3BGIA

Thiopurine s-methyltransferase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
231
structure length
231
Chain Sequence
b'DAEVQKNQVLTLEDWKEKWVTRHISFHQEQGHQLLKKHLDTFLKGQSGLRVFFPLCGKAIEMKWFADRGHTVVGVEISEIGIREFFAEQNLSYTEEPLAEIAGAKVFKSSSGSISLYCCSIFDLPRANIGKFDRIWDRGALVAINPGDHDRYADIILSLLRKEFQYLVAVLSYDPTKHAGPPFYVPSAELKRLFGTKCSMQCLEEVDALEERHKAWGLDYLFEKLYLLTEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiopurine S-methyltransferase
molecule tags Transferase
source organism Mus musculus
publication title Structural Basis of Substrate Recognition in Thiopurine S-Methyltransferase
pubmed doi rcsb
total genus 73
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.1.1.67: Thiopurine S-methyltransferase.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05724 TPMT Thiopurine S-methyltransferase (TPMT)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bgiA00
3EVBA 3MTEA 2ZZNA 5EMKA 3QOXA 4AUKA 3SSNA 1RI1A 4PYIA 4MWZA 2PVCA 5CVJA 1EIZA 3OZTA 1EG2A 1I9GA 2HTEA 3C0KA 3NVMB 4ISCA 2QYOA 5ERGB 3TM4A 4ER3A 5CUQA 2UYHA 5DTQA 1JG3A 3NMUF 3HP7A 3U81A 4HGZA 2JHPA 3BGIA 3HCDA 5D1NA 2P7HA 3B3FA 1KIAA 3DH0A 4P7GA 4RTKA 5EOVA 4YUVA 5LQRA 1X1CA 3SMQA 4RTRA 1R18A 3V8VA 1KHHA 4X1OA 5DSXA 1Y8CA 3KPYA 3AWIA 5CD1A 3KPWA 1WXWA 1N7IA 2PT6A 2AOUA 1NW7A 2JHAA 1AF7A 3VC2A 5E1OA 1NW6A 2ORED 1UFKA 2P1DA 2AOWA 3G2QA 2XVMA 4OA8A 2HMYB 1WY7A 4PYMA 4Y30A 4E33A 5U4XA 2QE6A 3PTAA 1DCTA 2ONYA 3P9KA 1R6AA 3PX3A 3G2PA 3MERA 3R3HA 3H2BA 1MJFA 3VYWA 4OBXA 3FUWA 4KRGA 5G02A 3MGGA 2H00A 4PIMA 2IH5A 1L3BA 4FGZA 5E1MA 2XYVA 3PS9A 4XUEA 3JWGA 4C05A 5HIKA 1G38A 3GRYA 3P9IA 3HVJA 2R6ZA 3PB3A 2IIPA 3NWBA 1V39A 2AOXA 5EVJA 4Z2YA 3FYDA 2P3OA 5FQNA 3NDIA 1O9HA 2BR3A 2PY6A 3FPGA 3BWCA 4XUCA 1Z3CA 3TKAA 2Z6AA 2NP6A 1NKVA 4RVFA 1ZHFA 3B5IA 5EIFA 1NBIA 3B3GA 3O4FA 3HA3A 3KQQA 3R0QA 2DPMA 2C7PA 5LSAA 2FHPA 1JTFA 3UJ7A 4EQZA 2IBSA 2P7IA 3DXXA 1L3CA 1QAOA 2GA9A 3KQYA 4DZRA 1ORIA 1VP9A 4QVKA 4X63A 4CKEA 2YQZA 4NECA 1BOOA 1RI4A 3KU1A 4KDRA 4WVLA 4EMSA 5LQAA 4PYJA 2ZZMA 2OBFA 5K0JA 1NW3A 3BWBA 3EMBA 5DLYA 2FRXA 1XDZA 3LHDA 5T67A 3KQSA 5K0GA 1QAMA 3FUUA 3PVCA 4PYOA 2NXJA 3EEOA 4V0QA 3ELDA 3BGDA 2PBFA 3CKKA 5CM2Z 4RTLA 3M70A 2NP7A 3P9CA 3P71T 3M33A 2N47A 3T7RA 3LCCA 3BKWA 3C3PA 3TOSA 3X0DA 3P9NA 3T0IA 2ESRA 4BP1A 2JHCA 3LX6A 1SG9A 2PJDA 3DR5A 3FRIA 5DRYA 3LKZA 4E30A 3UFBA 3DOUA 2IPXA 4C08A 4PYNA 2LD4A 1HMYA 5T6BA 5E8JA 1P39A 2ZCJA 5EEHA 1VPTA 3I64A 3BWYA 1FPQA 1OR8A 2NXNA 3TLJA 2PXCA 1KPIA 3GIWA 3GRVA 1YFLA 1MHTA 1P1CA 4RYLA 1BKYA 2YR0A 4YUZA 2YX1A 3EVCA 2ZULA 2CMGA 3RODA 3OE4A 4OQEA 5K0BA 3PT9A 4E70A 5K0NA 3R9XB 4X60A 5DM2A 4HRAA 3CVOA 4OX9Y 1R00A 4HSGA 1JQDA 5BW5A 4CXMA 5GOZA 4RTMA 4KVZA 3P97A 2OY0A 5EMLA 1P91A 4FZVA 1XDSA 2IDKA 1XXLA 3TR6A 3TRKA 1VBFA 3CCFA 3P2IA 4HC4A 2JH9A 5CVUA 2PXAA 2G72A 4U7TB 4ATNA 4DCGA 1X19A 3REOA 2JJQA 4KIFA 4LG1A 3EEYA 2ZLBA 3QOWA 1PRYA 1VIDA 5H02A 4EVIA 4JXJA 3IYLW 3HCFA 5FUBA 2GS9A 3MTIA 2B9EA 2FYTA 3F4KA 4PNEA 1WXXA 3FRHA 4RWZA 4P7KA 3TMAA 2OZVA 3EMDA 5E9QA 3HA5A 5DRTA 1X1AA 3BWMA 1KPGA 3A7EA 4H0NA 4O29A 5EGSA 3RIEA 2BM9A 3E23A 4MHTA 1N7JA 2G71A 1O9GA 2YTZA 3GGDA 4IV8A 4P7FA 2IBTA 7MHTA 2AOVA 1TW2A 4F84A 4YMHA 5CIYA 5F2KA 5FTWA 5KQRA 1F3LA 2VDUE 3PLAE 4ER6A 5DTRA 5E2BA 1QZZA 2BR4A 3CBGA 3MAGA 1SQFA 4B17A 3GNLA 5FWDA 5EIWA 4IWNA 5HZMA 2YVLA 3KPJA 4L7VA 4DMGA 4RTNA 2VDWA 1KP9A 4LWPA 4QQNA 3HVHA 3RW9A 1JSXA 2WA2A 2HWKA 3G8BA 4RTOA 3CJQA 3OU7A 1JSZA 2C7OA 3C3YA 1XCLA 5EPEA 3AY0A 5E2AA 2ZTHA 4P7JA 1RJEA 4RTJA 2AVNA 3ER8A 5DM4A 5EHGA 1G55A 3E7PA 3P2EA 2JH8A 2ZSUA 5E8RA 2UYOA 4QQKA 2NXEA 5EHIA 3LKDA 2BZGA 2OYRA 4YV0A 2PSSA 3FPFA 3DMFA 3LCUA 4MQ4A 1QANA 1M6YA 3BXOA 1JQ3A 3JWIA 4M38A 4F85A 3UJ8A 4AZVA 3AXSA 2IDJA 5GWXA 4DF3A 2C7QA 2C7RA 3A4TA 3HA7A 1G8AA 2E5WA 4GOMD 4RVHA 2QY6A 1T43A 2ZWVA 2XYQA 3FUVA 3KKZA 3OCJA 5D1HA 4MTLA 1SUIA 4E31A 3MHTA 1XDUA 4MIKA 2YXEA 2WK1A 3ELWA 3T7SA 4ER0A 5ICCA 3OZSA 2BR5A 3GCZA 1D2CA 1P1BA 2VZ9A 5CVEA 1M6EX 5FWAA 3M6UA 2ZIFA 3EVDA 2ZWAA 3GJYA 3SM3A 4RTQA 10MHA 2H11A 2BM8A 3B89A 3EVAA 3LL7A 3K0BA 3M4XA 1JG1A 5DXJA 5F2OA 4E2YA 2PKWA 2DULA 2XYRA 2FCAA 5DPMA 5E9JA 4HG2A 4RVDA 2ONZA 3KQTA 5EC8A 3DMGA 5HIMA 3TFWA 3NDJA 1XVAA 1VQ1A 5LQUA 3B3JA 2PX2A 3FTDA 1I1NA 3O31A 2AN3A 2JG3A 3IV6A 2QRVB 3MCZA 3UJDA 4QTTB 1NBHA 4C4AA 3FTEA 3A7DA 2Z6UA 5E1DA 2CWWA 2XBMA 5LQKA 5DM0A 3G2OA 3NW9A 4ER5A 2G70A 4XCXA 3LDUA 3SVZA 1X1DA 4M7RA 4M37A 2NNWB 2Y1WA 2ZBPA 3HNRA 4G56A 5HILA 5LQCA 1ZG3A 4X61A 2PGXA 2OB2A 3MCTA 4IKPA 3GRZA 1VLMA 4QDKA 3LSTA 5EZSA 4C06A 5K0CA 2NYUA 3LPMA 3S68A 2ZIEA 3KHKA 5MHTA 4GC9A 2YXLA 2Q41A 3HM2A 4YUWA 5CCBA 5C1IA 4R6WA 5F2NA 1XCJA 3NVKI 5EZQA 5FA8A 5P8WA 3KR2A 1IXKA 2P41A 3ER9A 2AOTB 3FPHA 3LDFA 3JWJA 2P3QA 3EPPA 3HCBA 1ORHA 1ZGAA 3R24A 2ZW9A 5FADA 2VS1A 3UJ9A 1YB2A 4GQBA 3UJCA 3EGVA 4YUYA 5KVAA 1EQAA 3SX0A 1PJZA 2B2CA 3A25A 3HCAA 4PWYA 1DL5A 4EKGA 3M6VA 4HGYA 3FPEA 4DM3A 4WXHA 3LBYA 1ZQ9A 4YV2A 5KYGA 1NW8A 5HIIA 3E05A 3KQVA 2B25A 2A14A 1INLA 1KR5A 2QM3A 5GINE 2G1PA 5K05A 3G5TA 3KQMA 3LBFA 5DXAA 5E9WA 4IV0A 3FUTA 4PGGA 3DXZA 2ZFUA 1X1BA 2EJTA 3P8ZA 5DX1A 4PYQA 2P40A 