3BGIA

Thiopurine s-methyltransferase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
231
structure length
231
Chain Sequence
DAEVQKNQVLTLEDWKEKWVTRHISFHQEQGHQLLKKHLDTFLKGQSGLRVFFPLCGKAIEMKWFADRGHTVVGVEISEIGIREFFAEQNLSYTEEPLAEIAGAKVFKSSSGSISLYCCSIFDLPRANIGKFDRIWDRGALVAINPGDHDRYADIILSLLRKEFQYLVAVLSYDPTKHAGPPFYVPSAELKRLFGTKCSMQCLEEVDALEERHKAWGLDYLFEKLYLLTEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiopurine S-methyltransferase
publication title Structural Basis of Substrate Recognition in Thiopurine S-Methyltransferase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 73
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.1.1.67: Thiopurine S-methyltransferase.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05724 TPMT Thiopurine S-methyltransferase (TPMT)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bgiA00
3G2OA 1QYRA 3Q7EA 4RTSA 2XBMA 3FTFA 1G6Q1 5ERGB 3CC8A 1AQJA 2IH5A 1SKMA 1XTPA 3JWIA 3HA3A 10MHA 5GINE 1WS6A 3HP7A 4CWAA 7MHTA 1QANA 4RYLA 3HVIA 5T67A 4HTFA 4K6MA 3B89A 1Y8CA 1T43A 2EG5A 4GBED 2OKCA 2GAFA 2PWPA 3KR9A 3A7DA 3ME5A 1JSZA 5DM2A 3R9XB 4PYKA 4E33A 3DP7A 3D2LA 4KRGA 5FCDA 3KQVA 2JH8A 3OU7A 4O29A 5E9WA 5K0GA 4E30A 3FUUA 4P7FA 4RTKA 2G1PA 3C3PA 2CMGA 2CL5A 3DTNA 1IM8A 4QPPA 5GP1A 5DXJA 3BGDA 3KQTA 4F86A 3GXOA 1SUSA 5HFJA 4RVHA 3NTVA 3UJBA 3HTXA 5E2BA 1FJXA 2H00A 5K8VA 2PX4A 5K0BA 4RSRA 3LCCA 2WA2A 3M6XA 2PT6A 2DPMA 2YVLA 3P9IA 5FUBA 4PCAA 3ORHA 1PRYA 1JG4A 1SG9A 5DXAA 5EMJA 3AJDA 4E2YA 1L9KA 5GM1A 2PY6A 3RIEA 3PTAA 5B1SA 5LQJA 1YZHA 3EVGA 3OZRA 5FTWA 4BLVA 3MTIA 2BR4A 4CKCA 5KVAA 4LG1A 2AVDA 3DMFA 2NNWB 3T7TA 1B42A 4C03A 2PX8A 1I1NA 4FS8A 4GF5A 1QAQA 3ELDA 2ADMA 5C9ZA 1O9HA 5K0EA 2EFJA 5CVEA 3M6UA 4PCLA 1D2CA 2YXDA 4KIFA 3OPNA 5F2NA 3NDIA 3MHTA 2HNKA 1JQDA 3HCCA 1KP9A 2PBFA 2P40A 2AOVA 2B3TA 4ER0A 5GM2A 3KQMA 4ISCA 3NVMB 5K0FA 3BWCA 2YUIA 3DR5A 2B25A 3JWGA 2FPOA 4C04A 4DQ0A 4P58A 1F38A 1L3CA 1VPTA 3LECA 1YB2A 2P7HA 1NW6A 4XCXA 1SQGA 2CWWA 3F4KA 4CTKA 5LQUA 4OX9Y 2PXXA 4QVGA 3DLCA 5HIKA 3G5TA 4DZRA 1P1BA 2XVAA 4ATNA 2QE6A 3EVAA 2F8LA 5LQRA 3NWEA 3EEYA 2VDVE 4R6WA 3G5LA 4RTOA 1SQFA 1KPHA 2BM8A 4DCMA 1RI4A 4MIKA 5DX0A 4YUXA 3TQSA 4B17A 1IXKA 4E31A 3MB5A 4QTUB 2O57A 3T7RA 1X1BA 4AZTA 5ICEA 4BY9E 3H2BA 4FZVA 2V74B 3PVCA 2ZIEA 4GOND 4PONA 1N2XA 2AOXA 3LDGA 2E5WA 3GGDA 2IDKA 2IDJA 2ONYA 3SGLA 4PYJA 5LQNA 5H02A 3FUXA 2AOTB 2ZZNA 3HEMA 2P1DA 4LWPA 4Y30A 1D2GA 2NP6A 4HSGA 3C3YA 1KR5A 1R18A 4V0RA 5EPEA 3BWBA 4EMSA 3FUVA 5K03A 4RX1A 2FK8A 2B9EA 2JHAA 3TM4A 3FTDA 5C1IA 5BW4A 3CJQA 2OZVA 2AR0A 2IIPA 1YFJA 3EMDA 5FA8A 5EEHA 1EJ6A 2FK7A 3PFHA 5DPMA 5CCBA 1UWVA 2KW5A 4G56A 3SVZA 4CXMA 3EGEA 3IHTA 5DM4A 3ELUA 3FPEA 3HNRA 3SSOA 5EHGA 5E8JA 4PYOA 3O31A 3ELWA 4AUKA 3KKZA 3LL7A 1P39A 2O0LA 4E70A 1H1DA 2OYRA 3V97A 2IH2A 3GRVA 3NW9A 3UJAA 2IP2A 5EG5A 2Q41A 2BR3A 3LGAA 4C07A 2V7EA 3NDJA 3T7SA 2ZZMA 2XYRA 2EJUA 5K09A 1G38A 2NYUA 3HCBA 1L3IA 2AOTA 3RW9A 4QDKA 4X61A 5DSTA 3Q87B 5GIPE 2H11A 3KPUA 1BOOA 3TPZA 3R0QA 3I58A 5DM0A 5FADA 1JR4A 1F3LA 2NXEA 2XYQA 3MQ2A 4P7KA 1G55A 1FP1D 1V39A 3BKXA 3DXZA 3EVDA 4PYNA 4X41A 1FPQA 4GC9A 5BP7A 1ZGAA 4FP9A 3X0DA 2FRXA 1O54A 3I5UA 2YXLA 3OU2A 1Z3CA 2ZSUA 3M4XA 3R24A 2XYVA 2ZW9A 3G88A 4FSXA 3KQSA 5FWDA 1VLMA 5CVJA 4C08A 4ER3A 2UZ4A 1AV6A 5F2KA 2NXCA 5U4XA 3DULA 4MWZA 2OO3A 1OR8A 3HCDA 2LD4A 3A25A 4H0NA 5E1OA 3DXXA 4RV9A 5E2AA 3VC1A 5ICCA 1DCTA 4PYIA 3GO4A 3UBTA 2EJTA 3P71T 5FHQA 3LBFA 5CD1A 1O9GA 5IKMA 3KPWA 4YMGA 1EQAA 2O05A 1XJ5A 2PT9A 5DTRA 5E9QA 2ZTHA 5FQOA 4ER5A 1VIDA 3OU6A 3THSA 3VSEA 1VQ1A 4RTJA 1JG1A 2IPXA 3G89A 4U7PB 5CCXA 4M38A 1YF3A 2PWYA 2JH9A 5C0OE 3V8VA 5ICFA 3B5IA 3B3FA 3FPFA 5EGSA 4BP1A 4HH4A 4PIMA 4YUYA 4PWYA 3BKWA 5LQKA 3LDFA 4DM3A 3NVKI 1P1CA 5T6BA 3P9KA 3FPGA 1XVAA 4KVZA 4MQ4A 4OQDA 1SUIA 1G8AA 3MCTA 3FTCA 3QV2A 4PINA 3PFGA 3UWPA 4E32A 5K01A 1ORHA 1R8XA 1NT2A 2IBTA 1KPIA 1KIAA 4R05A 3A26A 2PV0A 3B3GA 1WXWA 3UZUA 4FGZA 3CBGA 3KR2A 2UYCA 3OCJA 5HOQA 5EKXA 2JHCA 5IH3A 5FWAA 2ZZKA 3OE5A 5DTQA 2P3OA 1FP2A 1TPYA 4IV0A 4KDCA 3DLIA 5T64A 4EVIA 1FBNA 3SR4A 3IEIA 3SM3A 4E2XA 3QOWA 3RODA 4RTPA 1AF7A 4YV2A 3BT7A 1JTFA 4AX8A 4UOEA 1N7IA 2PLWA 3KPYA 5BXYA 3LX6A 2HV9A 2H1RA 3C6KA 3EVCA 9MHTA 3P8ZA 4MTLA 1JG3A 1ZG3A 2AS0A 2P8JA 1Q0TA 4PYLA 5HEKA 1EJ0A 5K05A 2O07A 3PLAE 1QAOA 2NXNA 1QAMA 3NWBA 4OQEA 3DMGA 3B7PA 1X1CA 2EX4A 2ZVJA 3GDHA 1VE3A 2YXEA 1DUSA 4EK9A 5K0JA 3OE4A 5LQAA 5EKUA 3T0IA 4PIPA 3UJDA 1EAMA 3JWJA 2GA9A 5EVJA 4DKJA 2BZGA 5BW5A 3CJRA 5ICGA 1HMYA 4PNEA 2ZWAA 3G8BA 5HIJA 4RVDA 5KQRA 5CIYA 4RTNA 5EIFA 2AN5A 3SSMA 3UFBA 3I64A 2I6GA 2YTZA 3IYLW 2GS9A 5HZMA 4CTJA 3TOSA 3FPHA 4QTTB 5DRYA 3KR0A 4YV1A 1KYZA 2VDWA 3DOUA 2PX2A 4QQNA 3BZBA 4KIGA 2NP7A 4FT2A 2A14A 5K0NA 1NW3A 2IGTA 3G2MA 5E1MA 4DF3A 4RVFA 4HGZA 2FHPA 3GJYA 5CVDA 3G8AA 5EIWA 3EVEA 3FTEA 1DL5A 2QM3A 3EVZA 2WA1A 2P35A 5JUWA 4E2WA 4DCGA 1ZHFA 4M7RA 1R00A 3LKZA 1XXLA 1NW5A 3HCFA 3TFWA 1X1DA 4IKPA 1I9GA 5P8WA 3GCZA 1R6AA 1VBFA 2ERCA 2O06A 1KHHA 3SX0A 1PJZA 3UJ9A 1UIRA 2ZIGA 2HWKA 1YUBA 1YZ3A 3EVBA 3MCZA 5CUQA 2I62A 1INLA 4QVKA 4HRAA 2VZ9A 2PKWA 3WSTA 5EMKA 