5LVAA

Crystal structure of thermophilic tryptophan halogenase (th-hal) enzyme from streptomycin violaceusniger.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
174
structure length
174
Chain Sequence
b'MKVLVLAFHPNMEQSVVNRAFADTLKDAPGITLRDLYQEYPDEAIDVEKEQKLCEEHDRIVFQFPLYWYSSPPLLKKWLDHVLLYGWAYGTNGTALRGKEFMVAVSAGAPEEAYQAGGSNHYAISELLRPFQATSNFIGTTYLPPYVFYQAGTAGKSELAEGATQYREHVLKSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H-FMN oxidoreductase
molecule tags Oxidoreductase
source organism Bacillus subtilis
publication title Structure and biocatalytic scope of thermophilic flavin-dependent halogenase and flavin reductase enzymes.
pubmed doi rcsb
total genus 62
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5lvaA00
2QMYA 5EMNA 3HLYA 1YKGA 1FVXA 1YRHA 1J9EA 3EDOA 3ESZA 5FUQA 3NHFA 3GFSA 3S2YA 4C76A 3NHWA 1AKVA 2Z9DA 4S24A 4F8YA 1KBQA 1YOBA 4XDHA 1CZOA 3FW1A 2N1MA 3OVMA 3UXEA 1YDGA 6NULA 4XDGA 1QR2A 4LTNA 5JROA 3QFCA 3L9XA 2XODA 2OHJA 3NHKA 1T5BA 1ZWKA 2FAXA 1X77A 2AMJA 2V5UA 4LTDA 2B3DA 2FLVA 3P0RA 3QFRA 5B3KA 1GG5A 3OWHA 1FUEA 3ES9A 3W79A 4QOEA 3O2NA 4N65A 4N9QA 4Y7CA 1WSWA 2Z98A 1FLVA 1E5DA 1OFVA 1NNI1 1DXQA 4N82A 3EYWA 4DIKA 3JSXA 2BF4A 3N3BC 4ICIA 1VMEA 5EAIA 1AKRA 2V9CA 4QOJA 4QOFA 1BU5A 1I1OA 2QMZA 2F1OA 1DX9A 1FX1A 2RG1A 4LA4A 3U7IA 5B3LA 2WC1A 4CETA 3LT5A 4HS4A 2Q62A 1CZUA 1AKTA 2X2PA 3HA2A 5EA2A 1SQSA 2BN4A 2MWMA 2OHHA 2V5VA 3K1YA 3NHYA 3NHRA 3FNIA 1D03A 3ESXA 1D04A 3F6RA 3GFQA 3N39C 1OBOA 5F4BA 1H66A 1CZRA 1AKWA 1XT6A 5LMCA 1D4AA 2QX8A 2Z9BA 2ZKIA 4GR9A 1XI2A 2MTBA 1ZWLA 2R96A 3ZHOA 2FOXA 5TGZA 5FA6A 2OYSA 1J9ZA 3L9WA 4FX2A 4U7FA 4Y9UA 4BMOB 2A5LA 5LLDA 2HNBA 4YAUA 2Q9UA 2FZ5A 4LAFA 2MT9A 1C7FA 2FZVA 2FX2A 4QOIA 3KAPA 3D7NA 1CZLA 3B6JA 3F6SA 3OX3A 4QOGA 4FGLA 1FLAA 5FX2A 4GQIA 3NHUA 1JA1A 1AMOA 2GSWA 4BMPB 1XYYA 1RLJA 1J9GA 1XYVA 3FVWA 3R6WA 3FX2A 4LTMA 4HEQA 1YCGA 1WSBA 4QOHA 5ULLA 3G5MA 3SVLA 4YALA 2D5IA 1TIKA 2Z9CA 1CZKA 1YCFA 2QX4A 4FGKA 1CZHA 3QE2A 3TE7A 2X2OA 1KBOA 5NLLA 4C14A 4DILA 1H69A 4CF6A 1CZNA 4PTZA 1AHNA 1RLIA 2XOEA 4U7GA 4D02A 3NLLA 1FTGA 1SG0A 4GI5A 4NULA 1T0IA 4OXXA 4R81A 3RPEA 3TZBA 3W7AA 3W78A 1FLDA 2QX9A 3FJOA 4C0WA 3OX1A 5LVAA 4ZVLA 3ESYA 4H2DA 1AZLA 4FGJA 4YAFA 3U7RA 3F2VA 1ZX1A 2KQUA 3NFRA 3NHLA 4NLLA 2KLBA 4DY4A 4ESEA 1J8QA 4ZVMA 4U7HA 1RTTA 2M6SA 2HPVA 3TEMA 2W5UA 4J8PA 2ARKA 5LJLA 5NULA 3K20A 3O73A 5BUCA 1QRDA 3B6IA 2FDXA 3GFRA 3KAQA 3HR4A 1QBGA 3UXHA 4PU0A 4Y9RA 5F51A 4YAOA 1B1CA 1V4BA 3OJWA 5LBTA 1DXOA 1RCFA 4PTYA 4YQEA 5A4KA 3KLBA 3F90A 4QODA 1YCHA 2R97A 5LBUA 2FCRA 2QX6A 5LJIA 2BMVA 1AKUA 1C7EA 2HNAA 5F12A 2OHIA 3OWXA 4H6PA 3N3AC 4ZVNA 2FVXA 3W77A 3B6MA 3LCMA 3B6KA 1BVYF 1QHEA 2M6RA 4ZVKA 4C0XA 1AG9A 2BPOA 2MOKA 3NHPA 3OX2A 1F4PA 3NHSA 3OJXA 4YAWA 3GAMA 3NHJA 1AKQA 1FLNA 1TLLA 2QR2A 1OBVA 4M0CA 2BZSA 2QWXA 1JA0A 3KEGA
chains in the Genus database with same CATH superfamily
3M2TA 3VPFA 3SX2A 3W5JA 2CSUA 3FPSA 1HX7A 2AZTA 4MS1B 4YJHA 4BU1A 5KOHA 4ECAA 4A0HA 4L7QA 1USIA 2P1ZA 2POQX 2PK3A 1KZ4A 2R8RA 1FU7A 1XTRA 2OESA 4BV8A 2WWWA 4I0WB 4OKSA 2OPHA 1WY7A 3RYIA 4BX3A 4D57A 2CT8A 3SYLA 1RACA 1DJNA 3D7LA 3ZLVA 3KZNA 4BECA 2NVBA 2E5FA 2Z98A 1NWCA 4OBXA 2QE7D 2DWUA 1D4FA 3TRFA 2I4TA 3V7WA 4DNFA 1AGXA 4YJ3F 3B1JA 4M9XA 2VP3A 3A1CA 5JOQA 3M89A 5A1TA 1YRBA 4IY1A 2CY0A 4EZBA 3FB4A 1QNLA 5FWAA 4WY2A 4DBLE 1DDGA 1A71A 4G63A 4HNTA 1M5TA 3E6AA 3NOXA 3X2FA 3RNOA 1XKXA 2XMRA 4IIXA 2VBFA 1DO8A 1AGRA 2Y9MB 4UOZA 4CBVA 5LOVB 5EXXA 4YQFA 3UHPA 3PUIA 4PSVA 2ZB8A 1FS6A 4MUYA 4P33A 2EIXA 2AW3A 2PM8A 5LP1A 1XCPA 3KSZO 1A7UA 1R4NB 3AW9A 1Z4QA 5HZGA 1L2TA 3C3KA 3OTGA 3WBJA 2C1XA 1P17A 5DSZA 3WIVA 5EEGA 1GR0A 3D0RA 5I3ZA 3CLTD 4RH3A 1E1CB 1EM8A 1W88B 1U5BB 1CIJA 1T9ZA 3KFLA 1TQ2A 3MCTA 4TZTA 1PD0A 2Z95A 4MRMA 2PLAA 3U16A 3RRNA 2X5JO 3K71B 3BXOA 3S8EA 221PA 5AHXA 2I34A 2VJOA 4YECA 3LM8A 4Z4HA 5LQUA 4K9OA 4GR5A 3S5UA 3E1GA 5HYVA 1DQRA 2FU5C 2RGAA 5KDDA 3HJTA 5KPJA 3KG2A 4NXMB 1YXMA 3UWPA 4RE5A 4BV9A 2HLHA 2AKYA 5CK4A 2OBFA 4YT4A 1TTPB 3PYMA 1XVTA 4BL5A 4OHVA 3FAZA 1T3TA 1HR0B 3CIFA 3CS3A 1FFBA 3T54A 2BAGA 4BCDA 1WCIB 2BV3A 2QZ9A 2BE9A 3B1WA 3PEFA 3U3XA 3W9SA 2BFEB 2ZJ3A 1OGJA 2CLFB 2AX3A 3VSDA 4O02B 5DM4A 2ZE5A 3MTDA 4FMDF 1E3JA 4XB6B 4BFCA 3IAS1 3F5DA 5G3YA 3WIDA 3GJ4A 1OLXB 2OECA 1ST3A 5L3VA 1YVDA 2PSJA 4XGIA 2XV1A 2EKDA 2B8EA 2C2WA 1VI5A 1ZC4A 1RWWA 2VH2A 4JAVC 2RGCA 1GZUA 1T1IA 1XQYA 3KLBA 3QBVA 2WUEA 1Z47A 4JQCA 5EMHA 1U63A 2Y4NA 1P4RA 4WFQA 2H52A 4RGBA 3GJ7A 1QH1A 4NZPA 1EP9A 3CR7A 3KQQA 1GFZA 1JTEA 1HDCA 3AGPA 3ZVNA 3ZDBA 3AESA 2Q1SA 2V7TA 3KZOA 4AZ0B 3CN9A 3TZCA 2XGGA 4BNZA 2D74A 1Q0ZA 1ZAKA 3LX5A 4YRDA 2B99A 1EXVA 1YT5A 4CDNA 1V4VA 2QRHA 2W6ZA 2MMCA 3E9QA 4W1SA 3PITA 3D4NA 3RAGA 3GDGA 3U09A 1Y8ZA 1VB3A 3NWOA 4D4JA 4YMGA 1I3NA 3OZUA 3V1YA 2DPYA 2I6TA 3EULA 3X1YA 4C0AC 3IDZA 4GR4A 4M87A 4URXR 3JVIA 2NZVG 3HHPA 2A86A 4RSMA 4LOJA 4G5RA 3V34A 2CUNA 5COBA 1IPEA 1LVHA 3CRW1 3CZMA 4Y8VA 1XDBA 4LXYA 2X6QA 2E4YA 1BA2A 3E0XA 3GPCA 1TZ2A 2AMFA 5A1JA 1Z8DA 4RFLA 4OHFA 3DFKA 3UJ8A 2WTBA 3K0FB 1X1CA 1JXMA 4HX5A 1ODFA 1MBZA 3FUTA 4CTKA 4HLUC 