5LVAA

Crystal structure of thermophilic tryptophan halogenase (th-hal) enzyme from streptomycin violaceusniger.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
174
structure length
174
Chain Sequence
MKVLVLAFHPNMEQSVVNRAFADTLKDAPGITLRDLYQEYPDEAIDVEKEQKLCEEHDRIVFQFPLYWYSSPPLLKKWLDHVLLYGWAYGTNGTALRGKEFMVAVSAGAPEEAYQAGGSNHYAISELLRPFQATSNFIGTTYLPPYVFYQAGTAGKSELAEGATQYREHVLKSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NAD(P)H-FMN oxidoreductase
publication title Structure and biocatalytic scope of thermophilic flavin-dependent halogenase and flavin reductase enzymes.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 62
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5lvaA00
4XDHA 2X2OA 2ZKIA 4J8PA 4ZVLA 3P0RA 4C14A 1ZWLA 5LJIA 4DY4A 4ZVKA 3HA2A 4QOIA 3K20A 4FX2A 3W7AA 1AKTA 1YOBA 4F8YA 5TGZA 3KEGA 3B6KA 4LTDA 3U7IA 2N1MA 5FA6A 5EMNA 4U7HA 2Q9UA 2OYSA 3ZHOA 3QFCA 3RPEA 3N39C 4QODA 3W79A 4ESEA 5LJLA 5NLLA 2W5UA 4U7GA 1D04A 2MTBA 4LTMA 2FOXA 2QWXA 1J9GA 1QRDA 2B3DA 2Z9CA 3O2NA 1DXOA 3FNIA 2FCRA 1D4AA 4FGJA 1BVYF 1AKUA 4FGLA 1AHNA 1X77A 1GG5A 4BMOB 2FX2A 2QX9A 1C7FA 1E5DA 1WSWA 4C0XA 1RTTA 1RCFA 3OJXA 3GFQA 2AMJA 3SVLA 2V5VA 2HNBA 4ZVNA 3OVMA 1RLJA 2Z9BA 1WSBA 4YAUA 1FVXA 1AG9A 2OHJA 3O73A 3FVWA 4Y7CA 2FZVA 2X2PA 5LBTA 5A4KA 2FZ5A 4YAWA 2Z9DA 2XOEA 2FDXA 1CZOA 5LMCA 4QOJA 1DX9A 2QX4A 5EAIA 1SQSA 4YALA 1FUEA 1TIKA 3OX3A 4H6PA 2MT9A 1AMOA 3NHRA 4C76A 4N65A 3ESYA 2MWMA 3GFSA 1CZHA 5LLDA 1XYYA 2Q62A 2HNAA 3W78A 5EA2A 2BN4A 3NHUA 1FLNA 1H69A 2QR2A 4ICIA 3GFRA 4YAOA 5FUQA 3U7RA 1OBVA 4S24A 2QX8A 1XI2A 2V9CA 3F2VA 3NFRA 4M0CA 3B6MA 4HEQA 4Y9RA 3QE2A 3D7NA 3JSXA 1B1CA 1OBOA 2QMYA 5F12A 1JA1A 3ES9A 2BF4A 4H2DA 3TE7A 2M6SA 4DIKA 3NHLA 3G5MA 1CZUA 2V5UA 4CETA 2RG1A 1F4PA 1YDGA 5F51A 3NHFA 3TZBA 1DXQA 3NHWA 1SG0A 3ESZA 3W77A 3R6WA 1C7EA 4PTZA 4QOFA 5BUCA 1T5BA 4OXXA 3EYWA 1OFVA 2QX6A 2FLVA 2BMVA 4LA4A 5NULA 3KAPA 3N3BC 1NNI1 3NHKA 5ULLA 4R81A 2D5IA 3OWXA 1CZKA 3ESXA 2KQUA 1D03A 4BMPB 3OJWA 4CF6A 1FX1A 4YQEA 3FW1A 4QOGA 3KAQA 4LTNA 1CZLA 1TLLA 3LT5A 3K1YA 3NHPA 3NHJA 4N9QA 3UXEA 2R97A 1QR2A 3OWHA 2MOKA 2A5LA 1AZLA 2F1OA 5LVAA 3OX2A 3N3AC 3B6JA 2Z98A 4PU0A 2WC1A 4PTYA 1CZNA 4Y9UA 1AKVA 1J8QA 1J9EA 2BZSA 1FLVA 2BPOA 3UXHA 1QBGA 1BU5A 1JA0A 3GAMA 2OHIA 4C0WA 3NLLA 2FAXA 4GI5A 1XYVA 2FVXA 3NHYA 1FLDA 1YRHA 1FTGA 5B3KA 1I1OA 2HPVA 1ZWKA 1QHEA 1CZRA 1YCGA 5JROA 2ARKA 2KLBA 2OHHA 3QFRA 1KBQA 1J9ZA 5FX2A 6NULA 4D02A 2M6RA 3F6RA 4GQIA 4YAFA 1AKQA 4GR9A 4U7FA 2XODA 4NLLA 3EDOA 3B6IA 3FX2A 3LCMA 3HLYA 5LBUA 1T0IA 3F90A 4QOHA 3FJOA 4QOEA 3L9XA 4LAFA 1VMEA 3NHSA 4DILA 4XDGA 1ZX1A 2QMZA 3HR4A 4NULA 4FGKA 1FLAA 3TEMA 1YCHA 1RLIA 1XT6A 1AKRA 3F6SA 3OX1A 3S2YA 3KLBA 5F4BA 2R96A 1YCFA 1V4BA 1YKGA 5B3LA 4ZVMA 1KBOA 1H66A 3L9WA 4N82A 4HS4A 2GSWA 1AKWA
chains in the Genus database with same CATH superfamily
1XDSA 4I14A 3FCSB 2IH4A 5AKZA 2V5AA 1KTVA 1V4VA 1JQAA 4KTVE 3DLIA 3G2MA 4Q3OA 2QVGA 4QNRA 3EYAA 1IOVA 5H1YA 4HN9A 4LXXA 4FEYA 3LT2A 3Q87B 2NYAA 4AJOA 3P0IA 2DWPA 3MUFA 5BQ3A 3IQIX 3NDBB 3FDZA 1R66A 1ZCBA 4OYRA 3AR4A 4E7OA 1E6LA 3NM4A 1E79D 4RENA 1JU9A 2WKRA 1QBKC 3SDSA 3UPUA 4DAOA 1A5SB 4B80A 2BFBA 3RU2A 5AVKA 1M34B 3IESA 1E4YA 2OCKA 3ZDEA 5KBYA 2CFCA 1NLZA 3H1TA 3SLGA 1DE0A 1JLSA 3IB6A 2JGNA 2ZAIA 3DS8A 4TL6A 1D4FA 1ZJ6A 3RSSA 1LPBB 3Q8KA 4B3CA 5L6MB 5JCJA 1KRWA 2ZYHA 3KR2A 4DV6B 2QTVA 3VR5D 1FK8A 2HFJA 3WDKA 4FUTA 3A3PA 3TLBA 3WGOA 1L7RA 1P1FA 1JLHA 1ODLA 1ZMRA 5AW9A 4PAMA 3OIFA 3NC1C 2DYKA 1P17A 1V5EA 2GD6A 3D3WA 3IEPA 3I9MA 3IMCA 2AB0A 1RSZA 2CB0A 4XLZA 4M38A 1P74A 2V54A 3EMDA 4PPNA 2W6MA 4D4LA 3WRXC 2AFHB 3V4ZA 5IJWA 3OA0A 5JNSA 3Q10A 5JNTA 1LVUA 4ND6A 1RMYA 4BAGA 2FEWB 3AXSA 4CNBA 4RTLA 1ZJ5A 1ZZEA 4AMUA 5FPPA 3WYCA 4O4HB 2DWQA 2OT3B 4RLQA 4DDVA 1VSVA 1EFPA 1L8OA 3A1NA 3CISA 4R6WA 3ZE8A 2FZKA 2VP6A 1NTRA 4HZUA 1KDYA 4Y2VA 2Z09A 1Q7GA 1Z2EA 3ROKA 5BNTA 3PP8A 4OUDB 4C6RA 3W5BA 3L46A 4UHJA 3GLRA 3V7NA 2VJAA 4DT1A 1SCDA 2G4CA 2OB1A 2K7FA 1W5SA 1QLWA 1HEUA 4RF2A 5FL7A 1FJGB 3OKFA 4MR8B 3QWHA 1K3FA 2C0PA 3J7AC 2Q46A 5H8WA 1GZ6A 4ED9A 2BJWA 1X9GA 1IPHA 3LK6A 3EBLA 2F17A 4F93B 1OREA 3BMOA 3S8MA 3OTQA 4LS3A 2CYBA 4X63A 5CNKA 4CQJA 4E21A 4N7MA 4ZZIA 1VLVA 1IWOA 1RIIA 2FW8A 3KELA 1PD1A 3T3PB 1DO2A 1BZYA 1CNMA 4IDGA 1NBEA 4RDXA 4POOA 2I7VA 2OQ2A 3DAHA 2I55A 2LXNA 1LCIA 1QWOA 4HWPA 1PR9A 4PZDA 3V7UA 1SUIA 3U7FB 4GP6A 2EIHA 2QY6A 4I4CA 4XAQA 4YCDA 2F2TA 4DXHA 4ETIA 4E33A 5I7VA 2OHXA 4MYTA 4BNYA 2LD4A 8ABPA 4ZCMA 1EK0A 3X2FA 3IRUA 1QYWA 2F4NA 1Z06A 1ISIA 1MQSA 2XUOA 3GVIA 3G79A 4UCWA 4BMOB 1G2OA 3PWSA 1U1GA 3G0BA 1UMBA 1R18A 2P4HX 1XUOA 2HSEA 2NTJA 5JSKA 2QX9A 2I71A 2XGSA 3Q41A 4X20A 1U0OC 4FX5A 1CD5A 4EFKA 3CV3A 3ZDYB 3LBAA 2J41A 4FZ5A 4URXR 5IEJA 4NK4A 1GGKA 4D5EA 1S3FA 1Y8QA 4XUDA 1ZI9A 4S1PA 1AB6A 2DT5A 3PDJA 2BM1A 1S5PA 5EHQA 3T7KA 4DCJA 1KK3A 3BG5A 4MVJM 5A5VA 1BXRA 2BMJA 4G1BA 4OP2A 3FWNA 4D3FA 1EDZA 1KZ1A 1BFKA 2WINI 4LF5B 3TI9A 3TL2A 2XZDA 3ZHRA 5I4IA 1O95A 4UTZA 4LHXA 4ER7A 2QBYA 4LV8B 1ZS9A 1XLWA 3DOJA 3OLXA 2ZXFA 5DSTA 3QE0A 1QANA 4E70A 2OMEA 2R85A 5GTDA 5JMOA 