2IH4A 4RTLA 1WY7A 5EC8A 3UJ7A 3L8DA 4RTRA 4V0QA 5FHRA 4EKGA 2AVNA 2N47A 1EG2A 5EZSA 4X63A 2IBSA 3S68A 1UFKA 5EZQA 1RI3A 3LHDA 5K0LA 4YUZA 5GIOE 3EEOA 2ZFUA 1ZGJA 5MHTA 1JTEA 3M6WA 3NMUF 1ZKDA 1R74A 4P7JA 4E2ZA 2IFTA 2ZWVA 5DX1A 3U81A 2XVMA 3K0BA 3EPPA 3ID6C 5FA5A 2GLUA 2HTEA 5DLYA 1P91A 4QDJA 5HIIA 1Q0SA 3KQWA 2PJDA 3P2IA 3O4FA 4HC4A 4HGYA 4FT4A 5EHIA 3TM5A 3UJ8A 3IV6A 5LR6A 2C7RA 3TR6A 2NXJA 3M33A 4L7VA 3P2KA 5LSAA 3I53A 3O7WA 3A4TA 5E1BA 3FPJA 4BLUA 5DWQA 2PVCA 3G2PA 4POOA 2OB1A 3KHKA 3QOXA 1RJGA 3ERCA 1L1EA 5KYGA 2ZBRA 2ORED 3HA7A 3MAGA 2UYOA 1EIZA 2ZIFA 4WVLA 1NV8A 2GPYA 3CKKA 4M36A 4C06A 4KDRA 1XDUA 2VDUE 3GWZA 3AXSA 2PX5A 3LDUA 5LQCA 2HR1A 2UYHA 4CKEA 1VP3A 4NECA 3LKDA 3DMHA 4EKIA 3EMBA 1X19A 2K4MA 4LECA 4BLWA 2Z6QA 1WG8A 1AQIA 3P97A 4RTMA 3B3JA 1VP9A 1XCLA 2Y1WA 2I9KA 5DX8A 1G60A 3BGVA 3VC2A 3TKAA 2VS1A 2Y1XA 2OY0A 2JJQA 4OA5A 4M37A 2DULA 2P3QA 1KPGA 3CJTA 1RJDA 2OBFA 3KQPA 4CKBA 3CVOA 2FCAA 3BUSA 2FYTA 3FRHA 2R6ZA 4PGHA 4A6EA 3KR1A 5E8RA 2CMHA 5F2OA 4GOLD 3GRZA 2ZLBA 1NKVA 2AOUB 3I9FA 4XUDA 1JQEA 4C4AA 2C7PA 1BHJA 1MHTA 5CM2Z 3GNLA 3OZTA 1VL5A 3C6MA 4RWZA 1RI5A 3DUWA 4ER7A 1RJEA 5K0CA 3G2QA 2OB2A 5GWXA 4U7TB 4AZWA 2BM9A 3C0KA 3ELYA 3MTEA 5D1NA 5DSXA 5HILA 1JG2A 3FYDA 1BKYA 4GC5A 2G8NA 3OZSA 5CVVA 3BXOA 3KQYA 4KW7A 3CCFA 4XUEA 5GOZA 4QPNA 5KQSA 4RVGA 3PT9A 4JXJA 5EMMA 2P7IA 2JHPA 2CKDA 2P3LA 3E05A 1RI2A 5DT2A 3TRKA 4ER6A 3AWIA 3GRYA 4PYQA 3UA4A 5E9JA 4YUWA 4F84A 1NBHA 2ZBQA 5FULA 1M6YA 1TW3A 2AZTA 2UYQA 1JQ3A 3PX2A 2AOUA 2OPBA 3KPJA 4BP3A 3P9CA 3EVFA 1XDSA 4IV8A 5EMLA 3REOA 3TLJA 3SXJA 3E23A 1KXZA 2C7QA 5DTMA 1TW2A 1NV9A 5DM1A 3GU3A 3HCEA 3BGIA 1HNNA 2B2CA 4GQBA 4XUCA 5EEGA 3HVHA 3SMQA 3KPVA 2G71A 3LSTA 3THRA 4MHTA 3PB3A 4DMGA 2PSSA 3HM2A 1ORIA 1SVUA 1IY9A 3E8SA 4RTQA 3M6VA 1NW8A 5E1DA 3TKYA 3VYWA 1WXXA 2AOWA 4FR0A 1D2HA 3LPMA 4GOOD 3CGGA 4LWOA 3FRIA 3G7UA 4AZSA 3SSNA 2AN3A 4YMHA 5M5BA 2ZBPA 4WXHA 4KWCA 3OFKA 4EQZA 5EOVA 3KU1A 5HIMA 1M6EX 2QY6A 3ER9A 4PYMA 5KS2A 1WZNA 4R8SA 2Z6UA 2YX1A 4OA8A 3FUTA 4GUAA 4R8RA 5FQNA 2C7OA 3ANXA 3R6TA 1U2ZA 4A6DA 4GOMD 2PXAA 4PGGA 3FYCA 1KYWA 5CVUA 4ZTBA 1YFLA 2ONZA 3M70A 1XCJA 1NW7A 2BH2A 3OFJA 4F85A 5G02A 3NJRA 2HMYB 4DA4A 1M0EA 2ZULA 3EGVA 2P41A 5DRTA 3FUWA 2PXCA 3PS9A 2G70A 3HVJA 2BR5A 3PX3A 2WK1A 2AN4A 3KQOA 3MERA 1RJFA 3R3HA 4HG2A 3UA3A 5JR3A 2QRVB 3LCUA 3GIWA 1JSXA 1I4WA 2I7CA 3GRRA 3A7EA 2Z6AA 3HA5A 2GB4A 1N7JA 3MGGA 4YUVA 1R8YA 3LCVB 3LBYA 3EGIA 5EQJB 4FSDA 3BWMA 1ZQ9A 3P2EA 4OBWA 1G8SA 1BC5A 3K6RA 4OBXA 2B78A 4HTFB 1QZZA 3UJ6A 3KQQA 2VP3A 4X60A 3TMAA 3AXTA 3ER8A 2G72A 3AY0A 4X1OA 3DXYA 1X1AA 8MHTA 4GEKA 5D1HA 2ZCJA 4AZVA 3BWYA 4R6XA 4QQKA 1NE2A 2ESRA 3FZGA 3A27A 3JWHA 4IWNA 1RI1A 3GRUA 4YV0A 4Z2YA 2JG3A 4Y2HA 2PGXA 2YR0A 3DH0A 2R3SA 2YQZA 3HCAA 1XDZA 2GH1A 4C05A 1L3BA 4P7GA 3UJCA 3E7PA 3P9NA 2QRVA 2QYOA 1MJFA 2OXTA 3HVKA 1NBIA
chains in the Genus database with same CATH superfamily
1QYRA 5FA6A 4HQ0A 4OGWA 2XBMA 2IOQA 3M89A 4BO1A 3HZRA 4FHGA 4HJXA 4XQEA 2WTMA 3QEMB 4ZD6A 4PTLA 1WS6A 5KHOC 2HX1A 3TL6A 9ATCA 4RYLA 3IUMA 3LJKA 3I6ZA 4OHMA 1C7FA 4PTYA 4JI5B 3TJMA 3G9TA 2PWPA 2JANA 1GNVA 3W79A 4MS1A 4V0LA 2XGJA 2JGFA 4OHXA 3DVLA 3VSDA 2TSYB 3F5DA 3EG9B 5BQOA 4CEHB 1HTTA 2ECQA 2D0IA 3K9LA 4W5WA 1ADBA 1EX6A 2AWOA 3GUVA 3MT8A 2JH8A 3JD2A 3ILXA 3P0RA 3OY2A 3L9XA 5TX7A 2NUPA 3ZQ6A 4BE9A 1L4EA 2IUEA 2JA2A 1KYTA 1UPCA 1ECPA 2BFCA 2FMTA 4Z4EA 1GRNA 4KO2S 1A7JA 1NRIA 3ZH9B 4B5LA 1GKUB 1U3FA 5H5JA 1RC1A 4CM4B 3DE5X 3O7MA 1T1JA 4PX9A 5FUBA 2HUNA 3QG5A 3RE1A 2D59A 4HAYA 5FUYA 4CF3A 4ESVA 4Y6RA 4U63A 2FZWA 4RSMA 5PGMA 1UK7A 4E2YA 3NEYA 2HIAA 4CDRA 1WHSA 2OFOA 3HWWA 1FC0A 1NMSA 3MT7A 1JA9A 1JDVA 2JAXA 4MWTA 4KE6A 4PLYA 4WN9A 4LG1A 5J5VA 2VZLA 2R6GA 3DMFA 1CUVA 5AUPB 4R2LA 3T7TA 4MV9A 2AHRA 4YO7A 4U02A 3S5JA 1L5OA 3V2HA 3THRA 3H6GA 2O0MA 3NM5A 5L4LA 1ZGBA 1J5XA 1QGYA 4JLBA 3AF1A 2YQ4A 4JJIA 3CRRA 3IQWA 3PT5A 3N0XA 5FR2A 1G2IA 1XRLA 3GUZA 3K0CA 3M5PA 5K45A 2F67A 1H4TA 2DWPA 1YQGA 1M34A 2HNKA 3CQ9A 1TIKA 1UKCA 3G17A 4XLTA 3S7TA 4KN9S 2I3AA 4YCNA 4B2LA 4EAQA 2JGNA 1MEOA 1RXYA 2YINC 4NJEB 2GCOA 4A16A 3R7WA 3JATA 1ESDA 1OXXK 3AR2A 4Z9XA 5KWIA 1CC1S 4LF8B 1NP3A 4A23A 4N3BA 4DNXA 2V0GA 2Z2IA 1Q3HA 1QTNA 1NZJA 3P0HA 4NSNA 4XCXA 2IUTA 1K3TA 2QKYA 2ZT5A 3UPDA 5LQUA 5JS1A 1K8RA 3B9RA 5JJKA 4DANA 4HFJA 3RYFA 2JVKA 4H17A 4MQFA 1X77A 4ALLA 4NKRA 1YDFA 4GU5A 3ZHZA 4Q4CA 5JRJA 1UKAA 3H19A 1XQYA 2IW3A 4YNBA 3EEYA 1M75A 2XA9A 4QJ5A 3RUEA 5I47A 4URWR 4RM3A 4AYTA 2W2XA 2ZYTX 4PE5B 1FOEB 1THGA 1YQEA 2NUAA 2BRUC 3ECSA 2O57A 3R3ZA 4PNPA 4LF5B 4Q4DA 2ZPAA 4NL4H 3AUXA 4BZXA 7REQB 4EA9A 2CLMB 4NFYA 1A04A 1XPJA 4EHAA 3HI6A 3AL2A 1GILA 1EPUA 3AY3A 3P32A 2GILA 4I66A 2EWVA 1ULHA 4MEAA 3WZMA 3M5DA 4YCBA 3CLRD 3NT5A 5D3QA 4ZC1A 3TTXA 3W5CA 3RANA 3Q3JB 4JT9A 5BW8A 3EAFA 3TLYA 5KYKA 2UUPA 1C1DB 1GGHA 1QMGA 1OZAA 2CNWA 1SVWA 2ZSAA 5CVCA 2YJTD 3ZHRA 4EUKA 5BW4A 4P3NA 1LJUA 2W5UA 3N86A 1TUBB 4KN5A 2I7XA 2NSJA 1NY6A 5FXMA 2HA3A 2AZMA 5I4IA 2HT1A 1KOJA 1EFRA 4XD2A 2DY1A 3QY9A 3MINB 3G0CA 3R3VA 3SSAA 3UKDA 2O8EB 1ECLA 3EUEA 1OW3B 3WWEA 1GPBA 3JQRA 3R0IA 2IEBA 4N18A 3KB6A 1F6BA 