2I6QA 2GLUA 3DMHA 5HCNA 5AVRA 3U5TA 1JZQA 2MYUA 3BCRA 4MUJA 2OHHA 1NF9A 3BK2A 2H00A 1IBLB 4NU0A 1JKJB 1D04A 2D5CA 2XF2A 3ILSA 4I1UA 4YRBA 2C42A 3R3VA 1P2SA 3A26A 3AVWA 2ZKIA 4R2KA 1L5YA 3W2HA 4GWLA 4DB4A 3UCEA 2QTRA 1PHPA 1G5TA 1QFXA 2OYSA 3ZUPA 5A5DA 5JJCA 1MEOA 3HR7A 2DWPA 2DUNA 2VPQA 5EUMA 2Q4BA 3SOZA 2OVBA 1RRGA 5TT0A 1E5VA 2WE8A 4FS8A 3V9AA 4BWYA 3VTFA 5ALEA 1KAEA 3DE2X 4EH1A 4TZKA 3KQMA 1TPZA 2C4TA 1RP7A 2X6RA 4FQ8A 4LEIA 3HVKA 2P6MA 1KETA 1VJ0A 1H1TA 2GZDA 1JJBA 1ZXLA 2WW8A 3H9UA 4FLFA 3LYHA 2QE6A 4GQIA 4RMIA 2GBLA 1M0EA 3MMSA 3MS4A 4TYMA 4CMIA 1X42A 1XYVA 2GXQA 1EA7A 4OHMA 2UDPA 2OV1A 4RZIA 4DM3A 4E5UA 1F06A 2FQXA 2WR8A 4ZZ1A 2X9QA 2D5IA 2ZWAA 2ATVA 1GPYA 3QE2A 3LDHA 1N9ZA 1XZPA 2VJQA 3MLBA 4UEWA 2UXCB 3B6ZA 2IX9A 3ZKWA 2HIAA 4ZEWA 3IV9A 3GJXC 1IEXA 4NULA 3QHAA 1FPQA 4BX2A 4OHOA 4UHCA 3NOOA 5EP4A 4ENVA 5AVJA 1T2UA 5MFPA 3VAZA 4HNVA 4YMLA 2XOKA 3F3SA 5JI2E 1MX9A 5L7TA 1VPTA 4NYMR 2OKGA 1Z8NA 2BGMA 5B1HA 2Z5LA 4BLQA 2ERXA 3K7EA 1SZPA 2XAUA 2E7ZA 1VL1A 3HM9A 1NOJA 3LP6A 1XRLA 5J2TF 1I9CA 3EG9A 4EB3A 2IRWA 1CSEE 3LAWA 3STVA 4IYRA 1J09A 1P0PA 1F8FA 4RS3A 3T0FA 1AN9A 1LVUA 3U48A 4E31A 2YJZA 3HXKA 4F71A 1D09A 1PG2A 1YJQA 1IWBB 3COZA 1Z0JA 1CUDA 1V16A 5EWMB 2B1JA 2JVKA 2CDCA 4J76A 1FXWF 3FHTA 5IVDA 4YO7A 3WQRA 4L3WA 2DG2A 2W90A 4N5MA 4F72A 2HSZA 2ZANA 3BIXA 2O5CA 4LJ9A 1RRVA 2ZJ1A 3N07A 1VHDA 1YR7A 3OCCA 3JQPA 3PT9A 2WHRA 3OFND 4YGXB 1JNYA 4JT9A 2ZITA 1FOEB 2XXJA 3CZRA 4NFHA 1F7VA 1R16A 1RS0A 2VSFA 3MILA 1WCYA 4KAXA 2NADA 3SJZA 4GH5A 4ER6A 5JSZA 3E05A 2IU3A 4DWWA 2B78A 3OZCA 4WBXC 5FR2A 2REQB 4WBNF 4W5RA 2JCVA 2JGIA 5DHTA 3M1YA 2UUBB 3IL2A 4XWGA 2FZGA 5G0VA 3NWPA 2WUGA 4FYPA 2D4AA 1VBFA 1D4OA 2FZEA 3V42A 2CC2A 5BV2P 1Z0KA 2JI8A 3T5AA 2W42A 3GFBA 3OLYA 1B0AA 1UUFA 1ZWKA 2QYHA 3HDTA 4XRRA 2P9CA 5GPBA 2NU7B 4RKWA 5CEFA 1QNFA 4CKEA 4QBIA 3WV5A 3L6UA 2AXEA 1CIVA 1NW6A 2PSEA 1GZ7A 1U3UA 4C01A 1KU6A 1FXSA 2JEOA 1CV2A 5IARA 4PZPA 1CFJA 4Q1DA 5DTEA 2V9CA 1B23P 4YGYA 1HYGA 4O4IB 3K1AA 4RQTA 1M2JA 1XMXA 1SY7A 1N2CA 2XHZA 1A5SB 1K1EA 1KPIA 2Y0PA 2ZULA 4DIEA 5KUTA 4MIKA 3U31A 2OCIA 2B2XA 3BKWA 4HQ0A 5E1MA 1AOXA 4MVJA 2P67A 5DNWA 2XX3A 2JGFA 5JAIA 4CKEB 3KSDO 2CCGA 2A4KA 4TS9A 2ZIVB 5IEBA 1H93A 3EGXB 3OEYA 4DC1A 1Y4SA 5DGHA 1HYQA 1N5JA 1SVSA 2EFEB 1FUUA 3EIQA 5EFOA 3SZRA 4AO6A 1PQWA 1YBAA 4BO0A 4JOCA 4RVHA 4UD2A 3A4YA 4ZIRB 5CA1F 3KVRA 2G77B 1ECJA 1GQSA 1W75A 3KAPA 5C51B 3PWKA 2POCA 5F1PA 2IBSA 1A50B 1YB1A 3UA4A 4NBRA 2CYBA 2HF9A 3NJ8A 3TRHA 3ANNA 1DBPA 2EJVA 2UUPA 3AGQA 4YVFA 3WYEA 2WZDA 2PJDA 4E46A 3PGLA 4Y0AA 5DI3A 2BFFA 3OH8A 5I6DA 5K3AA 4P4SA 1HG1A 3JASB 3U4GA 2REBA 4IHJF 1L5NA 1RWPA 2AC7A 3OQOA 1G8JA 2WU0A 2X3YA 3JYLA 4DN6A 1D5CA 1GLVA 1R4ZA 3NAZA 3OJFA 1C0KA 3Q85A 2IEIA 2ZIXB 4EO4A 3EJWA 3MLAA 5I7RA 1NJFA 5T67A 1IZZA 4JLVA 2ABWA 4TKMA 1D5WA 1V16B 2XGSA 1IM2A 3DZGA 2VDQB 4ZPJA 4MIEA 1VECA 1FRZA 2IXTA 3EGVA 3H0CA 3G23A 1T34A 2A1TS 2IW1A 4MA5A 3AB8A 2W93A 3KWFA 1SUEA 4CTMA 4PZEA 3V8MA 1KZ9A 1NDUA 4C0QC 2I6GA 4RJKA 5FLYA 3WB1A 3GZNA 3KAQA 4B32A 3U17A 2I62A 1SOWA 3PR3A 1JIUA 3KEOA 2IY7A 4AZVA 3UJPA 1S4QA 4LIPD 5HKAA 5FWYB 3ZDEA 1DJLA 1G1MA 6YASA 1XZAA 4W5JA 1K0FA 1X13A 1XCBA 3MQ2A 2Z8ZA 3NBMA 5CNIA 2OBYA 4DJEC 4AJ9A 1TJ4A 2PWAA 1XX6A 2A14A 2OYRA 1JA9A 2HF8A 2QM7A 3BWYA 1TKBA 3PC4A 3AFMA 4F46A 2DVMA 4EB8A 4BYGA 1AG9A 3NDBB 4WDRA 4MCHA 4UZSA 3T9AA 1TJPB 2O2JA 4JC8A 4X5OA 4EG3A 3T1YB 4FFWA 3D3NA 1M2FA 4PVDA 3Q8MA 2C8KA 1RYZA 5CVDA 1M7GA 1XQWA 5B58T 3TBKA 1EE9A 4RABA 2XKBA 3X43A 1CJMA 1NRXA 4NBVA 1BFUA 1VCNA 2C0QA 4HGNA 3UT6A 1XZFA 3G5UA 1I0ZA 1YZQA 1DAFA 2AR9A 1C7IA 2BMEA 2ZUDA 5AFSA 1IDOA 2P9TA 3QX7A 3W6UA 2YVLA 3V4PB 2ZVDA 4ZYLA 1E79A 3DTTA 2ONJA 4S2UA 3CGGA 1R6DA 4RGYA 3RSZA 5F9FA 4QGFA 2ZDQA 3AVOA 4NOMA 3TR6A 1W35A 4JZKA 4AJOA 2YN4A 3QP9A 4H9GA 3IAHA 3V46A 3C5WP 3LS2A 1JJVA 4U0JA 5DI9A 3UBTA 4JI4B 2ZRPA 4ZO7A 1WABA 3VOBA 1P39A 3W9UA 4B44A 2ANBA 3SYNA 2R4TA 2H8GA 2R2AA 3TMKA 7MHTA 3SVTA 4KLRA 1U1EA 3RBAA 3E18A 4CM6A 4WXEA 2OHOA 2QTGA 1F0NA 3P45A 5I9SA 3OBBA 4DSTA 1PFKA 1Y6FA 4YI5A 3NHYA 2EG9A 4RORA 5LA6F 2ISSD 1SVKA 2VA9A 3ANLA 3IQHX 4ZVOA 5BN4B 1L5GB 3U4AA 4IWXA 2B94A 1GU0A 3MWDB 4HB4A 4XYBA 2A5LA 3EXIA 1E89A 2ZB3A 3CZPA 1T8PA 3A3KA 4U7TB 2XB4A 3I2FA 2P6UA 4JLKA 4ASUD 5A2GA 13PKA 2W6QA 4O2BB 1OKKD 1EM6A 3VU0A 1JR4A 2JRLA 4KXNA 3LLSA 1YUNA 5D01A 1XROA 3PJRA 2DLDA 3GRUA 4PSKA 3L8CA 1WNFA 1E64A 1N5IA 4KQJA 3OOEA 4TYNA 1ZCFA 3IQEA 4XOUA 2ENWA 4KLCA 1KI3A 5H68A 1ZVKA 2GJAA 4PLTA 2DQSA 4D3ZA 1NX9A 1L5WA 3QHPA 3G3EA 1LKZA 4ZDJA 3EDCA 4X64B 5IG2A 2H7CA 4R41A 1O7JA 3DEKA 4BVHA 1KP9A 3ML1A 5FLXA 1BMFA 1BW9A 2HREA 5KOJA 4LWZA 4B80A 1CUZA 5J2TA 3NANA 3JALB 5E7JA 4CL2A 3C8ZA 1FQJA 1Y80A 2PQMA 2XDYA 3EQ9A 4ARIA 4HGYA 3ZXYA 3A6FA 1EFRD 3GRPA 2OLEA 3KJEA 2JIDA 4A0GA 1UAGA 3LNTA 2NO9A 4ARUA 4JT2A 3FYUB 2C4VA 4L5YA 1ODCA 3UH0A 3T3MB 1U8EA 3RRXA 2Q7DA 1TJYA 1RWOA 3R44A 1QG6A 5FWXB 2NYUA 5GWXA 3IQIX 2QVLA 1MJGM 1R2QA 2ZYDA 1EUCA 1PQUA 1OA0A 1AZWA 2BR4A 3FETA 4M1MA 3TLAA 2PH7A 4BVBA 4GC9A 3TL3A 5I9IA 4O3MA 3PYXA 1POXA 4C7VA 3A6HA 3NIDB 3T0IA 4ZZ2A 2NTJA 1VLQA 5JHGB 1XD8A 4MVJP 4ZGWA 