2AV6A 2VNSA 5HKKA 1GKKA 1ONBA 1PE0A 2QAGB 1S2GA 1U2ZA 3H1GA 4CMBA 1RLJA 1D1SA 1KRHA 1XTJA 6GPBA 3PFBA 1JIIA 3VVLA 1EK1A 1Z13A 3DFMA 2O0MA 2EDCA 3DC2A 4UXIA 4DVGA 3ZXUB 1ZVJA 2PA3A 1P5RA 2FE1A 4NU5A 2W7TA 3R3HA 1VIAA 2XE4A 1P8AA 1H8ED 4XI9A 3P32A 4HDSA 3FB4A 3VH3A 1IEVA 3H9GA 4G63A 5T41A 3S29A 5KX5F 1J39A 3ESQA 1Q50A 5LXTF 4B75A 4TLDA 1UZUA 2I8AA 4FHDA 3WO0A 4PGAA 4NBTA 1C1XA 2WQZA 3AZQA 5CEEA 4UC0A 1PDVA 3AOGA 1HE3A 3RVSA 4R8KA 3B12A 4BNGA 1FRFS 2Q3DA 3AJ9A 4RX1A 3S2GA 4UUPA 3SE0A 5H59A 2BFOA 1G8JA 2EP7A 1NP7A 2WNIA 2A9VA 4M8LA 1V7CA 3I1IA 4OMDA 1W5AA 1IN7A 2YHIB 3T5BA 4FDVA 3GXBA 3L6BA 1TIKA 3OX3A 4JR2A 4L4UA 3U31A 3GZTB 3LPAA 2BE7A 1WW8A 4FFOA 3ZGVA 3DOHA 4LRTB 4LVNA 3R7FA 3NRJA 5AKGA 4M88A 4NCKA 3STYA 5ARBA 4PICA 1LS6A 5CRIA 4C76A 4DM3A 1P1CA 1QH8B 1XLTC 3HEMA 2GT1A 3QSGA 4JT4A 4AKSA 2VRBA 3PNVA 1ZGAA 4Q47A 5DP2A 2NN3C 5KKAA 3G1UA 2P5YA 3V8QA 3C4VA 3TOVA 3I9V6 4YCMA 5KNCD 5KTSA 4C7MA 5BN5B 3Q8XB 5LLDA 1R4NB 3JQ7B 2A58A 2CY0A 1FS6A 1PEAA 3KO8A 13PKA 1VKRA 3QOYA 4L08A 1K8QA 4LDZA 4WN9A 1G5RA 4R7GA 5AUQA 5IW8A 4MW4A 4NX2A 1REQB 4DLRA 4DNXA 1TL7C 3GLVA 4G4GA 2EWVA 3KZOA 1IJKA 2G1UA 3E9MA 3ZWWA 3BE5A 2W11A 1XTTA 3JQ8B 1GTJ1 3MJFA 5E9AA 3R5SA 3AR5A 5SY6A 5CFOA 1Y82A 2B4KA 1PR2A 3WWYA 4ICIA 1HV8A 1ULAA 1ZEMA 3A10A 3GFRA 3PS9A 3LO5A 1MENA 1ZA1A 3WL6A 2FEKA 1CS0B 4LHEA 3UG7A 3EXEB 1YI0A 4PSDA 5JS8A 3LXXA 3L8ZA 2OXIA 5CH5A 3K2BA 3ZDZB 1ZUNA 3ZGOA 5U4QA 1V26A 2O2EA 1M2VB 1QFJA 3GG2A 3JQ9A 3MRTA 1WU7A 4JY7A 3TTSA 3OEEA 1OKKD 4G1EB 5TF4A 1PJAA 2CW5A 2NZVG 4ZVTA 1A9QA 4INOA 4QXPA 4L9WA 4HEQA 4JQYA 5E1DA 5KQLA 4GEKA 5FA8A 2QGZA 3M1LA 1GKLA 2OV4A 3O84A 3JWGA 1TIPA 3M89A 4L3OA 3WB9A 4BP8A 4DDKA 4EKNB 2F8MA 1G21B 1H23A 2QUHA 2PYIA 4MKFA 3VTAA 4AJJA 2R9VA 5ALZA 4CT5A 5ITZB 3AJEA 2W70A 3EH1A 4PG4A 4UDYX 1H6CA 1O89A 2NZUG 1GZ7A 3WAKA 3LQ1A 1KK0A 4FBMA 2H4WA 1GG2A 3GGPA 3U7EB 5C37A 1JEQB 3EB9A 4EPRA 3HUUA 4COKA 3TCKA 2QXUA 4PF1A 2UZIR 4LEIA 2I2XB 4JQSA 3R6LA 1OZAA 3OESA 2SCUA 4UZEA 4AD8A 2IHZA 2JATA 3K30A 1R9MA 4TS4A 2P9CA 2I78A 2QLFA 2E7ZA 2RKWA 3PK0A 1MABB 4U9IS 1JEYA 3JRNA 1U7UA 4AKTA 4Z4HA 2H9YA 2ZRPA 5D1NA 5C7YA 1XCBA 4DV1B 4MP8A 3PNPA 1UKCA 1W0JA 3CKLA 5FADA 3PUJA 2XD4A 2F67A 3TZKA 4RTOA 3QLVC 2ATEA 1YZYA 2IOYA 3AY6A 1QQTA 3JAWB 5BV7A 1EWVA 1KGDA 1R6DA 2IHJA 5I51A 2D8AA 4AM8A 3LWDA 1SNYA 2QJTA 3KHKA 4WLNA 1N75A 3N8KA 5PNTA 3SC3A 3C5WP 4KVAA 2HA7A 4YCLA 2XZPA 5D01A 2BMVA 1QGUA 2XYGA 4ARUA 1L5OA 2H7VA 3THWA 4RM3A 5BWNA 4RS4A 4YHHB 3NVKI 3E2PA 4TWBA 2EX1A 2ECKA 4TSFD 1AUQA 4MEAA 3A7DA 4QQKA 5IAJA 1Z4NA 3J81A 5ULLA 5KWEA 2XIQA 3WHPA 3FCEA 2DRIA 3QBEA 5D6OA 4I5IA 4B6RA 4ZZ1A 3ESXA 3GN2A 3X2EA 3ANYB 4C88A 4GM0A 3PHHA 2JIZA 1L4HA 2IYFA 4MUGA 5I9BA 3X2SA 3RSQA 4NYMQ 4EK9A 2QPOA 4U5XA 3P9QA 3AONB 3GGCA 1UC4B 1Q16A 4X1IB 1XAJA 4LW8A 4A1OA 3QEAZ 4DCSA 3FOFC 3DC7A 4RVCA 2X0EA 1JIQA 1JBQA 4CIXA 3RRXA 2RGRA 3ZIAD 2INGX 5JSUA 1OXMA 3OU2A 1NF2A 4YO8A 4E4TA 1NJ8A 1XRPA 1U28A 3AWIA 4CV2A 3KFXA 3W1WA 1ZUWA 1Z5UA 3K5WA 1LFDB 2QT1A 2OAEA 1PK9A 1YIDA 3EC7A 3H2BA 4EG1A 1UUFA 1CFJA 1ESMA 3B1JA 4W7IA 3ZWPA 4MLZA 2BGLA 3DM9B 3WGGA 5DI3A 1BGXT 2GYYA 3A4YA 4IIDA 4BZZA 4O4IA 3UK2A 1G8SA 2WF9A 1XEAA 1R12A 2PNJA 3ROFA 3V48A 3KQOA 1Z62A 3HXPA 4G25A 3KTAA 1R6AA 4HXYA 2PVCA 4KPUA 9ABPA 1ADJA 1KYVA 1NOIA 2I4IA 3D6MA 1M8GA 4S1WA 3MCVA 2QTZA 4HV4A 2H63A 1QOPB 2X1MA 3TMYA 1UMKA 2FSVC 3ZW7A 1CUAA 4LC1A 2BI7A 5IJ9B 3W3AH 1LC0A 2YWBA 4NV0A 2CXQA 3WICA 4E5VA 1SWWA 4LRQA 2YC2C 3BERA 2FHPA 1RXVA 1TAQA 5BV0A 1NC3A 5KTYA 2PLAA 2A33A 3BJMA 3UANA 2BUBA 4C6TB 2FWIA 1COZA 3QQ5A 2J7PD 4B45A 4IM7A 4OBBA 3VNQA 3SF8B 1XRQA 1ZY2A 1UWVA 1OFTA 4LMAA 4CG3A 4BXOA 1V6SA 3PT5A 1ISMA 4ZJZA 4CIAA 4R2MA 1A9PA 2YV4A 3PGA1 3DBOB 4DA6A 2QL7A 4D4JA 1GZSA 4DV3B 3KKOA 3B85A 4Y0NA 3NHYA 2PTHA 4N8EA 2WZQA 3OTOB 3EFEA 5BURA 4FTWA 2Q2QA 2PMEA 2HLNA 3TIVA 1UKAA 2OENG 1RPNA 4PX2A 4BPRA 2HPVA 4TVKA 3O3CA 1Y4AE 3OHPA 3QKTA 1H9CA 5EIHA 1RYZA 2GPWA 1K68A 3DYVA 3GV0A 5LP6C 2ARKA 7MHTA 1L7AA 1RD4A 4N0EA 3QKIA 4Q66C 3G9ZA 4R9NA 3HV0A 1E59A 3W7VA 1P75A 1R27A 4G65A 2A67A 2VN8A 4LHZA 4R6XA 3X1MA 1OVGA 1BMFD 1QVZA 5JFOA 4US0R 4N47A 4C7JA 2I8LA 4BNUA 2HBYA 2WPDD 1EDBA 3LG2A 4AICA 4ZU3A 5KTRA 2DBQA 1MOQA 3N8IA 3WK8A 4RF5A 2FPPA 2D4HA 4RKEA 1SUCA 4C0BA 3TZCA 2XTJA 1VKZA 2NSYA 1TJ3A 2ZJBA 5JCZA 3V2UA 3O8RA 1UC9A 3RFCA 3X1ZA 4DFDA 3EFBA 1OI3A 3IV7A 2QN3A 1Q44A 1QHHA 4IHJF 4UNNA 3TR5A 5A7FA 5FBVB 4DCNA 5J2UB 4JLUA 1UPFA 2J85A 4TPKA 2FWAA 2OXTA 1MH9A 3P8ZA 4NFLA 2EFCB 1A9XA 5AUOB 2AR0A 3MINB 3MD0A 1UPTA 4XD2A 4ZN6A 1O94D 1ONOA 4OA5A 4Q7MB 1KQGA 3AEZA 2X5NA 3MCAA 4UEKA 4K3UA 3G3EA 3LFUA 3ROQA 1DIBA 3OZDA 4IAOA 2XRMA 3PA6A 5CFZA 2X76A 1K27A 3LP6A 3T7IA 3MILA 5KO2A 3EISA 3NHSA 4YAJA 3B1FA 3I12A 3L5KA 2FW7A 3HDVA 1EIZA 4IJQA 1C1YA 1DTSA 3AI7A 5F73A 1GNPA 3CX7A 2ZSDA 5FWAA 2DUNA 4BVAA 4G24A 5AJTA 4M8NE 2H06A 3DMTC 4EW6A 1SULA 3UT5A 4D97A 5H81A 1D4ZA 2QTWB 2CJYA 3H5LA 3G1WA 3P94A 4LYAA 1K9VF 5B7GA 3P1JA 3CZCA 3E0XA 4I1VA 4JIGA 1PSZA 3ZVRA 3O8DA 1DTEA 3IOCA 5JAOA 1ZUIA 3E8MA 3V8MA 1N6PA 4OGWA 4QGGA 1QPZA 1K08A 4TYYA 4F4HA 1EI9A 2K6GA 4TT8A 4Q4HB 1Z0IA 4LZZA 