4ID3A 4UUOA 3HGTA 4LDJA 1N6OA 1KI4A 4LUCA 4M1YA 1S3SA 5IK2A 4LZPA 4H2DA 1PLLA 2OM6A 4FFNA 5DM0A 5FADA 1JR4A 2EWWA 2X4IA 1MFZA 5CFOA 1D1PA 3U60B 3DXZA 1XEWX 5HCIA 3JRWA 3NRCA 5FJIA 2EJCA 5BP7A 3MZ0A 3KXDA 5J59A 5THXA 3TZ6A 4AP6A 1PO7A 1G6HA 2D8MA 3IHWA 4NY1A 4UEOA 4D0NA 1VBNA 2CF5A 1DKLA 2JK0A 1TCBA 4ZO9A 3GD7A 5CIWA 4A26A 2OHJA 3NJ4A 1W8IA 4B8YA 5E1OA 1FXUA 4JT4A 4ZDWA 5IJXA 4Q4AB 2IDZA 4QASA 5A06A 1JQ5A 3GO4A 4OXIA 1KRHA 4DCCA 4EB0A 3EPKA 1M1YE 5JPIA 3UBTA 2RBKA 3EOBI 4V2UA 4KTVE 5DTRA 1M10A 4FMBB 5FQOA 2FQQA 3OU6A 5GGYA 1TM1E 1E60A 5AVTA 3JZMA 3K20A 3MF4A 3RUFA 4P1ZA 3JTEA 3QOYA 4L5BA 2ZWIA 2BZ0A 5HA5A 1QK3A 1GKYA 1Q50A 5ICFA 2ORYA 1JQAA 2DMRA 5HZHA 2JEZA 3QPAA 1XTBA 2IPNA 3OZUA 3R5TA 3R77A 3CO5A 4LYEA 2GYYA 1Z0FA 4CHGA 3PHBE 3LVRE 3NMUF 1ETUA 2PBRA 2VXBA 1SD5A 3QV2A 3F8WA 3FAZA 3M1AA 4I4TF 4Z53A 2VWHA 2XT0A 1J8VA 1F12A 3S3TA 4IVRA 5IRCD 2GI4A 1NONA 2IHTA 4BJ3A 3E9CA 4AKIA 1RBMA 3F98A 2OZKA 4PYRA 3C7CB 3D5TA 4FQ5A 3BILA 2A9OA 1FEZA 5H0IA 4PHHA 4HVCA 2P3OA 721PA 3SR4A 5B3KA 4BV2A 5GPBA 3BF8A 4WX2B 1W1IA 3AHCA 5HW0A 3HACA 3AHIA 4RESA 4YV2A 2VDWB 3FH0A 4PO3X 1T6ZA 1VDMA 2QD3A 2JLRA 3QVKA 3V9PA 1GZ6A 1CQPA 4GPTA 1CDZA 1PGJA 2H1RA 3SZLA 1O6CA 4Q4JA 2GEUA 3MMPA 3RVQA 3WNDA 4BUCA 9MHTA 1E98A 1JG3A 2P8JA 4MTLA 3LBHA 1NDHA 5T4FA 4JNCA 4W9NC 5K05A 1Q0TA 1SC9A 2V7QD 1X8XA 4UHBA 3ENQA 3NBFA 1EBUA 4HLCA 3LDAA 3W8EA 2JFGA 2PMBA 2I6TA 3L07A 4DAOA 5NLLA 2IW1A 4QQFA 4J0GA 4B45A 4ABYA 4Z5XA 2C29D 3RI3A 3DO8A 3QU7A 1JP7A 4R68A 1L7MA 2HJGA 1Z68A 5BMVA 2XCRB 3VKWA 5LKRA 4DT1B 4ZOAA 1SHLA 3UUGA 4BMYA 1YRYE 4O4LF 4OBEA 2XAUA 5EIXA 1OSNA 2V8OA 1NNLA 2I6GA 4RF3A 1KBQA 3QTTA 5EPOA 3LXXA 2JD2A 3TOSA 1H0KA 3GLQA 4B71A 3UYKA 1WNTA 3DOUA 1Z2DA 3OZEA 5K0NA 2CE2X 3R6GA 3O8OB 3BIOA 5EAIA 4O2AA 2J6HA 3GFOA 1RVV1 5BVGA 2FHPA 4R1NA 4NIMA 2Q7DA 3A6JA 3O1JC 3OPVA 2XADA 4I6EA 3HBAA 5T41A 1NASA 1SXIA 3GCWA 3L01A 1WQ3A 2P2ZA 3QVJA 5CG2A 3TQQA 2UDPA 1JYSA 1R00A 2FH5B 1NY5A 4B4OA 3G13A 4K9RA 4E07A 4KREA 4ZDIA 3UHOA 7MDHA 5CP8A 1YZ3A 2G5TA 3MCZA 1C0EA 2W8ZA 5TPZD 3MILA 2OORA 2PZGA 1YKSA 1R6UA 2R47A 2PMFA 3FBWA 4JEHA 3RUPA 5KSWB 4MDFA 4CEIB 2PHZA 4JGBA 1PFUA 2KJQA 1PZEA 4YWJA 4RDIA 4GXQA 3HUUA 2I4IA 2O0HA 3I5AA 2G7MC 4XARA 2A1TS 3TEJA 2WUGA 3B52X 3TZKA 4CFSA 1N9KA 3RU2A 3B8EA 1UBGA 4QATA 1NLUA 1OZHA 4MO9A 2C5HA 3DKRA 2BGLA 1BEEA 2CLSA 3GLVA 1UBLS 3H1AA 3ONNA 4QSHA 4ZVSA 1P2FA 1G5IA 2P30A 2ZOSA 2X6TA 5K2MA 3GI1A 2ZRHA 1HLFA 2GN4A 2VQDA 4YP9A 3OQNA 1P91A 1Y1PA 3T9AA 1RWNA 2ZP1A 1XP5A 4UKDA 3W1EA 3P2IA 3QMVA 1I7NA 4LVUA 2FWRA 2YBEA 1AQYA 1VKZA 2H0AA 2VDPB 3PUVA 1LBIA 1MQSA 3IEVA 5TT1A 2E21A 4MICA 1TM7E 1M7HA 4KGVA 2CHVA 2GBCA 4G97A 1PIWA 4O0LA 3KOXA 3WK8A 4GI3A 2ATXA 2MYNA 3OCYA 4LBZA 3WJ1A 1SXJE 4KKVA 1J56A 2QVYX 5LUBA 3O4RA 3WRXC 3GAZA 4GGMX 4OHBA 2GPYA 2WG2A 3OA2A 4RLQA 4C4XA 1I14A 3VU9B 4DHEA 1KDPA 4FPXA 3ZY5A 4Z4GA 1U7XA 4NE9A 4OB7A 1XCOA 3CLHA 4ND3A 2VDOB 3RRNA 3RC8A 3U4IA 4U0KA 1P1IA 2BMDA 1Y8AA 3BEOA 1VM6A 3U4AA 4HFRA 4PZDA 5CCDA 5DO9A 5A2QA 3T9CA 3RM3A 5EXDA 2A0YA 3LHFA 4WZZA 5ECGC 2EW2A 4PX2A 3H0EA 4L78A 1L5FA 1N32B 1WZEA 1GXSB 2Y1XA 4ZCTA 5JYBA 2XNDD 3W2TA 4J0QA 1UBHS 2H0QA 5COBA 4G0MA 3EGOA 1HEUA 1S2IA 4GE0A 1AK1A 2I3ZA 2J3JA 5HQ3B 1H2EA 5ERYA 1QG0A 1ZNQO 2NU8A 3KR1A 5KPJA 2NU7B 4GOLD 5CFPA 5B1DA 1CYDA 2XVZA 3AOEC 4MZXA 3SC3A 1OI2A 5HP4A 3CZQA 3QIAA 1BGXT 3A37A 5CM2Z 3CEAA 4J4BA 2PXHA 2REQA 5FF9A 5JG7A 3FPBA 1KC1A 2M6RA 1US8A 4OHVA 4BLQA 1EXVA 4HNTA 1PFYA 1VIAA 5JAOA 1WZ2A 1RE0A 1Y5NA 2FPGA 2XITA 2ZB3A 3C70A 1EX7A 3N8GA 3MTEA 5DSXA 3F49S 1G5PA 4HYYA 1SUAA 3NKLA 1CUAA 4GLJA 2V7WA 2NV0A 4ZZ3A 3IKTA 1WE2A 3C43A 4FHFA 3TRDA 1JIUA 4XM0A 4Q39A 1ESEA 1V2HE 2ZJ4A 3Q88A 5DCWA 4DDMA 4DWWA 3WVNA 2UYYA 1EFDN 3FNFA 4XWOA 1EZ4A 2UVQA 4OXRA 4RLFA 3HDQA 1RFLA 2BTQB 3MD0A 3PJGA 2BEKA 5ALMA 1AOXA 5AM4A 3AWIA 1YR7A 1SCQA 2WWHA 1RD4A 1Q7RA 4P4SB 5ALPA 5BOSA 2O8BA 1ISMA 2GD1O 4A73A 4F84A 2Y93A 5C8VA 4BIMA 4OYRA 2FFJA 3ORSA 2I4NA 3WKEA 1XMOB 2VCYA 4RK0A 2X77A 3BSWA 4QULA 5D6OA 1C7ZA 1SWVA 1IM2A 1IWOA 3NTOA 4B3MB 2H57A 2C83A 4TV8B 5C53B 4GSYA 1CS4C 3MBKA 3ZKWA 4PHFA 1LEHA 1V9LA 4A2PA 4IVNA 4OTZA 4BFUA 3UUEA 4V1CA 3BOSA 2ZETA 2OZPA 2WOOA 2K7FA 1TYBE 3AHHA 4NBNA 2XB4A 4QNMA 1H8ED 4AJPA 4IJ5A 4Q24A 1UJ4A 3HCEA 3N2ZB 4AO8A 4EW6A 1HNNA 1N5RA 2AFRA 3D4BA 3AM4A 4O1HA 4TRNA 1ZOSA 4R1UA 1I9CA 1GYPA 2G67A 3BA6A 4F56A 2AI2A 2GM3A 2EZUA 1L5VA 3W6OA 1IY9A 1YOVA 2A0UA 2BFBB 4G0YA 4RTQA 1UPUA 1GFWA 5K20A 2WHPA 4AJ9A 2VQSA 4MI3A 5H8WA 4AZ0B 2D0OB 1E2FA 3AB7A 1VXRA 2NOAA 4O4JF 1OPXA 2W11A 2XQFA 3ICEA 1BTOA 1KS2A 1FU8A 1T0BA 3C4JA 5FOXA 1N9GA 1NIJA 3LQ2A 1FP4A 2VRNA 2H85A 3MCWA 2DY0A 1PL7A 1PYOA 3OUZA 4OA8A 1L7EA 3FNIA 4Z1MD 2RI0A 2D7CA 4ISBA 2O8FA 1XCPA 3V4VB 1CHDA 1KMHA 4NYJR 3DE4X 1T1IA 5IVHA 1XMJA 1T29A 2UVPB 1UPTA 1FZTA 4MMZB 4H1TA 1T36A 4TXNA 1XNRB 5K3DA 2WI8A 3KKMA 2FF5A 1GLNA 3FUWA 3SLKA 2VK4A 3G2JA 3NC4A 4RXTA 4X6LA 4DCTA 2DF8A 4CUZA 3ABRB 4HQ6A 4LV5B 1BA2A 3UATA 2H4WA 1R8JA 1H4QA 1GAQA 5JR3A 3VH4A 1T10A 5GOTA 3B1WA 3CZRA 5T4HA 2QTCA 1FNCA 1XAHA 5F9MA 5EFZA 3PIIA 5FBVB 2FWNA 3AEZA 2B82A 5F12A 1BU5A 3LIIA 4I5FA 2DRIA 5JSHA 3THWB 