3HVRA 1OZAA 4Q4JB 3QNUA 5C1IA 1F6DA 4BGUA 4D9FA 4IDHA 3H5AA 1KWGA 1XTPA 5FNVB 4X3PA 1QYVA 4BMVA 1HH4A 3HS3A 2O19A 1JUDA 4OUDB 3K35A 3HCRA 2QN8A 4ND4A 3H9JA 3TZHA 3WV4A 1ZUD1 1K9SA 2X0DA 5AM3A 3D6HA 2PA3A 2RAUA 5I9TA 1GNSA 3NBXX 1REQA 1BQ4A 1Y5NA 2GCGA 2PCJA 4OJMX 1M6EX 1KGDA 4LTNA 4L73A 4M60A 4AROA 5JSYA 4LWOA 2GAOA 2C7RA 1C9MA 1KH1A 2C3UA 3FSJX 4G86A 5AW0A 3K31A 4C7OB 2FJ0A 1AQYA 5DULA 1JYFA 3A9TA 2E4VA 2YZNA 4DXDA 4TT3D 3ENKA 1T2NA 1Q84A 3BVPA 3F47A 2Z0MA 4DMGA 5I8WA 2PUVA 3QKWA 2PX4A 2CBXA 4C1NA 3OQBA 3QRWA 3WFZA 1ZMBA 3WADA 4WECA 5FTLA 1V26A 2ZBDA 4JFAA 4NAVA 2JL1A 2IIQA 1YMVA 3C5VA 3C8MA 1S2LA 3PYLA 1CY2A 4OI4A 4EENA 4HTFB 1TJ3A 1U1GA 1E3LA 2FW6A 1I01A 1XZGA 3DTVB 4GE0A 3ZCUA 4TLDA 1M8GA 2VS1A 1ICIA 2FB9A 4OXKA 5LMCA 3SIWA 3UM9A 1K2VN 4L5BA 3RFVA 5K4HA 1NC1A 2J67A 5CT9A 3FF4A 5L7WA 3DL7A 5EERA 4A23A 3CNNA 4KGDA 1G4AE 2XZDA 3KAKA 2FX2A 4OBWA 1T5DX 1Z56C 2OHGA 4HXEB 4Q7KA 5F21A 4H7IA 4BMSA 2HRRA 4ROTA 3K0BA 2H6EA 2HU8A 3I6IA 2QN7A 4AJ1A 3FNQA 3LXUX 1WS6A 4H3KB 1W87A 3DEYX 1GKYA 3ZZNA 5BURA 4DR5B 4Y6PA 3F4KA 2NLOA 1JAIA 4GNKA 4I4IA 4RELA 3S2EA 1HZJA 4Q19A 4DF3A 3KEMA 3JD3A 2BI4A 1DKPA 3K32A 3EZGA 1YRQA 2AG6A 2BM9A 3OJLA 4GLFA 4INAA 3RRBA 4AMZA 3U62A 3QBDA 2G5CA 2J5RA 3KSRA 2A9QA 5BQPA 3T4PA 2V96A 5I7FA 5KSZA 1EFHA 4ZC1A 3CT6A 2I2WA 5KMGB 1CNFA 1R4AA 3K09C 4X1KA 1KI6A 2AJDA 3RSOA 1VM6A 2ISQA 4PAQA 4LOLA 2FPIB 3OAAD 2LR0A 2C07A 2R7MA 4L9SA 4WLOA 3JQFC 4GZMA 4AN1A 3HR4A 5JCJA 1B1CA 1NQOA 3TI7A 3QEOA 2WF8A 3TRKA 5A4IS 3DZBA 4OX9B 2BVNA 1P1JA 4N47A 3U7GA 4WDQA 2R11A 5C31A 2CZGA 5ALRA 2OBBA 3WP1B 4AMGA 1C8BA 3DA8A 1NN5A 1Q17A 3GIWA 5E6RB 1ML4A 5C8YF 5CCBA 1FW6A 3I83A 3WGKA 3JWGA 4D98A 2WTNA 1L8XA 1MABA 3V97A 3VZDA 2QAJA 1E3MA 2MOKA 3C5HA 3BWCA 3LQ2A 3I09A 3V6LA 1C7ZA 3I1YA 4RTKA 2DTEA 3L1IA 3MTQA 1H6DA 1RHQA 3TTSA 4C0SA 1V1RA 4AS1A 3ILVA 3DB1A 1B6RA 1N8NA 4OQNA 1CS4C 1KMHB 2ODQA 2Q6KA 4R9RA 5THXA 4MWSA 1BMQA 3SLKA 1Q6YA 5EPOA 1DO2A 1YL7A 1V25A 2BFFB 5IH3A 4GGOA 3RV3A 1EUDB 1JWBB 2C9CA 2O2EA 2OO5A 2D62A 4G1FA 1EWTA 1KDTA 3ZI0A 1RKUA 5K0ZA 2XB2A 3NZEA 4UQPA 4RETA 3BDVA 1K06A 3CLRD 2XNCA 5JCZA 2XWSA 1I14A 2XOKD 4DNQA 5TQJA 4AF6A 3T4EA 2DGDA 2E37A 1WF3A 1JTFA 1M7BA 1KZ6A 1WSWA 2J6HA 3EVGA 4B84A 1M2OA 2VBGA 3IJ5A 4KYVA 1J8VA 4UVIA 4F4DA 1Q16A 1X0VA 1V47A 3GNLA 1GUZA 2D5AA 1Y9EA 5G41A 4R8VA 5SY9A 3RNLA 2FNAA 3GH3A 4L3VA 5BWOA 1V41E 2GBCA 3C3PA 4HDOB 3BFPA 2HLNA 2DHQA 3MJTA 1KYWA 1V5EA 2Q4OA 1JDNA 1XP8A 4MI9A 4G0PA 1JHXA 5DX1A 4LRYA 2XNSA 2NOAA 3HJRA 1P45A 1AZSC 3B12A 3FPJA 4WMLA 1KFEB 4P7BA 3HUDA 2J85A 1L4KA 3HGQA 3JD1A 3P71T 4JA0A 5EJMA 4F4CA 5AM2A 2BSXA 2HOQA 5KQPA 2OCKA 1UOOA 1US8A 3BCUA 3NYQA 3GRRA 3PC8C 4GW3A 2GXAA 5CA0F 4K9RA 5TMPA 2NT3A 2G28A 1V5GA 3SJCA 4MX8A 2CJWB 3IE2A 2B3TA 4KQ1A 4BUCA 3ZBUA 4NCAA 5B55A 3FUVA 1AB6A 3D4PA 3NHUA 3CXRA 1LPPA 3DKKA 1VRCA 4OAQA 1Q2UA 2AUTA 2JIZD 3TS1A 4IVQA 3OTQA 2P69A 4LBWA 1M2GA 2A9OA 2GEUA 4OL0A 3NIBA 4RIFA 5IKXA 3BDIA 4IIJF 1Z18A 3EDRA 4RDIA 2WG2A 2I1WA 3I32A 4ZO9A 4O4JB 5B12A 3MQFA 2BGKA 2A33A 3LDGA 1A1SA 4OQDA 1QQAA 2OHXA 2WI8A 5ER9A 4BQEA 1VKNA 1AT1A 1U9ZA 2W2MA 4OXXA 3OWOA 3CB2A 1QXSA 1V37A 2PXAA 4UNNA 3SD7A 2HI0A 4XX1A 1ADYA 3QPUA 3FLMA 4PPYA 3NWEA 2JJ2D 3C87A 4BB5A 1PFYA 3JD2A 3SN6A 4QXPA 5E6RA 5ADWA 3IDQA 1ZG3A 2B1GA 1AA9A 1VLVA 3EEBA 2NXEA 3TEMA 5JFOA 4EECA 4J8PA 2WYVA 1VP9A 1YA8A 3LUBA 3FHLA 1KY5A 3JZDA 4H7FA 4PRZA 3N70A 2SKDA 3LH5A 1K6MA 2F2TA 4R7TA 5KWIA 2P35A 3DOHA 3FTQA 3FFBA 2GUGA 4Y0VA 5DGTA 3WYAA 3DHEA 3MSXA 5KNLA 2V9ZA 2XXBA 3B38A 1CJCA 3EARA 4JHLA 5LZ4A 4N8DA 5DN9A 4TMFA 3TLKA 1CY6A 1P8JA 3O82A 4MQMA 3KLOA 3PUYA 4LNAA 2I29A 4Q34A 4XSGA 4V0RA 1I33A 5T6MA 3IBFA 3G0OA 1EEXB 4RTRA 1QSGA 1NE7A 5HG0A 3MELA 3OQ6A 1P33A 4J91A 1ABEA 2PZBA 5AVKA 1ZISA 2IPXA 3I23A 3EXG1 4NMLA 2JLWA 1E6EA 1GCIA 3PEEA 4Z1MA 6CHYA 5KDOA 1OIVA 2EZUA 4AG3A 3U2QA 4GECA 1Y7LA 4CV2A 3DV0A 5HW0A 1TEHA 1MAWA 2YIDA 4ZD6A 5FTNA 3G0CA 4II3A 3KXKA 3BBPA 1BWPA 3L7MA 3G0GA 4OJKA 4TPKA 3GCXA 2BSQA 2YRXA 5EZ6B 1ULZA 1RM3A 5A05A 3T12A 4D9KA 3EFOA 3ROKA 3UK0A 4E5YA 1CUVA 3DEJA 4ONEA 3UXEA 4J3NA 4R71A 1SHJA 1UPXA 2EJBA 5F3WB 3TNJA 4YAKA 3BYZA 3LWNA 1HT0A 1X1AA 1GHTA 2IL1A 2IP2A 4XVQA 5C4MA 4OX9Y 1NA5A 5JSKA 3EXAA 5G40A 3X2EA 4D82A 4EHLA 1FS4A 5AOBA 2BW0A 5CLLA 1JI0A 3AUSA 3SZUA 3DD5A 4G0MA 4NCNA 2YYSA 1W4RA 2X5XA 3HGTA 2WAOA 2ZI7A 3PQ8A 3NYIA 3EISA 4LOAA 5CAEA 1U0BB 2QLBA 2INGX 3AM4A 1NY5A 1T1RA 5D3QA 2FPMA 4CMJA 3INYA 5I48A 3K2BA 1IJFA 5AHRA 4HT3B 3TQQA 1ZR2A 4MUAA 4PSAA 4JH0A 2QRJA 4WUTA 2IT1A 2ZRKA 4RM2A 1B74A 2HQSA 1WW3A 1AKWA 3IUQA 1E3EA 4G23A 2JAQA 4I55F 4H77A 4OXYA 4DCGA 4YV2A 4KHPB 3K0FA 5EG5A 1MA3A 4A4DA 5CHEA 1K6EA 5KNDH 2V65A 1ULBA 3KR2A 4E5VA 1K98A 1M2EA 4Q6WA 2GWHA 1NI4B 1B41A 1FPMA 3CCBA 3KOWA 4DNXA 1QH8B 4Q1CA 1IN6A 1W52X 1R10A 4L85A 3KTDA 4I5IA 3K5PA 1SKQA 1Z3IX 3II6X 4ETNA 2B7BA 3GLHB 1EWRA 1Z8HA 4DEXA 1EZ1A 2ONKA 4FJ1A 3KB2A 1KAQA 2EWVA 1HQKA 4AG5A 1EHIA 1Z83A 2X0IA 4DILA 3G2HA 1MB4A 1CUWA 1JILA 3CEHA 4JA2A 1X7ZA 3L1HA 4LJ8A 1Q0TA 2OG2A 4ZO4A 1T6BY 2VJMB 3CIOA 4UAUA 2CHQA 5CT4A 3R7WB 1X87A 5AHWA 1B2RA 2QMEA 1ORIA 1ADGA 1OV6A 3L5KA 