2JFPA 4UXHA 4WE3A 4V0RA 3V4PB 1DLJA 1Q0QA 4UTRA 2AX3A 2JF0A 2XUDA 2FEXA 4GC5A 4M22A 1VYHA 5E3IA 4B7AA 3LSYA 2R96A 4B4VA 2X6TA 1ISPA 2V96A 5FBRB 2PUCA 5FUXA 4HDKB 5BR1A 1AK1A 3R6DA 3A37A 1GUYA 1RZVA 3RVJA 4YMIA 5K09A 3W6PA 2XCUA 3OO0A 1I0LA 5EJIA 2QD1A 1TA4A 3HUDA 2CC2A 4JD5A 3A2MA 2JGFA 3VV2A 1NVDA 5LWQA 2JLWA 2JANA 4MEBA 2VCHA 1DOZA 1WS6A 1ZH8A 2J5XA 3NHAA 1JP7A 1TC1A 2VHYA 3OPYA 4WL0A 3WZMA 4ZV7A 2V55B 3F8WA 1XRMA 1EFCA 3L93A 2VDOB 4OHOA 4RPCA 5F98A 5JBNA 1CWUA 1NAHA 3NCTA 4I4TF 5ER6A 4L6IA 5J23A 4GVLA 1OX6A 1V16A 3WK7A 4P84A 3ZHYA 5JFTA 4Q9LA 1ORDA 3NAGA 5LJIA 2JIMA 2EVWX 4QX6A 3KE8A 1JSXA 4WY5A 4DY4A 2GD2A 3MTBA 4EHIA 4QELA 3AUJB 1Y6RA 2W00A 2C3MA 1AGPA 3H4IA 4Q1BA 1KC1A 3IQEA 1YOBA 3HI4A 1SIWA 4A92A 2G7ZA 1N9GA 1U9JA 2EKDA 4QGAA 4K87A 5IM4F 3GPLA 1T6YA 5D85A 4JEMA 3ZK7A 2ONZA 2TSYB 4XDYA 4R8MA 4ZTUB 5AXCA 1JI0A 1OFUA 4U63A 4G1VA 2IU0A 1U9ZA 5DHSA 4MI3A 5JFGA 3DMFA 3QI7A 1HNWB 4CR7A 1KYTA 5ELXA 3PLRA 3TBFA 1IQRA 1OLSA 4LJYA 4LQDA 1I6KA 1MR3F 1SKMA 4OO3A 4K6OA 3OZEA 4D4KA 1GM5A 2HLDD 3OM1A 2WY2D 2DY0A 2I1QA 2BFCB 4OHPA 3OJCA 3CSUA 4TMVA 4W5HA 3VRHA 2F3UA 2W2XA 1JALA 3SZMA 1JJBA 1VE3A 5CYGA 5CVVA 4FD2A 3NYIA 1SMKA 2FPSA 3M0EA 3OUTA 4I1IA 4D3ZA 3ONVA 2YNMA 5NLLA 3S4YA 2MIIA 1HE4A 3ZCQA 3JATB 5D3ZA 2PGAA 1E4VA 4RVSA 1V41E 4YRZA 1TZMA 3IBFA 4ZYLA 4P58A 4DW8A 4RC9A 3FDXA 2IU6A 3GLUA 3D3EA 5LL6P 2C7RA 1PWXA 4UZSA 2ZXUA 4B81A 2X19A 3AXTA 1F6WA 2DPXA 3KKNA 3RSFA 1FP4B 5KZMB 2QL6A 1XTBA 2TRSB 2R47A 4L7VA 3B82A 3RVBA 2PE5A 1IPEA 4ND8B 5DHAA 1KERA 2ODBA 3K5IA 4P4SA 3TOSA 4V1CB 2J4CA 4O2BA 4RK4A 1VI2A 3IJEB 1LNQA 3MVEA 2G36A 4JT9A 2H0QA 3PLAE 2HA0A 4XB2A 4RFSA 3BD7A 4FK8A 3EGIA 1JYSA 4LKRA 3PFWO 4C0HA 3DGFC 4GZMA 3GRYA 2OZPA 3ET5A 3PHCA 3WWOA 2BKLA 3FMOB 3QKRA 3O9MA 3F9RA 3K0HA 4GPTA 1GTZA 4FT4A 4IWYA 4U3JA 3NKLA 3FWHA 1FYXA 1QO0A 1R15A 5AO9A 4YRJA 5TEWA 3OZGA 4O5OA 1C5KA 3UUFA 2Z8YA 4ZCPA 4MW5A 3VV3A 2Z5FA 4AW9A 2J31A 3RGWS 4C22A 1Y98A 4BKUA 2NZWA 3ABIA 2IHBA 3E9YA 1WXWA 3RYHA 3QV1A 4XQ9A 4F5EA 2VUUA 1JEJA 3D5TA 4OXRA 1GPUA 3NMUF 2QTHA 2VIIA 1B15A 3AETB 1PZXA 1RRPA 1WF3A 1XXHE 1YZHA 5I8ZA 2GXQA 5K2MA 5SV2A 2PTGA 3ZWQA 5HJEA 3M6FA 4CKYA 4R8LA 1Q91A 2GQ0A 3WGKA 2AXEA 1FF9A 1NV8A 4PYKA 1QFYA 5CLFA 5AVJA 4TZ6A 2JAWA 4EG3A 1OYVA 2EZ9A 1KI6A 1XZNA 3IODA 1QX4A 3TUZC 2V6BA 2D7JA 4DIFA 1S8OA 1SOUA 2ZSKA 3DVSX 3FXAA 2ZBUA 3UWMA 2BONA 2C5HA 2CBGA 3F3MA 3D6FA 4FFPA 1FMCA 2J3LA 2R8OA 1L0BA 2PZBA 3UAOA 1EJ0A 2BGJA 1DJOA 4CG1A 3ELDA 2MJLA 1UOQA 1XXHA 2JLQA 2DT8A 2ZUVA 2YIJA 3ETJA 4MUXA 4UKDA 4GGMX 3PWTA 3AW8A 4ZVNA 2A30A 5A3SA 5THQA 2WFAA 1JHAA 1L2TA 2ZJ8A 4GX5A 3NASA 2NUPA 3EQ2A 3ICVA 1LH0A 4IQ8A 1P0QA 2ZBFA 3TD6A 2WVAA 4DZTA 4YAUA 3JTMA 4I8DA 5FWYB 5J2TF 1JYEA 3KQNA 3A6HA 3Q9SA 2QRVB 2C5BA 5JWOA 2WD7B 1A96A 3FVWA 1U1CA 4KMOA 4QXRA 4M8SA 1PTKA 3G0DA 3PG5A 4H1TA 4HDAA 5JZSA 4PIVA 3TLJA 5A4KA 4UBOA 5BSHA 4Y30A 2PQ2A 1S8AA 2JLCA 5FAKA 2CL6X 2R4QA 1EHIA 3DE3X 3KXKA 5I4CA 1GN9A 3FSRA 1M6VA 2NPOA 2OCBA 1C8VB 2G1AA 3HZZA 1TMGE 4GMXA 4M0PA 4P31A 3TZLA 3VI3B 4B8ZA 3T54A 1E4EB 2BOVA 2O0JA 3T5DA 2XVMA 4F45A 1FL9A 1TEZA 3L05A 5BQPA 1LUAA 2Q1YA 3JYLA 4LBYA 3BGIA 2E18A 3KLPX 1CP2A 5I3ZA 4OHVA 3K9HA 3SJCA 1CLUA 3GRUA 3VU9A 4E88A 2RHTA 2VC2B 4CLOA 3IB3A 3TTTA 3WK4A 2C2XA 1YDMA 4TKZA 3KPUA 2E4VA 5GPBA 1C4OA 1Z83A 3BTVA 4RJIA 2MINA 1WMAA 2XUJA 2Z6VA 2W6QA 4PC1A 3X1KA 2IYSA 3GLSA 3FHOA 3G5UA 1DOHA 4F9FA 3IT1A 1A04A 4KX5A 1VKNA 5JRZA 4Y2PA 1DG1G 4KN5A 2P67A 5FO1A 4A0SA 4EELA 4BNLA 1KGSA 1U0LA 4N6OA 1ID1A 4C03A 1V2GA 1QKKA 2QAIA 4OI0A 1RMQA 4ZMRA 4QXOA 3X1JA 2DPYA 4QUHA 4EY3A 3VU3A 2PL9A 1W6UA 3LDFA 4NMLA 2ZJ7A 1AZTA 4QUIA 4XIJA 1SUWA 3DV9A 3FMVA 4O0MA 1US8B 3LF1A 3Q3HA 2ZU0C 4LY6A 3V4RA 4OHXA 2G3YA 3ITKA 1E6UA 2HU7A 3LL7A 3IE0A 3JVIA 4LVUA 5EP1A 3R3XA 3REFA 4BQQA 3DAGA 1Y8ZA 3GNQA 4WJLA 2HF7A 3RABA 4WEQA 4JLAA 1GG8A 3PQ2A 5C3MA 3KJEA 3H6GA 1BE1A 5ERYA 5EWMA 3MGKA 2DFPA 1GYQA 4X7MA 3EG9A 3RYIA 2XECA 3GFFA 4BTEA 5FUYA 5EIXA 1ULHA 1SUFA 4LGYA 3BIXA 2WJYA 1U94A 1XQWA 3K9BA 1L1EA 4R1PA 1O94A 4P3OA 1G6KA 3I2JA 4UNQA 1Z6QA 1GRVA 2XDAA 1YUBA 2GARA 2NXWA 1E94E 4LQLA 3BDIA 4HRAA 4D6YA 3H5VA 1LQ2A 3O8NA 4DC0A 4HH4A 3PYXA 4IDQA 3VMMA 3HFSA 1DJNA 3OIGA 5K6TA 1P1KA 1E64A 2XVZA 2QVXX 5TB5A 4EABA 2EW2A 4GOND 1ST2A 2PLWA 3IKLA 3Q12A 3T9BA 3S0JA 3G9TA 4NFSA 1PYOA 3TPFA 1NMZA 5A4FS 2F1JA 3MT8A 1VSQA 1MP0A 1WO8A 1I36A 3WQRA 3AB3A 2V6IA 4MQ5A 4HSGA 1YB2A 4N5HX 2JGAA 2P9FA 1TMKA 3DFUA 4X3CA 3RS5A 1TF5A 5BQOA 2UXDB 5HE9A 3I9OA 5G0WA 3NTLA 3TO5A 4ZOEA 3QXXA 4G2NA 2BGWA 3E4CA 2HU5A 4J2HA 2X9NA 4XIIA 4LC0A 5HYVA 3G2IA 3W6UA 3PC8C 1IY1A 4GG1A 2ZRFA 5L7TA 1M6HA 4Q4LA 4MDHA 4X9XA 3WTCA 1JG2A 2R8PA 4CTJA 4ENUA 5KKCA 1OB2A 1UM8A 3CKMA 4NH4A 5EN4A 1VBKA 5J9FA 2ZFUA 3NVAA 4X90A 5FFFA 2GCOB 4KK4A 3GI1A 2RJOA 3VPAA 3TR0A 1T6XA 4QGHA 1IZ9A 2AUMA 5TC4A 3EGXB 4GVPA 2XBMA 1A8HA 4EKDA 4ANFA 3HXTA 4DJDC 4UJ3A 3C74A 4L22A 2BR3A 3DDSA 1RXWA 1DOAA 4RD0A 3TL3A 4Z4IA 4PTZA 3RGGA 1FSFA 1DRJA 3INYA 2WF7A 4B1FA 3E4DA 1KFJB 3VZCA 5C35A 1GA4A 4DSTA 4YUXA 2FLVA 4ZT6A 4JI5B 2AQ8A 1N5JA 4LDRA 1G42A 3E70C 3RC9A 4DIMA 2R5WA 1ZHFA 3KAPA 1FNCA 4E03A 