5LVAA

Crystal structure of thermophilic tryptophan halogenase (th-hal) enzyme from streptomycin violaceusniger.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
174
structure length
174
Chain Sequence
MKVLVLAFHPNMEQSVVNRAFADTLKDAPGITLRDLYQEYPDEAIDVEKEQKLCEEHDRIVFQFPLYWYSSPPLLKKWLDHVLLYGWAYGTNGTALRGKEFMVAVSAGAPEEAYQAGGSNHYAISELLRPFQATSNFIGTTYLPPYVFYQAGTAGKSELAEGATQYREHVLKSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H-FMN oxidoreductase
publication title Structure and biocatalytic scope of thermophilic flavin-dependent halogenase and flavin reductase enzymes.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 62
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5lvaA00
1DX9A 2R97A 4PU0A 2FX2A 1FVXA 3L9XA 2HNAA 5EMNA 3TE7A 3P0RA 1FTGA 4GR9A 3F6SA 3KLBA 4ZVKA 3NHLA 1AMOA 5B3KA 4LA4A 2FAXA 1JA0A 4U7FA 3TZBA 2Z98A 6NULA 1VMEA 2MWMA 3RPEA 1D03A 1QR2A 2R96A 5FA6A 5FX2A 1XYVA 2HPVA 4Y9RA 3OJXA 1X77A 3NLLA 3QFCA 1AHNA 3KAPA 5NLLA 1CZNA 1C7EA 4Y7CA 1F4PA 4N9QA 1CZUA 4OXXA 3FW1A 2KQUA 3FNIA 3NHJA 4N82A 3SVLA 4PTZA 2BPOA 4J8PA 4FGKA 1DXOA 3OVMA 4C0XA 3W77A 4ESEA 4C76A 2KLBA 2QMZA 1E5DA 1T5BA 2B3DA 2W5UA 4CF6A 1DXQA 3KEGA 4QOJA 3NHPA 3NHFA 5B3LA 3N39C 4C14A 5LBTA 4BMOB 1AZLA 2FLVA 4FGJA 3F2VA 3GFRA 3OJWA 3ESZA 5BUCA 1ZWLA 3HR4A 1QRDA 3U7RA 2F1OA 3K1YA 3OX2A 1CZRA 2M6RA 1RLIA 1J9EA 1OBOA 1BVYF 2Z9CA 4QODA 2A5LA 3UXHA 2FOXA 3HA2A 5LBUA 3ESXA 4XDHA 3G5MA 2OHIA 4HS4A 3F6RA 1CZLA 5TGZA 2MOKA 2OHJA 2QWXA 4CETA 1FLNA 1AKRA 3EDOA 3D7NA 3ESYA 5F12A 4N65A 2FZVA 4ZVLA 1T0IA 1NNI1 2Z9BA 2FZ5A 1JA1A 3N3BC 4YALA 2AMJA 3W79A 4ZVMA 5EA2A 2XOEA 1SG0A 5NULA 1FX1A 3F90A 4H6PA 3JSXA 1YOBA 2ZKIA 2QX6A 4D02A 1YDGA 1B1CA 1CZKA 1XT6A 4QOGA 1GG5A 1C7FA 4DY4A 5ULLA 2XODA 3R6WA 2HNBA 1AKTA 4QOHA 3U7IA 1OFVA 4F8YA 3GFSA 3NHRA 3NHWA 2QX8A 4FX2A 5F51A 1CZHA 1YCGA 1H66A 4LAFA 2QR2A 3NFRA 3S2YA 3GFQA 1AKWA 4HEQA 3K20A 3O2NA 4LTDA 1YCFA 3OX3A 2QX4A 1WSWA 1XYYA 3TEMA 2QMYA 1YRHA 2FVXA 4NLLA 2BMVA 1FLDA 1RLJA 1TIKA 3OX1A 1D4AA 5LMCA 2BF4A 4LTNA 4C0WA 4YQEA 2RG1A 2Z9DA 1FLVA 2Q9UA 3HLYA 4GQIA 3QE2A 5FUQA 3UXEA 5LJLA 5LVAA 2ARKA 1BU5A 2MTBA 4GI5A 3LT5A 4R81A 1J9ZA 4U7GA 1V4BA 2BZSA 1YCHA 4PTYA 1AKUA 3B6IA 4U7HA 4BMPB 3GAMA 1ZWKA 1SQSA 4YAWA 3B6MA 1J8QA 2V5VA 3OWHA 2MT9A 3NHUA 3LCMA 4Y9UA 1AKQA 4QOFA 4DIKA 2X2PA 1FLAA 3W78A 1D04A 5LLDA 4YAOA 4FGLA 1KBQA 3EYWA 3FVWA 1FUEA 3N3AC 1H69A 3B6KA 1OBVA 5LJIA 3L9WA 2Q62A 4QOIA 4ZVNA 2N1MA 4NULA 1WSBA 5A4KA 3OWXA 2V5UA 1RCFA 2X2OA 3KAQA 4ICIA 2FCRA 3FX2A 1TLLA 1XI2A 1I1OA 5JROA 1J9GA 1AKVA 1YKGA 4YAFA 1QBGA 1CZOA 1ZX1A 4DILA 3NHKA 2OHHA 3O73A 3FJOA 2FDXA 1RTTA 2OYSA 3QFRA 2M6SA 4LTMA 4YAUA 1KBOA 3W7AA 5F4BA 1QHEA 2QX9A 3NHSA 2GSWA 1AG9A 4QOEA 3NHYA 5EAIA 2D5IA 4H2DA 2WC1A 4S24A 3ES9A 4M0CA 2V9CA 3ZHOA 4XDGA 3B6JA 2BN4A
chains in the Genus database with same CATH superfamily
2NOAA 3RSZA 4AJIA 1C41A 5EQJB 5K6AA 1LK7A 5LQAA 3CZRA 3FKSD 2OZLB 2PNFA 3E5NA 4ND8B 2CXUA 2ZT7A 1UZNA 1JQLB 3KJNA 1THMA 2ODPA 3P0RA 4KX5A 3RC2A 3RDPA 3U3OA 5FNVA 3SYKA 3LY9A 2BEUB 1ITZA 4DHWA 2V6FA 3I53A 3MAJA 3H04A 3DAFA 4GX5A 3JD0A 4KSBA 4XLLA 1LWNA 3S70A 3TOCA 1D6NA 1C1DA 4OHRA 4QSMA 2JARA 5DBEX 1Y98A 3RPEA 4ZJPA 5JSZA 2GYWA 2CKMA 4OUDB 4LHEA 4OLJA 3RHTA 4AI6A 1JLSA 3DOUA 5GP1A 1PUIA 3DLPX 2O2IA 3FFAA 2A0UA 2VHZA 1V2HE 2X0FA 3H11A 3R9IA 4AC9A 4BX8A 5K3BA 2I3GA 1EBFA 3GPIA 2QRNA 4NNOA 2WE8A 3ZGLA 1E99A 3IE0A 1JFFB 1V45E 1VG8A 4FFOA 1L7OA 3UJBA 4W5JA 1Y1KE 4BBJA 3H9UA 4FINA 5HX7A 4PYKA 4J4HA 4Q7LA 4KKVA 1AA9A 1M67A 1W5BA 1U8UA 2O0LA 1GCIA 4M0UA 1JAIA 1S8NA 1MJHA 5B55A 1B3BA 3QWIA 2MINA 3RUAA 5JBQA 3ZK7A 4D4IA 3FF1A 5JD4A 4IRUB 3PGKA 2AFHE 2FN8A 2OLEA 4NZYA 4YP6A 3F78A 2RARA 1R2QA 1ND6A 4HBGA 2BBTA 2VSFA 1GU7A 2IGTA 2WIKA 2QRGA 3KAPA 3PZRA 4DEVA 4DMLA 5A3RA 3IXQA 1XCPA 4KUEA 4BLVA 3DHWC 1S89A 5KC9A 1VBMA 2IYFA 4DJEC 1C7EA 1P3DA 4IXWA 2NXEA 4JJGA 3FKSA 1H93A 3CKMA 1L7RA 4NCNA 3TGLA 2VHUA 1L7NA 1WXGA 3SJ7A 2OL4A 2PGDA 1E9AA 3HY3A 3RABA 1OH6A 1CW2B 3E53A 3KB1A 4ZT3A 2HTFA 3JAKB 2PM8A 4OIFA 1FFDA 3ZWMA 1PNVA 1IOWA 3A4NA 1JDTA 2GCNA 2OXRA 2C1XA 4H1VA 3EW9A 4Q05A 3ZZUA 3AVVA 1F0YA 2XQKA 5ALPA 4KN8A 3HSYA 4M8LA 2O8FA 2H2GA 1PJ2A 1TLTA 4MQFA 1ZAYA 4I6GA 2O2DA 4RZSA 4R8VA 3RUDA 5D5PA 1XDBA 3LNCA 1ULBA 2HPZA 3JV7A 2XQIA 1YQUA 1Q12A 1W9HA 3CKYA 3L1KA 2IT1A 4A8JA 3R41A 1DQRA 1VE1A 3PNVA 1XZ8A 3B6ZA 2W8BA 3DE7X 4P3YA 1KVSA 4CW7A 1GTJ1 3GZNA 4NFHA 4Y2XA 2HK8A 2JEYA 1W85A 1ZD3A 3EVFA 5DLPA 4TWRA 1FPQA 1DADA 1MAWA 3HJBA 3N39C 2RCYA 4GE0A 2MYPA 3RS5A 3T1QA 4Q34A 6PFKA 4EHAA 4RU1A 2IQIA 1ZJ5A 1O54A 1RYDA 4L7QA 1AZLA 2FLVA 1H0KA 4KN9S 3A6ZA 2C2WA 2H51A 3N7UA 1H2HA 1EMDA 2C9YA 4MQLA 4Q9NA 3RF7A 3IA2A 5FNVB 1A7KA 3BFPA 4OAOA 2IYWA 4U02A 5D5QA 2DETA 5GADl 2H16A 2VF4X 2BRUC 1WXXA 1PI3A 3GGCA 3HE3A 4YACA 3ZWDA 5FLYA 4IIBA 2VNJA 4XFKA 5JG7A 5LMNB 1KZGB 2HBQA 2INGX 3GQBA 4X20B 1L5YA 4AICA 3A70A 1UZAA 1VYHA 1FS6A 4HQNA 4QBGB 3D4PA 2Q5QA 1B76A 2A88A 4PYMA 1PEKE 4AYTA 3UHJA 2UXCB 1EP2B 3WLNA 5LP1A 1DIBA 2FB9A 1RLIA 2NZWA 2O1XA 2QVCA 1NZJA 3T95A 3W3AD 4YWHA 5BURA 2BL4A 2XNCA 3TLAA 2I4NA 1DJQA 2O0JA 