1TFRA 4HDKA 2WE7A 5LWQA 4C7BA 2HSEA 4YCBA 1G21A 4ZC8A 2XF8A 4JXXA 4XKJA 4MVYA 3I9OA 1VB5A 4BX8A 1S2MA 1QS0A 2B8NA 3T5TA 3NTXA 3MB8A 3MNFA 2XYVA 4C1BA 1TUEA 3WI7A 1HLFA 1UL1X 1E20A 1X7WB 1Z7WA 2REXB 1NUHA 1DQSA 3L84A 2HQBA 4ZKDA 1OLOA 3IV7A 4DMKA 3ROEA 3C4VA 4D9MA 5LP6F 1CQIA 5EQJB 1HDXA 3PLAE 1ZP6A 2PO7A 2QD1A 3VR5H 1B0ZA 2KJQA 1Q12A 1XEAA 1FFDA 2L42A 5FOXA 2HHHB 1C30B 1JQDA 1IPFA 2ZP1A 5CEEA 4JGIA 3ORYA 2V0CA 2CHVA 4KODA 5KVCA 2QBYA 1MIHA 1MZVA 4KLNA 4U6SA 5TMEA 3HXPA 1QFYA 2HCJB 1KIAA 1QE5A 2YJ5A 5CLQA 3V7FA 5AI6A 1CD5A 1HBJA 2YW9A 3FF1A 1JDBC 2JI9A 3UHAA 1YZ3A 1L4EA 3H7IA 1I3LA 3OQNA 4LK2A 3HEBA 1D9XA 3BH7A 5COQA 4X6LA 2JIPA 1I3CA 1LC0A 1NOKA 4MH0R 1I24A 3I37X 9GPBA 4ED9A 4PYQA 3CNQS 2WB4A 1A3CA 1IIRA 2BRUC 5IUNC 5JCPA 1W581 3FW1A 1Z45A 1NHGA 4KE9A 1PDVA 4B3XA 4Z0TA 4IL5A 2V0GA 2OGSA 5B53A 4HNQA 5EIOA 2FLVA 3AY6A 4X20B 4XJSA 2VWGA 5IF9A 2WJYA 1DCKA 3TOCA 3C85A 3I9NA 5FPQA 3EWNA 3GLHA 1R4NA 2XWBF 4KFCA 1NNI1 1YF3A 3N8DA 3VV3A 4Y2PA 1UPFA 2DQZA 1XZ8A 1EJBA 5JMWA 2RD2A 2PGJA 1PL7A 2FY8A 3KQVA 4LA4A 1G3QA 3T3PB 5CBKA 3F8TA 4NX2A 5HHTA 1Q0SA 5EE5B 3SZOA 2I3DA 2VIIA 4GO1A 3BMCB 3BIWA 2P9EA 2VT6A 1Z5WA 5BR1A 4XJXA 4TYYA 3IVAA 3F6RA 4XM2A 1WDWB 4XWTA 1L7VC 4DCTA 1CZRA 3IDAA 3FXAA 1APBA 1VGRA 2IXGA 3I34X 5REQB 4PLWA 1R0BA 1XCMA 3FYUC 1BNCA 1H4QA 4A27A 4BRSA 3TIIA 1HEYA 3FTEA 2VTKA 3AVXA 2ECPA 3WDKA 1GZ5A 4KXFB 2GVZC 2O9JA 3JYPA 3R5HA 1UOEA 1XNGA 3ZHZA 1WV1A 1VE5A 2BGGA 2CLCX 2IHTA 4CF4A 2PA0A 4DMLA 2K4MA 2UZAA 3L8DA 3UG6A 4ENQA 5BNWA 5HDQA 4MYDA 3CJQA 3HLKA 1NZJA 1JEOA 3TSOA 5CIYA 2VTBA 3K9QO 1EEHA 1Z26A 4KDEA 1JDJA 2I6XA 2DY0A 1BGVA 4G0NA 1ZK2A 4BFZA 1F1BA 2I2DA 4CMEC 1JR2A 3ZVKA 4XLLA 1L7MA 2YWCA 2P0EA 4JJGA 3KC2A 4N6NA 2QU8A 3EVNA 4GPTA 3GWGA 4C0WA 5LIPA 1W0JD 1WD5A 2FVYA 1M6VB 3A4LA 4TSRA 4B7AA 4QDJA 3PX2A 3L7NA 4MR7A 3SC4A 4M1QA 2F1RA 3U7RA 1DTSA 2WHYA 2FMXA 2C4KA 2XCQA 3FVQA 3NEAA 4K2HA 4O4HF 4OQZA 4RA6A 2OB2A 2RHBA 3PFBA 4ZAFA 1RRPA 3NVAA 3T34A 4HAXA 4KH1A 4ZZ3A 2OK8A 2ZXEA 4YO8A 1SWVA 4RPIA 5IRCD 3Q2KA 5IT9A 3G85A 1PJLA 3HTXA 2JAPA 3BD7A 3N6XA 4HRXA 3NBZC 4HXGA 3ENZA 3ND6A 3UPUA 1L7PA 4RMGA 2Q0XA 1IG0A 5K6RA 5KYXA 2QF7A 1CP3A 1Q1EA 1L8OA 1NP3A 3AYXB 1EBUA 1QHIA 5ETJA 3GX1A 1XRJA 2QMUA 2WINI 3MGGA 3N1UA 4X94A 2W58A 4V1CA 1A9TA 2O0MA 3LY7A 3DE3X 1OYOA 3NBUA 4JJFA 3LWDA 1ZU4A 5BMVF 1VI2A 4GDFA 2I78A 5E7IA 2EBWA 4EG8A 2CGEA 3ADKA 5BSEA 1ECPA 4IHAA 3VQTA 3DFUA 5GGXA 4GLOA 4C2UA 4QU5A 1TCUA 2OAQ1 1E58A 1FVFA 2W6PA 5K3DA 1JQLB 1M2KA 1ZICA 4LXHA 2ZE7A 3AY3A 4XQ9A 1E2EA 1WA5A 3TM4A 4BJHB 4KYIB 4QHYA 3H2SA 5LYJF 1EP2B 2HPHA 5FPSA 2HR1A 2AQKA 1PV4A 3OFSA 5F1YA 2IC5A 3R0IA 1ES9A 4D9CA 2ZAMA 3BIJA 5J1TB 2HNKA 2BL4A 1YNSA 4LVUA 4XFJA 3KDAA 2PEYA 1JVSA 2CHFA 4XDGA 3WICA 1NVBA 4MHTA 1CEXA 1KYTA 2F7SA 2OFXA 3FY4A 2LBPA 3HCBA 1MNQA 3R0ZA 2JASA 5B1IA 1E2KA 1N4AA 4BTLA 2VP6A 2VYFA 2C84A 3QEMB 1JZTA 1W5SA 2MSEB 4CLOB 3RRYA 5JBQA 1JEJA 2FMFA 4I4TF 4M6WB 3ZJ4A 3UPTA 5J3JA 2RGWA 1VG8A 4EMUA 4UPEA 3QE9Y 4F5WA 1UBNA 2P4QA 3THYA 4D8WA 5DNAA 3LWZA 4ZMSA 2ZYHA 3L1KA 4YRIA 1XVUA 2X1VA 1NNUA 4HDSB 4RDHA 1FF9A 4L78A 2HM7A 1Z88A 1M1YA 2Q3EA 2Q62A 5I7HA 2W2LA 2WG0A 4GVPA 1QO9A 3CLTC 5ALXA 1X39A 2AJLI 1ZD4A 2Y92A 3FZEA 1TUBA 3CF6R 2QX8A 2GN1A 1Q83A 1EZ4A 3OLWA 4QZVA 4UATA 4PW0A 3THXB 2A5FA 1CP2A 4QPJC 2V6MA 4RD1A 3B6EA 3AV3A 4CI9A 2ZYSA 2JKYA 2AN9A 3CKYA 4G5OA 2F1JA 4L0MA 4PANA 3JXEA 1TA4A 4D43A 3GJSA 4DQDA 3TCKA 4KPUA 1PV1A 4FDUA 4I9NA 1T8SA 4ZRMA 4EA9A 1MZPA 4TMZA 2QVCA 1W6UA 3MT9A 2VDPB 4Y1RA 3K9NA 3FUXA 2CEKA 2O06A 3FROA 3GJTA 4LXIA 4FMCF 4QQRA 4AXBA 4DWOA 4EW1A 1EUZA 1HDGO 1I2MA 2XRZA 3NBYC 1QIEA 1N7GA 2Z2YA 3WYNA 3K0KA 1FUKA 3LLMA 1QMPA 1E1LA 4C4RA 4YMHA 5C4IA 4QGAA 1UINA 2HKIA 3FLAA 3D8TA 4M6WA 3H97A 3B89A 4B85A 3JQAA 3COPA 5D86A 4F93B 3QTLA 2L19A 2I7VA 2W0SA 4QFBA 3VBCA 4TV9A 1A8IA 1Q20A 4MK4A 2H0AA 3T7DA 2QUHA 2GJ4A 4JJ8A 2OV8A 3O8QA 4S35A 4LYDA 3MF4A 3T35A 3RVSA 4MVJI 4BHTA 1QQBA 1X94A 2YWHA 2JJYA 2P6PA 3ISJA 1LQTA 3NX4A 4AZ3A 1VKRA 3W6OA 5C8YB 4J9UE 4YXWA 2RAPA 3N0TA 1Y63A 4MPPA 3UAXA 2XZPA 2C7PA 3A2LA 5HOEA 3VGPA 3Q15C 4YASA 4RD0A 4OYRA 1FSPA 3QM1A 1PFUA 4M9SA 4AT1A 3QG1A 4KVFA 3PWZA 1R6UA 1YUMA 3LYUA 2X0JA 2ZTVA 2Z30A 1OGYA 1UODA 4Y1GA 1PJ8A 2X1HA 3B6KA 2VBCA 3SQDA 1XN1A 4ZCIA 4NPAA 2NV2B 3BHIA 1T1EA 3MXTA 4UVDA 4YWHA 1LBEA 2HTEA 3D3WB 2JEYA 3FKSD 2BFCA 4LHXA 5CVJA 3COYA 4D0GA 1E1YA 3NVMB 3KDPA 4JYAB 3DVAA 1V6AA 1KI6B 4NJOA 4M8NE 4K40A 2G4LA 1SCBA 2UUOA 4G07A 4IINA 2J4FA 1AKVA 3HCOA 3TSAA 3VDXA 3IEPA 2UZIR 2XE7A 5IT4A 3TTXA 1JG4A 4LMPA 4PXAA 3QHQA 1J8FA 4EYSA 4KIJA 3TD2A 2VJKA 2ZAIA 3L8GA 4IOJA 1CQPA 3GUCA 4JWTA 5DKFA 1G9TA 4B35A 2D7CA 1CS0B 4KO2S 4OAPA 5KOYA 3USZA 4MGHA 4I1PA 3LC1O 4XH9B 2PVSA 3D7MA 3DEFA 1HYBA 4CM7A 1L8AA 2AQIA 3QLTA 4Y9DA 4EEZA 4ILEA 1GPLA 4KACA 5DISB 4DA9A 3IH5A 3UJ6A 5JYDA 1XLUA 5JXHA 4D80A 3B3FA 2PT6A 2WU3A 2XYPA 3ZXSA 1Q11A 5FEUA 3KSUA 5CLGA 3GLFA 3RIMA 2E2WA 1ZKDA 2OXRA 2G8NA 4R1QA 5C7YA 3OIGA 4EL5A 3WL4A 5FA8A 1RI1A 3KELA 3KO8A 3P1JA 2UYCA 1G38A 4FUTA 2VDVE 4MLDA 1CUCA 2AE1A 3AF0A 1FTYA 1JVNA 2IXBA 4DYVA 1MQ8B 2NM0A 4KTVE 4U5XA 4C4PA 4C6SA 4CIAA 