1J90A 4ENPA 3CNBA 4ARVA 5DVZA 1T43A 4O4IF 3PHJA 4IXWA 2C9BA 3DV2A 4Z54A 4UVDA 3K3PA 3INTA 3EUEA 1W88B 2KX7A 4LQ4A 1B16A 1OV4A 2ZT5A 1PX0A 1UK6A 1L5FA 2KQUA 2QE7D 4UM9B 3GQBA 1FX1A 1KDOA 4DJFC 1Y7PA 4AKGA 5ES4B 3KT8A 1FS5A 2BI8A 1ZRNA 3H9QA 3S2FA 1GUBA 2FFAA 2P4QA 2QRMA 1QU3A 2QDXA 4IQ4A 1AKEA 3NHPA 4ETWA 3AP1A 5JQWA 3OWOA 4BNJA 2X4LA 3L4KA 1A77A 1LSJA 1S9DA 3EX7C 2W43A 5C80A 4H4EA 2PA0A 2MOKA 3C3BA 4KFUA 4Q4DA 1PR4A 1U7PA 2WTNA 3CGWA 4DXDA 1MBZA 3DBIA 3NNDA 1JPUA 3B20A 4RZQA 5TQ0B 2PKYX 5KYVA 1KORA 3CUEF 4OHZA 2GKSA 1VG9B 1N6HA 4JI4B 2OB2A 1T1SA 4D5GA 4Q1AA 4Y1GA 4ZYZA 1ZYUA 1BFDA 2FEMA 4MB0A 5K0TA 1TTTA 2XZLA 2CNBA 1EDOA 5HUQA 4R1UA 2Q27A 2OHFA 1KZ4A 1TGYA 1JLRA 2PRZA 2EJCA 1WCIA 4MVJI 5K0SA 4V0SA 1NURA 2EZUA 3UA4A 5C9ZA 2ERYA 4DEYA 2ZJYA 1V6CA 1NBAA 1NDQA 1YKSA 2JA1A 1K7YA 2HK7A 2WD8A 3DNFA 4DBVO 3WQSB 4CQMA 3UJ6A 4E7PA 4CGZA 2CUTA 4QPJC 4MHTA 4QFMA 3WIOA 1CY8A 3D9QX 2BBSA 4WK0B 5AJZA 3NWBA 1U8AA 2QV0A 3SHTA 4BX0A 1K1EA 5DSZA 3RO7A 4JA2A 1ZM3A 3ANSA 4YBRA 5E6RB 4AZSA 4ZV4A 4TYWA 1V47A 2C4KA 1JDBC 2ZR8A 1BVUA 3D1LA 3H16A 3R7DA 3SQDA 4X64B 1EX7A 3L4JA 2P7HA 3HNPA 3BJEA 5KJ1A 1XYVA 4FYIA 3R7NA 1GQ2A 2WJWA 2NXJA 3JQBA 1FVOA 3WVNA 2ZVDA 1C3OB 5T4FA 2R5FA 3IHLA 3VR4A 2C1ZA 1Q1BA 5AOCA 2GJSA 2N75A 5KVAA 4JJZA 1XPJA 2JBHA 5DZSA 3RIXA 1WB6A 2I6GA 2BDEA 3ABRB 5DNYB 3N2KB 2XAUA 1ZWKA 3LCRA 4I0WB 1J22A 4JBYA 1CZRA 2OBLA 1GTVA 5DOVA 1OZGA 1UODA 2N9UA 1V11A 1Z6GA 3N86A 5JROA 3GLIA 1QVRA 1R4AA 2Q8PA 3BFXA 4LE0A 3RE1A 3EHEA 3CEPB 2EFJA 5EJMA 1W36D 2GTHA 2E4WA 4PLGA 4S35A 1R6XA 1YZTA 5KC9A 2O19A 4P2GA 1TE2A 3IMGA 3P9CA 5T6BA 4L5IA 1M7GA 1A72A 2HQOA 3RUCA 2DR2A 2GM9A 4YIKA 3MS7A 3UJ8A 1NUPA 1SXJC 3SYKA 3OEHD 1YHYA 1EJ2A 1HQCA 2OK8A 1KPIA 2QZ9A 2ZXEA 1X7GA 3WLSA 1OC2A 4B4KA 1FJXA 4LCBA 5D3QA 2P0EA 1WB9A 1J4AA 1F0PA 1WUKS 3BKWA 3LPLA 4N0DA 3RADC 4IJ5A 1AM4D 1OZHA 2P75A 2OHOA 5DDIP 1EUCB 1KAHA 3L0OA 4L76A 4PV7A 1X1DA 4V03A 4TKUB 5JCOC 2ZUFA 5CLHA 4AIIA 2B30A 3PEWA 1BVHA 3W34A 1Z5PA 3F5QA 2HRRA 1H2HA 3BH0A 4YPFA 5K05A 1I30A 1SVIA 5BWCA 5F78A 4DB2A 4OLBA 3REGA 3JQAD 3W04A 1TCAA 1UKBA 3FCUB 4QATA 3WJ7A 3RYCA 3UGJA 2C2MA 1P4RA 3K0SA 2JVIA 4AZ3B 2BZ1A 3SZUA 3KQHA 1VHDA 4DANA 5FNVF 3C1AA 3ZC3A 3PD0A 4U9HS 2B7CA 3V7YA 1B23P 1C8KA 1ONNA 1W93A 4TS9A 2B4TO 2P3SA 3DPIA 4XUGB 5DHUA 5GJWC 1NYRA 1PDWA 3VNUA 1XK6A 3QMMA 3ZDXB 4ILEA 1BW9B 2YHAA 4L5JA 1Y42X 5ADVA 3A3KA 1N2GA 5F4BA 1ESCA 1ORRA 3H86A 4QXQA 3PR2B 4BO5A 1HKUA 4FIZA 2GZ3A 4S0XA 4MR7A 4KQGA 3WXMA 1T26A 1X1BA 3L4BA 1Z2PX 3BWEA 3HCFA 4TTTS 1F0KA 1J2JA 4M37A 3QWAA 1K86A 1U1FA 2WG2A 3HBMA 4X8MA 1MG0A 2I4RA 3KKZA 3LPMA 2PGJA 1HWYA 3NT4A 1RLMA 3O93A 2ZE5A 4LXIA 5BR8B 4OYYA 3GRFA 4DIBA 3K15A 3NXSA 1EP3B 4C4SA 1V5GA 1M0SA 1EB9A 1RWQA 5A6SA 1QPBA 5K0JA 4EJSC 1IB6A 1Z4IA 3R09A 5EMKA 3K53A 4LJLA 1I4EB 1THMA 2NZJA 5HILA 5A71A 2XD9A 2O5RA 1JBKA 3HUEA 2II6A 5IKXA 3TKYA 3RC2A 3GP8A 4URZR 5ICGA 4DSAA 3HCEA 3QWFA 3VTKA 5K3AA 3PTAA 2FPOA 2GZSA 5J59A 1OI7A 1SRRA 1XE3A 3TLZA 1ZGCA 1EEHA 2OO7A 5H68A 2OG2A 3JV7A 3NHMA 4B87A 5IJ0B 2IXAA 1Q7TA 2R6JA 1E9FA 3U3ZA 3OQIB 4Z8YA 5J4HA 2OOKA 3OU7A 1A7UA 2CHUA 4F8YA 4ZDJA 1E96A 5F52A 5ETJA 4FZVA 4OIMA 3ZJYA 1HETA 1U3TA 1C9DB 1GTG1 5JVDA 4AL4A 2HMVA 2D5AA 3N0XA 3KWLA 4CTMA 1YJBA 2RI1A 1J8MF 1I3KA 1M73E 2N1MA 2XH8A 1G8HA 3LC1O 4Q3CA 1P2SA 1TKCA 3FROA 5BR4A 2FSIA 2GX6A 3P5BA 4IV0A 2B36A 2CLKB 3SXJA 3OKCA 3KQQA 1GY8A 1MA0A 2YWGA 2A0YA 3ZXIA 3BXPA 3NWOA 1T6BY 4EKIA 5B2FA 4M0LA 3TQRA 4ENWA 3DT8A 1QHGA 5KJ6A 3O95A 2Y6UA 4OYHA 3L40A 2FZWA 3RPEA 1ID8A 1I3NA 3KJQA 5DLQC 2RK4A 4ESEA 2D59A 3A27A 5HBRA 1QTQA 2HO4A 1ECBA 1SQ5A 3IDQA 3JS5A 4RGVA 2BWJA 4R98A 4RIIA 3PQ4A 1R5OA 3H42B 1GGEA 2PCJA 3CPEA 2XMBA 5HMLA 5JR3A 1E9AA 1ZSYA 2GLTA 1RABA 4DE5A 2ST1A 2UUPA 2P3LA 4ESOA 1JECA 1IIBA 1OR8A 2B4RO 2RMKA 3VA7A 3T1QA 1Z0AA 1FBNA 3ISJA 3ABSB 3LKDA 5ALWA 2C8VA 2G4LA 5EL0A 3WHKA 4BJ3A 4BCCA 1YZ3A 4Z4CA 5C1OA 5KSYA 1U2TA 2AS0A 2PWPA 5JNVA 2D7DA 2ROQA 5DCUA 3Q0EA 1W4LA 3DKPA 5FULA 4S0ZA 1L4MA 1FFWA 5HM8A 4UULA 5ED4A 1POWA 5CW2A 1JLLB 4BNIA 2QMQA 5F3RA 1U2QA 3LGXA 3THXA 3JY6A 4FD3A 1LF0A 4XWWA 1XVIA 3URKA 4QUKA 3LCJA 3EIXA 1UCFA 5DB4A 5JCPA 1WZ2A 4X65B 4L74A 2GN2A 4LF7B 1ZOOA 2EV9A 4RJLA 5DIFA 1W87A 4Z4FA 2VNJA 2SECE 1RXUA 1X80A 1P7YA 2JCBA 1MRNA 2VKTA 1NW9B 2VDLB 4G01B 1TUGA 4HMQA 2H4ZA 4EF4A 3IR5A 3FF4A 5FHRA 3QM1A 2R1VA 2AI1A 1SCBA 2FNAA 4RXTA 1V25A 5HF8A 4N8DA 2QQ0A 2J87A 1KL7A 3LUPA 3A1SA 3E23A 4JLWA 4QNMA 1GLNA 1S0UA 1YQ9A 3JYPA 1IAVA 5TQVA 4AO7A 2YWJA 5GMOA 1I8TA 1KKUA 4TKVB 2YVKA 3C8DA 2C77A 1P2GA 1V43A 5E38A 4AIRA 4XDZA 5AH0A 4EY7A 5ICMA 2ZT7A 4JC5A 2EAUA 5ADUS 2X5XA 1WSWA 1J49A 1T2UA 2SKDA 10MHA 2Y67A 5KWIA 1GPJA 4E12A 2UVPA 3K9NA 1NG1A 5CDYA 1T5LA 2W2VA 1Y8RB 3I72A 1EXVA 3DWGA 4FYJA 4G0MA 1H4VB 4HBZA 3BKXA 4P6VF 2QNIA 5AW4A 5K8VA 4ACAA 3GFQA 2UYOA 1V8ZA 3O31A 2R00A 3CIOA 3B6ZA 5BYJA 4OMCA 1QB8A 3GUYA 1OC4A 2W2KB 3X1DA 3WP0A 5B5SA 1GARA 4O4JA 2ALJA 3TJMA 4DWOA 5KOIA 2E1PA 1J8VA 3QIVA 4I7EA 3QVWA 2J9ZB 3A25A 2HRDA 4M21A 5AI6A 1BS2A 5LMZA 4XYLA 3ROGA 2AD5A 2ECPA 4BIMA 2RCNA 4X60A 2AJBA 2EG5A 1M54A 3B52X 3DZBA 4PG8A 5G2OA 