3E3OA 1O5TA 5F3DA 3JSXA 1B6TA 5AM0A 1MDFA 4J0KA 1UMDB 3H8WA 3CH6A 3GVIA 4ZXPA 3ZIDA 4UUNA 5DK6A 4E1AA 2ACEA 2C4KA 4KXXA 3DHVA 3TUJC 5KNDD 4BX8A 5AVYA 5FDFA 4HLDA 4XQ0A 1IN7A 5JWHA 3SZRA 3I1IA 3LMKA 8MHTA 2ZCJA 4AZVA 1MJ5A 4ZVVA 4QQKA 5HCUA 2VWQA 4CYMA 1MU0A 4QXQA 2OP1A 4C29A 2JEYA 2V6MA 3B1FA 5BSTA 1Z17A 2PWAA 1OWNA 2FXVA 3WOVA 3AI1A 4XM1A 5MN6A 1UKYA 1U31A 3IUPA 5FAXA 1XVTA 1DJMA 4E5KA 3MVEA 1N9ZA 3PGVA 4C6SA 5D3KA 1FE8A 2QRVA 2QYOA 1HE5A 4OFZA 1NBIA 4KIUA 3V1YA 3WBJA 4PPGA 3CVWA 1QOPB 3OHPA 3TR5A 3VPFA 4BEBA 1PUXA 2V4MA 4DMRA 5DBOA 3OO1A 4DDUA 1JV2B 2GLXA 1AKNA 2XUDA 3KLNA 3MGAA 2HF8A 2ZB7A 4AU1A 4ALJA 4GBED 1E6CA 2WWVD 3ZU6A 1LPSA 2IEGA 1Q92A 2CNLA 5AW0A 4S1WA 1MD9A 1O4WA 2QL9A 4R69A 4RS4A 3UB2A 4GZMA 4CT0A 3FBTA 5JPDA 2DFLA 1TYAE 1HOXA 2WQ6A 4POAA 1V0JA 4EHKA 3U31A 4DPLA 1QFSA 3PDJA 4QUKA 4IOMA 3UG6A 3VO2A 5LOVF 4IJMA 5BN5A 4R8MA 5CW1A 4RVHA 5J2UF 1ZVJA 4ENSA 1RYFA 3WLTA 3HDTA 3OZXA 2PGLA 3F47A 3EQ7A 2X1MA 4WTOA 1AGPA 4CLXA 1OAKA 3M1IA 4TROA 2AXEA 4QUJA 1WAMA 1GM5A 1T5SA 1XKTA 4HWKA 2FUNB 4DZZA 1ZM2A 2PA3A 4ALKA 2OHVA 1YZHA 3RU3A 4CF6A 1UKBA 1GNTA 2PKEA 5FTWA 1ZGGA 1XWFA 1JHOA 2DPXA 3FDIA 5B37A 3Q8KA 1Z2NX 1TO6A 4Y7CA 4YQFA 4YCCA 3IB6A 1IVNA 4EGAA 2D6FA 4C4RA 2OR3A 1R0XA 1QAQA 3UMFA 2DR0A 1RQNA 1E2KA 4EA8A 4BJ1A 2FWAA 2H1CA 4N5DA 1Q7TA 1A1VA 4JB2A 3TTVA 2P2NA 3H4VA 4YRGA 3QVXA 1EP3B 4J3JA 2N42A 4QG3A 3FSGD 3JASB 3ZCSA 3GEEA 3ND6A 5C31A 4MW2A 3COVA 2ETVA 1HZZA 1W2HA 4I0WB 4Y6OA 3O83A 1YCGA 1W6UA 2A30A 1YJQA 3FFXA 2B25A 3BTSA 4KYIB 4OAOA 1DAHA 3EA0A 1JYEA 2EFDB 2Z4SA 2P7HA 5L7WA 3NB0A 1SHKA 2I6UA 3F4KA 3N39C 4GI7A 1RDFA 1C7EA 1T91A 3TTWA 1VJTA 2ZRJA 4YTEA 3BICA 4M0KA 3R7DA 4J0CA 3PXAA 1A2OA 2RONA 5TQ2B 4B31A 4BBZA 3H6HA 1G20E 1M2EA 3Q7QA 4RHFA 1FFEA 2HB6A 4CTMA 4K0KB 4UXHA 2GK6A 1L6IA 3IUNA 3IEXA 1RQXA 2QTWB 4X93A 4ZO8A 1U63A 3WMFA 4MV7A 3PNVA 3IUQA 2KLHA 2V74B 4DLWA 1KZ6A 2QTGA 3AT1A 2Q5HA 3OCWA 4LOAA 2PYZA 4HBZA 1VYTA 2WTBA 3KX2A 1YUMA 4MW5A 4O25A 3DA8A 2XTNA 1RYDA 3A28A 4FU0A 5FL7D 4AS3A 2APJA 3ANTA 4GL2A 3MCVA 4HFMA 3O47A 4CQNA 5H9WA 5DBGA 1BDHA 3FUXA 1LW7A 2CL0X 1KI7A 2WEKA 3OMWA 3EQ6A 2JI7A 4WXMA 5TF0A 1CUFA 1J8QA 1VHWA 1XX6A 2YS7A 3C5HA 3BWBA 4C0AC 3BGWA 5A4AA 4B76A 3RT1A 4HQKA 5DNCA 1AO0A 1SU7A 4QU0A 3V32A 5KWVA 2GNPA 2QVZX 4QOSA 1HDGO 2OZVA 1M33A 2BC9A 5EJMA 5FV7A 4C2UA 4UXIA 4MR7B 1B00A 1P2GA 1VYHA 3BBPA 4Y9RA 4D81A 4JLDA 1ADFA 5EEHA 1U0TA 3VO9A 1SXPA 4B3CA 1SEVA 3ZZTA 5JQGF 3PNSA 5J2TB 1K89A 3AI2A 3H11A 5JCOA 1OJ7A 2X0FA 3U4GA 4N76A 1CQJB 3FPEA 5C5DA 1TA4A 4RABA 5C9ZA 3FOZA 1JJVA 1Z82A 1K0UA 4HUQA 3R76A 2RBEA 2EW8A 3E82A 3OEED 4AECA 3CX8A 3ZGVA 5U9CA 3KXLA 4JQCA 1DRKA 3G0DA 4OI1A 1UAAA 3N0RA 5FYDA 4L2IB 3ENVA 4J1QA 4EP1A 2FQ1A 2Q9CA 4H27A 4M3NA 3HM9A 4ALMA 3H9CA 3HKBB 3DEKA 3ENKA 1H5UA 4M53A 2OECA 2V59A 1VLQA 4FLMA 3DWIA 1HDZA 2EEZA 4GZ6A 1BOOA 1DRVA 5KNCA 4DYHA 4G1CA 1GRCA 4LGCA 2EWMA 1V39A 1B0ZA 2QRQA 2XMPA 3BKXA 3EVDA 3O8NA 4OM7A 4WFJA 4AJHA 5A5FA 3OQMA 2FRXA 1O54A 1SCDA 3GCDA 3PZBA 1SVNA 4HDNA 4QXPA 1XTVA 1XHFA 2E5FA 821PA 1PYGA 4GI1A 3UXHA 2IZ0A 1J8YF 4R9UC 2YMLA 3RKRA 4NR0A 1U6IA 3ONVA 4I9FA 2D54A 3L8HA 5FO1A 1QH8A 2XUOA 5FNVA 2IEZA 3AOGA 1FMCA 3ZDFA 1KFBB 2BFEA 2XYGA 3GC6A 4XYEA 1HFEL 4GOXA 1SK9A 4MVCA 1F1BA 2ZB4A 3GJTA 2QL6A 4CMEA 3I9NA 4ER5A 1VKNA 1MX3A 4ZU1X 5KTPA 2WKRA 5K51A 4N47A 4WCDA 4GD3Q 1T5HX 2VCEA 4M38A 4QYTA 3V8VA 1BWSA 3B5IA 1JZQA 1NYQA 4HXEB 4YUYA 3F74A 1HY3A 3QXSA 5AKIA 4IBOA 4CUJA 1LJ8A 1U8CB 3FKSA 1GPDG 5EE9A 4TN1A 3KZVA 5ALLA 1SUIA 1VSQA 3ND7A 1O0BA 1P45A 2G08A 3VBEA 1ZNWA 2IBTA 1VCMA 2PDAA 4QSMA 2J3KA 4W1QA 2C54A 1VXOA 2ZZKA 3PXEA 2CMFA 2RC5A 3DB1A 1IUPA 3BZWA 1FBNA 2POCA 3H5AA 2B1IA 4J16A 4CM9A 4YT8A 4ZYVA 4WKBA 4DDWA 2BDTA 2COUA 3N87A 5CT6A 1A0OA 4F92B 2PUCA 1W73A 3DYIA 3ROGA 5DNAA 1QZTA 2HV9A 2QUKA 3T95A 3IQHX 3TLAA 3JSAA 5K4AA 2BHRA 1YS1X 1ZEMA 2R8ZA 3WTBA 2J4FA 3B9BA 3R7AA 5L6MB 3W5AA 3IURA 4L7QA 4TM8A 1KJQA 3GDHA 2ZVJA 2EF1A 2XBLA 2BFDB 2EATA 5K0JA 2GVZC 3ZVMA 1G3MA 1CY0A 2D3WA 4QUHA 4LK2A 3VNBA 1MIOB 4MVJP 1KQPA 1U0LA 3V4SA 3IDQA 4ZV4A 621PA 3KQKA 1JFTA 2GQ0A 4OMCA 1SVOA 1MPTA 1I36A 2B8NA 5AT1A 3WC4A 1M1ZA 4FS3A 2FPMA 4UFOA 3NGLA 1SHTX 3N75A 3ZDZB 4ETIA 4GH5A 2VTEA 3WK4A 1L5SA 4WESA 1W46A 3T34A 4TTQA 1X3SA 1GTL1 4RKYA 5JNVA 5BV1A 3VVLA 1R16A 2HA7A 5KQLA 4MX8A 4MSUA 1LSUA 2HHCA 4NG4A 5C35A 1DOZA 4QUAA 1SEPA 1L4BA 4IRUB 3ZE7A 5IYZB 5C8ZA 3U7QB 2JD0A 1VE1A 2WAYA 3KSMA 4NMMA 4E2WA 4A9AA 2I5PO 2FSHA 4NTZA 3OH8A 1XXLA 3CB4A 2B3DA 2YNMD 4A10A 5B4VA 3C3EA 2CHEA 1KI1A 3CH4B 1RU3A 2O8VA 3IELA 4ILEA 3UB3A 1BCSB 2FCRA 1QYXA 3RRMA 2IPMA 3V1LA 3EDCA 1WKVA 3T06B 4YR9A 4KFRA 5I7EA 1INLA 4YROA 4HRAA 2CLIB 5CM8B 5AIAA 3SQOA 2ZE7A 1WY7A 5BPHA 3B3QA 1Z6GA 4NK5A 1QPZA 5KKAA 2PKYX 3C7DB 3D7LA 4LTDA 3GPIA 2PIAA 4P08A 3AEKA 4Q4HA 3KS9A 4QOEA 3CNNA 3S68A 5EZQA 3ETNA 4CKZA 4FDAA 1J4AA 1E1CA 2ZFUA 5SY4A 1Q6YA 2D5AA 4H18A 1L5LA 5JC1A 5EJ9A 4OP3A 3BIXA 3FDZB 1HDEA 2C9MA 5BNFA 1LDYA 2A0XA 2MMCA 1DIGA 1F06A 2B8JA 3FHLA 2EYQA 3PQ8A 3B2QA 1DAFA 1T8YA 5FTJA 3L6OO 1LVUA 1EK1A 1P5ZB 1OA1A 4BO5A 1TJNA 4YAIA 3A32A 1LD3A 3VC3A 2OAP1 1G8JA 1YCDA 2BFMA 3TM5A 