5LVAA

Crystal structure of thermophilic tryptophan halogenase (th-hal) enzyme from streptomycin violaceusniger.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
174
structure length
174
Chain Sequence
MKVLVLAFHPNMEQSVVNRAFADTLKDAPGITLRDLYQEYPDEAIDVEKEQKLCEEHDRIVFQFPLYWYSSPPLLKKWLDHVLLYGWAYGTNGTALRGKEFMVAVSAGAPEEAYQAGGSNHYAISELLRPFQATSNFIGTTYLPPYVFYQAGTAGKSELAEGATQYREHVLKSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H-FMN oxidoreductase
publication title Structure and biocatalytic scope of thermophilic flavin-dependent halogenase and flavin reductase enzymes.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 62
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5lvaA00
3FJOA 4QOEA 3OWHA 4NULA 3U7IA 4DILA 1TIKA 1VMEA 3KLBA 2OHJA 1SQSA 3HA2A 1X77A 2AMJA 3F6RA 1CZRA 5ULLA 3N3BC 5LLDA 1J9EA 2Q9UA 3EYWA 1AKQA 1QRDA 3GFSA 2V5VA 1YCFA 3ESZA 3ESYA 5LBUA 1T5BA 4LAFA 1D04A 4ZVKA 3NLLA 3LT5A 2B3DA 4FGLA 2XODA 2RG1A 1AG9A 2ARKA 1QBGA 3GFRA 2N1MA 4Y9UA 1AZLA 3ES9A 1BVYF 5FA6A 3OX3A 5FX2A 2W5UA 5JROA 1H66A 1RLJA 4PTYA 4QOFA 2Z9DA 4H2DA 4M0CA 1AKUA 4QOGA 4GR9A 1CZLA 1FVXA 4CETA 4BMOB 2MOKA 3HLYA 2QX8A 4C0WA 1QR2A 3G5MA 1FLNA 1T0IA 3S2YA 4ICIA 3OVMA 4HEQA 2QX4A 3SVLA 1I1OA 3OX2A 3UXEA 2M6RA 2FDXA 1ZX1A 4R81A 1FTGA 1SG0A 1AKVA 1XT6A 4FX2A 3F90A 3B6JA 3O2NA 4BMPB 4ESEA 3U7RA 3QFCA 1QHEA 1J8QA 2GSWA 1GG5A 3QFRA 3OJWA 1YOBA 4U7FA 1KBQA 2MWMA 5LJLA 5F51A 4N82A 1ZWLA 3NHKA 1F4PA 2M6SA 1XI2A 2V5UA 1BU5A 2FX2A 5LBTA 1YCHA 4Y9RA 2R97A 2FZVA 2V9CA 3P0RA 2BN4A 2HNAA 5LJIA 1CZUA 3N3AC 5A4KA 5EMNA 4PTZA 3W77A 1DXQA 5F4BA 4Y7CA 3GAMA 3K20A 1AHNA 3FNIA 1V4BA 2Z98A 4LTMA 3D7NA 1AKWA 3FVWA 4QOHA 1KBOA 1FX1A 1XYVA 1C7FA 1RLIA 4ZVMA 3W7AA 2F1OA 1ZWKA 4DY4A 3TE7A 2Z9CA 4LA4A 3FX2A 2WC1A 2R96A 4F8YA 4QODA 2X2PA 4QOJA 1CZNA 1RCFA 1B1CA 1WSWA 4N65A 1C7EA 2ZKIA 3B6IA 3JSXA 2OHIA 2X2OA 3ZHOA 2BZSA 5F12A 3R6WA 1CZKA 1J9ZA 2QMZA 2XOEA 2HNBA 3L9WA 4J8PA 2MTBA 4N9QA 5BUCA 1RTTA 2FLVA 3EDOA 3F2VA 4C76A 1AKRA 4ZVLA 1YCGA 3NHLA 3NHWA 4ZVNA 2FAXA 3K1YA 1OBVA 3GFQA 3UXHA 4YAUA 3TEMA 2FVXA 3KAPA 3B6MA 3NFRA 4C0XA 1D03A 4HS4A 4PU0A 1JA0A 4U7HA 1CZOA 2A5LA 4YAFA 3W79A 1J9GA 5NULA 4D02A 3NHSA 1AMOA 1FLAA 1DXOA 1FLVA 1AKTA 4LTNA 2OYSA 4S24A 4DIKA 1YRHA 3F6SA 5EA2A 3NHPA 5LVAA 1JA1A 3OJXA 3NHFA 4XDGA 2D5IA 1YDGA 1FUEA 5B3LA 4GQIA 1WSBA 4C14A 4U7GA 2BPOA 1YKGA 3O73A 2KQUA 4YALA 2QMYA 3OX1A 4YAOA 2HPVA 3KAQA 1CZHA 1OFVA 1DX9A 2FCRA 2QX6A 1FLDA 5TGZA 4NLLA 1XYYA 3HR4A 2KLBA 1D4AA 6NULA 1OBOA 2FOXA 3RPEA 2OHHA 2MT9A 4QOIA 3TZBA 3LCMA 2QX9A 3NHUA 3N39C 3QE2A 4FGKA 5LMCA 3NHYA 5FUQA 4YAWA 3KEGA 4FGJA 3L9XA 3FW1A 1H69A 4GI5A 3ESXA 3B6KA 3NHRA 1E5DA 4CF6A 4YQEA 3W78A 5EAIA 3OWXA 2QR2A 4H6PA 3NHJA 2Z9BA 1TLLA 4XDHA 2Q62A 2BMVA 5NLLA 4OXXA 1NNI1 5B3KA 2FZ5A 2BF4A 4LTDA 2QWXA
chains in the Genus database with same CATH superfamily
4JI5B 2UZ0A 1ML4A 1NFRA 1DT5A 2IHTA 3FJOA 4JQOA 1TTHA 5JD6A 1YOVB 4H6WA 3PTZA 3ZBUA 3GLIE 2ZPUA 1S7GA 2XMPA 4PPYA 1N78A 3SXJA 1ZJ6A 2W2LA 4CBVA 2AC2A 4E5YA 3KT6A 3R7DA 2IEIA 4RVFA 1LTHR 2YY6A 2ZUBA 4N3BA 1O5TA 1L5FA 3ZU2A 3LGSA 5D6OA 1U7HA 1SHKA 2WJIA 3NM5A 3ICQB 1CE8B 1Z4LA 4FDAA 1KKLA 1H9BA 2HQRA 2V6JA 1TVMA 1EDZA 3VR5A 2V9ZA 1KP9A 3I58A 3EWNA 3V2IA 3ENNA 2PZMA 2IDKA 5DKFA 2GXUA 4ZA2A 3IKMB 1VQ1A 2O06A 3UAZA 1XR3A 4MV1A 3O2QB 3PXXA 2QY6A 2OV8A 4I6EA 4BQOA 1CETA 3N2GA 1A2OA 3GOHA 4V0MA 4QIHA 3K0HA 1KI8A 1N2CB 1E64A 3PC3A 4P8RA 2W2TA 5FBLB 2G72A 3M4NA 1EDDA 3C6QA 2FSPA 3TOSA 1UF9A 5E95A 5A7GA 1OLXA 3UVEA 3P97A 2JBHA 5DDIP 3KJQA 4IBOA 3LPDA 3P52A 3NBYC 3K70C 2C8VA 1Y0BA 2ZRBA 4IWXA 1M7GA 1H65A 2OUKA 1L5HB 3FPEA 5AM0A 3Q0EA 2V4ZA 3LKDA 5FORA 4BUCA 1HYHA 5MHTA 1M2EA 2ZYSA 1K8QA 4XM1A 3HL0A 3L07A 3A37A 4CV0A 2WKWA 1C0LA 2GCIA 3H8VA 1ZUNA 3OM9A 3OQIB 4JXJA 4LJYA 3DZKA 4EW1A 4M9CA 5L95A 2Q3HA 3MWYW 3LZCA 4RY8A 2FSVC 1PFWA 3GRZA 3K0FA 5LYJF 2H8GA 4JP8A 5G41A 5DLQC 4HYEA 2RHDA 1U9ZA 4DN6A 1AG9A 1G18A 1C3XA 1VMKA 2C0QA 3CO0S 4ZDIA 4DA0A 1PJ2A 2XNSA 2O8VA 4OXIA 1BVYF 1GG9A 4Q4HA 1SXJB 5GZ6A 1DQRA 1WXQA 5EJ2A 1MTZA 3CNBA 4EZBA 4XSHA 5FTMA 1CQXA 4IXNA 1SELA 4PEVA 1HDEA 3JVUA 3OQOA 4CEIA 3CH5A 1KIAA 2OCYC 2W22A 2X5JO 5TVKA 1JG1A 5CCDA 5KQMA 3HMQA 3EIFA 3L49A 4D0NA 1G7TA 5EQTA 4CDMA 3W3AH 4MK4A 3EGEA 4F5DA 3MCTA 2BISA 4YASA 4FFRA 5HFJA 3WDMA 4A2CA 5KYTA 2WK1A 3QVGA 1F8GA 3PQ8A 1ZEMA 4RF2A 1Y82A 5C7YA 2XBMA 1W85A 2B8NA 1KO4A 4ZVTA 2YWCA 2C5SA 3VZDA 4HLCA 4Q02A 2WB2A 3S2FA 2OV2A 1Y7TA 4F5EA 2PVPA 3R23A 2X22A 1Z7WA 1ZUHA 4J1QA 3VKUA 2H4WA 4UE3S 5CB0A 4GR4A 1USWA 1YDWA 2EBHX 2NSJA 3GX1A 3QIVA 4PLZA 2ZIFA 3WADA 1BFUA 2ZIGA 3BB4A 4I66A 1PFYA 3TCNA 3EXG1 3GA5A 1V48A 4TS9A 2BT4A 3BZBA 4AT1A 3FFXA 4GL2A 2CVPA 1W96A 5EKSA 4BNJA 3WQBA 1NG1A 3R0JA 3VR6D 2CXSA 1L7MA 5KX5A 2YJ6A 2GF0A 4ZYUA 4R31A 2PX6A 1Y6ZA 1TTPB 2LW7A 1W46A 2I1LA 3UJHA 4EQ6B 2BEVB 1CULC 2DE0X 3T4UA 4C0WA 3RYCB 3SZGA 4W5NA 2ZRNA 3DDOA 1EFKA 4KYVA 1TE2A 1TD9A 1B8UA 2D06A 3BFPA 1AQLA 3OPNA 2NU9A 1M2HA 3RJ9A 4X8HA 1LDGA 3BWXA 4D9GA 2WKPA 1EVQA 3B70A 3S55A 1IY8A 1O87A 2ODQA 3QBJA 4JC0A 3STWA 5AVSA 2W8BA 1L6RA 1U0OC 4NX2A 2ZRCA 3SLGA 