3H5WA 3UKJA 5AW4A 2CHEA 3NYWA 2P6NA 2YC2C 3PZRA 3QVTA 4U7FA 4UNSA 5KWEA 3CX8A 2J6IA 4UHJA 1ZK3A 4ZQEA 1FDTA 6REQB 3RS0A 4BO2A 1VLLA 3AQ4A 4JROA 4JI3B 3ZVMA 4KR7A 5DIZA 4L8GA 1T3ZA 3IPYA 4IDEA 3NMUF 1PWYE 3IIMA 3LGAA 4KN5A 4Q4HA 4RZSA 1AUXA 1I36A 2LDBA 2FGKA 2BMAA 3ADPA 1NBOA 1NXVA 1I3MA 4P08A 3PLRA 3SCZA 3U9SA 4HCJA 2WF7A 3DNMA 4J0KA 3FYDA 4MGIR 2ZLBA 3H5NA 1JPJA 1Q7BA 2FMKA 4FFOA 3QY0A 9ABPA 1U6KA 2EZ9A 4QPCA 1XD9A 1GIAA 1CZNA 2QVXX 2R65A 4LBZA 3CCFA 2J5KA 3P94A 3UMCA 3WE7A 2HU5A 1QLWA 4Q1BA 1N77A 4RZ2A 4EGJA 3VU9B 1Y3HA 4GVLA 2V1UA 3PNPA 3C3AA 3IKVA 1I2AA 1FBTA 2QUJA 3QU9A 4UNPA 2JC3A 5GV8A 1N92A 4ZCRA 5A5GA 3ABSB 1I2ZA 3SF8B 5IDVA 1ICEA 4N49A 2FX3A 3NIGB 1N5OX 1OLUA 4J43A 5EZSA 3TECE 4K0RA 3EF0A 2AZXA 1YR2A 5JNSA 5KKNB 1P8AA 3H5VA 4AULA 2O8DB 3NAQA 2XMCA 3FPHA 5AW8A 5IM5A 1O03A 2ID4A 5AJVB 1ISHA 1P61B 2OFWA 3B7PA 4ZQBA 3BXFA 1SQ5A 4P7JA 3G9UA 4TN1A 5A4KA 2OP0A 1DRUA 3CA8A 2RC5A 3O3MB 3K2EA 2UVPA 3B13B 3KJIA 4M7RA 3NORA 3LCCA 1S2DA 1AUOA 1X9GA 4QDKA 1QUFA 5AP9A 4UXJA 3QPWA 3UFXB 1A4XA 1D1PA 3JQ7A 4LSGA 1YI8A 4UM9B 4TLLB 3VZCA 2QR3A 3WZLA 3OX2A 3DMNA 1TL7C 4X41A 5AJUA 2Q5CA 2ONCA 1G6KA 2QW1A 1U3FA 3CH4B 3WAGA 1X3LA 3JR7A 5JNTA 2FWNA 2BZSA 1CDEA 3MTBA 4FZVA 2HUPA 5J63A 2OA0A 3SKVA 3SQMA 1E2BA 5FB3A 4GKVA 1XHLA 3CKMA 2PH3A 4CQMA 2ORWA 4YRNA 1WXHA 2VYNA 1JDZA 1JKFA 4LWQA 5DYTA 3ETLA 2V7EA 2VK2A 1COWD 2YJ4A 3N7AA 3RE1A 1H2YA 3IYLW 4C6RA 1UBMS 1Z75A 5AVXA 1I13A 1U7UA 2A5JA 5JRDS 4TVKA 1S4MA 1SHLA 2X41A 2FAXA 3I6ZA 3C39A 1NQUA 2JAHA 1OE0A 4MTCA 4NK4A 3FNRA 3O6VA 4QDTA 4QJBA 1T9GR 4HDKB 1VPVA 2IGTA 3WDMA 4B82A 2B7LA 2QP3A 1HTTA 2X1LA 4QGSA 3CWQA 1GDHA 2A0WA 4D4KA 3AEYA 1II8B 3IQFA 3BXEA 4QOJA 1CJBA 1H2ZA 5HE9A 2HSDA 2G9QA 4CMGA 4AZTA 4BDSA 3MT7A 2CMGA 2Y1GA 3R5TA 1UZMA 3HFRA 5K01A 5SV2A 1W8DA 2AT1A 2G6BA 1JU4A 4PY2A 4CDGA 3GPDG 4IEFB 4MZXA 1K7EB 3BD6A 1CNEA 3GLRA 4GBGA 1E9EA 2MHCA 4OH7A 2QT0A 4OHWA 1OJ7A 2OOKA 2R25B 1W34A 2DSNA 4ON9A 5BSGA 3R5SA 4IO0A 4H0NA 3D8UA 4HQLA 4PNPA 1NIPA 4DBVO 3B6JA 4GX2A 1EX9A 3TL2A 3GFOA 1WCXA 2RDMA 1RMYA 4I3HA 3IDSA 3PRKE 4HLUA 4HSGA 4F2WA 2Q6OA 2C92A 3OIYA 1NPYA 4C6TA 4F3YA 4KXLA 4YJGB 1B4DA 4IMIB 3WK8A 4RD2A 2RGNC 4QLOA 4QQNA 5B30A 1VGQA 2EZ8A 2OD7A 2WNHA 4XJTA 3RIEA 4CKBA 1E2UA 1J1IA 4RTSA 3AEXA 3CF4G 4U7GA 5A6SB 1ZH4A 3RANA 5JBNA 2G1UA 4CLHA 3NFYA 4DQKA 2EG5A 3PB3A 3PD0A 5K6AA 4CG3A 4GAEA 4R0VA 2ETVA 3ZK7A 3ZWVA 1XQ6A 4FGSA 4XAQA 1I51A 2XMZA 4ZZ0A 1H65A 2IOQA 2DKOA 3DBLA 4LGVA 3TBFA 1AO0A 5FOUA 4ZVMA 4QUDA 3TFQA 3KQTA 1PK8A 4A6DA 4DLUA 5C5DA 1XALA 1XWIA 5MGNA 3PP8A 4R7GA 3E5NA 5H1YA 3HDYA 4ENPA 5T3UA 1L7NA 3CLVA 4F8EA 2ZRJA 4L7VA 5D8DA 3QMVA 3SEAA 2C2MA 2SECE 3VXKA 4CM9D 2ERCA 2ZJBA 2BFBA 3B5JA 1U2PA 2OGUA 5EP2A 1QVZA 4HPJB 5CPBA 4ZCPA 3U6BA 2ORIA 3SAJA 4BBPA 3DLBA 2VYND 4RFSA 4QTYA 3EC2A 4ETMA 1O0SA 2V3VA 4HRYA 2Y99A 2W6NA 3O4VA 2MIIA 4ZI5A 3DAHA 1QHEA 1JHVA 2ORVA 1UBGA 4EHAA 4MJLA 1XZQA 4NFYA 4NZMA 1C3OA 4DUPA 1MGOA 5HUHA 3H16A 3UICA 4JBNA 1TZKA 2DUJA 1Q0UA 2I8AA 3U7HB 5FL7D 4QGHA 3ZC3A 1AS0A 5CW2A 4C76A 4X24A 2KI5A 2ZTMA 5I7EA 3W5HA 2IVFA 3N7TA 4AC9A 1ZGCA 3G0HA 3AWDA 2FPPA 3LHDA 4MW5A 2ACWA 3GC6A 3IESA 2R1TB 2WIFA 1Z0FA 3OE4A 4O6VA 4BGIA 4K87A 1LZLA 1VA4A 4K9MA 2NO7A 1OV4A 5BYJA 1ODLA 3D6VA 2NV0A 1VYUA 3ABRB 2P9BA 3PX3A 3H1TA 5FKJA 1GTMA 1Q21A 1YS9A 3AR4A 1FDRA 1VCHA 3K70B 3CX3A 4R05A 1KH3A 1YR9A 5DI3B 1RAIA 5LQSA 5AW7A 4W5TA 3IJRA 1DBVO 1HE4A 1KNXA 4OLJA 2OGWA 5IJ0A 1IE3A 3KHSA 3G0IA 3TCNA 2VDNB 4J0DA 3RR2A 3BWMA 2XXAB 2XUKA 3PUXA 3ASVA 4MCJA 3WSVA 2WSIA 2SKEA 3H6KA 4XUGB 3OZRA 5B2ZA 3L7JA 3IOBA 1Z7GA 5TGTA 4A03A 4AY5A 4EUHA 3TSYA 4ZIRA 3IXMA 2HCBA 3GLVA 4UBJA 2GASA 4CU2A 4Y9TA 4AECA 3AWIA 1NUAA 2PUTA 2WU1A 5K0NA 4I9UA 3NBQA 3WWDA 4RJ2A 4PAWA 4TXNA 5GZ1A 3GBVA 3OZGA 2D2EA 1JIXA 3EQ7A 5LB2A 3WSTA 4Y9SA 3TSZA 3MK31 1OLUB 5KI6A 4MOWA 5LP6B 1Y9JA 1WU7A 3SJUA 4EKYA 5A3QA 5CM8B 5JH7A 1IB6A 5CLHA 3PHJA 3CRMA 2GPSA 4F5EA 1JV2B 3TSWA 3Q5EA 1S2OA 2RHJA 1RPJA 2AC2A 3CKKA 3FPCA 4E13A 4P3NA 1GM5A 2Q3DA 4LXUA 4BMPB 4O2AF 4RTQA 1N36B 4HR7A 4ZVRA 1UPCA 3KYIB 3T1HB 2G07A 2PZKA 2Z8YA 5JH7B 2OCLA 3EAFA 1OPXA 1C9YA 3Q12A 3TK1A 4MITA 4R2LA 3K0SA 2IS2A 4MKXA 3IJEB 3IMGA 4IFEA 2DFDA 4PPNA 4KQ6A 2LW7A 2BFDB 3LPDA 3LVQE 1KMMA 2RGYA 1ZIOA 4LY6A 3K9HA 4MKFA 2C3MA 3CUUA 1G64A 4HJRA 5HMMA 5JHHB 4X62B 3RTCA 1X3SA 1DBIA 4LMAA 1U7XA 3OU7A 2ZUVA 1RXIA 3IURA 3P2EA 3ISTA 4PX2A 3QVVA 3SEFA 1I8TA 1RCTE 4KE7A 4LXXA 1CY7A 2HK7A 3KQPA 1GTL1 4F1JA 1X1TA 5E6UA 5CCEA 4E3WA 1TFUA 3PDCA 4ZMBA 4MQFA 3L6CA 3EZ2A 5DO9A 2AUMA 4OYYA 2KBEA 2NGRA 5C5EA 4GRIA 4K9SA 4KNVA 4PU0A 2MSCB 5EXDA 2XWQA 2W6ID 2OK7A 5DBOA 5LP6C 3VOSA 1YBVA 2ZBUA 4NBLA 4IXMA 1QIFA 2CLSA 2MCFA 4MRSA 3WG9A 1PR2A 3B2QA 3ZBQA 4GOXA 4D99A 1QH0A 2D8MA 2O4UX 2K7FA 3M5WA 2Z43A 4XD7D 1NW8A 1LRJA 5PNTA 1M2VB 5KTKA 1GYPA 3H2IA 3IS3A 3PFGA 1DFIA 3EVCA 2NZUG 3H4IA 3NHPA 3OUTA 3OCJA 4WVLA 3K53A 1IHXA 2E55A 5F7XA 1XEWX 1OXTA 1V8PA 2H2WA 3QJ5A 4CG1A 5EIXA 4B47A 1UWCA 1FSSA 2Z58A 4K28A 3GYGA 4Q3BA 1OAAA 1DOZA 1KAMA 1U28A 2LNDA 5CJJA 4Z3DA 4L3OA 2HWWA 3EDOA 1KEWA 1A7JA 1RZ3A 1TUIA 1Z4LA 2JFNA 3O4GA 3PVSA 4RWEA 3R7DA 