4GI2A 5ALKA 2H2IA 4XFJA 4A03A 4GX1A 1B7GO 3B36A 3GLHB 3RBXA 3ZZTA 4OF4A 3KKPA 4W8OA 5KU1A 16PKA 1VE7A 5E9JA 2H8KA 3VO1A 5D2CA 4BNXA 3CY6A 4FMBB 4JBLA 2J48A 2VBFA 4RJTA 3VH3A 1QWOA 4PPYA 5KQLA 2I55A 4C2UA 3BICA 1U1DA 2H31A 4BQOA 1DG3A 1WVIA 2YIDA 4TQUS 1JH9A 3PFNA 5K0CA 2VRCD 3HFRA 2AVDA 4AQYB 2X2FA 1P80A 4F3NA 1NXSA 2G1PA 3C70A 4MULA 4XCQA 4BO4A 1WCIB 3EPRA 3K2EA 3G7SA 3P2KA 2C7BA 3OQVA 1LCIA 1M2OA 1P7ZA 2ESRA 2ODQA 2QTAA 3QTBA 1EYZA 2OYCA 3EQ6A 5EXEA 3ER9A 4GZ5A 5EINA 3ZKWB 4KI0A 1C9MA 2NNLD 3FLAA 5P21A 4H7EA 1F3LA 3FOEC 4F56A 2VATA 1OTYA 3CWQA 4L5IA 3OKPA 1DQNA 1XRMA 1N77A 5CJPA 4FOLA 1V37A 4NBSA 4B7UA 5BQFA 5J2UA 2UXDB 1FQKA 4ZANA 2IU4A 3K0FB 1T34A 3B52X 2AMJA 4MW0A 4ARZA 4DPKA 4QPCA 4I1OA 2R6CA 4AULA 4COKA 1N0IA 2UZ4A 1COZA 3ITNA 3AIOA 6YASA 1IDN1 2Y2UA 3EDYA 4YMWA 5LYYA 5I5GA 3KXIA 3FM9A 3F90A 2H65A 4HPJB 5A4FS 3CBQA 1JWAB 4G89A 3JAWB 4I9FA 2FGJA 3RIMA 4QJ3A 4BXOB 1I7NA 4HAXA 5HUJA 2FQ1A 2I6GA 2ZLBA 4OXYA 3W3AA 4A8JB 3ADDA 3DP7A 2XKKA 1TQDA 5KSWB 4UVEA 3GJ5A 4ZU3A 4D02A 2AKEA 3L7YA 4HYQA 1BWQA 4TLAA 1ZGZA 2GN8A 2GO7A 1G6OA 4TSRA 2FUG6 3U62A 4XIFA 2YWXA 1GG5A 2Q0HA 4UHBA 3MRXA 5PGMA 3L7IA 2WRZA 2POCA 4WD3A 3KQMA 4OKSA 3E5HA 1T3GA 3ZHRA 4D8VA 3AQ4A 1E69A 1E6UA 1BJKA 2ISQA 2W2LD 4UU7A 3NO4A 4EKGA 1AJEA 1BFKA 2E3JA 3RHFA 3K9NA 2R6HA 1VHJA 2VRCA 4CT5A 4N76A 4ZAFA 2QJWA 3PUKA 4ZI2A 1KQFA 2O2SA 4JASB 1X7WA 1IDOA 2CUKA 3KJQA 2ACWA 3M5PA 3U17A 4MLDA 3L2OB 4LWPA 2WDPA 1UOEA 4L08A 1H22A 4DZTA 3GELA 4OBBA 5J1SB 2QVZX 2IPAB 4ARVA 4GBGA 3UFXB 1I32A 4XW2A 1ZUNB 1OI3A 1L6RA 2B25A 2NAFA 5EY5B 1PQYA 3G2JA 1W75A 3TW8B 3E81A 2CZCA 5JUWA 3I61A 1VKZA 1P4JA 2WV7A 3FXAA 3TNYA 4NG5A 1RWOA 2AZDA 1VIAA 1TQ6A 3QLVC 1UJNA 1QQ6A 4HVTA 2B8JA 1UFOA 2FR8A 3HBMA 3M3PA 4G24A 2EL9A 3Q41A 3RROA 2HHHB 3IQGX 4OQ4A 1AGNA 2JRCA 3WHKA 4WLVA 1T13A 4Q9KA 3SM3A 2P8JA 3PJFA 3W8NA 2CCGA 2ZTHA 3L7AA 2HA6A 1Z73A 2A5FA 4JJKA 3R3SA 1E4EB 3DTVB 5BMVB 2G0NA 2DQSA 2R6JA 1XEWX 2NNWB 3ESBA 1DDIA 4PR0A 1V96A 3UMCA 3ZJYA 5LQNA 5JSUA 2G1AA 3ZJVA 4J4TA 4CG2A 2JI9A 4ND4A 4BZXA 4CQMD 3PHCA 4LQCA 3FI9A 3MWDA 3E03A 1KO1A 3Q7EA 2X5JO 4OQQA 1B42A 4REQB 2CLEB 4JFAA 2BH9A 1M1YA 4RUKA 3TEMA 2BGKA 1YB7A 5FADA 1HETA 2WKPA 2IYOA 2X5KO 2VYFA 1RRKA 2HA2A 2O52A 2FWMX 4MW4A 2W2LA 1GT91 4LFAB 3JQBA 2ZAIA 1Q84A 3D0OA 4F71A 4TYYA 1Q17A 1DGQA 2H7YA 1JHXA 1GZ6A 3RFFA 5B5SA 2CMKA 4KDEA 4R3NA 5I7EA 5JCOA 1B2LA 2WYIA 4IDBA 2EVWX 4WZAA 5I5EA 5F9FA 3O84A 1MQ8B 5D3KA 2G5CA 3MIIA 1IN4A 1UBCA 1TKRA 2C3MA 1D4AA 2SHKA 3JX9A 4XX0B 5JZ9A 1MIHA 2SKCA 3CF4A 3O8QB 4X3OA 3WMRA 1NIPA 1FS4A 2XE6A 1Q6ZA 3N7AA 3BIJA 4K9NA 4D6PA 2XD4A 3ETHA 1ZJZA 1AQLA 2GN4A 1L5GB 1UK6A 1T5HX 3RE1A 3S2IA 1EGMB 1A5ZA 2IF2A 3LA6A 4BAZA 3C4VA 3TVTA 1GFIA 2DSTA 5CFZA 2GRAA 5CDHA 1N6HA 5A5EA 3V8BA 2WJYA 3G7UA 4UMFA 3ZCSA 1TRHA 5AT1A 1H9CA 1LLCA 1HYBA 4PS1A 1Z8NA 2ROQA 4F4UA 1FA9A 3GLFE 4KQFA 2KYRA 4G2NA 5EN4A 1Z0AA 2W2VA 3AG5A 1Z7WA 2BFPA 1ZI9A 4HR7A 1JHQA 1WDWB 3GA7A 3KUXA 4OYYA 2WY2D 4JEUA 1GTG1 4LE1A 4CCWA 3LKZA 4LEIA 4QD3A 4UQOA 2P2NA 4TVKA 4OHUA 4CQMA 3RFXA 2CNOA 1X7WB 1E9DA 1YC5A 3GIDA 1Q95A 2Y0DA 4K6CA 4U2CA 2BC9A 4ZP1A 3UK0A 4IF6A 1SQSA 3VPBA 1EQAA 2WJHA 2X42A 3D2LA 4JN6B 3IULA 4KNYA 2BCJQ 1WKVA 4YCAA 5IANA 3IEVA 3B6MA 3D6HA 4HB3A 1Y42X 5IUNC 4TQAA 3B8EA 4MDEA 3EWIA 4Q7MB 1YR9A 4RIEA 3KZCA 5CVJA 4BKRA 3TINA 1Z39A 1J0DA 2G83A 2YVAA 2ILTA 4KO1S 2XDQB 1NW4A 4GFDA 5A4DA 3OFSA 4R8SA 1X19A 3IXMA 1CU1A 2YQ4A 5KPDA 1A7AA 3VKGA 3OECA 3Q15C 4D0NA 3FFBA 1X15A 2VZ0A 5KNDA 5E2BA 4GX2A 2AZXA 5TS2A 2D5AA 5A1JA 4QVGA 4ZPXA 1TW2A 3F6BX 4HATA 1O6CA 4MV1A 2A1UB 3VNUA 3R7WA 5FEMA 1DJPA 3I09A 4EX7A 5EGNA 4FWBA 2B6HA 5HF8A 1ZDMA 5JCZA 2IC5A 2VHQA 4WK0B 5ALUA 1J2YA 2GHTA 3L4BA 2BZ0A 1AHHA 5KJ1A 2WFMA 1TCAA 1TU3A 2PYIA 1DE0A 3H8WA 4GKBA 4NWIA 1CB0A 5JMWA 2YL2A 1Y9ZA 3MWDB 5JT1A 4X90A 3RUCA 2E5WA 4K0RA 4ZK6A 1USIA 1B6RA 4LOAA 2OXEA 4WCFC 1ZW6A 2IPXA 2Y1KA 4YO7A 4QGHA 1CFZA 5GAJA 2JFVA 2VJLA 4DJDC 3M6VA 1JEOA 3TJZA 1Q7TA 1ANKA 4DV1B 2HBYA 1KY3A 2ISSD 1NMZA 1XPUA 3LQQA 1UPTA 1TNDA 2JS7A 3FI0A 3GZJA 1MQAA 3HKDA 4P5DA 4ZOEA 5E0KB 4BEWA 5IXJA 5EVCA 5I4IA 1HT0A 1ZKMA 2DHEA 2P2YA 5TGDA 3SJAA 3T6KA 2IS6A 3EBPA 4WZBA 2Y1OA 2H1OA 2H1VA 3G82C 4Y2SA 4ZVNA 2HQRA 3HJCA 4YP0A 1AK2A 3VR5D 2QD2A 1GTL1 1ZN7A 5AM5A 3TOZA 4TTVA 1U5CA 1W19A 4YJ3B 1N2XA 1GNRA 2IZ6A 5DLQC 4LF4B 1JHDA 1XZMA 3GK3A 4D4JA 1LZKA 1NXVA 3USES 5JC1A 2OV1A 1YR1A 4YC7A 4Z7OB 5GY7A 1C9JA 4OQXA 2VLBA 3AUAA 3KSZO 3EZLA 3S0JA 2W93A 4MUYA 3B1WA 2AXNA 4O4LA 1I1OA 3WAKA 3INYA 3Q3IA 4C0JA 3F0TA 3PFFA 1OH5A 1T9GR 5AW4A 3KZKA 4NU0A 4JI8B 2WHYA 3KYBA 1OT3A 3SMQA 1GDTA 2ZUVA 2VF5X 1QLHA 4EJFA 2HRRA 2OO3A 4JOBA 1OXUA 2NGRA 2MSDB 5AK3A 4A8PA 5CM8B 3E4CA 1WS6A 4CMGA 4HWRA 2G70A 3SKXA 4KMRA 4D5EA 3WRXA 5HQ3A 1T6NA 2ZIZA 3KZOA 4CQMB 4EA8A 2X6QA 3HB9A 1U5BB 4EUFA 4LDAA 4RTRA 1Y6QA 3S2ZA 3WB1A 1PL8A 5AM2A 3BDIA 1TF2A 2VHEA 2AC4A 4ZI7B 1OROA 3P9RA 1HDOA 1KBOA 5E4FA 3HC7A 4WFIA 4KSCA 2B34A 2ZT8A 4N0QA 1GPUA 2EZ8A 1DQZA 3NU1A 4QU8A 1GNLA 3OMWA 4FYPA 5H59A 2GZMA 4Q6WA 3PEYA 1Q7EA 3K6SA 1R8JA 2A5GA 1ODTC 2B2NA 3C43A 4ROTA 4Y6LA 4DJFC 2YWDA 3DUWA 1RXCA 