2RKWA 2V7PA 4FT4A 3T7EA 3SS7X 1SVKA 2ATEA 4K9DA 5H83A 1SHJA 4DMFA 4MWEA 1IBRA 3QLUC 3SICE 1CUIA 5CU7A 1RRVA 1WZIA 4Z51A 2PGIA 4HAXA 4HV4A 4UBJA 4TL9A 3EIOA 1UCFA 3IODA 5J9FA 4BNDA 3QOXA 3T15A 2QVGA 4P33A 4AIRA 2CJYA 1JGTA 1G0OA 1V4NA 5A71A 3DEYX 3HA7A 3MYYA 1TEVA 3NNSA 4GYKA 5FUMA 1NV8A 5JJCA 5CNJA 1RAGA 1XDUA 4JQSA 2PUVA 5L51A 1Y3FE 1YOBA 4C3OB 2WYHA 4KR2A 2DETA 3RWOA 5B36A 3PNBA 4EG6A 1CR1A 2RHOA 2ZRPA 4DZTA 4HMPA 2BUBA 3MQFA 3ZV4A 2QT0A 2FMUA 1CS0B 1QHXA 3FWZA 1UK6A 1VP9A 4IILA 5HKOA 1DEAA 3AEQA 1O97C 4M2LA 3VC2A 5BW6B 4K9KA 4F3YA 2JJQA 4DJDC 2HI0A 1A98A 5E6SB 2OBFA 1TLLA 2C5AA 5CNIA 1TQ4A 4N49A 1T3LA 3F8TA 7AT1A 2H7XA 4NEGA 2RGNC 2BH9A 5EJAA 4YJ3B 1MGPA 3FTPA 4L28A 1LKZA 4RU1A 1PGPA 3TSZA 4B6OA 3K6SB 3OJLA 1KK3A 1OH7A 1IFXA 2GYWA 4IR7A 2JB9A 3W90A 5JCPA 4HNRA 4JI6B 2B4AA 5KNCH 4PVCA 1K7FB 2JFBA 1IMJA 1GAXA 5IVKA 4GC5A 2I4TA 3IKMB 4RV4A 4TWJA 5D3MA 3C85A 1VG9B 4X45A 2XCTB 1DWQA 1CW2B 3FFAA 3AZOA 1OFUX 5AHXA 4ZQCB 5TE9A 1P7PA 3UMGA 1OAAA 1OYOA 3OWXA 2IOHA 4Q00A 5ES4B 1D0VA 1NT4A 1RWKA 2GPSA 5JH7B 1XF9A 1JBKA 1FB5A 2K5UA 3H75A 3CEMA 1QIGA 3SEQA 1EVLA 3LKVA 3QPVA 1VL2A 4Q03A 4X6YA 1X7ZB 1WCXA 5FWYA 3MWYW 3VNRA 1RQPA 1HQKA 2F3SA 2R62A 3OFND 4KGXA 3D6NB 4K3VA 2FPUA 3IFSA 5BT9A 2E9SA 2ZJOA 3FMGA 3OUUA 3QFHA 3ZVLA 5SY9A 1AIPA 1SHZA 1J20A 4L5AA 3R0JA 2IYFA 5DGHA 2RARA 3ZDRA 3G68A 5IKPA 3WOHA 2J5KA 4JB0A 3QNUA 3S8MA 3PGKA 5B58T 1NV9A 2WT4A 3CF4G 3GU3A 3UV7A 2IT1A 2NXWA 1EH5A 3ADKA 4GQBA 4BVGA 3GPLA 4Z4CA 2H08A 3KPVA 2PWBA 4PG7A 1Q95A 3V7WA 1L8OA 3RTEA 2VXOA 3CNHA 3PB3A 4CV0A 5T7BA 3S2UA 4E5SA 3EC1A 3L41A 3K2BA 3HXLA 1H3NA 1CR2A 3EXFB 3W04A 3ZJ4A 1IHYA 2V7QA 3MCAA 1WXXA 2R6AA 4MJXA 4X1KA 3RSCA 2GHQA 3I5MA 3QPDA 5WRFA 1L1RA 2P67A 3K15A 1EINA 1D2HA 3I73A 3IMEA 1FFXB 3R41A 4GOOD 1FIUA 4LWOA 3G7UA 4ETMA 1M6VA 5P21A 2E55A 2MSEB 3ZXXA 2VR1A 5KVVA 2ZBPA 4FIDA 2QPTA 4UUQA 4B40A 5KB3A 4V0MA 3PJDA 2WMDA 1A8QA 4IKEA 1WZNA 1JBEA 3IESA 2PPLA 4D6XA 5EIEA 4F97A 4OLFA 2ZT6A 1GUYA 3OZDA 4AY4A 4WCFB 5AM2A 4HS4A 2IXTA 2Q5OA 3RYIB 3ZOKA 4O2BB 3UK1A 2YMMA 1EGAA 4Q9JA 1X92A 2P9TA 5HF5A 1Y9EA 5A4MS 4B44A 2HMYB 2IHYA 4MQUA 1CEEA 4U7JA 2P41A 5DBHX 5DRTA 5BORA 1IOLA 5JAMA 2XZTA 1CEXA 2E87A 1LBTA 1J70A 2X9VA 2XNJA 2DGDA 3E1GA 4PX5A 2KPOA 3A04A 2YRXA 3B1JA 4G37A 2PRKA 3IVAA 3RK1A 4U6NA 4TRMA 1JHXA 4TLMB 4DRZA 2QROA 1IEWA 3MGGA 4TSFD 3TLCA 3H04A 4S3MA 2VHXA 1QE5A 4P81A 1BC5A 3UF0A 3H7IA 1ZI9A 3JYHA 3KSAC 3L4KA 3TLZA 5BSEA 1M2FA 2FR1A 5L40A 3LLCA 2AG8A 1EZZA 4Q47A 3LUAA 1VG1A 1GAJA 1LS6A 3AXTA 3EZNA 3GG9A 3KKPA 4MS1B 1E1QD 4YH1A 4YRIA 1MHPA 2PR7A 1QLJA 1KORA 2C1EA 2OCKA 2G09A 2ZU6A 4ZAYA 2NUPB 4IWNA 3GRUA 4AP9A 1PVVA 1I7QB 1J00A 2D1FA 1XLTA 2YR0A 2PCLA 3DH0A 2BFCB 2JGJA 4NG5A 3K9GA 1GSOA 2QLBA 5BN3A 1XDZA 3FDJA 5M7EA 3W78A 5ESRA 4ZEWA 4A0GA 4JBGA 1RYYA 4QTXA 1J2TA 2R84A 4UZFA 5FCDA 4EUFA 2E49A 2E6UX 3ZIUA 2VQFB 1ZR4A 1C2TA 1QIJA 2J7PD 3W5BA 2O8DB 1W44A 5IWCA 1N1DA 2AKEA 4LBYA 2ODBA 4QUGA 3U17A 3TTTA 1G8FA 4C7OA 1WHSB 3HP7A 3N3BC 4AKSA 4MI6A 1QVZA 5DGTA 1FX0A 1GDTA 1JLHA 1B1AA 1PZGA 3OE7D 2JK1A 2NQTA 3OTGA 1M5UA 1GQOA 3LP6A 3V4LA 3A9CA 4BX2A 3O4JA 4UNRA 1D7AA 1ML4A 2JLXA 2GRAA 1U0SY 1JSZA 5I01A 1G3QA 1QF6A 5K6TA 3KTOA 1EQUA 2G6BA 2WFLA 3OT5A 3I05A 1YVDA 3DV2A 3QWAA 1IXSB 2REBA 3HA2A 4R9NA 4B6PA 3V3TA 3INNA 1XTJA 3CXRA 3GHHA 3ZDQA 5I8ZA 3BGDA 4J1TC 1NX9A 1RMQA 1M34B 2I99A 1BSVA 1N5LA 1C4KA 5J5CA 3D3NA 3VOTA 5K0BA 1ILWA 1XQXA 5IJ9A 1CZHA 1LBSA 3T3IA 2GCOB 2O2DA 1Y3BE 1GVHA 3JATB 3GA5A 4JLVA 2RHHA 4OCZA 5DXAA 3R7WB 1MW8X 2ODQA 2XNDA 1KH1A 3K92A 2PRYA 5CYOA 3W7BA 1Z5OA 2HW8A 2ZSBA 1GCGA 4EPRA 4FMCF 4QBFA 1GR1A 4ZVQA 3RYFB 4MQFB 4EECA 1CUWA 1AKEA 1NR1A 4Z7NB 4DGQA 1JHRA 2XCQA 2W98A 3QG1A 5BSRA 2J7KA 3ANMA 4PLFA 3X1JA 5G0VA 3RRZA 1V8FA 3S6JA 1IG0A 3MWDA 1P29A 1S8AA 1X9GA 1YKGA 2BLLA 2NUAB 4EI9A 1T3TA 1O87A 4DV7B 3BB1A 1UOEA 1YMUA 1VJ5A 3HU2A 4I55F 5SV2A 3SC4A 2VK1A 1R0KA 4F5DA 1SXJB 1Y34E 2EP5A 1SR8A 2C2GA 3EB9A 3AR8A 2Q2NA 3D1LA 2ZYHA 5GM2A 4ZI7F 1CG6A 1NNUA 3KHTA 3RC3A 1KH3A 3FGNA 3TZLA 4DDHA 2ERYA 4B3GA 2I22A 1E1RD 4MARA 3V4PB 1Z8DA 4B3IA 4QRIA 2A9PA 3A6KA 4OJKA 4Z6KA 1P2DA 2Q3BA 1HNWB 1SCBA 3LUKA 3KDAA 5EHXA 1N36B 1K9SA 4N7RA 3M0EA 4KWIA 1GL6A 2VP0A 4HDKB 4WJLA 4CGZA 3WIUA 4EPYA 3Q7IA 3N28A 3DHEA 1COWD 4ATNA 2QE6A 3EVAA 5B6JA 2P5TB 2V7VA 1CYEA 1ZD2P 1Y89A 2XOXA 2RGBA 1ZH0A 2JJ1D 3A9TA 3AC0A 1V16B 4MIKA 1HE2A 1U8EA 2PZEA 3ACDA 5AH0A 4BGIA 2O2EA 4FKMA 4KVGA 1IPHA 3MB5A 4UNIA 4X95A 4BRUA 6REQA 2Z1NA 1H8EA 1X1BA 2F1JA 5HE8A 3W9SA 5ICEA 2PFSA 3SJCA 3H2BA 3O3MB 2YKGA 2G4LA 1FA9A 2AUTA 1KC3A 2PRIA 3VPDA 5H4GA 5K6RA 4WUTA 5IC5A 3K0AA 2C94A 4CU5A 1JDSA 3DSRA 2XBUA 2WHXA 2R7LA 1KXJA 4HX9A 2GHTA 4UAUA 5EHNA 1J0CA 3ANNA 1A4IA 2QX7A 1AV7A 2H1HA 2R2AA 4NOMA 2ROQA 5BOVA 4QGSA 5A5VA 4X97A 3R9WA 1MJHA 2ZDGA 4JNKA 4XASA 1ZOLA 2MU1A 4MK4A 1OLXA 3O3CA 3B1ZA 2AR0A 4K9OA 1UBOS 5G53C 1Y1TA 2VSXA 3ZUPA 4DV3B 4R54A 4HGQA 1BDBA 1NC1A 3E18A 1BFDA 2XF2A 3HKDA 4XYGA 5DBIA 5EQDA 1P6UA 4Z1MA 3TRIA 2DCMA 4AWBA 2Q2QA 1RJWA 2WAXA 3LGXA 4OGFA 5BR7A 2PZBA 3GQVA 3PEUA 2O52A 3MJFA 3Q40A 1CU1A 2EGHA 3A14A 4TXMA 4AUKA 4ZGWA 2FDCA 5TDHA 3V97A 