3WYNA 2CT8A 3TW6A 5BRAA 3K5PA 1FRVA 1VYTA 3LGAA 3PT5A 2IOFA 4KGZA 4LHXA 5F1KA 3A25A 3LLMA 4CLOA 3B5EA 3WK8A 2HGSA 3LS2A 3SS9X 3UV6A 1J8VA 4XCQA 3HN6A 2Y2VA 3BCHA 1ZJYA 3U26A 4BNZA 2B8EA 3AWIA 4LOHA 1V8BA 2GI4A 4E31A 4RK5A 5D7BA 4QKQA 1SULA 2D0IA 1GG5A 4HH4A 4IIVA 3U44B 2YN2A 2QZ9A 3G13A 3KTFA 2EW8A 3V8NA 4BV2A 2IEGA 5HWSA 2HTFA 1Y9ZA 1GYQA 3DAPA 2GZHA 1ZG3A 1UBEA 3B9RA 3LX8A 1CHDA 2XB6A 3LY9A 2X4GA 1KJNA 2FR1A 1XAIA 3DMNA 3QXCA 3TLYA 3VU8A 1E1MA 2ATIA 2ZRIA 4DCCA 2J3IA 4IICA 3PVZA 5BR1A 3COSA 3WFZA 1EVZA 3D3NA 1M0EA 2QUJA 3A1UA 3HJTA 4B8ZA 1YKFA 2F62A 2VWQA 5EKDA 1I33A 1XC7A 1H6DA 1QJCA 2JAUA 4GQBA 1TMYA 1ZXLA 1B2RA 4TLAA 4CL3A 4QVGA 4W6QA 3DZGA 3IB6A 3HFJA 3MLAA 4RPJA 4UVIA 5KWIA 4YJ2F 3A7EA 4N8DA 3FJ1A 2BFFB 4PAOA 5CLFA 4EFDA 1PJZA 1Z35A 2EYQA 4XVQA 5BN3B 2O8DB 2QUAA 3H5WA 1BXGB 4HDSA 1CY0A 4BFLA 1F9EA 4OPMA 4ILEA 4RZ3A 1POWA 2CB0A 3CLVA 1MO4A 1EWVA 2X77A 4MCHA 4ARUA 4ZODA 2VUSA 1KXZA 4ZAXA 5B37A 3AK4A 4G0PA 3O9VA 2OBNA 4G1EB 4KVZA 1RXSA 4CEJB 2OV4A 2HBRA 1W0KD 3E61A 3LX5A 1LDBA 3K0CA 3I73A 2LR0A 2GTHA 3DJFA 4A10A 5C18A 5FJIA 4AJ1A 2Q50A 4DIFA 1JECA 5IJ0B 3DTTA 2R00C 2PJUA 2H54A 3OPQA 3TIIA 2QMEA 3KRTA 1E4VA 2TYSB 3PGA1 4D46A 2P3LA 2O7RA 3E2MA 2ZT5A 2J9YB 4FOTA 4GRDA 1Q1NA 4QGHA 3NPAA 3UG7A 1HFEL 3MJHA 4GQAA 3VUEA 3ZX5A 2WU1A 4AZWA 1QQTA 1P2BA 2O8NA 1E8NA 1Q0QA 3RC3A 1P74A 4HZUB 5K0SA 5KPJA 1N36B 2CV1A 1EPUA 2EZ4A 2H4YA 1IIBA 3D5QA 1UT6A 2G06A 1G3MA 1ECJA 2B82A 4Y30A 5TY0A 1G0NA 3W2TA 5LZ2A 1IQRA 3ZGLA 3TQCA 3IAFA 1A8QA 4CKWB 2I3BA 4C3UA 4YBRA 2QHXA 1HMYA 1PX2A 3GI1A 2C98A 4OQMA 5LNK1 3PA6A 3IP1A 1E1QD 2XYVA 5BXYA 3L6DA 1JU4A 1LQTA 1HH4A 2ESRA 1W1WA 2CHEA 3CXUA 3W5SA 4QUEA 1OX5A 1XTKA 3IBYA 3TG8A 4CN9A 4WNIA 3K09C 1Y8QA 2R7AA 3F7MA 4Q18A 4ZYTA 1BZYA 1JDZA 4LYHA 4IL5A 1Q50A 3P2IA 5SZKB 2P69A 1DEXA 4J9VA 4A5SA 2GM4A 5KX5F 2A0KA 1UBNA 3IC5A 2WJYA 1VGVA 1XJCA 3B9QA 4MJ7A 5GPBA 3HKBB 1WB4A 5FTLA 2CZQA 1DLIA 1ZHFA 4LK3A 1NVKA 1CDZA 3K0BA 3GPIA 2OZLA 1L7EA 1SURA 3L40A 4C78A 3LW8A 3VHXA 2DULA 3CLRC 2IYEA 4IKOA 5EGNA 1C7EA 4AQYB 1TFUA 1UFRA 1C7QA 3DBRB 4G89A 4LRWA 3EVFA 5JAZA 1JYEA 2O54A 2XDWA 3MLEA 2B4YA 2QOEA 2X2OA 3E23A 3QE4A 4G0XA 4P3XA 4QDZA 1QDUA 3W5HA 1NUTA 1Z5GA 3FUCA 3ZHOA 4CKBB 4M7OA 2M9MA 2W2PA 2YMLA 4MZDA 2R8YA 4YCSA 4O63O 5THKA 3B78A 2BEKA 2NU6B 4GOJA 5CX1A 4F4UA 4ISCA 2HCTA 1G1MA 2WWIA 2Q5EA 1FMFA 5DU2A 1DIRA 1GUBA 3A6JA 2CZCA 4FBMA 3SI7A 1JG6A 1FBTA 4QTUB 3L4BA 1NI5A 1N9ZA 1NXXA 3A05A 2SKCA 2P9CA 1WAMA 3KJFA 3M5PA 4U2EA 3TLGA 4EFKA 3V4RA 3GWGA 4ZQFA 4XASA 1K27A 1G7SA 1SK8A 4IQFA 3LKBA 4Q21A 3ZTWA 4AMUA 1V1RB 3GNSA 3DD1A 3JWEA 1ZHOA 5DXAA 3RM3A 1XEXA 3F2VA 4NEHB 3C8HA 3OMXA 4UU7A 5ALWA 4WLOA 4ODIA 2WV7A 3JAKB 4TT3A 2EWWA 3RWBA 2BW0A 2QN2A 4EA9A 4BNNA 2B78A 3IVRA 4ZVLA 4UNRA 3SHWA 3ROFA 1O8BA 5T3UA 1G55A 2QTGA 4UVEA 5EJAA 3UMCA 4CTOA 5C3MA 2Z57A 3BGIA 3VC1A 3PR3A 1CJCA 4DPLA 2RGAA 3S2ZA 3FIUA 1E9FA 3FYSA 2ZBUA 1O1YA 3QLUC 3ANNA 1WBBA 1GZ3A 2EW1A 2OO7A 4JJ7A 2Q1UA 2Q3BA 1A0OA 3VO9A 3PL1A 2VTDA 3ROEA 4YAFA 1KVUA 1SVLA 1REQB 2HM7A 2AE1A 4L85A 4D9KA 2J59A 3H17A 5J4YA 1RKVA 4NTZA 1H0HA 4ND8A 5CJJA 5FYDA 3Q3JB 3EXHA 2ZJ0A 1H3EA 5CHEA 5KMGA 5E4JA 4RGYA 4DSTA 1NMYA 1EP2B 2Y1GA 3MQ2A 3BE5A 4DJEC 3ZXUB 1ZOOA 5ICFA 1LZLA 1OT3A 4L8GA 1W5BA 2JIOA 1E2BA 4M38A 4LTNA 4Z4IA 2BH2A 1IZ7A 2GHTA 4Z4HA 2VJQA 1JPNA 4RFVA 1MO5A 1YRHA 3AHGA 4TMFA 1B14A 2BFOA 3O21A 3R75A 3Q2IA 3KBOA 3EFOB 3FVRA 4MMZB 5EA2A 3UXYA 4YJDA 4KWIA 4I9GA 3HDQA 2OQIA 2EGHA 3PG5A 1JA1A 2N9UA 4NJOA 4O5OA 5FP0A 4IY1A 3BRWA 1GQRA 2XEDA 3VH3A 1JVBA 2IS2A 3UMRA 2ECQA 1WEHA 1GFIA 4RCYA 3WIEA 5J1TB 4HLDA 4N41A 1OKKD 3K8YA 4TVBA 1TQ8A 3L7KA 3DFFA 1M2VA 2GRJA 2FY8A 1ZRSA 4YFYA 1G8SA 2PRSA 5TPZA 4MW4A 1NVUQ 3VKGA 4Q37A 1KDZA 2PA3A 5ALYA 1F20A 1SC4A 1F38A 3OOEA 4KVGA 5J2UA 2R47A 4O4JB 4TUYB 3NOVA 3SPXA 1W6UA 3LBAA 2NQTA 2I2AA 3ONVA 4MROA 3CM0A 2C4KA 1UJBA 3GFPA 5B64A 2WWFA 4UHKA 1ZR4A 3EQ9A 4C4OA 3OQHA 1YKGA 3O73A 3E22A 3QVUA 3G85A 4HLQB 3TX2A 3V48A 1Z2EA 2G1UA 2QMYA 1CQJB 1PJQA 3PJDA 3M4XA 4FVTA 4QZVA 4QRHA 2YZNA 4M6WB 1T36A 3L41A 4OOEA 3GDGA 1GOTA 1V26A 2JA2A 3NIFB 4P5DA 1D1PA 1QC5A 2KYRA 5AM1A 3EF1A 4B8YA 3J80A 4YV2A 2DPXA 1TUBB 4RIFA 4UHHA 5DM70 1NUHA 4JKIA 1XGKA 1D8AA 5KI6A 4QUAA 2QM8A 5BQ5A 2WZDA 3ZWDA 4OHCA 2YWHA 2PKCA 2L17A 3ANLA 3DZHA 2C7VA 5LQDA 4INZA 2RDMA 1VG0B 5G53C 2ZB2A 1B4DA 3P9SA 5I48A 2HSJA 5IN4A 2JCYA 4RJKA 4FLMA 4Q3EA 1QRSA 2IIQA 3W3ZB 3TUJC 1NYRA 1X7ZA 4Y6OA 1KFJB 4J43A 3V8BA 4EHNA 1F2DA 4ZDKA 5CDSA 5DNAA 3PL5A 3EZ7A 1ZIDA 3CYFA 2D6FA 1S5PA 3D2AA 5JSKA 1N2BA 1T5HX 2WTAA 2I6TA 3R77A 1DZIA 1KI1A 3HCBA 1KEVA 2WQ7A 1Y6JA 1VLZA 3K70D 3K6JA 3HFRA 1K7CA 1G16A 1QMPA 1RT9A 4Q6BA 3UAYA 1S2MA 4PYOA 2VK2A 1NP7A 4RMJA 3D7RA 5AKEA 1EB9A 1LCIA 1KR5A 1A5ZA 3RVLA 1G6Q1 2ZYHA 1X7XB 3HJUA 1FDRA 4U8GA 3DYVA 4BX9A 2RGNC 4UTVA 3P2YA 2JBAA 3DEAA 2IYVA 2C7QA 2PH3A 1A4IA 3LUDA 1BWPA 4FUTA 4H6PA 1NBEA 3KL4A 3T7AA 3WYBA 4D9MA 5I4KA 3NATA 5CCXA 3CUSA 1H4QA 2UXDB 2PZKA 5K01A 1D5WA 2W7TA 4EARA 5TE9A 3JQ8B 5CAEA 1F17A 3R0VA 3TJMA 2IX3A 1W4CA 4OLJA 1UM8A 2QMHA 1THGA 1OAOA 2AN5A 3JAWB 4PC1A 2ET6A 1JHYA 4IDPA 1B6TA 