2PQ0A 2WVAA 3VR5A 3PSHA 4E13A 4H2DA 1GTZA 2G4CA 3U48A 1JB9A 1N9GB 2G9RA 3W5UA 3LA8A 4NV1A 2J5XA 3FYSA 3NHMA 4OK5A 4Q1VA 4QU5A 4ZODA 3RUFA 3UAOA 2JVIA 1IRIA 5TQ2A 2WF6A 5B7PA 3U7QB 3RBAA 2FSSA 1XUOA 1Z4LA 2M98A 4JBIA 3ECSA 1OBFO 3TTWA 2UUPA 3AINA 1FP1D 4S12A 3JARA 3M9LA 5IJZA 2X9LA 3FSRA 3NDRA 3P20A 4RHEA 4AN4A 2FUNB 3K9HA 2J7PD 1ZRSA 3NKVA 1NU8A 3GVXA 4M9XA 3NT4A 3FRJA 4KXUA 5L40A 3ROKA 4GZ3A 4DQDA 3VBCA 4RTMA 2PL5A 2CYAA 4NBWA 2H3HA 3WLKX 4TMTA 2QKYA 2YBDA 5FNZA 1AN9A 1R0RE 3VPCA 1GZDA 2PPVA 1J06A 2PX3A 1V8ZA 2XUGA 3GLVA 5T8KA 3VYVA 3D8RA 1QV9A 2PX5A 4JJ4A 3QE9Y 4B7CA 4ZZ2A 2OPHA 3GGPA 5CA0F 3WJ1A 3QOYA 3TSCA 3WGKA 4D46A 2VDKB 4Y30A 4L6CA 5IKXA 3GGDA 1NOJA 3C5WP 3V4PB 2BJVA 5FDFA 1N3BA 1IOLA 2H0QA 2X1HA 1QVVA 3UY4A 2QRJA 1V8FA 4B3DA 2GBFA 1J22A 3PPWA 4Q3OA 3GVPA 2NVUB 4V2UA 3S29A 1TAGA 3I76A 2Q2OA 3BWDD 1IHUA 4RTJA 4L5AA 3EX7C 1HI9A 2FUKA 5IS2A 2I4OA 1IHPA 4HLNA 4JK3A 4L8YA 3OPMA 5F1KA 3JD4A 5JOQA 4Z0HO 2NW6A 4J03A 3WIBA 4IUBS 3MERA 1WY5A 2ID8A 3A9CA 1QANA 5H81A 5IJXA 5KZMB 2A6PA 1C3VA 5AYVA 1RWBA 4EGAA 1DAFA 1YQTA 3KZMA 1QPBA 4XOUA 3WRYC 5I7RA 2DJIA 2I1WA 1PX0A 3IOYA 4KUHA 4MHSA 3THYB 4LI0A 2PUGA 2XHZA 3PQ7A 4YT4A 3PDJA 1HBJA 2BR4A 4BTEA 5BOSA 3REGA 5IYZA 4TUYB 3GLIA 3WSWA 2J0UA 4WZ6A 3H2GA 4BU0A 1GUZA 5L4SA 3AJ9A 3AIIA 2J7PA 4DMHA 1T5SA 1JUDA 2UZ1A 1RHKA 4AU1A 1SBCA 3E1GA 4I1IA 2RHWA 2Q7OE 1I1NA 1IWBB 1WD5A 3RWBA 3ZR4B 3CSDA 5KQSA 1ZESA 4PYLA 4WK4B 4YAEA 3OZRA 4GYKA 4M0MA 1DXOA 4BE9A 1FDWA 2POQX 3BIOA 3EC1A 3I1JA 3ITKA 3M4JA 1M76A 1EVZA 3O92A 4PRKA 2NP7A 5A4JA 5K0NA 1R3UA 1V8DA 5D51S 2N3ZA 1WNFA 1BEUB 2ZS8A 4ARSA 3D4IA 3NOOA 3NM6B 2Y1WA 4EI9A 3U3DA 2ZYRA 4J7UA 1TGYA 1P45A 2FDRA 3AT1A 4O4HB 3F3YA 3CPJB 5B37A 4NJEA 3PUIA 2CNNA 1JEQB 4MVJH 4JKOA 2QIOA 3AF3A 1PHPA 3BIFA 2G09A 2IXAA 3HBFA 4S2UA 1Z38A 2WMYA 4OJQA 4CT0A 3ESRA 4UM7A 3PKIA 4R8MA 5EJ6A 3ZU5A 2OAP1 5CUQA 1H2XA 3JARB 3J81A 1QNLA 5BXQC 3AGPA 1R4NA 2JIOA 4HZGA 5CT6A 5ARDA 3P27A 2HL6A 3G8CA 4JAVC 4M1KA 4BGEA 5JNVA 2AN4A 1UWKA 1ILWA 4A0SA 1EWKA 3IXLA 2OC9A 4I9UA 1KYWA 3UMVA 4Z7JA 1EUQA 3LX8A 4P4SB 4CM4A 2HCBA 4Y2HA 5DI3B 3ZGXA 2WZDA 2IQ5A 1F48A 4LYJA 4DQVA 4ZCSA 4OQNA 1HTTA 3N74A 2OCGA 4KO2S 5SY4A 3WZMA 4JX9A 5KTOA 1EDDA 2CF5A 2V6IA 2Y6UA 1LRKA 4FFBB 2VQ3A 5LNK1 4KQEA 2V6GA 5DWDA 5KPJA 4I19A 1X9HA 5KTMA 3T3OA 3JQGB 1P2UA 1TQ2A 4ZC8A 4QUEA 2VJYA 2NO9A 3CH5A 4NJMB 5LBUA 3UJAA 1NQAO 3W5SA 1S02A 3LDHA 1KZHA 5CAEA 2IITA 5HJEA 2ATEA 4YFVA 2GN2A 4WCFB 3IVAA 4YCLA 1PZGA 2E5LB 4XUEA 1B2RA 3QVMA 5LLSA 1U8FO 3KR9A 1SXJD 4KDRA 5ALNA 3NP7A 5E4JA 4I8DA 3RC3A 4CGYA 2WKRA 4DXDA 4HRXA 3VHXA 3FCSB 1F2TB 2HTEA 3L8DA 3OCXA 3ZYZA 3K5IA 3DPIA 4RZQA 2PFSA 1I3CA 1Q2XA 3M1LA 1QHSA 3ROQA 4MCIA 5ADVA 2Y8EA 3JYOA 3VKWA 3F6PA 1JBKA 2RHHA 5L6MB 2YQZA 3LL4A 1YRAA 5ALDA 5K4AA 1U8ZA 4TZTA 4NNJA 1QYVA 3IVGA 2FFBA 1AUXA 4WN3A 3ZDYB 2HLDD 5E0OA 5C37A 5BOSB 3CLVA 2BTQB 5DOZA 1C4OA 1YZQA 1K66A 3BF8A 3G0GA 3NUZA 4A36A 2FEOA 2QLMA 5DNCA 3GLIB 4JT2A 1HNWB 2F9FA 2X9NA 3IVXA 2P9CA 1YRBA 3R7AA 2VDMB 5BQ3A 4NU5A 4JROA 5FNVF 1CQIB 4DT1B 4HT3B 5H3CA 3ITDA 5AUPB 1CR2A 4MYUA 3I4CA 3DNFA 5TXGA 2AEJA 1P3JA 1ZM3A 4DVJA 2E85A 1WQ3A 1PU2A 5EP1A 5L7TA 4DCSA 3VSEA 4BLOA 4WT7A 4JJ7A 5K20A 3TNLA 3JAMA 2E37A 2YY7A 1SG0A 4OI4A 4RVFA 2O0HA 3H5NA 4YQZA 4Q12A 3EVDA 4HPXB 4B6PA 2PX6A 3WIUA 3NBFA 3C85A 3QENA 2G7MC 1Q1EA 3UGKA 4UW9A 2WHEA 3GJ7A 5DM70 3EBOA 2IDJA 2D4HA 2IEDA 1QHFA 1E5QA 3CUUA 3LPAA 3MNFA 4FDUA 1QV6A 3G9XA 3JRWA 3SHTA 3DE4X 4B84A 4DDWA 3WB2A 4CMKA 3K8YA 3EZYA 1OB5A 4HV4A 4GMXA 4WQMA 1E3WB 3JQ8B 4Y2RA 2P4SA 2REBA 3UICA 1XTVA 3U4QA 4I5EA 5J5CA 2P5YA 2BTEA 4Z4IA 3RIGA 1CS0B 3AU8A 3S5JA 3C48A 3SD7A 1Z3CA 5BWNA 4UVGA 3RVSA 4GOND 2Y0BA 1RLOA 2WJIA 3M6WA 4IKOA 3V1NA 1U5AA 4CMEC 3HP7A 4CM5A 4ZT5A 3ZHBA 4UBMA 4BKPA 2XB9A 4KSYA 5HM8A 3VA7A 1QGAA 4BO3A 5ESWA 4UVIA 1T35A 3P9YA 4H6XA 5KCZA 2C7OA 2HLDA 4PONA 5IVKA 2YYSA 1QPZA 3NOXA 1KC3A 3BXZA 3F5QA 3GHYA 4V0MA 4BJHB 3IRVA 5A3SA 4F8YA 3RT7A 2J67A 5A3QA 1QDLB 1XJ0A 5JPDA 4S1TA 2J7KA 3LHIA 1QR6A 2UZIR 1DOHA 3FDFA 3FNHA 4K9MA 1JKFA 3AF6A 3VAYA 4MA4A 1T6ZA 4FT4A 5B58T 3ZE0B 4F45A 3C3EA 1NSYA 1UKAA 2C58A 1VPTA 2GCOA 2HA3A 1VDMA 1ZD5A 4K9DA 2CLFB 4P35A 4X1IA 4P6VF 4FD2A 3W6NA 3KDSE 2X86A 5HF6A 5FWNA 4QQRA 2I22A 3BSFA 1TVKB 3BSYA 2ZB8A 1EX7A 1IQUA 1U2QA 2ZVPX 3F47A 3FB1A 4L0QA 4IIHA 3W4KA 2QZ4A 3L05A 4M46A 1TECE 4PX2A 1PR2A 4MDYA 5FOUA 2OHOA 1HYGA 3F5FA 5CAEB 4BX9A 2VIIA 2P1ZA 2FJUA 4TYWA 4C4AA 2FUG1 1AF7A 3E5MA 3ROFA 2EDCA 4OX9Y 3DKIA 1E9RA 5DYWA 2P3OA 4BNWA 4IMRA 2IF0A 2V7UA 4ZQGA 1XNJA 1TKBA 1OLXB 2RH9B 2YV2A 4L6AA 2JJYA 4ZQIA 5A9TA 3VSDA 3GJTA 5DBIA 5FFMA 3NDJA 3PEFA 4FSDA 1JLKA 1WSWA 2RHRA 2IIVA 2PBFA 2FF7A 3OKAA 1XROA 4KMOA 4LWOA 4QU9A 2HY7A 3UKOA 4G63A 5LZ5A 4OM8A 4BCDA 1FMFA 4RK0A 1YI1A 3KPWA 2YWBA 1BXRA 4JEIA 4IDDA 1VMAA 5G3YA 4EO4A 3AL3A 4IPTA 4BNDB 3PQ2A 4G5XA 2B6NA 4Q7EA 4DIBA 3KOWA 1XPOA 2JJ8A 4MS1B 4OLBA 2FVXA 1XXHB 3GYGA 4RY0A 3VR1A 1NW7A 2VRWA 3E1SA 1ZPDA 4UREA 2O19A 2Q5IA 2F8MA 4M1YA 3AC0A 4JC4A 4C3OB 3OAAD 1RLJA 3VDQA 1KKUA 4NENB 3C15C 1Z7YA 3FNGA 2VDWA 1N1DA 4L50A 5TB5A 3UQYS 5KYGA 2LR0A 1L4BA 