3FZGA 4DCMA 3MB5A 4R8SA 4ER7A 3BZBA 1UIRA 2OPBA 5IKMA 1FBNA 3G89A 1JQEA 3BGVA 3A27A 2P3LA 2V7EA 3TM5A 3PX2A 2K4MA 1R74A 1JG2A 1TPYA 2AOUB 3I53A 3KR1A 4RVGA 3UZUA 2ZBQA 4KDCA 5KQSA 4HTFB 2AN5A 1TW3A 2B3TA 3JWHA 5HOQA 2HR1A 5EKXA 4E2XA 1G6Q1 2FK7A 2G8NA 2R3SA 3A26A 1JR4A 3EGEA 3EVFA 5DM1A 1YFJA 1AV6A 1FP2A 1NT2A 5HFJA 2EFJA 1ZKDA 2HV9A 2I6GA 4QPPA 3KQOA 4RV9A 3K6RA 3G88A 4EKIA 3DLCA 3FTCA 3ID6C 4GF5A 5DX8A 4R05A 1Q0SA 3HCEA 3UBTA 3HVIA 3AXTA 3LCVB 3OPNA 2Z6QA 1KPHA 1KYWA 2ZVJA 3GRUA 3KPVA 3KR0A 3LGAA 4E2ZA 5M5BA 3PFGA 2EJUA 3CJTA 1VL5A 3FTFA 1NE2A 3HCCA 3UA3A 2EG5A 2BH2A 3DXYA 5DWQA 4QDJA 3PFHA 4E32A 4C07A 2GB4A 4BLUA 2O57A 8MHTA 4BLWA 2I62A 1NW5A 3ME5A 3DLIA 4FT4A 5E1BA 1ZGJA 5GM1A 5JUWA 3HVKA 3SGLA 4FSXA 3I9FA 3AJDA 3KQWA 3SSMA 5KS2A 1N2XA 2Y1XA 2ZIGA 2NXCA 5LQJA 1R8YA 4AZSA 3FYCA 2PLWA 1VP3A 4R6XA 5FQOA 3Q7EA 3THSA 3NWEA 2GLUA 3GWZA 3OU2A 4XUDA 3TQSA 3VC1A 4AZTA 3C6MA 2IGTA 2O0LA 5CVVA 4FR0A 1EAMA 3SR4A 4KIGA 4GEKA 5GM2A 5K0EA 2WA1A 3G8AA 3MQ2A 4FP9A 1QYRA 2H1RA 4OA5A 2AVDA 1SVUA 4PGHA 4A6EA 1SQGA 5K0FA 3GDHA 1EJ0A 4PYKA 2IH4A 3EGIA 4YV1A 4GBED 1D2HA 1EJ6A 3M6WA 2PX4A 1NV9A 5GP1A 4CTJA 4RTPA 2QRVA 1QAQA 3UJAA 5K01A 2I9KA 3ORHA 3KQPA 3M6XA 2GAFA 4CKBA 2O07A 3QV2A 5FCDA 4YMGA 2V74B 4KWCA 4PIPA 3L8DA 3ELYA 1G60A 4PCAA 1VE3A 3KPUA 4QVGA 4RX1A 5CCXA 1RJFA 3VSEA 1YZHA 3LECA 3CC8A 5LQNA 4ZTBA 3KR9A 4AX8A 2PX8A 3OU6A 2YUIA 3DP7A 3OE5A 4E2WA 5EQJB 4P58A 3EVZA 1D2GA 4M36A 1XJ5A 2CL5A 2FPOA 1JTEA 4OQDA 3GXOA 3THRA 3BT7A 4RTSA 4RSRA 4HTFA 2YXDA 2P8JA 5K09A 1G8SA 1WG8A 5ICEA 3OZRA 1KYZA 1O54A 1RI5A 4UOEA 2ERCA 1AQJA 1RJDA 5EEGA 1FJXA 2AR0A 4U7PB 1YF3A 5EMMA 5C0OE 5LR6A 5HIJA 2O05A 2PXXA 1DUSA 4BP3A 4LECA 3TPZA 2EX4A 3BUSA 4PINA 4YUXA 2UYCA 2PX5A 1RJGA 2B78A 3OFKA 5FULA 1L3IA 2GPYA 3FPJA 4GOND 5ICFA 1R8XA 4OBWA 5DSTA 3IHTA 1SUSA 1FP1D 5EMJA 5FA5A 3UJBA 1WS6A 2PV0A 3LDGA 4FT2A 1YUBA 3DMHA 3NTVA 4C03A 4BY9E 2CMHA 3I58A 3Q87B 4GUAA 1XTPA 1JG4A 3C6KA 1WZNA 2IP2A 2OKCA 1H1DA 3ANXA 3GU3A 3ELUA 4POOA 2PT9A 2HNKA 1BC5A 1IY9A 2OB1A 2ZBRA 3B7PA 4CKCA 3V97A 3FUXA 2IFTA 5IH3A 1F38A 3UA4A 1AQIA 4QTUB 1RI3A 4C04A 3TKYA 4GOLD 4Y2HA 1L1EA 1Q0TA 3HEMA 3UJ6A 5ICGA 5DTMA 5JR3A 3T7TA 4GC5A 3G7UA 2AOTA 3IEIA 3ERCA 9MHTA 1IM8A 3SXJA 4F86A 1U2ZA 1BHJA 4PCLA 5HEKA 4GOOD 2CKDA 5K8VA 5EG5A 1B42A 2ZZKA 4CWAA 1KXZA 2UYQA 4FSDA 3CGGA 3HTXA 5DX0A 4A6DA 3EVGA 3GO4A 2F8LA 3E8SA 5GIOE 1M0EA 3G2MA 5K03A 2VP3A 3GRRA 4AZWA 4DKJA 2IH2A 2GH1A 4LWOA 2OXTA 2ADMA 3DTNA 3D2LA 4PYLA 3G5LA 4V0RA 2AS0A 4CTKA 3DULA 5DT2A 1I4WA 5CVDA 4FS8A 5BXYA 1RI2A 3O7WA 5B1SA 4DQ0A 2PWYA 3R6TA 5BP7A 1YZ3A 3SSOA 2AN4A 2KW5A 5FHQA 4HH4A 2O06A 4EK9A 3P2KA 2AZTA 4X41A 1UWVA 2UZ4A 3EVEA 4BLVA 2I7CA 4PONA 2XVAA 1NV8A 2P35A 2PWPA 5EKUA 4DA4A 3CJRA 3BKXA 3UWPA 5BW4A 2OO3A 2VDVE 1HNNA 2FK8A 3I5UA 4K6MA 3DUWA 5C9ZA 4QPNA 5GIPE 1SKMA 3WSTA 4R8RA 1L9KA 4KW7A 3NJRA 5FHRA 3OFJA 5K0LA 5T64A
chains in the Genus database with same CATH superfamily
1M1NA 1VJDA 4YJHA 2IHNA 2I2WA 3EVTA 3KE8A 1RQ2A 2O50A 1CJCA 1XZGA 5EGNA 3AR4A 3RSOA 2VKQA 4F56A 5KVSA 1P5JA 3G2JA 1U0NA 4JHXA 4B3CA 3C97A 5F21A 4KODA 4K9QA 1FRFS 1RNLA 1G6KA 2MR5A 2QYOA 2VPPA 1N7HA 2ECFA 1ZD3A 3B52X 3FMIA 3JASB 5CUQA 5DTQA 5HBRA 3TTUA 5MFZA 4N76A 3NMUF 3FZYA 4EG6A 1QE0A 2XYGA 3P20A 2P7HA 4P7GA 4ZV7A 4LHWA 3JQGA 2BRUA 1JLMA 3ZWCA 3W2TA 1ZIPA 4H7IA 1PZXA 1W30A 2OHHA 2R97A 3I28A 2Z8YM 4N49A 3E4CA 3EF1A 2JGDA 3W8EA 3NC0C 2CXOA 1AE1A 4GMDA 1U2RA 4PICA 3RFTA 1QVRA 3QKTA 1UFKA 4F7DA 3K6JA 1JE1A 4BLSA 5U4XA 3S2ZA 5IXJA 2XQGA 1GDTA 3P9KA 1JAIA 2QWXA 3C7KA 1NVEA 2BLNA 3MERA 4ZRMA 3ZW7A 4B44A 4Z3KA 5A5VA 4YYZA 2C83A 3BH0A 1NTOA 1TQ8A 1JIVA 2YHUA 2Q4BA 2W2MA 3Q8LA 1Q74A 3V4RA 4F96A 3QITA 4Y2QA 5CFPA 2ZETA 2PHZA 1S6YA 4Y6RA 3ZHZA 1SZPA 5ESRA 3AX6A 3DJYA 3LQKA 3VYVA 4XR4A 1NXVA 1K2WA 4F46A 5LZ2A 1JX6A 1S89A 4AZ0A 4DOMA 4YAGA 3B7GA 3Q1KA 3MWJA 1V39A 3AV0B 3BIJA 1NULA 1R15A 1PD1A 3PWKA 1XQWA 2WP8J 3TN7A 1OHHA 2FPLA 5ARBA 2KLBA 3P32A 4MNTA 5E3HA 2VHWA 3EBOA 2JRLA 1CZRA 2XMDA 3ECCA 1I2CA 3RVPA 1D7OA 1L5FA 1D2NA 1Y37A 2WU8A 1P2DA 3PF8A 1QBKC 2W6PA 1IPHA 2VPYA 2WWIA 1LEHA 1EP9A 2BGKA 4MGZR 4F11A 5K8JB 1EVLA 2YRXA 2H0AA 5FBLB 4FCTA 5K7SA 5KNBA 1R7RA 4MQLA 1AKUA 3N8GA 4REQA 4CBVA 1J8YF 1VPLA 4U2GA 2Q2NA 1KGSA 1J7KA 1VMDA 3NPAA 4HZUB 4ND8B 3VV2A 2FMKA 1Z4IA 3RRBA 1Z2CA 2P5UA 3G7NA 4DLSA 3L9XA 1TMOA 2H65A 3CLUD 5IK2A 3BJZA 3MWKA 3AR9A 4L57A 3W5IA 3I9JA 4WMLA 1X0XA 2P6PA 2SICE 4MH0R 5AHXA 3T06B 1E79A 2FWBA 4IS3A 3HH8A 4LJSA 3VZPA 4KFUA 4ZOLB 4JCOA 3OTQA 3BGDA 2PBFA 1E9CA 3MHPA 3EX7C 2NP7A 3SLRA 5MN5A 1L5VA 2QAJA 4EO7A 3HJBA 1WHSA 1HWYA 1N1DA 2PL3A 2ZAOA 3T0IA 1E5DA 2ESRA 3PR2B 5BT9A 4IRMA 3ZG6A 1ZEMA 4U7FA 3IKTA 1KY3A 3CF6R 4NBKA 4JLOA 2F3UA 1PO7A 1GPH1 5LYJB 3WIOA 2PLNA 3H9QA 5JS7A 1U3CA 3EH2A 1RCFA 5EYPA 3WKEA 2RCNA 4W9NC 2ZTMA 4G01B 4GDFA 1R37A 3MMPA 4JC5A 1BOFA 5P21A 3L1IA 4MK4A 1L1FA 3WRYC 4A0RA 4F2DA 1JEOA 1XZKA 1KU0A 2OV1A 1E3JA 2GCEA 3JALB 4QAQA 3VDXA 4BP8A 4M2LA 3GT4A 1ZD5A 2Y99A 5EFOA 1NNSA 3O2JA 4RHCA 2FSVC 4TN1A 3WK9A 3OEHD 1E9DA 2ZULA 4NG4A 4AG5A 5D2CA 3OE4A 4E09A 1SWWA 1SRQA 1ZUNB 3F78A 1ZZGA 5ED0A 4O4JB 1NURA 