3G2PA 4JZYA 2RBEA 1L8LA 3M4XA 4N01A 4TUYA 1J0CA 4V0SA 3O8NA 2WBLC 1UFVA 2OQIA 3D6TB 1H8ED 4GMFA 1E98A 3GRZA 1DKMA 3NTLA 3BWVA 3VNVA 4QEDA 1ILEA 5HS4A 4MVJH 1M6VA 3A9UA 4FFNA 4UM8B 3U80A 5JDIA 2J09A 4QQKA 1O57A 4LNUA 1GTJ1 4N65A 3TQCA 4N82A 3WGNA 1YU6A 4JP1A 1W96A 1WW8A 1DZIA 2XEXA 4PG6A 4OA5A 2J3EA 4G4IA 4ZEMA 2VTBB 2PS3A 4HNGA 1I1OA 1QB8A 2PCLA 2Y4OA 3JQAD 3MG9A 4J0FA 4JEUA 4L5CA 1XAHA 3IULA 2ONYA 1T2EA 1A9ZA 1GPJA 1KEEA 3HO8A 2D1TA 3GRFA 1GUBA 5E9QA 4ZVKA 3U4QB 4G0ZA 3X1XA 2AJ8A 1W0KD 2BGIA 2BEWA 3DW3X 2VEDA 2PKXA 1VCIA 2WMOB 2X7HA 1X8JA 6GPBA 1NR5A 3ECSA 1KFJB 1X1EA 5DDIP 4ML3A 4ZVVA 4OHYA 4XWAA 1XMQB 1WXEA 1L7XA 4FCCA 4BO1A 5JCOC 4NOKA 5BVHB 5EJ5A 3E84A 4TM8A 3RHSA 4DIMA 3O8QB 4HN2A 2HIMA 4DFDA 1J42A 1Y6ZA 2G25A 3QPCA 3KZVA 1D2AA 4I66A 2CYCA 4TV9B 3IFSA 1O2DA 4GOOD 4XVRA 4YFVA 4BVAA 5KOIA 5G1NA 3B1XA 3WLNA 2WZQA 3T1TA 1T4CA 1Y9ZA 3HNRA 2ZM5A 2B4YA 1J33A 2GSWA 3F7OA 5CK5A 1RLJA 3BMCA 4KQKA 3WLFA 4A0SA 4UTRA 3T7JA 4R2WA 4IHQA 1K97A 3DZFA 1KOLA 4MPTA 3A6DA 1RWMA 1F0PA 1NXTA 1G8KA 1GNQA 3ERCA 1P77A 3HBLA 1RPTA 1N7JA 1LPAB 2WICA 1NKVA 1LH0A 2WJHA 4GNRA 4GP9A 4OHZA 1MAVA 5KNBA 2HRQA 2GHTA 1E2PA 4ND8A 1DUSA 2PMKA 2XYRA 1G291 1XWFA 3W78A 4GOMD 3W05A 3A4TA 1HKUA 1DWPA 3C4QA 3DMRA 4O0MA 1OWPA 4ZVLA 1FDSA 4HNSA 1JHRA 4IO1A 4BFVA 1PP4A 4DKJA 4AJHA 5KNCA 1EK2A 3FBWA 2R7NA 3O8DA 4U7WA 1AUQA 1PO7A 4AY2A 1Y7PA 1XPOA 4QVGA 4UM9D 1XLTC 3B6IA 3OTWA 4EB6B 4I1IA 4LCJA 3N2KA 5DLPA 3S70A 1IHDA 1T6NA 2FUCA 3D8RA 3AESB 1QLJA 5I47A 2QORA 3ETEA 3S29A 1Z73A 5JQGA 1GAXA 4WZBB 4ALIA 3GUZA 2LCQA 4D9GA 1E7MA 5EQTA 3WYBA 2NQ2C 2XMQA 3V8RA 1QG4A 1XFAA 1NYRA 2AK3A 3P9KA 4NS1A 2XQFA 2C0PA 3D6NB 5D5HA 5EI5A 1QIJA 3T3EA 1IUOA 4Z7OB 2VHTA 4LSWA 4B3HA 1OU4A 2PZEA 1RE1A 1MB0A 2JFQA 3DBVO 4PLYA 5KHLB 3WKEA 4AUNA 1CQZA 1KYVA 1R37A 4RK7A 5FWDA 5HR5A 1FRVA 4BEWA 2F8MA 5HCIA 4U6NA 2WUDA 3P5SA 3QVSA 1MRZA 1ND6A 5DF1A 5AW6A 1EQ2A 5KTRA 1ISFA 1XRSB 2GXSA 3ZI7A 1KQFA 1NXPA 4Y6OA 3SC6A 2JDIA 4J9VA 2VJNA 1HLPA 3HADA 3T9BA 1H2RS 3JYNA 4C3VA 5MN6A 3HWWA 1E0AA 2WM2A 1L5ZA 1VG9B 3EPRA 4WCFA 4ZRNA 3UMYA 3B36A 2FP4A 3TDNA 5AJWA 4ZJZA 1T3SA 1JDUA 2VYQA 1CW2B 4I7EA 1U99A 1IXRC 4URHA 5LMZA 1T5LA 3ELUA 3GA7A 3ONFA 3VSEA 3DAYA 2JFVA 3OZIA 3FCSB 5KOJB 1JMKC 4DCVA 1QFSA 1U0GA 1TCBA 2Y1DA 2ZJ6A 1R6TA 3G9XA 1J49A 2A5DA 3MCAA 2PGDA 4JSTA 2XPCA 3AUUA 1ZM2A 2XUJA 3HFSA 1I1QB 5JTTA 5CB4B 3TGLA 5IAOA 4FLEA 4V1CB 3Q41A 2PH1A 4MJXA 3Q9NA 1JS1X 3CW9A 4Q16A 3J7AC 4MQLA 2PZ8A 3GFQA 4LW8A 5BT9A 1QGED 3QITA 4KE6A 3ZUGA 4ALMA 3FPEA 3Q8WA 4R6XA 5FUYA 5ALQA 2P9FA 3M5DA 3KZXA 1V11A 2CNOA 3P0JA 1ZAYA 3ZHOA 2ZR0A 4JMLA 5CNJA 1JXAA 2EKLA 1A04A 4DQXA 4KUEA 2VHCA 2IYQA 3TO5A 3RAFC 1FDVA 4N5DA 2MT9A 4RACA 1FYXA 3MN1A 3IDFA 1KMIY 4NOJA 4Z2YA 3MINA 5AI5A 3EGDB 2LDXA 3K16A 3T7SA 1C1YA 1GITA 2EARA 1ZKMA 1H3FA 3EFEA 2GM4A 1L1RA 5HZMA 4HEJA 1RMTA 4QHTA 1K8QA 2AR7A 5IU6A 4AG6A 2QJOA 4EWLA 4ZGGA 3PR1A 3D6MA 3MT0A 1WSBA 1UJ5A 3FHCB 4CKXA 2QTWB 4CGYA 2UYOA 4DC9A 3TBHA 4E2FA 2O3RA 2XY4A 3C7TA 4NI5A 1Q3TA 2WIKA 3CZ5A 4YEDA 5TS3A 3CEJA 3G02A 4WLNA 1YGPA 3CTPA 2P3LA 5BN5B 5KSPA 3ICEA 4QRDA 4KWEA 2D5LA 1I7SB 1X19A 4UEQA 2PGIA 2BUBA 3I5MA 4KDFA 2D1SA 3A6LA 4G1VA 5L3ZA 3VKHA 2A9RA 2C20A 3ABIA 1I2DA 3B85A 1JNXX 3O8BA 4FHEA 1MVLA 4PONA 3MD9A 2PBZA 2Q9AA 2ZATA 2I4LA 1GILA 1SXHA 2B82A 2X9LA 2ZBEA 3R3JA 5BR7A 3GLFB 3RLIA 2VYCA 4E14A 1RBQA 4N03A 4JN6B 2JI6A 2JJ2A 4JP5A 3WGYA 4HDNA 1ZFNA 4D45A 1XCOA 2O3JA 3UXHA 4FP9A 2OXTA 4YRMA 5KVAA 5FTMA 5JMTA 4EPXA 1U9YA 1U3VA 2ASVA 2NUTB 3S6JA 2OFOA 3GP5A 3GW8A 3AKEA 1HOXA 4QUBA 3VOAA 2JLYA 3RVRA 3TLXA 3VR4D 1POWA 2FETA 4TOIA 4EI9A 4CLEA 2IS6A 1IZ7A 2FCRA 3MWKA 1YZGA 2GPNA 3GLIA 3OWXA 1YIOA 3DPIA 5JD5A 3QVJA 3RTAA 5JZOA 2W6OA 2ZYVX 1GQYA 2CJXA 4L8LA 4RY9A 1O9BA 2ADOA 2JFOA 2AOTA 4J94A 2BPOA 4RKFA 2BKEA 1PLKA 3I6QA 3NHSA 4C87A 5D1NA 1N34B 3STWA 1J39A 2PTHA 3EXFA 4HHEA 2PUHA 5EZYB 2WDPA 2BELA 2R2GA 3I61A 4J4TA 1YTUA 5AD1A 5IBCA 2VQ3A 2J87A 3WJAA 3WISA 1VJ1A 4H31A 2YY5A 4DMMA 1PR6A 4M7WA 2IYEA 3GUVA 1DPGA 1HZZA 2BRUA 4XPZA 3ZK9A 5HKKA 1AHPA 4YBRA 3C6QA 2QN6A 3OVMA 3Q8KA 2VSNA 4PIPA 3WNCA 3D4IA 1FIUA 3PE3A 2P2LA 1IY9A 4ZV9A 4KR9A 4TZ6A 1VIYA 5KYWB 5DHRA 4NZOA 1QYCA 3WWOA 5I7UA 3ZD6A 3R3HA 1DJPA 3LPCA 2NO1A 1N5RA 1L7QA 4E6PA 1ISRA 2BM1A 1B8PA 1XIVA 2NNWB 1RI2A 2JFYA 5LYJB 3AHJA 4GFDA 3SICE 5AVWA 4D25A 4HZUA 3WGGA 4QQFA 2RBGA 4NK5A 4GI1A 1IL0A 4HB0A 3ZWWA 4K0KB 5EKTA 4GX5A 4WX2B 1H2HA 2QTZA 2JLUA 5CD1A 3SM3A 4I5DA 2CK3A 4NMXB 3FBTA 3LBYA 5IYZF 3I5YA 1CQIB 1RABA 2XVZA 1E69A 2I6FA 1NVDA 2IUUA 4QYSA 3KP1A 3P9SA 5GONF 5LZ2A 4EI8A 1PR3A 3WYFA 1T0HB 3RC3A 3C1TA 3BXXA 3OLZA 4JGGA 4Y1RB 3ZTTA 5ALZA 1N6LA 5DM2A 3BKXA 3AR5A 3I6MA 3QA9A 3P9IA 1C1XB 1FZQA 3E4CA 1T2VA 2ZRLA 3EA5A 4KPUB 3UZUA 5HZKA 1SHZA 3FRJA 6PFKA 4OK6A 1R5JA 2ZYWX 1NRJB 4Y6SA 3B51X 1JLSA 1BN7A 3MERA 4IDBA 1Y98A 4INJA 1CY0A 3KE8A 1BH6A 3N05A 4WHMA 4WPGA 4RA9A 4AI6A 1P4AA 3MWFA 2ODWA 1ZZGA 4JVNA 4G0WA 3ENNA 5G3ZA 5H9VA 5BWMA 4O29A 4UU8A 2D2IA 1VMIA 3W2FA 4FFBB 2AFHB 2PV0A 4D8UA 1ZUIA 2ZGVA 1U1CA 5GINE 1MW8X 3C48A 1P6XA 2QP9X 3A6GA 3HN7A 4F7DA 3ZIAA 4UBNA 2XGOA 4EHBA 1H85A 