOHA 3MOGA 5DB4A 3RBAA 3ZJYA 1A9YA 3LTEA 1ELOA 4OGWA 1NTOA 1KHHA 3O03A 3PUWA 4EIWA 2XGOA 2QYHA 2J3LA 2ECFA 4MAFA 3R0JA 4KQ9A 4GUDA 1SH7A 1TK9A 2ZK7A 3WA6A 1P7PA 5JEDA 2FFAA 4WXMA 1RACA 3WG9A 4C4TA 1PZNA 4DHEA 1ILEA 1UBEA 1MR3F 1LKZA 4EEZA 4QOSA 3NNNA 5BSVA 4ZQFA 2E4AA 5BW5A 5BY2A 4X1YB 2J6BA 4RO0A 3CM0A 4BY9E 4CM4B 2R66A 4C6RA 4RY0A 4GP6A 3SC6A 3I83A 3ZTYA 2IUYA 1ZOLA 5HFNA 4OQZA 2OKCA 3T1YB 4NMWA 4RPKA 3O38A 2IYWA 3H86A 1PS9A 4Q7EA 1C1XB 4BNVA 1KJQA 1VIMA 1PR5A 1UP4A 4WGFA 4GOND 2GS9A 3R2JA 3DC2A 2NT3A 3VYTB 2XVZA 4HV4A 4LGCA 5GJVC 1RCUA 4TXHA 4DT1A 5CDTA 1XMOB 3GEIA 1SZCA 3W05A 2ADMA 1PJCA 5GJBA 4ZYZA 2JD0A 1UJNA 3SGLA 5F21A 3ANTA 4D9NA 4Y1RB 3CH5A 3N58A 5IG2A 5JIBA 4JEIA 2AD5A 4PO8A 4GYYA 2PMFA 4ARZA 3OLWA 1DIHA 1ZIXA 4TYNA 3IBGA 3CVYA 2ZPTX 3FOAA 5EI5A 1TVEA 3OCCA 1J90A 1LSJA 4G9GA 5DTJA 2WHEA 2HJRA 2MYPA 2YRFA 4QDKA 4ZZ3A 3N74A 4REQA 3NAZA 1XJ0A 3MBIA 4WOBA 1LNSA 5CFOA 4YJGA 3FMFA 5A71A 1GLNA 1YQXA 2ZRPA 3L7LA 2AA3A 2IHTA 4M6WA 3BBLA 3MWJA 5JBIA 1YS2X 4QARA 5AIBA 1CCWA 3KK0A 4YUYA 1AXRA 3ZDAA 2X8BA 1CNEA 3D8UA 1E6LA 5K3FA 4D4MA 3AHCA 2K5UA 4BKQA 2OHVA 4HWOA 4PRLA 2BFAA 3PNYA 3PUZA 1GO2A 1J21A 1DO2A 3C7TA 5DH9A 3HY6A 4DUZB 4MV5A 5JS6A 2WWWA 2PX5A 3RYFB 4A8JB 1Y80A 3QKTA 2H1OA 1MQAA 1LDNA 3SEQA 5E7IA 2AB0A 2H07A 4P84A 1PSZA 3H5TA 4WUVA 4A1OA 2N75A 5I7HA 1OV4A 1CRLA 2ADOA 1G16A 1E62A 2VQ6A 3R3YA 4Q05A 4Z9FA 3UGQA 3N86A 4Z1MA 3JYHA 4OJKA 1NUAA 3GJRA 1EH5A 2DPGA 1I24A 2GSWA 3WL4A 4AVYA 4CKBA 2YZGA 3A4NA 1PNVA 2PRIA 3KXKA 5GAJA 5T6MA 1TMGE 2D1TA 5J43A 1KZYC 4ASUD 1CZRA 3HR8A 2WU8A 4N7MA 5LUBA 3PZBA 1V3QE 3N2EA 3OE7A 4YRCA 2WPNA 3G6KA 3LHFA 5IDYA 4BV3A 4CPDA 3VOSA 2IEGA 4CEHA 