1W48A 2N1BA 2ORED 2QU8A 1GL6A 4LI3X 4G5OA 4GZMA 5ENDA 4ZKDA 3GXBA 2FPUA 2Z9DA 2PZFA 2VHTA 2I62A 2A9VA 2YHIB 4ZJZA 1MTZA 4G8BA 5BSMA 1HFKA 2HLHA 1U11A 2ZJ7A 3GLTA 4WY5A 2FSPA 4UM9D 5T3YA 4FMPA 1N2IA 1K5DA 2EKBA 3M1IA 2R8OA 3SZGA 1RBMA 1M1YE 4GI5A 2QSJA 3IBGA 5AJZA 5IZCA 2G71A 2ZRGA 1H3NA 4HAUA 3A2KA 1NURA 2BGNA 1VJCA 3EXHA 3QPBA 4C5CA 4CLOA 1C7ZA 3TTXA 1D8AA 5E6RA 1KJNA 4GMHA 3IR7A 3B9RA 2GA9A 3BOSA 3IQHX 4L1KA 1TVEA 2EJBA 2BFEB 4TKUA 8LDHA 1USWA 2XAUA 2PS3A 3EC7A 3R6GA 3CRW1 4GO1A 1J0EA 2A1TS 2R751 3NR2A 4U7HA 4BMPB 1H1LB 4WZAE 3C16C 4NBLA 3B13B 3K0KA 2XB4A 4IHJB 3GDWA 3T99A 4Q5IA 3WMXA 2Z6QA 2ZQYA 2W0MA 1ZCZA 3PXDA 1IY8A 2PAFA 1KARA 5AVKA 1FXWA 1JT2A 2D7CA 2HEIA 3I05A 4OGWA 5DXJA 1ORHA 3ZU6A 2O2YA 1OXSC 1IYZA 5J2UF 1GU0A 3WLAA 5AI9A 2HH9A 1X1BA 4LRUA 4Y1GA 5CVCA 3ER8A 1BIFA 3W9SA 2Z5LA 3OAAA 5FQNA 1L0BA 3TG8A 4N5HX 2D3TA 4AJPA 5TPWA 3UGJA 1PGNA 2XKBA 3W7VA 2GESA 4Q01A 5IHPA 1SZCA 1IQ0A 4TM7A 2GZDA 1UKEA 4NEQA 1FCJA 4W5TA 1KF0A 3DEHA 2YWEA 3LDFA 3PIRA 1JXOA 4HX2A 3UTDA 3JTEA 5LLDA 2NSDA 1FYDA 4PZAA 5K3OA 1G2PA 2JH9A 2W11A 3CU5A 1C4KA 2A7XA 2P1RA 3BJRA 4I5IA 4D45A 1VHWA 1KQ3A 4FGLA 5ESRA 4DLRA 5SZJA 3U3RA 4UHHA 1J21A 3D6UA 3Q40A 1E62A 2HRCA 5E3HA 2O3UA 3GJ4A 4P7GA 3TVDA 1HT2E 1GPJA 2PMEA 4BP3A 3BWYA 2CWWA 5ALXA 3RTEA 2H17A 3IVMA 1VIVA 1XLTA 2D7JA 1BXKA 2HQBA 2IDMA 3DV0A 4PCAA 4RSHA 4CN9A 2J3IA 2Q4EA 1M6YA 4O3MA 2ENWA 1MJNA 3WIOA 3L0YA 5E9AA 4LCJA 3OPXA 1JJFA 4HGOA 3L4EA 2HU2A 4D7AA 5EFOA 3B82A 1J7JA 2LCIA 4ARUA 5GIOE 4II7A 1N0UA 3OZDA 2DBQA 4HNAA 5ALMA 1NBOA 4WACA 4F5EA 4IF4A 3K9BA 3UUGA 1IXRC 2ASEA 3SIWA 3DVQX 2XGOA 3G2LA 2VDWB 3OOYA 5G4KB 3O31A 5IBRA 2ZJ3A 1BXGA 1VKNA 1X0XA 3V8EA 5FA5A 4FKZA 1KP3A 1LV8A 3O38A 4PC3A 1KHHA 2GLUA 5H02A 5JPCA 3EGIA 1J07A 1JXMA 3R5FA 3E9DA 1M1UA 2GHRA 2XCQA 2Z1DA 4W7SA 3P0JA 4AXBA 2JBAB 1R9MA 3SC4A 2NQ8A 2C2XA 3COSA 3NYIA 4LF7B 3KQOA 3W0LB 1TAUA 4B8ZA 3ONWA 4FI3F 1CZOA 1Q83A 1X14A 2O2XA 1RWXA 3F4BA 3M6IA 3UKDA 2ZREA 3OLCX 2HJRA 4MUGA 5DM0A 1NXXA 4BVGA 1WMEA 5CXQA 1ZVJA 1ISMA 1UJMA 2XZPA 4YDHB 1TEHA 4LC1A 5GONB 3CS3A 4CLOB 1G64A 3D6MA 4TKUB 1U7WA 2PSJA 1JILA 3B78A 4N3CA 3WGTA 2Y66A 5BN5B 2X7HA 3A3OA 1SHJA 2PKCA 2EFYA 2JK0A 4IZOA 3P2JA 1G5FA 1N75A 1XDWA 4M3NA 4WZBE 1RXEA 2HN9A 3NH9A 4PYNA 3IAS6 3V4RA 4BL5A 3KT8A 2JIDA 2V03A 3L1UA 4JKIA 3IYLW 3UYLA 1YOVB 1EHCA 1EUDB 4GM4A 3VC2A 1QQ5A 4OL0A 5I7WA 5THQA 1RPJA 4PE5B 5EE9A 5JCJD 2QR3A 3ZWCA 4ENRA 1G19A 3O0DA 1EA5A 4IFIA 3TEFA 1PR0A 4DUGA 4POOA 3L0ZA 1VL8A 2CNDA 3I9NA 1E3IA 3IDOA 3LS2A 3MUFA 4F91B 3F46A 5C1PA 3ICCA 2V74B 2D5IA 5ALZA 3WL4A 1XV5A 4X9XA 2Q2NA 2QF7A 4IEEA 3OKFA 3T3GA 4HQKA 3HYCA 4F3KA 4OBEA 1ARZA 2GZ1A 1G8SA 3G8YA 4P33A 5LYJA 5KQPA 5FUMA 4GOKA 2MHCA 2GLTA 4QX6A 4Z53A 2C4MA 3DEAA 4HTFB 4OA5A 4U39A 3Q10A 3FSGD 4X7RA 4WOPA 5TEVA 3QUBA 1EAYA 3C3JA 5EWMA 4RULA 5BR1A 4QNNA 1UFVA 3FUUA 3GGOA 3OIFA 4MEAA 5CM2Z 4UM9B 1V7PC 1G16A 2EP5A 3OJOA 3EMKA 2HNAA 3M6MD 4C6SA 4JI7B 3R9KA 5M29A 2ZZNA 3AETB 1DWQA 2WOOA 3FMFA 4R1PA 1N5KA 2R7MA 4HB0A 2DFTA 4JL5A 1PFKA 1B0UA 3CQ9A 3LZCA 2IW1A 2NV6A 2IP2A 1Z5UA 1ADCA 4UNIA 4ZAYA 5KOYA 3RRXA 4MRMA 4QFDA 4U7FA 4WVLA 3W5JA 4I2VA 1W25A 3OCVA 4A91A 2JLVA 5BV7A 3VOBA 2MWMA 2ORIA 1G8FA 3KYDA 3CUYA 1N6RA 5AOCA 3Q3JB 1DARA 2WYVA 4AP5A 4GH5A 2R6GA 2XQGA 3OBBA 2FMKA 3SOZA 1VHQA 2J6IA 3MSCA 1DCKA 1GVHA 1TT7A 4QGGA 4DCJA 1MP0A 3BWBA 4X71A 4EECA 2BEJA 2XMBA 2RK3A 3I6MA 4J0EA 1C50A 2ZROA 2H5IA 3U3MA 4WXYB 5JCJA 2YFQA 4PN7A 3E18A 5REQA 2OBBA 3OPYI 3EIEA 1J33A 3DXZA 2ZANA 4PLYA 3L0CA 5KI6A 2I2CA 1GPAA 2WMNB 4G65A 1N57A 2JEZA 2EW8A 2GCPA 2IEBA 3OF2A 4KTTE 4R2LA 1FMLA 2HXYA 3Q5DA 1HL3A 1UEXC 5IU6A 1B4DA 1E9FA 1J0AA 4H6WA 1L4FA 5DGIA 3CLHA 3LOQA 3WYAA 3U37A 4E1VA 1RKVA 1FMTA 4P3KA 2G77B 3A9TA 1TD9A 1OFTA 4XPIB 4ZO8A 4Z0TA 3FSGA 1CIJA 5MFPA 1PW7A 1K08A 1YC2A 3MCAA 3DDNA 2LRHA 3KT0A 4M86A 5CW1A 4Y7CA 2VYQA 5CVEA 5KYVA 4CIXA 2PLRA 4I08A 3KDAA 1CZUA 4MLCA 1LDBA 3ZWNA 1OFUX 4BE7B 5JARA 5K0JA 2D2EA 2Q5CA 4W63A 1TM2A 1ZIPA 3K4HA 3T3HA 4EQZA 2AG8A 3EXIA 1A5SB 2CY0A 2NMVA 1Z4JA 1ENOA 3ICQB 1YZGA 2FP3A 5EIHA 3THRA 1RRFA 1J2TA 3C7AA 3Q7QA 4UU0A 1XZKA 3U0BA 5C5IA 4BC0A 3MD0A 3E82A 3R3JA 4JLMA 1Z08A 1V2GA 2IZ1A 2FSGA 4KAXA 2ZRQA 4YH1A 1O6GA 1TB4A 1RI3A 3BRSA 3HUEA 2WM8A 3RRBA 4C0XA 2D2IA 1Y9AA 2C5SA 4U7WA 2OUKA 3ABZA 3URMA 5AUOB 5LM3A 3HDTA 3ANYB 3MCUA 5GVSA 4ALKA 3E1KA 4GPAA 1T10A 3NNNA 1PJZA 4HEJA 4HZUA 5C8VA 2BISA 4DSTA 3KJFA 5G2OA 4Q03A 4LZOA 2Z4TA 5FBRB 4I9GA 1PVDA 2V7XA 2ZWAA 3I8OA 3TK1A 1TYEB 1KR2A 4GR5A 3TUZC 1HLPA 1E6KA 3PQEA 3SIXA 1DWPA 5B3LA 2Q7XA 4MUNA 5CK5A 1QO9A 2QNRA 2RGNA 4ZT4A 3GF4A 4UDYX 4LYFA 5COAA 2YJ4A 5ESXA 1NAHA 2OZKA 1OV4A 4MYRA 1QIFA 1Z2OX 3QKUA 1K7FB 4TMZA 1EAMA 4GR4A 3FPCA 3Q2KA 3PZBA 2IK8A 1E3JA 3C3WA 1T0BA 2DWPA 1EP3B 2BM0A 1YAHA 2AX4A 3RS8A 1R1DA 1W4RA 4LKOA 2YUTA 3E4DA 1GPMA 2R4UA 3EXEA 5J43A 3EHDA 4E32A 4P80A 1I4OA 3EUAA 3LK6A 3IKVA 4I55B 5IDXA 4HN4B 1E3EA 2RAVA 1KDZA 2W2KB 2Z2JA 5FPPA 4BO1A 4MB6A 3VNRA 4Q3LA 3DOFA 4HX5A 5JVDB 4BFXA 3H9GA 2J33A 1EE9A 2CJXA 1TM3E 1HGXA 2O7NA 2G0AA 3OKCA 3PU6A 1P4SA 4A92A 2BFOA 1F5NA 3GW8A 4GOLD 2QTHA 3BGIA 