3KWFA 4S0ZA 4DA9A 3VKHA 1ZUIA 2AJTA 4PVDA 4OYHA 4FBLA 1C30A 4PYNA 1A5TA 1O08A 3O38A 5KPDA 1G6HA 1MORA 2EQBA 4PLPA 4YYZA 1WMDA 2B7LA 3ESDA 2G9RA 3HY3A 2PZEA 1EQUA 4J0GA 2P5TB 1WMSA 3JATA 3HSKA 1DIAA 2ERCA 1L1EA 4LOJA 1AH2A 2KBEA 4FZRA 4TKUB 3QYFA 2LDBA 4GBMA 4JBGA 1KI6B 4BLTA 5J2TA 3AM3A 3AHFA 1SWVA 1LBSA 1QGYA 2R25B 4ZJZA 2DWCA 1CR1A 4HTFB 1E2DA 1RKQA 3I9NA 5IS2A 4H4DA 1TM3E 4D7AA 1X1TA 4RLQA 4D4GA 1RMQA 3F6EX 4O3FA 3MGKA 4RVOA 2D7DA 1EDBA 2VF7A 1V16B 2K5UA 3UJ7A 5A0TA 2WG1A 4D4JA 4G0ZA 2H5EA 1BA3A 2GLXA 2M1XA 1RXCA 1P72A 4KGDA 2IHVA 4XYBA 2C5EA 5C2JB 2WNHA 1X19A 3DKRA 2OZEA 1UK8A 3I39X 1I1QB 3M1AA 3NO4A 2VDVE 4NU0A 4GBED 3T4EA 3B1YA 3H2HA 4HDCA 2P79A 2FPPB 2WINI 1KKMA 2W8ZA 3MT8A 4HGRA 3LFTA 4IYRA 1VI2A 4IIEA 4XB2A 4HXYA 3VU0A 4EG6A 2DBRA 1GGFA 2X3UA 2DRIA 4LPKA 1CUYA 1J90A 4QE3A 3W05A 4PICA 3AGQA 1PWEA 4L73A 5I7SA 5CG1A 1DKLA 1TW3A 3LQQA 2XTJA 5DFAA 2XECA 4YMHA 1XZMA 5JI2E 4WJZA 2WHEA 3PDUA 5J2UF 3V7UA 3V8QA 5ER9A 4EMTA 4EGSA 1QPZA 3GJSA 5FUWA 2CK3A 1DTEA 1W5SA 1XQWA 4DGQA 1NJSA 1Z6PA 2D13A 3GH3A 4RK7A 4BZQA 2KX7A 3G3EA 4UUQA 2KM1A 1DJLA 2ZQYA 4CM4A 2SICE 4FGLA 2BVNA 3QKSA 4YRIA 1EZ4A 4IM7A 4MIYA 3ZHXA 4CMIA 3JQDA 2FLKA 2PQ6A 4EIWA 1JFFB 2BBWA 3FROA 4KAXA 4LOAA 1MOSA 3SM3A 4ZJPA 2JG3A 4NV0A 4EEKA 2BONA 3AEKB 3C8MA 4KXVA 1CF9A 1C8VB 2YFQA 3I30X 1B26A 1NM5A 2JIZD 3HE3A 3VPCA 1V8OA 2AE2A 1N6RA 3V42A 3VX4A 2NO4A 3ZC3A 3N28A 3P9NA 1A97A 1U8TA 2REOA 2W4QA 3REOA 2D62A 4B3DA 4BU0A 2RBGA 1IL0A 2WT4A 1QK5A 2OP0A 3KHSA 3KVYA 4IH4A 5DHSA 5TEVA 3RJZA 2O8CA 1GAQA 1GQYA 1YZVA 4TYQA 1V3VA 1EJBA 2P2DA 2QAGC 3HADA 3AVYA 1PSDA 1QX3A 5AHRA 1Y1KE 4DBLC 4RPGA 3OM1A 3H2ZA 2QRLA 4P98A 5KTYA 4RH3A 4V02A 3FNHA 4YDRA 4AZ3B 3KXIA 1JHOA 4KDEA 1Y7PA 1Y4SA 4LYDA 4OBBA 5AM4A 4BKMA 1T1EA 4H2DA 4XUDA 3INNA 2UZ1B 2XXJA 1XMJA 1CE8A 3R2JA 1R0LA 2YASA 1Z36A 4MUAA 3I6MA 4OHRA 4PHGA 4C3VA 4I8IA 1K4YA 4JJ6A 1MNQA 2IYQA 5D84A 4MP6A 4QTYA 1LBEA 3M6VA 4DRZA 4BU1A 1SA0B 1L8AA 2QN9A 3SJZA 5LXTB 2FPOA 3TI9A 3RYIB 5KNBA 5CPFA 3UTDA 2XUHA 3MTGA 2FEAA 3FRJA 4LCBA 1I2AA 4GICA 2G08A 2ZI7A 2W2VA 3UW1A 3V97A 1I94B 3Q98A 3I6ZA 2B7CA 1X1SA 3HCAA 1A04A 1J1IA 1N2CA 3BKXA 3PTLA 4IIJB 3GCZA 2IU0A 4Z3KA 2A9FA 3D6AA 5HS4A 1YIAA 4G0YA 2GN8A 4NIMA 4MKXA 4PLGA 3E82A 2C9DA 3LBFA 2WG2A 4G1MB 1R0BA 2X8AA 3WP1B 2P9HA 2WUEA 3W7BA 4IXDA 2BGRA 3TQIA 2YCLA 4OQZA 3SVLA 5JWRA 2B2CA 1SXIA 1ODSA 3HI6A 3DLAA 4KBGA 1ZXBA 1E1CA 1JBQA 4QXRA 4KITB 2WD9A 1GZ4A 3ZK9A 4JJZA 3OQIA 4K6CA 4OVKA 3THOA 5K2OA 3EIOA 3TOXA 4PQRA 4MV7A 3PUXA 1SG0A 3PXAA 1KDOA 4RQAA 4FX2A 2NUAB 3RSQA 5HEKA 3WLTA 2QYSA 2J3LA 2VP2A 2AMVA 3AUXA 1YK1A 5KQPA 3AKEA 4G26A 4UZFA 1J0EA 1QZUA 4KP7A 1JDNA 2DCUA 4I1RA 1I3LA 5JPDA 3K9QO 2C2GA 2RGGA 4N03A 2I9KA 1GSAA 1SXJA 1FSSA 2J09A 1GL3A 3A4LA 3HWSA 3P96A 1OXTA 3L4EA 4LECA 1YOBA 4G2NA 4J7AA 4ZCLA 2DM6A 4YDHB 3IXQA 3P45A 3ZVMA 3GHYA 4IIHA 4P9NA 5MFPA 4GT1A 1KMNA 4RE6A 1HE4A 4OATA 4GFDA 3ZDFA 4A8HA 4CM3A 4ZGGA 1N32B 1CD5A 1ZWLA 2DGDA 2X0KA 1HMPA 5CT5A 4JBLA 1ZSVA 3N6VA 2G8NA 2YQ4A 2IQ5A 4QDJA 1Q2XA 2AX4A 3IDAA 1X3SA 1XZ8A 3A1FA 3IXMA 3WRXA 3KSZO 5DN6D 3NETA 5IJWA 1IM2A 1XQXA 1IMOA 1MVLA 1HZZA 5TQ0B 4YIKA 4F9FA 4BQSA 1JX6A 4ZYYA 3LKVA 4FMCF 2VDNB 3IAS6 3UUGA 2JAXA 4LPSA 4JGGA 2D8MA 4PC6A 1GYPA 1I2DA 5EE3A 3RYHB 3WSWA 2YHBA 4M86A 2JLUA 3CLRD 4H31A 4DA4A 5HIJA 1ZSNA 4PVCA 1WX1A 1BC5A 1J00A 2BDEA 3BIWA 4XH9B 2P3OA 4E88A 4RJJA 2ZRPA 4OK3A 1F0NA 1I3MA 1GKKA 4P5PA 4HB2A 4ZWNA 5TV2A 3RUFA 3EQ2A 1RQGA 1R6BX 4EBBA 2V7QD 3DEIA 2FN3A 1OJ7A 1ZNQO 2YMMA 3DWIA 4HB0A 2PUAA 2ZZMA 4BP9A 4X65B 1ST2A 3EAGA 2FPMA 1VPEA 3L82B 2YS6A 5CDFE 2O8FB 4EQ6A 2BEVA 4W1RA 1PD0A 4BE7B 3RYCA 3PNSA 5AKYA 4QG3A 1JYFA 2XGOA 1UC4B 2FWMX 4JGBA 1L9KA 2B98A 4OLFA 1OVMA 5AJYA 1VI5A 3N70A 1YDFA 1V4BA 1DZ3A 3SIRA 1CIJA 2R1UA 2W98A 4NEQA 2EX0A 3DXFA 4N0EA 2FUG1 1RKXA 1V7PC 2P1DA 3JQAB 4H16A 3S5JA 1JB9A 3UIEA 1RQRA 3I9V6 1Z74A 1P2SA 5B5SA 2QTAA 3ZHSA 3HNRA 3O0TA 2VPQA 1PN3A 1FYFA 4PN7A 4BATA 4JI3B 1PFGA 3H2SA 2F43B 5G0VA 5T8KA 1O57A 1KA9H 1JP7A 2JAQA 3K9HA 5CW2A 4D82A 2B83A 5B7NA 1XQ1A 1Q11A 3AERB 2HZ7A 3E9YA 3HSYA 3Q3HA 4ZVMA 3GGOA 5AKIA 2DECA 4UNNA 2ORED 1FSGA 1W19A 1USIA 2NV0A 2GD0A 2XRYA 2BMJA 4F06A 3Q15C 3U44A 3UAOA 2ZJAA 1DIHA 4Y6RA 2ZT7A 3CLTC 3LWBA 1DEKA 3RU9A 3VSCA 5BOVA 3KP1A 3Q6IA 2WWTA 3IUSA 7REQB 1PV2A 3LXUX 4QARA 4S1WA 1TAQA 3OKCA 4FILA 2FPXA 4NHOA 4QBGB 4ZEWA 3A58B 3R40A 3WNBA 5TLSA 5AJTA 4HJRA 2O7VA 1G5RA 4NATA 4RK6A 2EHJA 3R5KA 2R96A 3U48A 4C05A 2XA1A 4ZCTA 4DVGA 4PG5A 3ADBA 2C58A 3IIEA 1N4AA 3KPYA 3S27A 2HU2A 4G97A 4ETIA 3T0GA 2AH5A 1G1AA 4GKJB 2XQKA 5EHXA 3IDSA 4V0LA 1C2YA 1R6VA 3W2FA 3ZE1B 1V1MA 4EPTA 5KEIA 2P1RA 4F93B 4HMQA 1N3LA 1D6NA 1YASA 4OQLA 4RDIA 4ZN6A 2H5LA 4YMLA 1GRVA 2BFFA 3QOWA 1TT5B 3WE7A 4X1YB 4D5GA 3HDHA 1SMKA 3IT1A 3OOJA 3R6WA 3VBCA 5BN3A 1N33B 1NQUA 1EA7A 2ORWA 4C2BA 3AOEC 4M1ZA 1H2ZA 2V58A 1X87A 3VRHA 5GZ1A 4UTZA 5LN1A 2DOKA 2HSEA 1TQ4A 4GOLD 2ATEA 2RONA 3QVJA 3U4CA 5B4TA 1Q1EA 2VDJA 2PZGA 3IMCA 1QYCA 3KHUA 3QIAA 4XIIA 2OO5A 3R6DA 1BWSA 4CEJA 3JQBC 4BB6A 2O1WA 3R7LA 1UJCA 5LYYA 3IBSA 1Z73A 4JB8A 1Q74A 3FH0A 3JQPA 2GPNA 3M6AA 