4RHFA 2Q3JA 1H3NA 2SCUB 2ISCA 2CDNA 1QZTA 1P7ZA 4JJAA 4Q34A 1M66A 5D8DA 5F52A 4AYWA 1QQAA 3B9QA 4M1QA 5FLYA 3V8RA 2XXJA 3Q1KA 2YBDA 5EIHA 3PNMA 2IBSA 2PL3A 2GOYA 2YWCA 4JI4B 2VZ8A 4W4TA 3MTQA 1W93A 5EJEA 1PVOA 4I55F 1BE0A 1R6UA 3WJ2A 4C3UA 1VP3A 3KV3O 1MB2A 2AEEA 2IYQA 3F8TA 3G02A 3OIFA 4NS1A 1A3CA 5FYQA 4IJQA 1JXAA 4IDGA 3Q0EA 4HNVA 1E2PA 2G4VA 4FYYA 4RBNA 4EOGA 5GZ1A 2CC2A 3CGGA 4I50A 2WQ6A 4TLLB 4JL5A 4I2VA 5IBQA 2XSZD 5HTOA 5C1PA 4LG1A 1J09A 1YIOA 3JU3A 1ZESA 1M5TA 1STOA 4A92A 3ZW9A 3WHKA 4FB5A 1U0RA 1Q7GA 3FHLA 1YMVA 4YIHA 1S0UA 3CLVA 3NM4A 4LMPA 2CXXA 4KFRA 3RCBA 1TEXA 4G8DA 2Q8PA 3BFVA 4W5OA 1CE8B 1RYYA 2H5IA 1PYDA 3WHIA 5BO5A 1VP9A 2PR7A 2C83A 1X9HA 3QVMA 4O3FA 1UPCA 4Q02A 4UREA 3AG5A 5DHQA 2YWFA 5I8WA 1W85A 1MW9X 4JA2A 4AMZA 3W5HA 1MJHA 3CUTA 2ZIXB 1KK0A 1XVIA 1XZGA 2XBUA 4R7ZA 5E0OA 3UMJA 5FIUA 5LB4A 1Y1LA 4N5DA 5BW6B 3H9GA 5K4GA 1ZOPA 1RHUA 3B60A 4NSNA 4RSHA 2IV3A 4AWBA 3GHYA 1CUEA 5J47A 4PVCA 4Y0VA 1HDRA 3INYA 2NU8B 3RFCA 5T4BA 4KREA 2XCSB 1U1CA 1Z4OA 2G08A 3H87A 2XY4A 1B6GA 2GF9A 2N1BA 2FI1A 2HXYA 2P4UA 2YS6A 3COWA 5G41A 4YWJA 5GP1A 1GAWA 3RC3A 1GNTA 2WKPA 4G5OA 1ZICA 1OCEA 4URYR 3NM5A 1Q22A 2ZSFA 3LC2O 5AXCA 2C2YA 1XTVA 3TOSA 2FG5A 3SZMA 2FAXA 2ODAA 2Q6KA 5DM60 4I4NA 3OZBA 3F9IA 3KR9A 1XXHB 2XVXA 5HQ3A 2MIIA 2KJQA 5A4AA 3A1WA 3A58B 2R6FA 5DI9A 3VH4A 2YYZA 4CM6A 2J4CA 2ZUVA 3HDHA 2L19A 4C4RA 1EIZA 1H1LB 1DGQA 2IW3A 3MMNA 3L0ZA 1KZ1A 1PUXA 1GPJA 4QNRA 2P2ZA 2W11A 1FU8A 2J5KA 3KALA 3IAFA 2V7VA 4CQJA 4BXOA 2XXAB 4OMFG 4NULA 1WB6A 2AKAB 1F4VA 3E2MA 4FZ3A 3ZJ5A 1TKRA 3JYLA 3TFQA 3IUPA 2J9XB 4PN7A 4ENSA 5IARA 2PE5A 1E1LA 5REQB 1CRPA 4AZ0B 3PEEA 4DR2B 3R4CA 1WDWB 