2VJDA 3E1KA 1U0BB 4U2KA 1OSNA 2V7GA 5DNEA 3SY8A 4OH7A 4B47A 2Z1DA 4GI2A 4NMWA 4EYSA 1O95C 2I33A 1EVJA 1HQDA 1KI8A 3C7CB 4TTQA 4WA8A 5BORA 1KVUA 1VBMA 2Y0PA 1J0CA 5L6LB 1BDIA 3LDUA 5HQTA 3STWA 3TL6A 3VOSA 1WXEA 1JZTA 4G86A 1ODCA 4YS6A 5BYKA 1MW8X 3A9WA 4PVCA 5KB3A 1R8YA 4ZAYA 3NR2A 3B1XA 3QYPA 4LHYA 3GGJA 5HCIA 1E9EA 1MVLA 5DLYA 1JPNA 5LU8A 1RZUA 3FTQA 4NCIA 2PZMA 3UB2A 2G09A 4IIGA 1EM8B 2QM3A 1WV1A 4M1TA 3C14C 4QIHA 4ZCTA 4C3OB 3R24A 2GWRA 2R48A 2HCJB 3LT0A 1E2JA 3I9JA 1H4SA 2OMKA 5BMOA 1X7DA 2WF8A 3E7FA 4GR5A 2EP5A 3C6BA 1AMOA 1KK1A 4E5MA 5ALLA 1PYGA 2PUBA 4CTOA 4FS8A 3AEYA 2PRSA 1PZHA 1Y34E 3D4NA 1CY7A 1PFQA 3QJYA 3G82C 5ALYA 4O29A 4OP3A 4RF4A 3DMGA 2O4CA 1JZQA 3SEQA 4AK9A 3ELWA 1T8RA 3LU1A 5BPFA 3SXUA 2FKNA 1RADA 3H87A 4O3MA 5IDQA 3TEFA 3KKLA 2CXTA 1ZOPA 4Y6SA 4E6EA 4H6VA 2ADFA 1QHSA 5I9SA 1Z0UA 1N8NA 3P2OA 4WKOA 3FPLA 3ZJTA 2EFGA 2YZGA 4EA6A 1GCIA 1VKHA 3RNOA 5BV1A 4RXUA 4LC9A 3HXOA 2HT1A 1F2VA 4RA9A 1CUCA 1FSSA 4KKXB 2I2WA 2VSFA 4NZNA 3KSBC 1FFGA 3TCXB 3Q8MA 1YR8A 3K2EA 3NM6B 3Q7RA 5BY2A 4H77A 1O0CA 4RNCA 4DCTA 2JFQA 4MW1A 2VNKA 2GZHA 4JCOA 2DVMA 2XZOA 5E9WA 2QL5A 3A36A 4B3TB 1SK8A 3ONWA 2F1KA 3BA6A 4MUNA 4MRRA 2AG8A 2RFLA 4K28A 4RVDA 3EUAA 4S24A 4F71A 2PUFA 1CQIB 4AZ0B 1PR1A 1ZJJA 4PCUA 3I0NA 3B6MA 2KI5A 4BKQA 4I50B 2YYSA 3GJYA 3VU0A 1GDTA 2PGIA 3IX7A 2HA6A 2R2GA 3KUDA 3K0KA 4RD2A 4RAOA 4IUBS 1YVEI 1QFSA 4JB3A 1B1AA 3GNSA 4EUEA 1PKEA 3PJGA 5LSAA 1YE3A 1TKRA 2IHKA 5EJGA 3ILYA 2A0XA 4X41A 3JQ9C 3BGOS 2CYAA 4RBNA 3E9QA 2QQFA 3RUEA 4INAA 5HGJA 2AZXA 4FYMA 3E9RA 4LZNA 5K3FB 2NUTB 5K9ZA 5CJPA 1CE8B 1ZVQA 2PRJA 3NWPA 3SE7A 1S2LA 3D2BA 4QL3A 3FGPA 1D7OA 4DUGD 2GYVA 3NHLA 2NU8B 4HRYA 3OFJA 2GN0A 2GK7A 1E58A 1Q0SA 3KOWA 5JS2A 4HDRB 1PZNA 2I6FA 2RG1A 4L27A 5ALQA 3BXFA 3U4GA 4BE7B 4CYMA 3BB1A 2IZOA 5F51A 2IW1A 4LXGA 4IHAA 4CMKA 2C03A 3I73A 3OIWA 3UH1A 3ZDCA 5SZJA 1LDEA 1EXDA 2GUWA 3PB3A 1DAIA 4OXQA 1NE2A 4DSUA 4RTRA 2NZ2A 1IOWA 1E8DA 1I4LD 1N57A 2BBTA 2G0AA 3OFKA 2RGWA 1CVIA 1BS9A 2GN4A 1KETA 3DFFA 3PIDA 4IF6A 2Q4TA 5KNBH 1MU0A 4G5SA 4L57A 3HNOA 4O4LA 4OXIA 4DYVA 5HEKA 3GZJA 2C7BA 1QVVA 1A4UA 1S2OA 3O1HB 3TXXA 4G9GA 1MX9A 1SH7A 3SEZA 4RZHA 4MUBA 1F8FA 3B89A 4YJHB 5HGXA 3HO6A 3EYWA 3MJCA 1OFVA 4OLJA 2WWGA 3QXCA 1CK4A 3KL4A 3RT7A 4IOKA 2M2IA 1VCMA 2GEUA 3DB1A 4MVWA 2P9HA 4ZT3A 3OOEA 1DCTA 3GNLA 1H1LA 2IDMA 5KINB 1QYXA 2H7XA 4JP8A 5ERXA 4JXZA 2EF0A 5IJXA 3BXHA 4FFVA 1Z8DA 1E89A 1NW3A 4CCAA 4DLKA 5LD2B 1KYZA 5ANRB 3VKWA 1VMKA 5JMWA 1Z16A 3OWXA 1TZKA 1K8RA 2P1DA 4FR0A 4KB5A 3KSMA 1RKXA 4KR7A 2QS9A 1A98A 3WLHA 1TJPB 3CNLA 4CF6A 4H08A 2D2XA 5EXSA 2WSBA 4QOGA 2IEBA 2I6SA 2PQ0A 1L7OA 1ZW1A 1EVZA 3AV3A 4IWNA 4YRBA 1NI4B 5KQMA 1TAGA 4YV1A 2C8LA 5LP6B 1K5GA 3LKVA 4GWLA 3GT0A 5EHIA 4Q7QA 2VWHA 3ZVNA 1E3JA 4LOLA 1F7UA 3DULA 3X1WA 2M1ZA 4PBRA 2OM6A 5DW0A 1WULS 1BRTA 3F6BX 4NL4H 3CJQA 3GBSA 1B14A 2BFAA 1E0SA 1ISRA 1O6FA 2CLFB 3G49A 3UHFA 1QIMA 2Q2VA 5KKNB 2DJ5A 1UT8A 4B6OA 4Z3OA 3IXLA 4IEIA 2HN9A 2P9YA 2YWEA 3GOQA 4PHFA 5IULC 2QXYA 5KOHB 2QRLA 3CRRA 4C07A 4Z1OA 2VQ3A 3WL5A 3QXSA 5EHZA 1W5BA 4WZBE 2IPNA 3QF4B 1FXWA 5GONB 4BZXA 5L51A 2CHQA 3B6JA 3HGQA 2O1SA 1PR3A 2BEUB 2VYVD 1U28C 1QCDA 1QQ5A 4BFCA 3WLFA 4S2EA 3GMIA 5DGCA 3NBYC 4YUVA 3ZOKA 2AC4A 4Z9YA 1DTWA 2Q6TA 2VXYA 3IVRA 4GO1A 4MLCA 3L77A 4Q4AA 1Y9ZA 2DHQA 3I8OA 5HCUA 3VNAA 4OATA 2ORIA 2JA2A 4W5JA 3BDAA 2JCXA 1WXQA 2XMDA 2OESA 1L5HB 4WZBA 3A4IA 4UUQA 3OT1B 1CEXA 3ZZNA 2WTXA 3QKWA 1N78A 1ANKA 3IT0A 1JQ5A 1RRKA 3VNSA 1RM3A 3PNLA 4DMLA 3CCFA 2VTBA 3ICOA 4FEEA 4ZOLB 2FUNB 5KHAA 2UYQA 4E07A 5GOTA 4UDNA 1C2YA 4XYEA 4B3JA 4MS1A 1VJDA 5CPFA 1PT6A 3OT5A 4QQNA 1CT9A 1MGOA 1BCRA 4DRXA 4COOA 3CY6A 3O8OB 4ZQIA 4DS3A 1W73A 3GJ6A 4D8VA 4AJPA 2FH5B 4XWYA 4ZYWA 2YJGA 5HDQA 2WYHA 4BVEA 3DYBA 3LQ4A 5IKPA 5J47A 2D2VA 3DDWA 2IHUA 3BWMA 3FPAA 3KUKA 4WQMA 2G17A 4A5SA 2J3QA 2F59A 4BDTA 2I4MA 2IZZA 2OE2A 1W4RA 5FX2A 4AY3A 4BMZA 3HGTA 3KAKA 1R0XA 2KPOA 5AVQA 1NXWA 1XYGA 4ZYXA 4UEJA 5A9SB 4GKVA 2YC4C 1OTYA 3BA1A 3ACCA 1XEWY 1XTVA 3CLSC 3QBDA 1EWKA 2FEAA 3EC2A 3U2QA 1I6LA 2BLNA 3RRZA 4EYGA 3W6OA 2VH1A 2GJ9A 3AJRA 1SEPA 3ICPA 1XL1A 2GTIA 2PL5A 5U4XA 1ZH2A 3W5AA 3AR3A 1WG8A 2QT0A 2XNSA 4PYMA 4OJQA 4Z4GA 1K9SA 4H0CA 3IVAA 2F9FA 4HT3B 3L43A 5KPDA 5LBUA 1XA0A 5CMLA 3SIPA 5CURA 5K0NA 5BWOA 1LTKA 3QX9A 2FQWA 4MVJH 3KXDA 4EBBA 1N7IA 2BSQA 4ZREA 2XUZA 4QYTA 1IZYA 1GV0A 1M2OA 2FSGA 1R0RE 2NYVA 2Q1UA 5E0KB 3H4TA 5COBA 5C8YA 1Z0DA 3OHSX 4QAJA 2QJRA 2MMGA 3CTPA 3NIFB 1TVKA 1Z4PX 4KQEA 3JALA 2YRXA 5KCMA 4WK2B 3A6ZA 2BL4A 1SIUA 3TQTA 1XHFA 2P3QA 3KCQA 3CLVA 3NH9A 5FF9A 1QDUA 2QSZA 3UB3A 1R4MB 2ZB4A 4IMPA 5JMTA 1B0UA 1A7JA 1Y5MA 3DTVD 4MKIA 4W9RA 5I47A 1II8A 2OCAA 2QEQA 4BBZA 4FYKA 4EX6A 1QF6A 2ACWA 4QLAA 1UK7A 3WGYA 3RC1A 1FU8A 2HJGA 1V7QA 1YD7A 1TQ2A 1DKUA 3Q1LA 2V4MA 1TMYA 2G71A 1P3Y1 2ZRCA 1XFDA 3BJIC 5FXMA 2PH3A 3MPUA 2JGMA 1YCFA 3RUFA 1GCGA 3TQCA 5BWBA 5L4SA 1T36A 3QEMA 2BYTA 5A3VA 1PBNA 4DSZA 3O4GA 1Z29A 4XX0A 4P4NA 3DE5X 4WY8A 5JVDF 1NVWQ 3KHTA 3M9WA 2F8TA 1X1RA 3V80A 2V3CC 3HPQA 5H80A 1V8BA 1V8OA 2VPTA 4RNDB 2PH5A 5G1NA 3RJ5A 2JFNA 4JC8A 3H9BA 4FOSA 