4WERA 4JJ8A 1HWYA 1P9RA 2XY4A 3F8WA 1XO1A 3FGOA 1VBFA 4JT9A 4UFOA 1UEJA 4XUGB 4BMZA 2H4HA 4LZPA 1RQXA 1ZEMA 1A9TA 4GZ6A 5J4HA 3CNHA 5HUQA 1XKLA 4ZWNA 1FSPA 3EFHA 3SVZA 3H5LA 1E2EA 2VZ8A 1ZS9A 5F35A 3D7RA 1H9BA 4YONB 4CXMA 5DB4A 1PK9A 3M2PA 2CL5A 3TKAA 5K8LA 1LDNA 2LDXA 1V11B 3ABOB 2AEFA 4BRWA 4DWVA 5HKKD 3UEOA 5CB4A 4BVJA 1F7UA 2XXAA 2QENA 3W9BA 1V7CA 2X0DA 1F9EA 1RHJA 3UGTA 4UM8B 4DQXA 1IZ0A 3AL0C 1O96B 1K7SN 1GQQA 3CCFA 3GH1A 4ENQA 1T25A 4IZ6A 5CDFA 1JZQA 3KQNA 5BRAA 4Q47A 3PVZA 5J47A 5EE5B 1UQTA 2ZJ4A 3M9WA 3E3AA 4AG5A 3PL1A 4K03A 4UPVA 4I0WB 2AOTA 2BFBB 3GUVA 2GZRA 5LXTA 1MJGM 3LTEA 1Y4ZA 2PKQO 1Q0SA 2BFCA 2XX3A 1OH8A 2LWIA 3BFXA 1JA1A 3OQNA 1M1NA 3G2MA 4KO4S 1YZYA 3AU9A 4NOJA 4ND6A 2FR0A 1QQAA 3C5VA 1Q0RA 3SJCA 3UTCA 5CNJA 2IY7A 1GGFA 1TUBA 3EF0A 1GZ7A 1L5SA 1T15A 1R6DA 1G41A 1Z7BA 3L79A 4AJ9A 4JELA 4A6PA 4G0UA 2GN9A 4AMGA 4EG8A 4BUJA 3FHCB 2ONJA 1TYZA 1QP0A 4IJQA 4PAWA 4Y2JA 4U6NA 5AM0A 1XLWA 3EZ6A 3ABSB 4FFLA 3A7EA 1DDOA 3FPBA 2RIPA 4Q82A 2BSQA 1RKBA 5EKSA 1IOZA 3BWXA 4JEHA 4V0NA 3TBFA 1RD4A 1MXFA 3CXUA 1Q74A 3KOYA 3PPIA 5I3ZA 3MBIA 5DNYB 1IZ9A 4FZ5A 2QYOA 3ZLUA 3Q12A 3HJFA 5AICA 3EPJA 3CNBA 4XGKA 3IOEA 4YP5A 1EE2A 1E6MA 2IWRA 3QI2A 2I5PO 1U2SA 1XL0A 4KFTA 1HM5A 4O29A 2YJ5A 1C3JA 2ZVJA 3AHHA 5HKKA 3GV0A 2ZIAA 3DL2A 1G8JA 2HWWA 4KO3S 4F9EA 5IJ0A 2GPAA 3LQ4A 3W8FA 2DYKA 3TJRA 3KE8A 2C4VA 2VP6A 1EK2A 1JIUA 4B43A 1XEFA 4R41A 2F3QA 1BDIA 3DEYX 5CYOA 4RHCA 4XIIA 5C8ZA 3A1CA 1DAEA 2JGIA 4TMKA 1IBKB 1FP4A 2C98A 2IP1A 1Z47A 3NHWA 1VSVA 2Q5FA 1G21A 3WGGA 4LXHA 4QPJC 4QYIB 1IVSA 4M9QA 4J0QA 4WX2B 3ZE6A 5C9ZA 4DZRA 2JD0A 1R37A 4IZHA 3ZHSA 1KDVA 3S44A 3EVCA 2XTNA 4AWAA 2ZP1A 3BAFA 5CLGA 1O5TA 2A8YA 4YRNA 3NIWA 4X44A 3SYLA 4LVCA 1T26A 3MTEA 1C7JA 4M1EA 3QHQA 1EVQA 1SXJE 4EITA 1V39A 2VUIB 4L2IB 4Q7QA 1Y5RA 1Q7GA 1BKSB 2OFPA 2XJ4A 1ETUA 1Z4OA 1RRPA 2M1ZA 2Z56A 4TKVA 5I7HA 5LDHA 1JWBB 1N9ZA 4R9RA 5A2QA 2NXCA 4UXIA 4ER3A 3SXUA 2IZ5A 4RDXA 1G2OA 4M9ZA 1H2FA 1NF3A 4QPPA 2JCYA 3G23A 4COOA 3IMEA 3UPDA 4UMEA 1X7XA 4V0ME 2FEMA 1KSFX 3RHZA 2HF9A 3ACDA 2WUEA 1M2JA 4N6NA 1AZTA 1FXUA 5F98A 1FYEA 2PLAA 5HW0A 2DR2A 1Y7HA 2HJGA 1H23A 1SXQA 2F1HA 2GBPA 1ZBQA 2A35A 1QX3A 3S28A 4C30A 1T9GS 4X65B 5E6SB 4Q39A 5DM2A 5BXYA 2B5OA 3RKSA 5C7LO 1C2TA 3ZDCA 4MI3A 1QRUA 5TGTA 2JGRA 2G76A 3P9XA 5ECDA 1Y7IA 1QJ4A 4EVIA 3E22A 2EC5A 3FY4A 2IYXA 1QB8A 4DSUA 4AP9A 1MPTA 2GTIA 3LECA 3EN0A 1T8WA 4GOJA 5GVRA 4LJAA 4RQTA 4CMBA 5DSTA 2RB4A 3GEGA 3WGNA 1YHZA 1XJ5A 1RMYA 2MTBA 2R11A 3Q72A 5KCMA 4TWBA 3OOWA 4RH3A 3BKWA 5ARCA 2D1RA 1JDBC 4JUDX 4O2BA 4WXRA 2COKA 5HGJA 4C22A 1R4MA 1E2NA 3F1KA 3LZ6A 2V55B 3MS2A 4UE6A 1GUDA 5THXA 4XXHA 3NASA 3S1AA 5CEEA 3DCIA 3IILA 4PHFA 4BZQA 1KEEA 2P5UA 1V4BA 4FDMA 1ZO8A 3QU2A 4IRXA 3MT0A 1MO6A 5IJ0B 1CUGA 2GMWA 4E33A 1YZ3A 3QXSA 3SK0A 1MAHA 3A4MA 1AV6A 9MHTA 3MINA 1YDFA 2H11A 3Q7IA 4MGKR 1S1MA 1X1DA 1Y1SA 4HWGA 1CLEA 1ST3A 2CHGA 3EOBI 3KKMA 3MWEA 3NTXA 3QEOA 4YXWA 3NG1A 2XCTB 3QBVA 3Q9SA 1Y5IA 4CODB 3TLJA 4O59O 3ZUPA 2E87A 2I2WA 3FHJA 1DNPA 2G0TA 2XOKD 4MW1A 1QHYA 1VJGA 3ZVMA 1JTFA 1A5AB 4FMCF 5TVKA 1KI4A 4UQLA 1U3GA 2OV2A 1Y34E 1N1EA 4GGMX 2ZI7A 3S8EA 1MVOA 1E3LA 2F3PA 5L3VA 2I2BA 4HLDA 2EKPA 2Z2KA 3E27A 3EUFA 1KMCA 4KV9A 4M1TA 2H4JA 4UD6A 2ZRJA 2JJQA 1J90A 5BNWA 1O87A 3HM2A 3P52A 4DLSA 4CEIB 4V24A 1U04A 4ZOQI 3OY2A 1U0JA 4BX2A 1US8A 1FUIA 4LYEA 3I5YA 3K1AA 1DEHA 1F6DA 1I6LA 4YJGB 1EK1A 1G8GA 1QHIA 1B8NA 2VSNA 4E2FA 3GLRA 4NH0A 1YF3A 1J0BA 2JGDA 2IVZA 1ZW1A 3EXG1 3KL4A 1DAOA 3EOAI 4UZSA 4NH4A 4MS3A 5DBHX 3T35A 2BH2A 1R50A 4IVPA 4C2TA 3L6CA 2XQFA 1YE5A 4IDEA 3KSUA 2WU3A 3N3AC 4RIGA 1UT6A 4X5OA 1LC3A 1Y7PA 3BXPA 3P32A 4IOMA 4KWEA 4NEGA 1GNTA 3FNFA 2GERA 3IT3A 4XCXA 1CLUA 4DRXB 3R9XB 3X43A 4H1HA 1N7IA 4X1OA 4BLPA 2WP8J 3IE1A 1RM4A 1GSHA 4LK2A 2OFWA 2WSSD 3CRZA 1X7YB 1G42A 4XJXA 4IHJF 3AUJB 5HSGA 2FCAA 1ULUA 3LQYA 1ZGGA 4ZVTA 4TXLA 4ZYYA 1RI1A 3OETA 2GJKA 2FGKA 2ACVA 4TSFD 3VZDA 4U0KA 5IFLA 1L4HA 4K88A 3F98A 2JASA 2XOKA 4DC0A 1EFDN 2WYWA 3KV1A 1W5FA 1ZFNA 3LWNA 2C7GA 5FI1B 3OWXA 3RTBA 2OV3A 4J2HA 5F7ZA 1OYWA 1T9CA 1N2EA 5BV8A 1Y82A 2FCRA 4HY3A 1LBSA 4QTYA 3TMKA 3RGGA 3DDUA 3NRJA 4BKQA 3DLHA 2QV0A 1XZPA 3CLRC 3SFVA 1KU0A 2DLNA 2XB6A 4ZT2A 5JROA 2A0YA 3ELWA 2ETVA 1TYDE 2G28A 3RYFA 3CNQS 3IBTA 4O2BB 1YT5A 1B00A 1G20B 1ZX1A 4XZ3A 1R4MB 2Y68A 4HGYA 1MEEA 4ECAA 3ZWKA 1FOEB 1GQRA 5ES4B 3VX3A 2XDWA 3HKEA 4LWQA 4L57A 4R6XA 3KSRA 4KQHA 2DFKB 3EFOB 1MJFA 1FSFA 4FVTA 3FJOA 4A73A 4ZAWA 3K30A 2VLIA 4QUBA 2JFUA 2WM9B 2C61A 1TVMA 2EV9A 3EIWA 2EFJA 3QOFA 4HDKA 1S2MA 3ETLA 4WFKA 4D9MA 2VPTA 2RD2A 2VPPA 1GFZA 1I2AA 2E4AA 2PEZA 3PENA 3U1BA 1YWGO 3MCVA 4P4UA 3RIYA 5GIPE 3QSYA 1JEAA 3KTAA 2WSSA 1H2BA 4WBNA 2QLFA 5EIBD 1QTNA 4LNUA 4V03A 2QTZA 4WJZA 1Y6RA 1YS4A 3AY6A 4CQNA 3BMNA 1KEWA 3CNLA 1JH8A 3DWIA 4TSFA 5CW2A 2JFQA 1FDVA 1AG9A 4QREA 4B81A 3CUVA 3G59A 2OZEA 1UPBA 4NR0A 1NUSA 1SOVA 2Q6VA 4DA9A 4YUAA 3IMFA 1MUUA 3LGXA 3FTDA 3O8OB 4PFQA 4D92A 3BCHA 2BGRA 4GMFA 1IN8A 2ICAA 2AR9A 1NWHA 1T8UA 4F1WA 4EJSC 5AW1A 5FO0A 3CEHA 3GLKA 1A9YA 2EBFX 3GBPA 1IBSA 2C29D 2NLOA 3G0IA 1JFLA 2VYVD 3Q4GA 1RC8A 