2YMPA 4FDLA 1MJGM 4MVWA 4D3DA 2XD4A 3MBOA 1ITZA 2PN1A 4AKGA 1HE1C 2ODTX 3CKLA 3HK2A 1X3LA 4IJWA 5KYYB 1MW8X 2ZRCA 1M34A 4WN3A 3ZV6A 2SECE 1NT2A 3IUYA 3ZXIA 3QJ5A 3QUAA 2GYUA 2HDHA 3FJYA 4JYMA 1ODJA 4A26A 3I1JA 1K2VN 2JRLA 1DX6A 2IPLA 3F3YA 3NR2A 4KXFB 4NBTA 2P9QA 4G4SO 3WMFA 2QMQA 5I9IA 5CB4B 5NLLA 3A9TA 5EY5B 1XQ9A 5DOVA 5CNIA 4JYPA 3QX8A 2C4MA 3E9EA 4J3NA 1NDHA 3MTAA 3WFIA 4DN6A 5BORA 2R68A 2W70A 3GH1A 2YY6A 2E5LB 2AEJA 4ZQIA 3FUVA 1I2ZA 2R8RA 2Q4BA 3EXHC 1AB6A 5FRDA 1K9VF 1QRDA 4C0JA 3GCWA 4P93A 4TZ6A 1OFHA 1E9BA 4JELA 3K16A 4HWRA 3ONVA 4RC9A 4WKBA 5EIOA 5BSMA 4BFZA 3OQNA 2CBGA 4YO8A 3LC1O 3KE8A 1TZMA 2X5XA 4Y0AA 1YL7A 5E8RA 3Q8LA 5HKKD 5I9LA 5JSZA 5ED0A 1SKYE 5FV4A 3T4EA 1UWCA 5EG5A 5EUMA 1NBOA 2Q6LA 3TTSA 1V0JA 4CUKA 4GH5A 4GPZA 1NC1A 1PS0A 2YOHA 4U63A 3MXTA 1JG6A 3PQ8A 2P2DA 3K9QO 3QH4A 5C1OA 5B6PA 1VMDA 2WW8A 4YHHB 4ZT5A 2WKRA 3PJRA 1S1CA 3KVYA 3LHSA 4RQTA 1G4HA 1YK0A 3GPCA 5GONB 2GO1A 2I1QA 3N07A 1N5IA 2CYAA 5ESDA 4ENRA 3E70C 1V48A 4D02A 2VSXA 2PV7A 2R8EA 3MFYA 4OI4A 2R6DA 4PO9A 5ALJA 4UM9B 1JH9A 1MU0A 4GE3A 5DM0A 1L5SA 2A8YA 1FYFA 3F4LA 3M5DA 4V3CA 3ME5A 3NHMA 3O8LA 2C7PA 1E0JA 1TM3E 1X1DA 3VBCA 2NAPA 1DIRA 3A3KA 4HWTA 1K5PA 1V39A 1M1XB 1Z4JA 1P4JA 1RYFA 2WUWE 3BEDA 1IZ0A 1T3ZA 3OAAD 4E4TA 1SC1A 3R6TA 4XTCS 1ST3A 3IILA 4OQYA 3HL4A 4HI0E 1R9GA 5D5HA 3VO9A 4KAXA 5FR2A 5CLLA 4HATA 3PDIB 3PXDA 4BAUA 4KQGA 1V45E 1Z0ZA 3F67A 1FMTA 2AUNA 2CE2X 4XLTA 3F47A 3SBEA 3T61A 3UGKA 4DLKA 2NTNA 3CYFA 2IITA 3KQYA 3OZVA 2ORED 1L8LA 1YS6A 4RCVA 5BV7A 1R9MA 1ZK3A 2YXEA 3KVVA 5I3ZA 3HKBA 1ZH8A 5CNKA 4ZKEA 4BZPA 5AVSA 1W52X 2ZIZA 3DH0A 2QGFA 3PB3A 3QHQA 4ROTA 3LL4A 1CUZA 1I30A 1M6NA 