4EFDA 3KHKA 4QDUA 4W7SA 2AL7A 1JFTA 1KYZA 5F7ZA 2Q7XA 1FP1D 1SG6A 4PPFA 5AQ1A 3W2IA 1TM4E 2R86A 3KTFA 2Y68A 3ESQA 4XZ3A 2LP4Y 1ZBDA 4RS4A 3WDSA 4BFWA 1P91A 3L8MA 2PYZA 4F5DA 3DC7A 1ZEJA 4K46A 2J5BA 1H8EA 2GO7A 4LVOA 1OSNA 2PZFA 2WIBA 3H6HA 2DH6A 3ZE9A 1V1RB 2IEYA 4MWOA 1RLUA 1J7JA 4NENA 3LIPA 3TQFA 3C3CA 1AKUA 2ON6A 1SMKA 1Q1AA 1A8PA 1UP7A 2JZOA 2LZ0A 4OH1A 4YJFA 4EPRA 5IPFA 2VQEB 2CEAA 2Q1YA 2ZROA 3LL4A 1GL3A 3KQOA 3OZFA 4JITA 1GRNA 4IX9A 3X1MA 4KPYA 3QU2A 3DZIA 3NRBA 5GGYA 4F3CA 1QYWA 2A0YA 5ICEA 1E77A 3IHLA 1RKQA 4KYUA 1Z07A 5AK3A 3W3AA 4MR9A 4B3BA 4EY4A 4F85A 2Q5IA 3KLMX 3UMVA 1DUVG 2ACVA 2C1EA 1BYIA 2WA1A 3W8DA 3SIPA 4PNHA 4DGSA 4EPYA 1XA3A 3CNLA 3PQ4A 3G7SA 3LSYA 4N5LA 5CIWA 3UYKA 2Y1KA 4QEKA 2GPAA 4M0PA 5KREA 1D8AA 3PNLA 3UJNA 1GG5A 2GGSA 4WFJA 1XCJA 3ADOA 3ZK8A 1R6XA 2R9VA 5B5SA 1Q1ZA 3ES9A 2A3RA 3SZMA 3TW6A 4YB8A 2F8SA 3LZCA 4Q3DA 3I5AA 2ZSJA 5LQDA 4BFXA 1HEUA 3CTMA 3MOGA 3IMCA 2FPIA 1YHZA 2C29D 3JQQA 3N3BC 3OKAA 4M0LA 2J7PD 2JAUA 2IZZA 3IO5A 2J7KA 2WJVA 4M8KA 2FWAA 4O5AA 4C4SA 5TY0A 3ULKA 4AJPA 4LS3A 1U81A 5B3LA 2GVNA 1ODSA 2BUAA 2X4LA 3FMGA 4WY8A 2O7SA 1NI5A 2E6UX 3K2QA 1KU0A 4P4GA 3V1TC 4PVCA 1LLCA 1BJRE 2IUSA 2DWCA 3DV9A 2PVCA 4CVNA 1L5KA 1P3JA 5LL6P 1FSGA 2H2AA 2JW5A 2X42A 4DLNA 3PGJA 1CVIA 2VP4A 2PKYX 1SPBS 2R6GA 3G2MA 3KFXA 3KPYA 1HLDA 1MF7A 5TF0A 1U8ZA 5HILA 5JAHA 5CP8A 1QP4A 1CUAA 2P3SA 1Q7CA 3KFVA 5T3YA 2VHEA 4MR8A 1H0SA 4GQAA 4I46A 3WKAA 2W2KA 4BS9A 5FOQA 2IHVA 3CB4A 4WKGA 3ETGA 5EQDA 1QCYA 4B6RA 2OOSA 3ROZA 3N0RA 3REFA 5SZIA 1PJ3A 2DBRA 3UC5A 1DCFA 3F3KA 3R3UA 2FW0A 1CIPA 5DW0A 4KO3S 1GUFA 1MQAA 1IH8A 5FO1A 4UAVA 1T8WA 1GZDA 1GFWA 1AD2A 1RWBA 4ZEXA 4BP1A 1C3VA 5FPKA 3A4MA 4IHJB 2VDWA 2A59A 4OFZA 4B73A 4QOSA 4FEGA 2FUG6 1JDPA 5EJ9A 2O2YA 3HDHA 4UDYX 5LVAA 4FU0A 1EVZA 3UG7A 1LTKA 4JUCA 4I1RA 2X8LA 4OK5A 2VQFB 2J4CA 3O0DA 3LKDA 3TF5A 3ACCA 4KMOA 3LG2A 4G1MB 3SQOA 1YJ5A 2GR9A 2I7XA 3MINB 1U7WA 2W5UA 3DCNA 4I5EA 2GMWA 1K27A 5MF6A 1VIVA 5JD6A 5FP0A 2X2EA 2RHCA 2P9HA 1T9BA 5JS1A 2EKBA 1RW4A 3BTUA 1G6HA 4ITVA 1G2IA 3WGUA 3KSAC 3CVVA 1Q19A 4KTTE 3ZD7A 1PYGA 3SFZA 4M1EA 1J0DA 4A9AA 3MTEA 3L4BA 1E94E 1F14A 3P20A 1T8RA 4NDNE 4R9VA 3TE6A 3LCMA 3VJLA 1SU6A 1Z3CA 5DXAA 3RJ9A 4RXTA 2JGEA 3OOSA 4G0YA 3M1AA 2AB0A 2G83A 1F3LA 5FUMA 1C9NA 4M1WA 1KP3A 3OECA 1Z8FA 3RRJA 2UVDA 5AI4A 3H75A 3NTOA 3WRVA 2D7DA 1XU7A 1ZD2P 3M9XA 3GLQA 4HDRB 1TRHA 2WJWA 3ZV7A 2FPKA 3NEPX 4V0MA 2F17A 1L1FA 5G2OA 3AG5A 1QZXA 4IPTA 3GJQA 1JLMA 1LCIA 3VVCA 4EQZA 3ZVLA 5LXTF 1XA0A 3ZDQA 1CUSA 2H48A 5KVSA 2N1MA 4QJ3A 2H65A 2ZBPA 2OC9A 3GH1A 4CKWA 2PUGA 2BKUA 2HV9A 4IQFA 5FUWA 5JROA 1OQAA 2PV7A 5FWXA 2B3DA 2FP4B 4UAJA 5EIEA 5J4HA 1F17A 4JCOA 3ZDDA 3ORFA 4WCFB 2JFFA 1SU7A 1M1NA 4QOEA 4WKNA 3SSAA 4HUTA 4RUKA 5C8VA 1DIHA 5JPDA 2BP7A 4G5SA 4IGAA 4NFLA 1IOWA 3N0WA 4LGYA 4IFBA 4WEQA 5A4JA 8GPBA 4M2LA 4OCZA 4WW0A 1EFLA 4BTEA 1AHIA 2FLKA 2VDLB 2DAPA 3IOCA 3LL7A 4Q18A 4D42A 4E21A 2XGJA 2WYIA 3M70A 4YK7A 3UHJA 1PDWA 4L57A 2V5VA 5AR1A 4UFNA 4OJTA 2PNFA 3H6GA 4U2CA 3ZLJA 2E1PA 2HHCA 3IKLA 3DDHA 3EFHA 4MYRA 1TU4A 2Z9BA 1K8YB 2X77A 1IC6A 3TZQA 2XE8A 2R8BA 3DXYA 1P72A 3KKOA 3LCUA 4HVCA 1YZFA 1ZNXA 4BVLA 5JJBA 5AICA 2ZXUA 3AC0A 3NUQA 1CQWA 4D8TA 3ZZTA 1NYTA 3RVOA 4HVTA 1E0JA 3D7NA 1U0SY 1HE8B 2P27A 1WWKA 1Z13A 4JIGA 2B1RA 2ENUA 2JFZA 4UU0A 2J9FB 3JAWB 4NCKA 4CUZA 3UUWA 2J3MA 5CDGA 1ZU5A 5KDLA 3UBMA 4PHGA 1Z6YA 2ZRQA 2Z2JA 1TF7A 5TXGA 4B4UA 4H18A 1OFTA 4NZZA 1EB8A 1K0UA 1NW3A 4TN5A 4JKOA 3D2BA 1WXIA 2HMSA 4U2FA 4FLMA 1UK6A 4IR7A 3PS9A 4GI5A 3VSAA 3OQVA 2ZUFA 2PKWA 3NCHA 1AXEA 4R3NA 5F3RA 3QE4A 5AM4A 3HVIA 3OQPA 3IVXA 1BCRA 5H3CA 2JJMA 2XBMA 1Q2XA 1GTSA 3PXGA 4QBKA 3A4IA 2C2ZA 4RZ3A 1L6IA 3B2EA 1JKXA 4DY4A 3EXEB 5G4KA 4U9IS 1JHOA 5D3MB 2HJWA 1H2XA 3DE4X 3HCCA 3LUAA 3HUTA 1DBQA 4HJXA 4CIYA 1BWQA 3FSGD 4OREX 1DRVA 1YU9A 4UHKA 5H3LA 3WGIA 3K70C 1O77A 2WF5A 3WSWA 1DOAA 3PICA 2I3BA 3R5KA 5TC4A 4YR9A 5DM1A 1THGA 4D3FA 4JJ7A 5FV4A 3PGKA 3CO0S 2PZAA 3AUXA 3WA6A 1CLEA 1GFSA 3GT3A 4Q1FA 4HVAA 3O8LA 1P2TA 4WNAA 5LQAA 2A5YB 3I2GA 3MGKA 2XVAA 1RHMA 3ZE1B 3QMPA 3A9RA 2LIPA 3FNEA 4RX1A 3EEYA 1AUPA 1RLTA 4DL9A 5AVQA 4WD3A 4TS4A 4MWCA 3W6NA 1KJZA 4LSZA 2AFHE 3T7AA 1P2DA 5KZMB 2H7XA 2XKKA 1IN4A 4EIWA 4L8FA 5KWJA 2EHJA 2W4MA 4YMVA 5KNBH 1W19A 3NHWA 4OHRA 3GZNB 4IVPA 4MAFA 4J4BA 3PGXA 4FZJA 4XDHA 1T2DA 1MTZA 1J0BA 5J58A 2JIOA 3V1NA 3OA0A 4BPRA 1VJGA 3O5AA 4Q4CA 4YS6A 1KORA 2OHJA 3C41J 5CB4A 3DQPA 1NVGA 1CUIA 2CDNA 3A2KA 5F9MA 5HA5A 3TLMA 1JHUA 3TB6A 4E2ZA 4NQRA 4JL8A 1HM5A 3TPFA 4DIDA 2DFLA 2OAEA 2AYZA 4IDCA 4L4RA 2H63A 4PC2A 1GAQA 5ALKA 4DIKA 1R9GA 3B9PA 4GMKA 2I54A 4RMHA 4EDHA 1HRDA 1OKKA 2FX5A 3CBQA 1T6ZA 1HDIA 2HGZA 1DLIA 4HADA 2R47A 4OFWA 1DAKA 4UCWA 2CDRA 2OTCA 1M2VA 4G41A 3AU9A 4NHOA 3WGQA 4F45A 1LBIA 1NW4A 2PZJA 4KQEA 3UJDA 3C14C 4Q15A 3VO2A 5LZ8A 1DMRA 3L05A 5K20A 2V8OA 1R9MA 2GB4A 4OMDA 3T3IA 4PLCA 2PSSA 3T94A 3WS7A 1BO6A 2R4UA 3AVYA 2AD5A 5EKSA 4LMRA 3EBOA 4QYWA 1U5CA 2YH2A 3DOEA 2JH9A 4EHFA 4QT4A 1P4SA 3O91A 3U1VA 5L6MB 4FYKA 3UUEA 4Y6RA 5A7FA 1PX2A 1G60A 1ZL0A 2GBIA 2ZTHA 1RYEA 7GPBA 2UZ4A 1MTOA 4HUQA 5IP5A 