5GJCA 3AYXB 3Q6IA 5IAJA 3I62A 2N9UA 4GC9A 1ATIA 3GI1A 3PXAA 4XQ0A 1SKYE 1RACA 1JMKC 1RR6A 2ZRFA 3HJGA 4MKIA 2VWPA 1SC6A 1KI6B 4AZWA 2FPGA 1X9GA 3SEZA 3FZNA 1S7CA 3M6XA 1XNGA 3V2HA 5KYXB 4KBFA 4UXJA 4P92A 1PBTA 2GEJA 2HMYB 1QKJA 2J3EA 4NJOA 5GONF 3M81A 4ZZ0A 5SICE 1UBRS 4A0FA 3QBTA 2VDJA 1IQPA 1M2KA 3NRCA 5KJCA 4DTIA 2AF3C 2VYCA 2AK2A 3RRNA 4DBLE 1WM1A 4LZZA 4A0RA 4ZEVA 3DUFA 4MCJA 2WYOA 2JHGA 2IHYA 3ICWA 1H2YA 2AZ4A 2PV7A 4HB4A 2R5WA 4XWTA 2ACEA 5D00A 1SUIA 3SEFA 4G1MB 3EZFA 4LY6A 4CTNA 3K0HA 3MGAA 3CZ9A 3UJCA 1N2CA 2AMVA 4R3WA 5H16A 4R83A 3JY6A 2JI6A 4IBOA 4CF4A 6ADHA 2XT6A 2AR0A 4YYZA 2FP4A 3RYIA 3N6VA 2IJGX 3KTFA 2DLDA 3JATA 9GPBA 3FUXA 1O9HA 4MR7A 3GNTA 3I9V1 4JBNA 5HS4A 2P8SA 5SZHB 1FY2A 3WL6A 1X77A 3KCQA 4DM3A 1ZD8A 3COPA 4Y18A 1Z0DA 4BE4A 4PFJA 4CI9A 3VV3A 4IDGA 3OLVA 3Q7RA 2VYVA 5C7YA 3FZQA 1CZNA 1ZM4A 3WV5A 3ZE9A 2CMGA 3GMIA 4OIMA 3JPYA 4FYYA 1CKEA 2PIAA 3MS4A 4PLGA 1P9LA 3REOA 2FFAA 1RC0A 2LKDA 3FNIA 4YMUA 1K7YA 4JI0B 1D1TA 4N40A 4YQFA 2LCFA 2IXEA 3QEMB 3V48A 5DNUA 2O20A 4EJMA 4BFSA 2P9HA 4UVHA 1KS2A 4OYHA 3RVPA 4DYVA 4JITA 5T67A 4E5KA 1KGSA 1KK1A 2F59A 3CVVA 4LKRA 1V1MA 1RWPA 4KIWA 4N01A 1GQYA 1BS2A 2KWIA 4ESEA 2OUIA 1Y9DA 1JDBB 4RWEA 1NM5C 4IIJB 3RQSA 3AEYA 2Q1UA 4I7EA 2I0FA 3QWBA 2W5UA 2XTZA 4LZJA 4I4NA 1YS9A 4JJ6A 4K8OA 2VCHA 3T7SA 2DBVO 1O6FA 5DNAA 5KYWA 3IKTA 1PK8A 2W6JD 3BPSA 1U7PA 1DXQA 3ZY2A 1DEKA 2ADOA 4IJUA 1RT9A 4QOJA 4M6WB 3JWHA 3NHFA 5ERXA 5FUYA 2ZETA 1C3EA 3P8ZA 2PT5A 5FOSA 5A3VA 3EEQA 1XF9A 2VS1A 4MYCA 1ZNYA 1E9VA 3D1VA 3QOXA 1WCXA 5EL0A 1XALA 4X95A 5AP9A 2W4MA 5EQTA 4EPVA 4NPAA 4D9BA 5BN4A 1ZJ4A 2R1VB 5I9BA 4LJ6A 3SYMA 5I45A 3GRVA 2YS7A 1ZCBA 4YCDA 4UZFA 3TTVA 4KZPA 3ZV6A 3HUUA 1MIOA 2COUA 1PJLA 3AR4A 5JADA 2XDAA 5A5DA 1P81A 3VKFA 1DC5A 2NTJA 3KFXA 4EVRA 3F1LA 1Y7LA 1SMKA 3F9CA 4UCFA 1Q0ZA 1M34A 1E9CA 4HQ6A 4KL8S 1ISGA 1KJZA 1N2GA 1U1CA 4QG3A 1RLTA 4OGLA 1YE3A 2H2AA 2DKOA 1RHUA 3SF8A 4BFUA 4P3XA 5IT5A 1LNQA 4EZIA 4KLCA 3VPSA 5IM4A 1EM8B 3B38A 4AKSA 1WB5A 5JS2A 3HXKA 1B74A 4H0CA 3RYHB 3VZRA 1WW8A 1OBOA 2R60A 2Z9CA 3HCFA 4ID3A 4R2MA 1W49A 3V4OA 1RJEA 2BZGA 3UXHA 1N2CB 5JS7A 1UJCA 1GQOA 1ZK0A 2DFVA 2JFBA 2PY6A 3FBGA 4LYHA 3M4ZA 3LUGA 4HGQA 4KQXA 521PA 1ULSA 1A50B 3H2YA 3AJAA 1G8YA 3T61A 2FP4B 2P9GA 1Z0JA 5JH7A 3FPAA 3WDMA 3QPVA 2ZJ1A 2W6JA 5AH0A 1IQRA 4M7WA 4NZPA 1ZOLA 3RFCA 4HO1X 2GILA 1WUKS 4TTSA 1Z8DA 1ODFA 1D2GA 1YASA 4YRZA 1X2BA 2WSLA 5JXWA 1IK6A 4OEHA 2WYUA 2IEIA 2Q6OA 3ENWA 5DP2A 3VVMA 4E3ZA 1YV9A 1YZHA 1F38A 2W6ID 2ZS9A 1Z6XA 3ZXSA 4HDNB 4X45A 2G6BA 2FWRA 3T3PB 1KVRA 2J46A 3TQQA 3TGPA 2G40A 2AE2A 2PRJA 3H1EA 3R8FA 1JSLA 2Z9BA 2J32A 4YI3A 4UTNA 3FTCA 5DV9A 4TTTS 2VT6A 3ODGA 2EKZA 1N8KA 2LNDA 4TLMB 3A6PC 4IJWA 4KAFA 2PSHA 1PF7E 1KJQA 5AOVA 5FOXA 3C7TA 3QVSA 1YO6A 1CVRA 1G66A 1HY3A 2AFRA 1YDEA 4RA6A 4YPOA 4RBNA 1KQGA 1V1MB 4I55F 1MO2A 2IPLA 2PBZA 4TWZA 2F6RA 2FEKA 5JU6A 2Q1XA 3JQAD 3K1JA 4O5AA 3L40A 3L49A 5ECWA 1KAQA 2PCLA 4I5FA 4ZI3A 4M83A 5EJ4A 2XTMA 4HMOA 5G0VA 3ZX4A 8OHMA 3ICEA 4B6JA 2FQQA 1W581 4RC9A 2YHUA 4BPRA 3ZGYA 5BR7A 5DFAA 5JCXA 4AJ1A 3EVAA 1PDVA 3RFTA 3HUDA 5TE9A 3G8DA 3VZCA 1E63A 4M98A 2DTEA 2YZNA 4J0JA 4M54A 4TLEA 5EZSA 3CB4A 5IUJC 3H2IA 1H6CA 1CZKA 4U7PB 4XE5A 5EE1A 1R5BA 5F3DA 2D0IA 3IAAA 1CCWA 4US0R 4KPUA 3ZWVA 2IX9A 5CDFE 1CC1S 3PTLA 2I4LA 2O1EA 3TLGA 1CY6A 3KKOA 5BN4B 1YVRA 1C0EA 2ZRMA 4A5OA 2GEVA 3LT2A 2WF9A 2EWMA 4GG1A 4FYVA 2YOHA 5CFNA 3FGZA 4MEBA 4ZKEA 3RRMA 1EB9A 2EFDB 3WK4A 4M1SA 1PR4A 1L5NA 4QOHA 2WFLB 2FOLA 3Q9LA 3U81A 2W6IA 4PYOA 2M6KA 5IVPA 4AZ3A 2OFXA 1A2OA 1CV2A 1L4GA 1RAEA 1JR3D 3MLEA 3WL7A 5EFZA 4NFLA 3IQXA 3D6NB 3NTOA 4OFWA 2FMUA 4DJAA 4EJSB 1A82A 1KAHA 2Y2VA 4IQ4A 4MWGA 4ZJYA 2B7CA 5BWLA 2OGUA 1B8VA 1Q7CA 4OFZA 1KH3A 4JJIA 2FSFA 3SF8B 4NG4A 5T6MA 5DTJA 4RKFA 1LH0A 3ISVA 3HV0A 2YIVX 5B12A 3K05A 1VJTA 1JG3A 2QD3A 3V8NA 4ZQHA 5JJBA 1KNXA 2XZOA 3HA7A 1PO7A 1UDCA 3JQAA 2R48A 3NIFB 1HE2A 4GPTA 4OHFA 4PX3A 3SR4A 2HBRA 4WN9B 5C1OA 4MW2A 4MRPA 4ER6A 1MZVA 1P7YA 2QRKA 1CRQA 1DLJA 5ALGA 3T3EA 1P3Y1 3UPTA 1QYWA 3NTVA 3T5GA 4F85A 1DMSA 3PBKA 5FOTA 2WLSA 1U28C 5FWDA 3KTOA 3DXYA 1DEAA 1N8NA 4JUFA 2ZDHA 3CR7A 1IXKA 4GPZA 4HEA6 3OX3A 1K6JA 2HK7A 2QX4A 2QXYA 3KWFA 2QRPA 3PNOA 2VNIA 4U2DA 5CM9C 5DYTA 2LBPA 1DFHA 5FHRA 4BDSA 1K75A 4F92B 4J1NA 2IPMA 4UU8A 3ZDQA 5K8UA 4MKXA 2I3DA 2QPLA 3A1DA 4HXGA 2AN3A 4M22A 4OHWA 3NPMA 4INZA 1T9AA 4WMLA 4X41A 4DMKA 1HE4A 3SEAA 1G21E 3O8DA 5L95A 2WWFA 2JLZA 2FF5A 3QKRA 3QFFA 1VI5A 1H2WA 3HZRA 2C59A 1OZ0A 2IYLD 5E8RA 3RM3A 3RSLA 5E1MA 3VH2A 4IX1A 2ZJBA 1TXGA 2AFIB 4W9NA 5AK0A 5D3MA 4HN9A 4DYDA 1PFWA 5FBZA 1X7HA 1JR3A 1HTWA 4RA6B 3W2EA 1YCDA 2EATA 3AFMA 3OIVA 5CT4A 3REFA 3SP1A 2IBTA 4JT4A 3DTYA 3M6FA 4EABA 1H85A 4BB6A 3ZDFA 2QPAA 4Z51A 4P7FA 1NLZA 2RG1A 1DINA 2GEKA 2BGLA 2VCEA 1PV2A 2HSEA 1P91A 5AK4A 2F8LA 3GJ0A 2AKAB 4ZQEA 5DLDA 4C7XA 2C2HA 1V4NA 2WJ4A 1UMBA 2G5PA 4AWBA 2EEPA 3DJYA 5GZ6A 3KKLA 2B82A 4M0KA 3VR3D 2R8XA 4EPRA 1P1BA 3D8SA 1ZVQA 3HCBA 1BHSA 1HE5A 1EK5A 3DDCA 2FPMA 3I0ZA 4G86A 4KE6A 4Q0MA 1W5TA 1Z9BA 1V6CA 5T4FA 1O8BA 1V0JA 2OBFA 2Q7DA 5BVGA 1YB5A 3IUNA 3K8OE 5CB4F 