1TKCA 2Q9BA 4PCVA 4TKZA 4XJVA 4HNTA 3OECA 3K70B 4CM5A 2VHYA 2PZLA 3QEAZ 1KO1A 1I2CA 5DZSA 1PJRA 1V25A 1OX6A 3R3WA 4OP3A 3ROGA 5B7NA 2ZE7A 1GPBA 2EEZA 5EP4A 4FFOA 4L6CA 4G86A 4B0PA 5FUWA 5CEEA 3FPEA 121PA 2DQZA 1BKDR 4XA8A 4PR3A 1R4NA 2HFJA 1NVEA 2H51A 3BL5A 3IPLA 3QY9A 5T67A 1E2FA 2XX3A 5FUYA 4EJFA 4O4HF 1AZLA 3S0JA 3RAJA 1N77A 5DP2A 5C7IO 2EKDA 2VFAA 4MWEA 4RPGA 1ODKA 5KAPA 2IUTA 2JGIA 1W4RA 1ZJ6A 3KU1A 4HB2A 1Z5OA 3DS8A 1M8GA 3A06A 4BO5A 3SSAA 2EZ4A 2VAPA 1OXBB 2PYZA 1Y1TA 4LJKA 3W2EA 1QFXA 1AHPA 4B3SB 3LO5A 2OYCA 1QIEA 7GPBA 3TGLA 2FWAA 2A9FA 1N9ZA 3Q8XB 1R8XA 1XDZA 1DRWA 1BAPA 1G63A 1Q83A 1W5AA 3COSA 1NDUA 4NCIA 1EFAA 5K99A 4TUYA 1J24A 4D3XA 3F2IA 4ZARA 3HYSA 3KQPA 4I5IA 4QVIA 3HFGA 4K3UA 1QH1A 1WUKS 4DANA 2B1GA 1PIWA 4RM2A 1Q50A 4KXLA 4RAQA 4OD0A 3DV0B 4FFLA 1Y89A 2C7GA 4YMIA 3I6IA 4JJ8A 1E5VA 3HLKA 1USIA 3GFRA 3OA2A 3CT4A 3BJIC 3N75A 3PGLA 4FCTA 1NXVA 4YAFA 2QGZA 4HK4A 1GFIA 1DEOA 1L7MA 3EXIB 4LC9A 3L7KA 3INTA 4NENB 4YAEA 5FTNA 3X1KA 1LVUA 5D86A 1R88A 1NBHA 1IVNA 2QQFA 5ICCA 5AVVA 5FI1B 3I58A 1BJTA 2QPTA 1HYEA 3C3EA 3QWHA 1Z74A 3ZWCA 4LF4B 1RXSA 5EMHA 4B40A 3U09A 2PJRA 4HDOB 2JDID 4UBOA 3FVRA 3NGMA 3T7CA 4P86A 1RI1A 5KQGA 2JHPA 1EVYA 2R8YA 5IM4A 1G8AA 1CJTC 1H2BA 1U0SY 2XWQA 1A2KC 4DQ0A 1HNZB 2PS3A 3NO4A 1CUJA 3CF4A 1O94C 4S2UA 5F23A 1FLVA 1T9CA 2G5GX 1YRAA 3PL1A 3B1JA 4NP6A 4PQGA 3A1TA 4QQRA 3RJ9A 3V7FA 1FYEA 2PGOA 4GRIA 1T5SA 1GU1A 3L8CA 4YLEA 5F5XA 3QNMA 3WK6A 1XNJA 5JQGA 3ONWA 3IHWA 1QIFA 2Y0BA 2Z2YA 5FL3A 1Y7LA 3IDFA 1WDMA 2JAHA 4IJ5A 1SPXA 2N1MA 5JAZA 2C1EA 1BYUA 1TFUA 4LK2A 1RBQA 3R7AA 4A0RA 4LS3A 1YO6A 2OO7A 2ZETA 1QG0A 3CN9A 2CWWA 1OTHA 4MYSA 5TMDA 1NJFA 3FYHA 