2XV1A 3V8NA 3H9BA 3SYRA 4UU7A 2CNOA 4EMUA 4R8KA 3UY4A 2YIDA 2RMKA 1F8XA 1NVEA 5AM1A 4UM9D 4ZVMA 2C1ZA 3TCNA 4N0PA 2WB2A 2HPZA 2ZAYA 1YZQA 2IITA 5LQDA 2H11A 1P1HA 3CSUA 3B36A 2PD4A 1L5GB 1KARA 1SBYA 2GK3A 2LKDA 4Y1FA 3C87A 1GUFA 1JIKA 3EHDA 3OJXA 4AUMA 5J43A 1C0LA 16PKA 1WSAA 2XMZA 4GC9A 4U2DA 3JQFA 4UU8A 3V2GA 2ARKA 3FGOA 3R7SA 5TVKA 2QD2A 1FYWA 3WKCA 3KQSA 1AV6A 5AJVB 4NV3A 1QHYA 2OXCA 1XT6A 3KJEA 5F2KA 5FPKA 5KNDA 3CWQA 5LCXA 2C98A 2V96A 4EATA 1E6EA 1CZOA 2C61A 2AV6A 2HUPA 1O9GA 3KPWA 1T6YA 3OAAD 3X2EA 4LXHA 2Q3MA 1VIDA 3KOUA 4RTJA 4INPA 3U3ZA 4D26A 5KNLA 4WVFA 3UXYA 4OHPA 5JS7A 2RHGB 2HGSA 2UXCB 1P2VA 1U28C 1YZVA 2AMJA 1JIVA 1UQRA 4MHSA 1KO4A 3EAQA 4Q4JB 2W6ID 1PDVA 4XWGA 3W8RA 1QH0A 3ILVA 4PWYA 1EEHA 1LGYA 4QAJA 2HSEA 4GYWA 1J1ZA 1THMA 2QWXA 3HWX1 4JS0A 4OQDA 1N2CA 3BMQB 3MHTA 5E6RA 1G8AA 1M8KA 1V9SA 3Q6MA 3DMPA 1D8TA 3PFGA 1ORHA 1QIEA 3MA0A 4L3VA 4TXJA 1T35A 5A6SA 1FDSA 3NGXA 3ICOA 1W9MA 1MO5A 3QA9A 2OUIA 3WGOA 5DI3A 2CNNA 2Y4NA 3IMGA 4WNIA 1VHJA 5HKAA 3JTMA 4R8VA 3NO4A 4ADSG 2MTBA 3ZWAA 2ZIAA 5EJ8A 5LU8A 4P2GA 1U5BA 4AT1A 2O7VA 3ND8A 4UBIA 1KWGA 3MWFA 3ZCTA 3W5VA 3RT7A 3HH8A 3OEHD 1IZZA 4FYHA 4WNCA 4YRNA 4CW7A 1OXMA 3P1JA 1U8AA 2V7UA 2XUPA 3UTDA 3DKKA 3EVCA 2WM9B 3BORA 4V38A 3DAHA 3AFGA 1KEWA 2PRZA 1WSWA 4RIEA 4E4YA 5AUOB 3OI7A 5BVGB 1DMSA 3K35A 2QQGA 1F5SA 1U3GA 3AX6A 1FQJA 1YE3A 2OHOA 3BCUA 4KK3A 4ZDKA 4Z7QB 5HX7A 2GEBA 3GRAA 2V6BA 4NU6A 1KJYA 4K6GA 2PANA 2Q9UA 4FE4A 1DHTA 1WEKA 4W1SA 1KK0A 2IOFK 4XSGA 2YL2A 5KYUA 5CLFA 2Z8ZA 4J49A 4W7IA 3BMXA 1BDMA 1FDWA 1L7DA 2J9RA 3NNNA 1RTKA 2AFIE 3JQEA 4GLOA 4O59O 5I3CA 4U9UA 5FEUA 3CCBA 5KI6A 2O1XA 2YVAA 4KNVA 3DFUA 3FNEA 3K94A 3RVJA 3HMQA 3MIZA 1I1OA 3JZFA 2CEAA 1ZM9A 1YAHA 2CF6A 2HNBA 1ODFA 4U3JA 2FRDC 2V5UA 3ED1A 2GJAA 1R0CA 4DLVA 1X8LA 1YC5A 3ODGA 3N6RA 3W9UA 3B6EA 3FSGA 4JHXA 5K4HA 2BFWA 3ABQB 2VDJA 2XECA 1XZEA 1GD1O 2IPLA 1JIXA 1KA9H 2R9VA 2Y99A 3EARA 4EJSA 4LMBA 5B57C 4PLPA 1C9YA 1UJ5A 4PQRA 1XMVA 1PJCA 5AMXA 2VPYA 2ZUTA 3U3XA 2BPOA 1SIUA 1TEHA 2ZI9A 3MLBA 4YI5A 1Q0UA 4EY4A 5L8VA 1KZ7B 4KO8A 3PR1A 2DQKA 4WADA 1DEHA 2WR8A 1JG7A 4ZHQF 2PUGA 1QX4A 4G41A 1F0KA 4I9GA 1VG8A 1E96A 4DYVA 4QVKA 2OZLA 3BXFA 5EL0A 1I2DA 2V0CA 5L3VA 5AJWA 2OHFA 2P2SA 4XJTA 3F6RA 5H82A 2AYZA 2ISCA 5FHRA 5KYNA 4R3NA 2QTFA 2L18A 2NYAA 3JRNA 1U0HC 4YR7A 3I76A 4UASA 4FMDB 4F3RA 3KRTA 4B3BA 1J0XO 4I8XA 4J0FA 4GPEA 3D4PA 2ZXFA 3H42B 4O2LA 2CN1A 3M6WA 3O2JA 3ZV5A 3QVTA 3P9PA 3VHLB 1Q84A 2DERA 5FL7A 2Q6OA 2QJWA 3C24A 3GVHA 5DE3A 2X2FA 4A8JA 1I6LA 3OEWA 2W6JD 3OECA 4UU0A 1M6HA 1UXGA 2Y66A 5HIIA 5BWCA 2FG6C 1IUKA 3R3SA 1E3DA 1T9GR 1O4VA 1KMCA 3MG9A 4F1WA 2UUCB 5BRJA 3L4JA 3M33A 4L7VA 2CBGA 5KDOA 3I53A 4NXMB 2GXSA 4QUEA 4O4IA 5HK9A 5JSKA 2Y0CA 4W8OA 3AFNA 3R23A 5ISMA 2VXCA 3GG2A 4TQ9A 2REQB 1R8QA 2X13A 1D2MA 2C0CA 1Y33E 3BE4A 3D6VA 4IMJB 2VDUE 4RHTA 1US8B 3OEEA 3LDUA 3P19A 4INAA 3WBFA 3ZE8A 2FPGB 3HXTA 5LZ9A 1Y5RA 1NLFA 3QFCA 1G20B 1X19A 2IQ5A 3SZMA 2O54A 1QVAA 4AVYA 3V8BA 3GJRA 3FDXA 2F7SA 2QQ0A 1JDBC 3GPBA 3PNPA 2WAMA 5KYXA 1RRKA 1XZ8A 4GNKA 4XDGA 5GZ6A 2H2DA 5BWMA 3KUCA 5KU1A 1QUFA 1DO0A 4KQ9A 2YVUA 2GUGA 2RHTA 2X3FA 3CJTA 3EXHC 1GUBA 2RK6A 1A7KA 4J91A 5CHYA 4YRZA 4NLLA 3BUSA 2P6MA 2Q0HA 2VHWA 3I9OA 3R20A 1BMQA 2HF7A 4L6IA 4RFSA 4A6EA 5BOSB 2O8BB 5F2OA 2GJSA 5E7QA 3GRZA 4TN5A 1XA0A 1A8IA 3CU5A 1I51A 1FLVA 4MUFA 1BHJA 1DRWA 3HV2A 3LQYA 1GKIA 3GNLA 4ZALA 3OF5A 1WO8A 2RI6A 3ETLA 3H1PA 3M82A 4V1CB 1NN1A 1GKLA 2RH5A 4GR4A 1P4GA 3G2QA 4NNOA 1CUDA 3MEQA 4WOKA 3WIBA 1SIBE 3JY6A 4ZOEA 4OF4A 3NXSA 4E0BA 5ITWA 1PJRA 2JRLA 5CBPA 4L27A 4LJSA 4C5CA 1O95C 2G5CA 3UGTA 4YEDA 2X8WA 1ZXLA 3EBPA 3KZXA 4KW7A 1J8FA 1YHZA 3MJRA 4U2CA 4D8TA 4YRKA 5C51B 1PS8A 1YOVB 2L69A 1HRDA 4RVGA 3ZGNA 6NULA 1JLLB 2P9YA 1ACMA 5KNDH 1CT9A 3C74A 4O4HF 3T3PB 5CEEA 4Q3AA 5J1TB 3UANA 5HHTA 2QMUA 4OQMA 4UHHA 5DH9A 1KRXA 3KVNA 1LUAA 1FYVA 1QIHA 5COQA 1EWVA 1W88A 3W5DA 1PG2A 2R6FA 4I8IA 1PDOA 1N9GB 4L9RA 5FUWA 4BP3A 4CNQA 5KX5F 3LX5A 1B7GO 1FP4B 2EJBA 3KYJB 1XDSA 3TSOA 2G07A 5EMLA 2CV1A 3H87A 2CB0A 3GLTA 5J47A 5JCZA 3IV7A 1XZKA 4GWGA 3BQNB 4RZUA 4XJVA 3IO5A 3OG9A 1E61A 3IHKA 2QV0A 4FXOA 3AHJA 3U4DA 1KMHB 1X13A 2O8FB 1AQLA 1OXKB 3MSCA 3UJ3X 2Y6UA 1DV1A 3PPVA 3WNZA 2WAOA 3AP1A 2XIQA 3ABIA 4QYXA 3QHAA 2WSBA 3FJ1A 4N6OA 5AM5A 3K05A 2ZU0C 1OC4A 3KELA 2RKOA 4P92A 4EKYA 2PKQO 3LY8A 4FINA 4WGFA 4BEJA 5JT1A 4ONEA 2BFAA 1PUIA 2DHQA 3RC9A 4BQNA 4MVJI 1XHLA 2JIRA 4BO9A 1IIBA 1Y5MA 4M7OA 3QFSA 3DDUA 2JGAA 1S3FA 2HQOA 5T8KC 2CLOB 3ISVA 3LX4A 4EQZA 2ID4A 1JVNA 1D0IA 3ADOA 2GGSA 3FA2A 4PYMA 1E9EA 1H2BA 4I08A 4PGMA 4IEFB 4UDNA 2PYIA 2ZSKA 3E81A 4WXRA 2D7JA 2JIBA 3A2LA 4J8PA 3QYJA 5JJ5A 3T9EA 1CJBA 2C3OA 4B6QA 1NI4A 2H2FA 2Q2WA 3DAFA 4HRYA 4F38A 3PL5A 5KWEA 2Q1UA 5LMCA 3CVYA 1WUKS 1UBJS 3GJ8A 3OLZA 1J06A 3HNOA 5L95A 2C4NA 2QRVB 2I7CA 3A7EA 4MGYR 3H2YA 1N7HA 1WW3A 3L1VA 3S28A 4OX9B 2C3MA 3CLSD 3HY6A 2YNMA 4TZ6A 4INJA 2FG7C 4IO0A 3A6PC 4QGBA 3U7RA 4OYYA 3G5UA 1S3IA 3KM0A 4GLBA 2VHVA 1SPBS 1YL5A 2QT1A 4URYR 1HMPA 4AZ3A 5CXUA 1PN3A 1U2GC 1JPUA 4PC2A 3DXYA 4R1MA 4X1OA 4R0VA 4EWLA 1NN3A 1H6BA 5M2QA 2V0NA 1AQ6A 1YONA 