4ENVA 1MTZA 4FOLA 1SQSA 5SYNA 2R4UA 1EUYA 4QTYA 4D8WA 3DEHA 4XARA 3L7OA 4K9PA 1FP6A 4LW8A 5GOZA 2G08A 3CLTC 1LZLA 3LFUA 3R1IA 4GG1A 4PR3A 2INGX 4QLAA 5AJWA 3OC0A 1WBJB 3Q4GA 3LOQA 1EUQA 1U6KA 3ETHA 3EIEA 4M88A 4UUNA 2PXAA 1KP3A 3LWBA 4TUYA 4ZOLF 5F5NA 3RU3A 4BRSA 2C5FA 5FTWA 3RYTC 2V0GA 1CUUA 3DOEA 4DLKA 2QVZX 1X19A 3N8KA 3REOA 2GRAA 4OAPA 4R8MA 4E4TA 2PX6A 4KLNA 4PE5B 3WICA 2JGIA 3KWLA 1DBWA 2VJQA 3C3EA 2NU7B 2WB4A 2E49A 3CNLA 4JOBA 4RIEA 5CPBA 1C0EA 5EKTA 4B3GA 3ZVRA 4K0KB 1ZK1A 2CVFA 4NCKA 1C0KA 2R8YA 1AKEA 1EP3B 5DHRA 1ENOA 1OUMA 3RUCA 3O4GA 3U80A 4NMXB 4AJ9A 1V8PA 1FX0A 4MUMA 2JFFA 1Q7BA 1Z6PA 2X5OA 2BI7A 3CNBA 3O84A 5TIIA 1AHNA 1DG3A 3C15C 4KZPA 4CN9A 2PMEA 3ILHA 4P7FA 4GLFA 4HUTA 4UZFA 2V03A 1QV7A 1JBQA 2Z56A 3TO5A 3JZIA 5HUHA 3IDAA 5GOTA 4YMHA 1TAGA 1BH2A 2BFCA 1AGYA 1XVUA 1WVIA 2AN1A 2I0FA 2KWIA 3AR3A 3KT8A 3NHMA 2C2BA 3KKOA 4R2XA 1D09A 4NS4A 5DTRA 5DXFA 3C6QA 4CMKA 1QZZA 3W05A 1V4VA 2HBQA 4OHFA 4A9AA 1OFTA 4C2TA 3CSUA 4BBZA 2HJSA 4OXIA 4B8YA 5BNTA 5I6DA 4DC1A 3IQGX 1XI2A 1U9IC 3CF4A 3I42A 2VT6A 1PQPA 2X0IA 2FZGA 4G5GA 5BMOA 3F49S 5B3KA 1ZR4A 3IMFA 2OFFA 1PZFA 5FOWA 1QIEA 1CTQA 3TW8B 5IKEA 2IW1A 1JLRA 2BGTA 3KSBC 1UBEA 2JFVA 4RKRA 3GAZA 1E6KA 4OL9A 5SYAA 4RZQA 3ER8A 2ENWA 4GYKA 1H5NA 1XCGB 3A06A 1KNXA 1C8VB 1QRTA 3RUIA 3AVWA 2HA4A 4CM6A 3LC1O 5CA0F 721PA 4I5DA 1ECJA 2E7ZA 5AVYA 1RE1A 1UKYA 3LH5A 3NYQA 2ZRKA 5TMDA 3ZWXA 4BN4A 4E1VA 4RVHA 5EIOA 2HUPA 3VSCA 1G8PA 2O7VA 1I2MA 2ZE6A 4M1SA 4ECAA 3QQ5A 3CX4A 3ETCA 4WUTA 2D5CA 5L3QA 1NASA 5DI3A 5HCIA 1E1QD 2BEJA 3TOXA 1H2FA 5IF3A 1M34B 2FUKA 4BNXA 4I19A 1DBQA 3KVRA 4LX0A 3Q9NA 1SKYB 3HDJA 1C1HA 1P7PA 1WV1A 3HMKA 3NAQA 5MN6A 3EXFA 3WDSA 3R5FA 1AUVA 1DDIA 1UDAA 4HDOB 1UAAA 4GU5A 3V8BA 3WIUA 5AK6A 3RSQA 4NY1A 4CMJA 3RS9A 1HE5A 1JLSA 4QFDA 2ZB4A 4BVKA 4RVDA 2RGXA 1T9BA 3DZ8A 4HMOA 3AVOA 2FP3A 1WL8A 1XU4A 1DTWA 4NABA 2PX2A 4PLTA 4K86A 3H1GA 4L2IA 4PX2A 4BIMA 4M76B 1VCOA 1WD7A 2AYXA 1S2OA 1G7SA 2DUUA 2MYUA 2SHKA 5E1DA 4D8TA 5IKPA 5JAMA 4HDRB 3FOAA 1RKVA 1ZN8A 1ZN2A 3NW9A 3T3PB 4YRBA 1BN6A 2H92A 2P91A 4B87A 2Y1KA 4J7AA 4OGFA 5HDQA 1QYDA 3VDMA 2XMZA 1HE4A 2DPYA 3NXSA 1PKXA 1XQ1A 1ZH6A 2P6MA 1CJTC 3DE2X 2Z9DA 5J4VA 3PKIA 1D1SA 4TLEA 4TT3A 3J81k 1FYWA 1PQYA 3DF9A 1QHYA 1TTQB 1GAQA 2VRNA 3I1IA 3MUFA 5CTAA 4D80A 4YMVA 1OAAA 4ZMBA 4Z4EA 1CULC 3F9IA 1WB9A 1UZMA 2XIJA 4NBRA 1RWXA 1U7PA 5EUCA 5AXCA 1MW9X 4GR4A 3SDSA 4BCCA 3C8MA 5TVKA 2AN9A 2NSHA 2P41A 4JR2A 1XAJA 4RPHA 1E4EB 3AEQA 3AHFA 3BBLA 3WL3A 1U5BB 3BJMA 1PWHA 5HSGA 1QDUA 5HOEA 1N2CE 1T5OA 2VJMB 4FI3F 2GZ3A 3JD4A 4D9GA 1Q1NA 1BU5A 3QHAA 1EQAA 4OHKA 4RK1A 1KZ1A 3FLAA 1CHNA 3A2LA 1VSVA 1ZN7A 2G7MC 3IVAA 3ASYA 4O1IA 4JP8A 2IHJA 4PSUA 2CUTA 4LJ7A 4F5ZA 5DNWA 1ZQ9A 3W90A 1NW8A 3B1FA 4Q3OA 1FCJA 1MB9A 4CN8A 2ZUVA 3Q11A 3PCXA 4XKJA 3P0IA 3A6EA 4QU0A 3LPDA 4PYQA 3TTSA 4NYIR 2GN8A 4QXAA 3BZBA 4UXIA 1X15A 1K5GA 1G7TA 2B35A 2HGZA 2JA2A 1QMGA 2O8CB 2EV9A 2JZCA 5IHPA 2BEUB 3BC1A 2ZQZA 1T8SA 4R98A 3T7JA 4Z5XA 3MT0A 4CIAA 1ESEA 4ABTA 4D8YA 5AXDA 3V2IA 5FWYA 1V71A 1XZDA 3CPSA 4GRIA 5CA0A 4K6OA 2A57A 4DILA 2HHCA 2AG1A 2FK7A 2QVYX 2W7TA 2E4UA 2Z2XA 2IHVA 2DR2A 4GYWA 1KOLA 3AJAA 4PHTA 2OTCA 4QPPA 2HK6A 5CDTA 1AXEA 1MV8A 3D6TB 4MQEB 1ZI6A 2C00A 2W6IA 3FTCA 1P9LA 4Q3BA 4A3SA 3HCEA 3UBTA 4BNMA 3OP4A 3LY9A 2C7GA 1XA4A 2ORIA 2ZBGA 3KPVA 3ISJA 2H2WA 2E4XA 3FI9A 1AM4D 1PEAA 2DQSA 4ARUA 1BWQA 1NE2A 1WPQA 1G21B 1KZYC 2DUNA 2PZMA 3JQ6A 4KX5A 4I0WB 4LDQA 3PFHA 4IW3B 5CLGA 2O57A 2V7WA 1H85A 1RM5A 1HXHA 2H6EA 4X8HA 1V7PC 1NW5A 1RR6A 4WWHA 5ILGA 4OI1A 3V6MA 3JR3A 5LIRA 3HZRA 2EDAA 4CYMA 4PZZA 1JFRA 4ID3A 1HQYE 1Y1TA 3B6ZA 2PKQP 3JV7A 3ZH2A 4M8IA 4KO8A 2W2OA 3Q98A 3ESXA 4KVAA 3C6MA 3RTBA 2BBWA 1STOA 2V96A 4C7XA 1PVVA 1GZ7A 3G8AA 5JLJA 1IBLB 3L7LA 2AVDA 3A1FA 2K7ZA 2RHDA 3CG4A 1NXWA 3O8LA 4ND5A 4MVJH 5B4VA 1BRMA 1KJ9A 3RS5A 3A9VA 3BQNB 4TT3D 4MYSA 3A1TA 4MGIR 3O94A 1ZC4A 2P5TB 3G9ZA 4QL3A 1UWKA 3T4XA 4PG8A 2PA3A 1PFQA 4H1UA 5H5JA 3OLCX 1JILA 3LT4A 2Q7DA 5CYFA 3BERA 2CNDA 3CQ9A 2Q7OE 4CKBA 1D5CA 3QKIA 4OK6A 1TM2A 2CJWA 2H1FA 5FTMA 4R1OA 1DFIA 4KUEA 2YZMA 4C7BA 2CLDX 4JYBA 4DN6A 4RLSA 2ANBA 2P6UA 3LE8A 3SNHA 3K73O 4DJJA 5JXGA 2R5WA 4OP2A 1O8CA 3OEHA 3OE5A 3H9GA 4DPKA 2I34A 3WISA 1SUAA 1HDEA 2CL5A 4L4ZA 3KJZA 5REQB 4CKZA 1SBZA 2XB8A 3IDOA 3UJNA 2JRCA 1YJQA 2BBOA 4EW3A 4EJ0A 1QTQA 1LDEA 4M0FA 3IA2A 5AKHA 3HKBB 2F1JA 2R4TA 3D0RA 2JFZA 2BWJA 3WKDA 2Y93A 2XGJA 1NF2A 4DDTA 2IZ5A 3H3JA 3L1VA 3NZEA 1YF3A 1JTVA 1DC4A 4HSEA 3GR6A 4XDYA 1B23P 1LI7A 1CRZA 4TV8B 4UW9A 3GJXC 5DT9A 4WINA 1L3IA 3TEJA 2Y1CA 4JH0A 2O1XA 4YB8A 5DSTA 5LJIA 4CL8A 1UK9A 2A5JA 2FVXA 4DLNA 1FLAA 3UJBA 1Q1GA 4M1ZA 4YO8A 3TI9A 3CGWA 3H11B 3DO8A 2FX3A 4MS4B 4DNXA 1YT5A 5K0ZA 4MDEA 3QZUA 1VL0A 2CMHA 3R77A 1VB5A 2XB9A 2X8AA 1JWLA 2Z1NA 1X87A 1O5IA 1C30B 2WJGA 2PQ2A 2HNKA 5IVPA 2PS3A 5AW7A 1ND5A 2I55A 2GEKA 2J33A 1RYFA 3CZQA 2M9MA 2AJDA 4K9NA 5LLDA 2G83A 3UJ6A 4FMDB 4P3PA 4CG1A 4G6ZA 1TO2E 9MHTA 3GV0A 3K9FC 1D4FA 1IM8A 1GGJA 4TLLB 1FIUA 2FUNB 2A5FA 3N07A 3C6XA 1MX5A 4RAQA 1AUQA 2CMKA 4PNPA 4MWCA 3PXGA 3OQPA 4MROA 1C41A 3BX1A 3T7IA 4TM7A 3JAKA 3GCGA 1S2GA 