3X1JA 1N57A 1JIIA 2C5AA 2QL5A 3SN6A 1WMDA 3DGEC 2HYDA 2QUBA 3SXJA 2XV1A 1VE9A 4ZCPA 3RSHA 4EPYA 3D3NA 3DL2A 2Q2NA 3MWEA 3MRSA 4TN1A 3SQDA 4JI3B 3U40A 3BDIA 1JIJA 3EB9A 3I05A 5BVGA 1NJ8A 2AXNA 3SHFA 1CZKA 1J4AA 1JPJA 2G07A 5FPSA 4EHKA 4F4IA 2P11A 1UT8A 2AG8A 3A6ZA 3KE9A 4HEHA 4LYGA 4NLLA 3KZCA 4EVQA 2PKWA 5JWRA 4YASA 1Z5ZA 1WB5A 2VDUE 3Q98A 1K4YA 1F5NA 4PFJA 5FA5A 1KMIY 4I19A 3PUIA 1Y1SA 2WHXA 4AJ1A 2PMWB 2ZIEA 3S1AA 1JKMA 1RAHA 3AO0B 4BC0A 4D81A 2OBMA 1WKBA 3RE1A 4CE6A 3MTDA 4BQFA 4ARBA 4OLJA 3DP9A 1REQB 1CUYA 1WXDA 3UT5A 4NAHA 1V1JA 1DOAA 4F3CA 4TV9B 2NO9A 3KDSE 1T4CB 5L7YA 4E09A 2W2TA 2X2EA 2GN6A 2GVNA 1SKYB 2EZTA 3H1FA 4N3CA 1Q0SA 1G3IA 4MP6A 3LY9A 4K6HA 1N2XA 3G23A 5SV2A 2IVFA 4CQMD 1Q7CA 3PCTA 4DUGA 3MWKA 2HNAA 3UB4A 1RU3A 3AL0C 4I8DA 5AESA 3ROMA 1LDYA 2PD4A 1ZNWA 1SCAA 3DTYA 2VJKA 3QWIA 1I5OA 4H7PA 2IOHA 1K63A 5J59A 4EKDA 4EQ6B 2CXSA 2HBRA 1W2HA 1HQKA 2ORWA 4EPVA 2E89A 1A9ZA 5FUMA 1EX6A 2Z8XA 5JJCA 3U5ZB 1T0BA 5D01A 1L3BA 3V7YA 3HFJA 3CJQA 2A30A 4HEA1 4V38A 1L5HA 3QEBZ 3ERCA 1X1SA 3ZV5A 4ZT4A 5K4HA 4DQKA 2ZCJA 1G8KA 1Q2UA 4QHTA 1XEXA 2W43A 3PJDA 2Y2UA 2GPTA 1V16B 3FSRA 3PPVA 4O8ZA 4QZVA 2C1XA 3FGZA 3PC8C 1E7YA 2IPMA 3ETEA 3ZKWA 2ATCA 2A14A 2O8DA 2IYNA 1G21A 4FE3A 3GP5A 3O8NA 1V2HE 5CXSA 4GF5A 1S2MA 1KQNA 4CTJA 1B8PA 2B37A 4L0DA 2ZRIA 4ISCA 5B12A 1C7ZA 1E8MA 1XAIA 2H31A 2NVWA 2W2VA 1X15A 3N05A 4J1NA 2KBFA 3BFXA 5F1OA 5IXSA 4ZICA 1Z6PA 2WG2A 5G2OA 1GZ6A 2G67A 5IS2A 2FA9A 1L4NA 4KO4S 5FJIA 4G56A 3RWBA 3GBVA 3KOUA 3ZWKA 2GJ9A 4Y2PA 3X1MA 3COPA 3RD5A 3UHAA 4P0PB 4HQKA 2JFZA 1PWHA 4WL0A 4O5AA 2R6R1 4BVLA 2ZUFA 4H08A 4KDCA 2NUAB 1GTZA 3GG9A 2IY9A 4CMHA 1F7VA 1NXQA 2BSQA 