3BIJA 3FR8A 1PLJA 2PN1A 5FI3A 3UZUA 4JLJA 3VYWA 3BFPA 2DSTA 4YT2A 4MW6A 5L4NA 4NOMA 1AUPA 3PV0A 3D64A 1H0HA 1X9IA 3SG0A 4EM6A 2O50A 1Y1KE 3IKVA 3E5NA 4J3JA 4Z0NA 1F38A 5LWHA 1PFGA 2PZEA 4D96A 1QKIA 4W1QA 2JL1A 3ZY2A 5JECA 2B1GA 2ZBEA 4HI0E 3IAS6 4WJZA 5IYZA 1RJ9A 1V71A 3AVQA 4UU8A 1DINA 2O8DA 4F3NA 2PX4A 1ZINA 2V7TA 4L4XA 1DAFA 2W2TA 1C7QA 1XDWA 4G07A 5JJIA 2FUG6 4IS2A 4YJ2A 4UHEA 3UTCA 1HC7A 1EJBA 4AROA 1X2BA 1BWQA 1QG0A 2RGYA 3Q9NA 3KSUA 2PUDA 3AU9A 4BLPA 3M4ZA 1PTJA 5E2IA 2ZIFA 5TEVA 1TAHA 4BE9A 2FXIA 1O8CA 4RIEA 2NU7A 1JR3A 2LZ0A 3E84A 3ZGYA 1VRWA 2C8JA 1JHDA 2ODEA 4LXQA 2B8TA 1T3ZA 4KR9A 1T4BA 3AZPA 5A1TA 3UWPA 1G6OA 3NIGB 1G66A 1JVNA 1XF1A 1DEXA 1T1GA 2OCIA 3K7EA 3KUCA 3ZBTA 3R6TA 2R7KA 3WKCA 1SK9A 4QUAA 5F9FA 1CUEA 1MTZA 3RS3A 5EZYF 4BC1A 5MFZA 2EX4A 5IAGA 1QH1B 4DARA 2YIDA 2IEDA 3U9TA 3DMPA 4TYNA 3U09A 1Z4KA 1E7SA 1H3NA 5IANA 4IGEA 1JJIA 2R7MA 4CN9A 2P9QA 2I03A 3D1JA 5DYNA 2GEFA 3LW7A 4OPMA 1XCMA 2YNMC 3JQDA 4XASA 3TEJA 1EFRA 1NVKA 5IVIA 4B4WA 3BIWA 2QR3A 2YS6A 3JWJA 1J42A 1BD4A 3KLMX 3Q5DA 1TQ6A 1D2NA 3L8FA 5EMJA 4D1YA 1NF9A 5JAMA 2PK3A 3A4TA 2CXSA 1JPVA 3CMMA 2PWAA 4M0DA 5DGTA 3EXIB 2R6R1 4CKEB 3QKSB 1NVTA 1QV9A 3GA7A 4JVMA 4RORA 5B53A 2IBTA 1M2KA 1Z8HA 3KT0A 4JWTA 4YYZA 1RXYA 3STXA 1W35A 2C3UA 1ND6A 1Q20A 2HBZA 4NG5A 5G02A 4HATA 4N3AA 3PFHA 3FHCB 1I4TD 1UXKA 2JRCA 2VUIB 4G0WA 3A2KA 1XKQA 4QU0A 1U9IA 2YYAA 2E37A 2RIRA 2A5GA 2GDZA 2OO5A 3B2QA 3E48A 2NVUB 3GDGA 3NRBA 1HT3A 4BNZA 4EGFA 1M1NA 2OCLA 5SY4A 1X14A 2QZSA 1TZCA 2FMHA 1EH5A 3JW8A 4FMCB 3BTSA 3WLJA 1O08A 3S55A 5LYJB 3Q3IA 3R2JA 4UTPA 4F97A 2PWZA 1Z2CA 5FL3A 4XWAA 2Q5HA 5CDGA 5CEFA 1S8FA 4JR1A 4M1MA 3KFVA 4YQYA 5K8TA 2VHXA 3ED1A 5K0EA 1XMQB 1BWSA 3AF5A 4NBSA 5BWLA 1O97D 4YFVA 3HB9A 2MYPA 1G5HA 2I7XA 3TE6A 4A27A 4EYKA 4IEFB 4MLPA 4D9HA 3D8HA 4IMIB 4ASUA 5IZCA 4I5EA 3AYZB 3EGOA 3WIUA 4AYWA 3R0QA 5BMVB 3HKCA 4D98A 2IYTA 1G8AA 3J7TA 3MTEA 3DV0B 4B8WA 4JDUA 1QU2A 3OVMA 4RZ3A 5FPHA 4F3KA 5CB0A 3R23A 5BN4A 2XIJA 3K0CA 2JIRA 2IYYA 2VHJA 2CLLB 5KMGA 3EARA 5KX5B 1I7SB 1FW8A 4U00A 1JTFA 1Y7HA 1O96B 3NJ8A 1S6YA 5LBTA 2W58A 1YZQA 3TJRA 3AM1A 3DL0A 2FPKA 4NU0A 4ZMBA 4RKQA 3HZRA 3A1EA 4AS1A 1F51E 4S1VA 1N2CE 5DI9A 5GINE 2W9XA 1Q3KA 3JQQA 1VTKA 3KUXA 3SHQA 3SHOA 4TLMB 3DOUA 2Z9DA 4EHAA 3EGVA 3OZWA 4HUQA 3K0EA 4AG6A 2V8BA 4IIJA 1OLUA 4JNKA 1ZONA 1DEAA 1I6MA 2HOQA 1DBWA 1HG1A 2FN8A 3K8QA 2P30A 4D9IA 1FU7A 1BE6A 1MOPA 3VTZA 1FQWA 3V33A 2BFDB 2QI9C 4NQZA 1TM5E 3BL6A 1ILEA 3HP7A 4XYBA 3AUXA 4RD4A 2V97A 3FYUA 1N2CA 1NUQA 5JH7A 1CJKC 5A9TA 2AXPA 4QJ3A 2RG7A 3NOOA 3QPCA 4UAGA 3T9CA 1Y1QA 2QLBA 4IIBA 4NTZA 1C3LA 3NHRA 4EEXA 4L5YA 3L1UA 3RHFA 4YP1A 1SXQA 4GM1A 2Y1FA 4LRYA 1BYUA 1FMJA 3DCNA 4ER3A 1CQJB 5EZ5A 2QUIA 4B6FA 3OE5A 1P1JA 1G0OA 3M83A 1EB8A 6REQB 5I7RA 1RWOA 2HIGA 2OGUA 2ZTLA 3IDZA 4ZJPA 4Y2QA 1C29B 2FMKA 2OZLB 2W48A 3AY0A 3I2KA 4K2HA 1EBUA 2H3HA 4P4GA 4TRMA 3QLJA 3RS7A 4LF8B 3IP1A 2PNFA 3OLVA 4BWYA 2X7HA 5UKDA 1PNQA 5DLDA 1ADCA 1Y37A 1EMDA 1Z12A 2O1XA 2X8LA 4C9BA 1J21A 2AZTA 2Q21A 2XNHA 4FKBA 1H2ZA 4D8XA 2PG3A 2X5OA 2CT8A 5AK4A 5ENDA 4TLEA 5EJ7A 2HSJA 3JQRA 2DQSA 3TLXA 1YFLA 1NA5A 2BFMA 2G4VA 4FOPA 3EVGA 1OMOA 4FC7A 1JLMA 2XMCA 3F67A 3SX2A 3ONFA 4MYUA 3VDRA 2VYFA 5AM2A 3K35A 2QYOA 3DLAA 5BV2P 3U7RA 1NW5A 5HCNA 2ZPUA 5GJCA 1JXMA 1SBYA 3VO2A 1JHYA 3ZE2B 1DG3A 4PCVA 2WOJA 3DDOA 1RQ7A 4HQKA 4W6QA 3W5UA 4D9BA 1N32B 5CR9A 3SJZA 3MMZA 5ESDA 1KI7A 1P5HA 1F2DA 4IOMA 5EXEA 2HMAA 1I2AA 3EQ6A 2PQMA 3L01A 4Y9RA 5HIAA 1P3DA 4W9MC 1O94C 1WHTB 5JYDA 4K05A 4PPFA 4PE5B 3BD6A 3TAHA 1UBCA 3KSDO 4MCHA 3LT4A 4GPBA 4IDFA 4MPJA 2ES4A 2V8OA 1KR2A 3BXOA 2ODWA 3P0JA 2B2XA 4C0JA 1DUVG 3DZKA 1F2UB 3Q4GA 3QVXA 4JXJA 3TINA 4M1SA 1L5YA 5JS7A 4MDYA 4DPKA 3I6QA 4P0PB 2QYTA 3H2ZA 5FEMA 1O3YA 5AJXA 2PFSA 4B9EA 2OK7A 3EAFA 1JHVA 5K6AA 5CXXA 1CY4A 3N0WA 1TOAA 4XYGA 2NUAA 2HGZA 5FD8A 3D2AA 1COWD 4LYGA 1HX7A 3VNRA 1DWQA 2F3QA 2OBBA 2Z4RA 2ZUDA 4OQEA 4CCWA 1HA3A 2UDPA 4ZI2A 1E1LA 2DULA 1BEZA 5JWRA 4MX8A 1U8YA 1FNSA 5FT9A 2ZLBA 1XCOA 3SFVA 3CG4A 3KXLA 3L84A 5DT9A 1YS7A 2O07A 3JRXA 5EJ5A 1Z74A 2VJOA 1JSRA 2TMDA 2YXPX 2E4XA 4B3XA 4RH3A 1C7EA 3LGAA 2YY7A 5CA0A 2O3UA 3FPGA 2IH5A 3GLHE 2FUKA 4G5OA 4OMFG 4RHUA 4EHFA 3FSGD 2O0HA 3UTDA 1NONA 3LQQA 4KV9A 4QOFA 5FO0A 1LVHA 2JCYA 1WXXA 2JGDA 1HGXA 2XOKA 1MC8A 3AYXB 3BE4A 4JBLA 4Q7EA 4P1ZA 4TXMA 3MTIA 2QX6A 3DVAB 2QRQA 3WHLA 5EVJA 2GHIA 1ZCZA 2XLBA 4H7FA 4UM5A 3NC4A 4X1KA 4WLFA 1FFDA 4WA7A 4EMBA 1N6NA 4J16A 3P26A 5H5JA 1SOWA 2AMFA 1HBJA 1EFUA 1KO7A 4KXNA 1U8TA 3NYWA 1TQHA 3GMTA 2NSDA 4MV1A 3RFFA 2P79A 4CLRB 2QIPA 1JDBB 4JJ8A 4P53A 1CDOA 1Y8CA 4ZJUA 1YVPA 1F2TA 5B37A 3WY9A 1JIKA 1FXWF 2IOHA 1ZXLA 1J99A 2APJA 5IHXA 5FPQA 1G4AE 4NAUA 2FWJA 3RJZA 3PUKA 1K6MA 4ZYTA 5AVZA 1BHO1 3E5HA 3OT4A 4M76B 1XCLA 4PC7A 4Z4QA 1ZNXA 2G8NA 4L0QA 4PVDA 1FMLA 4KE9A 1EE2A 4QBGB 1W36B 1JEDA 1O1YA 2DH5A 2G80A 4OK6A 3K1YA 3DZIA 4MWSA 5FR1A 4KI0A 2CXUA 5FFNA 2E49A 2Z4SA 4WESA 3DFIA 3DHWC 4UM8B 4BQNA 3VTFA 2C88A 2WYIA 4N12A 3Q3EA 2PGDA 5DNVA 5HFAA 3TX2A 3HXMA 4EA8A 1XC7A 4HVTA 1DX6A 3L1IA 2HA5A 2BSAA 1BROA 1DAEA 3JARB 4UHCA 4XQCA 