4DCMA 1V7CA 2I6SA 4ZKEA 1G98A 4BP8A 5L51A 1E4YA 1E7SA 1NBWB 4AMBA 4MKHA 3LUJA 4ROSA 4OJQA 4OHCA 3IOYA 3DEIA 5DEOA 4L8YA 4TS3A 3H8JA 2B69A 4XD2A 3OEWA 1BWSA 1Y4AE 3UXMA 2CKMA 5KJ1A 1K7XB 2V58A 2IEBA 3A3PA 3DF7A 3GL9A 3ZWPA 3ZHUA 3L43A 1O0BA 2ZI4A 3K2IA 2XSZD 4V0OA 2Q5OA 3OPVA 5ES3A 2EDAA 5EYPB 5CYOA 5FO0A 1W47A 4PYOA 3TQSA 1CYEA 4O2BA 2AWNA 4YP7A 5EJFA 4QYIA 1BMFD 1FCJA 5DLEA 2JDID 4AX4A 2GPWA 5ESWA 3ZWCA 2YIJA 3NFRA 3GIDA 3OQIB 2Y1CA 2BE7A 4NLLA 3TW0A 5IZCA 2WTUA 3EXIB 3GDFA 3BAFA 1NNLA 5LJLA 1TD9A 1KI7A 3C3WA 3KS9A 2FDXA 3RSSA 2EKZA 1IMOA 1E79D 1Y7IA 5ER6A 2OXIA 3K0AA 3A31A 3GLHE 1W29A 3BMQA 2REQA 4IM7A 5DBIA 4ZYXA 4D3SA 1ZJJA 1KZ7B 1K68A 1PEKE 4FN4A 1EK6A 3HA7A 3AR7A 4F3NA 1KE1A 3MWEA 1T24A 2I7TA 4EQ6A 2P65A 4QBTA 2Q1UA 1JB9A 4URFA 2XUPA 1VHLA 5ENDA 4ZVNA 3S2SA 3TOVA 3CLUC 1OH6A 4GXNA 3EXHA 3MCVA 4RLHA 2QKYA 2W2KB 3SLRA 2DBQA 5F5NA 2P8SA 2CMFA 1SA0B 1N57A 1NF8A 2ATEA 1XVAA 3DXXA 1CDOA 1ZL2A 3HPRA 2VF7A 3KSBC 7REQA 4BMDA 4F6RB 4G0UA 3E2IA 2XUFA 4HLQB 2HTFA 2ZB7A 3U4CA 5G1OA 4M9CA 1IY2A 2C5HA 3G13A 1NASA 4MXDA 2D0DA 1E9VA 2MSLA 3PFCA 4UQOA 2VZ9A 4UPDA 5H83A 2ZJ4A 1MT3A 3ELDA 1II0A 2Z9DA 3TKAA 4EO9A 1JSZA 3T6KA 2Q8QA 1J21A 1X80A 2XNKA 1FP4A 2Y6VA 2PN1A 3OMLA 4DSUA 2O8EB 2B0JA 4UHFA 3A8TA 3COSA 4B48A 2CLHB 5EWMA 2RGXA 2ZBFA 4U4AA 2XZLA 1Q1BA 1HZZC 1PQPA 4JR0A 4LE1A 3DZDA 4LYGA 3KKLA 1DLJA 4LOKA 4N3BA 9LDTA 1YQEA 1GKLA 3COVA 4XUCA 4DG9A 4LNUB 3WA7A 3EIFA 1G20A 2HL6A 4EFKA 2B5WA 1NBAA 3EIOA 3DBRA 4L22A 4KH0A 4P3OA 3C5EA 4IDOA 3WB9A 4DRXB 4M99A 4WJKB 4KKVA 1OH7A 4YJ3A 2Z1NA 4BU0A 4LN1A 4MYTA 1SVUA 4BGVA 5LKRA 2GSDA 3GHYA 3RQIA 1NUUA 1RKVA 2J9YB 2N1BA 2D3TA 3A06A 3T9DA 2P62A 1KKMA 4PHHA 1EI9A 2QT9A 2VTDA 4GYYA 4EP1A 4WK2B 4XQ0A 2Z5VA 4HAUA 2RH8A 2UV8A 4H6XA 4F8JA 1TVKB 2YN2A 3P0FA 1PNOA 4W82A 1MFZA 3GG2A 4CUKA 5CGQB 4YJFB 3D02A 1R0SA 4R1NA 3UH1A 1M66A 1Z2PX 2X4GA 3EAGA 3RYCA 4DR7B 1A77A 2QD2A 4Z7NB 2BYTA 1BYUA 1GADO 3NRCA 4MW0A 3KETA 3PC6A 1FQKA 2IHBA 3D6AA 5K0FA 1BOOA 1XL0A 3A3OA 4RBNA 5KBYA 2ZJYA 5ALVA 1WMEA 4F5YA 3SVLA 1YJAA 2ADMA 2Y1FA 4JQYA 4JYBA 1SA0A 1F8UA 5K6AC 4ATNA 1BRTA 1SHTX 1ULHA 3DHYA 2R6ZA 4WLUA 4ZEOA 4XWOA 4ZVQA 5LWHA 1J2TA 1OOEA 3G2OA 2PPVA 5IDXA 1J1UA 1XPUA 4CTNA 2PX3A 2VVTA 2WAAA 2GX6A 3TPZA 3MWEB 1VP3A 1TMOA 2F3RA 1JXOA 2P79A 4DCSA 5BRJA 2AI1A 4B4OA 1H3NA 2Q3LA 3GV0A 3U3OA 2WIJA 3LQKA 3NI2A 1WZ2A 1THTA 4FTWA 4TMWA 4WOBA 3K0AB 1G5RA 2J8ZA 3PL5A 3OZDA 5IWAB 2M6SA 4FCTA 3EQ2A 3Q0EA 1US8B 2EF1A 3EB9A 1VE9A 2YWJA 3CW2A 4B46A 4I1SA 1ZXBA 4WA8A 3QUAA 4HRVA 4CL3A 2FSVA 5LOVF 4M46A 4UARA 4EZIA 1DTWA 3PPIA 3K9CA 2XNJA 2NYRA 1RCFA 1V5IA 4YQEA 3WL8A 1TAGA 3FOZA 1YA4A 1U6IA 3OM0A 1PN3A 4S1WA 2QDXA 5H02A 1PDOA 5DU2A 5TPZD 4M53A 4F86A 8ATCA 1TM5E 5KSYA 3PIRA 1U3TA 2VTEA 3FA2A 3PUWA 3QWIA 4BN4A 1U8TA 3OQ1A 5CNKA 2H4JA 2LUOA 2O23A 3EJ6A 3C5CA 3LPLA 4CM5A 4G4JA 4B4WA 2QR2A 3K9WA 1D07A 5CDYA 1ZRSA 5FWNA 3F9CA 3FWYA 4F91B 3C8HA 3DDUA 4YX9A 5BN1A 1EFTA 3A9SA 4HYEA 3PDUA 4HUQB 5B4UA 4FINA 2C5AA 3TRDA 621PA 3FUUA 4U9HS 3IBGA 5LXTB 3BOSA 3MUFA 2WKPA 1WP9A 5G0UA 5J9FA 2VHJA 1WTAA 2G70A 4WK0B 4XLTA 3IUYA 4B74A 4CG2A 4DA8A 3ZHXA 1OPRA 3RWBA 4IUDS 2R8ZA 2X0KA 4J29A 4CIXA 5BWCA 3KIPA 2EX4A 1JFLA 4LKRA 2QOEA 3RO7A 1EWYA 3FGPA 5CFZA 3KUUA 3HVHA 4HB2A 3R9KA 1AGNA 1PBTA 4NESA 4XTRA 1VTKA 1GT6A 2PX6A 2QXUA 3ZIAD 3N75A 2GCEA 4I4LA 4IIDA 1K8RA 1YZKA 2DPLA 2EERA 4ID9A 3SZ3A 5I8PA 3CVYA 3VPAA 1FNMA 3MWLA 1RCUA 1HT2E 3RU7A 1TRKA 2HEGA 1EGHA 1WCIA 3I0ZA 5AT1A 1XRQA 3PXXA 5A3VA 1D03A 4MRMB 1D2HA 3D31A 3E9EA 4A3SA 3AF6A 4H1HA 1K5GA 1MAHA 2CNNA 4B5KA 1JDBB 4X91A 1U5BA 4AFNA 4BNMA 4WNCA 4IRXA 4CM8A 5FPTA 4XWKA 1Y6RA 5FBWB 3DVSX 3TAXA 4CG0A 4RAOA 5SY6A 5I45A 4QYMA 3VYUB 2CHGA 3PQFA 4YUXA 2O5VA 5LDDC 2QTFA 3L0OA 4R8LA 1VPDA 2XOXA 3CSDA 3WGMA 4M9ZA 3D2AA 4MUNA 4DEYA 4Z9BA 5CX1A 3ZH9B 1QU2A 4TYPA 5IAGA 2EFHB 2X4IA 1XVLA 1L4GA 1UC8A 5IAKA 4H59A 1CR1A 1DS6A 2HAEA 3ODGA 1LB1B 1QYDA 4BB9A 5C3UA 1X7DA 5J4VA 3R77A 3CVXA 3OMWA 1OVMA 3KEFA 3NP9A 1NZDA 3VPSA 4EG6A 1AKNA 1QTRA 2QROA 4PG5A 1SZDA 3ESDA 1EKXA 1RI4A 2BFPA 1TZBA 1QU3A 3KYJB 5JNVA 3H13A 3N8NA 3WWCA 3A6PC 3PG5A 4I6JA 1IZYA 3LXXA 3F46A 3VPHA 4CFSA 4MQBA 2FW7A 4MW1A 3ET5A 1R3DA 1H1DA 2CVFA 4JB2A 5EJEA 3W4IA 1TF2A 4PFSA 4M1SA 1QG2A 1BHO1 2V7GA 3IUJA 4Q9NA 5KU1A 2DR3A 3DKRA 1UMBA 5IAJA 2BLNA 1GGEA 3EBPA 1YL6A 5BUCA 3S8YA 1UIMA 4QJIA 5KOHB 5D3MA 1THZA 2ZI5A 3IVRA 2DJIA 1N6OA 3FRIA 1BX1A 3EPJA 2CF6A 2VHWA 4F38A 2H2HA 4N9WA 4RXMA 4JOQA 2Z08A 1BSVA 3RYIB 1GXSA 5KVVA 2IYRA 3O8CA 2Q46A 4UNQA 3JD0A 1N6IA 2C3OA 3OY7A 2HNAA 5CUQA 1JXQA 2YX1A 1HNZB 1AA6A 4DADA 1UBHS 3D1JA 3I92A 4MYCA 3OA2A 4O1IA 2OZKA 5I9BA 2WWIA 2WFZA 4LDAA 3BB3A 3I30X 1J07A 4YCNA 3G7NA 4MEBA 3AIKA 1EUYA 1W4CA 1B43A 1N7IA 1RYHA 1CK4A 2ZREA 4QNRA 4LRQA 1WQ4A 2IU4A 2JFGA 1VFPA 3CFYA 2ZJ8A 4AF7A 3IKTA 1CDDA 2W71A 4E5NA 4JJZA 3Q8XB 2JNWA 1MD9A 4R9UC 1CZOA 4D97A 4RIEA 1AKEA 4PE5B 1DADA 3S7ZA 4DQVA 2O7RA 3FNHA 3D8HA 1NAIA 1TU3A 4KUHA 4Y6LA 5ALNA 1JPNA 3AF5A 5JC8A 8MHTA 1JH8A 5ALDA 3R4CA 3IP8A 1WV0A 3IAXA 4KXQA 2P77A 1JU9A 5CRIA 1OFVA 5CJ2A 4DTIA 2Q5FA 3AEUA 1SR8A 4KPGA 3GLTA 4B6PA 3BH6A