3HBNA 4TS3A 4UHKA 4GW3A 1RWNA 3IIIA 3TZ6A 5HXAA 1A9RA 2V6GA 1WMFA 2PPVA 4DR3B 1F6BA 4ZPXA 1TUIA 5L6LB 4UTXA 1RKQA 3ICPA 4E2XA 3LUKA 4F4CA 1Z4KA 2AFRA 2FZGA 3M9WA 4FN4A 2PBFA 1FIUA 3FOWA 3CIFA 5IK2A 1ZISA 2VWGA 3LWBA 2WHRA 2ERCA 4R40A 4B84A 3H7AA 4LOIA 3ZR4B 3H2KA 2JD1A 3VSEA 4PQEA 1YDHA 2P27A 4FT2A 2XQFA 4CMIA 4X91A 2MSKA 2HR1A 4X6LA 3EC1A 3BWYA 1OAKA 3JQFC 4PRKA 1E64A 3TE6A 2ZRMA 3NHLA 5INTA 2AQKA 3L7IA 2WOOA 3VYWA 4CM3A 4X95A 3NHKA 1TEHA 5KCMA 2OORA 1ZGHA 3K35A 4JZYA 1SCNE 5M7EA 4WN9B 2O0HA 2UVPA 1DB3A 2IL1A 4NYIR 4WWHA 1JLHA 5ALMA 4CR6A 5KWSA 4NYMQ 2V58A 3UK6A 3AKEA 4ZVPA 2DG2A 3I8SA 1PUJA 2BBWA 4I4TA 3V1KA 5LN1A 1BKSB 1Z17A 2JRCA 3W3ZB 1TK2A 1X94A 1GL9B 2LCFA 1YZQA 4JLJA 5GOZA 5JADA 1UFVA 4GKBA 4RTPA 2ZJ1A 2JHAA 1DHRA 1YQDA 1XHLA 3ELWA 4E4YA 4HAWA 3QVGA 5FB3A 2XCRB 3LT2A 3GGCA 5KCZA 2V7UA 1FUUA 2WIAA 3BERA 4NBUA 1UXIA 3GVXA 1KY4A 4MWSA 1EZ4A 3TIIA 3GT4A 3JD4A 3OQMA 4MI6A 3UJ3X 2B8NA 4GQAA 4I6EA 1G42A 4WDRA 3NP9A 4FX5A 4C0XA 1I14A 3VXKA 4NAVA 4LC0A 3SYNA 4ETIA 3C5HA 3F5QA 4OEHA 5AI0A 1CJBA 1D2NA 1Z68A 3SDBA 1QRRA 1VRVA 5BN4A 3ORQA 4KR6A 1ISSA 4P4LA 2H8KA 5E1BA 4E88A 3FSGD 2FSPA 3DEYX 3RFXA 4DMGA 3TUJC 4ABYA 3VC1A 1SHUX 1D0SA 2MU1A 2MINB 1WXGA 3UENA 4MUYA 3U7RA 5DWQA 1C7RA 1PWEA 4BWYA 4D3ZA 2XUFA 4MUGA 1YB4A 4HVTA 3E2PA 2MR6A 1W36D 4YPFA 2HSEA 2P0AA 4XX0B 1PQUA 2OGZA 5F3WB 2CL5A 2DHRA 1ZXXA 4PTZA 1HF3A 1Z15A 3KNZA 2R8BA 1QHIA 1ZVQA 3BH6A 4MVYA 4MQ5A 5E4FA 3TW6A 5DLPA 2QTGA 3T7IA 2WJ3A 1GTRA 2FN3A 2FSSA 4EYEA 1DJNA 2H1SA 5JZVA 2HF7A 2OGSA 1OAOA 4ZAZA 2Y6UA 2WBLC 5U4XA 2O59A 5K7SA 4A36A 4N8DA 3TPZA 3IVMA 1SRRA 2VTVA 4GU5A 4RJKA 3ZGNA 3OEWA 1Y6FA 5FNVA 3I42A 1TQ8A 3VYVA 