3OTWA 2Z5GA 3JWHA 4Y9UA 5KHLB 4Q66C 2GM9A 3AYZB 1TYDE 3KCQA 1H94A 3ZX4A 1RACA 5LZ4A 4NENB 1VL8A 3HCAA 5BN5B 1IQPA 3I30X 3JXEA 2WM3A 4KV7A 4MGIR 3VH2A 1DC8A 5ICSA 3IUYA 3G2NA 1NKSA 1RWQA 3STUA 1JR6A 3JX9A 1HSOA 1KFCB 1Y6JA 1TK3A 3CZ5A 3NOXA 1HEIA 4K86A 4PS1A 4K6KA 3ZE6A 1DXHA 2AH5A 1C81A 1GPJA 1UFOA 2IL1A 2X8AA 4M8LA 4OQZA 2VUTA 1SKUA 3PXGA 3UICA 3ER6A 1R4NB 4R3WA 3KBBA 1A9TA 1NOJA 5HTOA 3LZDA 1P9OA 2W6QA 3V2IA 3NG1A 5B4UA 2B94A 3K53A 1CUEA 2GAFA 3LCJA 4WXEA 4F8EA 1YASA 1SUFA 2J3IA 1XTRA 4OQLA 4Z86A 3FHTA 1CVIA 3ZW7A 4CTOA 1WA5A 3R9XB 1SCUA 2E4VA 3WLEA 3RNLA 1Z4KA 2ZVQX 3OIYA 3QNWA 8ATCA 1N1MA 1JHDA 3X1MA 4PSVA 2E37A 3A1CA 3DTNA 3L0PA 4D9GA 3ODPA 1IBSA 1UP6A 1NPTO 1UC4B 3HTXA 3ZJTA 3A3NA 1B2LA 3BRWD 3PUKA 5CH8A 2YZMA 1HZJA 1KGSA 1QWSA 1JDZA 3MLAA 4MVYA 4RMNA 1YMVA 4RSRA 4ZTUB 1AO3A 1UL1X 3WGNA 2F3RA 2XMGA 5C8DA 5D5HA 1EFUA 1LWOA 4Y2UA 4N7JA 5GMOA 3RIEA 2HSJA 1NLMA 2PY6A 1Z5UA 4M9SA 1GTVA 2BGTA 4RHXA 4MUEA 3LSYA 4FI3F 3V2UA 1CY4A 2KX7A 4I1YA 4RGQA 4XVQA 3WX0A 4MR9A 3ZGXA 1NQWA 3PNOA 2A7XA 1B42A 1SNYA 2CUNA 3MTQA 4LY6A 1P2BA 3VO8A 1GPWB 2H2WA 1FFSA 1SZCA 1N75A 4GF5A 4AO7A 1HQYE 1N5KA 1GCOA 1VMAA 2XHZA 3EA5A 4U2BA 4GBJA 4RK5A 3QHQA 3WQBA 1ZH4A 3L8GA 2R1TB 1I32A 3EPLA 4BWYA 2LW7A 5F2NA 2QM7A 3UAOA 3HYRA 4EL0A 1X1QA 1Z06A 2DHDA 1LZLA 2FMKA 3MMXA 3MCUA 4YCDA 1K1EA 1P18A 4XWWA 2JHFA 3IDAA 4CETA 4B83A 3HCOA 4BRSA 3OHMA 4F7DA 2ZCUA 1H5NA 1QCDA 3F4LA 1F38A 1VPTA 3K6KA 1YDEA 5EP2A 3MRSA 4KG7A 1B15A 1QG6A 1G2PA 2WB4A 5CK5A 3UK2A 1JQBA 4BLSA 3OFNA 4D4KA 4UTRA 1NI3A 1XPRA 1N2OA 4DZRA 4DQXA 1BWQA 1QRAA 2DWCA 3FWNA 4S1NA 2Y0EA 2A5YB 3NHUA 1Z47A 4TS9A 3T5TA 1J9EA 2EAUA 2DFKB 3WGGA 1Z2EA 3GGCA 1QYVA 1SCKA 3H11B 4MGHA 4D9EA 1DFHA 1IXKA 1E5VA 1SH7A 3EY4A 1VB5A 2OHGA 4HUQB 5F64A 1KZGB 2TMGA 2XB8A 4IGAA 4D46A 2HF9A 3I3OA 1D03A 4QL3A 1YUNA 1R64A 1ODKA 1HE4A 5LWQA 1QGAA 2QYHA 3BC1A 4QJ4A 2CFRA 4QO8A 1JVSA 1S8NA 1YGYA 4I1UA 3EQ9A 4M9ZA 4CM9D 3HDGA 2XDYA 1L4MA 1JG6A 1HA3A 2II6A 2X5JO 1U1GA 4PZPA 3TD2A 3AQIA 2NP6A 4YQEA 1EVJA 2PQ0A 3A0UA 3PUIA 3AVYA 1CERA 4ESEA 3HN7A 1RWBA 2ID8A 1GEEA 4YMTA 4XYLA 3O0TA 4FOSA 4Y9TA 1NYLA 3B51X 3DO5A 4OB8A 1Y81A 1XPUA 3B1VA 1QQBA 1PI3A 3EIEA 3LA6A 1Z25A 1L4YA 3AQ4A 4WLVA 2UZ1A 1E2EA 3I01A 5EGNA 1N5DA 1XCBA 3SKVA 3MPOA 4F2PA 1QH8B 3BBLA 3PE3A 1O96A 3D3WA 5FNVB 4MOWA 4CKEB 3EXEA 2BFEB 3I1YA 3NBQA 3RBZA 1O5IA 1E1NA 2J41A 3NT2A 1FS4A 3RFVA 4ZZ1A 4HLNA 4TWAA 2WJZB 1SB8A 1T3ZA 3KT3A 3QVOA 4B79A 2WJHA 1Y1QA 1X7WA 3TVTA 3DZFA 5TARA 1ZSNA 1BD4A 1SULA 1YGPA 3D64A 1KAEA 4JH0A 1MAUA 3JYQA 3MMSA 4UATA 4CKBB 4L4SA 1R5BA 3WGYA 1KJWA 2OLKA 2XYQA 5EZ5A 4PYNA 2WYIA 4I4TA 4TSFA 4YFVA 1FPQA 3BQ9A 1NF2A 1ZGAA 2RHWA 3TIVA 3X0DA 1N0HA 4DS3A 1AA6A 2RD2A 1R6DA 1U7HA 3OTHA 3H1FA 1TUGA 3KETA 3WIOA 2JAQA 2JLUA 3I0MA 3ZXUB 5G0WA 2YV3A 1ULBA 2J48A 4LSGA 3DULA 4Z7JA 1S0UA 4QM6A 4YY3B 4YJKA 1I94B 1A77A 1E6MA 1R0YA 1U3TA 1PDWA 1TLFA 1XL0A 1E1QA 2WDZA 3DOIA 1AKUA 3OX2A 3QF4A 4H15A 4PYIA 5KCZA 3A4MA 4WA8A 3F0TA 1WV0A 3IBFA 1Q77A 5JZBA 3LRTA 2PGDA 5E9QA 1U9IA 3NAQA 3SIPA 3THSA 3VSEA 2Z2ZA 3ZWOA 5DJ5A 3H1GA 2OWDA 2JLCA 3L4BC 1A69A 3SF8A 3JARA 1XZBA 1D2NA 3FCSB 5AI4A 1UPBA 4D42A 1ZZEA 3BKWA 4G5SA 4NDZA 4WBSA 1IHOA 3SBEA 3HZOA 1NW9B 1UZNA 2J7PA 2B83A 5AD1A 4JX8A 3CRNA 4L0QA 2E4WA 1NP7A 1RLJA 2AIRA 4JUDX 4DCNA 2D2VA 3C3JA 4YYZA 1MTOA 1C30A 4RBNA 1QFYA 5G3YA 3OE7A 4O4LA 5ER9A 2A5JA 2FQXA 4BNKA 4YIHA 4H7IA 4BMZA 2JFYA 2Y1DA 1E2QA 3BCSA 3CUWA 2J0UA 3D8HA 3CVJA 3IEIA 1TO2E 2HWXA 2RCYA 3KB8A 4AYWA 5C46F 3CA8A 2A5GA 1TVKA 3Q11A 3WGUA 4L07A 5AOVA 2N1MA 1I0LA 4L6CA 3TZHA 1AZTA 3R0VA 4OU4A 5IF9A 4PXAA 2ECKA 4ARUA 1YB5A 5EYPA 3B13B 5DW0A 4KKXB 4LISA 4Z3KA 3QU4A 1CRLA 2W6MA 4I36A 2OBMA 1I4TD 2SICE 5KHAA 1HDXA 3H97A 3WL5A 4ZVRA 2ZI5A 1EG7A 2JS7A 3CW9A 4LRTB 4C0QC 1ES9A 4KGZA 2H16A 3TXXA 1JLMA 2W6ZA 2DLCX 1GLGA 4O6VA 2FETA 3K1YA 4QWMA 1JUDA 2VRCD 3BXEA 3F3MA 1W5AA 3F8SA 2WSMA 3QEJA 4RY9A 5BSUA 5NULA 1P1JA 1LDGA 2D4AA 4W8HA 1Y6ZA 3INYA 1W5BA 2M1XA 3I2YX 1CRPA 5KQRA 1WCYA 2X2PA 1IG3A 1WXGA 3UTCA 2F4VB 1TQ2A 3TX6A 1E8DA 1A82A 5HRUA 2WAAA 4ZRDA 5F52A 3KQHA 2CFIA 9ABPA 2FSGA 1QR2A 2ZAOA 1Q1NA 1F5NA 4G3XA 2IWRA 1KYZA 3AEUA 4Q4HB 3AEKB 3Q3GE 4M0DA 3BZBA 3CEJA 4X7PA 4E5PA 5C37A 1E6UA 1V1MA 4UNQA 4G25A 1E1CB 1GG2A 4XIFA 1MAVA 2HZ7A 1CZKA 4MA5A 3RD5A 4W5JA 3S27A 3KSBC 5DKFA 1PEAA 3U26A 4Q05A 3EVEA 1DL5A 1UC8A 3CRW1 3BH6A 5B1IA 3WV5A 2XZLA 1KP3A 1E1RA 1U0JA 1MLDA 1XZDA 3HFSA 4AM8A 5ERXA 4WZ6A 3LKZA 3WMEA 5I4KA 3OBIA 3L7DA 1K92A 5AVWA 1NQTA 1L4HA 3WDKA 1ZKMA 1PTKA 5L7TA 3JQCA 3VPXA 5H3CA 5L3QA 4G0OA 3KJQA 3OD1A 4HH3C 3GARA 4NFLA 1FRVA 4BNDB 2VZ9A 4HSEA 5FPPA 1JPVA 1P4JA 2JJ1A 3SDZA 1BNCA 3LOPA 1ICEA 3NYWA 1C7QA 4EPVA 1LVGA 1Y80A 1C8LA 1W0JD 1L7AA 2HMSA 3PDIA 4QT0A 2GN1A 1OXSC 4QE3A 5K0LA 1NF3A 4NAVA 5CX4A 3CW2A 1SRRA 2C5EA 4EFMA 2O2GA 3I1FA 3SVLA 1DG3A 2DC1A 4D8XA 4JD5A 3JQBA 4KMOA 5E0OA 4YRQA 5DX1A 3NATA 2W4IA 2FZ4A 1NIPA 3C3KA 1Q14A 5EKDA 4OK5A 2XOEA 3D6UA 4MW0A 1DBPA 4RGBA 4WCFC 3O4FA 3HG7A 3OIFA 3K5HA 1BW9A 1ABBA 3D7KA 2SNIE 3TR6A 1BE6A 3O1HB 4C4YA 4HLQB 3LNCA 5LSAA 2FR0A 2OV4A 3CRVA 4NBUA 5E1BA 3R4VA 4Y2XA 1I24A 4B9EA 