4IGIA 1GN8A 3QFSA 4I99A 2V7UA 4RZHA 4TTIA 3WR5A 4XWOA 2HWXA 3ZJVA 1ONNA 2TMKA 3BD8A 4U8HA 4KHZA 2IYOA 4RFSB 3I9OA 1JHQA 2GEBA 3EHEA 3HMQA 4UVEA 4B4KA 1WU8A 4B3MB 2WNSA 4ND1A 4Q9JA 2XOXA 4Z7JA 2VCEA 4ZTUB 2QXUA 3COPA 3ISVA 3PSAA 1JR2A 2BL4A 3FCAA 4LTNA 5J4LA 5C53B 2QLLA 1VYHA 4L22A 1N1EA 1QTIA 3AZQA 2AK2A 3IIIA 1AA9A 3H9UA 1LRLA 4RMHA 3E9RA 1HM5A 4DM7A 2GFQA 4YJGA 1S2MA 5AUQA 3BKXA 4BCBA 3LCRA 3SDZA 2JLYA 4LHEA 3LUHA 1GKYA 4F72A 4DT1A 4QM7A 3GFTA 5GIPE 1C7ZA 1JALA 1ODLA 5HGJA 4G65A 1T5HX 2LBPA 3C1OA 4UMVA 3VNRA 4MPPA 3T5PA 1M2OB 1K7FB 4TLBA 4C88A 1N34B 1DCMA 1LPPA 4Z1MD 1AKRA 3NONA 4I55A 4ML3A 4MWZA 2QUKA 3L40A 4DVGA 2WUFA 3N9IA 4DZZA 3T3MB 2P79A 2P9ZA 4J16A 4AKEA 1QP0A 2OKGA 2YZ7A 4PSDA 1UIMA 2ODNA 4MV8A 2EAUA 2ATCA 3BGIA 1D6MA 2WWVD 3LLMA 5CPFA 1FNNA 2NGRA 2QR5A 4UAUA 5AUOB 1WDLA 1Q0LA 5C8XA 4EGAA 4EVQA 1FLVA 1PK8A 4EI8A 5BSKA 1RQGA 3IQZA 3KPWA 2QNIA 1O9BA 2FI1A 4ENRA 3U48A 1WPRA 3AUSA 5CXXA 4E5MA 2ZT8A 3ZCVA 1KYXA 3OZBA 1R4ZA 2GFIA 3CY6A 4JBXA 5KYUA 4B75A 1Z8NA 5D86A 3VNSA 4EG0A 1HDIA 4E5VA 2PBZA 3ELBA 2WYIA 5C8YB 3VYWA 2VR1A 4JFAA 1ZD2P 4OBXA 4NU0A 4LJKA 4Z1OA 1XBTA 1VC2A 2J3MA 2IEGA 5AW6A 4PIMA 2IK8A 5JSHA 5LJLA 4XUEA 3MCWA 3GZJA 1QCYA 4HVTA 5TGTA 4ZYYA 1HO3A 2JFYA 3DMPA 4FYPA 4G89A 4LRYA 5T3UA 1GNLA 3V1LA 1T8WA 3QJYA 3ZN2A 1AV7A 4TYNA 3LF1A 1RABA 3CVWA 3R4CA 3D8NA 4BB6A 2FVYA 3RFXA 1E7SA 3TB4A 4RCYA 2YY5A 5IZCA 4YY3B 1YR3A 1VLVA 3GLIE 4R9NA 3STXA 1KOFA 2VFAA 3QE4A 4F9GA 3R0QA 1Z4NA 3AIIA 5FR2A 3WYGA 5AJTA 1O7JA 1JTFA 2ZJ4A 4TVKA 2NUPA 4D42A 1NMSA 4X5OA 2O3SA 2GDJA 4MW6A 4ILKA 4EB6B 5JHHB 2H2DA 3ADPA 3UCXA 3ZZNA 3L1JA 5LD2B 2XZPA 4P8RA 4JIMA 2PFSA 1P4RA 1AS3A 3UJHA 1CS0B 1TVKB 3QWBA 5JY6A 2JARA 1C9JA 1IIRA 1MGPA 3ZJ4A 5C7IO 4E11A 3ESCA 4EF6A 5CFRA 3T3HA 3IUYA 2H0RA 4US0R 2GTIA 4GI3A 2GR9A 2JBAA 1GUAA 1H2ZA 3SXPA 5IFLA 4CF5A 2IRWA 3PVCA 2OBYA 4M22A 5JOQA 1Z88A 2YQ5A 4IJMA 4UBNA 1NVUQ 3ROEA 1UOOA 2RAFA 4W82A 3SPXA 3CKKA 5AUPB 1BRTA 3D1LA 3EC1A 3HR8A 4ITUA 4UEJA 1GAWA 3A3PA 5AQ1A 4AS3A 1QF9A 1QIJA 3H5OA 5CJPA 2RBEA 3AVTA 2NU6A 4LBZA 4CLHA 3JYNA 4CMAA 3EZLA 1E6LA 4C0JA 3CB2A 4RBNA 5DEIA 4DAOA 1SD1A 3L7KA 3T0GA 4RFSA 2I67A 3IMKA 3KO8A 3MA0A 5B1DA 4NBNA 2XHZA 4PG6A 3RVRA 5A1TA 5BNIA 3TS1A 5CVCA 3JYPA 2J0UB 5C8YF 3U19A 3T5MA 3AF4A 4J4TA 3OIVA 4AG6A 3OE1A 1M54A 1MG5A 1G8KA 2BC9A 2ZUCA 3H7AA 4OQZA 3LL4A 4P3KA 5EEHA 3TLJA 3AL3A 3BM5A 4TWRA 2JBHA 3KB1A 1QFZA 1GPKA 4N0EA 4DRYA 5BSHA 1BYIA 1BJTA 5HK8A 5J4HA 2E3JA 4RWEA 1BX3A 4XJTA 3A1UA 4FS3A 4G37A 5IULC 1QHEA 4EG3A 2QRPA 5JVDF 1BVUA 1TCVA 3W1VA 1X7ZB 3TSCA 2XKJE 2JJ8A 3TW8A 4RHYA 1TF2A 1U0SY 2ZBVA 3G0BA 4RANA 4YWHA 4EG8A 2C5BA 2I4LA 2DT8A 3N1UA 4KBFA 1WDWB 2Q2QA 2V6BA 3IL2A 2HWWA 2MSLA 1VCMA 3IO3A 3AUYA 4UULA 3CF0A 2ZAMA 4I50A 4OM7A 4HT3B 5IANA 2JIMA 3WRWA 4E7OA 1SBYA 2VBCA 2VK8A 3A4YA 2QAGA 4WA8A 5B53A 1OLXA 4PXSA 1HLGA 2CXXA 3U3KA 1F4PA 2W42A 2HRBA 4IICA 2WSSD 2PR7A 2WYVA 1VIDA 2PBLA 3EEYA 3IGFA 4RFLA 3TLKA 5BV0A 5CW1A 1XMIA 5ITSA 3EEQA 4LY9A 4YJ3F 3LT0A 2IHBA 3DONA 4I8IA 2YMQA 1O08A 4GS5A 2FSSA 2FQXA 5CH3A 5DLQC 3QSYA 3P52A 3WMFA 2BM9A 2AMYA 3RJ5A 4WKBA 1PL7A 2MR6A 4U6NA 4XQCA 1R9MA 3ROZA 3GGDA 3C5EA 3UQYS 3CIOA 3M1IA 5AKGA 3D5QA 1Y8RB 3O8DA 5AJUA 4JC0A 5BQXA 4Q12A 2PIDA 1A72A 3OPYA 1DPGA 1BROA 4GMKA 5E2BA 4ZN6A 1XYYA 1OB2A 3RREA 2FWJA 3Q6NA 4NBUA 3CBGA 4B3DA 1MAUA 5C1PA 1JA9A 4R2MA 5JARA 1PR4A 4AWXA 2POQX 3IMGA 1Y1SA 3DVLA 3LAWA 3OEED 1Z35A 4HAVA 5FYQA 3X43A 1PX0A 3L0OA 5AM4A 5B1YA 4GAEA 2XB2A 5IMSA 3LP8A 3GCWA 1PNOA 1QVAA 3C3YA 3TAUA 2QD1A 3V7YA 3AY0A 1JFSA 1CCWA 1WHTB 4P7JA 3OHPA 4JL6A 1DX9A 2VAWA 3VI3B 1KEUA 2YBEA 3G2HA 5GVRA 2NXEA 4IDQA 4K87A 5DNYB 4K9RA 4IPTA 2MDTA 3DZIA 4DMCA 4UBKA 4IMIB 3A31A 4Y6LA 4K2HA 3BH7A 5A9RA 1JXMA 3SKYA 2VNIA 4O5OA 1J20A 1YJ8A 4M38A 2HRQA 1CKEA 1NVWQ 4RADA 4WA7A 1XK7A 3S2IA 3UIEA 4AZVA 3N2EA 4PM4A 1G8AA 2XOKD 3AMVA 3SJUA 1KFJB 1MC5A 4EB8A 1NU6A 1GTJ1 4NPCA 3WQRA 2SKCA 3P26A 5CR9A 4XIFA 2W4MA 5CD9A 4HLCA 4EW2A 2B1JA 1FFSA 3DYBA 3AP1A 3TDMA 2OC9A 1U9YA 4XVCA 4XVQA 1IZYA 2PSEA 1CLEA 2HSWA 3DW3X 3EVAA 2O2ZA 3HBFA 4FHEA 4WN9B 5DXJA 1S3FA 1V95A 3TCKA 1RYZA 5IZ4A 4YBZA 3PDUA 1QCDA 2L0XA 4XVHA 3RKRA 4NBLA 3HVRA 4LJRA 2AXQA 2LR0A 4JKYA 5FFMA 1E5XA 3IE1A 2E55A 4IX9A 4PQEA 1RQRA 4YRRA 4ZOBA 5LBTA 3ZTTA 1G66A 1OXUA 4R2HA 5AKZA 3EXHC 5IDQA 4IJQA 4Q4DA 3TOVA 2JANA 4EVRA 3GK3A 3U7QB 1I0IA 4O2LA 1D0IA 4O2BF 3TIGA 4A36A 1APBA 3E0QA 3I9NA 4CV3A 3HYRA 3W7BA 4C0QC 4XYGA 1GPMA 1U2QA 1P5ZB 1YB5A 2ZBPA 4EHBA 1U63A 2EIHA 4OATA 1G8JA 5LVAA 1O6GA 1E2PA 1TVCA 2FPRA 2V54A 3W8FA 1LSSA 4TTAA 1OBVA 1OLSA 2ZYGA 2GNAA 3C3WA 1JYSA 4DR1B 3UZUA 3NX4A 3U37A 3TX2A 5F9FA 3GT0A 2XKAA 5EQTA 4BAGA 1J2YA 3DB1A 2DPGA 3C16C 3HB9A 3FGOA 3QJGA 4E15A 3X1DA 4BWVA 4FINA 3A4LA 3TB6A 5A6SB 2ACWA 4YP1A 3DBLB 3Q0EA 4LXQA 2PU5A 1IXKA 3TVDA 1PLKA 3B5JA 1FTGA 1M34E 3FPHA 3V3TA 3JWJA 5ALLA 2P3QA 4EYSA 4F2HA 5G2OA 2IXBA 2FMXA 3DG9A 1Y1LA 5FO1A 2UYCA 1MX1A 3Q72A 3SQLA 4B33A 4TVSA 3ZE9A 5BSWA 2FZKA 5JD4A 3KZ1E 3IFSA 1RAEA 1QFMA 2XADA 4X1IB 2Y27A 2M1ZA 1J8FA 2EKZA 1FF9A 1KR5A 3CNEA 3RRFA 5GINE 2DETA 2QRLA 4HF7A 2TS1A 4AJIA 3OJEA 4PPNA 3IILA 1KK0A 4B3FX 