3VKVA 5K8VA 4YRSA 3NPMA 2O54A 4YEDA 3L8YA 2FB9A 4TTQA 2NQ2C 4KE8A 2XGMA 4MLZA 4D5EA 3MGKA 1ISGA 4YY3B 3HFRA 1JHMA 3C87A 3M0EA 2XNJA 4DJDC 4LWQA 1YWGO 2IU4A 4MYHA 2HLPA 5EKXA 1RAFA 2LKDA 3E9RA 5ERXA 1YZLA 4LNUA 1ZMXA 1WJGA 5ILGA 2XA9A 4FINA 1T5DX 2IQ5A 4UKDA 1Y4DE 3UJBA 4X0EA 2JKVA 3L18A 3IO3A 4D9FA 3VU8A 3BCHA 5ESRA 5AVXA 3FTDA 1CC1S 1PR2A 1QK5A 1Z5UA 2AJTA 1LEHA 3A4MA 3EBPA 2NO0A 3GZNA 4HGOA 2QRHA 4PLTA 2C2GA 8MHTA 2OXCA 2XMZA 4M53A 2H3EA 4MKXA 2QAGA 1WKCA 2P9CA 3DULA 2C78A 3NH6A 4GOKA 3G5TA 5LP6C 4GBJA 2Q7DA 3HHEA 4GSYA 4ZOEA 4E21A 4G0PA 4EK9A 4YUAA 1M2FA 4ZPJA 1IBSA 1O7JA 3CKYA 3GEDA 3F71A 4EGCB 1BS1A 1SULA 2ESRA 4L5CA 4EA8A 3AFMA 4BB9A 1I4OA 3LCMA 3CLSD 3E81A 1EFHA 4OHRA 2HGZA 4RD0A 1LZLA 3ZQUA 4FNGA 1LI4A 5FWXB 5IJ0A 5J3JA 3S28A 4ACAA 5CFRA 1FP6A 3VU3A 1K5HA 1IIRA 2R4TA 3SE7A 1J39A 1LFDB 5ARBA 2C3UA 2GPSA 4EW1A 1P29A 4JAVC 3M81A 2E4WA 5JZ9A 3BKXA 1SHJA 1X74A 3U4AA 1XK6A 3RJTA 4PZ0A 2VDQB 1Z37A 1X19A 1U0FA 3HSSA 5B57C 2ZI3A 2XOKD 1TMOA 5DHSA 1KO7A 3AY7A 3HXLA 5GADl 2HRDA 1OX4B 2X23A 4QTXA 3RASA 1GTSA 4YCCA 1SWWA 3HKCB 3LT1A 2ZUSA 1IZ7A 1YU9A 3ER8A 4MKFA 1CEEA 5EMLA 1HQYE 3H9CA 1YUBA 3H0EA 5B6IA 2WIGA 4OHCA 3OM8A 1ICIA 1CY0A 4ZO7A 2XMQA 1HORA 1CTQA 3FRHA 1NLFA 3LXUX 3AY0A 4NBWA 4EFKA 4GP9A 3MJRA 4MIOA 2R48A 5GZ6A 4LQDA 2JLXA 4LF5B 1W75A 1NPYA 4OXRA 5B64A 1X7WB 4BTVA 3IP6A 1K6XA 1WU7A 3CF4G 1FS5A 1RKXA 2YQ4A 1TI7A 2LW7A 5FWDA 3U62A 3ZDEA 3WFZA 4CFSA 3CVWA 3TG8A 4CV3A 4XYMA 1TQDA 2HFKA 2IBTA 3ANYB 1KF0A 2VRWA 4I81A 2ZWPA 2EV9A 4KXXA 4Y7DA 1M2HA 1N9GA 1PR3A 3V1TC 3QGMA 1FRZA 4ZU6X 3C1TA 1G55A 1PGNA 2AV6A 2DCUA 4JJGA 3LBAA 3OSZA 3RG8A 3GW8A 3ZJTA 1ST2A 4Q4DA 2W4QA 3VZSA 1SM4A 