3OOHA 4NMLA 5CT9A 5ILGA 1B0AA 5AQ1A 2JLQA 3BWYA 3ENVA 3HCFA 5ALHA 3PGLA 2NLOA 4RPHA 3S2UA 4L4XA 3NGMA 5FCDA 1VE3A 1EU1A 4MVJA 4ANFA 1WXEA 1RRVA 1WVGA 3DG9A 3N74A 4BNVA 5HOEA 5JFTA 1R8QA 2Q8QA 2F9MA 3LQ2A 3ERCA 1ETUA 1B0UA 1P6QA 3JRNA 4V0QA 1ZLXA 1XL0A 4HZUA 1K5DA 1NUAA 4JJIA 4MV3A 4NC9A 5HA5A 1NRXA 2OK7A 3B6MA 3IDOA 2BMWA 4LV5B 1NGSA 4BLSA 4CKWA 1KJ9A 2H06A 2X1HA 4DLBA 2CV0A 1KNQA 3IR6A 3AF2A 4NY1A 2QLBA 3RK1A 3VJMA 5B55A 1J9GA 2C5LA 3D64A 2NZWA 3I6IA 3H3FA 4HNRA 5CFOA 4QPDA 1N2JA 1PGQA 4R5HA 3ULKA 3KOMA 2P9YA 2DCMA 2NUTB 3NPMA 3OU6A 5ADUS 3MHTA 2PLWA 3L5OA 3ZE6A 4BTVA 1QCCA 2JLXA 3UK2A 3UB4A 3HR8A 3A4TA 1KK0A 3EDYA 4CDNA 4QECA 1LI4A 3TW0A 4JR2A 3NALA 3AM4A 3HCOA 4YEDA 4DV4B 1G3RA 4WECA 3HJAA 1IPFA 4DA6A 4M1EA 4DHEA 5DNVA 2IQIA 2VZ8A 4IQ4A 3WMXA 4DDMA 1U5BB 3HKBA 1P4SA 5WRFA 1XTQA 3V8PA 2QR3A 4KVAA 3KZCA 2HADA 3IV9A 1L4YA 1PEDA 1T4BA 2LUOA 1VCIA 1TT7A 1U2EA 4JBWA 2EFHB 2Z2JA 1GPLA 4XX0B 4BJ5A 1EWQA 3AVPA 2VP3A 3HB4X 3JQQA 4WDRA 3DBRA 3AUTA 1V3UA 1QGDA 4S1PA 3H9QA 2VHQA 5K6AC 3JD0A 2QLFA 3A10A 4CKBA 1G8KA 3O1JC 5J58A 1T6ZA 1ISIA 1YKSA 2ILTA 4RY9A 2WAAA 4F4IA 3O74A 4QELA 1QTIA 5JMTA 1J99A 3HJHA 2JIQA 4HRAA 3JALB 1XMIA 2NU6A 2VEDA 3F5FA 3GYBA 3L8YA 1XMPA 4H35A 4R4JA 5EXXA 1PQPA 4J03A 2A4KA 1WUYA 3NCTA 1M2OA 3ABIA 4CTKA 4CL2A 4B0OA 3D4OA 2JEZA 4H6XA 3WY9A 4GDFA 4BNTA 3N1UA 4M83A 1GFZA 2EX1A 1BJTA 1E66A 1WW8A 3MCVA 4BQRA 5ADWA 4DNQA 1A2QA 3A3NA 1I7DA 1E0SA 4F12A 1PS0A 1V1RA 1Z7BA 5ALVA 2XH8A 2O2ZA 4E51A 3IBFA 3DMYA 1EWTA 2J6BA 2VYFA 4XA8A 3CO5A 1ZP6A 1W8DA 4HQFA 2PKWA 4LMPA 3S68A 4NI5A 3JAKA 3NNNA 4AI6A 3EUEA 4H7DA 4KN6A 3K2BA 1HM5A 4RENA 2YVAA 1Z08A 2AXNA 1T2FA 2F7SA 5ICEA 4NLLA 1XXHE 2CDBA 2ONYA 3ITEA 3IKJA 3MRTA 1O6FA 3OIUA 1O7JA 3TL6A 3VJRA 3V1KA 2Q3EA 1D4FA 2BSXA 3OFJA 2P11A 2HLDA 1UZNA 2RC6A 2QVLA 1SCNE 1H8EA 4F4DA 2GVZC 5B6JA 4AVYA 4JS0A 3EMBA 2EJCA 2IOQA 1K5GA 2KBFA 3MW8A 2PUFA 3PFIA 4FIDA 3IEVA 1REQA 4ZEVA 4DLSA 1PTKA 4OP2A 2XKBA 1BS1A 3UKJA 4R7GA 4U9IS 1TQHA 2WSSA 1PU2A 3KQTA 1KFEB 3S7TA 5A04A 3AVWA 4YAWA 1WQ3A 3SNHA 2HMVA 2QQGA 3BEDA 4ZHQB 3MC1A 3WK9A 2IYSA 3OQBA 2Y68A 3D8SA 1KJZA 4O1IA 2ZCUA 2VDWB 2VJYA 4NCJA 5DNEA 1BDIA 1IM5A 2IYFA 2JJQA 3EG9B 1MAHA 2HSDA 3KXPA 1JDVA 4FQ5A 2IHYA 3PBKA 4RADA 4YJ3B 1N5OX 5FWDA 3DMPA 1QF9A 4WEQA 2VAWA 3EFOA 1HNZB 1E9CA 2ZVPX 4Z51A 1Q91A 2WJ4A 2R1VB 1ULZA 2YN0A 3GP8A 3OTWA 3SQNA 2GWHA 4L8FA 5JMWA 2X5OA 4ZK6A 3G88A 4DLTA 4MO9A 5BO5A 3RD5A 4B35A 4DHWA 5ALXA 9ATCA 3HV0A 5KNCH 4M0UA 4YYEA 3T3IA 4I46A 4MVJF 3D6VA 4ZIRB 3AHCA 4ABTA 4NP6A 1T6NA 3TXXA 4C1NA 1Q21A 2FWNA 1UQUA 2VJKA 2Y93A 4MVJM 4PPFA 4O4JA 2BF4A 4TUYA 2C9BA 1XO1A 2O8CB 1Y8AA 5IZCC 4U5QA 1TL7C 3CZCA 3NOQA 1QNLA 2O6HA 3QBEA 1KSHA 3BHNA 4K81B 4MIKA 2B4AA 3QUAA 1LLUA 1L5RA 4NULA 1IB6A 2V6IA 1OXMA 2YH2A 3BGSA 1ORHA 4GKVA 1CQJA 4HAYA 4HG2A 4OL0A 4REOA 2IOHA 3RI3A 3SEZA 4AULA 4TSRA 3KK0A 1LW6E 2OHJA 2OGZA 1QP4A 3OE7A 3ORYA 4M6WA 1DX4A 1Z0IA 2JFNA 4C0SA 1FE8A 3W6UA 1RZRD 4N3NA 1NQWA 4MB2A 3MLBA 1JHDA 1NW6A 2AD5A 4MS1B 1K68A 2IS1A 1MJGA 1TUBA 4CODB 2VBFA 4QEZA 4XPZA 3LK7A 3IX7A 3R9XB 2OPBA 3E48A 3IR7A 3WBFA 4UOEA 1BE1A 2EC5A 1QLJA 4ER7A 1GTMA 2OK8A 3NV9A 5DHUA 3HVRA 5G1NA 5AVVA 4LIPD 1KKUA 4AO8A 1LV7A 1MO2A 3KQVA 1NUUA 1L5QA 1SQ6A 3DMHA 3EYWA 5FOSA 5C1PA 2FE4A 1WCYA 5AVYA 5KVCA 3I1YA 4X7RA 2XWQA 1JU9A 4B3TB 3QUTA 1C41A 1CDDA 3GLGB 3SY8A 4F7WA 3PHLA 5JQGB 1SZJG 2YZKA 3JU3A 4LDZA 4D44A 5JAHA 2WHRA 2PUDA 4P4NA 3QVVA 1NDUA 1NWCA 2DHCA 2PBRA 3LJKA 3NJRA 2YRWA 3T5MA 1BHQ1 4NE2A 2DPGA 3F4KA 3U4MA 4ER5A 3T5PA 2GK3A 3S70A 2YNMA 5MFZA 3U1TA 2R66A 4V3BA 2DB3A 4HZGA 1XCOA 4QPCA 5GVRA 3U3ZA 1QRUA 4PF1A 4R1LA 1FCJA 4EENA 2WKSA 1LVGA 1X7XA 4K9PA 1JEAA 1WZ2A 3BEOA 5EWJB 2UYQA 3OZTA 1L7NA 1XZJA 5I47A 3IO5A 3GVIA 1GD1O 1W581 4L7QA 1IAVA 3E0XA 5DXJA 3JQ8A 1YGYA 3G5AA 2IVZA 3JWGA 1NVTA 3EMVA 4LK2A 5ALMA 1XHFA 3M2TA 3TSYA 5K9ZA 2CYCA 3JAWA 2Z2XA 3QW4B 4EB8A 4ESHA 3MBIA 5ALIA 2Q49A 3DONA 3VOAA 4TMKA 1NYQA 2D00A 2OV6A 4K9OA 1PG2A 1TEZA 1XAJA 4LDRA 4NQZA 4XUGB 1JUDA 4R0MA 3CGWA 3ZUGA 3L8GA 3BXOA 3ZS8A 5HKBA 1YZKA 2CJWB 4O4IF 4WN9B 4F96A 16PKA 4F6LA 1YR2A 1ZCAA 4ZYXA 1NX6A 1Z7YA 4HWKA 4K28A 1RDFA 2PWPA 2VYVD 1MABB 1EK5A 1K8ZB 3IPCA 1NWHA 5F3DA 1AJEA 4QEDA 4URXR 2EG5A 1GP2A 1H2AS 4NMXB 4TKUA 3AR5A 1KI6A 5AOAA 5J4HA 2P6RA 3PKJA 1ZGCA 5H70A 1WXHA 2ACVA 4BLRA 5TR9A 3SDBA 3T15A 4Q34A 4HTFA 4BFTA 2FFRA 2VJPA 2GOYA 2PTHA 3GP3A 4ONEA 1UDAA 2JVIA 2JLVA 2OXFA 2WJHA 1J5PA 1V16A 4KAJA 3SZUA 4IF6A 4GWLA 4REMA 1EXWA 1LSSA 1KS2A 1KYTA 4CLDA 4A2WA 1GNQA 1G98A 4LXIA 4J0IA 2Q0SA 2MOKA 4RZSA 4RMGA 4S0XA 4LY0A 3VGJA 2BMAA 3SSAA 3TOZA 1XCLA 4ES6A 1I4LD 1NZJA 4YJKA 2WDZA 4F1KA 1H6CA 3M7IA 3Q0IA 4O59O 3IMEA 4KDFA 4P33A 3LFHA 3L1VA 5DVZA 1H2RS 4P82A 4DQUA 4EPXA 3BWVA 2C54A 1KSJA 2HHHB 3B5IA 3C7TA 1IPHA 4IRUB 2GPAA 5E8JA 4Z6KA 2WHPB 3D1JA 2D54A 1G2QA 1BEEA 1RHUA 5DLEA 1KVTA 2WPDA 5IKEA 2XE8A 2OC4A 3CRZA 3N07A 4V38A 4TUYF 2QTRA 1NBIA 2IXBA 4JXKA 1I1OA 1R1DA 4JLDA 5CLJA 1GL9B 4NARA 1OGJA 2W6ZA 3OFND 1I2BA 4BKUA 1J6UA 3WGUA 3CRQA 1OVGA 1RBMA 3O6VA 1GPNA 3QNMA 1NMSA 3AI2A 2G36A 1P4AA 2ZBDA 3IDQA 2CVFA 4GLFA 2JFBA 