3K15A 3LX8A 4KMRA 4B4UA 3OF3A 3W2EA 5LP6A 2P3LA 4CR7A 2I6XA 2K4MA 3EK2A 1AGPA 3R8XA 4D46A 1CRLA 2EU8A 3I53A 1C1DB 3D0QA 2BV3A 3ZV6A 2NWQA 2HA6A 1U9IA 3JQ7A 4L28A 2XUFA 3KUKA 3QVUA 4PLPA 4R9SA 4RYDA 4X1KB 6ABPA 2JLZA 2IXTA 5U4QA 1AG9A 2B3TA 4PQFA 1E8DA 4RTJA 3HKDB 2O0HA 4H27A 1FL9A 1MDFA 1U4SA 1Y1PA 1FRNA 3P94A 4P82A 4WSOA 4KI0A 1Z37A 1JV2B 1WMEA 3VX3A 2ZR9A 3K09A 3AY6A 3UV3A 3AL0C 1CK4A 4C6RA 4YLYA 1EYZA 1K5PA 1N6IA 1EPUA 1M2EA 2ZRLA 3OM0A 3HVIA 4OG2A 4RESA 4UUBA 2GBIA 1BWPA 2XJ4A 4G07A 2NUTB 4YAFA 1Q5PA 5J2UB 1WF6A 3TBKA 1NI3A 2I33A 4MGYR 2Q3DA 3D8SA 2X5XA 1NBOA 4G0NA 4GLOA 3E3NA 2PS1A 2CV1A 3THYB 1ZIDA 2FSIA 4K7JA 1LTQA 4BGIA 5AWFC 2NACA 2GZAA 1T1GA 1MB3A 1SKUA 2WYWA 2VUHB 4UXJA 5GVSA 5KC8A 3TIVA 1YXMA 2IZOA 1HF3A 2N1BA 1QQTA 2PA0A 4RCVA 4REQB 1CR0A 4KO3S 2BTEA 1RWQA 5IC5A 2JLAA 3N3BC 5HJ7A 1NYQA 1PW5A 3GJ8A 2DBQA 4WBNF 2EP7A 3G6WA 4BB0A 3ASVA 1A3CA 3GVXA 2CUNA 1ZJYA 1TIBA 3SR4A 4E03A 3I5XA 2L19A 4NYJR 4S1TA 5IVHA 4ZP1A 4ZJUA 3ORRA 3WZMA 4F4CA 5FUQA 1SVWA 4UQOA 3KP1A 2PSDA 1EJ0A 1L5WA 2CC2A 1VG0B 1P2TA 3B8EA 1DC7A 2QLTA 1NDUA 1CQJB 2FP4A 2IELA 4OH7A 4P9NA 1U2TA 5CNMA 3M6WA 5ALQA 3GRKA 1GO2A 4YC7A 4YFYA 3ZZ1A 3R5XA 5AW8A 2CHGA 3WMEA 3N5CA 2J0QA 4BOYA 3KTFA 5K01A 1G63A 1RKBA 2VDQB 4F71A 3ETDA 1SHZA 4KN6A 3O8RA 3KXPA 3H9JA 3I92A 3PXXA 1F12A 1CUEA 3CE9A 3ELYA 4IWYA 2JGAA 3OA2A 4AZTA 3VR5D 5U9CA 4WNYA 1K3UB 3D9QX 3IRUA 3VSEA 3HQ4O 1JDPA 2G9VA 2JDIA 4E51A 2H4JA 1VMKA 1G9TA 1LPBB 3VTFA 2BEVA 3OIDA 4LNHA 4R51A 3G2IA 4DA8A 4PLZA 3HUEA 2WF8A 2W0SA 4L5AA 1II8B 4OQQA 3U3JA 4D26A 4WGGA 4IGEA 4YA6A 5K9ZA 4CV0A 4WZBE 3UT6A 4BV3A 5HUQA 7AT1A 2NVWA 4EY6A 3AHEA 2O6LA 2QTHA 1O8BA 1RXIA 4HTFA 2QENA 4M98A 3I5YA 1U2SA 1WG8A 4WNAA 3L7MA 3OZRA 1YU9A 3C8UA 1RI5A 2BKUA 3SD7A 1BZYA 1QPBA 2REQA 3N7TA 3O75A 4U7PB 5FNVF 1NHGA 3WSWA 4AY5A 1GR1A 4OQXA 3OUUA 3KYIB 3NAGA 2QJWA 3KJEA 5HIJA 1PLLA 4BQIA 4YP5A 1I4TD 2PX5A 4QE3A 3GZNB 2GPYA 4H1WA 1DQYA 2J4DA 4INZA 4FMPA 2G28A 2HQSA 2X1VA 2ZG6A 3NIBA 2F3TA 4CUJA 1XWWA 2GTPA 2VXBA 4LOKA 5HG0A 1Y9ZA 5TV2A 4B81A 3F9RA 1CJKC 3ANXA 3BCUA 4DSOA 3HG7A 5JADA 1PJLA 2IYNA 2F7SA 2C2HA 2CXRA 1QOZA 3B3QA 1RZRD 3V8NA 2OR3A 1MO2A 3C1UA 4JSRA 4ZVUA 1SKAA 3GD7A 5BSMA 1TU0A 2BONA 4B2LA 3PIDA 3ERCA 4DLZA 2WSSA 4PX3A 4FGKA 5EA2A 4B85A 2QY9A 5HNKA 1H3NA 2FRDA 4KWTA 2COEA 1KBQA 4PHHA 3CGGA 1YR2A 3HB7A 1CX9B 1E1YA 4QEKA 4N6NA 1OF1A 3AKDA 4V0OA 3FCUB 1VJ1A 5D3MA 4EYQA 4V1CB 4OGKA 4LSGA 4EATA 3F6PA 2IH2A 4JI8B 4NENB 2GH1A 3DEFA 4LWOA 1NRXA 4N01A 1ZNQO 3CRNA 1R8SA 3VR6A 1IJFA 2XSZA 1OPRA 4PZAA 4RD3A 5DHAA 4NCIA 1Z45A 3SLKA 2XNHA 4E2FA 1E5TA 4X8OA 1P31A 3GFPA 4ZDWA 1H0RA 1GUZA 3LPAA 4MVJF 2HI0A 1VMEA 2VTEA 2JFNA 2Z83A 1MU0A 2G6BA 3N7UA 2HF2A 1Q16A 1PGNA 2CDNA 4WESB 4J0DA 1P60A 2BFEA 4MKIA 2DYKA 5JAQA 5FEMA 3ROXA 1THZA 1XRSB 1JIKA 3NYRA 2RB5A 2ZRDA 4I4TB 4DJTA 3SC2A 2V7PA 2NAPA 4F3NA 4UATA 3HO1A 2E6UX 4NCXA 5LPNA 4GX0A 3T4PA 1P3JA 2EW8A 2XVZA 3GRPA 3OFJA 3RVQA 4H1HA 1NLZA 4Y6PA 1SIWA 3RAJA 3LDHA 4B80A 1CUHA 1YCFA 2KLHA 2ERXA 4AUKA 4QATA 4X62B 1EU1A 4H15A 3SSNA 2TMYA 3GLTA 2DBVO 3QGMA 4DRXB 5AT1A 2V7GA 2WJAA 3MWDA 4FFSA 1K8YB 2HW8A 3K6SA 1II9A 4IQFA 5AXAA 2AR7A 1MUUA 4HGZA 3SVLA 3TW6A 2AMJA 4PZPA 5D1NA 3QW2A 4S1VA 3QRWA 2NUPB 4UNPA 5BV8A 2AE2A 5LOVA 1GPDG 2G40A 3V8VA 4LTDA 4K6CA 4ND3A 1M0TA 4YCMA 5AESA 2D7DA 4UTZA 4F4DA 2FZLA 1KR2A 1WXWA 3FCYA 1NJGA 4IUDS 3PQ6A 3PXEA 1NW7A 1AF7A 2GVDC 2WIFA 4OB7A 4TS4A 3VR4D 5FV4A 4HWSA 3RSHA 5ES3A 3RH0A 4BMVA 1NBEA 2XUDA 3H2SA 1OX4B 3MUNA 4FR2A 5IS2A 4X97A 3N05A 5ALKA 2DTDA 1Q0UA 2FEOA 4MMZB 1FS5A 4MW9A 1PL6A 1E32A 1W9MA 3UK7A 5JMWA 1CC1S 2BJHA 1JHRA 4KQGA 4QJ5A 4AB1A 1R5OA 4KE6A 4UAVA 1E62A 1KVUA 1SBNE 1PS8A 1VHDA 2FPIB 2R86A 4FGZA 4QEZA 1VG8A 5JEEA 2GQ0A 2GXQA 5GGYA 4IJUA 4PX5A 3G9QA 2HZ7A 2PYDA 2R6ZA 1ECLA 3R6LA 2EBWA 3TTXA 1ZIOA 3D2CA 5D3KA 3CRVA 3HP1A 3PHCA 3IJRA 5FV7A 3KAQA 2OMKA 3U5ZB 3FYDA 2JVIA 1QIFA 3NDIA 4MVJI 1QHHA 3OT5A 1DJPA 1QDLB 3FLBA 3IBTA 4URFA 3HWRA 3AFMA 3M6AA 4KPFC 4C87A 1Z7EA 2MSCB 3BMOB 5C7YA 2ONCA 3CUUA 4X90A 5J23A 2XITA 3FOFC 2QN9A 1I94B 1ZLYA 2IBSA 2NSJA 3QU7A 2I65A 2CXSA 1L3CA 5CX1B 3KXIA 4M8LA 4JCCA 2W48A 4TQGA 1Y5LA 2PEZA 3DHWC 5C3MA 2HT1A 4O6VA 2JIRA 2Q8QA 2QTBA 3RTDA 3A4IA 2KM1A 4AK9A 2CL7X 4BEJA 4F21A 3GT3A 4I3GA 2JLVA 4MZXA 4I50B 5LU8A 3M6IA 3FROA 3IRVA 3ZEIA 3RVKA 4MV7A 3EZGA 2HCFA 5BN3A 4PO8A 2WD8A 2WE7A 2WD7A 3WKBA 2F90A 3BZUA 4RZ3A 5T67A 5ICSA 2CV0A 1QAMA 1ZM7A 1B0ZA 2ORVA 3Q2OA 1DCFA 1ND6A 4IDGA 1SPXA 2VHXA 1EVEA 3GLIB 2PSFA 3LXXA 2ZAIA 1RU3A 2ZSFA 4LXHA 5DJ5A 2PLAA 3A1WA 2H7CA 4X95A 3FHTA 2AXEA 3OJFA 4L8VA 1X80B 2X7JA 1CDDA 1LX6A 3C45A 3ETGA 3L7CA 1GKIA 4R1MA 1RJWA 5IC6A 1FFAA 3QFTA 1E3EA 3Q7RA 4E30A 1T1SA 2QN2A 1B14A 1CHDA 1N2ZA 3EDQA 3LYAA 5JDCC 3VHLB 1WWKA 1GNPA 2IOFA 2JFHA 3E03A 2W6JA 2LD4A 3PXAA 4JT2A 2XPCA 3JQFA 3A6JA 1V9CA 2WINI 4MR8A 2ECPA 3EF0A 3FTPA 3GVIA 1KFKB 3VV3A 4A26A 4Z86A 4RYLA 1HC7A 2QL7A 2OE2A 1GRVA 1O3YA 1SC3A 3GUUA 5I8ZA 4UM9B 3HWSA 2DHQA 1ISPA 5I9MA 2N3ZA 4CT5A 1JDSA 7GPBA 3TNYA 5BVGB 1MT3A 5KHAA 1U0BB 1QE3A 5GTDA 1TJ4A 1H5UA 5TF0A 4MDYA 2XJ9A 4XDZA 4O4HF 1Z6YA 2RKBA 1XZMA 4XAQA 4CXMA 4NV3A 