2H1IA 3KJNA 4XEHA 3DTTA 5CXUA 4REMA 3MHTA 3ZD7A 4AIRA 3DLHA 3HMKA 1Y4SA 3D6VA 2FDCA 3C16C 3PGKA 4UM9D 1MV5A 1YTUA 3L8FA 5BUSA 1Z62A 1HETA 5DTEA 1FFBA 1P72A 2JVIA 2HUPA 2WJAA 5H80A 1RM4A 2J6IA 3O31A 2PSHA 1W96A 1Q14A 2HHJA 3EXAA 3HV0A 1KAMA 3IVRA 1C0KA 2ZJ5A 4M0KA 3G8BA 1CUWA 4A2PA 2WG1A 3CZQA 4QTZA 1OBHA 5I51A 5EPUA 2ILTA 4WZAA 4LOLA 2GYWA 2JEOA 2Y0PA 1FDOA 4IGIA 3JSXA 5FYDA 4O1HA 1QX3A 4TKVB 4JI8B 1OFUA 4MVXA 1T2EA 2HA0A 1ML3A 2IA5A 3C8ZA 4MW2A 5DKFA 3ZWNA 4BKMA 4TN5A 2VVTA 4C1BA 4RAOA 4A0HA 1DADA 2JZOA 2WZDA 2GUGA 3LS2A 3EF3A 2H2WA 3SX2A 2A4KA 3PPIA 2XRYA 4KAAA 4P32A 5ESXA 4R9RA 2IYLD 1H0SA 2JCSA 2O1XA 2Q5JA 3NEYA 3OT5A 2VRBA 1T3TA 2IYOA 1A9XB 2C03A 4RIIA 4UE2A 1E9CA 2VHUA 1W0KA 2RHRA 13PKA 3TSCA 1RAGA 5AI8A 4F38A 3DFMA 2Y1CA 3QNUA 1OR8A 1J2YA 1U3CA 2AN3A 2CHEA 4RM3A 4RU1A 2UUCB 2SBTA 4O4IF 3THRA 1IY2A 4R31A 3NATA 1IZ8A 5I7WA 1DUIA 2J41A 1PYOA 1NJ5A 1K0FA 1R00A 1T5HX 2CLMB 2V5UA 421PA 1J8DA 1QK4A 3FGPA 3AU8A 1G66A 4TOIA 3GPBA 1YH3A 3ISJA 1A82A 4UU1A 5A7FA 3NFYA 4BP1A 4O8CA 2P79A 3SQLA 3HADA 1G291 4N40A 4E5KA 2H1LA 3PG5A 4GZ6A 5KTSA 5IPFA 1UBRS 2HXGA 3C2QA 3GCDA 4IL5A 4B6FA 4EHIA 2X8WA 3GJZA 1WO8A 1GAXA 1QHNA 4P08A 2OAEA 1JALA 2HK9A 5IAEA 1LQTA 4XWTA 4IHKA 3DSRA 4OGFA 4Q15A 2G1AA 5M29A 5CA0A 4URHA 5G0VA 2EC5A 1XP5A 1SQGA 1KE2A 9ATCA 5LLDA 2W42A 3DE4X 1P33A 3I9JA 1OI7A 2XW6A 3JD3A 1VYVA 3JRWA 3L6CA 2VF2A 5J5AA 1PFGA 1SXPA 4XQCA 3ID6C 1XCOA 3W4IA 3ZXXA 5K6AA 4N41A 1R3UA 4J8PA 1DT3A 2EJBA 3OOYA 1EP2B 1CY7A 4J6EA 3N2IA 2PT6A 1YZHA 2I4RA 2CW5A 1TYCA 3DAOA 2HLDD 3G3EA 2C04A 3G59A 4RFLA 4ZV7A 3EHDA 3LRPA 2IUUA 3BK1A 3D43A 4DW8A 2VTDA 4KDRA 5JT1A 1E99A 2JLSA 2HPHA 1G5FA 2HF8A