1GAJA 5DCLA 3A1DA 1YVEI 1YZFA 3B6JA 3MB8A 3OEED 3B1XA 5HK9A 3HJFA 3UTCA 1LDNA 3ZWOA 1JFFA 1Z5WA 4FEEA 1KRWA 1IZZA 3WLPA 2Y9MB 3F3MA 3LWDA 4ZPXA 1SAYA 2ZSJA 3AEKA 3F5MA 3L6RA 3LTEA 5KOJB 2BM8A 5AUPB 2KSQA 4OH7A 3A1NA 1E20A 1EH5A 2E9SA 3AUFA 4URZR 3H5LA 1GZUA 3I9LA 5CHYA 3BC1A 3W2EA 5ICMA 2ZBFA 2AVDA 1MC4A 1SKBA 1R5BA 2WKRA 3I34X 1VPLA 2ZEJA 3KDSE 3GLRA 1FXWF 2DQSA 1GFSA 3HVJA 3CLTD 3N8IA 1I2ZA 4H1UA 1FFBA 1MDFA 1JQDA 4OQQA 4HNGA 1ABFA 4IG9A 1MJGM 2VJBA 5AKLA 3VR4D 4MVJI 5BP7A 4UPVA 3RKRA 4B4UA 5I5EA 4G36A 4NBVA 5BQPA 1F2UB 4MH0R 3LFUA 5F2EA 4ZPJA 1SVIA 4BVFA 2HRDA 2FX3A 2WTMA 4TYPA 4AZ3A 3NV7A 1KJWA 2QT0A 4IVNA 5IW8A 3ETJA 1FUIA 4JFRA 1VHQA 4NE9A 2P2GA 4K1LA 3AU9A 3QSGA 4XWTA 1UFVA 2HMYB 4FKMA 2UZ1A 4R2LA 4IFTA 1DV2A 4WESB 4WZZA 2JGRA 2EKDA 3OZAA 2J5RA 3BHIA 3GLSA 1AE1A 4JT4A 3SC3A 3WP0A 4FOLA 1BHSA 3IQGX 4MI9A 3DQPA 2JFQA 1OZFA 5G02A 1X2EA 3WMGA 1SA0A 4EG5A 2CNBA 1XN4A 1JLHA 5AHKA 5D6NA 1GGMA 1U6KA 3RYIA 5LXTA 5CRIA 5A3SA 3WBJA 1Z9BA 4MZXA 4W7IA 1OH7A 3ZLBA 1PR0A 3OLYA 2FX5A 2WSMA 2WZQA 4ZVUA 1L5GB 2Z0MA 3UJPA 4HNTA 4J0DA 3A31A 2PMDA 2QGFA 5A4KA 3OEWA 1VSTA 1M34E 1BGXT 3LNCA 4R83A 4E33A 3P0IA 3MNFA 3IAXA 1DKRA 4LXGA 4O33A 2IW3A 1ADYA 5FULA 1FUKA 2LE0A 4MPRA 4RZ2A 2VHUA 3CW2A 3UMSA 1GPBA 4AF6A 3CU5A 2NYUA 1P1HA 1T1IA 2XF2A 1YI0A 4PO1A 4KXNA 4TXJA 2UV8A 4REQB 5AJHA 4C0QC 2X14A 3OPYI 3NTQA 2ZROA 4G85A 4OM7A 3T34A 2BZ0A 4NNPA 3T5BA 2XCIA 5IAOA 2ONZA 4MKHA 1GR1A 1MB0A 1IFXA 1CT9A 2E0IA 5LP6B 4M37A 5JSHA 4IX1A 1W7AA 3QMMA 3G8DA 3AUUA 1V2GA 3RAPR 3X2SA 2NUAA 3ZGVA 1YS6A 4DFDA 3FFTA 4F21A 4C0KA 4BEBA 1PTJC 4ZCPA 2J7KA 4KODA 1BMQA 3TOCA 1UDWA 1Y33E 2APJA 4L2IB 3EE6A 3GLFE 2XQGA 3HM2A 2RGEA 2X0RA 1QKJA 1DC6A 5KJFA 4EG0A 2I6FA 1QTRA 3T94A 1NXQA 4P3YA 4A0SA 2PFSA 4Q1AA 3ZHUA 3EXIB 4RTRA 2QROA 3RC8A 3BS4A 2D2XA 3RF6A 4X6XA 5LQJA 4Z54A 3GVHA 4LA4A 1XDGA 1GZHB 1YFKA 2RHBA 4Q24A 3UJNA 3FTFA 2CW5A 1U8EA 4UHFA 5TQ2B 3D8HA 4WXHA 4BKRA 4KO2S 1Y37A 1T2EA 1H0RA 2YRFA 3ETGA 2ZSKA 3L7NA 4US1R 2IEAA 4GP6A 4YT8A 2WIBA 5G0TA 5T6BA 4AUMA 5FPKA 2GM3A 2PT9A 1B8VA 2QG6A 1O96A 1P77A 3F5QA 1PK8A 4TKZA 2YDXA 3ILHA 3ZI4A 5TQ0A 1BXZA 2J8ZA 4NG5A 4DV5B 5D51S 3RS0A 1PT6A 1MZPA 4HB4A 2C8KA 3B6IA 1E1RD 1QLWA 2XHZA 3VR5H 1KTVA 2FZ4A 2I8AA 3WKEA 3RYHA 3VZQA 5B1YA 1MX9A 4EG7A 3WLEA 1Z07A 2BUCA 1LJ8A 2R5FA 1PS9A 5IDQA 5FTKA 3ZZNA 1J9ZA 2Q8NA 3G49A 4WUTA 2B1GA 3O8BA 3UJ8A 1IXSB 3C85A 1NF8A 3N2IA 3DLPX 3ZGNA 3E9ZA 1CUWA 3PEFA 3R5JA 4JJKA 3DHNA 2JANA 3IILA 3CIOA 3FCYA 3ID6C 4IGAA 3L9WA 4FW9A 3N8HA 5IAKA 5FV4A 5L8VA 1HE2A 1MB4A 4GH5A 4Q03A 1U9YA 1RWMA 2F1IA 5TX7A 3N6RA 1BXRB 3TRHA 1RM0A 3FJYA 5FRDA 1R0ZA 1HY3A 4NCAA 3EDOA 1UXIA 2LV8A 3IT0A 3TL3A 1ULSA 4S05A 3IQIX 2YXLA 3VNRA 3AUAA 5JIBA 2PWYA 2I7TA 2H1IA 4FYMA 1COWD 1Z4JA 2VWPA 3FSJX 3NM4A 5FWYA 2WF8A 4ML3A 3VXKA 2WYIA 3VU1A 2IEDA 1H6AA 3KKPA 2Y0PA 1P3DA 2EIXA 4YHHB 2HHCA 4CXMA 4KLAA 1ZNWA 3KKNA 3MGAA 4IXMA 5EHNA 4BMDA 1CW2B 1K3FA 4E5KA 1NVGA 1S7CA 2EHDA 2F43A 2RK4A 3AIKA 3ORQA 2RHGB 1CDEA 5IZ4A 1HL7A 4ZD6A 1GDHA 1OY1A 2A5LA 2E82A 1JAYA 1P2VA 2VK8A 5D8DA 1H0KA 1JG3A 3ETNA 3GN2A 3MG9A 1G19A 1A7KA 2OXCA 1W93A 4RD3A 1XZBA 1PS8A 2FUNB 3DAYA 2YJ4A 2JW5A 4GOXA 4G5OA 4IQ8A 4NECA 1GPKA 2DHQA 4JVLA 4RO0A 1KRHA 4MI3A 7REQA 5DTEA 1NXVA 1WCV1 3PR2B 4XD7A 5LXTF 5JWOA 1B41A 1RU3A 1ORIA 1T5OA 1GFWA 4RJTA 4ZHSA 4AN0A 4S24A 3SFVA 2Q2QA 2Y27A 5EUQB 4AP6A 4CYMA 1TYZA 1K97A 1ZGAA 5HNKA 2HFJA 3MTJA 3WZ2A 4DZZA 2VDLB 2LIPA 2QIPA 1CY6A 4WBNB 1MD9A 5AK5A 2P9ZA 2ZJ1A 3E7PA 5FEMA 3VZBA 4NVRA 3L0IB 2VT2A 1OF1A 3NHFA 2FFQA 2W2XA 4IRMA 5EJGA 4ZRDA 4AQ7A 2CZGA 2IEZA 4AJEA 3OICA 1WB6A 5I9BA 4D74A 5JW6A 3CS3A 1KMIY 2DR0A 2GAJA 5C8VA 4CGZA 1TT5A 1FSPA 3GJZA 4X1YA 2XDYA 1FZTA 3UMFA 1GA6A 2HU7A 1E6LA 3L0BA 1DKNA 3A3PA 2IUEA 2R6CA 4J1TA 4DSAA 4HATA 3GBPA 2VC2B 2ZOSA 4P81A 3QK7A 1W94A 2WHQA 3P2KA 4RELA 5DOZA 2QE7D 4GLLA 4ND1A 5DH9A 1GDTA 1CV2A 5FQOA 1U80A 2BM0A 3IRVA 2FZLA 3RABA 3DZDA 4YRGA 3VOTA 3BIJA 4U7GA 2IP2A 5LP1A 3K9LA 3U4AA 4WKPA 4B75A 1T8YA 2HPZA 3K70B 4LGCA 4KFTA 1OILA 2RHOA 3OF2A 5JJKA 5HRCA 2G09A 4L28A 4R0NA 4YAOA 3TAXA 5J1SB 4U6QA 4L74A 1J0DA 5C7LO 2BGGA 3IAHA 3U4GA 3R7WB 5K5EA 3AB8A 3FYTA 2JJ2D 1WTCA 1YC5A 3MWEB 5GINE 4BJHB 5ICGA 1VKNA 4F7DA 1W2GA 2FEWB 2REQA 4L76A 5A5VA 4B5LA 4UEQA 1M2FA 5DK6A 2XIQA 5E3HA 2RGBA 3VZCA 3LCMA 3LC7O 2FG5A 4OD0A 4WLEA 3WISA 2Y0EA 4HWOA 1A27A 3TTVA 3OKPA 4EGFA 5AR1A 3Q41A 5JANA 3ZWNA 3IAS1 1CP3A 1JRLA 4EPRA 1U2DC 4S1VA 3TXYA 2FZEA 3W2GA 4DNFA 4NJEB 1RBZA 2E3JA 2CMGA 3LL4A 1SIBE 2AJDA 2CC2A 4UU0A 1BHJA 5FB3A 3ZV5A 5IVKA 2NUTA 3QELB 3CGGA 5FDFA 5K6RA 2QVBA 3D6NB 1XP5A 1MC5A 3PFFA 2HCJB 5D5HA 3HSSA 5LA6B 2PWZA 1NTOA 2CXHA 3FGNA 1VHJA 3LOQA 1YB6A 2L82A 1OU0A 4OK6A 1BJRE 1R8JA 1U5BA 2GFHA 3OECA 2ONJA 5IHXA 4AD8A 1B6RA 2I55A 3SMVA 4TL9A 1IXYA 2QW8A 5FOVA 5E9QA 1O2DA 3GZ4A 1TO2E 5CGQB 4N5LA 1UBKS 4X97A 1P7WA 1EGVB 3MUNA 3SC2B 5KYYA 4XX0A 4M98A 5EP1A 3QY9A 3QKIA 3M4ZA 3ZY2A 5MF6A 4ALJA 1TEHA 2I7DA 3MOGA 3I9V1 4XI9A 3AZOA 4RTJA 1GPMA 3AUYA 4AKEA 4YMUA 4P3NA 3WDLA 3Q9SA 2BH9A 1E89A 2XYRA 1DBQA 3MWKA 4HPJB 4IKEA 2I4OA 4Z9XA 1G6OA 5C1DA 1FL9A 2B99A 