5DM0A 3WLRA 4TKLA 4EHLA 4ZGWA 1IAQA 2VT7A 3QLUA 1SXJB 2DQYA 1WCV1 1RWBA 3DKKA 5LZ2A 2VHZA 4G0YA 3I2HA 2Z98A 4DLUA 4KQFA 3ROEA 3T38A 3DLBA 5JD6A 1NBMD 1BJRE 4PTYA 4MKZA 2R6CA 2D5LA 1P0CA 4FC6A 4DDMA 4XPIB 3SYTA 1EX9A 4EVQA 4JI6B 5ITSA 1UEXC 3P19A 3L0PA 3ER9A 821PA 3WQBA 1JHZA 4F2PA 2Z6QA 1RHJA 3M3HA 4ZKEA 3HG7A 1U0FA 5AVOA 4BU1A 3FKSA 4DAEA 1L5LA 3IKTA 2B7BA 2IGBA 3NLLA 2ZREA 3TTVA 1ZJ4A 3CPSA 3WNVA 4B3FX 4LQCA 2GVZC 5ARDA 3ZW8A 4DHEA 3DCYA 1RDFA 2CHFA 3KYDA 4HQLA 1SCIA 2VF5X 3E9DA 4RA6B 2OBYA 3JVDA 4XZ3A 1ZCFA 3C8UA 1QAQA 2JJ8A 4JLPA 2PSEA 2HWKA 3HDHA 2OAGA 2R8XA 3PSAA 4IJMA 4IRXA 4CVNA 5HJ2A 3GJ4A 2XXAB 4DUYB 1DBIA 3IQHX 4G1CA 1TKAA 2C97A 4FZJA 4NS1A 2CLMB 2XPCA 4RVOA 3CUTA 3AI3A 4M53A 1YOVA 2XXJA 3JQBC 2BSXA 3L04A 4L75A 4PS0A 5ALNA 3OI7A 1U8UA 2ZROA 5J4KA 1R1DA 4O4HF 3LCCA 2VAXA 3F3KA 2WWIA 4Y2GA 1P0FA 4J2TA 4BMSA 5C5IA 1N5DA 2DFNA 1XLUA 4WCFA 4I9UA 4UBIA 5IT4A 2AE2A 5HG0A 3OE7D 4OIFA 2XODA 2B8EA 1FFXA 2E4UA 4KNVA 5F1PA 5DJ5A 1Z88A 2YYZA 1RWKA 2AQHA 2G9VA 4PYNA 4DLBA 1M0TA 4P7GA 1PYDA 5HQ3A 2E2WA 4EJSB 2DU8A 1EVLA 3WGMA 3NUZA 1A4RA 5DGHA 1L8AA 4MUHA 4KLAA 3CKKA 3TNDA 1GHTA 2IZ6A 1C4WA 2AN9A 4RTPA 1Q0LA 3B7WA 2DKFA 3A9TA 1EZZA 4XQEA 4GPAA 1SZJG 2BKXA 5GIPE 1U4SA 2AFIE 4ITRC 3C16C 4HNTA 1KH1A 3M6AA 3D7SA 1N5IA 2UUAB 4LOAA 1IVNA 2JLBA 2IUYA 1YVRA 2PBFA 3TSWA 2GPYA 3WAJA 2WBLC 4DMFA 4W5QA 4AS2A 1GR0A 5F3WB 2IUSA 4ZZ2A 4HLUA 4BECA 3QE9Y 2XCQA 5I7AA 5FWXA 5B6JA 5JAHA 2Q49A 3HCDA 3ONEA 3VR2D 3FOZA 1J0EA 4JJEA 1GL6A 3ND5A 4DHWA 3VR5H 4KO3S 3MFQA 1NM5A 2PXAA 2QJWA 5EUQB 1FDOA 1RLIA 1P31A 2AFIA 3ETEA 3FDZB 3ZW9A 1ENZA 4M9UA 1V0JA 3ITEA 2WJZB 4D46A 4N7JA 3DTYA 1TUBA 3H1PA 5F5XA 4ZMSA 3FPKA 5EE0A 3Q0IA 4ZALA 4H1UA 5FV4A 1UWLA 4YROA 1AMUA 1VYTA 1X74A 2ILVA 2XE8A 2C58A 3ZZ1A 5IYZF 1RAGA 2O3TA 3UWSA 3VJMA 3B3GA 3VZQA 3NOQA 3KJZA 1X19A 2H2FA 2QP4A 3H05A 4BMVA 4PG7A 1ES9A 3KOZA 4Q6BA 4EUSA 1GYRA 1RZRA 2QTRA 3KQYA 2BHSA 2VF2A 1QIIA 2CFOA 2VPXA 1KIAA 3PC2A 4KYVA 4W8OA 3VO1A 3IEXA 1VL6A 1DZ3A 3WGJA 3G23A 3D3WB 3GFPA 4NMXB 4UPVA 4DKXA 4WBNA 1OJ7A 1NVVQ 5CNJA 2XF8A 4I4TB 4YJ3A 2B1IA 5KWJA 1XV5A 2JFOA 2Z2XA 2B20A 3AX6A 1CJBA 4PNEA 2XQGA 2EBFX 1BGWA 2G8LA 2ZKIA 3L4BC 5E7MA 5DWDA 5ECWA 5FJIA 2DHDA 5IUKC 5TJ9A 3O7MA 1JAXA 4MAMA 1GPH1 3NT2A 1E6WA 1PFKA 2ZSUA 3MW8A 3KR9A 3VHXB 1BTOA 3FBWA 5C2JB 2HJWA 3MGGA 1EFPB 1THGA 2WDZA 1TLTA 1FX0A 4HZUB 5CBPA 1EUYA 2Q29A 3QP9A 1DWPA 3GGDA 4QG7A 5CNMA 3WMEA 3RS0A 2V6GA 5ALGA 3KV3O 2XYVA 2MSWA 4PEVA 1ACMA 3JZIA 4DT1B 4KXFB 3DEKA 5TGZA 3ROZA 2P68A 2GYUA 4PANA 4TQ9A 5BW5A 2YQZA 5ESXA 3DWEX 4ZT4A 3D1VA 5IXJA 1XQVA 3EVNA 1B2LA 1G3IA 2QSJA 5LZ9A 3M81A 3OMLA 1IY9A 3T9DA 3BMOB 1K3UB 3CZQA 4QSHA 1CRLA 3I8SA 3PVZA 2VDPB 1NMXA 4BLVA 4Q00A 2ZSJA 1AT1A 1CJCA 1Q74A 5B30A 5K03A 1EK2A 4CQLA 1J25A 1YUMA 2O05A 3BRWD 3G7NA 1NPTO 4KYIB 4NPAA 4RIGA 4PAGA 1YB5A 3WWZA 1OFGA 3AVOA 4HFMA 2BHLA 3OTHA 4Q3EA 4Q24A 5B55A 3X43A 2H2AA 3EVCA 5LQDA 2ZIAA 1FCJA 2I7TA 2XQIA 1A9OA 1V1MA 1IULA 3BGVA 4OK5A 4YJFA 4DPLA 5ILQA 1G20E 1Q7RA 2OGTA 3VJRA 1GYPA 3PXEA 2ETXA 2J3EA 2X9QA 1UMBB 5K4HA 3DGEC 4BQOA 1GTSA 2DE0X 3MLBA 3BK1A 4JKOA 3W3AA 5KNLA 3GWZA 5CCEA 3P45A 3PXUA 3LPDA 4X20B 1CTQA 3V9PA 2BH2A 4TVBA 1KFBB 2PSSA 1IBSA 2PLRA 1R3UA 4ZT2A 1NP6A 2Y71A 3N87A 2V7QA 5EJEA 1EVQA 2EW8A 2Z9CA 4LNHA 1FDIA 1EUDA 1PCXA 2PANA 3QFSA 3SICE 2OC4A 2PZ8A 2RHOA 1BXRB 1WAMA 3D2LA 1BU8A 1G20A 3BE6A 3I23A 3W2FA 3AVYA 1CR4A 5CCXA 4KC0A 1PR6A 3H2IA 3N2GA 4YFYA 2Z4TA 4C6SA 3PUIA 4I6EA 1RPAA 2JAHA 1UBJS 2CE2X 3I5AA 2GJAA 3DHYA 4FGJA 4RESA 3HDYA 5HM6A 4BKMA 4TWJA 2I7CA 3GO4A 3KJGA 4F2DA 2P35A 3AEXA 3Q9LA 3CVYA 2W6IA 4IO1A 4URYR 3VKFA 3MLEA 3V42A 1ZH0A 2FN7A 3BTOA 1Y3IA 4JLNA 3CF2A 4CMCA 5TLSA 4Z0TA 3DLCA 4ZVQA 3T7CA 4HDSB 2UVQA 3CHYA 1C8BA 3TM4A 3VR3D 3SQWA 1BE0A 4JGBA 3RRYA 3G6WA 4QU5A 2Q8NA 2BLLA 2PKEA 2X4DA 4FIDA 5MDHA 2R751 2W8BA 2FX2A 1OPXA 3GLFE 1C1XB 4JJ4A 2FB9A 4TYMA 4Q9IA 2JAQA 4ZVUA 4AU1A 1WQ4A 1CR0A 2GRAA 4EGQA 2AG1A 4CM4A 4GLLA 3K70D 1IK6A 1DAHA 2OBFA 2Z43A 2V74B 3JYNA 3IIEA 4PAQA 4QDXA 3A2NA 3GCZA 3PCTA 1NBME 3KPVA 4ZO7A 5G4KB 5KNCH 5HF9A 4JOBA 2YBDA 2ON6A 3O2JA 4YAEA 3EEIA 4HNSA 2DH6A 3OZFA 2AMJA 2H5LA 2YHSA 1DKQA 4MVJP 4PZZA 5LUAA 1IRXA 4GQBA 2HJVA 2JEYA 1DELA 2V5VA 2VAMA 2XDWA 1ESZA 1YFKA 3LPCA 4DJJA 4YXWD 3O94A 9ATCA 1LFAA 3MTAA 4XGRA 2HV9A 4YP0A 5T4BA 4YRPA 1L5GB 3SZ3A 3WYBA 4AN4A 2RDMA 2XUAA 3LBFA 2J3JA 5JH7F 1SCAA 4I3GA 1H2RS 4YRSA 1R9JA 1I2DA 2GF0A 3GZ4A 3JASA 3I0ZA 4Q5IA 3QE3A 2X0FA 1FVXA 5BQXA 1RI1A 2AC7A 2V3VA 1E3DA 2ZWOA 3DBVO 2R00C 1W581 4WN9B 1CFZA 2FPMA 2X2PA 4HGOA 4GI1A 5F7XA 1LLUA 2XB4A 3FHTA 3A1FA 1W44A 1YS9A 2OG1A 3H65A 1TJ5A 2PMDA 4OI4A 1SXGA 4UU7A 3P71T 4LECA 4MQFA 3NV9A 4WFIA 1FVFA 2ICAA 2IDJA 1UBSB 3HYNA 4FONA 3VR6H 3ZQ6A 3HTXA 3OIUA 3AU8A 2H4YA 4L6AA 2MSKA 5M34A 2AL7A 4YCSA 5EIEA 3DD5A 2Q2NA 4I1SA 4GZLA 5EAIA 2ODAA 1KK2A 1G9XA 4GPEA 1F5SA 3L0CA 3LD9A 1JDTA 2UZ1A 1QRRA 4NYJR 1BRMA 4RK7A 1ZSVA 3RVMA 3IR6A 1E2HA 3GFGA 1OLXA 3QU7A 4J2OA 4GYJA 4P92A 3C6YA 4S2UA 2WJIA 1E3WA 3SS9X 4LSGA 1VB3A 3AFHA 3PHBE 1QGAA 5TR9A 3GRVA 3WJ2A 3MIZA 2QR5A 3IMKA 4HGZA 4RQUA 3IIIA 4AECA 2VH5R 