2AJTA 1V8BA 2J1LA 4N5HX 1M5RA 4LF6B 1M0WA 4XRRA 4GKBA 3FIJA 4NJMA 4U2EA 1T0BA 2IDKA 2R79A 3LUKA 4MQFB 4OU4A 3TCXB 4I3HA 3O2NA 4B4VA 4TSFD 5JJ5A 3QF4A 3FYSA 3RI3A 5B55A 2ETVA 2LW7A 1HSZA 3CN7A 1A5BB 3HL4A 5IWCA 4PFKA 5JJIA 4F06A 1GQQA 1LTKA 1RADA 2PS9A 5F9HA 1I30A 3HJUA 3B9RA 4O3MA 2EZ8A 3FWZA 1MIHA 1OT5A 4FJ2A 1CQZA 1Y81A 4E3ZA 5K0FA 2XXBA 1LWOA 1QYVA 4IH9A 1DO2A 4D9IA 3JAKB 1NVTA 4ZC1A 3O4RA 2II6A 1X3SA 3SEZA 4NPAA 2UYYA 3OUZA 3FOCA 4LYHA 2RE8A 3FLMA 5CBPB 3TUZC 1OVGA 4DS3A 2PKCA 3ZE1B 2J41A 5EUQB 3O90A 3QMMA 4O4LF 2FZEA 3I6IA 5CURA 4EKNB 2JH3A 2XHEA 5IM5A 3ZZUA 5IRCD 1R9NA 1XSEA 1E89A 2HXYA 1J0DA 1SG6A 1YS7A 3JR7A 2BZSA 4J0JA 4JHLA 3UMGA 4G1EB 2YVLA 2ZAGA 2EZUA 2YFHA 2YWEA 3MZ0A 5EHZA 1RPNA 4R84A 3RW9A 1XHEA 2XODA 3TD2A 1Y34E 1U1FA 2YZ2A 3SYNA 5EP1A 4PPFA 3AKZA 4ZRNA 2OHVA 3THXA 2FB9A 1P7WA 1UXKA 1XQYA 2R1ZA 4IQ4A 4H6PA 4GWKA 2BHRA 2XI4A 3GCXA 4DT1B 5KX5A 1OBCA 2AVNA 1KVTA 1SC6A 2YXNA 3IQXA 1RLIA 2V9ZA 1U3VA 1VCNA 1GT91 4K5QA 3ZGNA 1XCOA 1NC3A 2YVAA 2A0WA 4IF6A 1TRHA 4ROTA 4TTQA 3ULKA 4RH1A 2PSSA 1B15A 4PLYA 3DBLA 3FI0A 4KXMA 4CDMA 3FR8A 1U28A 1QANA 5F2EA 2QZSA 5H4HA 3IPAA 2XOEA 3R20A 2QROA 3QVLA 4JVSB 5E8JA 1BSVA 4GOMD 5EINA 1N36B 1K4YA 3K0EA 2BOVA 1D9XA 4PX9A 1CVIA 1HGXA 2KB0A 1UXGA 3W6PA 1A2KC 1ZI9A 1P1BA 3GCZA 4D6XA 4BATA 4AP6A 4HDKA 3L04A 1FNMA 2Q5IA 2CSUA 4MO2A 4DIDA 4EJFA 4UTPA 1DAHA 1JFFA 1DUVG 4RK6A 1JZSA 1RXEA 10MHA 2LCQA 1WKVA 1N8NA 1NF3A 2YOHA 3KXKA 4HFNA 2BKLA 3OFVA 5LL6P 4MQ6A 4NAUA 5JPDA 4E46A 1ZY2A 1X74A 4HBZA 1PR9A 1U90A 2XYRA 4QYXA 5CM8B 4HG2A 2KX7A 1ZRHA 2OT3B 2WUVA 2HF8A 5JALA 5FNZA 5C5IA 4EIWA 2W4QA 2JG3A 1TMYA 4LFCB 4QTTB 2O3TA 3M1AA 5F1PA 2HSJA 3KOZA 5JC1A 1BKDR 5LMCA 3G2KA 3EIQA 4RD1A 4Q93A 3LDUA 2CWDA 3N0WA 2EJCA 1LKZA 2HHJA 3HNRA 5EZ6B 5B1IA 5INTA 4ARAA 2DXIA 1OLUB 3DT9A 3MCTA 4DIEA 5C2JB 4O63O 4MPDA 2H3HA 5C51B 2P0AA 2WJIA 1YMVA 3KHKA 5L3VA 3HUFA 1ULTA 2I9PA 5JQGB 4WRRA 3N3AC 1G5TA 3ZGZA 3Q88A 1MZPA 1G4HA 1T29A 2HMWA 5C1IA 2PKRA 3E2PA 3PKZA 4I1YA 1LDMA 4H16A 4NBVA 1T26A 4BP9A 1D7AA 3OLZA 2D4HA 4CGZA 5JIBA 1C1XA 3ANSA 3BFKA 5DGDA 3WP1B 4KWHA 4PV7A 3E27A 3USES 1A8UA 2ZSIA 4NI5A 5LKRA 4WY8A 2Q1TA 4HD8A 3RS7A 1U2DC 3U2QA 1ZGAA 3UJ9A 5JJLA 2FQQA 2IV2X 1F51E 1EK0A 4LY0A 6CHYA 4AKIA 2VN8A 1CBUA 3NRCA 1YIOA 1FRVA 3A4MA 2V45A 3DDNA 2PVSA 3LBYA 4W6QA 4YV2A 5AK5A 1DWUA 3WB0A 1DAEA 3NR2A 1OKKA 4GL4A 3I2IA 5IF9A 1W47A 3ADCA 2ZFUA 1X1BA 2EJTA 2JCSA 2HADA 1U1DA 3W1EA 5CXQA 2ILVA 3DWFA 2P2DA 3HXMA 2EBUA 2HA2A 1CNEA 1R74A 2D5IA 1SXHA 1XD8A 2QE7D 1E6EA 4K81B 3REQB 4EWLA 2MSDB 2WJWA 4KQWA 4RVGA 1E7MA 3W3AD 4F7WA 4G5FA 1QYXA 2IWHA 3M0EA 2BEUA 4BIIA 4FFDA 3VMFA 2G8NA 2AEFA 2I8CA 3LIIA 1N77A 1YFJA 1YJXA 4GUDA 4JJEA 3CUVA 5DLEA 2ZVPX 1MOPA 2I6GA 5SZIA 3WWEA 1CYDA 3W04A 3REGA 3UK2A 1E3SA 1CUSA 5CH5A 3V4FA 4D4LA 1TOAA 5IW8A 5C1DA 3HBLA 5GQSA 1XCBA 4X1YB 3HZHA 2XUOA 4KL8S 4J2TA 2CEAA 5EJGA 1A8IA 1WMBA 4H7DA 1C3OA 3FCSB 3PE3A 2I3BA 4Y2GA 4EI7A 1ONPA 5AJHA 1I7QB 5HQ3B 1IEVA 4XM1A 5JRZA 3NHFA 3FDZA 4XA8A 3A32A 3R3WA 4NIMA 1GAJA 4MYRA 4OJNA 2O5VA 2AK3A 2JW5A 3HYTA 4LOIA 1XPUA 2B8TA 4D43A 3ZHVA 3AUAA 3S5UA 5LQJA 3FD8A 3NHRA 4ON9A 3VHXA 1IC6A 1B3RA 2A3NA 4MKXA 5HMLA 3NWEA 1DVRA 2QJTA 4JB8A 3ZWAA 1I8TA 1XVLA 4MCAA 3E4DA 2EFGA 5BV7A 2JJYA 3QXSA 3KS9A 2J6HA 3MQ2A 4U7JA 3TYXA 1Y42X 3E35A 2H7XA 4C21A 1SU7A 4LK2A 1CY2A 2OWDA 3IQEA 3KJXA 3C3KA 4EDHA 1C9DB 4X3OA 5J9FA 3TIXB 3THOA 3NDBB 1T5DX 1J0EA 4ZEWA 1YDEA 4O4JF 1EUZA 3BILA 3CLUC 4AS2A 2D13A 2NZYA 3GPCA 4L4SA 1FA9A 5HIAA 4U9HS 5HF9A 1G18A 4MYTA 1Y6QA 3B60A 5DNUA 4JUAA 5ICCA 2PRYA 2FZCA 4J03A 1G60A 5DNDA 1VE3A 1DB3A 3CCBA 2VHVA 3V1TC 3EIXA 5HF8A 1J0AA 1A7KA 1XZFA 4OD0A 2W4IA 2FRVA 2W6QA 5IJ9A 3MELA 5ABPA 4JKOA 2JI8A 3HK2A 1L4KA 4MVCA 1K0FA 4MV3A 3JQRA 3D8UA 1W76A 1KA9H 2GJSA 1UZLA 2W71A 3B48A 3FPSA 3K1TA 3L4BA 4U7WA 2XE8A 2RGBA 3KFLA 4P58A 3I9MA 4HEJA 3DVSX 4OQDA 4KR2A 2HMAA 4E5NA 2EZ4A 1IQUA 3M1LA 1SCAA 1PT6A 3MN1A 1UT5A 2NTEA 3W5UA 4LF8B 2GTHA 5ICEA 2HY7A 2ATXA 5FJJA 1PT5A 4DQVA 4YDQA 5G0VA 1W36B 1T0IA 1BAPA 4ZEXA 1LJUA 1B8UA 1F17A 2XBUA 5AVKA 3WLQA 4BS9A 2IOFK 3KYCB 3PGJA 2MMGA 1I4LD 1VKJA 1SUSA 1XIVA 2PS0A 2WF5A 3A6DA 3OZDA 2HO4A 2PV0A 4EB0A 1IHXA 2VQEB 1ECGA 4MRPA 3LDGA 2EKBA 3MLBA 3DVRX 4K88A 4TV9B 3L8MA 3N2ZB 2IKQA 2BFAA 1XTPA 3FVVA 3E9NA 1HPLA 2ZBEA 1KO8A 5EIHA 1TJ3A 1U2GA 4RH3A 3DAOA 5J5AA 4JD5A 4TSRA 5DN6D 1RI3A 2QMUA 1XNRB 1RAHA 3PUKA 3JCZA 2CMFA 4MJXA 3WLAA 5ICGA 3UAYA 3G8DA 2F3RA 3O91A 2WAXA 3U4IA 4GC5A 3ND5A 1YB7A 4O0MA 1DTWB 4OQPA 1J1ZA 3WLKX 2CNOA 4QU9A 5L7WA 2J9RA 3L7NA 2D2IA 2CE7A 1BMQA 3CT4A 4S35A 4CWAA 5IT4A 4A1FA 5JECA 3CVYA 5I47A 1O97C 1CEEA 1KJYA 3PEVA 4GPEA 1H8ED 1J7JA 4C0WA 4QDTA 1M7BA 3P2YA 4WPGA 2F8SA 4WLVA 8LDHA 2ODTX 3DLBA 3L1KA 4BFLA 4DVJA 1ZXXA 3D2LA 4JJGA 5KYNA 3RE1A 2UZ3A 4YR7A 1ZUWA 1ANKA 4GI5A 3K70B 1DPFA 2X7XA 3O7WA 3V9PA 5CDHA 4AUNA 1Y1KE 2AEJA 2R87A 4J7UA 4QT0A 4BNLA 2Z3ZA 1DTEA 2C78A 1ZC3A 1UBOS 2BGIA 2IPAB 1UKCA 2ZATA 3CIFA 4M0PA 1MQ9A 4DCPA 5TLSA 8MHTA 1BFUA 1H4TA 4U1RA 4NE2A 5KTPA 1C3XA 1O77A 2HLDD 1NQOA 2JHFA 2P9FA 1JDVA 3K8QA 4NU6A 2Y2VA 5LBUA 5MF6A 3D4NA 5L3ZA 1CY6A 2FPIA 4QRDA 