4KUEA 1E6WA 2LCIA 2VYND 1STOA 3ROKA 2XNHA 2X8JB 3EN0A 5CIQA 1E5LA 4U2CA 3SOZA 4XVCA 1SB8A 2I2WA 3FF4A 5JARA 1C9JA 1CEYA 3K32A 4KGVA 3B13B 3C0KA 4JCCA 4DR3B 2RK3A 3NYQA 1CRLA 1OI7A 3AP2A 4TYYA 2VHWA 4A26A 1AZTA 2O3QA 3E35A 1SY7A 4KFRA 5ALDA 4Z4QA 3K2EA 1XLTA 3KTOA 4LVNA 3RUCA 2JC3A 1XQVA 3KYCB 3OTHA 3KO8A 4IVQA 1K6IA 4XEHA 3M6IA 2TS1A 2XUDA 3WRYA 1T13A 2JAHA 3C5CA 3HDTA 3N0RA 4IJQA 1NMEA 1OR8A 5KCZA 1OWLA 1XJ0A 3C3JA 5KSZA 4HEA1 3BA1A 2IV3A 1OQAA 2JIRA 3A2NA 2WJ3A 3CWZA 3ZLJA 4DV2B 4G5GA 1L4MA 4AIRA 5KQSA 1P17A 3QHAA 4AO7A 2B35A 2BDUA 1AKQA 2IS6A 1PK7A 2WV9A 1P3Y1 1YSCA 1KOFA 3RTCA 1YRQA 1M8FA 2GNOA 1YBMA 5DRTA 1NSFA 3DEZA 1P2UA 3O4HA 1PZGA 5FA8A 5E3JA 1BJKA 1BWQA 1OW3B 2HHLA 4ZHQA 2OLEA 2V59A 1NHWA 3H6KA 4JDPA 5A6SB 2QAJA 4IOLA 3U7HB 1TDJA 5D1HA 1R5JA 3FSGD 1WO8A 4KAAA 2G4VA 2VDWA 1LS1A 3EMKA 4LAFA 3EG9A 3FGOA 3NT5A 2HXYA 2OCPA 1EXVA 4NFHA 1ZQ1A 3NKLA 4YJ3A 1I3CA 1U4OA 4EJSC 5IANA 1XZCA 4IHJB 5COAA 4RTQA 4OHMA 2O23A 4J7XA 4DUPA 4UTNA 2W0MA 4DLRA 2ARKA 1CJKC 5HJEA 3CVUA 1DE0A 3LLVA 5TF0A 1N2SA 1EJ0A 2YYSA 2D2FA 2BJHA 3C3DA 1KF0A 2BHNA 2OQRA 2VA9A 1E5XA 4Q9DA 5AW9A 4H4EA 4ZIRA 3LHFA 3KHTA 4DZTA 4G0OA 1G5HA 3KXKA 1NX9A 4EH1A 1FA9A 4WKOA 3IRUA 3B82A 3FPGA 1E92A 5FX2A 1N8NA 3PZBA 3V4FA 4B48A 4A8PA 5AW0A 3DBOB 1ZAYA 1F2TB 3O92A 2JK0A 4TQ9A 1UPCA 3IHWA 4FSXA 5H5JA 4R40A 4BVKA 3BDVA 1NF9A 1Q17A 3GCGA 2DFLA 3HO1A 1VFNA 2LGJA 3AF1A 4K3VA 1O77A 3WI7A 3CNNA 4OHPA 3TB4A 3PPWA 4PZPA 3GYGA 4HBZA 2WMYA 3M70A 1EP1B 3EOZA 5G40A 2JD0A 5E1MA 2G28A 2I4LA 3IDZA 5IPFA 1G5TA 1EG7A 2Q9AA 4MUHA 1VLJA 1QDLB 4MS1A 1Q7BA 4B47A 2G6BA 5GY7A 2PQ0A 3U4QB 4NQRA 2HIGA 2P62A 3DWEX 3QEJA 5F77A 1U99A 4UTOA 3Q10A 3UUFA 1TM2A 4HVAA 4FI3C 4LXQA 3ASVA 5FI5A 1PJBA 2WHYA 1JQ3A 3C3AA 3PSHA 1U6JA 4RH0A 2OCAA 1BU8A 3D0RA 1GV1A 4Q3NA 1D4ZA 5CD1A 1HT0A 1XRRA 4IGEA 3AINA 4BPRA 4PSCA 4QC2A 4NHEA 1DRKA 5TRTA 4KR7A 1D09A 4I5EA 3PPXA 3MERA 4W5JA 3CUYA 1OBFO 1R0XA 5HE9A 4Q6WA 1T0IA 1MLDA 1T43A 1OFHA 3ASUA 4RTOA 4KH0A 2EP5A 2QDKA 3TQOA 1SHZA 1IN5A 3NWPA 3RQSA 2IGTA 2WEKA 4HRXA 4TTVA 4G65A 5BNTA 2FZWA 4KTVE 5GONB 1T24A 2FG7C 2VH1A 3ZCPA 2PMEA 3OZCA 4XQ0A 2CXUA 2FN7A 4E7PA 4C03A 4LZNA 3KB8A 4MYHA 4N8SA 5KYVA 4MQLA 5EWJA 3TW4A 3PDIB 2C9YA 3VR6A 4C7VA 4FOSA 1D2RA 2ZU0C 2O9JA 1IN6A 4X41A 3WYGA 4Z3OA 1Z2OX 1EFPB 2JI7A 2GSWA 3EG5A 4P35A 2OWDA 5EPUA 3B1KA 5E6SB 5L3ZA 3KOZA 1B8NA 3ZOZA 1JQ5A 1GN9A 4R6XA 4BASA 4U7FA 1XPUA 2AJCA 1R0SA 1EGHA 1GKUB 3K4QA 4YBZA 5SZJA 2C7RA 3EVBA 4PGGA 4ENRA 1ZOLA 3F8WA 3GARA 3GRUA 3TUIC 1SHTX 2CJWA 1L0BA 3ETHA 4FFVA 4H15A 4URYR 421PA 4BNGA 5AWFC 1G9XA 1RP7A 1MABA 1S3GA 4KR0A 4JN6B 3HNPA 5HG0A 2HMSA 3MS2A 1Q1GA 2C31A 3F8SA 4B7ZA 3LHKA 2LCFA 2XJ4A 2P78A 2VRNA 4K6KA 4RSHA 3QHPA 2H2FA 4MKIA 3D1VA 1JDSA 1IEXA 4OJNA 2C2HA 1NSTA 2ZRFA 2H00A 2F1RA 2NIPA 2X0IA 4ZHQF 4CLRB 5H80A 4AJHA 4EHFA 3JQ9A 3PGVA 1ZHHA 4G07A 3FHCB 3WGTA 2ICAA 1W88B 4N5DA 4JX8A 3OLVA 1PZHA 2ZWOA 4R2KA 4G5XA 5FR1A 3VFDA 3G2NA 5KZMB 4I6JA 1E58A 3MGBA 4I99A 3EEOA 3PHHA 3UQZA 1GCUA 4YJ3F 2HRBA 2C82A 1F4LA 5LJIA 3A1WA 2EG9A 5KAPA 2PVSA 5M2QA 2WWWA 3HL4A 1D2CA 3SZLA 2SBTA 3SDZA 2LDXA 4BMXA 1NLZA 4Z1MD 5F4BA 4ZMBA 2OBBA 3K20A 1Z2DA 2BOVA 4PRLA 3C24A 1P9WA 4UAJA 5CNKA 2UUCB 2QW1A 3HGMA 4MVWA 2WHPA 3UBTA 2GXSA 3EIQA 5K8LA 3L7IA 5JBQA 1R27A 2WA1A 1VOTA 5KHLB 3SE0A 1D6SA 3DAGA 1N5IA 4YI5A 1W73A 2BWJA 1T6XA 4HFMA 1VBNA 5F33A 4AY4A 1I1NA 2ZJ7A 4INJA 4P4GA 4UCXA 1P81A 3VAYA 4EUKA 1E6KA 1RYBA 4AS3A 5CB4B 2QD5A 1GHTA 2JLAA 4YQFA 4Z5XA 4KQ2A 3F67A 4FJ1A 3WKDA 3KR2A 2IXDA 1Z2AA 4QL3A 4CLEA 4COOA 2GESA 4ETMA 3GFGA 5KOJA 3KWJA 5SYMA 1KO1A 3BSSA 4OXNA 1OYOA 3SZRA 1QE0A 5FBKA 1W0KA 1OZGA 2WU0A 2C5FA 3BMNB 3F6PA 1QG2A 1KVQA 1PYDA 4RVCA 4AZ0B 1IZ9A 4BN4A 4LF9B 1ZK4A 4WZAB 1WQ4A 4DCGA 3EIWA 4XWKA 3RFUA 4JP1A 5L7TA 1IQ0A 1RQNA 4YC7A 3R9IA 1S2IA 4KWCA 3PI7A 3A9VA 1XVLA 3JPWA 3DFIA 5AJWA 4NXNB 1VHDA 5DCWA 4DMFA 3K94A 2BFCB 2V9PA 4TS1A 4D98A 1F2UA 3N2EA 4U6NA 2F4NA 3KTAB 4QX6A 4QOJA 1KWGA 5HJ2A 3ENQA 1P80A 2F8SA 1CUBA 2PNFA 3Q8WA 2BGLA 3EDCA 2I8CA 1XDBA 2Q4DA 3HYRA 4LBZA 5F9MA 3U5ZB 1G60A 1FRZA 1M0WA 1MT3A 1QV6A 1WNTA 1Y9JA 2P65A 2R5NA 2WILA 2A5GA 3E1KA 1XN1A 3H65A 4IIBA 1VRCA 1AN9A 1THTA 2OHIA 4WESA 5IG2A 1U0HC 2HJ9A 1K86A 2WF5A 2FGKA 1V8ZA 3GC6A 2UVQA 1OH6A 4RVUA 2H59A 2PR2A 3CJTA 3FY4A 5F12A 2XCRB 3KKEA 1P3JA 3OCWA 4R16A 1E1QA 1Z8FA 1T5SA 3BB3A 2I78A 3EY9A 4QBHA 2VSQA 2GK4A 4IG4A 5LR6A 3Q6NA 1KAMA 3RRFA 4DSUA 4TZ6A 2I91A 1WULS 1PCXA 1K06A 2ACWA 1TQ2A 3NHAA 3QVKA 4H3KB 2F1JA 1R4NB 4LQDA 4ZOLB 4EMUA 2VJLA 4LRSB 3EEYA 2MIIA 4QNRA 3TR6A 5CEFA 1MEEA 1R8YA 1JDPA 2HKIA 4F3RA 1T9CA 5JG7A 4ZAWA 5BNFA 3C1TA 2BDTA 3Q72A 4WCFA 1DAFA 3WGIA 4JYAB 1NBME 2JIMA 1RSZA 5HJ7A 4AJNA 4XDYA 2PL9A 3TLKA 4XWOA 4REQA 2JIPA 4NK5A 1FRQA 3SU8A 4GM0A 2WSLA 2HSZA 4HT3B 1CUEA 2BGJA 1NI4A 2GEUA 2GEFA 3PF8A 4ZZIA 1R8XA 1V37A 1N5MA 3GUUA 4JIMA 1DJPA 2J0VA 4HS4A 4KAFA 1WU7A 1A9TA 4EWLA 1OBHA 2DLCX 4U7JA 2RGXA 2YIMA 2ABWA 5LUBA 4XFDA 4RK1A 5CXSA 2PX0A 4RTNA 5E4FA 8MHTA 4H27A 3E5NA 3REFA 1KWKA 3OI7A 3VC7A 2G1KA 1OGYA 4P2BA 4MGIR 4DWJA 4L2IA 4DCUA 3PX7A 3L1IA 3CEPB 4LY9A 4BVEA 2WAYA 4EHBA 