5D87A 2WJAA 3WWOA 3DE0X 3LO8A 1WVIA 2RK4A 3KAPA 2IUFA 2IUUA 1C50A 3UO8B 1JT9A 1RRPA 3GLGA 3UXEA 8ABPA 2QNIA 3PIDA 3CKKA 1ZPDA 3ZEAA 4C06A 4G4SP 4LKRA 1L5WA 2FLKA 4KL8S 2W0MA 1YVUA 3RSLA 4DTIA 2FQYA 2OP0A 1CY2A 1S7GA 1UT8A 4DYDA 2K4MA 4MVXA 2NSYA 2QNBA 4NZMA 2RAPA 2EIXA 2YC2C 4JL8A 5D3MB 4KUHA 3KJIA 5KJCA 2FN7A 4B33A 4FHEA 4EW1A 1WRBA 2R8YA 4IIVA 4F6RB 4YA6A 5B3AA 1QRDA 2RHDA 3MTAA 1T9ZA 3RIXA 2VS1A 3UK0A 2XZPA 2PLNA 5AHKA 4HPXB 2WWRA 4HS9A 4ROSA 1VHQA 3K2IA 3ML1A 1ZRMA 3KQNA 3V8PA 4BP9A 3KLPX 2ZT7A 5FWYB 2VQ3A 4XFKA 5E8RA 1AXGA 5FH9A 4M1TA 3EQZA 4YWHA 4QFMA 1KR2A 5KPDA 3PU6A 5EA2A 1HKUA 2ILTA 3NWPA 5C4IA 5LL6P 3FNQA 5AKXA 4E15A 1AC5A 3DGEC 3TO5A 3AEYA 1BX3A 4IDGA 2GJ8A 3V7UA 1DXOA 2NQ8A 3ZTYA 2VA8A 1NDUA 2VF5X 2GHIA 1G98A 3C0KA 1U7TA 3OAAA 4JFRA 5D1NA 4XQ9A 1COZA 3NYIA 3FYDA 3KLOA 4OH7A 3GN1A 4P38A 1QONA 3X1KA 4FTWA 3OZSA 3U1BA 3NWOA 4QHSA 3ZY6A 1CZNA 3S2ZA 5DZSA 3B7WA 1B6RA 2DEUA 2W6IA 3OFSA 2HU5A 3CZAA 2JHPA 1SBZA 5U4QA 2R7MA 4X1KB 3GRYA 3ZS9A 1T6BY 3AKDA 5IDYA 3DUFA 1K3UB 1M6VB 5HSGA 5AXBA 1TOAA 3QKSB 4Q0MA 3MELA 2ZSDA 1RLMA 1K5GA 1ULZA 3P9CA 1DAMA 4NPCA 3L8MA 4MV8A 5J3JA 4FUQA 2QMHA 2GCGA 1ACJA 2WVAA 1QH1A 5LXTF 4MQ5A 3SFTA 2B1JA 4Z49A 5ALZA 2GZ1A 4GG1A 1JLSA 4F4JA 3OIVA 1ISHA 2B2CA 3IQZA 4XUCA 2ODPA 2XMCA 5ALKA 3OEHA 2OGWA 2SKEA 3MTDA 4CM7A 4NU5A 2QTBA 1MC5A 5FI5A 4H7EA 3TKYA 5GONF 5CJJA 1MABB 2ON6A 4S0ZA 4TMXA 4KX5A 1HF3A 2PMDA 1U65A 2GWRA 3IMCA 4JP8A 4BV3A 4ESHA 1U6JA 2MYPA 4IOLA 1FTYA 2DHRA 3PPXA 3ZNQA 1RHJA 2B0CA 1G18A 1SD1A 2FEMA 4MA0A 4WECA 4Y18A 5IJ0B 3BB4A 4P0QB 2D13A 1E2HA 1W25A 2A92A 2GRUA 3UWMA 5A7GA 3VJLA 3OPQA 1FXSA 1RW4A 1S3GA 3DAYA 4PGAA 3EXG2 4QO7A 4NNJA 4LE1A 1F7VA 3ZUGA 3IJEB 5JNWA 1P9NA 1Q2UA 4IO1A 3TW0A 1NQAO 1ZJ5A 3H3FA 3E2PA 2BGMA 4BRZA 2B4TO 4H1HA 1DKRA 3DZHA 2PXAA 1TT5A 1KYWA 1K08A 4JUIA 4A27A 3FCYA 4BX0A 4JBHA 2I4RA 2VQ6A 3MRTA 1N6RA 1JWAB 5EZYF 1DBIA 4Q1FA 2CJWA 2R97A 1HDRA 3E9QA 1XTTA 4HVTA 5BN3B 1POXA 2H18A 2QMEA 3Q0TA 3KHSA 3R3HA 1XU9A 4MGEA 4P98A 1JL3A 4TYMA 5FI1B 4WDRA 1OX5A 2C4WA 5HQJA 5JZOA 2PT7A 3MNFA 3OLQA 4FQ7A 5M3BA 5L6LB 2ZTSA 1N7JA 3LCVB 1EK5A 3LBYA 4IV5A 4FSDA 2I8LA 4OHYA 2H29A 3BREA 3VH1A 4EG1A 2IYAA 1I7DA 4NWIA 1FX0B 4HQNA 2NNLD 4O1MA 1NBMD 3QSYA 2HBQA 4G24A 4NATA 1BZYA 2F62A 4QBKA 1UJ6A 2G72A 2QV7A 4XTRA 2A78A 1PNRA 2WFLB 1J0EA 1JJBA 4MHOA 4OMFG 4YCMA 5IUNC 1T0HB 4Z99A 1Y8ZA 5K3BA 3LP5A 1I13A 4MWDA 2Q3HA 4R9VA 1SC3A 2AFIB 2DPYA 3J81A 3HJTA 3VC7A 5J2UA 1M2NA 4LYDA 2HA0A 2JBHA 5FPHA 3KAJA 4RO0A 2QP3A 4P7GA 4JC0A 1MV5A 3R9KA 1HDYA 2PKXA 2QW1A 2ATVA 3CZPA 2W6JA 3HJHA 4KO1S 1TA0A 3A1SA 4N3CA 1E9AA 1V3TA 4DV4B 3ST7A 4D9NA 5AICA 4EF4A 10MHA 4P0PB 3HVIA 2G4VA 2JIDA 3KAQA 4RZ2A 4KRFA 3OQIA 4K6MA 5DM60 1HX7A 3MT9A 2OKCA 4ZHSA 2WHRA 2FNAA 3NM4A 1YB1A 4OIMA 3ME5A 3G7NA 4Q3DA 5AYVA 4D99A 3LUCA 2AQHA 1SBTA 3HEBA 3IB3A 4CCYB 1MA0A 3KQVA 4IEIA 1X74A 3DDSA 3MWDB 3LDHA 2AMLA 5KOYA 1IY2A 1YR1A 3W2HA 2I2BA 3FLEA 2R6CA 1Y9JA 4AN0A 4DR1B 3HB4X 4LRYA 1B93A 1BDJA 2H00A 4ZI3A 4B3SB 4P5DA 1WDMA 1VFNA 1H6AA 1VKHA 3M9XA 3CX6A 4Y0VA 2DPMA 4GSLA 1BAPA 1JG4A 3E2IA 2YOFA 2CUKA 2GAIA 4QVIA 4RQAA 1QVRA 3K1ZA 4YRLA 1U80A 2Q0XA 3P94A 4JLKA 2RAUA 1NGSA 2CDBA 2B6NA 2XUZA 2BI8A 4E6PA 4JKIA 1Q0ZA 5JXGA 2LE0A 1RLUA 1Z7BA 1LPBB 2HMVA 1XLWA 1QOQB 2FB9A 4IINA 5ADHA 2XQKA 1U2EA 4X7MA 4FGUA 4FS8A 2QE7D 1NG1A 3Q9NA 1XK6A 3L43A 4HDSA 2W9XA 4M87A 3RS8A 5AW1A 2B0JA 4NRDA 4QLOA 1ILEA 2P65A 2V97A 4FD2A 4PCLA 6REQB 1FMLA 1WBDA 1EUDA 2Q29A 1JT2A 2X3UA 2OZEA 3C3MA 2PUEA 4KHPB 5UKDA 1LNZA 1JKIA 1X80A 1HYQA 2Q5EA 4YVFA 4D44A 1CR0A 4LPSA 1YJ5A 2WMOB 1WTCA 3IO3A 3LM8A 3BF7A 1VMIA 3O3OB 3OZVA 4JC8A 3KKOA 3D6TB 4KI0A 3UHPA 4BAZA 3K0AB 1F4PA 5FFNA 4JVLA 4QGHA 4K03A 2BFFB 3I09A 4G8BA 4IG4A 1SQGA 2C5LA 2ZYSA 3H5VA 3RVPA 4TWZA 2BMWA 1KJZA 2BD0A 3VKHA 3T3DA 4FMPA 4P54A 3A4YA 1W581 4LXXA 1DC4A 2JLZA 5HIKA 1OLXB 2OCAA 1GAWA 4L4XA 5AJZA 1PTJA 3EGDA 3EXIA 3KYDA 5JAPA 2BM8A 3VR0A 1TGVA 3D4LA 2JKYA 4PNHA 1IUOA 1DQYA 2I2WA 1OJLA 2NPFA 3L49A 4WJKB 4NNPA 2QVLA 3IHLA 3KEFA 4KRYA 2VJYA 3I2FA 3Q12A 3CR8A 4AZTA 4EF6A 5ALXA 1OFIA 1AKRA 2ZIEA 5JW6A 2BP7B 3P7MA 4V1CI 3LDGA 4D1YA 3VVCA 5BNZA 4ND1A 5LBIA 1CE8A 1V5FA 4HNSA 3ACBA 3QPCA 1QHNA 2P1DA 3GRCA 3IDZA 4D4HA 2H1FA 4ZJPA 2YHSA 2G0TA 3DF9A 4LXUA 1VHDA 1K4MA 1DOAA 2XE8A 3F3KA 5DNWA 1ZJ6A 4S1TA 3VTFA 2B7BA 4DUPA 2FK8A 4EO9A 2QZZA 5IN5A 1M2WA 2G36A 2WV9A 3GFPA 1QIKA 4PLVA 3F6SA 5ALQA 2BM0A 3L6RA 4LHEA 4MZDA 5C1BA 5CCBA 2R96A 1UK8A 4KXUA 3SMVA 1Y6RA 2R00A 3ELUA 3II6X 1NWHA 1KJJA 4Q9LA 2WKWA 3L5KA 2YVKA 1JDPA 2J9GA 3VI3B 3PHJA 2FE1A 3PKZA 2WJWA 2RH8A 1YR3A 3PFNA 4C3UA 2EERA 2ZI3A 4QYMA 2A9VA 4JI0B 4N9QA 2IP4A 4MKRA 2C0PA 5CITA 4C07A 2J6IA 3T7SA 4PBSA 2XYRA 2ODEA 4M6WA 2NYUA 1UEJA 2ZUBA 2AEFA 1TE2A 3LZ6A 4QDKA 4B2IA 4KVAA 3TAUA 5EMHA 2OGZA 1SVSA 4H3VA 4EENA 2F64A 5KOIA 3T0GA 3TQHA 4H6PA 2RBGA 1N2CB 3ITDA 2QTNA 4LJ9A 5E6RB 2Z5FA 5HGXA 1IQUA 4DCPA 2O59A 1VJ1A 4M8SA 1A72A 3A4NA 4QPCA 3SIRA 5CX1A 1MFPA 5A6SB 3B1YA 4FE7A 2Q1WA 3GZJA 1MNAA 3MOIA 4E13A 1JB1A 1F8GA 2L82A 1WUJS 4G1FA 1DAIA 3PBKA 5E3JA 4BDSA 1ZHHA 4C4TA 1W36B 1G41A 3FMVA 4C3ZA 2GA8A 4X20A 2X9NA