5G1PA 4MI3A 2GK6A 3DFFA 3UHAA 1I4OA 4KBGA 1F9AA 1PJQA 1J8MF 1ESMA 1HNNA 2OO3A 2XE6A 3I5UA 2O8EB 3FKQA 1N5IA 4CF7A 1NWHA 1GCAA 3GI1A 3KOYA 3WSTA 1SUFA 3WRYA 1AXGA 2H8KA 3ZU2A 3B13B 4HX5A 4S05A 2HU2A 3R7NA 1CQJA 3IKVA 2YWJA 4BQEA 4OJKA 3LOUA 1EIZA 4GQAA 4BMCA 4ER3A 2HTEA 4B3SB 1QE5A 2FQ1A 3VYUB 3FM9A 3RNOA 1RAFA 2R8OA 2Q3MA 4WBXC 4N40A 1N2IA 2WPDA 4P36A 4UU1A 3DH0A 4DCTA 3KXDA 3JYLA 4DV5B 4MW0A 2C9DA 3VU9B 4MV4A 1W88A 5FLXA 4MGHA 4I81A 3O21A 4GSLA 3ED5A 1F2TA 2BZ1A 5BMVB 3O4JA 1GKKA 4Q3NA 4WOKA 2ZYVX 3KBOA 1I32A 2NO4A 4WZAE 4BYGA 5B7GA 4QLBA 2EVWX 4OEHA 2JHAA 4NKRA 1P5RA 3U9LA 2GHQA 5K3AA 1SUCA 2HMYB 2G1JA 4I1VA 4PYMA 1JFTA 3JQ7B 3TPFA 1DDOA 1Z39A 4WY2A 3UH0A 2MSWA 2OCAA 1EBBA 2IQ5A 3NUQA 4EI2A 3X2EA 1L4MA 3KLPX 2AJCA 3C5VA 1NFQA 5FI1B 5BQOA 1GCOA 2V0CA 4WBNA 1USKA 4LZLA 2F3QA 1YOBA 4TMXA 3EZYA 4UTXA 3R0XA 5DIZA 3DLHA 2Z5LA 3QP9A 3H83A 2W2KA 2AFHE 2J9XB 3P9IA 1O96A 1T8TA 1DADA 3C85A 1Z38A 4P84A 3VO1A 1OH5A 2X22A 4N0PA 4LI0A 1JR3A 1NBWB 1DAFA 3PFFA 2P3OA 4NFYA 4KSCA 4KKXB 4TV9A 3IQWA 4WJKB 5DGTA 3HL0A 4EJSB 3L7AA 1DRWA 2I2XB 1HORA 2FWAA 4FYWA 4O4HB 5EIFA 1V7QA 2RI6A 2P2LA 3RSZA 1EQUA 1MG0A 1T6NA 4CUKA 4UCXA 2ZBUA 2EW1A 2ZB2A 1W85A 2RHCA 3ZWOA 2F55A 1H66A 3FBWA 2X0FA 3LVQE 4CRWB 5KTYA 3IAEA 3VNVA 1P75A 1DJLA 3HPQA 1PBTA 1T35A 2JJ1D 1YZLA 1E99A 1GFWA 2WLTA 2YQZA 1RI4A 3TIIA 4KDRA 5DHPA 3I3SR 3CM0A 2ZZMA 1KU6A 2GF2A 3ZWBA 2GCOA 1SOMA 3E22A 3W3AA 4UFNA 2N75A 4L72A 3QH4A 3NHLA 2Y0DA 5EJ4A 1PJRA 2GHTA 2E4ZA 2DP4E 1EE2A 1AF4A 3F47A 5C31A 5DLYA 1Z2NX 1ZVJA 1Y7LA 1QKJA 2IIVA 1NMYA 1YR1A 1WETA 2Q1UA 2YINC 3O1HB 4MS1B 3SBOA 1W59A 2QGFA 1YI8A 2VJYA 3H5RA 1RYMA 1PUJA 2JCXA 1Y7IA 3E3LA 3L0ZA 4HDQB 4PYOA 5AMXA 2OCYC 1LQ2A 4RTLA 1E1DA 1AMUA 1NVKA 2ZUDA 4YAOA 4HNTA 2HPZA 3O8OB 3P71T 4DB4A 4WNCA 4LGCA 3T7RA 2VYFA 2P9GA 3R76A 2JL1A 1OMOA 4JBIA 1EUDA 1S3SA 2CNKA 5AW9A 3QXGA 2BDUA 4PGFA 1T15A 1TZBA 2JHCA 5B64A 4GWLA 4NCHA 1AS2A 4GNKA 4L3WA 2J09A 2ZT5A 1DKOA 1VHLA 5CU7A 3NBYC 4MB0A 5F4BA 2B36A 2IPLA 3B78A 3LKZA 2PUDA 3BGWA 2O14A 5HE9A 5LWQA 1RE0A 2RGRA 4HDMA 3BRQA 2UXDB 4WNAB 2GBLC 1NYTA 1OXMA 5IYZB 4TLDA 4RSMA 3BWYA 5K8TA 3LBNA 1ZWKA 3H1PA 5HE8A 4DJAA 2DUWA 1H5QA 2IA5A 2H1OA 4HB3A 3FWPA 1WSBA 2FKAA 1NNEA 1FUEA 2OC4A 4G23A 4EO9A 4X60A 3UW1A 3OMWA 4HRAA 4NH0A 3N2GB 4BLOA 3K9BA 2P2CA 3RUHA 2X2PA 2HTFA 3H75A 5TPZA 3BXPA 4JQOA 2ZOSA 1N2SA 1XJCA 1KI6A 3C48A 3NTUA 1C4WA 1IBCA 1Z8FA 1KDYA 3SR0A 4BC0A 2XRYA 2EC5A 2FSUA 2YV2A 3LF2A 4OHMA 1M5UA 2PWBA 4QUBA 2BRUC 3OQIB 4I1IA 2JJQA 4JMPA 3GRFA 3ML1A 1W4LA 1DOZA 1YS1X 2NYVA 4GECA 4KIJA 2ID9A 4ZC8A 1PRYA 4ZHQA 2O8BB 4KEAA 1BFKA 1GZSA 1YNSA 5FUBA 1Y5MA 1B26A 3OP1A 3KUDA 3IR6A 1I36A 1OGYA 3FFXA 2GAOA 3EMDA 2JAUA 3ER6A 3UGKA 2QRNA 4EB6A 2YQ4A 2OESA 3RIEA 4Y3UA 2OVFA 2QMOA 3PRYA 1ID1A 3T99A 4Y2RA 2UYGA 1WB4A 3TJMA 1O9GA 1QGZA 4X8MA 1X1SA 1NSTA 1IWBB 1FBTA 3BZWA 4YRNA 2OYSA 1COZA 2QZ4A 1GHTA 1MIOB 4UUOA 1LQUA 1SIBE 4NAHA 5FF9A 3QEMA 4LGYA 4BO2A 4C78A 2VDNB 2QLMA 2HIHA 3VNUA 1JA1A 1O96B 3OOEA 5IARA 4B3HA 3L1HA 2JK1A 4YJ2F 2VDWA 4RZUA 2CFIA 3K71B 4DC9A 3HVHA 2IHTA 4AAYA 3WQBA 5TT1A 1GNQA 5HUJA 2HWKA 2LUOA 3YASA 4P22A 3CJQA 3N7AA 1AVTA 1O94A 1XA0A 1ENYA 5CM9C 2O7NA 1L4YA 2KMLA 1B8PA 1WCWA 1TTHA 1KI6B 3ZEAA 1O0CA 2AFRA 2A4KA 2UYOA 4Q4JB 1RVV1 4P3OA 4KQJA 4KE7A 1E3QA 2IC5A 3NHZA 1P6XA 2W6MA 2EF1A 4BFUA 1MPTA 3BEDA 3B1ZA 4MRMA 3A04A 1KO4A 1LDBA 1QNLA 4N7JA 5AOVA 3K20A 1IVNA 3R3UA 4HCJA 2IX9A 1WKCA 3HA7A 3AVQA 2UUAB 2OV4A 2FSVA 5A4IS 2ONKA 4DLPA 1Q91A 1NQVA 4LCBA 4ZT6A 4G1FA 3ADBA 1DE0A 2QV0A 2VZ9A 4TS1A 2PFGA 5FYDA 1VSTA 2CXHA 1T8YA 5KTTA 3EOBI 3U26A 3LA8A 4WOCA 1VJ0A 1JFLA 2F9FA 2BM8A 2FN3A 2H11A 2DJ5A 4L9AA 1UKZA 5E6UA 4E2YA 2GJAA 2JLWA 2O3QA 4DY4A 2DULA 1KAMA 3BJRA 4LYGA 3ADOA 2XMPA 1I24A 5KTNA 3WLSA 1K98A 3D8BA 1N5OX 3KQTA 3MJDA 4LRSB 1UFVA 1T3HA 5EUBA 3T8YA 4F8JA 5EIBD 2C92A 2JGRA 3ICWA 2GM3A 3KT6A 3BXXA 3QBVA 3LO5A 3WGQA 1OQAA 4QX6A 5J5VA 3G5AA 4X93A 3A7DA 4DLYA 4O2AB 2CWWA 3R3VA 5LQKA 4MR7A 4CEIA 3F7TA 1V5IA 5DBHX 3VAAA 3C8DA 5EHXA 3NM4A 4DSAA 5BSUA 2PGXA 3BIOA 3HHPA 3JVUA 1GGNA 4XFJA 2QRUA 1BMTA 5EZSA 4EFMA 2OHOA 1VCHA 2NQTA 1Z8DA 2WWTA 5HJ2A 3PRHA 4DLXA 3GOQA 4P08A 1C0IA 3DD5A 5U1PA 4D56A 4GH5A 4L75A 4UBIA 3S55A 3VPHA 4NZNA 1XN1A 3IOBA 5TX7A 3D7NA 3OI7A 1MOZA 1OXKB 1KH1A 2VTDA 3FB1A 3ER9A 1HI9A 3UM9A 4KQEA 1L4NA 2Y0CA 4Q1CA 4EP1A 3AHIA 4FKZA 1YVPA 4HADA 4QDZA 2K87A 2UDPA 2I03A 4Z99A 5DSZA 5JNVA 3L6OO 3B9PA 4NYMQ 4Y6GB 1U04A 1NN5A 1ZD4A 3GEGA 3G6KA 5B4TA 1QIIA 2AG6A 3ZUPA 4ENSA 3LI2A 4ZU3A 4HQ0A 3FPEA 5HQ3A 1T2NA 4R1QA 1XO1A 2HA7A 4QXQA 5IP5A 4CCYB 3KQVA 2TYSB 2XCUA 2Y68A 3HZOA 2NVUA 4QBTA 4CLDA 4AXXA 3WV5A 3WYCA 1XPRA 1SKQA 2ISQA 2Q1XA 4FEEA 1XDGA 1YDWA 3CHYA 2SCUA 4R3WA 5DGHA 3VPAA 5JH7A 1T6YA 1CP2A 2WIDA 3V9AA 4DXDA 5FEUA 2WUWE 2BGRA 1G9SA 2HYIC 1ZM4A 5F1OA 4QRIA 5KYUB 2EX1A 3NTRA 3JX9A 2VK1A 2XV1A 2YUTA 2W2TA 3K4HA 1UF9A 3PITA 4TL7A 4JJ7A 1NVXQ 5HM8A 3A14A 5BT8A 5CA1F 4JBWA 3OM9A 2FEKA 2ROQA 3IQDB 3GLFE 2PJUA 4JJ4A 4RPGA 2E5LB 4G9EA 5HFJA 3TG2A 5LUBA 2B1IA 4LRQA 4XR9A 2H1LA 2I3DA 3G88A 4EKIA 4EYKA 2E89A 3LU1A 3QM1A 1CY7A 4YYEA 4R9UC 1ZVQA 2IJGX 1Y3IA 3CUWA 