5BWOA 1YE5A 3K9CA 4LSMA 3EXIA 4HAIA 1E2EA 3FDFA 3SHQA 1GLGA 2Z1NA 2XGJA 5CXXA 2A5FA 4DLXA 3COPA 5EQFA 4EKIA 4TVSA 2G1JA 3BZUA 1T6YA 1Z5UA 3PQDA 4CE6A 2X23A 3GJ8A 4MEBA 3K9FC 5TQ2A 1PYOA 3OP1A 1N25A 4RACA 2R6DA 3KQMA 3F0TA 3JYQA 2QTBA 3A70A 3BGVA 4MWEA 4O6VA 4LRTB 3DXYA 4OHUA 4LFBB 3A6DA 3LT1A 3CKMA 2NZXA 4GPIB 3GMDA 3AETB 4DR5B 2Z6QA 1ZK1A 2D1QA 5K1ZA 5EE5B 1FDWA 3K1AB 3WGLA 4EA7A 4TLMB 2VSOA 3EPKA 2NP7A 1LLDA 3CPSA 5AK0A 5GTDA 4YLGA 1YONA 1G8FA 2Q7DA 1YS4A 4RLFA 4XRGA 4LZJA 5KNBH 3RSCA 3A0UA 3KAKA 1E79D 2FTKE 4LQLA 4PRYA 4XQEA 2NQ2C 3OUTA 4MULA 4ZU1X 4KVFA 2DLNA 3OTGA 1WXIA 4HWTA 3ZN2A 3JARB 9LDBA 4DDWA 5BNWA 3U9SA 1DWQA 1X2BA 3DMDA 1D2MA 4QDXA 1V5WA 5B3LA 5AKKA 4L8YA 3UNXA 3WL6A 5FH9A 3BWEA 4MHOA 5L3VA 3C6KA 1WSBA 5JYDA 4XVHA 4WFKA 3WLNA 3REQB 5L4SA 5G0WA 1O89A 1BXRA 1PWHA 1VMIA 1YMVA 1YS9A 2BR3A 4YALA 5T5QA 4W4TA 4B9EA 1FJGB 1NY6A 3AFIA 4HNUA 1O94C 4JXZA 5K2MA 4IJ6A 3K6SB 4Q1BA 2VA8A 2CNDA 1KEKA 4YAKA 2YWRA 4MVXA 4HJXA 3QBTA 1CJUC 5G4KB 3K0EA 2G80A 4CHGA 4OGWA 1AQNA 2O1EA 4E5UA 5L4LA 2CFCA 1WDTA 1UH5A 3FPKA 4LZOA 1E2JA 1L5LA 1QU3A 3I32A 3JX9A 1OKKA 1QHNA 3TO5A 4BVHA 3RRXA 4N76A 3G0OA 3MJDA 1ID8A 6NULA 3H5TA 3QVTA 3RPEA 2MT9A 1SVMA 3C4QA 3TZBA 3FVQA 2R5WA 3GGJA 3D1LA 4LJRA 1RAFA 2XMSA 4HN2A 4C88A 1Y5NA 4RW0A 4AX4A 1IEWA 4CV3A 2HF2A 2DZDA 2QF7A 2ZE6A 2FWBA 3DCYA 4NK4A 4RXMA 4BX8A 3IKVA 5JAOA 3EX7C 4RWEA 3X3HA 1WUHS 3C1UA 1KJYA 1A1VA 1CHNA 1MUUA 1QHIA 1XELA 1X8KA 3SYRA 2Y1KA 3W5UA 1V96A 3LO5A 1V45E 1NJ8A 1YMUA 1VZ2A 2GBLC 2QAGB 1RHJA 4M9SA 4YQZA 4B6OA 2PUEA 3GLTA 4AN1A 5IEJA 5FBZA 1GCIA 1G0OA 3VNSA 1BW9A 1PQWA 2PHZA 4NR0A 1UUFA 1I9CA 2ZYTX 4JEMA 5MGBA 5I6DA 1E2HA 1K7XB 5KDOA 3ZH2A 3FHJA 3RG8A 3LSTA 1O97C 3V1NA 5J3JA 1N5RA 3B89A 3WC4A 1W59A 4JVMA 2UDPA 4WXRA 1HE3A 3MOIA 2P35A 5CB6A 2KE5A 1LDEA 1ICIA 5FPHA 1N1EA 2UZ3A 2RHWA 1NASA 3GAZA 3WIDA 3ITDA 1GYRA 3GRVA 1P6UA 4FHGA 1Y7LA 1XDWA 5ITVA 5ERYA 1JIQA 1XF9A 2EQAA 1WXXA 2J67A 3D59A 3OLQA 4HFNA 3KIPA 4PSDA 3MD0A 3ODGA 4PPQA 5A3VA 3SQDA 1MRZA 5JO0A 4E2XA 3W6PA 4JMLA 4U2BA 4HDNA 1JWAB 3E0QA 1U7ZA 2CHFA 2GN4A 3EOAI 3PX2A 3U4IA 4G8CA 2IK8A 4PWYA 4JI6B 4B0PA 4C1BA 5IWAB 221PA 4U6SA 4IEFB 3AI1A 4LV6A 3O8OB 2NZJA 1B15A 3IPYA 1JW9B 3P0FA 2YXDA 2HDOA 2O8EA 3HJRA 4F6CA 4PZUA 1VG9B 2Y1WA 1M5UA 4QGBA 5BMVB 2H57A 4EMSA 2DR2A 3R7WA 3EPHA 1L5YA 3HFSA 1IUPA 5JY1A 1OA1A 1SPXA 1J21A 3LA8A 4OQXA 3MWEA 4PRZA 3D3EA 5F9FA 2Y1EA 3H5RA 1MTOA 1WNFA 2FSVA 4HCJA 2E4UA 2I5PO 3N8NA 2ZJFA 4LJLA 1W4BA 5ULLA 1AZWA 3JD1A 5AJVB 3RVDA 1ISPA 1TMOA 2AB0A 1UBOS 2Z4RA 3KFLA 3ZE0B 3ZXXA 4Z7OB 4GSKA 5H9WA 4OCZA 4F8EA 4ALKA 2Q9UA 3NM6B 4M3NA 3BULA 4HH3C 2YIJA 5I9MA 5C4IA 2O0JA 5IUKC 4KQKA 2XKKA 1KDVA 2X7XA 4NJEA 4ZP1A 1JEJA 1EHIA 1C7ZA 3QI7A 1NN0A 1A5AB 1K5PA 4UBJA 4LWPA 2Y92A 1K2WA 1X1AA 3CKYA 4PSAA 5E7MA 2HF7A 4DTCA 4OF4A 3QMVA 2C2ZA 3ESZA 2EDCA 1MVNA 1IHDA 1R8SA 2ZUUA 3FAKA 5LA6A 3SS8A 1I7QB 4MV4A 3MQFA 4FHCA 3K8ZA 4A5OA 3ZD7A 5BQXA 3ILVA 1DDGA 1Z5ZA 1HF3A 2OO3A 3A6HA 3CIFA 4L0DA 4MINA 4UQPA 3OJ0A 4YCBA 3IA2A 4FCWA 5ENDA 1JTFA 1KH2A 1Y1RA 4AXBA 1UKYA 2H52A 4A03A 1DQPA 1HG1A 1TJ4A 1DBSA 5JJCA 3H1FA 2O7NA 1XDDA 2GBPA 3TNDA 3FWPA 3OSZA 3QGMA 3MYRA 3V4ZA 3SC2A 2Z5FA 1OH5A 4LF4B 1UMCB 4KX3A 1RADA 2IZ7A 2AOWA 3ES9A 4OX9B 5JISA 4CQNA 3FFAA 3JVIA 1BMDA 3KXDA 5JXHA 4QGGA 4CMHA 1ABEA 1XLVA 3K6SA 4BX2A 3GFBA 3HQ4O 2GYYA 4C29A 4RMNA 2WAMA 5FADA 4DEVA 2ZTUA 1Y4UA 2V96A 3LQ1A 1P4JA 1DELA 2YJTD 5IKPA 4GNKA 5JALA 1JQJC 1L4UA 2W5UA 3JQ7B 4BIIA 1FFWA 3H2BA 5A4AA 2PRZA 3HG7A 5M7EA 1BWRA 4CR6A 3RAFC 4LG1A 2HGZA 4YVFA 4OHOA 2RGDA 4ZO8A 4D99A 2IC5A 4KGXA 1CJVC 4JI1B 5A4IS 4K6HA 4MVJH 2D74A 1Q95A 1O95C 4XJXA 1I14A 3C7KA 4M0CA 4AG6A 1X42A 2DUJA 3NONA 3CE9A 2WFLB 1N6NA 2BFAA 2B4KA 4J9UE 2JJYA 4Q01A 1UPFA 2TSYB 4PX2A 2X9QA 3S40A 3KYCA 1OXSC 5HPYB 2GLTA 1AKUA 4NH4A 1JR6A 2VJCA 2IHZA 4NAUA 1ZNYA 3PF9A 5EZQA 3PHCA 5JXJA 2JIZA 3GJQA 1ZNZA 4MJXA 4D1YA 3MK31 4HXGA 5IKOA 2H2AA 2RSLA 4GU5A 2UUOA 4B8WA 5A62A 4WKGA 1Z47A 3SE7A 3SYLA 2WRZA 3T3MB 2H7YA 4E5PA 2IZ6A 2H3HA 2CCGA 4HMPA 2P91A 1MXFA 4M8LA 3MBKA 4JENA 1JFLA 4NOLA 5AVZA 1Z4NA 4Q0MA 4H7PA 1DBVO 3G0BA 3ZY4A 4LYEA 4BWVA 1N1MA 4ENVA 3JZAA 1UADA 3IEPA 3OM8A 4PZLA 4ZYVA 3RV4A 4MQ6A 3S2YA 3LE8A 3DDZX 2Z83A 4TN5A 4IDOA 4UAGA 4ZALA 4DV0B 3TDKA 3KOYA 3CEHA 1NNLA 1T5IA 4ID9A 4XOIA 5A6SA 3V1LA 1QYXA 1P2TA 3EBPA 1QB8A 1YZGA 4QLBA 1V71A 4DCPA 4TSFD 1ONOA 2I4NA 4TZTA 4HNVA 3KCNA 4GOOD 4FWIB 2CL0X 1YGPA 2WTEA 3HV2A 4LN1A 4N7RA 3KVVA 1EAMA 2Z4SA 3IP6A 1G41A 4IHJA 4H3HB 4GECA 2V55B 5B58C 5AVUA 1NLUA 5I51A 1K3TA 4MV6A 4KQHA 3DD5A 4RGVA 4Y7DA 3KQNA 3H2GA 2ZJ3A 1QHEA 3GFTA 3WJAA 5E1BA 1YZLA 2YVQA 1SNYA 3CKKA 4QGFA 3RU2A 4BO3A 1KVRA 5CLIA 1QR6A 4IIFA 5JS7A 4DJAA 5KNDD 1Q16A 3DULA 4KK3A 4WJLA 2RHJA 3HCWA 3SEQA 4E09A 2DKNA 621PA 1NC3A 2IZOA 3VX3A 2B6HA 3EVEA 3BSYA 2DPHA 2ZM6B 1ENZA 3ROPA 4JB2A 2R00A 3LRTA 4MUBA 3UOWA 4Z2AA 1BYIA 2Q1SA 3SZMA 4M1WA 4OQPA 1XF1A 5SY4A 1SR8A 1RM3A 1I4DD 1WBJB 4A6PA 4UREA 4F56A 3LLSA 3IERA 4QYSA 4RKEA 3ZY5A 4KW7A 3WBKA 1UK7A 3B48A 4G4SP 5U4QA 2OB1A 1H42A 2FPKA 2P9QA 4L57A 4ZAGA 4OB6A 1JI0A 4IZHA 5LA6F 3EZYA 1F0PA 