3U5ZB 3K53A 4TL9A 4Y98A 4PTYA 3ZHYA 5E4YA 2QRVB 4DSZA 3EVNA 3WZ2A 1M5TA 1ZWKA 3WSTA 2OBYA 1FDOA 4HH4A 4MW9A 3QFSA 4E03A 5KNBD 4FOTA 3OURA 3WNZA 5DJ5A 3TIVA 1S9DA 5KO2A 3ZV7A 2IDKA 1NVXQ 2VP4A 5LXTF 4Z5XA 1G38A 2E21A 1KAMA 1N3YA 3GJSA 3HB0A 2OXTA 1ZISA 3ZGVA 3KR2A 5F2EA 4QRDA 1V6SA 2QYSA 2VJQA 4QEKA 5CHYA 1MU0A 2CZGA 5AKZA 4Z3KA 5KYNA 1P31A 2J08A 2OBLA 1DP4A 2A92A 1F5SA 3B2QA 1JMVA 1X42A 3MOSA 2ORVA 3ZV4A 4E5NA 1GUAA 2ZDQA 5FLKA 4QM7A 1CUXA 1IEQA 4GL4A 4P7BA 1AGRA 3V6MA 4F4JA 4FFSA 2XB8A 2V7VA 1E2GA 3KZ1E 1Z29A 4AROA 1AKQA 2O8CB 3TOXA 1LJLA 2CHQA 7REQA 2F4NA 2Z8YM 1WVGA 3B5JA 3UCEA 5IJ9B 3RUEA 1XJQA 4B0PA 4CKWA 2QIPA 1G1MA 5J9FA 1R5OA 3HCRA 3QWFA 4LOIA 4NX2A 4Z49A 3E70C 2FPIB 4JDUA 4XM0A 3GJRA 1MFPA 2BBWA 3W2TA 5AK5A 5HM6A 1ZUIA 3GRUA 2GD0A 3H17A 3AERB 1OJLA 5DIZA 1HZZA 5BP7A 5K3EA 5KWEA 4YJ2A 5D6OA 2BIFA 4EYQA 1KRXA 1SXJC 1I1HA 2WAYA 1AS0A 4EF5A 3KQKA 3MG9A 4NMXB 1LBHA 3CR8A 4LJ4A 4KAJA 3LUPA 3KVVA 1Z82A 4MQEB 3U19A 3BA6A 1FP7A 1K2VN 4QT0A 1ZCAA 3F7TA 2DH6A 3PPXA 4ZAZA 2GXQA 4ZZIA 3FR8A 3PXEA 3T4UA 5L3QA 4HRAA 4LN1A 5LJIA 2KW5A 4RM2A 3S2SA 1Z2DA 3QPUA 1Y89A 1O6BA 3QVUA 5KNBA 2EGGA 5TC4A 3C1UA 2IEAA 5ADHA 4AG6A 4J7AA 3WNVA 5KREA 3CLUD 1ID1A 4IDCA 3ORSA 1ZNQO 1BDBA 2HCJB 4I1UA 4PTLA 3TZLA 5HUHA 4KIUA 3DVAA 1VYVA 2PFKA 4UTRA 3C2QA 4P38A 3TTUA 2FN9A 2YDXA 2W2OA 3EZXA 1X1AA 2QAGA 1E2BA 4TGLA 5BW4A 3FX2A 4WIAA 3ANXA 4N48A 1L8LA 2ES4A 2Q8QA 5DLEA 5J23A 2QL7A 5JAUA 4REMA 1X1QA 3IUMA 3V33A 2OCAA 3D6JA 3LF1A 3TYXA 2C4HA 5JYEA 1TFUA 5IDVA 1J99A 1L4NA 4LE2A 1O77A 1XLVA 1YKGA 2QQEA 4YAFA 4AUKA 4DYHA 2JZCA 4YMGA 1NF8A 2PS1A 3MAGA 2CJPA 1S01A 2LP4Y 4HF7A 4GPBA 4AJJA 1T4CB 4AJOA 2FFRA 4Q4JA 4CUKA 3O3NB 4DR5B 2A2ZA 1HSZA 3CURA 3FMIA 3HJHA 3MQ2A 3YASA 1NJ2A 3I30X 5HDBB 2Y6VA 1XN4A 4A15A 1KAEA 1U99A 3DE0X 3LLSA 4TXJA 4EH1A 1UMDA 1LB1B 3NRBA 1XWWA 1SVLA 1OGJA 3LBYA 4JY7A 4EYEA 4PNEA 3CVOA 2JIPA 5KYYB 1XZGA 4DY6A 1FVFA 1RTTA 3FAZA 4ZHQB 2M6SA 5EG5A 3DMFA 3M1AA 1GAEO 5BWBA 2X8JB 3KR1A 1RI2A 2NU7A 3I1FA 5GMOA 1XMOB 1KSHA 1ML4A 3DT9A 5B6PA 1G8KA 2BGMA 5EIOA 2C42A 3QY0A 5JAMA 5ICSA 4RCYA 1VE9A 5ENZA 3E2IA 3NHYA 4WDRA 3TMAA 1ECPA 2GHIA 2R85A 2X19A 3P97A 2P90A 1XZEA 3E9EA 3OEED 3LVQE 5A5FA 4OU5A 1S3GA 2YWGA 3PWSA 3TO5A 4M8IA 3U26A 3SQWA 7REQB 4OX9B 2P6UA 4MA0A 5HHTA 1E2FA 2CVFA 1OU0A 1SZJG 1J5XA 3BJMA 4DADA 4ZGBA 5I3CA 2J30A 4OLAA 4H0NA 2DWOA 3M2TA 4MRSA 4OSEA 2R1TB 3SLRA 4N3NA 4AP6A 4B4OA 4KI7A 3FSJX 3PX7A 2ZPAA 3LC7O 2GBLA 2FX2A 4PCVA 2W42A 2PH1A 1EFPB 4TTJA 1Q22A 2QZJA 4ARAA 1J1UA 2MMCA 4MJ7A 4YCSA 3K09C 4D9GA 4YJ2B 4O2BF 5KHOC 1JLLA 2IL1A 2Q2VA 2ID7A 4TT8A 4YRCA 3RSHA 3WBBA 3PYXA 4ZVKA 5U4QA 2GX6A 3DMYA 4HVLA 5A9RA 3LT1A 5KKAA 1CD5A 1SCBA 4RPKA 4BQEA 1WE2A 5JS1A 2OWDA 1EJ0A 2OCXA 1IN1A 1DG1G 3O4HA 1R66A 4TYPA 1QB7A 2Z30A 3C0KA 3QEAZ 3ENNA 1B0AA 3MAAC 1EHIA 2B78A 4LISA 1BS1A 3S7TA 5CH8A 1YS2X 1GXSA 2AJBA 1OXXK 1HEIA 4O0LA 4DIFA 1FUKA 4EHHA 2QTWB 3LVFO 2H08A 3ZD7A 2G3YA 1HA3A 1C9DB 4DANA 1UQUA 4CKCA 3Q0TA 3CKKA 1OFHA 1JE1A 4EENA 4BFLA 2UZAA 1GGKA 1U7TA 4D44A 3R7FA 1T24A 1ZGCA 1FB5A 2GYYA 5H1YA 4RA9A 3PV0A 2DVMA 3LCUA 2HHJA 3OJCA 1V26A 3TIXB 4RZ2A 1UFKA 2EERA 2FEPA 3JYPA 3OEEA 4ILKA 5KNLA 3OJLA 4AKTA 1N5IA 1B16A 2GN6A 4Z7QB 3QFCA 4PQEA 3KC2A 3EIQA 4IIFA 3ZK8A 4F3CA 2BKXA 4GLJA 2XCLA 4Q4JB 3S4YA 1P4HA 2XECA 4XKJA 2HIAA 5NLLA 4D3SA 3RF6A 1D9ZA 2AQHA 4D4HA 1G8MA 3E9CA 2O7QA 2R47A 1N2OA 2Y92A 1VLMA 3AI7A 3FW1A 4YJHB 4FE7A 4AJLA 4LF6B 4UCWA 3WLHA 4XASA 1X74A 1PR9A 4N82A 3MGCA 3BULA 4ZAXA 4EB3A 1IAQA 3WNDA 2ZK7A 1Q15A 1WUJS 4G8CA 4U8GA 3RFVA 4L28A 4CIAA 3H4IA 4FYWA 3TIGA 1YA6A 2NU7B 3QQPA 3W5CA 2X4IA 5I7VA 2EFEB 1H42A 1XHFA 5KVVA 5I47A 2ECFA 2E82A 2KLBA 4FDVA 2FU5C 4ZD6A 4JR1A 1ZA2A 2QMZA 8ATCA 2GD2A 3HHPA 4UHJA 4HQ0A 4JYAB 1CQJA 1NNSA 4G9BA 4R01A 1EFCA 1YK0A 2JLUA 3WTBA 4D9KA 1M8KA 2Q1YA 4MUIA 2H1HA 3KVRA 1X94A 5FTMA 2MSNA 4QQKA 1AY0A 2JHAA 2ZCJA 1EDBA 2PSFA 4YHHB 5M04A 4CM1A 1YIAA 3M83A 4HDMA 4C14A 3BRCA 1KVQA 2G63A 1Y0BA 2M2IA 2KB0A 3IUEA 3P2IA 4X93A 4YRRA 5ALTA 1PZXA 4GPEA 4ZI5A 3GROA 4AF6A 3W5AA 3GJ8A 1RVV1 2IZOA 4YRFA 3AWIA 4EB6A 3GGGA 1XTUA 4ERXA 5JXHA 1Y6GA 1GWNA 1OB2A 2HWXA 1QYIA 1FSGA 1WHTA 3FNRA 3N2GA 1IMJA 1CDZA 1CJTC 1NTRA 4QDJA 5ILGA 2EZTA 4C4RA 2Z2YA 3HKCA 5F9MA 3D7KA 4BEBA 2B8TA 4D96A 1CR1A 3LT0A 1Z2PX 4KIFA 3WDLA 3BE8A 5JRZA 3AUYA 5FI3A 1N2HA 2X4DA 3CNEA 4GVLA 1T8YA 5DNEA 1J8DA 1TJYA 1NR5A 3MIZA 4IJ5A 4WOCA 4BRSA 4CG1A 1S2NA 4XJTA 2BR3A 1FMJA 2DY0A 3OI7A 1U02A 1CY7A 4NBTA 3UJ6A 3JZIA 4YECA 2PL1A 3B5EA 1UK7A 4FHCA 2ZZMA 3R4CA 2V7PA 3H1BA 5P8WA 2R2AA 1F6WA 5B3JC 3CZPA 1RXYA 1AQJA 1XRPA 4WBNF 2GKGA 3E6AA 1SKAA 1UP4A 1F2UA 1Z88A 3X3HA 5AESA 3DDSA 5U4XA 4ZAVA 3N76A 1REQB 4KHZA 1A2KC 2ZIEA 3LBFA 2Z3WA 3A3NA 2AI3A 1IM2A 3GNQA 4YQYA 4R3UC 2J59A 4MVYA 4YAKA 2BGIA 1IJBA 1ADJA 1INLA 1GFSA 1IZ8A 3BGSA 3MC1A 4H17A 3ZWWA 3VU9B 2JLYA 3D6AA 3WGIA 4LOHA 3P9PA 2ZBUA 2ZIFA 1X39A 5HIKA 4QNMA 3VC7A 2B83A 1V9CA 1GY8A 4G4SP 4Z4QA 3D7NA 1GAQA 4KVAA 5G0SA 3HJAA 3DWFA 1MOSA 4B34A 2QRLA 2XNHA 1GZSA 1VP3A 2BBOA 1M34E 1ZMRA 2FQYA 3N2ZB 2ZJFA 4KE9A 2CLSA 4WEOA 5EE0A 1SOMA 3U5TA 3TDMA 3R1IA 