3TMAA 4EBFA 1P33A 1HLFA 3BWBA 3BCUA 5ALVA 3DVLA 2IITA 2CKMA 2MWMA 3QHAA 5DFAA 2AG0A 2EX0A 3LUDA 4X3PA 3NHZA 5AKLA 1SVKA 2LP4Y 1UXGA 3P96A 4OSEA 3ZBPA 2H0AA 1GGNA 3I52A 4IKOA 4MWCA 4JP5A 2IWRA 1ZIOA 3B9RA 4E5UA 1IVSA 1Z56C 1G59A 5E1BA 1AY0A 4MIYA 2FV8A 3OMXA 1O0SA 4MEJA 1XMXA 2PFGA 1SKUA 1XQXA 2VRNA 4ILKA 4OLFA 4QJIA 3TAXA 2L0XA 3F4KA 4ZO4A 4N6NA 3WADA 2OXFA 2SCUB 2WIKA 9MHTA 1DXHA 3UAYA 4ZAWA 1CVRA 3QOFA 3WLAA 1H69A 1R8QA 2P90A 4FDTA 3SYNA 3WG9A 5COQA 2C2GA 4U8GA 4D9KA 1JEYB 5DM70 3RKSA 3B5JA 5K8UA 2HUNA 2ORWA 4HDQB 1MAAA 1RKBA 1OGJA 2IW3A 4FCCA 2O2XA 2PR7A 2FW6A 1UJBA 1UP6A 2BTEA 2CWWA 4NCHA 4QECA 3AUAA 2ISSD 4XX1A 3O4HA 2JPDA 4HDNB 1PW5A 2HBRA 2M9MA 2WSSD 5E6UA 1HOTA 2GXUA 1N1MA 3MHPA 2IWHA 3FRIA 2ZS7A 3BBPA 1SG9A 2SICE 4RH1A 3ROXA 1PZEA 4UOEA 1H8HA 4J7CA 4O1MA 1DXYA 1ODSA 1T8WA 3F49S 2ODTX 1UFOA 2HMTA 1GU1A 8AT1A 2Z8YM 1ZU4A 5G4LA 3ZXYA 1N6IA 2Y93A 4KHPB 3L7BA 5L4LA 2A9PA 5HRUA 1BDJA 1OZ0A 1NQVA 3A26A 2Y2UA 3ES9A 4GYWA 2ZE8A 2C4VA 3K9CA 5IKOA 4EPWA 5CFRA 5H7XA 1H6BA 3GB9A 5L3QA 3HKEA 4OYLA 4GHWA 3WNDA 3KPJA 1WTCA 3PEUA 2VHTA 5F76A 4D3XA 1CETA 1E2NA 4BV2A 4E30A 2R60A 3R0IA 1SCUB 1WQ1R 3T7EA 4WZZA 2O5CA 2BELA 4EQ6B 4JUAA 4OMUA 2WZDA 3RHZA 4AJIA 2HTEA 1PWEA 2Y05A 2Z6AA 5IZ4A 2EYQA 3CLUC 4HAYA 5SZHB 3H8WA 1ZG3A 3I39X 3KHSA 1Q15A 1Z8FA 2HZ7A 3C5CA 3NHFA 3OP1A 3JD2A 4OAPA 4ZXPA 5HUHA 5KIAA 1W85A 4MWDA 4JHXA 2EJWA 3I9KA 4DQ0A 3G68A 3GD5A 1UBUS 2IELA 2OVBA 1JW9B 3AIKA 5FWDA 3L8MA 1XK7A 3IIKA 1VPVA 4L5AA 3RBZA 5BSFA 1DC4A 1IEXA 5KWSA 2IIQA 1N0IA 2VDUE 4JI7B 1UJ6A 3PQCA 4GH5A 1LBIA 5JDCA 1R3DA 2FZLA 2VFAA 3AVUA 8OHMA 1XCPA 2AQKA 2WTBA 3IMFA 4YLGA 1KYXA 4KE7A 5ICFA 4D0GA 4YT4A 4DWJA 3I6MA 4UNPA 5DI3B 4EY4A 1EQUA 2O2IA 2XUGA 3X44A 2I2AA 4OV6B 5JZBA 4O4IB 4Q9NA 5K0LA 3RIHA 4WJKB 2OFXA 4DXAA 3DLTA 3KTAB 4KPUB 5A02A 2CNNA 3N74A 1XA3A 4HTAA 4QRDA 3EIUA 3EVEA 2HADA 3FWZA 2J09A 1WW3A 1NY6A 4QQRA 4KJZA 1XAIA 4O8CA 3E1GA 1NBWB 1X7ZA 1TUIA 4QFBA 3TLKA 1M6YA 3C1OA 3DE7X 3E8XA 4EYQA 2J0SA 2DLCX 4MUAA 2ZEJA 1UDRA 3SP1A 4WZAE 4CV0A 4HNUA 2ZP1A 4B48A 3C8HA 4A5OA 1XFAA 4BLRA 4MQUA 5AOVA 1NMYA 3ZWMA 1HTTA 1I5OA 1SVSA 2VI5A 3VR6A 3UXYA 3HJGA 2B1QA 2FFRA 2VAVA 2WWRA 1SHUX 3ESAA 1QP8A 3IKMB 3NHJA 3ZH2A 3TS1A 1SD5A 5KSOA 1DC7A 3A6JA 3E0QA 2DP4E 1XHEA 3IUPA 4L0CA 4U4AA 2R97A 1ZUHA 3KQKA 1UXOA 4YJGB 5IC4A 1D2RA 1OYYA 2EGGA 3AHJA 2ZYGA 5C1BA 2RAUA 4WV3A 4XGIA 4R4JA 1FDVA 2PO5A 1JG4A 2YY5A 5HFJA 1W9HA 3HN6A 4WZAA 1VMDA 3BZWA 1YA8A 5LA6A 3IFSA 1QO7A 1XP5A 1P6XA 1ZGHA 2K4MA 4GE3A 2W37A 2K2QB 2ZUSA 3R8FA 4IH9A 3O8LA 3TFWA 5JAZA 3MRXA 4E5PA 1JNXX 2X7JA 1YI8A 5ALMA 2CDAA 2JI7A 3F46A 2PU7A 2QTBA 1UQUA 1GXSB 1U7DA 1OXUA 2F48A 2RGXA 2JC3A 3M2PA 4FFSA 4X00A 5FOQA 3BILA 3VKGA 4JLKA 4J76A 2NWQA 1AKVA 1DHRA 1DBQA 1J8QA 1TZ2A 2C9OA 2FPPB 2EDAA 1G5FA 1R0ZA 1BQEA 2BZSA 2HK9A 2OQRA 2XRFA 3C6MA 3FGZA 3OJEA 5CHYA 1C0KA 1QK4A 3CB2A 3KZCA 1FMTA 3QEOA 4HTFA 4A8JA 1BU5A 1FDWA 3RVQA 1QHHB 2QRGA 4LOKA 1JHQA 2C82A 4P4LA 4K81B 5DYIA 4Z49A 1WMSA 3CZAA 3GEGA 3TSAA 3BF8A 2C7QA 1KP9A 2UZ3A 1O03A 1A9XB 1ZD5A 2SKCA 1XVLA 4Y2YA 5FIUA 4CEHA 2E4YA 5I7UA 2F1IA 3NUQA 2G1PA 1K5PA 2FVXA 4DUGA 3SNKA 3RUHA 5JALA 1DL5A 1HK7A 1RYEA 4GLOA 2HR1A 2PAFA 4MMYB 3EUWA 5J4LA 3L6EA 3BFJA 1U7OA 4P7KA 3FETA 2B34A 2A1UA 4QDKA 3WWDA 3THRA 1GT6A 4AN0A 1QHEA 2GAOA 2VQDA 3RYFA 2C99A 5IBPA 4CKXA 3DVQX 4FB4A 1JR6A 2XNCA 1L9XA 1N5MA 4LI3X 3EOZA 4Q1DA 2IXFA 3QNMA 5FBQB 3TDNA 1KZ6A 3W6NA 2X8AA 2QG9A 5BRAA 3QFRA 3KPYA 1IN6A 1HEYA 4AMZA 4U39A 4C05A 1JEOA 1XN1A 4BZWA 1ULBA 2WSIA 1G3QA 4XEHA 4XE5A 3UT5B 3GUUA 2BFFA 4IIVA 3MWKA 4TMTA 2PKQP 4LXHA 3HKBA 4GQIA 4DZRA 3GYGA 1QP4A 1U0EA 1OHHA 5DRYA 3E9ZA 4CHTA 4MKGA 2CJXA 3WSTA 4PLTA 5AHXA 1GGVA 4RPGA 3FAKA 4TM7A 1U31A 1I94B 3CF4G 4EB3A 1OBHA 1UMDA 4MB2A 1ZHHA 2JIPA 1QZXA 1CUSA 3AR8A 4JJKA 1D2MA 3KX2A 4LGCA 3H7IA 1QUFA 1SVNA 3IVXA 3L0DA 2BRUA 3U7HB 3R3SA 2DPMA 5C5DA 4KN6A 1U0NA 3KQTA 2J9FA 3TSYA 3EJ6A 3GBVA 2VDMB 5EXPA 2WZBA 1O5TA 3R5TA 4PBTA 3L9XA 3DHEA 1MA3A 1M1YE 1Z4QA 2DBYA 5IBRA 3ROMA 5HXAA 3BSFA 1NI3A 3PKZA 4Y6OA 1ESDA 2GZRA 3OPYB 2B82A 1ZM7A 1JXAA 4BP3A 2ZZMA 4U0KA 2MR5A 2FDRA 3I04A 3EXG2 3IPCA 1GNLA 4IDEA 4BNHA 1LBHA 1UBOS 3VDNB 4BVFA 3IQWA 4IG9A 5AW1A 2CZCA 3HJCA 1KE2A 3IT2A 5EQFA 3DE4X 3KC2A 4JMPA 4P7FA 4ZU6X 3EPLA 1NXSA 1LB1B 3ELYA 1RWWA 3I5XA 1WLSA 1IMJA 2FWNA 3UGQA 3T7DA 1M0EA 3WAGA 2NP6A 4MCAA 1JKJB 3RSCA 3UV7A 3OUUA 4KQMA 2FYTA 4L28A 1THZA 2AEFA 4J1TA 5AJWA 2JI6A 1QHFA 2JBAA 2G9NA 2FP4B 3C24A 4X1YA 1RACA 2OO3A 2IOQA 3AKDA 4TQAA 4EL0A 5JNLA 2D1TA 2G07A 4ZO6A 1V4BA 3RBVA 1Y3HA 2QN7A 2GERA 3ZDRA 5B3LA 2ERXA 3R3JA 2P9GA 5T4EA 3QK7A 3VO9A 1LDBA 2UYCA 3AESA 1OLSB 1H66A 1DAMA 2B4QA 3IUJA 4RK1A 2BAGA 3AM3A 5J2TB 1CKEA 4K6FA 2PJRA 3EQ8A 3LQYA 3MJVA 4H3HB 4K8OA 1I7LA 3RH0A 2Q1XA 1XMPA 1KEPA 2IU3A 5BUZA 1OV6A 1NMSA 4URWR 3OE4A 4QGSA 2EJTA 2F00A 2EZ8A 2ZTUA 3EFHA 3WLMA 3ZQ4A 3S1LA 1IXRC 4P5DA 4YV0A 5IF9A 4G23A 3S2UA 1YQEA 2HMWA 1XMVA 2Q6VA 4C3UA 1EAMA 4LBVA 4LUCA 4BNDB 3F6PA 1TADA 1BDMA 4K6GA 1VSUA 1GUDA 2PYZA 4ZVKA 4DG5A 1ZAKA 5DCLA 3NGXA 3PE6A 5HKLA 4H1HA 3KOXA 1B8PA 1OTXA 1IHOA 4V0NA 2Z2KA 3IEVA