2OG2A 4MUKA 5E4TA 2AF4C 3U3RA 5CB8A 5I7FA 3I42A 1GJRA 1GQOA 5ITWA 2VRCD 1DSSG 2VNIA 3LHSA 4X00A 5TXGA 4QGSA 3Q2KA 4K9DA 4G4IA 5EEGA 2QBYB 4PAGA 3WRVA 1MAVA 3KDAA 1I7PA 2PLAA 3PE3A 4ZYZA 5JWHA 3VYUB 5LIRA 4DMUB 2PH5A 3IVXA 1WDLA 3BK1A 4CM6A 1CZUA 1QP8A 1W29A 2PNJA 1PSWA 1F7UA 1KZGB 5K03A 3I8XA 2I03A 4FK8A 2QD2A 3RC1A 1UODA 3CZ4A 2I0FA 3K09A 3MWGA 3GEBA 1QQBA 1AK9A 2BTQB 4CNQA 5DN6A 2W2OA 3W1EA 2VUTA 3RSHA 1I0ZA 5TIIA 1SHLA 2HRRA 2NAPA 2ZCVA 3G9XA 4HOYA 1MOQA 2BZGA 4Y6PA 5CYFA 4ZYLA 4BFXA 1Z2NX 4C7KA 1WKBA 5DLYA 1BD3A 2X42A 4PZYA 3ZPXA 2D0DA 1WTAA 1VL5A 2R3SA 3TLZA 1IJKA 2C3OA 2HQ1A 2XITA 3L6BA 2LIVA 3NU1A 2NN3C 1FRNA 1ODLA 4PSKA 5H16A 4BEVA 1IEQA 2OEPA 4N3CA 5GONA 3V1YA 4BQFA 4OKNA 4RFLA 1EX7A 2ADFA 4H6VA 4HDMB 1PZNA 5J5VA 3DJYA 1L3IA 4OGGA 3D8UA 1IH8A 4PGHA 4Z4EA 2AOVA 3GU3A 2DFDA 5BRNA 1DGQA 1PBTA 4YRTA 2QP4A 3O4JA 1GT91 1J0CA 2BGKA 2CCKA 2V7QA 3OZVA 1N75A 2E49A 1MIOB 3GPLA 1JPVA 4I4TF 4R1TA 7YASA 1T9GS 2EEPA 5GJVC 1EFPA 5P21A 2PBZA 1IBMB 5E6SA 2RE8A 4LBWA 4HGYA 3VMFA 3RBZA 1E1KA 3ILSA 1K4MA 1E9RA 2PSFA 3Q8MA 3RRZA 5LZ8A 2BFNA 1QFYA 4ZEOA 1LH0A 1UJMA 3AIMA 1DEOA 5CLHA 3LYUA 1H9CA 1RAIA 1RYZA 4V03A 1MBZA 2NYRA 4PANA 4QODA 1HSOA 3VO2A 1QGUB 2G5GX 4X91A 4IWYA 4RHXA 4L16A 5GOTA 3MILA 4K9MA 1RCFA 2WMOB 3ONEA 5DTJA 5HBGA 3OHMA 3UHAA 2HX1A 2XGMA 1RFGE 4LE2A 3IL2A 1NPDA 3WAJA 1E9SA 1U3TA 1CR2A 1QH9A 1Q0LA 3DAOA 3OTIA 3ZVKA 1XROA 4E30A 3D9QX 3QLUA 2ZZKA 4CLRA 5MDHA 2MR6A 4F6RB 2YOGA 1D2EA 2QVGA 4ZI2A 4M76B 3RAEC 1DCMA 1W88A 3NDIA 2QGNA 3G79A 2FKAA 4KN5A 4NYIQ 4XWGA 4KPFC 3ZLUA 3ZWYA 4D26A 1OXKB 1E6MA 1T8SA 3KYDB 2HNBA 4MGHA 5LB2A 1Q83A 2WYUA 1XTPA 4HR7A 2IXGA 3NRCA 3INRA 3AUSA 3KX2A 4P0QB 3RR2A 2DQ4A 3ANSA 4CTJA 4RJ2A 5BUCA 3FUUA 3E03A 1EI9A 3W5VA 3DNPA 4ZAFA 5EXPA 2D1SA 1Y4AE 2VBIA 1SXHA 2X58A 4UQOA 1G20E 4BBAA 5EIEA 3MJSA 1NY5A 4HYYA 1EFHA 1P1FA 1TX4B 1G5PA 3KQWA 4FCTA 3MJFA 4KNVA 4LYJA 1FXSA 3CNHA 3P9RA 4O0LA 4BO0A 1YQEA 4Y1FA 3M1YA 4EUHA 3S8YA 4ZV9A 3TLAA 1GPUA 4UAVA 3QFTA 3QYPA 4A82A 2CNNA 1KO5A 1O94D 1ODJA 3LVQE 4M1SA 4URHA 4OAOA 4C2UA 1UP4A 5AXDA 2JVKA 3JQFC 5BVGB 4G0NA 2IZ5A 5DHTA 2XUZA 3G7SA 1FMTA 5D00A 3TIGA 4BNHA 5B36A 5K8IA 1NIPA 1ENYA 1QIHA 2FPWA 2AUMA 4QJIA 1DVRA 2UYOA 1JTEA 4DSOA 4BMYA 5CB4A 1G9SA 2J6CA 1RI1A 3GEMA 1NMZA 4LZAA 4NS1A 1ZUWA 2VP6A 1LY1A 1EFLA 2FJ0A 5IYZB 2C88A 3TLCA 5KINB 3MYYA 1ZH2A 2G88A 1TEXA 1S2GA 1U8AA 1DRWA 1E98A 2FSIA 1U2QA 3KFVA 3O8QA 4PYQA 3T52A 4B6JA 3CRMA 2YYYA 4RLHA 3C98A 4HLNA 2PSJA 5ECDA 4BO2A 2D5LA 1FYXA 2PRIA 3L84A 2VP4A 3H1EA 1IY0A 1DG3A 2AK3A 3WYFA 3BMNA 1I6LA 2R79A 4WERA 4K3UA 3AC0A 2FP4B 4AZ0A 3HU3A 4B4KA 2PANA 3T3HA 4D80A 1Q92A 5KU1A 2F59A 1AKTA 3LX4A 2KB0A 2OAEA 4FDMA 4ZZ0A 2RCNA 4HLUC 2VCEA 3R4CA 5C80A 5SICE 2QZSA 3DNMA 4MLZA 2ZUFA 1H9AA 4Z1OA 4YAGA 1NOKA 2YZMA 1U3DA 3GO4A 5AI6A 5ENVA 3AVXA 3KTAA 2O6LA 2J1LA 4S1TA 3EZNA 2OBFA 2C8JA 1PQUA 5IU6A 1WHTB 1CPYA 3V55A 1O97D 2BCJQ 3NT4A 5C7OO 2OBXA 5F7ZA 4BNLA 2D1FA 2EU8A 3ZJTA 4CMAA 2WQ6A 2HSGA 3KJZA 4KBYA 2JLYA 3G5TA 4Q00A 4EY3A 1V9SA 4EGQA 4DUZB 2EIHA 3UHFA 4BMCA 2J3DA 3C3MA 4EPWA 5F7OA 1F6DA 4EG8A 1QAOA 3LU1A 3VYSB 4C22A 1GEEA 2O5RA 5ITZB 2Y99A 1JA9A 5GONF 3TZLA 3IPLA 3M5CA 4F4FA 2VH2A 1OLSB 2C4MA 1KZ9A 3H3XA 3WIVA 1U8ZA 1MB2A 3QLVC 3TGLA 3UO8B 3ZX4A 3LI2A 4HZIA 4RIGA 4W5TA 3BH0A 2C77A 4ZOLA 1R4NA 5IT0A 2DHDA 5CVVA 1Z5PA 1IXRC 1CUXA 1DWUA 2KQUA 2CLOB 2W2QA 3KBBA 1FVHA 4LOLA 1UEIA 2ZLBA 2V0CA 3N9IA 4GC9A 4KREA 3MPOA 2R60A 3CW9A 4Y2PA 4Q3OA 4QPZA 5IAAA 3PQ2A 4ZI5A 3I01M 4GGOA 1VA5A 1SBYA 2DU8A 1DC4A 1FMJA 4B81A 2RGNA 2CGEA 3AJRA 3UK0A 5JNTA 1CY7A 4DMHA 1OBOA 4OU4A 4I1PA 1AXEA 2GAFA 2OXEA 1YULA 2I6SA 4LDJA 4OGKA 1L4NA 5AK6A 1TJ3A 4PWZA 3W2HA 2PYIA 7ABPA 5JSQA 1AHPA 1XNJA 3DQQA 3DW3X 1X0VA 3P2EA 4W63A 3TIXB 3FTDA 2YX1A 1Z4PX 4YCDA 4D41A 4LISA 1M1YA 4D96A 1G63A 2FXVA 1NC1A 3JWIA 4OQNA 2UZ4A 1ZD1A 4HADA 3HUUA 5CX4A 1RI4A 4UNSA 2GNAA 2R68A 3ZKWB 3ROTA 1GTSA 3HVHA 2ZJ2A 3KEGA 1M1NB 2JCGA 3LCUA 4ENQA 1P0QA 3VM6A 5BPHA 2X5NA 4ZMSA 1N6IA 3NOXA 1W49A 2OZVA 3KV3O 4CIBA 1QANA 1Z6GA 3EPRA 2KPOA 1HLFA 5EY5B 1VRWA 4AJKA 1Y8RB 3T7EA 4ALNA 3W8RA 1RC0A 4I4LA 4NDNE 4X64B 3BSWA 2M6LA 1A2KC 1OYVA 1FBNA 1Q0HA 4KBFA 4YGYA 3DZIA 3AETA 3VISA 1R3DA 3WB9A 3T7JA 1EKXA 1T8PA 3K1AA 3SJUA 1HFJA 3B3AA 2WU4A 4XARA 5AW4A 3JVDA 1KTIA 3IEIA 4D3DA 2G63A 2WFZA 4XVRA 1Q14A 3DCNA 1JKMA 1SGWA 1VG1A 2W71A 5A5GA 4GZ6A 1AF4A 5EPOA 5NLLA 3N0TA 1XTUA 3JARA 1ODTC 3EBOA 1TADA 3A9RA 1RAAA 3RFXA 2NO6A 2XCOA 2NOAA 2C7GA 4R8VA 4B6QA 5BYAA 1Y5RA 3FRHA 4BNIA 5JOQA 4IDNA 3GDWA 5C0OE 1SK9A 1IUKA 3REQA 3VJKA 1P7YA 2HYDA 1YR7A 3AR3A 3KPVA 3O8LA 2PGJA 1KMQA 2J3QA 2H11A 1MC1A 2PGIA 3H9EO 4LEIA 4TWIA 3IQHX 4L5JA 3FI9A 3U7IA 4LVCA 1JVSA 3O3NB 4DXHA 3R0IA 5TMBA 3G2MA 4AWXA 5ARDA 4EYQA 1GUYA 1ECGA 1NATA 3I2FA 5J43A 5AXCA 2YR0A 5G4KA 3ZUPA 4D4KA 1ZK0A 5EUBA 1M72A 1JLSA 4IMPA 2JFZA 1SQSA 4B71A 5D3MB 3SZOA 1O95D 1UJ4A 3RSFA 2XVXA 3LUCA 3HDGA 2K6GA 3A6FA 3NVDA 2P9FA 2IKQA 1PFUA 2HK7A 3FDXA 1XTTA 3D7LA 3EXG2 3HUFA 3UAWA 4E03A 2AXPA 2AS0A 4RYLA 1ML3A 3EUAA 1CJTC 3MWLA 1U2RA 4QSMA 4QREA 1D7AA 4MRRA 3VUFA 4R71A 4G37A 4WEOA 5KOIA