4X7MA 2ZUUA 1U2DA 4GXTA 3USCS 3TL3A 3EQ9A 5ALTA 3K70D 3RLIA 3V80A 3HCCA 1T9AA 1RXSA 3KL2A 4LISA 4AXBA 4ZQFA 4TTVA 4I1PA 1J5PA 2NVOA 5IX8A 1MA3A 4LDPA 1LNSA 1GZ6A 3JQAA 4BLWA 5J2UA 3THWB 3KV3O 4PYRA 2HK7A 4RZXA 3CUTA 2O2IA 4GYJA 5GM1A 2J3KA 4C29A 1YR9A 2WZQA 4G0XA 5EJ8A 3ETEA 1IJEA 4I9FA 1GCIA 2C59A 3VSBA 4HDNA 3T95A 2Q6TA 4JXZA 2V7QA 2XDQB 5JCJD 2FG6C 2ZUSA 1L5ZA 3OCYA 2HRRA 4E70A 3S0JA 6Q21A 3VO8A 1H4VB 13PKA 1KC1A 1SVUA 2HQOA 2PANA 3KYCA 4KRXA 4RAOA 4YJFB 5F78A 5FBKA 4UHHA 4YWJA 3SFZA 4D9MA 1ZA1A 5HM6A 3M81A 4MWEA 1EWRA 2XRZA 1VMAA 4X45A 3WWPA 1JN0A 1UOQA 4OOFA 1FQJA 5A4JA 1EJ6A 3HZZA 2XCOA 3HKEB 4MOWA 2QL6A 2Q62A 4EUHA 2Q3HA 2VSXA 4MMYB 2IXDA 3IQFA 4R5HA 2VWPA 3LV8A 3IQIX 1OAKA 3PC7A 3UJAA 1LJ8A 4PSAA 2I80A 2AWNA 5I3CA 1Z5NA 4XX1A 1EX1A 1OWMA 1R6XA 3VR2A 3NTXA 5AVXA 3ZJYA 3VAYA 4DSUA 5CDSA 1BO6A 1P61B 1NQWA 1P1RA 1ZGGA 2R25B 3UPDA 2Z2YA 2NPIA 4IS2A 2RIPA 3RFVA 3ZU3A 4ETNA 3TLMA 1WMDA 1QWOA 3L8ZA 3IX7A 4TYPA 4UE2A 5H81A 4C7KA 3A4NA 4FHZA 3FETA 1ICEA 3LA6A 4E2WA 3D3NA 2W9XA 4JUFA 4M36A 5EQJB 1E98A 3F1KA 4Z3OA 3H0KA 3FJ1A 1JTEA 3ASUA 4ND2A 4TKMA 5KUTA 2MTBA 1OBHA 3OOJA 1GPWB 5D6OA 5DMXA 2VQFB 1QRRA 5ALZA 2ZKLA 2QTRA 4Q03A 4I50F 4PNHA 4QOSA 4DR6B 4WDRA 3KYDA 3GVPA 4W5QA 1BVYF 3QELA 2OFOA 4U00A 5T41A 1ORDA 3U13A 2P4UA 4TMTA 1VRCA 3I61A 1HEIA 5J47A 1CUJA 1KEZA 1JHDA 1XP8A 3E15A 3NBQA 5IXSA 4BNTA 4YUXA 2NU8A 1W4RA 4C5CA 4F97A 2FLVA 5IASA 1OLOA 1TLFA 5KQRA 3FPJA 1IN5A 1R8XA 1NONA 4NG5A 3NEYA 3WNDA 1ZM3A 5ED4A 2XSZD 1CDZA 5BYBA 1RMYA 2X76A 1YUBA 4JKIA 4M0LA 5FPPA 1FTNA 2QAGB 1HKUA 1H1DA 4HEQA 3A9SA 5H3CA 2JAXA 3ISTA 4FYVA 4BFSA 5IJ0A 4DV3B 1OGJA 4C04A 4L5BA 4Y2HA 4EPTA 3II6X 1TA9A 1WQ1R 3HXTA 3E9DA 3WGLA 4AD8A 4WCFA 2B98A 2FLKA 4JT8A 1TL7C 2NADA 3HR4A 2WTXA 2IXFA 3NH6A 4P86A 4B31A 4Q82A 3H97A 1KAHA 1FDSA 2V65A 4LZAA 2BCJQ 3ROQA 5FPHA 5A3VA 1USVA 3CTMA 3JQFC 4M46A 1XZBA 1Y3FE 3WYDA 3MWLA 5GONB 5ALRA 2JCYA 5EIEA 3E8SA 4IIEA 4PO9A 2QG6A 1SVNA 4ASUA 3TAXA 4NESA 4P4GA 4KR6A 5AK0A 1RYEA 3DMTA 4YRTA 4WI1A 5DFAA 2LTAA 3SBXA 4ZICA 3BG5A 1LK5A 2ZRFA 1LGYA 4EUFA 1NVBA 2QPOA 4Z0HO 4ZZ2A 4FDTA 2Q5HA 1TAQA 4LRXA 1RI2A 2VQSA 4DJDC 4LVCA 2V1XA 4OLJA 5SZKB 4X71A 1O97D 1U8ZA 1WHTA 4IIBA 4YMUA 2AZTA 2J0UA 3WRXC 2UZ4A 4PONA 3H2KA 3PV0A 4LXUA 4N54A 5DH9A 4NCAA 1NV8A 1UBMS 2P35A 1SCKA 3BK2A 3K0HA 1UDWA 2OEPA 3DNMA 5EI5A 1BNCA 3G0OA 3LIPA 4X91A 2G4LA 1JXQA 4TM8A 1GPJA 4N03A 3LWNA 1SCIA 3IAXA 4IDHA 4MLCA 1MDBA 4UJ3A 3IPXA 4JC8A 1E9SA 1A97A 2GBGA 3QKWA 3MINA 1NF8A 4RXTA 3R7DA 3HP4A 1J5XA 1OY1A 5JAPA 4PAMA 3T1HB 1KDTA 3MIIA 3PC8C 3JS5A 1CQIB 3LFHA 4CEJA 5IN4A 2A0KA 3AKCA 2PVCA 3GJ5A 4PYIA 5CVJA 1KH2A 5ITZB 1EFCA 2JDID 3TF5A 2HJHA 4HWGA 4D5EA 5JSZA 3A3NA 1H3EA 3H5WA 1Y3BE 4OKNA 4BNIA 1H6DA 2Q49A 3CWQA 1IUOA 4Y2SA 5GZ6A 4H7PA 3TBHA 4FDLA 1YB6A 3D6HA 3IUPA 4S3MA 3ZNNA 4TOIA 2GRUA 2CXTA 2DHDA 3FPLA 3TX6A 1CEQA 4HDCA 4LKOA 621PA 4QAJA 4D3SA 2YVQA 4U0JA 2X2EA 4WKNA 5EE5B 1T2EA 1DJQA 3F0TA 2OHIA 1WUTA 2XIQA 3PNPA 4LJYA 4Q4HB 5ELLA 5LXTB 5C8DA 2YWRA 1J2TA 4L8WB 3STYA 5EESA 4YT2A 4HLUC 2BM1A 2CD9A 3GLVA 3MXOA 4UCFA 1JIIA 3LZ6A 2VEOA 3GJ6A 2Y1OA 3RYCA 1TQ6A 3TNDA 3QOFA 4CCWA 1JU9A 3LCJA 2VTKA 1S4QA 1G20B 1L8AA 4FFRA 4AW9A 2G67A 3I8SA 1EM8A 1IY0A 3BHMA 3U17A 1X2BA 1C3OB 3CZ5A 1T1RA 1VYUA 4HAYA 5A06A 1ZJ4A 4M3NA 3A2KA 1NXQA 2Y4OA 2C0PA 5AVSA 1ZHHA 3QKSA 1K92A 1XNGA 3TRFA 2G17A 2OLEA 2IIPA 3EGDA 4XLTA 3NHJA 1CE8A 1NUQA 2AOXA 4BL5A 2YN0A 2ZJ8A 2QLBA 2GN4A 4HDMB 1ST3A 1EA5A 4IINA 4YTEA 2I4OA 4B32A 4MW7A 2ZJBA 4G3XA 1ATZA 1DHTA 1W5SA 1QBGA 4FFNA 3PEYA 1XF9A 1M1XB 2AFIE 3CW2A 3KWFA 1MAHA 4EEKA 5BNFA 2P7IA 2VHZA 4NZZA 1N3LA 1N6KA 5B7PA 3JU3A 3K2BA 4AU1A 4QVKA 3S4YA 2EQBA 2C3OA 1ODKA 1I33A 1A9OA 2ZR8A 5AIAA 4CT4B 5JYEA 4HXGA 4DCOA 2WTNA 3FNGA 4LEIA 1FE8A 1PX2A 2QVBA 1A9YA 3NTOA 2PZBA 1LB1B 4MPJA 1QRUA 3BWBA 3F74A 4MB6A 4Z0TA 1QG0A 1JKJA 2V7VA 3TD9A 4DG8A 8AT1A 4YLEA 5AI5A 4KSYA 5L4NA 2RMKA 3VBEA 5ESDA 2BJWA 4M0KA 5ECGC 2VF2A 1PVDA 1M2OA 4BLRA 4ODIA 3W5VA 5KNDH 4Y1FA 3ELDA 2BT4A 4HDSB 2YHBA 1U80A 3JRNA 4XD2A 5DTEA 1Z0JA 1WQ3A 4CJXA 2D3WA 3Q7QA 3S6JA 5EZYF 4E21A 4ZKDA 3C7AA 4IRUB 4UARA 1Y5NA 4Q9HA 3P9NA 3ZY2A 1P74A 2HJWA 2ZRJA 3IIKA 4IMJB 4MAFA 3GLKA 4AN4A 4EL0A 5L95A 2H9AA 1CU1A 3BMNB 4D41A 1DT5A 4HGRA 1LLCA 1YCDA 1EDDA 1JT2A 2G9ZA 4W9MC 2FGJA 2WMYA 821PA 1E0SA 3N39C 1QVWA 4GZ5A 4YAEA 1B93A 3K8YA 1B3BA 4E3WA 5DK6A 1DFGA 1MV5A 1P39A 1AK2A 1RWOA 2I3ZA 2YASA 3A9RA 1YUMA 1WUIS 3PGLA 4EEXA 4J49A 1H9BA 4A15A 4P38A 3RRNA 3GIWA 3L6CA 4Z49A 2YCBA 2Y1LA 1WDMA 2OCBA 2YJGA 2FW8A 4FDVA 3OKPA 4F3KA 4IOJA 2X77A 1I14A 3EW9A 4G8JA 1CQIA 1NNLA 1W1IA 1YRHA 5CB6A 4I36A 4ZKEA 3KRTA 1K6XA 4N6OA 4CMHA 4NXMB 3I52A 2Q21A 2F1RA 1YQTA 2HMUA 2NV6A 3CVOA 3FPCA 1JQDA 1KDPA 1V5EA 4P5EA 1OREA 1DQSA 1VJ5A 1WXEA 2Y67A 4HY3A 4BO8A 3VMMA 2XGMA 4RTMA 4L7QA 3S2SA 1XDSA 4OLFA 2R0QC 4PPGA 1T9HA 1YHNA 2W11A 3TE6A 2KHZA 4G86A 3QA3E 4HC4A 2AEMA 4CL3A 1F7VA 3V7NA 1W87A 1XP5A 1NSYA 3L5KA 3OCVA 4S0ZA 1G17A 2M32A 3MWYW 5B58C 2D5LA 4V1CI 1AN0A 1EVYA 3I6QA 4AMYA 1VE5A 4L1KA 3RM3A 3ZLJA 3CXUA 4DJ5X 1DC6A 2QTCA 3IYLW 5FOSA 3DTYA 3SZLA 3U4QA 1FTWA 2FYTA 1ZYUA 2GX6A 3L77A