4E22A 3G6KA 4JP3A 1P7VA 2EJVA 1I1QB 1HURA 1Y8QA 4NYJQ 4O2AA 3THXA 4HN2A 4M9SA 1U98A 2FXIA 1J20A 3VYUB 1BDHA 2WE7A 3HCEA 1T2UA 4LSMA 3LQKA 5AKLA 4FC6A 4IH1A 2EJCA 4QUAA 4UTOA 1ZMOA 3NH6A 4FGUA 4JODA 2JNWA 4PVDA 2Z2IA 4DWJA 3KJHA 3O9MA 3PHJA 4BWVA 4TWAA 1P2BA 2R62A 3EY9A 3KTDA 4Z54A 1E1YA 1ADGA 1LF5A 1RJFA 1PNOA 4Z6KA 5DM60 4D25A 2W48A 2DHDA 3L1IA 3LC1O 4KKXB 1L5OA 3UT5B 4PNHA 3I9JA 4R1LA 1GKLA 1GGEA 2QZSA 1OTHA 1R6BX 2H4FA 3OQBA 1QP7A 3QW4B 3DEZA 4HNTA 4KZKA 1A9PA 1CQJB 4N8EA 4EUNA 5JLAA 1EUZA 3VQTA 1E77A 1YOBA 3H8JA 3GU3A 3JPWA 5COBA 1CDOA 3LXUX 1NP3A 2QRZA 3NNDA 4XRRA 5EQDA 3WZLA 5IC4A 1TOAA 2FW0A 3IPAA 4ZVSA 1PKEA 3ABQB 3KYJB 4HWTA 2XZTA 2WKQA 1ZLXA 1Z5WA 2X1VA 5CIQA 4L27A 4PG6A 5A9SA 1UXKA 4ARCA 4RFVA 2QQFA 2WIGA 2FRDA 2IRWA 3V7YA 1RRMA 4TT3D 1PJQA 5ITZB 3PGMA 4UOEA 3OE1A 1PLJA 3O8BA 4U5QA 1WHTB 1CX9B 2R8BA 2HNBA 1XDSA 2FMIA 5CLHA 4NOKA 2YYYA 1A3CA 3GRCA 3OO0A 4PG7A 5EJ2A 2NXNA 4MUEA 2VJBA 1KDYA 5JDIA 3I34X 1YVEI 1KZ1A 2DMRA 1TQ8A 4OXIA 4I9NA 3ZVLA 4LXYA 1L9KA 3E5RA 1O4WA 4XTCS 1J5PA 3KLOA 1C0IA 3ZY3A 5C4IA 2JVJA 2GPJA 3JALA 5DNWA 1A9OA 1XRLA 4MKZA 3U7HB 3NUQA 4BUZA 4PYQA 1L3BA 2XWJI 4QJ5A 1EIWA 3G9QA 3ZHXA 4KVZA 2EFGA 1R5NA 4IW3B 2C2BA 3CLTC 4TMWA 3LY8A 3N2LA 2JAPA 2VAPA 1I2ZA 4IKPA 3DOJA 4NL4H 1QIMA 1TMOA 4X1YB 2O0MA 2Z95A 3ONFA 1TUEA 1LBIA 5K09A 4HAIA 4TN1A 2QUIA 2CYBA 5BNIA 3FN4A 1B0ZA 3O2NA 4AJKA 2QN2A 1SG6A 4BJ1A 1TLFA 1PKXA 1VKJA 3C3PA 1KYXA 1SBIA 2E4ZA 3D7SA 2QGFA 2NO7A 1E1CB 4ZU6X 3RC9A 1JLHA 1XDGA 1RW4A 4TYQA 4CDNA 3HM9A 1W0CA 2DOKA 3DZ8A 2GVDC 4WEQA 4KLZA 4KUGA 5TV2A 3K70C 1YZNA 5KU7A 2WG1A 5EKDA 5I51A 2EW1A 3LT4A 4TT3A 3QJYA 1JHZA 5BN3B 5KSYA 1THGA 2F43A 2WMDA 1XA4A 4KIJA 3Q2OA 4O2AB 4RHTA 2Q3FA 4XB6B 3TECE 3THXB 3K1ZA 3RAPR 3AH8A 3UANA 3VGJA 4A0HA 2FE4A 3S8MA 5FAXA 4EQ6B 2OO5C 2WD7A 3M4NA 4TL8A 4NV0A 2CJYA 3LW8A 4LYDA 3ECAA 3ODPA 3JD3A 5EHIA 1U0NA 4QXOA 3PXGA 1USGA 3F9RA 3VHRA 4C6RA 3GCZA 5DASA 5F21A 2MU1A 3AVTA 1ELOA 1ZSVA 2DHCA 3K96A 1PZNA 5H7XA 1FQWA 1H65A 2VHJA 5IM4F 2YV3A 4BFYA 2JGJA 1JEYB 2DUUA 3JQ9C 3LRXA 2WT9A 3KKNA 5LJLA 1FYXA 2GCGA 3N8DA 4W9MC 2FWIA 4B3GA 1N9KA 3DBHB 4E09A 3V46A 3P9CA 2IHJA 3H84A 1D1QA 2QQ0A 2Q2QA 4QNRA 4KR0A 2QNBA 2IXFA 1WRBA 3RBVA 3VR0A 2X8BA 3D3KA 5EI5A 2ILVA 2F17A 5JH7F 2P0YA 1R64A 1QH1B 2O07A 3EUWA 1FRNA 4PC7A 3U9TA 2F55A 1F2DA 4WJLA 3HPQA 2WWVD 1W4ZA 1J2RA 3LE8A 2Y3IA 3NYWA 5AVVA 5HKOA 1N2JA 1XU7A 4X63A 3BFVA 4JQOA 2QM3A 3PNBA 4HGNA 3ANNA 4R2WA 3T0IA 1JQKA 1PJSA 2A14A 4V3BA 1KYQA 4B5LA 1PCXA 3N0RA 2XA9A 2X0IA 4AMBA 1RBZA 1VPVA 1OI4A 4ZN6A 4G25A 1JR3E 3AI3A 5F2KA 1FRVA 2OG2A 1IBCA 1MABA 2QAIA 2K5UA 3PGVA 3AVOA 3W8DA 1EVIA 3QVKA 4DC9A 1T3HA 4F11A 4FKMA 3EXFB 5E7JA 1FRZA 2N47A 3DZGA 3HB7A 4XDYA 5AVUA 3O8CA 1QIJA 2VDNB 3KAJA 5J40A 4YPFA 4EGQA 4UCXA 4W82A 3PXCX 1RQPA 1WXFA 2VKQA 5ICMA 4R1TA 1UWVA 1BHQ1 1GIAA 2RH8A 3ZTYA 2ZOSA 4EY3A 1GDHA 421PA 1XCBA 3ZLVA 5ALIA 4JOCA 1PG5A 2QS9A 4JOSA 5D85A 1JAYA 1ENZA 2NUAB 2X1MA 1TKCA 1K6MA 1Y5LA 3HA3A 4DM4A 4C7JA 2Y9PB 1IWPB 2JFFA 2PD3A 3PE3A 1GRCA 2CMHA 1UM8A 3SI7A 2F90A 2E1PA 2GKSA 2EQ5A 3JD1A 2ZYSA 4J0GA 2RHBA 1ZUHA 1WEKA 2NV2B 4MIEA 2F3UA 1W59A 5C80A 3BEDA 1H0SA 1EINA 2HW8A 4PLZA 1JI3A 2YMMA 2PU7A 2BLLA 3C5EA 3LX4A 3TR0A 2W6ZA 4D3ZA 3CCCA 3OOSA 3RU3A 4UUQA 2C5EA 4GC5A 4N8SA 3Q7SA 4R0NA 2JGKA 5JZVA 4G0QA 1C1XB 3HL4A 4KV7A 4MJXA 2ZIXB 1LBEA 2SICE 3I01M 4J91A 3DVSX 1XELA 2XWPA 1FF9A 4AMZA 3A2LA 5I7SA 4LE0A 2BYTA 1EB8A 1JIQA 1OAOA 1EU1A 1ZY2A 1ZU5A 2OWEA 3QI7A 1WW2A 2R7LA 2ZYHA 2R0QC 2C54A 1AUVA 2WD7B 1XYGA 3BB4A 3EGCA 4OJKA 4MR9A 3THWB 1FQJA 1EFTA 2C92A 2VYND 1CPYA 1J8YF 1ISIA 2RDMA 2YV4A 4Q9IA 2AE1A 2XITA 2A4MA 1DT5A 2CHEA 2CJWA 4OQLA 4IVQA 3EJWA 2PVCA 5CRIA 1TLLA 4BRZA 2DKNA 4XAQA 3SC6A 2WVJA 2W2XA 2Y93A 4W8GA 5CH3A 1MORA 4DMCA 2RGEA 3HCDA 2EQAA 4NDNE 3ZS9A 2ABWA 4H7JA 4RK5A 1BVHA 4TX1A 4DQKA 3O91A 2IZ7A 1BC5A 2J9XB 4NZMA 3VNAA 1FP2A 4ZTZB 2A58A 4BJ5A 1FUUA 2FLWA 1ZRHA 5BYKA 1QWSA 4QXMA 5EXTA 1TF5A 3BH0A 4EEXA 3L5KA 4L8VA 3HWWA 1SQ5A 5DTQA 5J2TA 4YRQA 1JVNA 4I1PA 5JALA 1T6XA 1OUMA 4ES6A 1KTVA 4L95C 1FL9A 3KJEA 4I50A 3TLXA 1DIOB 2C07A 3K4PA 5HZMA 1UZLA 3IR6A 4LSWA 2YMQA 3FRIA 3RNOA 3DXXA 2GASA 2P41A 4GKAA 2YBEA 1DKUA 1HMYA 3AF4A 2NTVA 1QF6A 3L8ZA 4C4XA 2QI9C 3PF9A 5FWYB 2CN1A 4E5MA 3UC5A 2GTPA 4CIYA 1AGYA 2OOKA 4DG9A 1RKQA 4YX9A 5C46F 2GUGA 4H16A 4J29A 1DC8A 4KRYA 4XSGA 3IDQA 2O8BA 1CJUC 5ED4A 2BFDA 4GNKA 2NTNA 5IM5A 1LA2A 2GSWA 5BQXA 3RYCB 2FZEA 4Q24A 2FSVA 3LDAA 2PH7A 2VYNA 2C97A 3LY5A 2B4KA 4NBNA 2V7QD 1ADFA 5BT9A 2K2QB 3SJZA 1WXEA 3W5BA 3OTWA 3RVBA 1AUQA 2CW5A 4DIDA 3SBEA 4C1BA 1CJBA 3ADOA 1EESA 1ADYA 4V3CA 2Q29A 4UTVA 2MSKA 4WCVA 4XDGA 5B3AA 3N2EA 4HC4A 1QVRA 3AK4A 2QV7A 1RZUA 4FLMA 1LBQA 3Q88A 3VU1A 1XFDA 2AEMA 3SIPA 1YJCA 1GYPA 2K2WA 4Q1DA 4B17A 4ZZ1A 1UC4B 4PZZA 3UH1A 4CDRA 1Q1ZA 3J7AC 4AY2A 3H87A 1ESMA 3O0TA 3OEWA 2AWOA 4M38A 3UWOA 3IESA 5HYVA 4BNJA 3IUSA 4BMDA 4BNTA 3VDXA 2P75A 3FE2A 4G1UC 3RU2A 2CXNA 1K2WA 4LA4A 4QGBA 3FTEA 3A06A 1KOGA 5LQCA 1QONA 2FWPA 1NVAA 2WKWA 3BK2A 4GXQA 3ZQ6A 4D81A 4R1SA 4D82A 1U0OC 3PC6A 3BTVA 3ZK9A 4BB5A 1UIRA 4JQYA 4ATNA 2E6KA